data_3COG
# 
_entry.id   3COG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3COG         
RCSB  RCSB047022   
WWPDB D_1000047022 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2NMP 
_pdbx_database_related.details        'Crystal structure of human cystathionine gamma lyase' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3COG 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Collins, R.'                          1  
'Karlberg, T.'                         2  
'Lehtio, L.'                           3  
'Arrowsmith, C.H.'                     4  
'Berglund, H.'                         5  
'Dahlgren, L.G.'                       6  
'Edwards, A.M.'                        7  
'Flodin, S.'                           8  
'Flores, A.'                           9  
'Graslund, S.'                         10 
'Hammarstrom, M.'                      11 
'Johansson, I.'                        12 
'Kallas, A.'                           13 
'Kotenyova, T.'                        14 
'Moche, M.'                            15 
'Nilsson, M.E.'                        16 
'Nordlund, P.'                         17 
'Nyman, T.'                            18 
'Olesen, K.'                           19 
'Persson, C.'                          20 
'Schuler, H.'                          21 
'Svensson, L.'                         22 
'Thorsell, A.G.'                       23 
'Tresaugues, L.'                       24 
'Van den Berg, S.'                     25 
'Sagermark, J.'                        26 
'Busam, R.D.'                          27 
'Welin, M.'                            28 
'Weigelt, J.'                          29 
'Wikstrom, M.'                         30 
'Structural Genomics Consortium (SGC)' 31 
# 
_citation.id                        primary 
_citation.title                     
;Structural basis for the inhibition mechanism of human cystathionine gamma-lyase, an enzyme responsible for the production of H(2)S.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                3076 
_citation.page_last                 3085 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19019829 
_citation.pdbx_database_id_DOI      10.1074/jbc.M805459200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sun, Q.'                1  
primary 'Collins, R.'            2  
primary 'Huang, S.'              3  
primary 'Holmberg-Schiavone, L.' 4  
primary 'Anand, G.S.'            5  
primary 'Tan, C.H.'              6  
primary 'van-den-Berg, S.'       7  
primary 'Deng, L.W.'             8  
primary 'Moore, P.K.'            9  
primary 'Karlberg, T.'           10 
primary 'Sivaraman, J.'          11 
# 
_cell.entry_id           3COG 
_cell.length_a           105.350 
_cell.length_b           107.220 
_cell.length_c           153.310 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3COG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cystathionine gamma-lyase'     44335.672 4    4.4.1.1 ? ? ? 
2 non-polymer syn 'NITRATE ION'                   62.005    3    ?       ? ? ? 
3 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"        247.142   3    ?       ? ? ? 
4 non-polymer syn '(2S)-2-aminopent-4-enoic acid' 115.130   3    ?       ? ? ? 
5 non-polymer syn GLYCEROL                        92.094    5    ?       ? ? ? 
6 non-polymer syn 'DI(HYDROXYETHYL)ETHER'         106.120   1    ?       ? ? ? 
7 water       nat water                           18.015    1160 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gamma-cystathionase 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALD
GAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETP
TNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFL
QNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIK
GTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
PSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALD
GAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETP
TNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFL
QNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIK
GTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
PSG
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLN n 
1 4   GLU n 
1 5   LYS n 
1 6   ASP n 
1 7   ALA n 
1 8   SER n 
1 9   SER n 
1 10  GLN n 
1 11  GLY n 
1 12  PHE n 
1 13  LEU n 
1 14  PRO n 
1 15  HIS n 
1 16  PHE n 
1 17  GLN n 
1 18  HIS n 
1 19  PHE n 
1 20  ALA n 
1 21  THR n 
1 22  GLN n 
1 23  ALA n 
1 24  ILE n 
1 25  HIS n 
1 26  VAL n 
1 27  GLY n 
1 28  GLN n 
1 29  ASP n 
1 30  PRO n 
1 31  GLU n 
1 32  GLN n 
1 33  TRP n 
1 34  THR n 
1 35  SER n 
1 36  ARG n 
1 37  ALA n 
1 38  VAL n 
1 39  VAL n 
1 40  PRO n 
1 41  PRO n 
1 42  ILE n 
1 43  SER n 
1 44  LEU n 
1 45  SER n 
1 46  THR n 
1 47  THR n 
1 48  PHE n 
1 49  LYS n 
1 50  GLN n 
1 51  GLY n 
1 52  ALA n 
1 53  PRO n 
1 54  GLY n 
1 55  GLN n 
1 56  HIS n 
1 57  SER n 
1 58  GLY n 
1 59  PHE n 
1 60  GLU n 
1 61  TYR n 
1 62  SER n 
1 63  ARG n 
1 64  SER n 
1 65  GLY n 
1 66  ASN n 
1 67  PRO n 
1 68  THR n 
1 69  ARG n 
1 70  ASN n 
1 71  CYS n 
1 72  LEU n 
1 73  GLU n 
1 74  LYS n 
1 75  ALA n 
1 76  VAL n 
1 77  ALA n 
1 78  ALA n 
1 79  LEU n 
1 80  ASP n 
1 81  GLY n 
1 82  ALA n 
1 83  LYS n 
1 84  TYR n 
1 85  CYS n 
1 86  LEU n 
1 87  ALA n 
1 88  PHE n 
1 89  ALA n 
1 90  SER n 
1 91  GLY n 
1 92  LEU n 
1 93  ALA n 
1 94  ALA n 
1 95  THR n 
1 96  VAL n 
1 97  THR n 
1 98  ILE n 
1 99  THR n 
1 100 HIS n 
1 101 LEU n 
1 102 LEU n 
1 103 LYS n 
1 104 ALA n 
1 105 GLY n 
1 106 ASP n 
1 107 GLN n 
1 108 ILE n 
1 109 ILE n 
1 110 CYS n 
1 111 MET n 
1 112 ASP n 
1 113 ASP n 
1 114 VAL n 
1 115 TYR n 
1 116 GLY n 
1 117 GLY n 
1 118 THR n 
1 119 ASN n 
1 120 ARG n 
1 121 TYR n 
1 122 PHE n 
1 123 ARG n 
1 124 GLN n 
1 125 VAL n 
1 126 ALA n 
1 127 SER n 
1 128 GLU n 
1 129 PHE n 
1 130 GLY n 
1 131 LEU n 
1 132 LYS n 
1 133 ILE n 
1 134 SER n 
1 135 PHE n 
1 136 VAL n 
1 137 ASP n 
1 138 CYS n 
1 139 SER n 
1 140 LYS n 
1 141 ILE n 
1 142 LYS n 
1 143 LEU n 
1 144 LEU n 
1 145 GLU n 
1 146 ALA n 
1 147 ALA n 
1 148 ILE n 
1 149 THR n 
1 150 PRO n 
1 151 GLU n 
1 152 THR n 
1 153 LYS n 
1 154 LEU n 
1 155 VAL n 
1 156 TRP n 
1 157 ILE n 
1 158 GLU n 
1 159 THR n 
1 160 PRO n 
1 161 THR n 
1 162 ASN n 
1 163 PRO n 
1 164 THR n 
1 165 GLN n 
1 166 LYS n 
1 167 VAL n 
1 168 ILE n 
1 169 ASP n 
1 170 ILE n 
1 171 GLU n 
1 172 GLY n 
1 173 CYS n 
1 174 ALA n 
1 175 HIS n 
1 176 ILE n 
1 177 VAL n 
1 178 HIS n 
1 179 LYS n 
1 180 HIS n 
1 181 GLY n 
1 182 ASP n 
1 183 ILE n 
1 184 ILE n 
1 185 LEU n 
1 186 VAL n 
1 187 VAL n 
1 188 ASP n 
1 189 ASN n 
1 190 THR n 
1 191 PHE n 
1 192 MET n 
1 193 SER n 
1 194 PRO n 
1 195 TYR n 
1 196 PHE n 
1 197 GLN n 
1 198 ARG n 
1 199 PRO n 
1 200 LEU n 
1 201 ALA n 
1 202 LEU n 
1 203 GLY n 
1 204 ALA n 
1 205 ASP n 
1 206 ILE n 
1 207 SER n 
1 208 MET n 
1 209 TYR n 
1 210 SER n 
1 211 ALA n 
1 212 THR n 
1 213 LYS n 
1 214 TYR n 
1 215 MET n 
1 216 ASN n 
1 217 GLY n 
1 218 HIS n 
1 219 SER n 
1 220 ASP n 
1 221 VAL n 
1 222 VAL n 
1 223 MET n 
1 224 GLY n 
1 225 LEU n 
1 226 VAL n 
1 227 SER n 
1 228 VAL n 
1 229 ASN n 
1 230 CYS n 
1 231 GLU n 
1 232 SER n 
1 233 LEU n 
1 234 HIS n 
1 235 ASN n 
1 236 ARG n 
1 237 LEU n 
1 238 ARG n 
1 239 PHE n 
1 240 LEU n 
1 241 GLN n 
1 242 ASN n 
1 243 SER n 
1 244 LEU n 
1 245 GLY n 
1 246 ALA n 
1 247 VAL n 
1 248 PRO n 
1 249 SER n 
1 250 PRO n 
1 251 ILE n 
1 252 ASP n 
1 253 CYS n 
1 254 TYR n 
1 255 LEU n 
1 256 CYS n 
1 257 ASN n 
1 258 ARG n 
1 259 GLY n 
1 260 LEU n 
1 261 LYS n 
1 262 THR n 
1 263 LEU n 
1 264 HIS n 
1 265 VAL n 
1 266 ARG n 
1 267 MET n 
1 268 GLU n 
1 269 LYS n 
1 270 HIS n 
1 271 PHE n 
1 272 LYS n 
1 273 ASN n 
1 274 GLY n 
1 275 MET n 
1 276 ALA n 
1 277 VAL n 
1 278 ALA n 
1 279 GLN n 
1 280 PHE n 
1 281 LEU n 
1 282 GLU n 
1 283 SER n 
1 284 ASN n 
1 285 PRO n 
1 286 TRP n 
1 287 VAL n 
1 288 GLU n 
1 289 LYS n 
1 290 VAL n 
1 291 ILE n 
1 292 TYR n 
1 293 PRO n 
1 294 GLY n 
1 295 LEU n 
1 296 PRO n 
1 297 SER n 
1 298 HIS n 
1 299 PRO n 
1 300 GLN n 
1 301 HIS n 
1 302 GLU n 
1 303 LEU n 
1 304 VAL n 
1 305 LYS n 
1 306 ARG n 
1 307 GLN n 
1 308 CYS n 
1 309 THR n 
1 310 GLY n 
1 311 CYS n 
1 312 THR n 
1 313 GLY n 
1 314 MET n 
1 315 VAL n 
1 316 THR n 
1 317 PHE n 
1 318 TYR n 
1 319 ILE n 
1 320 LYS n 
1 321 GLY n 
1 322 THR n 
1 323 LEU n 
1 324 GLN n 
1 325 HIS n 
1 326 ALA n 
1 327 GLU n 
1 328 ILE n 
1 329 PHE n 
1 330 LEU n 
1 331 LYS n 
1 332 ASN n 
1 333 LEU n 
1 334 LYS n 
1 335 LEU n 
1 336 PHE n 
1 337 THR n 
1 338 LEU n 
1 339 ALA n 
1 340 GLU n 
1 341 SER n 
1 342 LEU n 
1 343 GLY n 
1 344 GLY n 
1 345 PHE n 
1 346 GLU n 
1 347 SER n 
1 348 LEU n 
1 349 ALA n 
1 350 GLU n 
1 351 LEU n 
1 352 PRO n 
1 353 ALA n 
1 354 ILE n 
1 355 MET n 
1 356 THR n 
1 357 HIS n 
1 358 ALA n 
1 359 SER n 
1 360 VAL n 
1 361 LEU n 
1 362 LYS n 
1 363 ASN n 
1 364 ASP n 
1 365 ARG n 
1 366 ASP n 
1 367 VAL n 
1 368 LEU n 
1 369 GLY n 
1 370 ILE n 
1 371 SER n 
1 372 ASP n 
1 373 THR n 
1 374 LEU n 
1 375 ILE n 
1 376 ARG n 
1 377 LEU n 
1 378 SER n 
1 379 VAL n 
1 380 GLY n 
1 381 LEU n 
1 382 GLU n 
1 383 ASP n 
1 384 GLU n 
1 385 GLU n 
1 386 ASP n 
1 387 LEU n 
1 388 LEU n 
1 389 GLU n 
1 390 ASP n 
1 391 LEU n 
1 392 ASP n 
1 393 GLN n 
1 394 ALA n 
1 395 LEU n 
1 396 LYS n 
1 397 ALA n 
1 398 ALA n 
1 399 HIS n 
1 400 PRO n 
1 401 PRO n 
1 402 SER n 
1 403 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CTH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CGL_HUMAN 
_struct_ref.pdbx_db_accession          P32929 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDG
AKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPT
NPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQ
NSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKG
TLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPP
SG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3COG A 2 ? 403 ? P32929 1 ? 402 ? 1 402 
2 1 3COG B 2 ? 403 ? P32929 1 ? 402 ? 1 402 
3 1 3COG C 2 ? 403 ? P32929 1 ? 402 ? 1 402 
4 1 3COG D 2 ? 403 ? P32929 1 ? 402 ? 1 402 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3COG SER A 1 ? UNP P32929 ? ? 'EXPRESSION TAG' -1 1 
2 3COG SER B 1 ? UNP P32929 ? ? 'EXPRESSION TAG' -1 2 
3 3COG SER C 1 ? UNP P32929 ? ? 'EXPRESSION TAG' -1 3 
4 3COG SER D 1 ? UNP P32929 ? ? 'EXPRESSION TAG' -1 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2AG 'L-peptide linking' n '(2S)-2-aminopent-4-enoic acid' L-allylglycine                  'C5 H9 N O2'     115.130 
ALA 'L-peptide linking' y ALANINE                         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ?                               'C5 H11 N O2 S'  149.211 
NO3 non-polymer         . 'NITRATE ION'                   ?                               'N O3 -1'        62.005  
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'         ?                               'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE                   ?                               'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"        'VITAMIN B6 Phosphate'          'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3COG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   49.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.3 
_exptl_crystal_grow.pdbx_details    
;0.2M Di-ammonium hydrogen citrate, 20% PEG 3350. Streak seeding used, apo crystal soaked with inhibitor, pH 5.3, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-10-19 
_diffrn_detector.details                'Double mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91841 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.91841 
# 
_reflns.entry_id                     3COG 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   109200 
_reflns.number_all                   109200 
_reflns.percent_possible_obs         92.9 
_reflns.pdbx_Rmerge_I_obs            0.123 
_reflns.pdbx_Rsym_value              0.123 
_reflns.pdbx_netI_over_sigmaI        13.81 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.1 
_reflns_shell.percent_possible_all   98.9 
_reflns_shell.Rmerge_I_obs           0.469 
_reflns_shell.pdbx_Rsym_value        0.445 
_reflns_shell.meanI_over_sigI_obs    3.2 
_reflns_shell.pdbx_redundancy        4.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3COG 
_refine.ls_number_reflns_obs                     103738 
_refine.ls_number_reflns_all                     103738 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.91 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.16061 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.15831 
_refine.ls_R_factor_R_free                       0.20406 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5460 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               14.036 
_refine.aniso_B[1][1]                            -0.79 
_refine.aniso_B[2][2]                            -0.11 
_refine.aniso_B[3][3]                            0.89 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 2NMP' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.163 
_refine.pdbx_overall_ESU_R_Free                  0.148 
_refine.overall_SU_ML                            0.095 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.356 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11836 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         118 
_refine_hist.number_atoms_solvent             1160 
_refine_hist.number_atoms_total               13114 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        19.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 12263 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 8164  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.374  1.967  ? 16629 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.931  3.000  ? 20006 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.201  5.000  ? 1534  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.618 24.397 ? 514   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.029 15.000 ? 2046  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.156 15.000 ? 50    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.119  0.200  ? 1886  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 13522 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2362  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.207  0.200  ? 2698  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.196  0.200  ? 8906  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.176  0.200  ? 5977  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.089  0.200  ? 6173  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.156  0.200  ? 1100  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.107  0.200  ? 11    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.146  0.200  ? 26    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.201  0.200  ? 19    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.808  1.500  ? 8238  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.177  1.500  ? 3097  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.189  2.000  ? 12357 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.999  3.000  ? 4976  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.896  4.500  ? 4268  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.051 
_refine_ls_shell.number_reflns_R_work             7936 
_refine_ls_shell.R_factor_R_work                  0.185 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.251 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             417 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3COG 
_struct.title                     
'Crystal structure of human cystathionase (Cystathionine gamma lyase) in complex with DL-propargylglycine' 
_struct.pdbx_descriptor           'Cystathionine gamma-lyase (E.C.4.4.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3COG 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
;CTH, PLP, Propargylglycine, SGC, inhibitor, Structural Genomics, SGC Stockholm, Structural Genomics Consortium, Amino-acid biosynthesis, Cysteine biosynthesis, Disease mutation, Lyase, Phosphoprotein, Pyridoxal phosphate
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 2 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 18  ? VAL A 26  ? HIS A 17  VAL A 25  1 ? 9  
HELX_P HELX_P2  2  ASP A 29  ? TRP A 33  ? ASP A 28  TRP A 32  5 ? 5  
HELX_P HELX_P3  3  ASN A 66  ? GLY A 81  ? ASN A 65  GLY A 80  1 ? 16 
HELX_P HELX_P4  4  SER A 90  ? HIS A 100 ? SER A 89  HIS A 99  1 ? 11 
HELX_P HELX_P5  5  TYR A 115 ? VAL A 125 ? TYR A 114 VAL A 124 1 ? 11 
HELX_P HELX_P6  6  ALA A 126 ? GLY A 130 ? ALA A 125 GLY A 129 5 ? 5  
HELX_P HELX_P7  7  LYS A 140 ? ILE A 148 ? LYS A 139 ILE A 147 1 ? 9  
HELX_P HELX_P8  8  ASP A 169 ? HIS A 178 ? ASP A 168 HIS A 177 1 ? 10 
HELX_P HELX_P9  9  CYS A 230 ? GLY A 245 ? CYS A 229 GLY A 244 1 ? 16 
HELX_P HELX_P10 10 SER A 249 ? LYS A 261 ? SER A 248 LYS A 260 1 ? 13 
HELX_P HELX_P11 11 THR A 262 ? SER A 283 ? THR A 261 SER A 282 1 ? 22 
HELX_P HELX_P12 12 GLN A 300 ? CYS A 308 ? GLN A 299 CYS A 307 1 ? 9  
HELX_P HELX_P13 13 THR A 322 ? LEU A 333 ? THR A 321 LEU A 332 1 ? 12 
HELX_P HELX_P14 14 LEU A 361 ? GLY A 369 ? LEU A 360 GLY A 368 1 ? 9  
HELX_P HELX_P15 15 ASP A 383 ? HIS A 399 ? ASP A 382 HIS A 398 1 ? 17 
HELX_P HELX_P16 16 HIS B 18  ? VAL B 26  ? HIS B 17  VAL B 25  1 ? 9  
HELX_P HELX_P17 17 ASP B 29  ? TRP B 33  ? ASP B 28  TRP B 32  5 ? 5  
HELX_P HELX_P18 18 ASN B 66  ? GLY B 81  ? ASN B 65  GLY B 80  1 ? 16 
HELX_P HELX_P19 19 SER B 90  ? HIS B 100 ? SER B 89  HIS B 99  1 ? 11 
HELX_P HELX_P20 20 TYR B 115 ? VAL B 125 ? TYR B 114 VAL B 124 1 ? 11 
HELX_P HELX_P21 21 ALA B 126 ? GLY B 130 ? ALA B 125 GLY B 129 5 ? 5  
HELX_P HELX_P22 22 LYS B 140 ? ILE B 148 ? LYS B 139 ILE B 147 1 ? 9  
HELX_P HELX_P23 23 ASP B 169 ? HIS B 180 ? ASP B 168 HIS B 179 1 ? 12 
HELX_P HELX_P24 24 CYS B 230 ? GLY B 245 ? CYS B 229 GLY B 244 1 ? 16 
HELX_P HELX_P25 25 SER B 249 ? LYS B 261 ? SER B 248 LYS B 260 1 ? 13 
HELX_P HELX_P26 26 THR B 262 ? ASN B 284 ? THR B 261 ASN B 283 1 ? 23 
HELX_P HELX_P27 27 GLN B 300 ? CYS B 308 ? GLN B 299 CYS B 307 1 ? 9  
HELX_P HELX_P28 28 THR B 322 ? LEU B 333 ? THR B 321 LEU B 332 1 ? 12 
HELX_P HELX_P29 29 ASP B 383 ? HIS B 399 ? ASP B 382 HIS B 398 1 ? 17 
HELX_P HELX_P30 30 HIS C 18  ? VAL C 26  ? HIS C 17  VAL C 25  1 ? 9  
HELX_P HELX_P31 31 ASP C 29  ? TRP C 33  ? ASP C 28  TRP C 32  5 ? 5  
HELX_P HELX_P32 32 ASN C 66  ? GLY C 81  ? ASN C 65  GLY C 80  1 ? 16 
HELX_P HELX_P33 33 SER C 90  ? HIS C 100 ? SER C 89  HIS C 99  1 ? 11 
HELX_P HELX_P34 34 TYR C 115 ? VAL C 125 ? TYR C 114 VAL C 124 1 ? 11 
HELX_P HELX_P35 35 ALA C 126 ? PHE C 129 ? ALA C 125 PHE C 128 5 ? 4  
HELX_P HELX_P36 36 LYS C 140 ? ILE C 148 ? LYS C 139 ILE C 147 1 ? 9  
HELX_P HELX_P37 37 ASP C 169 ? HIS C 180 ? ASP C 168 HIS C 179 1 ? 12 
HELX_P HELX_P38 38 MET C 192 ? GLN C 197 ? MET C 191 GLN C 196 1 ? 6  
HELX_P HELX_P39 39 CYS C 230 ? GLY C 245 ? CYS C 229 GLY C 244 1 ? 16 
HELX_P HELX_P40 40 SER C 249 ? LYS C 261 ? SER C 248 LYS C 260 1 ? 13 
HELX_P HELX_P41 41 THR C 262 ? SER C 283 ? THR C 261 SER C 282 1 ? 22 
HELX_P HELX_P42 42 GLN C 300 ? CYS C 308 ? GLN C 299 CYS C 307 1 ? 9  
HELX_P HELX_P43 43 THR C 322 ? LEU C 333 ? THR C 321 LEU C 332 1 ? 12 
HELX_P HELX_P44 44 LEU C 361 ? GLY C 369 ? LEU C 360 GLY C 368 1 ? 9  
HELX_P HELX_P45 45 ASP C 383 ? HIS C 399 ? ASP C 382 HIS C 398 1 ? 17 
HELX_P HELX_P46 46 HIS D 18  ? VAL D 26  ? HIS D 17  VAL D 25  1 ? 9  
HELX_P HELX_P47 47 ASP D 29  ? TRP D 33  ? ASP D 28  TRP D 32  5 ? 5  
HELX_P HELX_P48 48 ASN D 66  ? GLY D 81  ? ASN D 65  GLY D 80  1 ? 16 
HELX_P HELX_P49 49 SER D 90  ? HIS D 100 ? SER D 89  HIS D 99  1 ? 11 
HELX_P HELX_P50 50 TYR D 115 ? VAL D 125 ? TYR D 114 VAL D 124 1 ? 11 
HELX_P HELX_P51 51 ALA D 126 ? GLY D 130 ? ALA D 125 GLY D 129 5 ? 5  
HELX_P HELX_P52 52 LYS D 140 ? ILE D 148 ? LYS D 139 ILE D 147 1 ? 9  
HELX_P HELX_P53 53 ASP D 169 ? HIS D 180 ? ASP D 168 HIS D 179 1 ? 12 
HELX_P HELX_P54 54 ARG D 198 ? GLY D 203 ? ARG D 197 GLY D 202 5 ? 6  
HELX_P HELX_P55 55 CYS D 230 ? GLY D 245 ? CYS D 229 GLY D 244 1 ? 16 
HELX_P HELX_P56 56 SER D 249 ? LYS D 261 ? SER D 248 LYS D 260 1 ? 13 
HELX_P HELX_P57 57 THR D 262 ? SER D 283 ? THR D 261 SER D 282 1 ? 22 
HELX_P HELX_P58 58 GLN D 300 ? CYS D 308 ? GLN D 299 CYS D 307 1 ? 9  
HELX_P HELX_P59 59 THR D 322 ? LEU D 333 ? THR D 321 LEU D 332 1 ? 12 
HELX_P HELX_P60 60 LEU D 361 ? GLY D 369 ? LEU D 360 GLY D 368 1 ? 9  
HELX_P HELX_P61 61 ASP D 383 ? HIS D 399 ? ASP D 382 HIS D 398 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 213 NZ ? ? ? 1_555 F PLP . C4A ? ? A LYS 212 A PLP 500 1_555 ? ? ? ? ? ? ? 1.275 ? 
covale2 covale ? ? C LYS 213 NZ ? ? ? 1_555 K PLP . C4A ? ? C LYS 212 C PLP 500 1_555 ? ? ? ? ? ? ? 1.281 ? 
covale3 covale ? ? D LYS 213 NZ ? ? ? 1_555 O PLP . C4A ? ? D LYS 212 D PLP 500 1_555 ? ? ? ? ? ? ? 1.277 ? 
covale4 covale ? ? A TYR 115 OH ? ? ? 1_555 G 2AG . C1E ? ? A TYR 114 A 2AG 501 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale5 covale ? ? C TYR 115 OH ? ? ? 1_555 L 2AG . C1E ? ? C TYR 114 C 2AG 501 1_555 ? ? ? ? ? ? ? 1.343 ? 
covale6 covale ? ? D TYR 115 OH ? ? ? 1_555 P 2AG . C1E ? ? D TYR 114 D 2AG 501 1_555 ? ? ? ? ? ? ? 1.342 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 159 A . ? THR 158 A PRO 160 A ? PRO 159 A 1 -9.23 
2 ASN 162 A . ? ASN 161 A PRO 163 A ? PRO 162 A 1 9.08  
3 THR 159 B . ? THR 158 B PRO 160 B ? PRO 159 B 1 -8.77 
4 ASN 162 B . ? ASN 161 B PRO 163 B ? PRO 162 B 1 -1.37 
5 THR 159 C . ? THR 158 C PRO 160 C ? PRO 159 C 1 -6.18 
6 ASN 162 C . ? ASN 161 C PRO 163 C ? PRO 162 C 1 5.04  
7 THR 159 D . ? THR 158 D PRO 160 D ? PRO 159 D 1 -7.51 
8 ASN 162 D . ? ASN 161 D PRO 163 D ? PRO 162 D 1 4.82  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 5 ? 
C ? 7 ? 
D ? 5 ? 
E ? 7 ? 
F ? 5 ? 
G ? 7 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 84  ? PHE A 88  ? TYR A 83  PHE A 87  
A 2 GLY A 224 ? VAL A 228 ? GLY A 223 VAL A 227 
A 3 ILE A 206 ? SER A 210 ? ILE A 205 SER A 209 
A 4 ILE A 184 ? ASP A 188 ? ILE A 183 ASP A 187 
A 5 THR A 152 ? GLU A 158 ? THR A 151 GLU A 157 
A 6 GLN A 107 ? MET A 111 ? GLN A 106 MET A 110 
A 7 LYS A 132 ? VAL A 136 ? LYS A 131 VAL A 135 
B 1 VAL A 287 ? ILE A 291 ? VAL A 286 ILE A 290 
B 2 MET A 314 ? ILE A 319 ? MET A 313 ILE A 318 
B 3 LEU A 374 ? SER A 378 ? LEU A 373 SER A 377 
B 4 LEU A 348 ? GLU A 350 ? LEU A 347 GLU A 349 
B 5 THR A 337 ? LEU A 338 ? THR A 336 LEU A 337 
C 1 TYR B 84  ? PHE B 88  ? TYR B 83  PHE B 87  
C 2 GLY B 224 ? VAL B 228 ? GLY B 223 VAL B 227 
C 3 ILE B 206 ? SER B 210 ? ILE B 205 SER B 209 
C 4 ILE B 184 ? ASP B 188 ? ILE B 183 ASP B 187 
C 5 THR B 152 ? GLU B 158 ? THR B 151 GLU B 157 
C 6 GLN B 107 ? MET B 111 ? GLN B 106 MET B 110 
C 7 LYS B 132 ? VAL B 136 ? LYS B 131 VAL B 135 
D 1 VAL B 287 ? ILE B 291 ? VAL B 286 ILE B 290 
D 2 MET B 314 ? ILE B 319 ? MET B 313 ILE B 318 
D 3 LEU B 374 ? SER B 378 ? LEU B 373 SER B 377 
D 4 LEU B 348 ? GLU B 350 ? LEU B 347 GLU B 349 
D 5 THR B 337 ? LEU B 338 ? THR B 336 LEU B 337 
E 1 TYR C 84  ? PHE C 88  ? TYR C 83  PHE C 87  
E 2 GLY C 224 ? VAL C 228 ? GLY C 223 VAL C 227 
E 3 ILE C 206 ? SER C 210 ? ILE C 205 SER C 209 
E 4 ILE C 184 ? ASP C 188 ? ILE C 183 ASP C 187 
E 5 THR C 152 ? GLU C 158 ? THR C 151 GLU C 157 
E 6 GLN C 107 ? MET C 111 ? GLN C 106 MET C 110 
E 7 LYS C 132 ? VAL C 136 ? LYS C 131 VAL C 135 
F 1 VAL C 287 ? ILE C 291 ? VAL C 286 ILE C 290 
F 2 MET C 314 ? ILE C 319 ? MET C 313 ILE C 318 
F 3 LEU C 374 ? SER C 378 ? LEU C 373 SER C 377 
F 4 LEU C 348 ? GLU C 350 ? LEU C 347 GLU C 349 
F 5 THR C 337 ? LEU C 338 ? THR C 336 LEU C 337 
G 1 TYR D 84  ? PHE D 88  ? TYR D 83  PHE D 87  
G 2 GLY D 224 ? VAL D 228 ? GLY D 223 VAL D 227 
G 3 ILE D 206 ? SER D 210 ? ILE D 205 SER D 209 
G 4 ILE D 184 ? ASP D 188 ? ILE D 183 ASP D 187 
G 5 THR D 152 ? GLU D 158 ? THR D 151 GLU D 157 
G 6 GLN D 107 ? MET D 111 ? GLN D 106 MET D 110 
G 7 LYS D 132 ? VAL D 136 ? LYS D 131 VAL D 135 
H 1 VAL D 287 ? ILE D 291 ? VAL D 286 ILE D 290 
H 2 MET D 314 ? ILE D 319 ? MET D 313 ILE D 318 
H 3 LEU D 374 ? SER D 378 ? LEU D 373 SER D 377 
H 4 LEU D 348 ? GLU D 350 ? LEU D 347 GLU D 349 
H 5 THR D 337 ? LEU D 338 ? THR D 336 LEU D 337 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 88  ? N PHE A 87  O GLY A 224 ? O GLY A 223 
A 2 3 O SER A 227 ? O SER A 226 N SER A 207 ? N SER A 206 
A 3 4 O ILE A 206 ? O ILE A 205 N VAL A 187 ? N VAL A 186 
A 4 5 O ASP A 188 ? O ASP A 187 N ILE A 157 ? N ILE A 156 
A 5 6 O TRP A 156 ? O TRP A 155 N ILE A 109 ? N ILE A 108 
A 6 7 N ILE A 108 ? N ILE A 107 O LYS A 132 ? O LYS A 131 
B 1 2 N ILE A 291 ? N ILE A 290 O THR A 316 ? O THR A 315 
B 2 3 N PHE A 317 ? N PHE A 316 O ILE A 375 ? O ILE A 374 
B 3 4 O ARG A 376 ? O ARG A 375 N GLU A 350 ? N GLU A 349 
B 4 5 O ALA A 349 ? O ALA A 348 N THR A 337 ? N THR A 336 
C 1 2 N PHE B 88  ? N PHE B 87  O GLY B 224 ? O GLY B 223 
C 2 3 O SER B 227 ? O SER B 226 N SER B 207 ? N SER B 206 
C 3 4 O MET B 208 ? O MET B 207 N VAL B 187 ? N VAL B 186 
C 4 5 O VAL B 186 ? O VAL B 185 N ILE B 157 ? N ILE B 156 
C 5 6 O LEU B 154 ? O LEU B 153 N ILE B 109 ? N ILE B 108 
C 6 7 N ILE B 108 ? N ILE B 107 O LYS B 132 ? O LYS B 131 
D 1 2 N ILE B 291 ? N ILE B 290 O THR B 316 ? O THR B 315 
D 2 3 N PHE B 317 ? N PHE B 316 O ILE B 375 ? O ILE B 374 
D 3 4 O ARG B 376 ? O ARG B 375 N GLU B 350 ? N GLU B 349 
D 4 5 O ALA B 349 ? O ALA B 348 N THR B 337 ? N THR B 336 
E 1 2 N PHE C 88  ? N PHE C 87  O GLY C 224 ? O GLY C 223 
E 2 3 O LEU C 225 ? O LEU C 224 N TYR C 209 ? N TYR C 208 
E 3 4 O MET C 208 ? O MET C 207 N VAL C 187 ? N VAL C 186 
E 4 5 O ILE C 184 ? O ILE C 183 N VAL C 155 ? N VAL C 154 
E 5 6 O TRP C 156 ? O TRP C 155 N ILE C 109 ? N ILE C 108 
E 6 7 N ILE C 108 ? N ILE C 107 O LYS C 132 ? O LYS C 131 
F 1 2 N ILE C 291 ? N ILE C 290 O THR C 316 ? O THR C 315 
F 2 3 N VAL C 315 ? N VAL C 314 O LEU C 377 ? O LEU C 376 
F 3 4 O SER C 378 ? O SER C 377 N LEU C 348 ? N LEU C 347 
F 4 5 O ALA C 349 ? O ALA C 348 N THR C 337 ? N THR C 336 
G 1 2 N PHE D 88  ? N PHE D 87  O GLY D 224 ? O GLY D 223 
G 2 3 O SER D 227 ? O SER D 226 N SER D 207 ? N SER D 206 
G 3 4 O MET D 208 ? O MET D 207 N VAL D 187 ? N VAL D 186 
G 4 5 O ASP D 188 ? O ASP D 187 N ILE D 157 ? N ILE D 156 
G 5 6 O TRP D 156 ? O TRP D 155 N ILE D 109 ? N ILE D 108 
G 6 7 N ILE D 108 ? N ILE D 107 O LYS D 132 ? O LYS D 131 
H 1 2 N ILE D 291 ? N ILE D 290 O THR D 316 ? O THR D 315 
H 2 3 N PHE D 317 ? N PHE D 316 O ILE D 375 ? O ILE D 374 
H 3 4 O SER D 378 ? O SER D 377 N LEU D 348 ? N LEU D 347 
H 4 5 O ALA D 349 ? O ALA D 348 N THR D 337 ? N THR D 336 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NO3 C 606' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NO3 D 607' 
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NO3 A 608' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PLP A 500' 
AC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PLP C 500' 
AC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PLP D 500' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE 2AG A 501' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE 2AG C 501' 
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE 2AG D 501' 
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL D 601' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL C 602' 
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 603' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL D 604' 
BC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL D 605' 
BC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PEG A 609' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7  TYR C 115 ? TYR C 114 . ? 1_555 ? 
2   AC1 7  ASN C 162 ? ASN C 161 . ? 1_555 ? 
3   AC1 7  LYS C 213 ? LYS C 212 . ? 1_555 ? 
4   AC1 7  SER C 341 ? SER C 340 . ? 1_555 ? 
5   AC1 7  LEU C 342 ? LEU C 341 . ? 1_555 ? 
6   AC1 7  THR C 356 ? THR C 355 . ? 1_555 ? 
7   AC1 7  ARG C 376 ? ARG C 375 . ? 1_555 ? 
8   AC2 7  TYR D 115 ? TYR D 114 . ? 1_555 ? 
9   AC2 7  ASN D 162 ? ASN D 161 . ? 1_555 ? 
10  AC2 7  LYS D 213 ? LYS D 212 . ? 1_555 ? 
11  AC2 7  SER D 341 ? SER D 340 . ? 1_555 ? 
12  AC2 7  LEU D 342 ? LEU D 341 . ? 1_555 ? 
13  AC2 7  THR D 356 ? THR D 355 . ? 1_555 ? 
14  AC2 7  ARG D 376 ? ARG D 375 . ? 1_555 ? 
15  AC3 7  TYR A 115 ? TYR A 114 . ? 1_555 ? 
16  AC3 7  ASN A 162 ? ASN A 161 . ? 1_555 ? 
17  AC3 7  LYS A 213 ? LYS A 212 . ? 1_555 ? 
18  AC3 7  SER A 341 ? SER A 340 . ? 1_555 ? 
19  AC3 7  LEU A 342 ? LEU A 341 . ? 1_555 ? 
20  AC3 7  THR A 356 ? THR A 355 . ? 1_555 ? 
21  AC3 7  ARG A 376 ? ARG A 375 . ? 1_555 ? 
22  AC4 12 SER A 90  ? SER A 89  . ? 1_555 ? 
23  AC4 12 GLY A 91  ? GLY A 90  . ? 1_555 ? 
24  AC4 12 LEU A 92  ? LEU A 91  . ? 1_555 ? 
25  AC4 12 TYR A 115 ? TYR A 114 . ? 1_555 ? 
26  AC4 12 ASN A 162 ? ASN A 161 . ? 1_555 ? 
27  AC4 12 ASP A 188 ? ASP A 187 . ? 1_555 ? 
28  AC4 12 THR A 190 ? THR A 189 . ? 1_555 ? 
29  AC4 12 SER A 210 ? SER A 209 . ? 1_555 ? 
30  AC4 12 THR A 212 ? THR A 211 . ? 1_555 ? 
31  AC4 12 LYS A 213 ? LYS A 212 . ? 1_555 ? 
32  AC4 12 TYR B 61  ? TYR B 60  . ? 1_555 ? 
33  AC4 12 ARG B 63  ? ARG B 62  . ? 1_555 ? 
34  AC5 12 SER C 90  ? SER C 89  . ? 1_555 ? 
35  AC5 12 GLY C 91  ? GLY C 90  . ? 1_555 ? 
36  AC5 12 LEU C 92  ? LEU C 91  . ? 1_555 ? 
37  AC5 12 TYR C 115 ? TYR C 114 . ? 1_555 ? 
38  AC5 12 ASN C 162 ? ASN C 161 . ? 1_555 ? 
39  AC5 12 ASP C 188 ? ASP C 187 . ? 1_555 ? 
40  AC5 12 THR C 190 ? THR C 189 . ? 1_555 ? 
41  AC5 12 SER C 210 ? SER C 209 . ? 1_555 ? 
42  AC5 12 THR C 212 ? THR C 211 . ? 1_555 ? 
43  AC5 12 LYS C 213 ? LYS C 212 . ? 1_555 ? 
44  AC5 12 TYR D 61  ? TYR D 60  . ? 1_555 ? 
45  AC5 12 ARG D 63  ? ARG D 62  . ? 1_555 ? 
46  AC6 12 TYR C 61  ? TYR C 60  . ? 1_555 ? 
47  AC6 12 ARG C 63  ? ARG C 62  . ? 1_555 ? 
48  AC6 12 SER D 90  ? SER D 89  . ? 1_555 ? 
49  AC6 12 GLY D 91  ? GLY D 90  . ? 1_555 ? 
50  AC6 12 LEU D 92  ? LEU D 91  . ? 1_555 ? 
51  AC6 12 TYR D 115 ? TYR D 114 . ? 1_555 ? 
52  AC6 12 ASN D 162 ? ASN D 161 . ? 1_555 ? 
53  AC6 12 ASP D 188 ? ASP D 187 . ? 1_555 ? 
54  AC6 12 SER D 210 ? SER D 209 . ? 1_555 ? 
55  AC6 12 THR D 212 ? THR D 211 . ? 1_555 ? 
56  AC6 12 LYS D 213 ? LYS D 212 . ? 1_555 ? 
57  AC6 12 LEU D 342 ? LEU D 341 . ? 1_555 ? 
58  AC7 5  TYR A 115 ? TYR A 114 . ? 1_555 ? 
59  AC7 5  ARG A 120 ? ARG A 119 . ? 1_555 ? 
60  AC7 5  GLU A 340 ? GLU A 339 . ? 1_555 ? 
61  AC7 5  TYR B 61  ? TYR B 60  . ? 1_555 ? 
62  AC7 5  ARG B 63  ? ARG B 62  . ? 1_555 ? 
63  AC8 5  TYR C 115 ? TYR C 114 . ? 1_555 ? 
64  AC8 5  ARG C 120 ? ARG C 119 . ? 1_555 ? 
65  AC8 5  GLU C 340 ? GLU C 339 . ? 1_555 ? 
66  AC8 5  TYR D 61  ? TYR D 60  . ? 1_555 ? 
67  AC8 5  ARG D 63  ? ARG D 62  . ? 1_555 ? 
68  AC9 6  GLU C 60  ? GLU C 59  . ? 1_555 ? 
69  AC9 6  TYR C 61  ? TYR C 60  . ? 1_555 ? 
70  AC9 6  ARG C 63  ? ARG C 62  . ? 1_555 ? 
71  AC9 6  TYR D 115 ? TYR D 114 . ? 1_555 ? 
72  AC9 6  ARG D 120 ? ARG D 119 . ? 1_555 ? 
73  AC9 6  GLU D 340 ? GLU D 339 . ? 1_555 ? 
74  BC1 4  GLU C 128 ? GLU C 127 . ? 1_555 ? 
75  BC1 4  HIS D 100 ? HIS D 99  . ? 1_555 ? 
76  BC1 4  LEU D 101 ? LEU D 100 . ? 1_555 ? 
77  BC1 4  LEU D 102 ? LEU D 101 . ? 1_555 ? 
78  BC2 4  HIS C 100 ? HIS C 99  . ? 1_555 ? 
79  BC2 4  LEU C 101 ? LEU C 100 . ? 1_555 ? 
80  BC2 4  LEU C 102 ? LEU C 101 . ? 1_555 ? 
81  BC2 4  GLU D 128 ? GLU D 127 . ? 1_555 ? 
82  BC3 4  HIS A 100 ? HIS A 99  . ? 1_555 ? 
83  BC3 4  LEU A 101 ? LEU A 100 . ? 1_555 ? 
84  BC3 4  LEU A 102 ? LEU A 101 . ? 1_555 ? 
85  BC3 4  GLU B 128 ? GLU B 127 . ? 1_555 ? 
86  BC4 6  TRP B 33  ? TRP B 32  . ? 1_555 ? 
87  BC4 6  THR B 34  ? THR B 33  . ? 1_555 ? 
88  BC4 6  SER B 35  ? SER B 34  . ? 1_555 ? 
89  BC4 6  TRP D 33  ? TRP D 32  . ? 1_555 ? 
90  BC4 6  THR D 34  ? THR D 33  . ? 1_555 ? 
91  BC4 6  SER D 35  ? SER D 34  . ? 1_555 ? 
92  BC5 5  LEU C 44  ? LEU C 43  . ? 1_555 ? 
93  BC5 5  SER C 249 ? SER C 248 . ? 1_555 ? 
94  BC5 5  PRO C 250 ? PRO C 249 . ? 1_555 ? 
95  BC5 5  ASP D 220 ? ASP D 219 . ? 1_555 ? 
96  BC5 5  ASP D 252 ? ASP D 251 . ? 1_555 ? 
97  BC6 8  PRO A 296 ? PRO A 295 . ? 1_555 ? 
98  BC6 8  HIS A 298 ? HIS A 297 . ? 1_555 ? 
99  BC6 8  PRO A 299 ? PRO A 298 . ? 1_555 ? 
100 BC6 8  GLN A 300 ? GLN A 299 . ? 1_555 ? 
101 BC6 8  HIS A 301 ? HIS A 300 . ? 1_555 ? 
102 BC6 8  GLU A 302 ? GLU A 301 . ? 1_555 ? 
103 BC6 8  LEU A 303 ? LEU A 302 . ? 1_555 ? 
104 BC6 8  ARG A 306 ? ARG A 305 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3COG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3COG 
_atom_sites.fract_transf_matrix[1][1]   0.009492 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009327 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006523 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLY A 1 11  ? 3.931   48.284  -25.761 1.00 23.06 ? 10  GLY A N   1 
ATOM   2     C CA  . GLY A 1 11  ? 4.328   48.250  -24.317 1.00 22.69 ? 10  GLY A CA  1 
ATOM   3     C C   . GLY A 1 11  ? 3.667   47.105  -23.566 1.00 22.00 ? 10  GLY A C   1 
ATOM   4     O O   . GLY A 1 11  ? 3.909   46.886  -22.377 1.00 22.50 ? 10  GLY A O   1 
ATOM   5     N N   . PHE A 1 12  ? 2.828   46.356  -24.267 1.00 21.32 ? 11  PHE A N   1 
ATOM   6     C CA  . PHE A 1 12  ? 2.190   45.197  -23.674 1.00 20.59 ? 11  PHE A CA  1 
ATOM   7     C C   . PHE A 1 12  ? 3.153   43.995  -23.589 1.00 20.52 ? 11  PHE A C   1 
ATOM   8     O O   . PHE A 1 12  ? 4.235   43.966  -24.192 1.00 20.19 ? 11  PHE A O   1 
ATOM   9     C CB  . PHE A 1 12  ? 0.940   44.827  -24.464 1.00 20.10 ? 11  PHE A CB  1 
ATOM   10    C CG  . PHE A 1 12  ? -0.190  45.825  -24.335 1.00 19.65 ? 11  PHE A CG  1 
ATOM   11    C CD1 . PHE A 1 12  ? -0.183  47.001  -25.059 1.00 20.08 ? 11  PHE A CD1 1 
ATOM   12    C CD2 . PHE A 1 12  ? -1.260  45.582  -23.485 1.00 20.52 ? 11  PHE A CD2 1 
ATOM   13    C CE1 . PHE A 1 12  ? -1.237  47.910  -24.963 1.00 18.66 ? 11  PHE A CE1 1 
ATOM   14    C CE2 . PHE A 1 12  ? -2.319  46.488  -23.384 1.00 18.60 ? 11  PHE A CE2 1 
ATOM   15    C CZ  . PHE A 1 12  ? -2.298  47.652  -24.120 1.00 19.20 ? 11  PHE A CZ  1 
ATOM   16    N N   . LEU A 1 13  ? 2.748   43.010  -22.805 1.00 20.28 ? 12  LEU A N   1 
ATOM   17    C CA  . LEU A 1 13  ? 3.387   41.709  -22.805 1.00 20.30 ? 12  LEU A CA  1 
ATOM   18    C C   . LEU A 1 13  ? 3.475   41.245  -24.252 1.00 20.29 ? 12  LEU A C   1 
ATOM   19    O O   . LEU A 1 13  ? 2.509   41.396  -25.010 1.00 21.26 ? 12  LEU A O   1 
ATOM   20    C CB  . LEU A 1 13  ? 2.522   40.762  -21.978 1.00 20.50 ? 12  LEU A CB  1 
ATOM   21    C CG  . LEU A 1 13  ? 3.072   39.630  -21.142 1.00 21.36 ? 12  LEU A CG  1 
ATOM   22    C CD1 . LEU A 1 13  ? 4.197   40.108  -20.215 1.00 21.10 ? 12  LEU A CD1 1 
ATOM   23    C CD2 . LEU A 1 13  ? 1.895   39.066  -20.377 1.00 19.75 ? 12  LEU A CD2 1 
ATOM   24    N N   . PRO A 1 14  ? 4.639   40.726  -24.680 1.00 19.97 ? 13  PRO A N   1 
ATOM   25    C CA  . PRO A 1 14  ? 4.733   40.188  -26.031 1.00 19.37 ? 13  PRO A CA  1 
ATOM   26    C C   . PRO A 1 14  ? 3.667   39.111  -26.284 1.00 18.36 ? 13  PRO A C   1 
ATOM   27    O O   . PRO A 1 14  ? 3.299   38.377  -25.373 1.00 17.28 ? 13  PRO A O   1 
ATOM   28    C CB  . PRO A 1 14  ? 6.131   39.582  -26.067 1.00 20.22 ? 13  PRO A CB  1 
ATOM   29    C CG  . PRO A 1 14  ? 6.881   40.261  -24.976 1.00 19.96 ? 13  PRO A CG  1 
ATOM   30    C CD  . PRO A 1 14  ? 5.921   40.640  -23.952 1.00 20.58 ? 13  PRO A CD  1 
ATOM   31    N N   . HIS A 1 15  ? 3.157   39.044  -27.504 1.00 18.12 ? 14  HIS A N   1 
ATOM   32    C CA  . HIS A 1 15  ? 2.167   38.015  -27.857 1.00 18.03 ? 14  HIS A CA  1 
ATOM   33    C C   . HIS A 1 15  ? 2.699   36.601  -27.654 1.00 17.89 ? 14  HIS A C   1 
ATOM   34    O O   . HIS A 1 15  ? 3.884   36.309  -27.911 1.00 17.77 ? 14  HIS A O   1 
ATOM   35    C CB  . HIS A 1 15  ? 1.696   38.191  -29.300 1.00 18.31 ? 14  HIS A CB  1 
ATOM   36    C CG  . HIS A 1 15  ? 0.684   39.280  -29.465 1.00 18.36 ? 14  HIS A CG  1 
ATOM   37    N ND1 . HIS A 1 15  ? -0.600  39.169  -28.989 1.00 17.24 ? 14  HIS A ND1 1 
ATOM   38    C CD2 . HIS A 1 15  ? 0.768   40.500  -30.043 1.00 20.83 ? 14  HIS A CD2 1 
ATOM   39    C CE1 . HIS A 1 15  ? -1.272  40.268  -29.278 1.00 19.57 ? 14  HIS A CE1 1 
ATOM   40    N NE2 . HIS A 1 15  ? -0.463  41.095  -29.919 1.00 19.97 ? 14  HIS A NE2 1 
ATOM   41    N N   . PHE A 1 16  ? 1.805   35.714  -27.217 1.00 17.38 ? 15  PHE A N   1 
ATOM   42    C CA  . PHE A 1 16  ? 2.162   34.339  -26.914 1.00 16.44 ? 15  PHE A CA  1 
ATOM   43    C C   . PHE A 1 16  ? 2.575   33.614  -28.166 1.00 16.19 ? 15  PHE A C   1 
ATOM   44    O O   . PHE A 1 16  ? 1.822   33.556  -29.132 1.00 14.62 ? 15  PHE A O   1 
ATOM   45    C CB  . PHE A 1 16  ? 0.995   33.616  -26.242 1.00 16.64 ? 15  PHE A CB  1 
ATOM   46    C CG  . PHE A 1 16  ? 0.476   34.330  -25.050 1.00 17.06 ? 15  PHE A CG  1 
ATOM   47    C CD1 . PHE A 1 16  ? -0.861  34.710  -24.956 1.00 17.28 ? 15  PHE A CD1 1 
ATOM   48    C CD2 . PHE A 1 16  ? 1.356   34.721  -24.030 1.00 19.46 ? 15  PHE A CD2 1 
ATOM   49    C CE1 . PHE A 1 16  ? -1.316  35.415  -23.828 1.00 15.83 ? 15  PHE A CE1 1 
ATOM   50    C CE2 . PHE A 1 16  ? 0.903   35.412  -22.913 1.00 17.07 ? 15  PHE A CE2 1 
ATOM   51    C CZ  . PHE A 1 16  ? -0.446  35.764  -22.831 1.00 18.10 ? 15  PHE A CZ  1 
ATOM   52    N N   . GLN A 1 17  ? 3.769   33.021  -28.130 1.00 16.01 ? 16  GLN A N   1 
ATOM   53    C CA  . GLN A 1 17  ? 4.291   32.264  -29.247 1.00 16.83 ? 16  GLN A CA  1 
ATOM   54    C C   . GLN A 1 17  ? 3.408   31.082  -29.591 1.00 15.38 ? 16  GLN A C   1 
ATOM   55    O O   . GLN A 1 17  ? 2.869   30.432  -28.704 1.00 14.34 ? 16  GLN A O   1 
ATOM   56    C CB  . GLN A 1 17  ? 5.681   31.695  -28.917 1.00 17.78 ? 16  GLN A CB  1 
ATOM   57    C CG  . GLN A 1 17  ? 6.811   32.645  -29.095 1.00 23.07 ? 16  GLN A CG  1 
ATOM   58    C CD  . GLN A 1 17  ? 7.856   32.066  -30.011 1.00 29.03 ? 16  GLN A CD  1 
ATOM   59    O OE1 . GLN A 1 17  ? 8.448   31.018  -29.728 1.00 33.12 ? 16  GLN A OE1 1 
ATOM   60    N NE2 . GLN A 1 17  ? 8.065   32.724  -31.140 1.00 31.86 ? 16  GLN A NE2 1 
ATOM   61    N N   . HIS A 1 18  ? 3.328   30.812  -30.893 1.00 15.09 ? 17  HIS A N   1 
ATOM   62    C CA  . HIS A 1 18  ? 2.638   29.672  -31.492 1.00 14.52 ? 17  HIS A CA  1 
ATOM   63    C C   . HIS A 1 18  ? 1.113   29.662  -31.312 1.00 14.15 ? 17  HIS A C   1 
ATOM   64    O O   . HIS A 1 18  ? 0.485   28.654  -31.648 1.00 14.49 ? 17  HIS A O   1 
ATOM   65    C CB  . HIS A 1 18  ? 3.227   28.335  -31.007 1.00 14.86 ? 17  HIS A CB  1 
ATOM   66    C CG  . HIS A 1 18  ? 4.711   28.261  -31.139 1.00 15.57 ? 17  HIS A CG  1 
ATOM   67    N ND1 . HIS A 1 18  ? 5.351   28.425  -32.344 1.00 16.95 ? 17  HIS A ND1 1 
ATOM   68    C CD2 . HIS A 1 18  ? 5.683   28.062  -30.220 1.00 17.49 ? 17  HIS A CD2 1 
ATOM   69    C CE1 . HIS A 1 18  ? 6.660   28.328  -32.164 1.00 19.00 ? 17  HIS A CE1 1 
ATOM   70    N NE2 . HIS A 1 18  ? 6.887   28.108  -30.883 1.00 17.20 ? 17  HIS A NE2 1 
ATOM   71    N N   . PHE A 1 19  ? 0.536   30.752  -30.818 1.00 13.47 ? 18  PHE A N   1 
ATOM   72    C CA  . PHE A 1 19  ? -0.909  30.786  -30.515 1.00 13.75 ? 18  PHE A CA  1 
ATOM   73    C C   . PHE A 1 19  ? -1.777  30.410  -31.721 1.00 12.87 ? 18  PHE A C   1 
ATOM   74    O O   . PHE A 1 19  ? -2.632  29.548  -31.604 1.00 13.71 ? 18  PHE A O   1 
ATOM   75    C CB  . PHE A 1 19  ? -1.338  32.164  -30.006 1.00 13.68 ? 18  PHE A CB  1 
ATOM   76    C CG  . PHE A 1 19  ? -2.718  32.177  -29.396 1.00 13.32 ? 18  PHE A CG  1 
ATOM   77    C CD1 . PHE A 1 19  ? -2.886  32.097  -28.028 1.00 12.11 ? 18  PHE A CD1 1 
ATOM   78    C CD2 . PHE A 1 19  ? -3.841  32.223  -30.194 1.00 13.57 ? 18  PHE A CD2 1 
ATOM   79    C CE1 . PHE A 1 19  ? -4.143  32.096  -27.469 1.00 12.57 ? 18  PHE A CE1 1 
ATOM   80    C CE2 . PHE A 1 19  ? -5.097  32.227  -29.621 1.00 12.91 ? 18  PHE A CE2 1 
ATOM   81    C CZ  . PHE A 1 19  ? -5.231  32.185  -28.258 1.00 12.30 ? 18  PHE A CZ  1 
ATOM   82    N N   . ALA A 1 20  ? -1.581  31.100  -32.844 1.00 12.72 ? 19  ALA A N   1 
ATOM   83    C CA  . ALA A 1 20  ? -2.310  30.838  -34.097 1.00 12.92 ? 19  ALA A CA  1 
ATOM   84    C C   . ALA A 1 20  ? -2.091  29.403  -34.631 1.00 13.12 ? 19  ALA A C   1 
ATOM   85    O O   . ALA A 1 20  ? -3.052  28.708  -35.003 1.00 13.16 ? 19  ALA A O   1 
ATOM   86    C CB  . ALA A 1 20  ? -1.934  31.876  -35.160 1.00 12.31 ? 19  ALA A CB  1 
ATOM   87    N N   . THR A 1 21  ? -0.840  28.939  -34.616 1.00 12.43 ? 20  THR A N   1 
ATOM   88    C CA  . THR A 1 21  ? -0.540  27.556  -35.000 1.00 12.28 ? 20  THR A CA  1 
ATOM   89    C C   . THR A 1 21  ? -1.289  26.549  -34.104 1.00 12.85 ? 20  THR A C   1 
ATOM   90    O O   . THR A 1 21  ? -1.911  25.598  -34.596 1.00 12.48 ? 20  THR A O   1 
ATOM   91    C CB  . THR A 1 21  ? 0.993   27.289  -34.917 1.00 12.07 ? 20  THR A CB  1 
ATOM   92    O OG1 . THR A 1 21  ? 1.687   28.227  -35.766 1.00 11.21 ? 20  THR A OG1 1 
ATOM   93    C CG2 . THR A 1 21  ? 1.316   25.839  -35.284 1.00 11.90 ? 20  THR A CG2 1 
ATOM   94    N N   . GLN A 1 22  ? -1.250  26.771  -32.791 1.00 13.34 ? 21  GLN A N   1 
ATOM   95    C CA  . GLN A 1 22  ? -1.884  25.846  -31.850 1.00 14.17 ? 21  GLN A CA  1 
ATOM   96    C C   . GLN A 1 22  ? -3.401  25.846  -31.930 1.00 13.18 ? 21  GLN A C   1 
ATOM   97    O O   . GLN A 1 22  ? -4.020  24.789  -31.805 1.00 13.41 ? 21  GLN A O   1 
ATOM   98    C CB  . GLN A 1 22  ? -1.457  26.120  -30.418 1.00 14.44 ? 21  GLN A CB  1 
ATOM   99    C CG  . GLN A 1 22  ? -0.046  25.675  -30.140 1.00 17.02 ? 21  GLN A CG  1 
ATOM   100   C CD  . GLN A 1 22  ? 0.472   26.137  -28.812 1.00 16.79 ? 21  GLN A CD  1 
ATOM   101   O OE1 . GLN A 1 22  ? 1.567   25.750  -28.412 1.00 26.40 ? 21  GLN A OE1 1 
ATOM   102   N NE2 . GLN A 1 22  ? -0.255  26.994  -28.149 1.00 22.68 ? 21  GLN A NE2 1 
ATOM   103   N N   . ALA A 1 23  ? -3.989  27.033  -32.099 1.00 12.57 ? 22  ALA A N   1 
ATOM   104   C CA  . ALA A 1 23  ? -5.449  27.186  -32.262 1.00 11.33 ? 22  ALA A CA  1 
ATOM   105   C C   . ALA A 1 23  ? -5.995  26.401  -33.443 1.00 10.94 ? 22  ALA A C   1 
ATOM   106   O O   . ALA A 1 23  ? -7.093  25.858  -33.375 1.00 11.70 ? 22  ALA A O   1 
ATOM   107   C CB  . ALA A 1 23  ? -5.839  28.665  -32.366 1.00 10.25 ? 22  ALA A CB  1 
ATOM   108   N N   . ILE A 1 24  ? -5.213  26.330  -34.520 1.00 11.51 ? 23  ILE A N   1 
ATOM   109   C CA  . ILE A 1 24  ? -5.617  25.662  -35.738 1.00 10.96 ? 23  ILE A CA  1 
ATOM   110   C C   . ILE A 1 24  ? -5.285  24.166  -35.699 1.00 11.95 ? 23  ILE A C   1 
ATOM   111   O O   . ILE A 1 24  ? -5.983  23.350  -36.319 1.00 10.60 ? 23  ILE A O   1 
ATOM   112   C CB  . ILE A 1 24  ? -4.991  26.377  -36.965 1.00 11.37 ? 23  ILE A CB  1 
ATOM   113   C CG1 . ILE A 1 24  ? -5.636  27.745  -37.115 1.00 10.45 ? 23  ILE A CG1 1 
ATOM   114   C CG2 . ILE A 1 24  ? -5.167  25.584  -38.284 1.00 11.38 ? 23  ILE A CG2 1 
ATOM   115   C CD1 . ILE A 1 24  ? -4.776  28.776  -37.802 1.00 8.16  ? 23  ILE A CD1 1 
ATOM   116   N N   . HIS A 1 25  ? -4.244  23.783  -34.965 1.00 12.06 ? 24  HIS A N   1 
ATOM   117   C CA  . HIS A 1 25  ? -3.762  22.398  -35.070 1.00 12.60 ? 24  HIS A CA  1 
ATOM   118   C C   . HIS A 1 25  ? -3.951  21.490  -33.850 1.00 12.48 ? 24  HIS A C   1 
ATOM   119   O O   . HIS A 1 25  ? -4.112  20.283  -34.020 1.00 13.18 ? 24  HIS A O   1 
ATOM   120   C CB  . HIS A 1 25  ? -2.332  22.375  -35.580 1.00 12.82 ? 24  HIS A CB  1 
ATOM   121   C CG  . HIS A 1 25  ? -2.205  22.858  -36.986 1.00 12.69 ? 24  HIS A CG  1 
ATOM   122   N ND1 . HIS A 1 25  ? -2.537  22.073  -38.069 1.00 12.85 ? 24  HIS A ND1 1 
ATOM   123   C CD2 . HIS A 1 25  ? -1.846  24.064  -37.488 1.00 13.61 ? 24  HIS A CD2 1 
ATOM   124   C CE1 . HIS A 1 25  ? -2.353  22.765  -39.178 1.00 12.43 ? 24  HIS A CE1 1 
ATOM   125   N NE2 . HIS A 1 25  ? -1.919  23.970  -38.854 1.00 11.78 ? 24  HIS A NE2 1 
ATOM   126   N N   . VAL A 1 26  ? -3.966  22.037  -32.646 1.00 12.77 ? 25  VAL A N   1 
ATOM   127   C CA  . VAL A 1 26  ? -4.024  21.196  -31.463 1.00 12.96 ? 25  VAL A CA  1 
ATOM   128   C C   . VAL A 1 26  ? -5.366  20.521  -31.366 1.00 14.15 ? 25  VAL A C   1 
ATOM   129   O O   . VAL A 1 26  ? -6.421  21.140  -31.609 1.00 14.53 ? 25  VAL A O   1 
ATOM   130   C CB  . VAL A 1 26  ? -3.684  21.925  -30.147 1.00 12.89 ? 25  VAL A CB  1 
ATOM   131   C CG1 . VAL A 1 26  ? -3.897  20.970  -28.942 1.00 12.58 ? 25  VAL A CG1 1 
ATOM   132   C CG2 . VAL A 1 26  ? -2.255  22.450  -30.203 1.00 11.27 ? 25  VAL A CG2 1 
ATOM   133   N N   . GLY A 1 27  ? -5.299  19.220  -31.088 1.00 14.84 ? 26  GLY A N   1 
ATOM   134   C CA  . GLY A 1 27  ? -6.464  18.356  -31.046 1.00 15.97 ? 26  GLY A CA  1 
ATOM   135   C C   . GLY A 1 27  ? -7.062  18.060  -32.403 1.00 16.52 ? 26  GLY A C   1 
ATOM   136   O O   . GLY A 1 27  ? -8.104  17.432  -32.474 1.00 17.57 ? 26  GLY A O   1 
ATOM   137   N N   . GLN A 1 28  ? -6.401  18.483  -33.485 1.00 17.07 ? 27  GLN A N   1 
ATOM   138   C CA  . GLN A 1 28  ? -6.950  18.361  -34.828 1.00 17.71 ? 27  GLN A CA  1 
ATOM   139   C C   . GLN A 1 28  ? -6.189  17.393  -35.753 1.00 18.47 ? 27  GLN A C   1 
ATOM   140   O O   . GLN A 1 28  ? -6.423  17.416  -36.975 1.00 16.84 ? 27  GLN A O   1 
ATOM   141   C CB  . GLN A 1 28  ? -7.009  19.740  -35.496 1.00 17.35 ? 27  GLN A CB  1 
ATOM   142   C CG  . GLN A 1 28  ? -7.522  20.885  -34.594 1.00 16.23 ? 27  GLN A CG  1 
ATOM   143   C CD  . GLN A 1 28  ? -8.947  20.718  -34.081 1.00 16.15 ? 27  GLN A CD  1 
ATOM   144   O OE1 . GLN A 1 28  ? -9.909  20.749  -34.870 1.00 15.97 ? 27  GLN A OE1 1 
ATOM   145   N NE2 . GLN A 1 28  ? -9.104  20.630  -32.744 1.00 13.14 ? 27  GLN A NE2 1 
ATOM   146   N N   . ASP A 1 29  ? -5.313  16.555  -35.175 1.00 19.14 ? 28  ASP A N   1 
ATOM   147   C CA  . ASP A 1 29  ? -4.438  15.656  -35.946 1.00 19.49 ? 28  ASP A CA  1 
ATOM   148   C C   . ASP A 1 29  ? -5.310  14.721  -36.775 1.00 19.39 ? 28  ASP A C   1 
ATOM   149   O O   . ASP A 1 29  ? -6.163  14.026  -36.218 1.00 18.76 ? 28  ASP A O   1 
ATOM   150   C CB  . ASP A 1 29  ? -3.514  14.851  -35.014 1.00 20.22 ? 28  ASP A CB  1 
ATOM   151   C CG  . ASP A 1 29  ? -2.431  14.015  -35.777 1.00 22.18 ? 28  ASP A CG  1 
ATOM   152   O OD1 . ASP A 1 29  ? -2.429  13.906  -37.027 1.00 26.32 ? 28  ASP A OD1 1 
ATOM   153   O OD2 . ASP A 1 29  ? -1.570  13.409  -35.090 1.00 31.05 ? 28  ASP A OD2 1 
ATOM   154   N N   . PRO A 1 30  ? -5.129  14.736  -38.107 1.00 20.25 ? 29  PRO A N   1 
ATOM   155   C CA  . PRO A 1 30  ? -5.885  13.822  -38.990 1.00 20.65 ? 29  PRO A CA  1 
ATOM   156   C C   . PRO A 1 30  ? -5.693  12.330  -38.703 1.00 21.08 ? 29  PRO A C   1 
ATOM   157   O O   . PRO A 1 30  ? -6.549  11.509  -39.082 1.00 20.89 ? 29  PRO A O   1 
ATOM   158   C CB  . PRO A 1 30  ? -5.346  14.151  -40.380 1.00 20.63 ? 29  PRO A CB  1 
ATOM   159   C CG  . PRO A 1 30  ? -4.721  15.492  -40.274 1.00 20.59 ? 29  PRO A CG  1 
ATOM   160   C CD  . PRO A 1 30  ? -4.217  15.612  -38.880 1.00 20.09 ? 29  PRO A CD  1 
ATOM   161   N N   . GLU A 1 31  ? -4.587  11.991  -38.042 1.00 21.33 ? 30  GLU A N   1 
ATOM   162   C CA  . GLU A 1 31  ? -4.263  10.599  -37.725 1.00 22.16 ? 30  GLU A CA  1 
ATOM   163   C C   . GLU A 1 31  ? -5.237  10.010  -36.721 1.00 20.96 ? 30  GLU A C   1 
ATOM   164   O O   . GLU A 1 31  ? -5.315  8.792   -36.590 1.00 19.91 ? 30  GLU A O   1 
ATOM   165   C CB  . GLU A 1 31  ? -2.833  10.454  -37.178 1.00 23.23 ? 30  GLU A CB  1 
ATOM   166   C CG  . GLU A 1 31  ? -1.840  10.044  -38.244 1.00 28.08 ? 30  GLU A CG  1 
ATOM   167   C CD  . GLU A 1 31  ? -1.747  11.051  -39.361 1.00 34.51 ? 30  GLU A CD  1 
ATOM   168   O OE1 . GLU A 1 31  ? -1.862  10.627  -40.545 1.00 37.99 ? 30  GLU A OE1 1 
ATOM   169   O OE2 . GLU A 1 31  ? -1.559  12.261  -39.052 1.00 38.12 ? 30  GLU A OE2 1 
ATOM   170   N N   . GLN A 1 32  ? -5.975  10.866  -36.014 1.00 19.39 ? 31  GLN A N   1 
ATOM   171   C CA  . GLN A 1 32  ? -6.998  10.393  -35.078 1.00 18.94 ? 31  GLN A CA  1 
ATOM   172   C C   . GLN A 1 32  ? -8.142  9.628   -35.743 1.00 18.33 ? 31  GLN A C   1 
ATOM   173   O O   . GLN A 1 32  ? -8.855  8.887   -35.062 1.00 19.22 ? 31  GLN A O   1 
ATOM   174   C CB  . GLN A 1 32  ? -7.623  11.573  -34.338 1.00 18.86 ? 31  GLN A CB  1 
ATOM   175   C CG  . GLN A 1 32  ? -6.666  12.305  -33.464 1.00 18.76 ? 31  GLN A CG  1 
ATOM   176   C CD  . GLN A 1 32  ? -7.289  13.545  -32.895 1.00 19.10 ? 31  GLN A CD  1 
ATOM   177   O OE1 . GLN A 1 32  ? -7.717  13.543  -31.754 1.00 19.38 ? 31  GLN A OE1 1 
ATOM   178   N NE2 . GLN A 1 32  ? -7.367  14.611  -33.697 1.00 15.04 ? 31  GLN A NE2 1 
ATOM   179   N N   . TRP A 1 33  ? -8.343  9.847   -37.043 1.00 18.02 ? 32  TRP A N   1 
ATOM   180   C CA  . TRP A 1 33  ? -9.511  9.349   -37.756 1.00 17.70 ? 32  TRP A CA  1 
ATOM   181   C C   . TRP A 1 33  ? -9.073  8.431   -38.875 1.00 17.80 ? 32  TRP A C   1 
ATOM   182   O O   . TRP A 1 33  ? -8.089  8.703   -39.555 1.00 16.54 ? 32  TRP A O   1 
ATOM   183   C CB  . TRP A 1 33  ? -10.330 10.501  -38.348 1.00 17.45 ? 32  TRP A CB  1 
ATOM   184   C CG  . TRP A 1 33  ? -10.251 11.721  -37.513 1.00 17.85 ? 32  TRP A CG  1 
ATOM   185   C CD1 . TRP A 1 33  ? -9.680  12.921  -37.856 1.00 16.79 ? 32  TRP A CD1 1 
ATOM   186   C CD2 . TRP A 1 33  ? -10.701 11.860  -36.153 1.00 17.75 ? 32  TRP A CD2 1 
ATOM   187   N NE1 . TRP A 1 33  ? -9.760  13.791  -36.803 1.00 15.90 ? 32  TRP A NE1 1 
ATOM   188   C CE2 . TRP A 1 33  ? -10.380 13.170  -35.744 1.00 17.38 ? 32  TRP A CE2 1 
ATOM   189   C CE3 . TRP A 1 33  ? -11.351 11.010  -35.251 1.00 17.67 ? 32  TRP A CE3 1 
ATOM   190   C CZ2 . TRP A 1 33  ? -10.681 13.646  -34.474 1.00 16.35 ? 32  TRP A CZ2 1 
ATOM   191   C CZ3 . TRP A 1 33  ? -11.660 11.490  -33.983 1.00 16.93 ? 32  TRP A CZ3 1 
ATOM   192   C CH2 . TRP A 1 33  ? -11.326 12.799  -33.611 1.00 18.11 ? 32  TRP A CH2 1 
ATOM   193   N N   . THR A 1 34  ? -9.840  7.364   -39.083 1.00 17.79 ? 33  THR A N   1 
ATOM   194   C CA  . THR A 1 34  ? -9.568  6.408   -40.156 1.00 18.28 ? 33  THR A CA  1 
ATOM   195   C C   . THR A 1 34  ? -9.614  7.139   -41.516 1.00 18.25 ? 33  THR A C   1 
ATOM   196   O O   . THR A 1 34  ? -8.904  6.779   -42.454 1.00 18.16 ? 33  THR A O   1 
ATOM   197   C CB  . THR A 1 34  ? -10.592 5.226   -40.103 1.00 18.36 ? 33  THR A CB  1 
ATOM   198   O OG1 . THR A 1 34  ? -11.917 5.760   -40.099 1.00 20.92 ? 33  THR A OG1 1 
ATOM   199   C CG2 . THR A 1 34  ? -10.430 4.388   -38.807 1.00 17.65 ? 33  THR A CG2 1 
ATOM   200   N N   . SER A 1 35  ? -10.416 8.200   -41.596 1.00 18.25 ? 34  SER A N   1 
ATOM   201   C CA  . SER A 1 35  ? -10.561 9.010   -42.832 1.00 17.88 ? 34  SER A CA  1 
ATOM   202   C C   . SER A 1 35  ? -9.386  9.926   -43.163 1.00 17.81 ? 34  SER A C   1 
ATOM   203   O O   . SER A 1 35  ? -9.247  10.400  -44.311 1.00 17.24 ? 34  SER A O   1 
ATOM   204   C CB  . SER A 1 35  ? -11.842 9.877   -42.733 1.00 17.91 ? 34  SER A CB  1 
ATOM   205   O OG  . SER A 1 35  ? -11.740 10.872  -41.702 1.00 18.04 ? 34  SER A OG  1 
ATOM   206   N N   . ARG A 1 36  ? -8.577  10.226  -42.147 1.00 18.22 ? 35  ARG A N   1 
ATOM   207   C CA  . ARG A 1 36  ? -7.562  11.277  -42.233 1.00 18.34 ? 35  ARG A CA  1 
ATOM   208   C C   . ARG A 1 36  ? -8.178  12.662  -42.534 1.00 17.40 ? 35  ARG A C   1 
ATOM   209   O O   . ARG A 1 36  ? -7.531  13.520  -43.128 1.00 15.99 ? 35  ARG A O   1 
ATOM   210   C CB  . ARG A 1 36  ? -6.473  10.969  -43.263 1.00 19.07 ? 35  ARG A CB  1 
ATOM   211   C CG  . ARG A 1 36  ? -5.692  9.715   -43.054 1.00 23.29 ? 35  ARG A CG  1 
ATOM   212   C CD  . ARG A 1 36  ? -4.793  9.802   -41.862 1.00 29.85 ? 35  ARG A CD  1 
ATOM   213   N NE  . ARG A 1 36  ? -5.310  8.994   -40.763 1.00 34.42 ? 35  ARG A NE  1 
ATOM   214   C CZ  . ARG A 1 36  ? -4.970  7.730   -40.507 1.00 36.01 ? 35  ARG A CZ  1 
ATOM   215   N NH1 . ARG A 1 36  ? -4.084  7.096   -41.271 1.00 38.36 ? 35  ARG A NH1 1 
ATOM   216   N NH2 . ARG A 1 36  ? -5.520  7.094   -39.472 1.00 34.87 ? 35  ARG A NH2 1 
ATOM   217   N N   . ALA A 1 37  ? -9.426  12.866  -42.115 1.00 17.30 ? 36  ALA A N   1 
ATOM   218   C CA  . ALA A 1 37  ? -10.072 14.185  -42.203 1.00 17.04 ? 36  ALA A CA  1 
ATOM   219   C C   . ALA A 1 37  ? -9.189  15.267  -41.568 1.00 16.57 ? 36  ALA A C   1 
ATOM   220   O O   . ALA A 1 37  ? -8.649  15.070  -40.482 1.00 15.43 ? 36  ALA A O   1 
ATOM   221   C CB  . ALA A 1 37  ? -11.452 14.138  -41.501 1.00 16.15 ? 36  ALA A CB  1 
ATOM   222   N N   . VAL A 1 38  ? -9.061  16.421  -42.225 1.00 17.66 ? 37  VAL A N   1 
ATOM   223   C CA  . VAL A 1 38  ? -8.226  17.505  -41.665 1.00 17.42 ? 37  VAL A CA  1 
ATOM   224   C C   . VAL A 1 38  ? -8.981  18.326  -40.634 1.00 17.57 ? 37  VAL A C   1 
ATOM   225   O O   . VAL A 1 38  ? -8.367  19.034  -39.830 1.00 18.42 ? 37  VAL A O   1 
ATOM   226   C CB  . VAL A 1 38  ? -7.584  18.414  -42.756 1.00 17.69 ? 37  VAL A CB  1 
ATOM   227   C CG1 . VAL A 1 38  ? -6.796  17.577  -43.749 1.00 16.51 ? 37  VAL A CG1 1 
ATOM   228   C CG2 . VAL A 1 38  ? -8.606  19.301  -43.443 1.00 16.87 ? 37  VAL A CG2 1 
ATOM   229   N N   . VAL A 1 39  ? -10.310 18.227  -40.652 1.00 17.35 ? 38  VAL A N   1 
ATOM   230   C CA  . VAL A 1 39  ? -11.159 18.750  -39.582 1.00 17.17 ? 38  VAL A CA  1 
ATOM   231   C C   . VAL A 1 39  ? -11.762 17.554  -38.845 1.00 17.45 ? 38  VAL A C   1 
ATOM   232   O O   . VAL A 1 39  ? -12.267 16.632  -39.490 1.00 18.12 ? 38  VAL A O   1 
ATOM   233   C CB  . VAL A 1 39  ? -12.306 19.636  -40.160 1.00 17.19 ? 38  VAL A CB  1 
ATOM   234   C CG1 . VAL A 1 39  ? -13.149 20.175  -39.064 1.00 15.38 ? 38  VAL A CG1 1 
ATOM   235   C CG2 . VAL A 1 39  ? -11.738 20.766  -41.040 1.00 16.81 ? 38  VAL A CG2 1 
ATOM   236   N N   . PRO A 1 40  ? -11.730 17.549  -37.492 1.00 17.43 ? 39  PRO A N   1 
ATOM   237   C CA  . PRO A 1 40  ? -12.378 16.468  -36.713 1.00 17.31 ? 39  PRO A CA  1 
ATOM   238   C C   . PRO A 1 40  ? -13.884 16.267  -36.979 1.00 17.74 ? 39  PRO A C   1 
ATOM   239   O O   . PRO A 1 40  ? -14.663 17.243  -36.949 1.00 18.01 ? 39  PRO A O   1 
ATOM   240   C CB  . PRO A 1 40  ? -12.177 16.918  -35.258 1.00 17.53 ? 39  PRO A CB  1 
ATOM   241   C CG  . PRO A 1 40  ? -10.948 17.745  -35.295 1.00 17.07 ? 39  PRO A CG  1 
ATOM   242   C CD  . PRO A 1 40  ? -11.048 18.505  -36.608 1.00 17.69 ? 39  PRO A CD  1 
ATOM   243   N N   . PRO A 1 41  ? -14.301 15.010  -37.255 1.00 17.51 ? 40  PRO A N   1 
ATOM   244   C CA  . PRO A 1 41  ? -15.745 14.693  -37.392 1.00 17.08 ? 40  PRO A CA  1 
ATOM   245   C C   . PRO A 1 41  ? -16.574 15.055  -36.151 1.00 16.19 ? 40  PRO A C   1 
ATOM   246   O O   . PRO A 1 41  ? -16.054 15.028  -35.030 1.00 15.96 ? 40  PRO A O   1 
ATOM   247   C CB  . PRO A 1 41  ? -15.767 13.170  -37.593 1.00 17.52 ? 40  PRO A CB  1 
ATOM   248   C CG  . PRO A 1 41  ? -14.375 12.780  -38.052 1.00 17.93 ? 40  PRO A CG  1 
ATOM   249   C CD  . PRO A 1 41  ? -13.429 13.843  -37.512 1.00 17.72 ? 40  PRO A CD  1 
ATOM   250   N N   . ILE A 1 42  ? -17.849 15.392  -36.354 1.00 15.69 ? 41  ILE A N   1 
ATOM   251   C CA  . ILE A 1 42  ? -18.795 15.545  -35.256 1.00 16.18 ? 41  ILE A CA  1 
ATOM   252   C C   . ILE A 1 42  ? -19.316 14.154  -34.864 1.00 16.06 ? 41  ILE A C   1 
ATOM   253   O O   . ILE A 1 42  ? -20.083 13.535  -35.602 1.00 16.24 ? 41  ILE A O   1 
ATOM   254   C CB  . ILE A 1 42  ? -20.001 16.450  -35.630 1.00 15.95 ? 41  ILE A CB  1 
ATOM   255   C CG1 . ILE A 1 42  ? -19.535 17.791  -36.215 1.00 16.80 ? 41  ILE A CG1 1 
ATOM   256   C CG2 . ILE A 1 42  ? -20.880 16.667  -34.404 1.00 15.70 ? 41  ILE A CG2 1 
ATOM   257   C CD1 . ILE A 1 42  ? -20.677 18.612  -36.889 1.00 16.95 ? 41  ILE A CD1 1 
ATOM   258   N N   . SER A 1 43  ? -18.889 13.640  -33.722 1.00 16.74 ? 42  SER A N   1 
ATOM   259   C CA  . SER A 1 43  ? -19.365 12.330  -33.271 1.00 16.74 ? 42  SER A CA  1 
ATOM   260   C C   . SER A 1 43  ? -20.536 12.513  -32.329 1.00 17.01 ? 42  SER A C   1 
ATOM   261   O O   . SER A 1 43  ? -20.352 12.917  -31.180 1.00 16.87 ? 42  SER A O   1 
ATOM   262   C CB  . SER A 1 43  ? -18.252 11.515  -32.605 1.00 17.06 ? 42  SER A CB  1 
ATOM   263   O OG  . SER A 1 43  ? -18.725 10.218  -32.184 1.00 19.49 ? 42  SER A OG  1 
ATOM   264   N N   . LEU A 1 44  ? -21.745 12.217  -32.819 1.00 17.38 ? 43  LEU A N   1 
ATOM   265   C CA  . LEU A 1 44  ? -22.939 12.308  -31.989 1.00 18.08 ? 43  LEU A CA  1 
ATOM   266   C C   . LEU A 1 44  ? -23.264 11.030  -31.202 1.00 18.54 ? 43  LEU A C   1 
ATOM   267   O O   . LEU A 1 44  ? -24.052 11.078  -30.261 1.00 17.57 ? 43  LEU A O   1 
ATOM   268   C CB  . LEU A 1 44  ? -24.163 12.676  -32.837 1.00 17.77 ? 43  LEU A CB  1 
ATOM   269   C CG  . LEU A 1 44  ? -24.187 14.023  -33.557 1.00 18.65 ? 43  LEU A CG  1 
ATOM   270   C CD1 . LEU A 1 44  ? -25.608 14.278  -34.048 1.00 16.83 ? 43  LEU A CD1 1 
ATOM   271   C CD2 . LEU A 1 44  ? -23.673 15.152  -32.665 1.00 17.93 ? 43  LEU A CD2 1 
ATOM   272   N N   . SER A 1 45  ? -22.717 9.886   -31.612 1.00 19.32 ? 44  SER A N   1 
ATOM   273   C CA  . SER A 1 45  ? -23.092 8.616   -30.987 1.00 20.30 ? 44  SER A CA  1 
ATOM   274   C C   . SER A 1 45  ? -23.017 8.693   -29.470 1.00 21.48 ? 44  SER A C   1 
ATOM   275   O O   . SER A 1 45  ? -22.068 9.238   -28.906 1.00 21.75 ? 44  SER A O   1 
ATOM   276   C CB  . SER A 1 45  ? -22.226 7.442   -31.502 1.00 20.39 ? 44  SER A CB  1 
ATOM   277   O OG  . SER A 1 45  ? -22.731 6.221   -31.010 1.00 17.85 ? 44  SER A OG  1 
ATOM   278   N N   . THR A 1 46  ? -24.046 8.178   -28.811 1.00 23.22 ? 45  THR A N   1 
ATOM   279   C CA  . THR A 1 46  ? -24.048 8.067   -27.348 1.00 25.04 ? 45  THR A CA  1 
ATOM   280   C C   . THR A 1 46  ? -23.580 6.658   -26.931 1.00 26.81 ? 45  THR A C   1 
ATOM   281   O O   . THR A 1 46  ? -23.220 6.446   -25.777 1.00 27.88 ? 45  THR A O   1 
ATOM   282   C CB  . THR A 1 46  ? -25.454 8.303   -26.755 1.00 24.32 ? 45  THR A CB  1 
ATOM   283   O OG1 . THR A 1 46  ? -26.377 7.360   -27.318 1.00 24.32 ? 45  THR A OG1 1 
ATOM   284   C CG2 . THR A 1 46  ? -25.942 9.702   -27.037 1.00 21.33 ? 45  THR A CG2 1 
ATOM   285   N N   . THR A 1 47  ? -23.587 5.711   -27.877 1.00 28.42 ? 46  THR A N   1 
ATOM   286   C CA  . THR A 1 47  ? -23.271 4.315   -27.615 1.00 29.18 ? 46  THR A CA  1 
ATOM   287   C C   . THR A 1 47  ? -22.030 3.891   -28.406 1.00 30.51 ? 46  THR A C   1 
ATOM   288   O O   . THR A 1 47  ? -21.765 4.373   -29.519 1.00 29.92 ? 46  THR A O   1 
ATOM   289   C CB  . THR A 1 47  ? -24.456 3.414   -28.029 1.00 30.00 ? 46  THR A CB  1 
ATOM   290   O OG1 . THR A 1 47  ? -25.686 4.010   -27.593 1.00 31.86 ? 46  THR A OG1 1 
ATOM   291   C CG2 . THR A 1 47  ? -24.317 1.999   -27.444 1.00 30.78 ? 46  THR A CG2 1 
ATOM   292   N N   . PHE A 1 48  ? -21.254 2.988   -27.816 1.00 32.05 ? 47  PHE A N   1 
ATOM   293   C CA  . PHE A 1 48  ? -20.042 2.507   -28.460 1.00 33.02 ? 47  PHE A CA  1 
ATOM   294   C C   . PHE A 1 48  ? -19.957 0.994   -28.329 1.00 33.74 ? 47  PHE A C   1 
ATOM   295   O O   . PHE A 1 48  ? -20.260 0.436   -27.272 1.00 33.17 ? 47  PHE A O   1 
ATOM   296   C CB  . PHE A 1 48  ? -18.819 3.205   -27.870 1.00 33.31 ? 47  PHE A CB  1 
ATOM   297   C CG  . PHE A 1 48  ? -18.902 4.707   -27.938 1.00 33.55 ? 47  PHE A CG  1 
ATOM   298   C CD1 . PHE A 1 48  ? -19.627 5.417   -26.988 1.00 34.10 ? 47  PHE A CD1 1 
ATOM   299   C CD2 . PHE A 1 48  ? -18.277 5.410   -28.962 1.00 34.60 ? 47  PHE A CD2 1 
ATOM   300   C CE1 . PHE A 1 48  ? -19.711 6.801   -27.043 1.00 34.07 ? 47  PHE A CE1 1 
ATOM   301   C CE2 . PHE A 1 48  ? -18.359 6.797   -29.030 1.00 34.94 ? 47  PHE A CE2 1 
ATOM   302   C CZ  . PHE A 1 48  ? -19.082 7.493   -28.069 1.00 34.42 ? 47  PHE A CZ  1 
ATOM   303   N N   . LYS A 1 49  ? -19.598 0.335   -29.430 1.00 34.54 ? 48  LYS A N   1 
ATOM   304   C CA  . LYS A 1 49  ? -19.428 -1.107  -29.426 1.00 35.60 ? 48  LYS A CA  1 
ATOM   305   C C   . LYS A 1 49  ? -18.194 -1.433  -28.586 1.00 36.84 ? 48  LYS A C   1 
ATOM   306   O O   . LYS A 1 49  ? -17.167 -0.762  -28.698 1.00 36.82 ? 48  LYS A O   1 
ATOM   307   C CB  . LYS A 1 49  ? -19.279 -1.631  -30.849 1.00 35.29 ? 48  LYS A CB  1 
ATOM   308   C CG  . LYS A 1 49  ? -19.050 -3.130  -30.953 1.00 35.38 ? 48  LYS A CG  1 
ATOM   309   C CD  . LYS A 1 49  ? -19.040 -3.584  -32.403 1.00 35.38 ? 48  LYS A CD  1 
ATOM   310   C CE  . LYS A 1 49  ? -18.248 -4.872  -32.583 1.00 35.70 ? 48  LYS A CE  1 
ATOM   311   N NZ  . LYS A 1 49  ? -18.178 -5.248  -34.032 1.00 36.17 ? 48  LYS A NZ  1 
ATOM   312   N N   . GLN A 1 50  ? -18.313 -2.431  -27.716 1.00 38.43 ? 49  GLN A N   1 
ATOM   313   C CA  . GLN A 1 50  ? -17.216 -2.788  -26.819 1.00 40.14 ? 49  GLN A CA  1 
ATOM   314   C C   . GLN A 1 50  ? -16.541 -4.055  -27.312 1.00 40.21 ? 49  GLN A C   1 
ATOM   315   O O   . GLN A 1 50  ? -15.911 -4.030  -28.372 1.00 40.55 ? 49  GLN A O   1 
ATOM   316   C CB  . GLN A 1 50  ? -17.703 -2.928  -25.372 1.00 40.38 ? 49  GLN A CB  1 
ATOM   317   C CG  . GLN A 1 50  ? -18.561 -4.150  -25.077 1.00 41.54 ? 49  GLN A CG  1 
ATOM   318   C CD  . GLN A 1 50  ? -19.101 -4.152  -23.649 1.00 42.53 ? 49  GLN A CD  1 
ATOM   319   O OE1 . GLN A 1 50  ? -19.394 -5.212  -23.089 1.00 47.39 ? 49  GLN A OE1 1 
ATOM   320   N NE2 . GLN A 1 50  ? -19.225 -2.963  -23.051 1.00 45.33 ? 49  GLN A NE2 1 
ATOM   321   N N   . GLY A 1 65  ? -15.288 11.148  -22.507 1.00 28.86 ? 64  GLY A N   1 
ATOM   322   C CA  . GLY A 1 65  ? -16.603 11.486  -23.064 1.00 28.40 ? 64  GLY A CA  1 
ATOM   323   C C   . GLY A 1 65  ? -16.658 11.202  -24.552 1.00 27.87 ? 64  GLY A C   1 
ATOM   324   O O   . GLY A 1 65  ? -17.011 10.085  -24.956 1.00 29.22 ? 64  GLY A O   1 
ATOM   325   N N   . ASN A 1 66  ? -16.313 12.186  -25.388 1.00 25.75 ? 65  ASN A N   1 
ATOM   326   C CA  . ASN A 1 66  ? -16.446 11.968  -26.821 1.00 24.32 ? 65  ASN A CA  1 
ATOM   327   C C   . ASN A 1 66  ? -15.341 12.648  -27.600 1.00 22.23 ? 65  ASN A C   1 
ATOM   328   O O   . ASN A 1 66  ? -14.732 13.604  -27.098 1.00 20.68 ? 65  ASN A O   1 
ATOM   329   C CB  . ASN A 1 66  ? -17.855 12.391  -27.320 1.00 25.12 ? 65  ASN A CB  1 
ATOM   330   C CG  . ASN A 1 66  ? -17.836 13.638  -28.214 1.00 24.68 ? 65  ASN A CG  1 
ATOM   331   O OD1 . ASN A 1 66  ? -17.804 14.741  -27.709 1.00 24.35 ? 65  ASN A OD1 1 
ATOM   332   N ND2 . ASN A 1 66  ? -17.870 13.447  -29.546 1.00 21.10 ? 65  ASN A ND2 1 
ATOM   333   N N   . PRO A 1 67  ? -15.070 12.143  -28.821 1.00 20.17 ? 66  PRO A N   1 
ATOM   334   C CA  . PRO A 1 67  ? -13.960 12.656  -29.625 1.00 19.14 ? 66  PRO A CA  1 
ATOM   335   C C   . PRO A 1 67  ? -14.016 14.158  -29.879 1.00 17.13 ? 66  PRO A C   1 
ATOM   336   O O   . PRO A 1 67  ? -13.029 14.845  -29.675 1.00 17.54 ? 66  PRO A O   1 
ATOM   337   C CB  . PRO A 1 67  ? -14.098 11.888  -30.952 1.00 19.67 ? 66  PRO A CB  1 
ATOM   338   C CG  . PRO A 1 67  ? -14.862 10.649  -30.606 1.00 19.84 ? 66  PRO A CG  1 
ATOM   339   C CD  . PRO A 1 67  ? -15.789 11.048  -29.502 1.00 20.34 ? 66  PRO A CD  1 
ATOM   340   N N   . THR A 1 68  ? -15.157 14.665  -30.324 1.00 15.30 ? 67  THR A N   1 
ATOM   341   C CA  . THR A 1 68  ? -15.272 16.071  -30.729 1.00 14.46 ? 67  THR A CA  1 
ATOM   342   C C   . THR A 1 68  ? -15.037 17.015  -29.552 1.00 14.16 ? 67  THR A C   1 
ATOM   343   O O   . THR A 1 68  ? -14.305 17.998  -29.683 1.00 14.18 ? 67  THR A O   1 
ATOM   344   C CB  . THR A 1 68  ? -16.642 16.371  -31.408 1.00 13.95 ? 67  THR A CB  1 
ATOM   345   O OG1 . THR A 1 68  ? -16.927 15.353  -32.362 1.00 12.43 ? 67  THR A OG1 1 
ATOM   346   C CG2 . THR A 1 68  ? -16.617 17.735  -32.126 1.00 13.87 ? 67  THR A CG2 1 
ATOM   347   N N   . ARG A 1 69  ? -15.630 16.697  -28.404 1.00 14.16 ? 68  ARG A N   1 
ATOM   348   C CA  . ARG A 1 69  ? -15.362 17.432  -27.171 1.00 14.56 ? 68  ARG A CA  1 
ATOM   349   C C   . ARG A 1 69  ? -13.889 17.346  -26.750 1.00 14.55 ? 68  ARG A C   1 
ATOM   350   O O   . ARG A 1 69  ? -13.289 18.353  -26.347 1.00 13.03 ? 68  ARG A O   1 
ATOM   351   C CB  . ARG A 1 69  ? -16.236 16.943  -26.029 1.00 14.35 ? 68  ARG A CB  1 
ATOM   352   C CG  . ARG A 1 69  ? -16.102 17.838  -24.818 1.00 15.34 ? 68  ARG A CG  1 
ATOM   353   C CD  . ARG A 1 69  ? -16.992 17.440  -23.685 1.00 15.49 ? 68  ARG A CD  1 
ATOM   354   N NE  . ARG A 1 69  ? -16.452 16.293  -22.947 1.00 17.77 ? 68  ARG A NE  1 
ATOM   355   C CZ  . ARG A 1 69  ? -17.192 15.483  -22.187 1.00 19.29 ? 68  ARG A CZ  1 
ATOM   356   N NH1 . ARG A 1 69  ? -18.493 15.654  -22.083 1.00 19.60 ? 68  ARG A NH1 1 
ATOM   357   N NH2 . ARG A 1 69  ? -16.641 14.470  -21.548 1.00 19.56 ? 68  ARG A NH2 1 
ATOM   358   N N   . ASN A 1 70  ? -13.296 16.162  -26.866 1.00 14.80 ? 69  ASN A N   1 
ATOM   359   C CA  . ASN A 1 70  ? -11.895 15.999  -26.448 1.00 15.34 ? 69  ASN A CA  1 
ATOM   360   C C   . ASN A 1 70  ? -10.968 16.853  -27.295 1.00 14.67 ? 69  ASN A C   1 
ATOM   361   O O   . ASN A 1 70  ? -10.054 17.475  -26.781 1.00 15.29 ? 69  ASN A O   1 
ATOM   362   C CB  . ASN A 1 70  ? -11.468 14.543  -26.500 1.00 16.28 ? 69  ASN A CB  1 
ATOM   363   C CG  . ASN A 1 70  ? -12.202 13.664  -25.473 1.00 18.99 ? 69  ASN A CG  1 
ATOM   364   O OD1 . ASN A 1 70  ? -13.039 14.132  -24.690 1.00 26.10 ? 69  ASN A OD1 1 
ATOM   365   N ND2 . ASN A 1 70  ? -11.890 12.368  -25.487 1.00 24.52 ? 69  ASN A ND2 1 
ATOM   366   N N   . CYS A 1 71  ? -11.198 16.880  -28.597 1.00 13.97 ? 70  CYS A N   1 
ATOM   367   C CA  . CYS A 1 71  ? -10.420 17.751  -29.493 1.00 14.11 ? 70  CYS A CA  1 
ATOM   368   C C   . CYS A 1 71  ? -10.485 19.239  -29.088 1.00 13.16 ? 70  CYS A C   1 
ATOM   369   O O   . CYS A 1 71  ? -9.462  19.943  -29.065 1.00 12.15 ? 70  CYS A O   1 
ATOM   370   C CB  . CYS A 1 71  ? -10.897 17.567  -30.926 1.00 13.76 ? 70  CYS A CB  1 
ATOM   371   S SG  . CYS A 1 71  ? -10.578 15.924  -31.635 1.00 18.06 ? 70  CYS A SG  1 
ATOM   372   N N   . LEU A 1 72  ? -11.691 19.702  -28.735 1.00 13.39 ? 71  LEU A N   1 
ATOM   373   C CA  . LEU A 1 72  ? -11.898 21.075  -28.294 1.00 12.90 ? 71  LEU A CA  1 
ATOM   374   C C   . LEU A 1 72  ? -11.169 21.356  -27.001 1.00 13.04 ? 71  LEU A C   1 
ATOM   375   O O   . LEU A 1 72  ? -10.511 22.388  -26.866 1.00 12.42 ? 71  LEU A O   1 
ATOM   376   C CB  . LEU A 1 72  ? -13.394 21.383  -28.103 1.00 13.17 ? 71  LEU A CB  1 
ATOM   377   C CG  . LEU A 1 72  ? -13.736 22.728  -27.425 1.00 12.67 ? 71  LEU A CG  1 
ATOM   378   C CD1 . LEU A 1 72  ? -13.252 23.956  -28.226 1.00 11.23 ? 71  LEU A CD1 1 
ATOM   379   C CD2 . LEU A 1 72  ? -15.243 22.807  -27.177 1.00 12.52 ? 71  LEU A CD2 1 
ATOM   380   N N   . GLU A 1 73  ? -11.295 20.450  -26.034 1.00 13.10 ? 72  GLU A N   1 
ATOM   381   C CA  . GLU A 1 73  ? -10.646 20.656  -24.735 1.00 13.86 ? 72  GLU A CA  1 
ATOM   382   C C   . GLU A 1 73  ? -9.114  20.736  -24.798 1.00 13.70 ? 72  GLU A C   1 
ATOM   383   O O   . GLU A 1 73  ? -8.490  21.586  -24.134 1.00 13.67 ? 72  GLU A O   1 
ATOM   384   C CB  . GLU A 1 73  ? -11.065 19.565  -23.771 1.00 13.61 ? 72  GLU A CB  1 
ATOM   385   C CG  . GLU A 1 73  ? -12.517 19.714  -23.322 1.00 14.16 ? 72  GLU A CG  1 
ATOM   386   C CD  . GLU A 1 73  ? -13.022 18.526  -22.554 1.00 15.40 ? 72  GLU A CD  1 
ATOM   387   O OE1 . GLU A 1 73  ? -12.350 17.454  -22.622 1.00 16.69 ? 72  GLU A OE1 1 
ATOM   388   O OE2 . GLU A 1 73  ? -14.096 18.655  -21.913 1.00 15.38 ? 72  GLU A OE2 1 
ATOM   389   N N   . LYS A 1 74  ? -8.531  19.838  -25.576 1.00 14.26 ? 73  LYS A N   1 
ATOM   390   C CA  . LYS A 1 74  ? -7.111  19.874  -25.914 1.00 15.32 ? 73  LYS A CA  1 
ATOM   391   C C   . LYS A 1 74  ? -6.674  21.223  -26.507 1.00 14.15 ? 73  LYS A C   1 
ATOM   392   O O   . LYS A 1 74  ? -5.652  21.795  -26.115 1.00 13.41 ? 73  LYS A O   1 
ATOM   393   C CB  . LYS A 1 74  ? -6.795  18.759  -26.922 1.00 15.41 ? 73  LYS A CB  1 
ATOM   394   C CG  . LYS A 1 74  ? -6.426  17.415  -26.320 1.00 18.21 ? 73  LYS A CG  1 
ATOM   395   C CD  . LYS A 1 74  ? -5.594  16.574  -27.340 1.00 19.44 ? 73  LYS A CD  1 
ATOM   396   C CE  . LYS A 1 74  ? -5.717  15.060  -27.110 1.00 22.70 ? 73  LYS A CE  1 
ATOM   397   N NZ  . LYS A 1 74  ? -4.927  14.259  -28.132 1.00 23.87 ? 73  LYS A NZ  1 
ATOM   398   N N   . ALA A 1 75  ? -7.426  21.718  -27.484 1.00 14.10 ? 74  ALA A N   1 
ATOM   399   C CA  . ALA A 1 75  ? -7.096  22.996  -28.127 1.00 13.76 ? 74  ALA A CA  1 
ATOM   400   C C   . ALA A 1 75  ? -7.120  24.162  -27.138 1.00 13.99 ? 74  ALA A C   1 
ATOM   401   O O   . ALA A 1 75  ? -6.172  24.959  -27.064 1.00 13.78 ? 74  ALA A O   1 
ATOM   402   C CB  . ALA A 1 75  ? -8.054  23.268  -29.303 1.00 13.94 ? 74  ALA A CB  1 
ATOM   403   N N   . VAL A 1 76  ? -8.198  24.246  -26.367 1.00 13.95 ? 75  VAL A N   1 
ATOM   404   C CA  . VAL A 1 76  ? -8.370  25.325  -25.396 1.00 13.76 ? 75  VAL A CA  1 
ATOM   405   C C   . VAL A 1 76  ? -7.294  25.225  -24.329 1.00 13.50 ? 75  VAL A C   1 
ATOM   406   O O   . VAL A 1 76  ? -6.713  26.217  -23.952 1.00 13.34 ? 75  VAL A O   1 
ATOM   407   C CB  . VAL A 1 76  ? -9.792  25.331  -24.758 1.00 13.51 ? 75  VAL A CB  1 
ATOM   408   C CG1 . VAL A 1 76  ? -9.932  26.493  -23.760 1.00 12.34 ? 75  VAL A CG1 1 
ATOM   409   C CG2 . VAL A 1 76  ? -10.879 25.424  -25.830 1.00 12.29 ? 75  VAL A CG2 1 
ATOM   410   N N   . ALA A 1 77  ? -7.010  24.014  -23.867 1.00 13.74 ? 76  ALA A N   1 
ATOM   411   C CA  . ALA A 1 77  ? -5.924  23.811  -22.920 1.00 13.68 ? 76  ALA A CA  1 
ATOM   412   C C   . ALA A 1 77  ? -4.642  24.439  -23.464 1.00 13.76 ? 76  ALA A C   1 
ATOM   413   O O   . ALA A 1 77  ? -4.020  25.259  -22.787 1.00 14.33 ? 76  ALA A O   1 
ATOM   414   C CB  . ALA A 1 77  ? -5.730  22.309  -22.584 1.00 13.19 ? 76  ALA A CB  1 
ATOM   415   N N   . ALA A 1 78  ? -4.281  24.109  -24.700 1.00 14.09 ? 77  ALA A N   1 
ATOM   416   C CA  . ALA A 1 78  ? -3.084  24.663  -25.315 1.00 14.18 ? 77  ALA A CA  1 
ATOM   417   C C   . ALA A 1 78  ? -3.123  26.190  -25.340 1.00 14.75 ? 77  ALA A C   1 
ATOM   418   O O   . ALA A 1 78  ? -2.161  26.840  -24.973 1.00 15.17 ? 77  ALA A O   1 
ATOM   419   C CB  . ALA A 1 78  ? -2.917  24.145  -26.703 1.00 14.42 ? 77  ALA A CB  1 
ATOM   420   N N   . LEU A 1 79  ? -4.244  26.762  -25.767 1.00 14.44 ? 78  LEU A N   1 
ATOM   421   C CA  . LEU A 1 79  ? -4.360  28.224  -25.848 1.00 14.53 ? 78  LEU A CA  1 
ATOM   422   C C   . LEU A 1 79  ? -4.157  28.932  -24.491 1.00 14.39 ? 78  LEU A C   1 
ATOM   423   O O   . LEU A 1 79  ? -3.635  30.053  -24.452 1.00 13.53 ? 78  LEU A O   1 
ATOM   424   C CB  . LEU A 1 79  ? -5.705  28.636  -26.482 1.00 14.23 ? 78  LEU A CB  1 
ATOM   425   C CG  . LEU A 1 79  ? -5.988  28.168  -27.920 1.00 13.88 ? 78  LEU A CG  1 
ATOM   426   C CD1 . LEU A 1 79  ? -7.210  28.924  -28.533 1.00 12.70 ? 78  LEU A CD1 1 
ATOM   427   C CD2 . LEU A 1 79  ? -4.747  28.305  -28.824 1.00 13.94 ? 78  LEU A CD2 1 
ATOM   428   N N   . ASP A 1 80  ? -4.563  28.274  -23.405 1.00 14.43 ? 79  ASP A N   1 
ATOM   429   C CA  . ASP A 1 80  ? -4.342  28.760  -22.057 1.00 15.12 ? 79  ASP A CA  1 
ATOM   430   C C   . ASP A 1 80  ? -2.943  28.487  -21.489 1.00 15.64 ? 79  ASP A C   1 
ATOM   431   O O   . ASP A 1 80  ? -2.621  28.983  -20.418 1.00 15.21 ? 79  ASP A O   1 
ATOM   432   C CB  . ASP A 1 80  ? -5.363  28.116  -21.090 1.00 14.97 ? 79  ASP A CB  1 
ATOM   433   C CG  . ASP A 1 80  ? -6.636  28.933  -20.951 1.00 16.62 ? 79  ASP A CG  1 
ATOM   434   O OD1 . ASP A 1 80  ? -6.532  30.116  -20.573 1.00 17.64 ? 79  ASP A OD1 1 
ATOM   435   O OD2 . ASP A 1 80  ? -7.729  28.376  -21.197 1.00 15.31 ? 79  ASP A OD2 1 
ATOM   436   N N   . GLY A 1 81  ? -2.125  27.707  -22.188 1.00 16.53 ? 80  GLY A N   1 
ATOM   437   C CA  . GLY A 1 81  ? -0.894  27.189  -21.600 1.00 16.96 ? 80  GLY A CA  1 
ATOM   438   C C   . GLY A 1 81  ? -1.175  26.153  -20.520 1.00 17.79 ? 80  GLY A C   1 
ATOM   439   O O   . GLY A 1 81  ? -0.332  25.929  -19.651 1.00 18.21 ? 80  GLY A O   1 
ATOM   440   N N   . ALA A 1 82  ? -2.338  25.495  -20.585 1.00 17.54 ? 81  ALA A N   1 
ATOM   441   C CA  . ALA A 1 82  ? -2.777  24.570  -19.537 1.00 18.14 ? 81  ALA A CA  1 
ATOM   442   C C   . ALA A 1 82  ? -2.562  23.104  -19.915 1.00 18.21 ? 81  ALA A C   1 
ATOM   443   O O   . ALA A 1 82  ? -2.461  22.762  -21.095 1.00 17.61 ? 81  ALA A O   1 
ATOM   444   C CB  . ALA A 1 82  ? -4.258  24.808  -19.185 1.00 17.67 ? 81  ALA A CB  1 
ATOM   445   N N   . LYS A 1 83  ? -2.467  22.240  -18.904 1.00 19.09 ? 82  LYS A N   1 
ATOM   446   C CA  . LYS A 1 83  ? -2.360  20.797  -19.150 1.00 19.82 ? 82  LYS A CA  1 
ATOM   447   C C   . LYS A 1 83  ? -3.696  20.258  -19.571 1.00 18.67 ? 82  LYS A C   1 
ATOM   448   O O   . LYS A 1 83  ? -3.752  19.359  -20.392 1.00 18.16 ? 82  LYS A O   1 
ATOM   449   C CB  . LYS A 1 83  ? -1.896  19.994  -17.922 1.00 20.25 ? 82  LYS A CB  1 
ATOM   450   C CG  . LYS A 1 83  ? -0.538  20.377  -17.319 1.00 22.10 ? 82  LYS A CG  1 
ATOM   451   C CD  . LYS A 1 83  ? 0.198   19.133  -16.692 1.00 23.98 ? 82  LYS A CD  1 
ATOM   452   C CE  . LYS A 1 83  ? -0.585  18.418  -15.557 1.00 27.89 ? 82  LYS A CE  1 
ATOM   453   N NZ  . LYS A 1 83  ? -0.125  18.695  -14.119 1.00 29.78 ? 82  LYS A NZ  1 
ATOM   454   N N   . TYR A 1 84  ? -4.769  20.801  -18.991 1.00 18.36 ? 83  TYR A N   1 
ATOM   455   C CA  . TYR A 1 84  ? -6.118  20.264  -19.179 1.00 17.98 ? 83  TYR A CA  1 
ATOM   456   C C   . TYR A 1 84  ? -7.170  21.356  -19.379 1.00 16.55 ? 83  TYR A C   1 
ATOM   457   O O   . TYR A 1 84  ? -6.996  22.482  -18.941 1.00 15.49 ? 83  TYR A O   1 
ATOM   458   C CB  . TYR A 1 84  ? -6.549  19.488  -17.943 1.00 18.69 ? 83  TYR A CB  1 
ATOM   459   C CG  . TYR A 1 84  ? -5.576  18.438  -17.459 1.00 20.99 ? 83  TYR A CG  1 
ATOM   460   C CD1 . TYR A 1 84  ? -4.841  18.620  -16.286 1.00 21.82 ? 83  TYR A CD1 1 
ATOM   461   C CD2 . TYR A 1 84  ? -5.418  17.241  -18.161 1.00 22.96 ? 83  TYR A CD2 1 
ATOM   462   C CE1 . TYR A 1 84  ? -3.958  17.644  -15.841 1.00 22.14 ? 83  TYR A CE1 1 
ATOM   463   C CE2 . TYR A 1 84  ? -4.545  16.258  -17.722 1.00 23.27 ? 83  TYR A CE2 1 
ATOM   464   C CZ  . TYR A 1 84  ? -3.812  16.465  -16.574 1.00 21.94 ? 83  TYR A CZ  1 
ATOM   465   O OH  . TYR A 1 84  ? -2.954  15.463  -16.164 1.00 23.08 ? 83  TYR A OH  1 
ATOM   466   N N   . CYS A 1 85  ? -8.295  20.967  -19.969 1.00 15.03 ? 84  CYS A N   1 
ATOM   467   C CA  . CYS A 1 85  ? -9.468  21.824  -20.051 1.00 14.25 ? 84  CYS A CA  1 
ATOM   468   C C   . CYS A 1 85  ? -10.711 20.951  -20.044 1.00 13.41 ? 84  CYS A C   1 
ATOM   469   O O   . CYS A 1 85  ? -10.655 19.829  -20.487 1.00 14.35 ? 84  CYS A O   1 
ATOM   470   C CB  . CYS A 1 85  ? -9.421  22.676  -21.312 1.00 13.69 ? 84  CYS A CB  1 
ATOM   471   S SG  . CYS A 1 85  ? -10.878 23.723  -21.537 1.00 14.86 ? 84  CYS A SG  1 
ATOM   472   N N   . LEU A 1 86  ? -11.803 21.464  -19.480 1.00 13.01 ? 85  LEU A N   1 
ATOM   473   C CA  . LEU A 1 86  ? -13.090 20.774  -19.421 1.00 12.33 ? 85  LEU A CA  1 
ATOM   474   C C   . LEU A 1 86  ? -14.186 21.704  -19.947 1.00 11.73 ? 85  LEU A C   1 
ATOM   475   O O   . LEU A 1 86  ? -14.293 22.863  -19.522 1.00 11.26 ? 85  LEU A O   1 
ATOM   476   C CB  . LEU A 1 86  ? -13.449 20.353  -17.999 1.00 11.96 ? 85  LEU A CB  1 
ATOM   477   C CG  . LEU A 1 86  ? -12.426 19.556  -17.184 1.00 12.68 ? 85  LEU A CG  1 
ATOM   478   C CD1 . LEU A 1 86  ? -11.576 20.460  -16.317 1.00 10.95 ? 85  LEU A CD1 1 
ATOM   479   C CD2 . LEU A 1 86  ? -13.123 18.524  -16.330 1.00 10.88 ? 85  LEU A CD2 1 
ATOM   480   N N   . ALA A 1 87  ? -15.002 21.173  -20.849 1.00 11.50 ? 86  ALA A N   1 
ATOM   481   C CA  . ALA A 1 87  ? -16.039 21.946  -21.522 1.00 11.50 ? 86  ALA A CA  1 
ATOM   482   C C   . ALA A 1 87  ? -17.371 21.695  -20.853 1.00 12.20 ? 86  ALA A C   1 
ATOM   483   O O   . ALA A 1 87  ? -17.638 20.588  -20.402 1.00 11.22 ? 86  ALA A O   1 
ATOM   484   C CB  . ALA A 1 87  ? -16.095 21.581  -22.988 1.00 10.28 ? 86  ALA A CB  1 
ATOM   485   N N   . PHE A 1 88  ? -18.203 22.738  -20.801 1.00 12.22 ? 87  PHE A N   1 
ATOM   486   C CA  . PHE A 1 88  ? -19.477 22.679  -20.108 1.00 12.30 ? 87  PHE A CA  1 
ATOM   487   C C   . PHE A 1 88  ? -20.591 23.289  -20.943 1.00 12.40 ? 87  PHE A C   1 
ATOM   488   O O   . PHE A 1 88  ? -20.348 24.017  -21.913 1.00 11.16 ? 87  PHE A O   1 
ATOM   489   C CB  . PHE A 1 88  ? -19.374 23.381  -18.733 1.00 12.50 ? 87  PHE A CB  1 
ATOM   490   C CG  . PHE A 1 88  ? -18.413 22.705  -17.811 1.00 12.83 ? 87  PHE A CG  1 
ATOM   491   C CD1 . PHE A 1 88  ? -17.108 23.147  -17.698 1.00 12.68 ? 87  PHE A CD1 1 
ATOM   492   C CD2 . PHE A 1 88  ? -18.792 21.578  -17.109 1.00 15.19 ? 87  PHE A CD2 1 
ATOM   493   C CE1 . PHE A 1 88  ? -16.207 22.511  -16.847 1.00 13.44 ? 87  PHE A CE1 1 
ATOM   494   C CE2 . PHE A 1 88  ? -17.900 20.932  -16.277 1.00 15.35 ? 87  PHE A CE2 1 
ATOM   495   C CZ  . PHE A 1 88  ? -16.602 21.396  -16.139 1.00 12.67 ? 87  PHE A CZ  1 
ATOM   496   N N   . ALA A 1 89  ? -21.811 22.984  -20.539 1.00 12.76 ? 88  ALA A N   1 
ATOM   497   C CA  . ALA A 1 89  ? -23.024 23.416  -21.226 1.00 12.44 ? 88  ALA A CA  1 
ATOM   498   C C   . ALA A 1 89  ? -23.184 24.931  -21.261 1.00 12.81 ? 88  ALA A C   1 
ATOM   499   O O   . ALA A 1 89  ? -23.914 25.470  -22.112 1.00 13.87 ? 88  ALA A O   1 
ATOM   500   C CB  . ALA A 1 89  ? -24.249 22.749  -20.555 1.00 12.35 ? 88  ALA A CB  1 
ATOM   501   N N   . SER A 1 90  ? -22.498 25.627  -20.350 1.00 13.31 ? 89  SER A N   1 
ATOM   502   C CA  . SER A 1 90  ? -22.521 27.082  -20.288 1.00 13.07 ? 89  SER A CA  1 
ATOM   503   C C   . SER A 1 90  ? -21.474 27.577  -19.288 1.00 13.22 ? 89  SER A C   1 
ATOM   504   O O   . SER A 1 90  ? -20.956 26.797  -18.493 1.00 12.89 ? 89  SER A O   1 
ATOM   505   C CB  . SER A 1 90  ? -23.910 27.593  -19.887 1.00 13.00 ? 89  SER A CB  1 
ATOM   506   O OG  . SER A 1 90  ? -24.223 27.325  -18.524 1.00 13.02 ? 89  SER A OG  1 
ATOM   507   N N   . GLY A 1 91  ? -21.182 28.872  -19.340 1.00 13.24 ? 90  GLY A N   1 
ATOM   508   C CA  . GLY A 1 91  ? -20.364 29.557  -18.332 1.00 13.90 ? 90  GLY A CA  1 
ATOM   509   C C   . GLY A 1 91  ? -20.916 29.378  -16.929 1.00 13.81 ? 90  GLY A C   1 
ATOM   510   O O   . GLY A 1 91  ? -20.153 29.086  -16.008 1.00 14.36 ? 90  GLY A O   1 
ATOM   511   N N   . LEU A 1 92  ? -22.240 29.540  -16.762 1.00 13.93 ? 91  LEU A N   1 
ATOM   512   C CA  . LEU A 1 92  ? -22.894 29.293  -15.472 1.00 14.25 ? 91  LEU A CA  1 
ATOM   513   C C   . LEU A 1 92  ? -22.703 27.854  -15.020 1.00 14.18 ? 91  LEU A C   1 
ATOM   514   O O   . LEU A 1 92  ? -22.392 27.635  -13.874 1.00 15.15 ? 91  LEU A O   1 
ATOM   515   C CB  . LEU A 1 92  ? -24.388 29.670  -15.456 1.00 14.25 ? 91  LEU A CB  1 
ATOM   516   C CG  . LEU A 1 92  ? -24.671 31.187  -15.388 1.00 16.80 ? 91  LEU A CG  1 
ATOM   517   C CD1 . LEU A 1 92  ? -26.175 31.478  -15.379 1.00 17.26 ? 91  LEU A CD1 1 
ATOM   518   C CD2 . LEU A 1 92  ? -23.970 31.885  -14.184 1.00 18.11 ? 91  LEU A CD2 1 
ATOM   519   N N   . ALA A 1 93  ? -22.858 26.877  -15.914 1.00 14.32 ? 92  ALA A N   1 
ATOM   520   C CA  . ALA A 1 93  ? -22.625 25.457  -15.541 1.00 14.01 ? 92  ALA A CA  1 
ATOM   521   C C   . ALA A 1 93  ? -21.159 25.189  -15.171 1.00 13.66 ? 92  ALA A C   1 
ATOM   522   O O   . ALA A 1 93  ? -20.878 24.392  -14.297 1.00 13.14 ? 92  ALA A O   1 
ATOM   523   C CB  . ALA A 1 93  ? -23.076 24.507  -16.646 1.00 13.54 ? 92  ALA A CB  1 
ATOM   524   N N   . ALA A 1 94  ? -20.228 25.860  -15.838 1.00 13.79 ? 93  ALA A N   1 
ATOM   525   C CA  . ALA A 1 94  ? -18.825 25.808  -15.434 1.00 14.29 ? 93  ALA A CA  1 
ATOM   526   C C   . ALA A 1 94  ? -18.648 26.321  -14.008 1.00 14.30 ? 93  ALA A C   1 
ATOM   527   O O   . ALA A 1 94  ? -17.928 25.712  -13.217 1.00 14.79 ? 93  ALA A O   1 
ATOM   528   C CB  . ALA A 1 94  ? -17.944 26.602  -16.391 1.00 13.40 ? 93  ALA A CB  1 
ATOM   529   N N   . THR A 1 95  ? -19.305 27.444  -13.708 1.00 14.48 ? 94  THR A N   1 
ATOM   530   C CA  . THR A 1 95  ? -19.269 28.083  -12.400 1.00 14.25 ? 94  THR A CA  1 
ATOM   531   C C   . THR A 1 95  ? -19.907 27.193  -11.339 1.00 14.60 ? 94  THR A C   1 
ATOM   532   O O   . THR A 1 95  ? -19.340 27.018  -10.268 1.00 13.99 ? 94  THR A O   1 
ATOM   533   C CB  . THR A 1 95  ? -19.977 29.446  -12.424 1.00 14.13 ? 94  THR A CB  1 
ATOM   534   O OG1 . THR A 1 95  ? -19.366 30.267  -13.428 1.00 13.41 ? 94  THR A OG1 1 
ATOM   535   C CG2 . THR A 1 95  ? -19.847 30.161  -11.046 1.00 13.38 ? 94  THR A CG2 1 
ATOM   536   N N   . VAL A 1 96  ? -21.069 26.627  -11.651 1.00 14.83 ? 95  VAL A N   1 
ATOM   537   C CA  . VAL A 1 96  ? -21.731 25.675  -10.757 1.00 14.34 ? 95  VAL A CA  1 
ATOM   538   C C   . VAL A 1 96  ? -20.836 24.453  -10.503 1.00 15.82 ? 95  VAL A C   1 
ATOM   539   O O   . VAL A 1 96  ? -20.657 24.045  -9.357  1.00 17.18 ? 95  VAL A O   1 
ATOM   540   C CB  . VAL A 1 96  ? -23.098 25.260  -11.315 1.00 14.61 ? 95  VAL A CB  1 
ATOM   541   C CG1 . VAL A 1 96  ? -23.713 24.104  -10.487 1.00 12.43 ? 95  VAL A CG1 1 
ATOM   542   C CG2 . VAL A 1 96  ? -24.020 26.469  -11.355 1.00 12.58 ? 95  VAL A CG2 1 
ATOM   543   N N   . THR A 1 97  ? -20.231 23.888  -11.542 1.00 16.38 ? 96  THR A N   1 
ATOM   544   C CA  . THR A 1 97  ? -19.380 22.714  -11.365 1.00 17.04 ? 96  THR A CA  1 
ATOM   545   C C   . THR A 1 97  ? -18.164 23.047  -10.465 1.00 17.53 ? 96  THR A C   1 
ATOM   546   O O   . THR A 1 97  ? -17.860 22.313  -9.524  1.00 17.87 ? 96  THR A O   1 
ATOM   547   C CB  . THR A 1 97  ? -18.945 22.100  -12.739 1.00 17.83 ? 96  THR A CB  1 
ATOM   548   O OG1 . THR A 1 97  ? -20.088 21.921  -13.601 1.00 16.99 ? 96  THR A OG1 1 
ATOM   549   C CG2 . THR A 1 97  ? -18.288 20.752  -12.561 1.00 17.51 ? 96  THR A CG2 1 
ATOM   550   N N   . ILE A 1 98  ? -17.488 24.160  -10.735 1.00 17.42 ? 97  ILE A N   1 
ATOM   551   C CA  . ILE A 1 98  ? -16.347 24.596  -9.916  1.00 17.72 ? 97  ILE A CA  1 
ATOM   552   C C   . ILE A 1 98  ? -16.754 24.758  -8.463  1.00 18.11 ? 97  ILE A C   1 
ATOM   553   O O   . ILE A 1 98  ? -16.005 24.411  -7.562  1.00 18.87 ? 97  ILE A O   1 
ATOM   554   C CB  . ILE A 1 98  ? -15.736 25.935  -10.414 1.00 17.28 ? 97  ILE A CB  1 
ATOM   555   C CG1 . ILE A 1 98  ? -15.064 25.748  -11.777 1.00 17.69 ? 97  ILE A CG1 1 
ATOM   556   C CG2 . ILE A 1 98  ? -14.716 26.468  -9.432  1.00 16.90 ? 97  ILE A CG2 1 
ATOM   557   C CD1 . ILE A 1 98  ? -14.805 27.066  -12.530 1.00 18.29 ? 97  ILE A CD1 1 
ATOM   558   N N   . THR A 1 99  ? -17.935 25.314  -8.230  1.00 18.50 ? 98  THR A N   1 
ATOM   559   C CA  . THR A 1 99  ? -18.441 25.476  -6.871  1.00 18.62 ? 98  THR A CA  1 
ATOM   560   C C   . THR A 1 99  ? -18.684 24.118  -6.184  1.00 19.10 ? 98  THR A C   1 
ATOM   561   O O   . THR A 1 99  ? -18.560 24.009  -4.976  1.00 19.81 ? 98  THR A O   1 
ATOM   562   C CB  . THR A 1 99  ? -19.712 26.343  -6.881  1.00 18.59 ? 98  THR A CB  1 
ATOM   563   O OG1 . THR A 1 99  ? -19.423 27.543  -7.618  1.00 17.46 ? 98  THR A OG1 1 
ATOM   564   C CG2 . THR A 1 99  ? -20.125 26.716  -5.476  1.00 17.57 ? 98  THR A CG2 1 
ATOM   565   N N   . HIS A 1 100 ? -18.991 23.081  -6.955  1.00 19.45 ? 99  HIS A N   1 
ATOM   566   C CA  . HIS A 1 100 ? -19.188 21.734  -6.390  1.00 19.69 ? 99  HIS A CA  1 
ATOM   567   C C   . HIS A 1 100 ? -17.860 21.031  -5.979  1.00 20.33 ? 99  HIS A C   1 
ATOM   568   O O   . HIS A 1 100 ? -17.876 19.882  -5.533  1.00 20.84 ? 99  HIS A O   1 
ATOM   569   C CB  . HIS A 1 100 ? -20.023 20.866  -7.357  1.00 19.10 ? 99  HIS A CB  1 
ATOM   570   C CG  . HIS A 1 100 ? -21.497 21.139  -7.295  1.00 18.75 ? 99  HIS A CG  1 
ATOM   571   N ND1 . HIS A 1 100 ? -22.077 22.256  -7.861  1.00 18.33 ? 99  HIS A ND1 1 
ATOM   572   C CD2 . HIS A 1 100 ? -22.508 20.452  -6.712  1.00 19.48 ? 99  HIS A CD2 1 
ATOM   573   C CE1 . HIS A 1 100 ? -23.379 22.238  -7.639  1.00 16.94 ? 99  HIS A CE1 1 
ATOM   574   N NE2 . HIS A 1 100 ? -23.665 21.158  -6.934  1.00 18.07 ? 99  HIS A NE2 1 
ATOM   575   N N   . LEU A 1 101 ? -16.730 21.717  -6.167  1.00 20.77 ? 100 LEU A N   1 
ATOM   576   C CA  . LEU A 1 101 ? -15.439 21.317  -5.626  1.00 20.98 ? 100 LEU A CA  1 
ATOM   577   C C   . LEU A 1 101 ? -15.414 21.528  -4.120  1.00 21.83 ? 100 LEU A C   1 
ATOM   578   O O   . LEU A 1 101 ? -14.566 20.987  -3.436  1.00 22.75 ? 100 LEU A O   1 
ATOM   579   C CB  . LEU A 1 101 ? -14.286 22.148  -6.226  1.00 20.56 ? 100 LEU A CB  1 
ATOM   580   C CG  . LEU A 1 101 ? -13.869 21.934  -7.670  1.00 19.53 ? 100 LEU A CG  1 
ATOM   581   C CD1 . LEU A 1 101 ? -12.836 22.980  -8.067  1.00 19.58 ? 100 LEU A CD1 1 
ATOM   582   C CD2 . LEU A 1 101 ? -13.318 20.546  -7.873  1.00 17.64 ? 100 LEU A CD2 1 
ATOM   583   N N   . LEU A 1 102 ? -16.334 22.335  -3.614  1.00 22.61 ? 101 LEU A N   1 
ATOM   584   C CA  . LEU A 1 102 ? -16.350 22.690  -2.220  1.00 23.28 ? 101 LEU A CA  1 
ATOM   585   C C   . LEU A 1 102 ? -17.247 21.728  -1.428  1.00 23.75 ? 101 LEU A C   1 
ATOM   586   O O   . LEU A 1 102 ? -17.622 20.675  -1.912  1.00 24.39 ? 101 LEU A O   1 
ATOM   587   C CB  . LEU A 1 102 ? -16.782 24.161  -2.075  1.00 23.24 ? 101 LEU A CB  1 
ATOM   588   C CG  . LEU A 1 102 ? -15.914 25.192  -2.821  1.00 23.75 ? 101 LEU A CG  1 
ATOM   589   C CD1 . LEU A 1 102 ? -16.360 26.658  -2.555  1.00 21.51 ? 101 LEU A CD1 1 
ATOM   590   C CD2 . LEU A 1 102 ? -14.451 24.997  -2.473  1.00 25.10 ? 101 LEU A CD2 1 
ATOM   591   N N   . LYS A 1 103 ? -17.536 22.072  -0.190  1.00 24.57 ? 102 LYS A N   1 
ATOM   592   C CA  . LYS A 1 103 ? -18.376 21.256  0.674   1.00 25.20 ? 102 LYS A CA  1 
ATOM   593   C C   . LYS A 1 103 ? -19.049 22.210  1.637   1.00 24.82 ? 102 LYS A C   1 
ATOM   594   O O   . LYS A 1 103 ? -18.606 23.334  1.795   1.00 24.65 ? 102 LYS A O   1 
ATOM   595   C CB  . LYS A 1 103 ? -17.546 20.216  1.435   1.00 25.39 ? 102 LYS A CB  1 
ATOM   596   C CG  . LYS A 1 103 ? -16.341 20.777  2.177   1.00 26.33 ? 102 LYS A CG  1 
ATOM   597   C CD  . LYS A 1 103 ? -15.650 19.706  3.032   1.00 27.08 ? 102 LYS A CD  1 
ATOM   598   C CE  . LYS A 1 103 ? -14.235 20.143  3.519   1.00 29.21 ? 102 LYS A CE  1 
ATOM   599   N NZ  . LYS A 1 103 ? -13.996 21.629  3.699   1.00 30.15 ? 102 LYS A NZ  1 
ATOM   600   N N   . ALA A 1 104 ? -20.124 21.767  2.265   1.00 25.44 ? 103 ALA A N   1 
ATOM   601   C CA  . ALA A 1 104 ? -20.841 22.596  3.224   1.00 25.53 ? 103 ALA A CA  1 
ATOM   602   C C   . ALA A 1 104 ? -19.855 23.134  4.254   1.00 25.85 ? 103 ALA A C   1 
ATOM   603   O O   . ALA A 1 104 ? -19.048 22.376  4.794   1.00 25.91 ? 103 ALA A O   1 
ATOM   604   C CB  . ALA A 1 104 ? -21.950 21.780  3.899   1.00 25.51 ? 103 ALA A CB  1 
ATOM   605   N N   . GLY A 1 105 ? -19.893 24.446  4.488   1.00 26.40 ? 104 GLY A N   1 
ATOM   606   C CA  . GLY A 1 105 ? -18.995 25.099  5.453   1.00 26.40 ? 104 GLY A CA  1 
ATOM   607   C C   . GLY A 1 105 ? -17.875 25.939  4.849   1.00 26.65 ? 104 GLY A C   1 
ATOM   608   O O   . GLY A 1 105 ? -17.318 26.806  5.526   1.00 26.32 ? 104 GLY A O   1 
ATOM   609   N N   . ASP A 1 106 ? -17.543 25.702  3.578   1.00 26.73 ? 105 ASP A N   1 
ATOM   610   C CA  . ASP A 1 106 ? -16.462 26.449  2.937   1.00 26.92 ? 105 ASP A CA  1 
ATOM   611   C C   . ASP A 1 106 ? -16.931 27.875  2.626   1.00 26.95 ? 105 ASP A C   1 
ATOM   612   O O   . ASP A 1 106 ? -18.126 28.141  2.533   1.00 27.18 ? 105 ASP A O   1 
ATOM   613   C CB  . ASP A 1 106 ? -15.976 25.760  1.655   1.00 26.56 ? 105 ASP A CB  1 
ATOM   614   C CG  . ASP A 1 106 ? -15.355 24.397  1.902   1.00 27.22 ? 105 ASP A CG  1 
ATOM   615   O OD1 . ASP A 1 106 ? -14.832 24.138  3.002   1.00 27.31 ? 105 ASP A OD1 1 
ATOM   616   O OD2 . ASP A 1 106 ? -15.379 23.567  0.971   1.00 27.49 ? 105 ASP A OD2 1 
ATOM   617   N N   . GLN A 1 107 ? -15.983 28.800  2.506   1.00 26.81 ? 106 GLN A N   1 
ATOM   618   C CA  . GLN A 1 107 ? -16.312 30.170  2.153   1.00 26.51 ? 106 GLN A CA  1 
ATOM   619   C C   . GLN A 1 107 ? -15.782 30.478  0.755   1.00 25.27 ? 106 GLN A C   1 
ATOM   620   O O   . GLN A 1 107 ? -14.677 30.054  0.400   1.00 24.67 ? 106 GLN A O   1 
ATOM   621   C CB  . GLN A 1 107 ? -15.727 31.157  3.161   1.00 26.58 ? 106 GLN A CB  1 
ATOM   622   C CG  . GLN A 1 107 ? -15.893 32.632  2.741   1.00 27.55 ? 106 GLN A CG  1 
ATOM   623   C CD  . GLN A 1 107 ? -14.924 33.574  3.428   1.00 28.29 ? 106 GLN A CD  1 
ATOM   624   O OE1 . GLN A 1 107 ? -15.287 34.704  3.779   1.00 32.32 ? 106 GLN A OE1 1 
ATOM   625   N NE2 . GLN A 1 107 ? -13.687 33.124  3.618   1.00 29.57 ? 106 GLN A NE2 1 
ATOM   626   N N   . ILE A 1 108 ? -16.582 31.229  -0.004  1.00 24.19 ? 107 ILE A N   1 
ATOM   627   C CA  . ILE A 1 108 ? -16.203 31.746  -1.308  1.00 24.11 ? 107 ILE A CA  1 
ATOM   628   C C   . ILE A 1 108 ? -16.052 33.263  -1.214  1.00 23.62 ? 107 ILE A C   1 
ATOM   629   O O   . ILE A 1 108 ? -16.958 33.953  -0.749  1.00 24.24 ? 107 ILE A O   1 
ATOM   630   C CB  . ILE A 1 108 ? -17.288 31.414  -2.406  1.00 24.29 ? 107 ILE A CB  1 
ATOM   631   C CG1 . ILE A 1 108 ? -17.538 29.902  -2.461  1.00 24.51 ? 107 ILE A CG1 1 
ATOM   632   C CG2 . ILE A 1 108 ? -16.863 31.950  -3.770  1.00 23.20 ? 107 ILE A CG2 1 
ATOM   633   C CD1 . ILE A 1 108 ? -18.664 29.473  -3.401  1.00 25.16 ? 107 ILE A CD1 1 
ATOM   634   N N   . ILE A 1 109 ? -14.905 33.775  -1.646  1.00 23.39 ? 108 ILE A N   1 
ATOM   635   C CA  . ILE A 1 109 ? -14.733 35.215  -1.854  1.00 23.01 ? 108 ILE A CA  1 
ATOM   636   C C   . ILE A 1 109 ? -14.901 35.481  -3.354  1.00 22.36 ? 108 ILE A C   1 
ATOM   637   O O   . ILE A 1 109 ? -14.231 34.869  -4.164  1.00 22.61 ? 108 ILE A O   1 
ATOM   638   C CB  . ILE A 1 109 ? -13.364 35.717  -1.376  1.00 23.13 ? 108 ILE A CB  1 
ATOM   639   C CG1 . ILE A 1 109 ? -13.271 35.653  0.154   1.00 23.87 ? 108 ILE A CG1 1 
ATOM   640   C CG2 . ILE A 1 109 ? -13.102 37.167  -1.860  1.00 22.92 ? 108 ILE A CG2 1 
ATOM   641   C CD1 . ILE A 1 109 ? -11.862 35.875  0.683   1.00 23.34 ? 108 ILE A CD1 1 
ATOM   642   N N   . CYS A 1 110 ? -15.822 36.375  -3.705  1.00 21.61 ? 109 CYS A N   1 
ATOM   643   C CA  . CYS A 1 110 ? -16.103 36.692  -5.092  1.00 20.89 ? 109 CYS A CA  1 
ATOM   644   C C   . CYS A 1 110 ? -15.825 38.169  -5.311  1.00 20.88 ? 109 CYS A C   1 
ATOM   645   O O   . CYS A 1 110 ? -16.149 39.011  -4.465  1.00 21.29 ? 109 CYS A O   1 
ATOM   646   C CB  . CYS A 1 110 ? -17.558 36.336  -5.452  1.00 21.31 ? 109 CYS A CB  1 
ATOM   647   S SG  . CYS A 1 110 ? -18.028 36.698  -7.194  1.00 20.77 ? 109 CYS A SG  1 
ATOM   648   N N   . MET A 1 111 ? -15.198 38.484  -6.434  1.00 20.57 ? 110 MET A N   1 
ATOM   649   C CA  . MET A 1 111 ? -15.009 39.870  -6.848  1.00 20.07 ? 110 MET A CA  1 
ATOM   650   C C   . MET A 1 111 ? -16.341 40.602  -6.750  1.00 20.20 ? 110 MET A C   1 
ATOM   651   O O   . MET A 1 111 ? -17.397 40.033  -7.060  1.00 20.12 ? 110 MET A O   1 
ATOM   652   C CB  . MET A 1 111 ? -14.467 39.898  -8.272  1.00 20.22 ? 110 MET A CB  1 
ATOM   653   C CG  . MET A 1 111 ? -14.205 41.274  -8.832  1.00 19.91 ? 110 MET A CG  1 
ATOM   654   S SD  . MET A 1 111 ? -12.987 42.157  -7.868  1.00 22.65 ? 110 MET A SD  1 
ATOM   655   C CE  . MET A 1 111 ? -13.202 43.839  -8.468  1.00 17.14 ? 110 MET A CE  1 
ATOM   656   N N   . ASP A 1 112 ? -16.308 41.850  -6.289  1.00 20.03 ? 111 ASP A N   1 
ATOM   657   C CA  . ASP A 1 112 ? -17.560 42.545  -5.980  1.00 20.07 ? 111 ASP A CA  1 
ATOM   658   C C   . ASP A 1 112 ? -18.350 42.898  -7.249  1.00 19.77 ? 111 ASP A C   1 
ATOM   659   O O   . ASP A 1 112 ? -19.566 42.858  -7.235  1.00 20.25 ? 111 ASP A O   1 
ATOM   660   C CB  . ASP A 1 112 ? -17.351 43.742  -5.012  1.00 20.28 ? 111 ASP A CB  1 
ATOM   661   C CG  . ASP A 1 112 ? -16.505 44.871  -5.595  1.00 20.89 ? 111 ASP A CG  1 
ATOM   662   O OD1 . ASP A 1 112 ? -16.470 45.959  -4.959  1.00 21.10 ? 111 ASP A OD1 1 
ATOM   663   O OD2 . ASP A 1 112 ? -15.861 44.686  -6.647  1.00 20.03 ? 111 ASP A OD2 1 
ATOM   664   N N   . ASP A 1 113 ? -17.645 43.192  -8.336  1.00 19.28 ? 112 ASP A N   1 
ATOM   665   C CA  . ASP A 1 113 ? -18.255 43.431  -9.656  1.00 19.55 ? 112 ASP A CA  1 
ATOM   666   C C   . ASP A 1 113 ? -18.048 42.204  -10.545 1.00 18.93 ? 112 ASP A C   1 
ATOM   667   O O   . ASP A 1 113 ? -16.928 41.881  -10.898 1.00 18.65 ? 112 ASP A O   1 
ATOM   668   C CB  . ASP A 1 113 ? -17.617 44.663  -10.311 1.00 19.57 ? 112 ASP A CB  1 
ATOM   669   C CG  . ASP A 1 113 ? -18.391 45.161  -11.540 1.00 19.40 ? 112 ASP A CG  1 
ATOM   670   O OD1 . ASP A 1 113 ? -17.718 45.592  -12.494 1.00 16.64 ? 112 ASP A OD1 1 
ATOM   671   O OD2 . ASP A 1 113 ? -19.649 45.145  -11.535 1.00 20.31 ? 112 ASP A OD2 1 
ATOM   672   N N   . VAL A 1 114 ? -19.130 41.500  -10.874 1.00 19.25 ? 113 VAL A N   1 
ATOM   673   C CA  . VAL A 1 114 ? -19.044 40.320  -11.745 1.00 18.94 ? 113 VAL A CA  1 
ATOM   674   C C   . VAL A 1 114 ? -20.256 40.256  -12.641 1.00 19.24 ? 113 VAL A C   1 
ATOM   675   O O   . VAL A 1 114 ? -21.208 41.017  -12.458 1.00 19.11 ? 113 VAL A O   1 
ATOM   676   C CB  . VAL A 1 114 ? -18.932 38.971  -10.956 1.00 19.25 ? 113 VAL A CB  1 
ATOM   677   C CG1 . VAL A 1 114 ? -17.506 38.763  -10.386 1.00 17.33 ? 113 VAL A CG1 1 
ATOM   678   C CG2 . VAL A 1 114 ? -20.006 38.867  -9.864  1.00 18.30 ? 113 VAL A CG2 1 
ATOM   679   N N   . TYR A 1 115 ? -20.203 39.360  -13.621 1.00 19.79 ? 114 TYR A N   1 
ATOM   680   C CA  . TYR A 1 115 ? -21.365 39.013  -14.420 1.00 19.89 ? 114 TYR A CA  1 
ATOM   681   C C   . TYR A 1 115 ? -22.578 38.791  -13.507 1.00 19.74 ? 114 TYR A C   1 
ATOM   682   O O   . TYR A 1 115 ? -22.508 38.052  -12.512 1.00 19.54 ? 114 TYR A O   1 
ATOM   683   C CB  . TYR A 1 115 ? -21.092 37.759  -15.271 1.00 21.27 ? 114 TYR A CB  1 
ATOM   684   C CG  . TYR A 1 115 ? -22.310 37.322  -16.067 1.00 22.37 ? 114 TYR A CG  1 
ATOM   685   C CD1 . TYR A 1 115 ? -22.969 38.227  -16.902 1.00 24.58 ? 114 TYR A CD1 1 
ATOM   686   C CD2 . TYR A 1 115 ? -22.816 36.027  -15.975 1.00 23.80 ? 114 TYR A CD2 1 
ATOM   687   C CE1 . TYR A 1 115 ? -24.101 37.854  -17.629 1.00 24.62 ? 114 TYR A CE1 1 
ATOM   688   C CE2 . TYR A 1 115 ? -23.961 35.639  -16.695 1.00 23.25 ? 114 TYR A CE2 1 
ATOM   689   C CZ  . TYR A 1 115 ? -24.584 36.559  -17.524 1.00 23.99 ? 114 TYR A CZ  1 
ATOM   690   O OH  . TYR A 1 115 ? -25.710 36.225  -18.242 1.00 25.10 ? 114 TYR A OH  1 
ATOM   691   N N   . GLY A 1 116 ? -23.676 39.465  -13.834 1.00 19.30 ? 115 GLY A N   1 
ATOM   692   C CA  . GLY A 1 116 ? -24.917 39.349  -13.081 1.00 19.11 ? 115 GLY A CA  1 
ATOM   693   C C   . GLY A 1 116 ? -25.304 37.926  -12.709 1.00 19.50 ? 115 GLY A C   1 
ATOM   694   O O   . GLY A 1 116 ? -25.741 37.676  -11.589 1.00 19.74 ? 115 GLY A O   1 
ATOM   695   N N   . GLY A 1 117 ? -25.166 37.005  -13.665 1.00 19.90 ? 116 GLY A N   1 
ATOM   696   C CA  . GLY A 1 117 ? -25.449 35.586  -13.468 1.00 19.08 ? 116 GLY A CA  1 
ATOM   697   C C   . GLY A 1 117 ? -24.543 34.894  -12.466 1.00 19.16 ? 116 GLY A C   1 
ATOM   698   O O   . GLY A 1 117 ? -24.972 33.963  -11.782 1.00 18.72 ? 116 GLY A O   1 
ATOM   699   N N   . THR A 1 118 ? -23.288 35.326  -12.393 1.00 19.34 ? 117 THR A N   1 
ATOM   700   C CA  . THR A 1 118 ? -22.362 34.840  -11.367 1.00 19.55 ? 117 THR A CA  1 
ATOM   701   C C   . THR A 1 118 ? -22.755 35.342  -9.979  1.00 19.92 ? 117 THR A C   1 
ATOM   702   O O   . THR A 1 118 ? -22.801 34.576  -8.994  1.00 19.71 ? 117 THR A O   1 
ATOM   703   C CB  . THR A 1 118 ? -20.910 35.248  -11.707 1.00 19.75 ? 117 THR A CB  1 
ATOM   704   O OG1 . THR A 1 118 ? -20.572 34.740  -12.999 1.00 19.43 ? 117 THR A OG1 1 
ATOM   705   C CG2 . THR A 1 118 ? -19.921 34.712  -10.673 1.00 18.53 ? 117 THR A CG2 1 
ATOM   706   N N   . ASN A 1 119 ? -23.067 36.632  -9.902  1.00 19.93 ? 118 ASN A N   1 
ATOM   707   C CA  . ASN A 1 119 ? -23.596 37.223  -8.671  1.00 20.27 ? 118 ASN A CA  1 
ATOM   708   C C   . ASN A 1 119 ? -24.838 36.449  -8.199  1.00 20.17 ? 118 ASN A C   1 
ATOM   709   O O   . ASN A 1 119 ? -24.907 35.955  -7.072  1.00 19.72 ? 118 ASN A O   1 
ATOM   710   C CB  . ASN A 1 119 ? -23.907 38.714  -8.921  1.00 20.59 ? 118 ASN A CB  1 
ATOM   711   C CG  . ASN A 1 119 ? -24.238 39.487  -7.645  1.00 20.63 ? 118 ASN A CG  1 
ATOM   712   O OD1 . ASN A 1 119 ? -25.280 39.266  -7.014  1.00 20.22 ? 118 ASN A OD1 1 
ATOM   713   N ND2 . ASN A 1 119 ? -23.368 40.433  -7.292  1.00 16.83 ? 118 ASN A ND2 1 
ATOM   714   N N   . ARG A 1 120 ? -25.801 36.309  -9.096  1.00 20.09 ? 119 ARG A N   1 
ATOM   715   C CA  . ARG A 1 120 ? -27.030 35.617  -8.790  1.00 20.30 ? 119 ARG A CA  1 
ATOM   716   C C   . ARG A 1 120 ? -26.801 34.185  -8.280  1.00 20.39 ? 119 ARG A C   1 
ATOM   717   O O   . ARG A 1 120 ? -27.382 33.768  -7.275  1.00 20.54 ? 119 ARG A O   1 
ATOM   718   C CB  . ARG A 1 120 ? -27.928 35.624  -10.017 1.00 20.21 ? 119 ARG A CB  1 
ATOM   719   C CG  . ARG A 1 120 ? -29.196 34.788  -9.860  1.00 21.18 ? 119 ARG A CG  1 
ATOM   720   C CD  . ARG A 1 120 ? -30.058 34.865  -11.119 1.00 21.29 ? 119 ARG A CD  1 
ATOM   721   N NE  . ARG A 1 120 ? -29.386 34.209  -12.238 1.00 23.59 ? 119 ARG A NE  1 
ATOM   722   C CZ  . ARG A 1 120 ? -29.254 34.705  -13.465 1.00 23.74 ? 119 ARG A CZ  1 
ATOM   723   N NH1 . ARG A 1 120 ? -29.772 35.882  -13.788 1.00 25.01 ? 119 ARG A NH1 1 
ATOM   724   N NH2 . ARG A 1 120 ? -28.610 34.001  -14.386 1.00 24.23 ? 119 ARG A NH2 1 
ATOM   725   N N   . TYR A 1 121 ? -25.950 33.426  -8.957  1.00 20.88 ? 120 TYR A N   1 
ATOM   726   C CA  . TYR A 1 121 ? -25.717 32.046  -8.538  1.00 20.14 ? 120 TYR A CA  1 
ATOM   727   C C   . TYR A 1 121 ? -25.167 31.961  -7.108  1.00 20.86 ? 120 TYR A C   1 
ATOM   728   O O   . TYR A 1 121 ? -25.723 31.256  -6.270  1.00 20.27 ? 120 TYR A O   1 
ATOM   729   C CB  . TYR A 1 121 ? -24.781 31.321  -9.493  1.00 19.90 ? 120 TYR A CB  1 
ATOM   730   C CG  . TYR A 1 121 ? -24.323 30.007  -8.918  1.00 19.30 ? 120 TYR A CG  1 
ATOM   731   C CD1 . TYR A 1 121 ? -25.257 29.039  -8.544  1.00 19.60 ? 120 TYR A CD1 1 
ATOM   732   C CD2 . TYR A 1 121 ? -22.974 29.744  -8.699  1.00 19.22 ? 120 TYR A CD2 1 
ATOM   733   C CE1 . TYR A 1 121 ? -24.854 27.834  -7.982  1.00 18.99 ? 120 TYR A CE1 1 
ATOM   734   C CE2 . TYR A 1 121 ? -22.564 28.527  -8.137  1.00 20.25 ? 120 TYR A CE2 1 
ATOM   735   C CZ  . TYR A 1 121 ? -23.510 27.584  -7.778  1.00 19.56 ? 120 TYR A CZ  1 
ATOM   736   O OH  . TYR A 1 121 ? -23.131 26.376  -7.209  1.00 17.16 ? 120 TYR A OH  1 
ATOM   737   N N   . PHE A 1 122 ? -24.077 32.670  -6.838  1.00 21.30 ? 121 PHE A N   1 
ATOM   738   C CA  . PHE A 1 122 ? -23.465 32.642  -5.518  1.00 21.76 ? 121 PHE A CA  1 
ATOM   739   C C   . PHE A 1 122 ? -24.459 33.160  -4.438  1.00 22.95 ? 121 PHE A C   1 
ATOM   740   O O   . PHE A 1 122 ? -24.761 32.482  -3.446  1.00 22.95 ? 121 PHE A O   1 
ATOM   741   C CB  . PHE A 1 122 ? -22.179 33.481  -5.520  1.00 21.57 ? 121 PHE A CB  1 
ATOM   742   C CG  . PHE A 1 122 ? -21.000 32.851  -6.252  1.00 20.73 ? 121 PHE A CG  1 
ATOM   743   C CD1 . PHE A 1 122 ? -20.746 31.485  -6.194  1.00 21.03 ? 121 PHE A CD1 1 
ATOM   744   C CD2 . PHE A 1 122 ? -20.109 33.647  -6.948  1.00 20.62 ? 121 PHE A CD2 1 
ATOM   745   C CE1 . PHE A 1 122 ? -19.647 30.926  -6.842  1.00 20.62 ? 121 PHE A CE1 1 
ATOM   746   C CE2 . PHE A 1 122 ? -19.005 33.104  -7.595  1.00 19.49 ? 121 PHE A CE2 1 
ATOM   747   C CZ  . PHE A 1 122 ? -18.766 31.750  -7.545  1.00 20.27 ? 121 PHE A CZ  1 
ATOM   748   N N   . ARG A 1 123 ? -25.004 34.345  -4.670  1.00 23.70 ? 122 ARG A N   1 
ATOM   749   C CA  . ARG A 1 123 ? -25.863 35.002  -3.693  1.00 24.89 ? 122 ARG A CA  1 
ATOM   750   C C   . ARG A 1 123 ? -27.163 34.254  -3.432  1.00 24.43 ? 122 ARG A C   1 
ATOM   751   O O   . ARG A 1 123 ? -27.571 34.138  -2.292  1.00 24.04 ? 122 ARG A O   1 
ATOM   752   C CB  . ARG A 1 123 ? -26.172 36.428  -4.158  1.00 24.66 ? 122 ARG A CB  1 
ATOM   753   C CG  . ARG A 1 123 ? -26.657 37.333  -3.066  1.00 26.95 ? 122 ARG A CG  1 
ATOM   754   C CD  . ARG A 1 123 ? -26.876 38.750  -3.584  1.00 28.18 ? 122 ARG A CD  1 
ATOM   755   N NE  . ARG A 1 123 ? -28.056 38.823  -4.444  1.00 30.98 ? 122 ARG A NE  1 
ATOM   756   C CZ  . ARG A 1 123 ? -29.311 38.796  -3.995  1.00 33.31 ? 122 ARG A CZ  1 
ATOM   757   N NH1 . ARG A 1 123 ? -29.573 38.718  -2.688  1.00 36.00 ? 122 ARG A NH1 1 
ATOM   758   N NH2 . ARG A 1 123 ? -30.323 38.873  -4.853  1.00 33.62 ? 122 ARG A NH2 1 
ATOM   759   N N   . GLN A 1 124 ? -27.809 33.737  -4.475  1.00 24.64 ? 123 GLN A N   1 
ATOM   760   C CA  . GLN A 1 124 ? -29.165 33.172  -4.330  1.00 25.18 ? 123 GLN A CA  1 
ATOM   761   C C   . GLN A 1 124 ? -29.252 31.643  -4.269  1.00 24.79 ? 123 GLN A C   1 
ATOM   762   O O   . GLN A 1 124 ? -30.212 31.102  -3.712  1.00 25.05 ? 123 GLN A O   1 
ATOM   763   C CB  . GLN A 1 124 ? -30.093 33.697  -5.444  1.00 25.53 ? 123 GLN A CB  1 
ATOM   764   C CG  . GLN A 1 124 ? -30.349 35.211  -5.356  1.00 26.52 ? 123 GLN A CG  1 
ATOM   765   C CD  . GLN A 1 124 ? -31.093 35.767  -6.548  1.00 26.94 ? 123 GLN A CD  1 
ATOM   766   O OE1 . GLN A 1 124 ? -30.554 36.587  -7.295  1.00 32.55 ? 123 GLN A OE1 1 
ATOM   767   N NE2 . GLN A 1 124 ? -32.337 35.343  -6.729  1.00 29.24 ? 123 GLN A NE2 1 
ATOM   768   N N   . VAL A 1 125 ? -28.285 30.939  -4.848  1.00 24.09 ? 124 VAL A N   1 
ATOM   769   C CA  . VAL A 1 125 ? -28.355 29.486  -4.882  1.00 23.59 ? 124 VAL A CA  1 
ATOM   770   C C   . VAL A 1 125 ? -27.276 28.839  -3.984  1.00 23.98 ? 124 VAL A C   1 
ATOM   771   O O   . VAL A 1 125 ? -27.595 28.120  -3.036  1.00 23.32 ? 124 VAL A O   1 
ATOM   772   C CB  . VAL A 1 125 ? -28.241 28.960  -6.325  1.00 23.27 ? 124 VAL A CB  1 
ATOM   773   C CG1 . VAL A 1 125 ? -28.504 27.459  -6.363  1.00 23.03 ? 124 VAL A CG1 1 
ATOM   774   C CG2 . VAL A 1 125 ? -29.204 29.695  -7.242  1.00 22.31 ? 124 VAL A CG2 1 
ATOM   775   N N   . ALA A 1 126 ? -26.010 29.096  -4.289  1.00 24.14 ? 125 ALA A N   1 
ATOM   776   C CA  . ALA A 1 126 ? -24.902 28.455  -3.568  1.00 24.41 ? 125 ALA A CA  1 
ATOM   777   C C   . ALA A 1 126 ? -24.980 28.726  -2.044  1.00 24.81 ? 125 ALA A C   1 
ATOM   778   O O   . ALA A 1 126 ? -24.732 27.827  -1.218  1.00 24.43 ? 125 ALA A O   1 
ATOM   779   C CB  . ALA A 1 126 ? -23.550 28.895  -4.157  1.00 23.69 ? 125 ALA A CB  1 
ATOM   780   N N   . SER A 1 127 ? -25.364 29.950  -1.694  1.00 24.86 ? 126 SER A N   1 
ATOM   781   C CA  . SER A 1 127 ? -25.533 30.347  -0.306  1.00 25.77 ? 126 SER A CA  1 
ATOM   782   C C   . SER A 1 127 ? -26.491 29.425  0.477   1.00 26.30 ? 126 SER A C   1 
ATOM   783   O O   . SER A 1 127 ? -26.356 29.271  1.692   1.00 26.06 ? 126 SER A O   1 
ATOM   784   C CB  . SER A 1 127 ? -26.092 31.763  -0.266  1.00 25.50 ? 126 SER A CB  1 
ATOM   785   O OG  . SER A 1 127 ? -27.365 31.775  -0.881  1.00 27.02 ? 126 SER A OG  1 
ATOM   786   N N   . GLU A 1 128 ? -27.467 28.850  -0.230  1.00 26.63 ? 127 GLU A N   1 
ATOM   787   C CA  . GLU A 1 128 ? -28.482 27.986  0.376   1.00 27.08 ? 127 GLU A CA  1 
ATOM   788   C C   . GLU A 1 128 ? -27.986 26.568  0.674   1.00 26.53 ? 127 GLU A C   1 
ATOM   789   O O   . GLU A 1 128 ? -28.715 25.773  1.271   1.00 25.97 ? 127 GLU A O   1 
ATOM   790   C CB  . GLU A 1 128 ? -29.731 27.917  -0.514  1.00 27.42 ? 127 GLU A CB  1 
ATOM   791   C CG  . GLU A 1 128 ? -30.481 29.240  -0.642  1.00 29.44 ? 127 GLU A CG  1 
ATOM   792   C CD  . GLU A 1 128 ? -31.241 29.648  0.646   1.00 34.09 ? 127 GLU A CD  1 
ATOM   793   O OE1 . GLU A 1 128 ? -31.465 30.868  0.852   1.00 35.83 ? 127 GLU A OE1 1 
ATOM   794   O OE2 . GLU A 1 128 ? -31.622 28.753  1.446   1.00 36.52 ? 127 GLU A OE2 1 
ATOM   795   N N   . PHE A 1 129 ? -26.759 26.253  0.271   1.00 26.25 ? 128 PHE A N   1 
ATOM   796   C CA  . PHE A 1 129 ? -26.224 24.899  0.437   1.00 26.41 ? 128 PHE A CA  1 
ATOM   797   C C   . PHE A 1 129 ? -24.958 24.854  1.287   1.00 26.49 ? 128 PHE A C   1 
ATOM   798   O O   . PHE A 1 129 ? -23.980 24.177  0.966   1.00 26.83 ? 128 PHE A O   1 
ATOM   799   C CB  . PHE A 1 129 ? -26.047 24.245  -0.928  1.00 26.07 ? 128 PHE A CB  1 
ATOM   800   C CG  . PHE A 1 129 ? -27.345 24.045  -1.645  1.00 25.42 ? 128 PHE A CG  1 
ATOM   801   C CD1 . PHE A 1 129 ? -27.780 24.967  -2.585  1.00 25.61 ? 128 PHE A CD1 1 
ATOM   802   C CD2 . PHE A 1 129 ? -28.162 22.959  -1.346  1.00 24.37 ? 128 PHE A CD2 1 
ATOM   803   C CE1 . PHE A 1 129 ? -28.983 24.787  -3.241  1.00 24.80 ? 128 PHE A CE1 1 
ATOM   804   C CE2 . PHE A 1 129 ? -29.376 22.783  -1.994  1.00 24.08 ? 128 PHE A CE2 1 
ATOM   805   C CZ  . PHE A 1 129 ? -29.788 23.697  -2.933  1.00 24.75 ? 128 PHE A CZ  1 
ATOM   806   N N   . GLY A 1 130 ? -25.022 25.582  2.396   1.00 27.24 ? 129 GLY A N   1 
ATOM   807   C CA  . GLY A 1 130 ? -23.979 25.590  3.415   1.00 27.28 ? 129 GLY A CA  1 
ATOM   808   C C   . GLY A 1 130 ? -22.669 26.238  3.030   1.00 27.49 ? 129 GLY A C   1 
ATOM   809   O O   . GLY A 1 130 ? -21.641 25.993  3.687   1.00 28.03 ? 129 GLY A O   1 
ATOM   810   N N   . LEU A 1 131 ? -22.691 27.049  1.977   1.00 27.59 ? 130 LEU A N   1 
ATOM   811   C CA  . LEU A 1 131 ? -21.522 27.808  1.528   1.00 27.41 ? 130 LEU A CA  1 
ATOM   812   C C   . LEU A 1 131 ? -21.705 29.298  1.856   1.00 27.12 ? 130 LEU A C   1 
ATOM   813   O O   . LEU A 1 131 ? -22.768 29.874  1.625   1.00 26.94 ? 130 LEU A O   1 
ATOM   814   C CB  . LEU A 1 131 ? -21.304 27.637  0.013   1.00 27.15 ? 130 LEU A CB  1 
ATOM   815   C CG  . LEU A 1 131 ? -21.098 26.218  -0.545  1.00 27.75 ? 130 LEU A CG  1 
ATOM   816   C CD1 . LEU A 1 131 ? -21.498 26.142  -2.040  1.00 27.15 ? 130 LEU A CD1 1 
ATOM   817   C CD2 . LEU A 1 131 ? -19.671 25.692  -0.336  1.00 24.10 ? 130 LEU A CD2 1 
ATOM   818   N N   . LYS A 1 132 ? -20.645 29.908  2.369   1.00 27.43 ? 131 LYS A N   1 
ATOM   819   C CA  . LYS A 1 132 ? -20.618 31.322  2.754   1.00 27.77 ? 131 LYS A CA  1 
ATOM   820   C C   . LYS A 1 132 ? -20.014 32.134  1.621   1.00 27.20 ? 131 LYS A C   1 
ATOM   821   O O   . LYS A 1 132 ? -18.934 31.825  1.167   1.00 27.11 ? 131 LYS A O   1 
ATOM   822   C CB  . LYS A 1 132 ? -19.781 31.484  4.030   1.00 28.09 ? 131 LYS A CB  1 
ATOM   823   C CG  . LYS A 1 132 ? -19.543 32.923  4.514   1.00 28.19 ? 131 LYS A CG  1 
ATOM   824   C CD  . LYS A 1 132 ? -18.872 32.920  5.891   1.00 29.80 ? 131 LYS A CD  1 
ATOM   825   C CE  . LYS A 1 132 ? -18.316 34.301  6.291   1.00 31.57 ? 131 LYS A CE  1 
ATOM   826   N NZ  . LYS A 1 132 ? -19.358 35.374  6.195   1.00 35.01 ? 131 LYS A NZ  1 
ATOM   827   N N   . ILE A 1 133 ? -20.735 33.158  1.162   1.00 27.60 ? 132 ILE A N   1 
ATOM   828   C CA  . ILE A 1 133 ? -20.324 33.995  0.033   1.00 27.44 ? 132 ILE A CA  1 
ATOM   829   C C   . ILE A 1 133 ? -19.991 35.413  0.531   1.00 26.94 ? 132 ILE A C   1 
ATOM   830   O O   . ILE A 1 133 ? -20.846 36.087  1.077   1.00 26.88 ? 132 ILE A O   1 
ATOM   831   C CB  . ILE A 1 133 ? -21.454 34.143  -1.056  1.00 27.63 ? 132 ILE A CB  1 
ATOM   832   C CG1 . ILE A 1 133 ? -22.121 32.794  -1.417  1.00 28.49 ? 132 ILE A CG1 1 
ATOM   833   C CG2 . ILE A 1 133 ? -20.896 34.835  -2.296  1.00 27.95 ? 132 ILE A CG2 1 
ATOM   834   C CD1 . ILE A 1 133 ? -21.233 31.756  -2.162  1.00 27.28 ? 132 ILE A CD1 1 
ATOM   835   N N   . SER A 1 134 ? -18.751 35.848  0.330   1.00 26.95 ? 133 SER A N   1 
ATOM   836   C CA  . SER A 1 134 ? -18.337 37.218  0.625   1.00 26.50 ? 133 SER A CA  1 
ATOM   837   C C   . SER A 1 134 ? -17.944 37.944  -0.663  1.00 26.19 ? 133 SER A C   1 
ATOM   838   O O   . SER A 1 134 ? -17.130 37.446  -1.433  1.00 25.97 ? 133 SER A O   1 
ATOM   839   C CB  . SER A 1 134 ? -17.147 37.216  1.587   1.00 26.82 ? 133 SER A CB  1 
ATOM   840   O OG  . SER A 1 134 ? -17.494 36.579  2.816   1.00 27.71 ? 133 SER A OG  1 
ATOM   841   N N   . PHE A 1 135 ? -18.517 39.127  -0.880  1.00 25.55 ? 134 PHE A N   1 
ATOM   842   C CA  . PHE A 1 135 ? -18.173 39.952  -2.035  1.00 24.91 ? 134 PHE A CA  1 
ATOM   843   C C   . PHE A 1 135 ? -17.161 41.009  -1.645  1.00 24.46 ? 134 PHE A C   1 
ATOM   844   O O   . PHE A 1 135 ? -17.424 41.806  -0.761  1.00 23.79 ? 134 PHE A O   1 
ATOM   845   C CB  . PHE A 1 135 ? -19.424 40.596  -2.614  1.00 24.70 ? 134 PHE A CB  1 
ATOM   846   C CG  . PHE A 1 135 ? -20.304 39.628  -3.348  1.00 24.32 ? 134 PHE A CG  1 
ATOM   847   C CD1 . PHE A 1 135 ? -19.972 39.209  -4.634  1.00 24.45 ? 134 PHE A CD1 1 
ATOM   848   C CD2 . PHE A 1 135 ? -21.449 39.120  -2.756  1.00 24.03 ? 134 PHE A CD2 1 
ATOM   849   C CE1 . PHE A 1 135 ? -20.775 38.313  -5.315  1.00 24.01 ? 134 PHE A CE1 1 
ATOM   850   C CE2 . PHE A 1 135 ? -22.267 38.211  -3.439  1.00 23.51 ? 134 PHE A CE2 1 
ATOM   851   C CZ  . PHE A 1 135 ? -21.924 37.809  -4.710  1.00 24.23 ? 134 PHE A CZ  1 
ATOM   852   N N   . VAL A 1 136 ? -16.011 41.008  -2.315  1.00 24.20 ? 135 VAL A N   1 
ATOM   853   C CA  . VAL A 1 136 ? -14.871 41.852  -1.947  1.00 24.60 ? 135 VAL A CA  1 
ATOM   854   C C   . VAL A 1 136 ? -14.218 42.501  -3.171  1.00 24.56 ? 135 VAL A C   1 
ATOM   855   O O   . VAL A 1 136 ? -14.101 41.873  -4.213  1.00 23.69 ? 135 VAL A O   1 
ATOM   856   C CB  . VAL A 1 136 ? -13.775 41.011  -1.245  1.00 24.96 ? 135 VAL A CB  1 
ATOM   857   C CG1 . VAL A 1 136 ? -12.540 41.889  -0.907  1.00 24.63 ? 135 VAL A CG1 1 
ATOM   858   C CG2 . VAL A 1 136 ? -14.338 40.276  -0.013  1.00 23.85 ? 135 VAL A CG2 1 
ATOM   859   N N   . ASP A 1 137 ? -13.775 43.744  -3.035  1.00 25.19 ? 136 ASP A N   1 
ATOM   860   C CA  . ASP A 1 137 ? -13.094 44.421  -4.141  1.00 26.05 ? 136 ASP A CA  1 
ATOM   861   C C   . ASP A 1 137 ? -11.643 44.004  -4.225  1.00 26.54 ? 136 ASP A C   1 
ATOM   862   O O   . ASP A 1 137 ? -10.762 44.641  -3.626  1.00 27.70 ? 136 ASP A O   1 
ATOM   863   C CB  . ASP A 1 137 ? -13.171 45.945  -4.023  1.00 25.99 ? 136 ASP A CB  1 
ATOM   864   C CG  . ASP A 1 137 ? -12.658 46.652  -5.272  1.00 26.63 ? 136 ASP A CG  1 
ATOM   865   O OD1 . ASP A 1 137 ? -12.827 47.869  -5.366  1.00 27.26 ? 136 ASP A OD1 1 
ATOM   866   O OD2 . ASP A 1 137 ? -12.098 45.989  -6.181  1.00 27.90 ? 136 ASP A OD2 1 
ATOM   867   N N   . CYS A 1 138 ? -11.382 42.974  -5.022  1.00 26.85 ? 137 CYS A N   1 
ATOM   868   C CA  . CYS A 1 138 ? -10.034 42.428  -5.153  1.00 26.85 ? 137 CYS A CA  1 
ATOM   869   C C   . CYS A 1 138 ? -9.121  43.247  -6.065  1.00 27.41 ? 137 CYS A C   1 
ATOM   870   O O   . CYS A 1 138 ? -7.952  42.908  -6.217  1.00 27.48 ? 137 CYS A O   1 
ATOM   871   C CB  . CYS A 1 138 ? -10.100 40.975  -5.621  1.00 26.93 ? 137 CYS A CB  1 
ATOM   872   S SG  . CYS A 1 138 ? -11.117 39.906  -4.567  1.00 25.36 ? 137 CYS A SG  1 
ATOM   873   N N   . SER A 1 139 ? -9.641  44.319  -6.666  1.00 28.04 ? 138 SER A N   1 
ATOM   874   C CA  . SER A 1 139 ? -8.794  45.302  -7.348  1.00 28.56 ? 138 SER A CA  1 
ATOM   875   C C   . SER A 1 139 ? -7.898  46.018  -6.329  1.00 29.35 ? 138 SER A C   1 
ATOM   876   O O   . SER A 1 139 ? -6.884  46.632  -6.693  1.00 29.36 ? 138 SER A O   1 
ATOM   877   C CB  . SER A 1 139 ? -9.636  46.317  -8.135  1.00 28.65 ? 138 SER A CB  1 
ATOM   878   O OG  . SER A 1 139 ? -10.373 47.163  -7.278  1.00 28.14 ? 138 SER A OG  1 
ATOM   879   N N   . LYS A 1 140 ? -8.294  45.935  -5.060  1.00 29.97 ? 139 LYS A N   1 
ATOM   880   C CA  . LYS A 1 140 ? -7.502  46.432  -3.944  1.00 30.62 ? 139 LYS A CA  1 
ATOM   881   C C   . LYS A 1 140 ? -6.977  45.242  -3.166  1.00 30.59 ? 139 LYS A C   1 
ATOM   882   O O   . LYS A 1 140 ? -7.631  44.773  -2.247  1.00 30.54 ? 139 LYS A O   1 
ATOM   883   C CB  . LYS A 1 140 ? -8.374  47.312  -3.051  1.00 30.72 ? 139 LYS A CB  1 
ATOM   884   C CG  . LYS A 1 140 ? -8.778  48.618  -3.733  1.00 31.70 ? 139 LYS A CG  1 
ATOM   885   C CD  . LYS A 1 140 ? -10.043 49.184  -3.149  1.00 34.32 ? 139 LYS A CD  1 
ATOM   886   C CE  . LYS A 1 140 ? -10.701 50.167  -4.090  1.00 35.80 ? 139 LYS A CE  1 
ATOM   887   N NZ  . LYS A 1 140 ? -9.951  51.439  -4.136  1.00 38.15 ? 139 LYS A NZ  1 
ATOM   888   N N   . ILE A 1 141 ? -5.790  44.769  -3.541  1.00 30.78 ? 140 ILE A N   1 
ATOM   889   C CA  . ILE A 1 141 ? -5.217  43.534  -2.993  1.00 31.14 ? 140 ILE A CA  1 
ATOM   890   C C   . ILE A 1 141 ? -5.288  43.484  -1.462  1.00 31.20 ? 140 ILE A C   1 
ATOM   891   O O   . ILE A 1 141 ? -5.582  42.432  -0.895  1.00 31.80 ? 140 ILE A O   1 
ATOM   892   C CB  . ILE A 1 141 ? -3.747  43.298  -3.494  1.00 31.14 ? 140 ILE A CB  1 
ATOM   893   C CG1 . ILE A 1 141 ? -3.735  42.932  -4.973  1.00 31.82 ? 140 ILE A CG1 1 
ATOM   894   C CG2 . ILE A 1 141 ? -3.074  42.149  -2.742  1.00 31.51 ? 140 ILE A CG2 1 
ATOM   895   C CD1 . ILE A 1 141 ? -2.360  43.006  -5.616  1.00 31.19 ? 140 ILE A CD1 1 
ATOM   896   N N   . LYS A 1 142 ? -5.053  44.611  -0.795  1.00 30.97 ? 141 LYS A N   1 
ATOM   897   C CA  . LYS A 1 142 ? -5.107  44.665  0.662   1.00 30.69 ? 141 LYS A CA  1 
ATOM   898   C C   . LYS A 1 142 ? -6.435  44.135  1.191   1.00 30.79 ? 141 LYS A C   1 
ATOM   899   O O   . LYS A 1 142 ? -6.461  43.400  2.175   1.00 30.39 ? 141 LYS A O   1 
ATOM   900   C CB  . LYS A 1 142 ? -4.883  46.103  1.153   1.00 30.94 ? 141 LYS A CB  1 
ATOM   901   N N   . LEU A 1 143 ? -7.530  44.490  0.515   1.00 30.66 ? 142 LEU A N   1 
ATOM   902   C CA  . LEU A 1 143 ? -8.866  44.048  0.913   1.00 30.87 ? 142 LEU A CA  1 
ATOM   903   C C   . LEU A 1 143 ? -9.044  42.533  0.752   1.00 30.67 ? 142 LEU A C   1 
ATOM   904   O O   . LEU A 1 143 ? -9.699  41.899  1.571   1.00 30.26 ? 142 LEU A O   1 
ATOM   905   C CB  . LEU A 1 143 ? -9.952  44.811  0.131   1.00 30.95 ? 142 LEU A CB  1 
ATOM   906   C CG  . LEU A 1 143 ? -10.081 46.328  0.363   1.00 32.07 ? 142 LEU A CG  1 
ATOM   907   C CD1 . LEU A 1 143 ? -11.120 46.947  -0.585  1.00 31.79 ? 142 LEU A CD1 1 
ATOM   908   C CD2 . LEU A 1 143 ? -10.462 46.643  1.801   1.00 32.66 ? 142 LEU A CD2 1 
ATOM   909   N N   . LEU A 1 144 ? -8.445  41.952  -0.284  1.00 30.41 ? 143 LEU A N   1 
ATOM   910   C CA  . LEU A 1 144 ? -8.465  40.500  -0.462  1.00 30.71 ? 143 LEU A CA  1 
ATOM   911   C C   . LEU A 1 144 ? -7.694  39.806  0.658   1.00 31.37 ? 143 LEU A C   1 
ATOM   912   O O   . LEU A 1 144 ? -8.211  38.875  1.287   1.00 31.48 ? 143 LEU A O   1 
ATOM   913   C CB  . LEU A 1 144 ? -7.865  40.090  -1.819  1.00 30.63 ? 143 LEU A CB  1 
ATOM   914   C CG  . LEU A 1 144 ? -7.741  38.581  -2.063  1.00 29.84 ? 143 LEU A CG  1 
ATOM   915   C CD1 . LEU A 1 144 ? -9.082  37.841  -1.868  1.00 28.76 ? 143 LEU A CD1 1 
ATOM   916   C CD2 . LEU A 1 144 ? -7.176  38.328  -3.450  1.00 30.80 ? 143 LEU A CD2 1 
ATOM   917   N N   . GLU A 1 145 ? -6.464  40.277  0.894   1.00 31.63 ? 144 GLU A N   1 
ATOM   918   C CA  . GLU A 1 145 ? -5.596  39.760  1.956   1.00 31.93 ? 144 GLU A CA  1 
ATOM   919   C C   . GLU A 1 145 ? -6.322  39.751  3.311   1.00 31.78 ? 144 GLU A C   1 
ATOM   920   O O   . GLU A 1 145 ? -6.234  38.777  4.051   1.00 32.84 ? 144 GLU A O   1 
ATOM   921   C CB  . GLU A 1 145 ? -4.311  40.589  2.035   1.00 31.84 ? 144 GLU A CB  1 
ATOM   922   C CG  . GLU A 1 145 ? -3.264  40.042  3.001   1.00 31.96 ? 144 GLU A CG  1 
ATOM   923   C CD  . GLU A 1 145 ? -1.924  40.761  2.902   1.00 31.59 ? 144 GLU A CD  1 
ATOM   924   O OE1 . GLU A 1 145 ? -0.972  40.330  3.584   1.00 30.82 ? 144 GLU A OE1 1 
ATOM   925   O OE2 . GLU A 1 145 ? -1.812  41.755  2.150   1.00 29.95 ? 144 GLU A OE2 1 
ATOM   926   N N   . ALA A 1 146 ? -7.060  40.818  3.599   1.00 32.03 ? 145 ALA A N   1 
ATOM   927   C CA  . ALA A 1 146 ? -7.845  40.943  4.835   1.00 31.91 ? 145 ALA A CA  1 
ATOM   928   C C   . ALA A 1 146 ? -9.072  40.057  4.903   1.00 32.30 ? 145 ALA A C   1 
ATOM   929   O O   . ALA A 1 146 ? -9.506  39.699  6.000   1.00 32.85 ? 145 ALA A O   1 
ATOM   930   C CB  . ALA A 1 146 ? -8.271  42.383  5.037   1.00 31.78 ? 145 ALA A CB  1 
ATOM   931   N N   . ALA A 1 147 ? -9.667  39.728  3.756   1.00 32.08 ? 146 ALA A N   1 
ATOM   932   C CA  . ALA A 1 147 ? -10.923 38.974  3.748   1.00 31.72 ? 146 ALA A CA  1 
ATOM   933   C C   . ALA A 1 147 ? -10.720 37.473  3.922   1.00 31.33 ? 146 ALA A C   1 
ATOM   934   O O   . ALA A 1 147 ? -11.643 36.759  4.310   1.00 30.99 ? 146 ALA A O   1 
ATOM   935   C CB  . ALA A 1 147 ? -11.709 39.263  2.471   1.00 31.55 ? 146 ALA A CB  1 
ATOM   936   N N   . ILE A 1 148 ? -9.512  36.996  3.648   1.00 31.23 ? 147 ILE A N   1 
ATOM   937   C CA  . ILE A 1 148 ? -9.239  35.572  3.697   1.00 31.22 ? 147 ILE A CA  1 
ATOM   938   C C   . ILE A 1 148 ? -9.414  35.060  5.126   1.00 31.94 ? 147 ILE A C   1 
ATOM   939   O O   . ILE A 1 148 ? -9.025  35.715  6.088   1.00 32.34 ? 147 ILE A O   1 
ATOM   940   C CB  . ILE A 1 148 ? -7.833  35.244  3.160   1.00 31.24 ? 147 ILE A CB  1 
ATOM   941   C CG1 . ILE A 1 148 ? -7.769  35.530  1.654   1.00 30.57 ? 147 ILE A CG1 1 
ATOM   942   C CG2 . ILE A 1 148 ? -7.480  33.783  3.429   1.00 30.97 ? 147 ILE A CG2 1 
ATOM   943   C CD1 . ILE A 1 148 ? -6.390  35.367  1.039   1.00 30.56 ? 147 ILE A CD1 1 
ATOM   944   N N   . THR A 1 149 ? -10.040 33.902  5.251   1.00 32.39 ? 148 THR A N   1 
ATOM   945   C CA  . THR A 1 149 ? -10.268 33.261  6.543   1.00 32.78 ? 148 THR A CA  1 
ATOM   946   C C   . THR A 1 149 ? -9.798  31.818  6.408   1.00 32.59 ? 148 THR A C   1 
ATOM   947   O O   . THR A 1 149 ? -9.455  31.389  5.306   1.00 32.72 ? 148 THR A O   1 
ATOM   948   C CB  . THR A 1 149 ? -11.756 33.294  6.943   1.00 32.84 ? 148 THR A CB  1 
ATOM   949   O OG1 . THR A 1 149 ? -12.463 32.262  6.246   1.00 34.15 ? 148 THR A OG1 1 
ATOM   950   C CG2 . THR A 1 149 ? -12.376 34.644  6.630   1.00 32.43 ? 148 THR A CG2 1 
ATOM   951   N N   . PRO A 1 150 ? -9.726  31.075  7.524   1.00 32.32 ? 149 PRO A N   1 
ATOM   952   C CA  . PRO A 1 150 ? -9.338  29.665  7.414   1.00 31.94 ? 149 PRO A CA  1 
ATOM   953   C C   . PRO A 1 150 ? -10.358 28.817  6.639   1.00 31.34 ? 149 PRO A C   1 
ATOM   954   O O   . PRO A 1 150 ? -10.001 27.768  6.082   1.00 31.17 ? 149 PRO A O   1 
ATOM   955   C CB  . PRO A 1 150 ? -9.240  29.219  8.878   1.00 32.27 ? 149 PRO A CB  1 
ATOM   956   C CG  . PRO A 1 150 ? -9.042  30.507  9.645   1.00 32.13 ? 149 PRO A CG  1 
ATOM   957   C CD  . PRO A 1 150 ? -9.922  31.473  8.929   1.00 32.41 ? 149 PRO A CD  1 
ATOM   958   N N   . GLU A 1 151 ? -11.600 29.295  6.602   1.00 30.89 ? 150 GLU A N   1 
ATOM   959   C CA  . GLU A 1 151 ? -12.691 28.661  5.852   1.00 30.73 ? 150 GLU A CA  1 
ATOM   960   C C   . GLU A 1 151 ? -12.726 29.036  4.361   1.00 30.16 ? 150 GLU A C   1 
ATOM   961   O O   . GLU A 1 151 ? -13.496 28.442  3.608   1.00 30.30 ? 150 GLU A O   1 
ATOM   962   C CB  . GLU A 1 151 ? -14.040 29.025  6.471   1.00 31.00 ? 150 GLU A CB  1 
ATOM   963   C CG  . GLU A 1 151 ? -14.276 28.434  7.840   1.00 33.10 ? 150 GLU A CG  1 
ATOM   964   C CD  . GLU A 1 151 ? -13.458 29.112  8.926   1.00 35.74 ? 150 GLU A CD  1 
ATOM   965   O OE1 . GLU A 1 151 ? -13.585 30.345  9.106   1.00 37.81 ? 150 GLU A OE1 1 
ATOM   966   O OE2 . GLU A 1 151 ? -12.676 28.405  9.593   1.00 38.78 ? 150 GLU A OE2 1 
ATOM   967   N N   . THR A 1 152 ? -11.917 30.014  3.943   1.00 29.38 ? 151 THR A N   1 
ATOM   968   C CA  . THR A 1 152 ? -11.863 30.420  2.538   1.00 28.92 ? 151 THR A CA  1 
ATOM   969   C C   . THR A 1 152 ? -11.229 29.315  1.684   1.00 28.19 ? 151 THR A C   1 
ATOM   970   O O   . THR A 1 152 ? -10.064 28.954  1.880   1.00 27.74 ? 151 THR A O   1 
ATOM   971   C CB  . THR A 1 152 ? -11.045 31.714  2.330   1.00 29.16 ? 151 THR A CB  1 
ATOM   972   O OG1 . THR A 1 152 ? -11.532 32.749  3.190   1.00 27.98 ? 151 THR A OG1 1 
ATOM   973   C CG2 . THR A 1 152 ? -11.148 32.179  0.873   1.00 29.03 ? 151 THR A CG2 1 
ATOM   974   N N   . LYS A 1 153 ? -12.003 28.768  0.749   1.00 27.23 ? 152 LYS A N   1 
ATOM   975   C CA  . LYS A 1 153 ? -11.489 27.726  -0.151  1.00 26.33 ? 152 LYS A CA  1 
ATOM   976   C C   . LYS A 1 153 ? -11.510 28.097  -1.650  1.00 25.37 ? 152 LYS A C   1 
ATOM   977   O O   . LYS A 1 153 ? -10.852 27.440  -2.463  1.00 25.02 ? 152 LYS A O   1 
ATOM   978   C CB  . LYS A 1 153 ? -12.244 26.408  0.100   1.00 26.37 ? 152 LYS A CB  1 
ATOM   979   C CG  . LYS A 1 153 ? -11.475 25.437  1.003   1.00 28.42 ? 152 LYS A CG  1 
ATOM   980   C CD  . LYS A 1 153 ? -11.630 25.768  2.450   1.00 30.50 ? 152 LYS A CD  1 
ATOM   981   C CE  . LYS A 1 153 ? -10.418 25.362  3.306   1.00 31.23 ? 152 LYS A CE  1 
ATOM   982   N NZ  . LYS A 1 153 ? -9.727  24.133  2.837   1.00 31.91 ? 152 LYS A NZ  1 
ATOM   983   N N   . LEU A 1 154 ? -12.268 29.129  -2.004  1.00 24.11 ? 153 LEU A N   1 
ATOM   984   C CA  . LEU A 1 154 ? -12.391 29.560  -3.393  1.00 23.38 ? 153 LEU A CA  1 
ATOM   985   C C   . LEU A 1 154 ? -12.397 31.069  -3.467  1.00 22.34 ? 153 LEU A C   1 
ATOM   986   O O   . LEU A 1 154 ? -13.201 31.729  -2.817  1.00 21.98 ? 153 LEU A O   1 
ATOM   987   C CB  . LEU A 1 154 ? -13.679 28.997  -4.031  1.00 23.16 ? 153 LEU A CB  1 
ATOM   988   C CG  . LEU A 1 154 ? -13.983 29.389  -5.494  1.00 23.76 ? 153 LEU A CG  1 
ATOM   989   C CD1 . LEU A 1 154 ? -12.832 29.031  -6.427  1.00 22.72 ? 153 LEU A CD1 1 
ATOM   990   C CD2 . LEU A 1 154 ? -15.288 28.724  -5.963  1.00 23.58 ? 153 LEU A CD2 1 
ATOM   991   N N   . VAL A 1 155 ? -11.486 31.606  -4.269  1.00 21.95 ? 154 VAL A N   1 
ATOM   992   C CA  . VAL A 1 155 ? -11.485 33.020  -4.623  1.00 20.89 ? 154 VAL A CA  1 
ATOM   993   C C   . VAL A 1 155 ? -11.797 33.167  -6.125  1.00 20.68 ? 154 VAL A C   1 
ATOM   994   O O   . VAL A 1 155 ? -11.055 32.663  -6.971  1.00 19.74 ? 154 VAL A O   1 
ATOM   995   C CB  . VAL A 1 155 ? -10.150 33.659  -4.295  1.00 20.98 ? 154 VAL A CB  1 
ATOM   996   C CG1 . VAL A 1 155 ? -10.175 35.144  -4.668  1.00 19.35 ? 154 VAL A CG1 1 
ATOM   997   C CG2 . VAL A 1 155 ? -9.847  33.469  -2.796  1.00 20.36 ? 154 VAL A CG2 1 
ATOM   998   N N   . TRP A 1 156 ? -12.901 33.862  -6.425  1.00 20.62 ? 155 TRP A N   1 
ATOM   999   C CA  . TRP A 1 156 ? -13.445 33.968  -7.788  1.00 19.92 ? 155 TRP A CA  1 
ATOM   1000  C C   . TRP A 1 156 ? -13.312 35.390  -8.314  1.00 20.10 ? 155 TRP A C   1 
ATOM   1001  O O   . TRP A 1 156 ? -13.975 36.317  -7.845  1.00 20.47 ? 155 TRP A O   1 
ATOM   1002  C CB  . TRP A 1 156 ? -14.912 33.546  -7.831  1.00 19.79 ? 155 TRP A CB  1 
ATOM   1003  C CG  . TRP A 1 156 ? -15.490 33.532  -9.220  1.00 20.03 ? 155 TRP A CG  1 
ATOM   1004  C CD1 . TRP A 1 156 ? -15.867 34.622  -9.968  1.00 20.25 ? 155 TRP A CD1 1 
ATOM   1005  C CD2 . TRP A 1 156 ? -15.732 32.381  -10.042 1.00 20.07 ? 155 TRP A CD2 1 
ATOM   1006  N NE1 . TRP A 1 156 ? -16.314 34.217  -11.201 1.00 19.63 ? 155 TRP A NE1 1 
ATOM   1007  C CE2 . TRP A 1 156 ? -16.250 32.848  -11.273 1.00 20.18 ? 155 TRP A CE2 1 
ATOM   1008  C CE3 . TRP A 1 156 ? -15.539 31.004  -9.866  1.00 19.91 ? 155 TRP A CE3 1 
ATOM   1009  C CZ2 . TRP A 1 156 ? -16.598 31.984  -12.319 1.00 20.13 ? 155 TRP A CZ2 1 
ATOM   1010  C CZ3 . TRP A 1 156 ? -15.885 30.144  -10.902 1.00 20.01 ? 155 TRP A CZ3 1 
ATOM   1011  C CH2 . TRP A 1 156 ? -16.404 30.640  -12.115 1.00 20.66 ? 155 TRP A CH2 1 
ATOM   1012  N N   . ILE A 1 157 ? -12.455 35.580  -9.296  1.00 19.87 ? 156 ILE A N   1 
ATOM   1013  C CA  . ILE A 1 157 ? -12.332 36.906  -9.838  1.00 20.19 ? 156 ILE A CA  1 
ATOM   1014  C C   . ILE A 1 157 ? -12.557 36.964  -11.338 1.00 18.94 ? 156 ILE A C   1 
ATOM   1015  O O   . ILE A 1 157 ? -12.319 35.992  -12.071 1.00 17.85 ? 156 ILE A O   1 
ATOM   1016  C CB  . ILE A 1 157 ? -10.987 37.587  -9.477  1.00 20.69 ? 156 ILE A CB  1 
ATOM   1017  C CG1 . ILE A 1 157 ? -9.840  37.063  -10.320 1.00 21.37 ? 156 ILE A CG1 1 
ATOM   1018  C CG2 . ILE A 1 157 ? -10.662 37.468  -7.959  1.00 20.79 ? 156 ILE A CG2 1 
ATOM   1019  C CD1 . ILE A 1 157 ? -8.590  37.913  -10.149 1.00 21.26 ? 156 ILE A CD1 1 
ATOM   1020  N N   . GLU A 1 158 ? -13.039 38.130  -11.755 1.00 17.82 ? 157 GLU A N   1 
ATOM   1021  C CA  . GLU A 1 158 ? -13.046 38.539  -13.146 1.00 17.24 ? 157 GLU A CA  1 
ATOM   1022  C C   . GLU A 1 158 ? -12.045 39.674  -13.301 1.00 16.25 ? 157 GLU A C   1 
ATOM   1023  O O   . GLU A 1 158 ? -11.961 40.556  -12.455 1.00 16.32 ? 157 GLU A O   1 
ATOM   1024  C CB  . GLU A 1 158 ? -14.417 39.082  -13.557 1.00 17.16 ? 157 GLU A CB  1 
ATOM   1025  C CG  . GLU A 1 158 ? -15.472 38.068  -13.888 1.00 17.22 ? 157 GLU A CG  1 
ATOM   1026  C CD  . GLU A 1 158 ? -16.805 38.718  -14.132 1.00 16.99 ? 157 GLU A CD  1 
ATOM   1027  O OE1 . GLU A 1 158 ? -16.808 39.904  -14.517 1.00 18.26 ? 157 GLU A OE1 1 
ATOM   1028  O OE2 . GLU A 1 158 ? -17.856 38.063  -13.943 1.00 17.28 ? 157 GLU A OE2 1 
ATOM   1029  N N   . THR A 1 159 ? -11.323 39.676  -14.410 1.00 15.62 ? 158 THR A N   1 
ATOM   1030  C CA  . THR A 1 159 ? -10.573 40.868  -14.802 1.00 14.85 ? 158 THR A CA  1 
ATOM   1031  C C   . THR A 1 159 ? -10.389 40.964  -16.329 1.00 13.85 ? 158 THR A C   1 
ATOM   1032  O O   . THR A 1 159 ? -9.945  40.011  -16.944 1.00 13.96 ? 158 THR A O   1 
ATOM   1033  C CB  . THR A 1 159 ? -9.222  40.964  -14.029 1.00 15.16 ? 158 THR A CB  1 
ATOM   1034  O OG1 . THR A 1 159 ? -8.570  42.178  -14.385 1.00 14.64 ? 158 THR A OG1 1 
ATOM   1035  C CG2 . THR A 1 159 ? -8.305  39.774  -14.295 1.00 13.20 ? 158 THR A CG2 1 
ATOM   1036  N N   . PRO A 1 160 ? -10.754 42.114  -16.945 1.00 13.08 ? 159 PRO A N   1 
ATOM   1037  C CA  . PRO A 1 160 ? -11.487 43.229  -16.343 1.00 13.17 ? 159 PRO A CA  1 
ATOM   1038  C C   . PRO A 1 160 ? -12.880 42.795  -15.901 1.00 13.60 ? 159 PRO A C   1 
ATOM   1039  O O   . PRO A 1 160 ? -13.417 41.847  -16.445 1.00 13.03 ? 159 PRO A O   1 
ATOM   1040  C CB  . PRO A 1 160 ? -11.551 44.274  -17.472 1.00 13.14 ? 159 PRO A CB  1 
ATOM   1041  C CG  . PRO A 1 160 ? -10.462 43.902  -18.418 1.00 13.99 ? 159 PRO A CG  1 
ATOM   1042  C CD  . PRO A 1 160 ? -10.353 42.412  -18.323 1.00 12.80 ? 159 PRO A CD  1 
ATOM   1043  N N   . THR A 1 161 ? -13.445 43.473  -14.911 1.00 14.34 ? 160 THR A N   1 
ATOM   1044  C CA  . THR A 1 161 ? -14.771 43.131  -14.419 1.00 14.50 ? 160 THR A CA  1 
ATOM   1045  C C   . THR A 1 161 ? -15.919 43.490  -15.391 1.00 15.05 ? 160 THR A C   1 
ATOM   1046  O O   . THR A 1 161 ? -15.858 44.467  -16.147 1.00 14.95 ? 160 THR A O   1 
ATOM   1047  C CB  . THR A 1 161 ? -15.042 43.762  -13.020 1.00 14.52 ? 160 THR A CB  1 
ATOM   1048  O OG1 . THR A 1 161 ? -15.179 45.196  -13.120 1.00 15.88 ? 160 THR A OG1 1 
ATOM   1049  C CG2 . THR A 1 161 ? -13.943 43.371  -12.072 1.00 14.83 ? 160 THR A CG2 1 
ATOM   1050  N N   . ASN A 1 162 ? -16.964 42.674  -15.362 1.00 15.69 ? 161 ASN A N   1 
ATOM   1051  C CA  . ASN A 1 162 ? -18.166 42.917  -16.144 1.00 16.15 ? 161 ASN A CA  1 
ATOM   1052  C C   . ASN A 1 162 ? -19.232 43.521  -15.229 1.00 16.07 ? 161 ASN A C   1 
ATOM   1053  O O   . ASN A 1 162 ? -19.731 42.826  -14.370 1.00 16.80 ? 161 ASN A O   1 
ATOM   1054  C CB  . ASN A 1 162 ? -18.659 41.584  -16.727 1.00 17.10 ? 161 ASN A CB  1 
ATOM   1055  C CG  . ASN A 1 162 ? -19.845 41.750  -17.679 1.00 16.67 ? 161 ASN A CG  1 
ATOM   1056  O OD1 . ASN A 1 162 ? -20.291 42.859  -17.918 1.00 17.11 ? 161 ASN A OD1 1 
ATOM   1057  N ND2 . ASN A 1 162 ? -20.337 40.635  -18.235 1.00 17.77 ? 161 ASN A ND2 1 
ATOM   1058  N N   . PRO A 1 163 ? -19.646 44.790  -15.446 1.00 16.12 ? 162 PRO A N   1 
ATOM   1059  C CA  . PRO A 1 163 ? -19.374 45.707  -16.560 1.00 15.65 ? 162 PRO A CA  1 
ATOM   1060  C C   . PRO A 1 163 ? -18.441 46.912  -16.315 1.00 15.34 ? 162 PRO A C   1 
ATOM   1061  O O   . PRO A 1 163 ? -18.176 47.661  -17.253 1.00 14.76 ? 162 PRO A O   1 
ATOM   1062  C CB  . PRO A 1 163 ? -20.764 46.246  -16.840 1.00 15.71 ? 162 PRO A CB  1 
ATOM   1063  C CG  . PRO A 1 163 ? -21.372 46.383  -15.448 1.00 16.09 ? 162 PRO A CG  1 
ATOM   1064  C CD  . PRO A 1 163 ? -20.616 45.410  -14.532 1.00 15.81 ? 162 PRO A CD  1 
ATOM   1065  N N   . THR A 1 164 ? -17.978 47.133  -15.091 1.00 15.32 ? 163 THR A N   1 
ATOM   1066  C CA  . THR A 1 164 ? -17.285 48.383  -14.772 1.00 15.36 ? 163 THR A CA  1 
ATOM   1067  C C   . THR A 1 164 ? -15.793 48.319  -15.089 1.00 15.16 ? 163 THR A C   1 
ATOM   1068  O O   . THR A 1 164 ? -15.103 49.332  -15.042 1.00 15.16 ? 163 THR A O   1 
ATOM   1069  C CB  . THR A 1 164 ? -17.486 48.786  -13.310 1.00 15.49 ? 163 THR A CB  1 
ATOM   1070  O OG1 . THR A 1 164 ? -16.787 47.870  -12.447 1.00 15.51 ? 163 THR A OG1 1 
ATOM   1071  C CG2 . THR A 1 164 ? -19.009 48.840  -12.945 1.00 15.70 ? 163 THR A CG2 1 
ATOM   1072  N N   . GLN A 1 165 ? -15.303 47.127  -15.413 1.00 15.05 ? 164 GLN A N   1 
ATOM   1073  C CA  . GLN A 1 165 ? -13.960 46.960  -15.974 1.00 15.30 ? 164 GLN A CA  1 
ATOM   1074  C C   . GLN A 1 165 ? -12.838 47.405  -15.046 1.00 15.78 ? 164 GLN A C   1 
ATOM   1075  O O   . GLN A 1 165 ? -11.871 48.051  -15.455 1.00 15.59 ? 164 GLN A O   1 
ATOM   1076  C CB  . GLN A 1 165 ? -13.857 47.603  -17.349 1.00 15.17 ? 164 GLN A CB  1 
ATOM   1077  C CG  . GLN A 1 165 ? -14.736 46.848  -18.384 1.00 16.55 ? 164 GLN A CG  1 
ATOM   1078  C CD  . GLN A 1 165 ? -14.197 46.976  -19.763 1.00 14.80 ? 164 GLN A CD  1 
ATOM   1079  O OE1 . GLN A 1 165 ? -13.072 46.538  -20.040 1.00 18.10 ? 164 GLN A OE1 1 
ATOM   1080  N NE2 . GLN A 1 165 ? -14.985 47.575  -20.663 1.00 12.42 ? 164 GLN A NE2 1 
ATOM   1081  N N   . LYS A 1 166 ? -12.987 47.012  -13.789 1.00 16.04 ? 165 LYS A N   1 
ATOM   1082  C CA  . LYS A 1 166 ? -11.911 47.084  -12.836 1.00 16.80 ? 165 LYS A CA  1 
ATOM   1083  C C   . LYS A 1 166 ? -10.963 45.950  -13.164 1.00 16.56 ? 165 LYS A C   1 
ATOM   1084  O O   . LYS A 1 166 ? -11.381 44.856  -13.599 1.00 15.92 ? 165 LYS A O   1 
ATOM   1085  C CB  . LYS A 1 166 ? -12.443 46.982  -11.406 1.00 16.47 ? 165 LYS A CB  1 
ATOM   1086  C CG  . LYS A 1 166 ? -12.880 48.292  -10.830 1.00 20.35 ? 165 LYS A CG  1 
ATOM   1087  C CD  . LYS A 1 166 ? -14.028 48.172  -9.832  1.00 22.25 ? 165 LYS A CD  1 
ATOM   1088  C CE  . LYS A 1 166 ? -13.819 47.158  -8.733  1.00 24.05 ? 165 LYS A CE  1 
ATOM   1089  N NZ  . LYS A 1 166 ? -15.044 47.033  -7.839  1.00 23.01 ? 165 LYS A NZ  1 
ATOM   1090  N N   . VAL A 1 167 ? -9.675  46.221  -12.960 1.00 16.80 ? 166 VAL A N   1 
ATOM   1091  C CA  . VAL A 1 167 ? -8.614  45.303  -13.285 1.00 16.24 ? 166 VAL A CA  1 
ATOM   1092  C C   . VAL A 1 167 ? -7.932  44.832  -11.991 1.00 17.16 ? 166 VAL A C   1 
ATOM   1093  O O   . VAL A 1 167 ? -7.610  45.635  -11.093 1.00 16.86 ? 166 VAL A O   1 
ATOM   1094  C CB  . VAL A 1 167 ? -7.640  45.973  -14.260 1.00 17.04 ? 166 VAL A CB  1 
ATOM   1095  C CG1 . VAL A 1 167 ? -6.389  45.131  -14.495 1.00 14.37 ? 166 VAL A CG1 1 
ATOM   1096  C CG2 . VAL A 1 167 ? -8.363  46.275  -15.598 1.00 14.96 ? 166 VAL A CG2 1 
ATOM   1097  N N   . ILE A 1 168 ? -7.745  43.520  -11.896 1.00 16.85 ? 167 ILE A N   1 
ATOM   1098  C CA  . ILE A 1 168 ? -7.159  42.891  -10.730 1.00 17.19 ? 167 ILE A CA  1 
ATOM   1099  C C   . ILE A 1 168 ? -5.777  42.415  -11.125 1.00 16.81 ? 167 ILE A C   1 
ATOM   1100  O O   . ILE A 1 168 ? -5.589  41.860  -12.204 1.00 16.13 ? 167 ILE A O   1 
ATOM   1101  C CB  . ILE A 1 168 ? -8.016  41.674  -10.231 1.00 17.61 ? 167 ILE A CB  1 
ATOM   1102  C CG1 . ILE A 1 168 ? -9.393  42.137  -9.738  1.00 18.86 ? 167 ILE A CG1 1 
ATOM   1103  C CG2 . ILE A 1 168 ? -7.306  40.919  -9.121  1.00 17.72 ? 167 ILE A CG2 1 
ATOM   1104  C CD1 . ILE A 1 168 ? -10.277 42.707  -10.800 1.00 19.93 ? 167 ILE A CD1 1 
ATOM   1105  N N   . ASP A 1 169 ? -4.813  42.654  -10.240 1.00 16.90 ? 168 ASP A N   1 
ATOM   1106  C CA  . ASP A 1 169 ? -3.455  42.140  -10.368 1.00 16.61 ? 168 ASP A CA  1 
ATOM   1107  C C   . ASP A 1 169 ? -3.490  40.643  -10.134 1.00 16.92 ? 168 ASP A C   1 
ATOM   1108  O O   . ASP A 1 169 ? -3.517  40.198  -8.983  1.00 16.44 ? 168 ASP A O   1 
ATOM   1109  C CB  . ASP A 1 169 ? -2.563  42.810  -9.308  1.00 16.82 ? 168 ASP A CB  1 
ATOM   1110  C CG  . ASP A 1 169 ? -1.095  42.469  -9.467  1.00 17.41 ? 168 ASP A CG  1 
ATOM   1111  O OD1 . ASP A 1 169 ? -0.749  41.418  -10.012 1.00 15.77 ? 168 ASP A OD1 1 
ATOM   1112  O OD2 . ASP A 1 169 ? -0.271  43.283  -9.053  1.00 17.94 ? 168 ASP A OD2 1 
ATOM   1113  N N   . ILE A 1 170 ? -3.485  39.846  -11.201 1.00 16.92 ? 169 ILE A N   1 
ATOM   1114  C CA  . ILE A 1 170 ? -3.703  38.399  -11.007 1.00 17.02 ? 169 ILE A CA  1 
ATOM   1115  C C   . ILE A 1 170 ? -2.541  37.750  -10.224 1.00 18.50 ? 169 ILE A C   1 
ATOM   1116  O O   . ILE A 1 170 ? -2.769  37.027  -9.261  1.00 18.02 ? 169 ILE A O   1 
ATOM   1117  C CB  . ILE A 1 170 ? -3.955  37.619  -12.318 1.00 16.57 ? 169 ILE A CB  1 
ATOM   1118  C CG1 . ILE A 1 170 ? -5.293  38.041  -12.968 1.00 15.50 ? 169 ILE A CG1 1 
ATOM   1119  C CG2 . ILE A 1 170 ? -3.989  36.106  -12.009 1.00 16.71 ? 169 ILE A CG2 1 
ATOM   1120  C CD1 . ILE A 1 170 ? -5.346  37.787  -14.472 1.00 14.22 ? 169 ILE A CD1 1 
ATOM   1121  N N   . GLU A 1 171 ? -1.311  38.024  -10.635 1.00 20.39 ? 170 GLU A N   1 
ATOM   1122  C CA  . GLU A 1 171 ? -0.139  37.465  -9.956  1.00 22.26 ? 170 GLU A CA  1 
ATOM   1123  C C   . GLU A 1 171 ? -0.075  37.857  -8.483  1.00 22.76 ? 170 GLU A C   1 
ATOM   1124  O O   . GLU A 1 171 ? 0.194   37.012  -7.620  1.00 23.86 ? 170 GLU A O   1 
ATOM   1125  C CB  . GLU A 1 171 ? 1.125   37.919  -10.675 1.00 23.04 ? 170 GLU A CB  1 
ATOM   1126  C CG  . GLU A 1 171 ? 2.341   37.164  -10.277 1.00 25.77 ? 170 GLU A CG  1 
ATOM   1127  C CD  . GLU A 1 171 ? 3.368   37.174  -11.381 1.00 29.39 ? 170 GLU A CD  1 
ATOM   1128  O OE1 . GLU A 1 171 ? 3.715   38.282  -11.845 1.00 29.05 ? 170 GLU A OE1 1 
ATOM   1129  O OE2 . GLU A 1 171 ? 3.791   36.071  -11.802 1.00 34.05 ? 170 GLU A OE2 1 
ATOM   1130  N N   . GLY A 1 172 ? -0.344  39.134  -8.199  1.00 23.29 ? 171 GLY A N   1 
ATOM   1131  C CA  . GLY A 1 172 ? -0.410  39.650  -6.832  1.00 23.26 ? 171 GLY A CA  1 
ATOM   1132  C C   . GLY A 1 172 ? -1.469  38.952  -6.009  1.00 23.87 ? 171 GLY A C   1 
ATOM   1133  O O   . GLY A 1 172 ? -1.228  38.582  -4.859  1.00 23.71 ? 171 GLY A O   1 
ATOM   1134  N N   . CYS A 1 173 ? -2.650  38.760  -6.593  1.00 23.88 ? 172 CYS A N   1 
ATOM   1135  C CA  . CYS A 1 173 ? -3.730  38.053  -5.903  1.00 24.26 ? 172 CYS A CA  1 
ATOM   1136  C C   . CYS A 1 173 ? -3.385  36.590  -5.637  1.00 24.21 ? 172 CYS A C   1 
ATOM   1137  O O   . CYS A 1 173 ? -3.702  36.061  -4.560  1.00 24.25 ? 172 CYS A O   1 
ATOM   1138  C CB  . CYS A 1 173 ? -5.036  38.164  -6.694  1.00 24.70 ? 172 CYS A CB  1 
ATOM   1139  S SG  . CYS A 1 173 ? -5.777  39.780  -6.491  1.00 27.50 ? 172 CYS A SG  1 
ATOM   1140  N N   . ALA A 1 174 ? -2.727  35.964  -6.606  1.00 23.56 ? 173 ALA A N   1 
ATOM   1141  C CA  . ALA A 1 174 ? -2.293  34.570  -6.501  1.00 24.00 ? 173 ALA A CA  1 
ATOM   1142  C C   . ALA A 1 174 ? -1.299  34.375  -5.350  1.00 24.44 ? 173 ALA A C   1 
ATOM   1143  O O   . ALA A 1 174 ? -1.430  33.442  -4.549  1.00 24.26 ? 173 ALA A O   1 
ATOM   1144  C CB  . ALA A 1 174 ? -1.667  34.114  -7.812  1.00 23.87 ? 173 ALA A CB  1 
ATOM   1145  N N   . HIS A 1 175 ? -0.300  35.248  -5.277  1.00 24.94 ? 174 HIS A N   1 
ATOM   1146  C CA  . HIS A 1 175 ? 0.680   35.190  -4.193  1.00 25.42 ? 174 HIS A CA  1 
ATOM   1147  C C   . HIS A 1 175 ? -0.013  35.309  -2.849  1.00 25.81 ? 174 HIS A C   1 
ATOM   1148  O O   . HIS A 1 175 ? 0.313   34.586  -1.900  1.00 27.28 ? 174 HIS A O   1 
ATOM   1149  C CB  . HIS A 1 175 ? 1.729   36.296  -4.336  1.00 25.60 ? 174 HIS A CB  1 
ATOM   1150  C CG  . HIS A 1 175 ? 2.698   36.063  -5.449  1.00 25.03 ? 174 HIS A CG  1 
ATOM   1151  N ND1 . HIS A 1 175 ? 3.117   37.070  -6.293  1.00 25.59 ? 174 HIS A ND1 1 
ATOM   1152  C CD2 . HIS A 1 175 ? 3.316   34.934  -5.869  1.00 25.84 ? 174 HIS A CD2 1 
ATOM   1153  C CE1 . HIS A 1 175 ? 3.963   36.572  -7.180  1.00 26.10 ? 174 HIS A CE1 1 
ATOM   1154  N NE2 . HIS A 1 175 ? 4.095   35.276  -6.950  1.00 25.59 ? 174 HIS A NE2 1 
ATOM   1155  N N   . ILE A 1 176 ? -0.987  36.206  -2.775  1.00 25.82 ? 175 ILE A N   1 
ATOM   1156  C CA  . ILE A 1 176 ? -1.731  36.426  -1.545  1.00 26.32 ? 175 ILE A CA  1 
ATOM   1157  C C   . ILE A 1 176 ? -2.600  35.248  -1.162  1.00 27.16 ? 175 ILE A C   1 
ATOM   1158  O O   . ILE A 1 176 ? -2.596  34.826  0.005   1.00 27.73 ? 175 ILE A O   1 
ATOM   1159  C CB  . ILE A 1 176 ? -2.571  37.716  -1.657  1.00 26.13 ? 175 ILE A CB  1 
ATOM   1160  C CG1 . ILE A 1 176 ? -1.639  38.947  -1.562  1.00 27.47 ? 175 ILE A CG1 1 
ATOM   1161  C CG2 . ILE A 1 176 ? -3.731  37.759  -0.637  1.00 25.26 ? 175 ILE A CG2 1 
ATOM   1162  C CD1 . ILE A 1 176 ? -0.652  38.981  -0.363  1.00 27.48 ? 175 ILE A CD1 1 
ATOM   1163  N N   . VAL A 1 177 ? -3.351  34.711  -2.123  1.00 26.86 ? 176 VAL A N   1 
ATOM   1164  C CA  . VAL A 1 177 ? -4.326  33.655  -1.836  1.00 27.08 ? 176 VAL A CA  1 
ATOM   1165  C C   . VAL A 1 177 ? -3.618  32.314  -1.556  1.00 27.46 ? 176 VAL A C   1 
ATOM   1166  O O   . VAL A 1 177 ? -4.127  31.466  -0.827  1.00 26.48 ? 176 VAL A O   1 
ATOM   1167  C CB  . VAL A 1 177 ? -5.341  33.506  -3.018  1.00 26.93 ? 176 VAL A CB  1 
ATOM   1168  C CG1 . VAL A 1 177 ? -6.289  32.384  -2.782  1.00 26.72 ? 176 VAL A CG1 1 
ATOM   1169  C CG2 . VAL A 1 177 ? -6.123  34.804  -3.226  1.00 26.75 ? 176 VAL A CG2 1 
ATOM   1170  N N   . HIS A 1 178 ? -2.448  32.137  -2.153  1.00 28.31 ? 177 HIS A N   1 
ATOM   1171  C CA  . HIS A 1 178 ? -1.680  30.916  -2.007  1.00 29.31 ? 177 HIS A CA  1 
ATOM   1172  C C   . HIS A 1 178 ? -0.637  30.975  -0.881  1.00 30.84 ? 177 HIS A C   1 
ATOM   1173  O O   . HIS A 1 178 ? 0.155   30.043  -0.738  1.00 31.07 ? 177 HIS A O   1 
ATOM   1174  C CB  . HIS A 1 178 ? -0.963  30.582  -3.317  1.00 29.02 ? 177 HIS A CB  1 
ATOM   1175  C CG  . HIS A 1 178 ? -1.885  30.224  -4.437  1.00 28.09 ? 177 HIS A CG  1 
ATOM   1176  N ND1 . HIS A 1 178 ? -1.567  30.443  -5.759  1.00 27.83 ? 177 HIS A ND1 1 
ATOM   1177  C CD2 . HIS A 1 178 ? -3.107  29.646  -4.432  1.00 27.43 ? 177 HIS A CD2 1 
ATOM   1178  C CE1 . HIS A 1 178 ? -2.555  30.015  -6.519  1.00 28.02 ? 177 HIS A CE1 1 
ATOM   1179  N NE2 . HIS A 1 178 ? -3.502  29.530  -5.738  1.00 27.59 ? 177 HIS A NE2 1 
ATOM   1180  N N   . LYS A 1 179 ? -0.619  32.056  -0.104  1.00 32.51 ? 178 LYS A N   1 
ATOM   1181  C CA  . LYS A 1 179 ? 0.418   32.233  0.907   1.00 34.28 ? 178 LYS A CA  1 
ATOM   1182  C C   . LYS A 1 179 ? 0.226   31.196  2.000   1.00 35.69 ? 178 LYS A C   1 
ATOM   1183  O O   . LYS A 1 179 ? 1.188   30.574  2.468   1.00 36.17 ? 178 LYS A O   1 
ATOM   1184  C CB  . LYS A 1 179 ? 0.390   33.638  1.498   1.00 34.33 ? 178 LYS A CB  1 
ATOM   1185  C CG  . LYS A 1 179 ? 1.786   34.134  1.908   1.00 35.65 ? 178 LYS A CG  1 
ATOM   1186  C CD  . LYS A 1 179 ? 2.087   35.519  1.319   1.00 36.02 ? 178 LYS A CD  1 
ATOM   1187  C CE  . LYS A 1 179 ? 3.517   35.641  0.871   1.00 36.62 ? 178 LYS A CE  1 
ATOM   1188  N NZ  . LYS A 1 179 ? 3.577   36.408  -0.372  1.00 37.50 ? 178 LYS A NZ  1 
ATOM   1189  N N   . HIS A 1 180 ? -1.034  30.990  2.366   1.00 37.08 ? 179 HIS A N   1 
ATOM   1190  C CA  . HIS A 1 180 ? -1.402  29.936  3.297   1.00 37.90 ? 179 HIS A CA  1 
ATOM   1191  C C   . HIS A 1 180 ? -2.641  29.177  2.851   1.00 37.79 ? 179 HIS A C   1 
ATOM   1192  O O   . HIS A 1 180 ? -3.346  29.580  1.925   1.00 38.81 ? 179 HIS A O   1 
ATOM   1193  C CB  . HIS A 1 180 ? -1.627  30.547  4.673   1.00 38.39 ? 179 HIS A CB  1 
ATOM   1194  C CG  . HIS A 1 180 ? -0.401  31.196  5.226   1.00 40.36 ? 179 HIS A CG  1 
ATOM   1195  N ND1 . HIS A 1 180 ? -0.282  32.564  5.367   1.00 41.93 ? 179 HIS A ND1 1 
ATOM   1196  C CD2 . HIS A 1 180 ? 0.784   30.668  5.617   1.00 41.34 ? 179 HIS A CD2 1 
ATOM   1197  C CE1 . HIS A 1 180 ? 0.914   32.848  5.851   1.00 42.37 ? 179 HIS A CE1 1 
ATOM   1198  N NE2 . HIS A 1 180 ? 1.581   31.716  6.007   1.00 43.33 ? 179 HIS A NE2 1 
ATOM   1199  N N   . GLY A 1 181 ? -2.892  28.064  3.520   1.00 37.10 ? 180 GLY A N   1 
ATOM   1200  C CA  . GLY A 1 181 ? -4.110  27.315  3.302   1.00 36.53 ? 180 GLY A CA  1 
ATOM   1201  C C   . GLY A 1 181 ? -4.128  26.629  1.953   1.00 35.69 ? 180 GLY A C   1 
ATOM   1202  O O   . GLY A 1 181 ? -3.103  26.519  1.279   1.00 35.82 ? 180 GLY A O   1 
ATOM   1203  N N   . ASP A 1 182 ? -5.308  26.159  1.573   1.00 34.45 ? 181 ASP A N   1 
ATOM   1204  C CA  . ASP A 1 182 ? -5.496  25.490  0.305   1.00 33.74 ? 181 ASP A CA  1 
ATOM   1205  C C   . ASP A 1 182 ? -6.672  26.185  -0.364  1.00 31.48 ? 181 ASP A C   1 
ATOM   1206  O O   . ASP A 1 182 ? -7.824  25.798  -0.170  1.00 30.92 ? 181 ASP A O   1 
ATOM   1207  C CB  . ASP A 1 182 ? -5.766  24.003  0.556   1.00 34.27 ? 181 ASP A CB  1 
ATOM   1208  C CG  . ASP A 1 182 ? -5.913  23.201  -0.729  1.00 37.39 ? 181 ASP A CG  1 
ATOM   1209  O OD1 . ASP A 1 182 ? -5.054  23.356  -1.639  1.00 40.89 ? 181 ASP A OD1 1 
ATOM   1210  O OD2 . ASP A 1 182 ? -6.888  22.404  -0.812  1.00 40.29 ? 181 ASP A OD2 1 
ATOM   1211  N N   . ILE A 1 183 ? -6.367  27.243  -1.122  1.00 29.29 ? 182 ILE A N   1 
ATOM   1212  C CA  . ILE A 1 183 ? -7.396  28.079  -1.744  1.00 27.30 ? 182 ILE A CA  1 
ATOM   1213  C C   . ILE A 1 183 ? -7.262  28.054  -3.256  1.00 25.80 ? 182 ILE A C   1 
ATOM   1214  O O   . ILE A 1 183 ? -6.167  28.240  -3.804  1.00 25.46 ? 182 ILE A O   1 
ATOM   1215  C CB  . ILE A 1 183 ? -7.340  29.539  -1.262  1.00 27.42 ? 182 ILE A CB  1 
ATOM   1216  C CG1 . ILE A 1 183 ? -7.330  29.603  0.271   1.00 27.56 ? 182 ILE A CG1 1 
ATOM   1217  C CG2 . ILE A 1 183 ? -8.516  30.321  -1.835  1.00 27.74 ? 182 ILE A CG2 1 
ATOM   1218  C CD1 . ILE A 1 183 ? -7.364  31.009  0.851   1.00 26.50 ? 182 ILE A CD1 1 
ATOM   1219  N N   . ILE A 1 184 ? -8.384  27.790  -3.924  1.00 23.86 ? 183 ILE A N   1 
ATOM   1220  C CA  . ILE A 1 184 ? -8.423  27.750  -5.377  1.00 22.17 ? 183 ILE A CA  1 
ATOM   1221  C C   . ILE A 1 184 ? -8.639  29.187  -5.841  1.00 21.08 ? 183 ILE A C   1 
ATOM   1222  O O   . ILE A 1 184 ? -9.564  29.843  -5.380  1.00 19.97 ? 183 ILE A O   1 
ATOM   1223  C CB  . ILE A 1 184 ? -9.569  26.826  -5.894  1.00 22.22 ? 183 ILE A CB  1 
ATOM   1224  C CG1 . ILE A 1 184 ? -9.335  25.362  -5.468  1.00 22.24 ? 183 ILE A CG1 1 
ATOM   1225  C CG2 . ILE A 1 184 ? -9.684  26.912  -7.400  1.00 20.59 ? 183 ILE A CG2 1 
ATOM   1226  C CD1 . ILE A 1 184 ? -10.597 24.525  -5.355  1.00 20.80 ? 183 ILE A CD1 1 
ATOM   1227  N N   . LEU A 1 185 ? -7.759  29.679  -6.716  1.00 20.22 ? 184 LEU A N   1 
ATOM   1228  C CA  . LEU A 1 185 ? -7.959  30.991  -7.365  1.00 19.58 ? 184 LEU A CA  1 
ATOM   1229  C C   . LEU A 1 185 ? -8.500  30.784  -8.791  1.00 18.52 ? 184 LEU A C   1 
ATOM   1230  O O   . LEU A 1 185 ? -7.791  30.273  -9.649  1.00 17.11 ? 184 LEU A O   1 
ATOM   1231  C CB  . LEU A 1 185 ? -6.651  31.807  -7.418  1.00 18.98 ? 184 LEU A CB  1 
ATOM   1232  C CG  . LEU A 1 185 ? -6.638  33.166  -8.161  1.00 20.17 ? 184 LEU A CG  1 
ATOM   1233  C CD1 . LEU A 1 185 ? -7.713  34.123  -7.692  1.00 18.64 ? 184 LEU A CD1 1 
ATOM   1234  C CD2 . LEU A 1 185 ? -5.274  33.836  -8.061  1.00 19.87 ? 184 LEU A CD2 1 
ATOM   1235  N N   . VAL A 1 186 ? -9.748  31.208  -9.017  1.00 18.44 ? 185 VAL A N   1 
ATOM   1236  C CA  . VAL A 1 186 ? -10.349 31.209  -10.343 1.00 17.90 ? 185 VAL A CA  1 
ATOM   1237  C C   . VAL A 1 186 ? -10.284 32.588  -10.956 1.00 17.25 ? 185 VAL A C   1 
ATOM   1238  O O   . VAL A 1 186 ? -10.680 33.564  -10.327 1.00 17.72 ? 185 VAL A O   1 
ATOM   1239  C CB  . VAL A 1 186 ? -11.860 30.847  -10.331 1.00 18.15 ? 185 VAL A CB  1 
ATOM   1240  C CG1 . VAL A 1 186 ? -12.447 31.003  -11.754 1.00 16.52 ? 185 VAL A CG1 1 
ATOM   1241  C CG2 . VAL A 1 186 ? -12.108 29.444  -9.772  1.00 18.25 ? 185 VAL A CG2 1 
ATOM   1242  N N   . VAL A 1 187 ? -9.791  32.656  -12.184 1.00 16.66 ? 186 VAL A N   1 
ATOM   1243  C CA  . VAL A 1 187 ? -9.979  33.822  -13.018 1.00 15.67 ? 186 VAL A CA  1 
ATOM   1244  C C   . VAL A 1 187 ? -10.928 33.496  -14.189 1.00 14.91 ? 186 VAL A C   1 
ATOM   1245  O O   . VAL A 1 187 ? -10.602 32.703  -15.084 1.00 15.74 ? 186 VAL A O   1 
ATOM   1246  C CB  . VAL A 1 187 ? -8.656  34.347  -13.570 1.00 16.07 ? 186 VAL A CB  1 
ATOM   1247  C CG1 . VAL A 1 187 ? -8.916  35.541  -14.479 1.00 13.83 ? 186 VAL A CG1 1 
ATOM   1248  C CG2 . VAL A 1 187 ? -7.686  34.718  -12.413 1.00 16.05 ? 186 VAL A CG2 1 
ATOM   1249  N N   . ASP A 1 188 ? -12.089 34.135  -14.169 1.00 13.84 ? 187 ASP A N   1 
ATOM   1250  C CA  . ASP A 1 188 ? -13.005 34.170  -15.302 1.00 13.31 ? 187 ASP A CA  1 
ATOM   1251  C C   . ASP A 1 188 ? -12.391 35.124  -16.335 1.00 13.64 ? 187 ASP A C   1 
ATOM   1252  O O   . ASP A 1 188 ? -12.446 36.358  -16.162 1.00 13.98 ? 187 ASP A O   1 
ATOM   1253  C CB  . ASP A 1 188 ? -14.362 34.691  -14.821 1.00 13.22 ? 187 ASP A CB  1 
ATOM   1254  C CG  . ASP A 1 188 ? -15.417 34.705  -15.908 1.00 10.97 ? 187 ASP A CG  1 
ATOM   1255  O OD1 . ASP A 1 188 ? -15.093 34.861  -17.098 1.00 13.37 ? 187 ASP A OD1 1 
ATOM   1256  O OD2 . ASP A 1 188 ? -16.593 34.626  -15.559 1.00 10.73 ? 187 ASP A OD2 1 
ATOM   1257  N N   . ASN A 1 189 ? -11.829 34.528  -17.393 1.00 13.35 ? 188 ASN A N   1 
ATOM   1258  C CA  . ASN A 1 189 ? -11.070 35.195  -18.455 1.00 13.25 ? 188 ASN A CA  1 
ATOM   1259  C C   . ASN A 1 189 ? -11.914 35.447  -19.718 1.00 13.35 ? 188 ASN A C   1 
ATOM   1260  O O   . ASN A 1 189 ? -11.367 35.674  -20.806 1.00 13.57 ? 188 ASN A O   1 
ATOM   1261  C CB  . ASN A 1 189 ? -9.857  34.296  -18.804 1.00 13.22 ? 188 ASN A CB  1 
ATOM   1262  C CG  . ASN A 1 189 ? -8.724  35.043  -19.479 1.00 13.45 ? 188 ASN A CG  1 
ATOM   1263  O OD1 . ASN A 1 189 ? -8.465  36.198  -19.170 1.00 15.04 ? 188 ASN A OD1 1 
ATOM   1264  N ND2 . ASN A 1 189 ? -8.041  34.384  -20.402 1.00 12.89 ? 188 ASN A ND2 1 
ATOM   1265  N N   . THR A 1 190 ? -13.240 35.436  -19.551 1.00 13.53 ? 189 THR A N   1 
ATOM   1266  C CA  . THR A 1 190 ? -14.201 35.635  -20.639 1.00 14.04 ? 189 THR A CA  1 
ATOM   1267  C C   . THR A 1 190 ? -13.922 36.855  -21.500 1.00 14.89 ? 189 THR A C   1 
ATOM   1268  O O   . THR A 1 190 ? -13.917 36.734  -22.719 1.00 15.84 ? 189 THR A O   1 
ATOM   1269  C CB  . THR A 1 190 ? -15.650 35.744  -20.096 1.00 14.32 ? 189 THR A CB  1 
ATOM   1270  O OG1 . THR A 1 190 ? -15.986 34.543  -19.420 1.00 11.58 ? 189 THR A OG1 1 
ATOM   1271  C CG2 . THR A 1 190 ? -16.667 35.976  -21.210 1.00 12.84 ? 189 THR A CG2 1 
ATOM   1272  N N   . PHE A 1 191 ? -13.688 38.003  -20.867 1.00 15.26 ? 190 PHE A N   1 
ATOM   1273  C CA  . PHE A 1 191 ? -13.492 39.287  -21.560 1.00 15.78 ? 190 PHE A CA  1 
ATOM   1274  C C   . PHE A 1 191 ? -12.222 39.380  -22.373 1.00 15.75 ? 190 PHE A C   1 
ATOM   1275  O O   . PHE A 1 191 ? -12.219 39.961  -23.469 1.00 17.28 ? 190 PHE A O   1 
ATOM   1276  C CB  . PHE A 1 191 ? -13.477 40.459  -20.556 1.00 15.82 ? 190 PHE A CB  1 
ATOM   1277  C CG  . PHE A 1 191 ? -14.799 41.145  -20.382 1.00 15.78 ? 190 PHE A CG  1 
ATOM   1278  C CD1 . PHE A 1 191 ? -15.998 40.433  -20.432 1.00 16.47 ? 190 PHE A CD1 1 
ATOM   1279  C CD2 . PHE A 1 191 ? -14.848 42.517  -20.121 1.00 18.09 ? 190 PHE A CD2 1 
ATOM   1280  C CE1 . PHE A 1 191 ? -17.213 41.092  -20.257 1.00 17.38 ? 190 PHE A CE1 1 
ATOM   1281  C CE2 . PHE A 1 191 ? -16.058 43.166  -19.940 1.00 17.31 ? 190 PHE A CE2 1 
ATOM   1282  C CZ  . PHE A 1 191 ? -17.242 42.455  -20.005 1.00 16.36 ? 190 PHE A CZ  1 
ATOM   1283  N N   . MET A 1 192 ? -11.137 38.841  -21.833 1.00 15.03 ? 191 MET A N   1 
ATOM   1284  C CA  . MET A 1 192 ? -9.841  38.953  -22.476 1.00 14.09 ? 191 MET A CA  1 
ATOM   1285  C C   . MET A 1 192 ? -9.574  37.890  -23.556 1.00 13.83 ? 191 MET A C   1 
ATOM   1286  O O   . MET A 1 192 ? -9.050  38.227  -24.631 1.00 14.16 ? 191 MET A O   1 
ATOM   1287  C CB  . MET A 1 192 ? -8.728  38.976  -21.418 1.00 14.37 ? 191 MET A CB  1 
ATOM   1288  C CG  . MET A 1 192 ? -8.786  40.168  -20.495 1.00 14.66 ? 191 MET A CG  1 
ATOM   1289  S SD  . MET A 1 192 ? -8.811  41.762  -21.325 1.00 16.71 ? 191 MET A SD  1 
ATOM   1290  C CE  . MET A 1 192 ? -7.202  41.730  -22.136 1.00 17.06 ? 191 MET A CE  1 
ATOM   1291  N N   . SER A 1 193 ? -9.970  36.639  -23.298 1.00 13.55 ? 192 SER A N   1 
ATOM   1292  C CA  . SER A 1 193 ? -9.532  35.452  -24.062 1.00 13.07 ? 192 SER A CA  1 
ATOM   1293  C C   . SER A 1 193 ? -8.057  35.184  -23.745 1.00 13.26 ? 192 SER A C   1 
ATOM   1294  O O   . SER A 1 193 ? -7.331  36.095  -23.345 1.00 11.83 ? 192 SER A O   1 
ATOM   1295  C CB  . SER A 1 193 ? -9.764  35.583  -25.583 1.00 13.56 ? 192 SER A CB  1 
ATOM   1296  O OG  . SER A 1 193 ? -8.666  36.187  -26.271 1.00 13.21 ? 192 SER A OG  1 
ATOM   1297  N N   . PRO A 1 194 ? -7.599  33.939  -23.968 1.00 13.72 ? 193 PRO A N   1 
ATOM   1298  C CA  . PRO A 1 194 ? -6.197  33.612  -23.735 1.00 13.44 ? 193 PRO A CA  1 
ATOM   1299  C C   . PRO A 1 194 ? -5.254  34.213  -24.749 1.00 13.48 ? 193 PRO A C   1 
ATOM   1300  O O   . PRO A 1 194 ? -4.036  34.078  -24.631 1.00 13.28 ? 193 PRO A O   1 
ATOM   1301  C CB  . PRO A 1 194 ? -6.179  32.089  -23.812 1.00 13.94 ? 193 PRO A CB  1 
ATOM   1302  C CG  . PRO A 1 194 ? -7.322  31.739  -24.696 1.00 14.51 ? 193 PRO A CG  1 
ATOM   1303  C CD  . PRO A 1 194 ? -8.372  32.774  -24.440 1.00 13.81 ? 193 PRO A CD  1 
ATOM   1304  N N   . TYR A 1 195 ? -5.800  34.854  -25.773 1.00 12.80 ? 194 TYR A N   1 
ATOM   1305  C CA  . TYR A 1 195 ? -4.969  35.510  -26.741 1.00 12.33 ? 194 TYR A CA  1 
ATOM   1306  C C   . TYR A 1 195 ? -4.348  36.698  -26.032 1.00 12.25 ? 194 TYR A C   1 
ATOM   1307  O O   . TYR A 1 195 ? -3.195  37.031  -26.304 1.00 13.24 ? 194 TYR A O   1 
ATOM   1308  C CB  . TYR A 1 195 ? -5.776  35.957  -27.969 1.00 11.79 ? 194 TYR A CB  1 
ATOM   1309  C CG  . TYR A 1 195 ? -4.925  36.566  -29.037 1.00 12.06 ? 194 TYR A CG  1 
ATOM   1310  C CD1 . TYR A 1 195 ? -4.032  35.790  -29.768 1.00 11.10 ? 194 TYR A CD1 1 
ATOM   1311  C CD2 . TYR A 1 195 ? -5.015  37.920  -29.336 1.00 12.59 ? 194 TYR A CD2 1 
ATOM   1312  C CE1 . TYR A 1 195 ? -3.262  36.343  -30.749 1.00 11.06 ? 194 TYR A CE1 1 
ATOM   1313  C CE2 . TYR A 1 195 ? -4.230  38.482  -30.302 1.00 13.24 ? 194 TYR A CE2 1 
ATOM   1314  C CZ  . TYR A 1 195 ? -3.351  37.687  -31.004 1.00 12.16 ? 194 TYR A CZ  1 
ATOM   1315  O OH  . TYR A 1 195 ? -2.590  38.243  -31.980 1.00 12.01 ? 194 TYR A OH  1 
ATOM   1316  N N   . PHE A 1 196 ? -5.114  37.326  -25.134 1.00 12.11 ? 195 PHE A N   1 
ATOM   1317  C CA  . PHE A 1 196 ? -4.671  38.562  -24.487 1.00 12.36 ? 195 PHE A CA  1 
ATOM   1318  C C   . PHE A 1 196 ? -4.234  38.402  -23.036 1.00 13.53 ? 195 PHE A C   1 
ATOM   1319  O O   . PHE A 1 196 ? -3.472  39.226  -22.522 1.00 13.35 ? 195 PHE A O   1 
ATOM   1320  C CB  . PHE A 1 196 ? -5.730  39.659  -24.586 1.00 12.19 ? 195 PHE A CB  1 
ATOM   1321  C CG  . PHE A 1 196 ? -5.862  40.269  -25.956 1.00 11.02 ? 195 PHE A CG  1 
ATOM   1322  C CD1 . PHE A 1 196 ? -7.117  40.498  -26.511 1.00 12.02 ? 195 PHE A CD1 1 
ATOM   1323  C CD2 . PHE A 1 196 ? -4.749  40.643  -26.674 1.00 10.73 ? 195 PHE A CD2 1 
ATOM   1324  C CE1 . PHE A 1 196 ? -7.236  41.063  -27.746 1.00 11.47 ? 195 PHE A CE1 1 
ATOM   1325  C CE2 . PHE A 1 196 ? -4.853  41.208  -27.909 1.00 13.27 ? 195 PHE A CE2 1 
ATOM   1326  C CZ  . PHE A 1 196 ? -6.097  41.418  -28.461 1.00 12.83 ? 195 PHE A CZ  1 
ATOM   1327  N N   . GLN A 1 197 ? -4.722  37.360  -22.375 1.00 14.27 ? 196 GLN A N   1 
ATOM   1328  C CA  . GLN A 1 197 ? -4.403  37.157  -20.980 1.00 15.01 ? 196 GLN A CA  1 
ATOM   1329  C C   . GLN A 1 197 ? -4.410  35.674  -20.609 1.00 15.02 ? 196 GLN A C   1 
ATOM   1330  O O   . GLN A 1 197 ? -5.375  34.971  -20.886 1.00 15.09 ? 196 GLN A O   1 
ATOM   1331  C CB  . GLN A 1 197 ? -5.416  37.923  -20.145 1.00 14.85 ? 196 GLN A CB  1 
ATOM   1332  C CG  . GLN A 1 197 ? -5.249  37.807  -18.653 1.00 16.20 ? 196 GLN A CG  1 
ATOM   1333  C CD  . GLN A 1 197 ? -6.167  38.750  -17.927 1.00 15.64 ? 196 GLN A CD  1 
ATOM   1334  O OE1 . GLN A 1 197 ? -5.751  39.830  -17.515 1.00 17.23 ? 196 GLN A OE1 1 
ATOM   1335  N NE2 . GLN A 1 197 ? -7.433  38.358  -17.772 1.00 12.56 ? 196 GLN A NE2 1 
ATOM   1336  N N   . ARG A 1 198 ? -3.333  35.226  -19.972 1.00 15.24 ? 197 ARG A N   1 
ATOM   1337  C CA  . ARG A 1 198 ? -3.188  33.838  -19.504 1.00 15.97 ? 197 ARG A CA  1 
ATOM   1338  C C   . ARG A 1 198 ? -3.082  33.747  -17.979 1.00 15.74 ? 197 ARG A C   1 
ATOM   1339  O O   . ARG A 1 198 ? -1.967  33.696  -17.445 1.00 14.97 ? 197 ARG A O   1 
ATOM   1340  C CB  . ARG A 1 198 ? -1.963  33.197  -20.148 1.00 16.19 ? 197 ARG A CB  1 
ATOM   1341  C CG  . ARG A 1 198 ? -2.257  32.456  -21.428 1.00 18.01 ? 197 ARG A CG  1 
ATOM   1342  C CD  . ARG A 1 198 ? -0.993  32.039  -22.111 1.00 16.15 ? 197 ARG A CD  1 
ATOM   1343  N NE  . ARG A 1 198 ? -1.308  31.327  -23.332 1.00 16.76 ? 197 ARG A NE  1 
ATOM   1344  C CZ  . ARG A 1 198 ? -0.403  30.873  -24.168 1.00 16.55 ? 197 ARG A CZ  1 
ATOM   1345  N NH1 . ARG A 1 198 ? 0.882   31.044  -23.901 1.00 19.65 ? 197 ARG A NH1 1 
ATOM   1346  N NH2 . ARG A 1 198 ? -0.775  30.218  -25.249 1.00 18.69 ? 197 ARG A NH2 1 
ATOM   1347  N N   . PRO A 1 199 ? -4.244  33.700  -17.277 1.00 15.72 ? 198 PRO A N   1 
ATOM   1348  C CA  . PRO A 1 199 ? -4.290  33.655  -15.807 1.00 15.68 ? 198 PRO A CA  1 
ATOM   1349  C C   . PRO A 1 199 ? -3.481  32.531  -15.165 1.00 16.37 ? 198 PRO A C   1 
ATOM   1350  O O   . PRO A 1 199 ? -2.936  32.734  -14.072 1.00 15.79 ? 198 PRO A O   1 
ATOM   1351  C CB  . PRO A 1 199 ? -5.775  33.464  -15.511 1.00 15.87 ? 198 PRO A CB  1 
ATOM   1352  C CG  . PRO A 1 199 ? -6.474  34.033  -16.710 1.00 14.51 ? 198 PRO A CG  1 
ATOM   1353  C CD  . PRO A 1 199 ? -5.607  33.701  -17.850 1.00 15.85 ? 198 PRO A CD  1 
ATOM   1354  N N   . LEU A 1 200 ? -3.418  31.362  -15.821 1.00 16.32 ? 199 LEU A N   1 
ATOM   1355  C CA  . LEU A 1 200 ? -2.581  30.253  -15.319 1.00 16.36 ? 199 LEU A CA  1 
ATOM   1356  C C   . LEU A 1 200 ? -1.101  30.627  -15.327 1.00 17.05 ? 199 LEU A C   1 
ATOM   1357  O O   . LEU A 1 200 ? -0.366  30.259  -14.428 1.00 17.37 ? 199 LEU A O   1 
ATOM   1358  C CB  . LEU A 1 200 ? -2.816  28.967  -16.100 1.00 16.16 ? 199 LEU A CB  1 
ATOM   1359  C CG  . LEU A 1 200 ? -4.207  28.316  -15.984 1.00 15.61 ? 199 LEU A CG  1 
ATOM   1360  C CD1 . LEU A 1 200 ? -4.266  27.098  -16.900 1.00 15.44 ? 199 LEU A CD1 1 
ATOM   1361  C CD2 . LEU A 1 200 ? -4.519  27.919  -14.561 1.00 14.07 ? 199 LEU A CD2 1 
ATOM   1362  N N   . ALA A 1 201 ? -0.667  31.384  -16.327 1.00 18.28 ? 200 ALA A N   1 
ATOM   1363  C CA  . ALA A 1 201 ? 0.725   31.843  -16.390 1.00 18.66 ? 200 ALA A CA  1 
ATOM   1364  C C   . ALA A 1 201 ? 1.023   32.807  -15.264 1.00 18.75 ? 200 ALA A C   1 
ATOM   1365  O O   . ALA A 1 201 ? 2.175   32.945  -14.835 1.00 20.04 ? 200 ALA A O   1 
ATOM   1366  C CB  . ALA A 1 201 ? 1.026   32.496  -17.748 1.00 18.16 ? 200 ALA A CB  1 
ATOM   1367  N N   . LEU A 1 202 ? -0.009  33.477  -14.772 1.00 18.93 ? 201 LEU A N   1 
ATOM   1368  C CA  . LEU A 1 202 ? 0.147   34.467  -13.698 1.00 19.05 ? 201 LEU A CA  1 
ATOM   1369  C C   . LEU A 1 202 ? -0.151  33.891  -12.307 1.00 18.91 ? 201 LEU A C   1 
ATOM   1370  O O   . LEU A 1 202 ? -0.181  34.620  -11.328 1.00 19.69 ? 201 LEU A O   1 
ATOM   1371  C CB  . LEU A 1 202 ? -0.770  35.668  -13.964 1.00 18.64 ? 201 LEU A CB  1 
ATOM   1372  C CG  . LEU A 1 202 ? -0.600  36.438  -15.272 1.00 18.89 ? 201 LEU A CG  1 
ATOM   1373  C CD1 . LEU A 1 202 ? -1.900  37.122  -15.714 1.00 15.22 ? 201 LEU A CD1 1 
ATOM   1374  C CD2 . LEU A 1 202 ? 0.533   37.452  -15.166 1.00 19.39 ? 201 LEU A CD2 1 
ATOM   1375  N N   . GLY A 1 203 ? -0.386  32.582  -12.205 1.00 18.71 ? 202 GLY A N   1 
ATOM   1376  C CA  . GLY A 1 203 ? -0.536  31.951  -10.894 1.00 17.40 ? 202 GLY A CA  1 
ATOM   1377  C C   . GLY A 1 203 ? -1.944  31.553  -10.512 1.00 17.03 ? 202 GLY A C   1 
ATOM   1378  O O   . GLY A 1 203 ? -2.164  31.044  -9.409  1.00 15.85 ? 202 GLY A O   1 
ATOM   1379  N N   . ALA A 1 204 ? -2.921  31.814  -11.386 1.00 16.05 ? 203 ALA A N   1 
ATOM   1380  C CA  . ALA A 1 204 ? -4.284  31.361  -11.102 1.00 16.09 ? 203 ALA A CA  1 
ATOM   1381  C C   . ALA A 1 204 ? -4.279  29.841  -11.154 1.00 15.22 ? 203 ALA A C   1 
ATOM   1382  O O   . ALA A 1 204 ? -3.428  29.252  -11.799 1.00 14.69 ? 203 ALA A O   1 
ATOM   1383  C CB  . ALA A 1 204 ? -5.292  31.935  -12.101 1.00 15.38 ? 203 ALA A CB  1 
ATOM   1384  N N   . ASP A 1 205 ? -5.213  29.218  -10.454 1.00 15.94 ? 204 ASP A N   1 
ATOM   1385  C CA  . ASP A 1 205 ? -5.333  27.753  -10.467 1.00 16.15 ? 204 ASP A CA  1 
ATOM   1386  C C   . ASP A 1 205 ? -6.273  27.276  -11.573 1.00 16.16 ? 204 ASP A C   1 
ATOM   1387  O O   . ASP A 1 205 ? -6.159  26.146  -12.053 1.00 15.46 ? 204 ASP A O   1 
ATOM   1388  C CB  . ASP A 1 205 ? -5.826  27.260  -9.112  1.00 16.08 ? 204 ASP A CB  1 
ATOM   1389  C CG  . ASP A 1 205 ? -4.861  27.592  -8.011  1.00 17.95 ? 204 ASP A CG  1 
ATOM   1390  O OD1 . ASP A 1 205 ? -3.700  27.110  -8.110  1.00 20.11 ? 204 ASP A OD1 1 
ATOM   1391  O OD2 . ASP A 1 205 ? -5.244  28.371  -7.113  1.00 18.25 ? 204 ASP A OD2 1 
ATOM   1392  N N   . ILE A 1 206 ? -7.210  28.152  -11.933 1.00 16.15 ? 205 ILE A N   1 
ATOM   1393  C CA  . ILE A 1 206 ? -8.229  27.889  -12.938 1.00 16.10 ? 205 ILE A CA  1 
ATOM   1394  C C   . ILE A 1 206 ? -8.425  29.149  -13.788 1.00 15.95 ? 205 ILE A C   1 
ATOM   1395  O O   . ILE A 1 206 ? -8.637  30.235  -13.245 1.00 15.85 ? 205 ILE A O   1 
ATOM   1396  C CB  . ILE A 1 206 ? -9.585  27.527  -12.272 1.00 16.25 ? 205 ILE A CB  1 
ATOM   1397  C CG1 . ILE A 1 206 ? -9.509  26.143  -11.617 1.00 16.64 ? 205 ILE A CG1 1 
ATOM   1398  C CG2 . ILE A 1 206 ? -10.724 27.590  -13.302 1.00 17.06 ? 205 ILE A CG2 1 
ATOM   1399  C CD1 . ILE A 1 206 ? -10.761 25.715  -10.786 1.00 15.72 ? 205 ILE A CD1 1 
ATOM   1400  N N   . SER A 1 207 ? -8.317  28.977  -15.111 1.00 15.72 ? 206 SER A N   1 
ATOM   1401  C CA  . SER A 1 207 ? -8.722  29.955  -16.120 1.00 16.05 ? 206 SER A CA  1 
ATOM   1402  C C   . SER A 1 207 ? -10.050 29.495  -16.767 1.00 16.01 ? 206 SER A C   1 
ATOM   1403  O O   . SER A 1 207 ? -10.106 28.451  -17.433 1.00 15.93 ? 206 SER A O   1 
ATOM   1404  C CB  . SER A 1 207 ? -7.633  30.088  -17.177 1.00 16.25 ? 206 SER A CB  1 
ATOM   1405  O OG  . SER A 1 207 ? -7.948  31.107  -18.089 1.00 16.54 ? 206 SER A OG  1 
ATOM   1406  N N   . MET A 1 208 ? -11.114 30.256  -16.506 1.00 16.12 ? 207 MET A N   1 
ATOM   1407  C CA  . MET A 1 208 ? -12.486 29.886  -16.871 1.00 15.70 ? 207 MET A CA  1 
ATOM   1408  C C   . MET A 1 208 ? -13.053 30.868  -17.918 1.00 15.36 ? 207 MET A C   1 
ATOM   1409  O O   . MET A 1 208 ? -12.639 32.041  -17.980 1.00 15.17 ? 207 MET A O   1 
ATOM   1410  C CB  . MET A 1 208 ? -13.338 29.824  -15.579 1.00 15.73 ? 207 MET A CB  1 
ATOM   1411  C CG  . MET A 1 208 ? -14.850 29.721  -15.752 1.00 16.48 ? 207 MET A CG  1 
ATOM   1412  S SD  . MET A 1 208 ? -15.666 31.324  -16.020 1.00 15.50 ? 207 MET A SD  1 
ATOM   1413  C CE  . MET A 1 208 ? -17.376 30.776  -16.206 1.00 16.62 ? 207 MET A CE  1 
ATOM   1414  N N   . TYR A 1 209 ? -13.964 30.364  -18.773 1.00 14.40 ? 208 TYR A N   1 
ATOM   1415  C CA  . TYR A 1 209 ? -14.660 31.171  -19.753 1.00 13.02 ? 208 TYR A CA  1 
ATOM   1416  C C   . TYR A 1 209 ? -16.143 30.859  -19.861 1.00 12.33 ? 208 TYR A C   1 
ATOM   1417  O O   . TYR A 1 209 ? -16.572 29.694  -19.782 1.00 11.28 ? 208 TYR A O   1 
ATOM   1418  C CB  . TYR A 1 209 ? -14.090 30.931  -21.157 1.00 13.66 ? 208 TYR A CB  1 
ATOM   1419  C CG  . TYR A 1 209 ? -12.611 31.103  -21.248 1.00 14.36 ? 208 TYR A CG  1 
ATOM   1420  C CD1 . TYR A 1 209 ? -11.754 30.054  -20.972 1.00 13.86 ? 208 TYR A CD1 1 
ATOM   1421  C CD2 . TYR A 1 209 ? -12.067 32.331  -21.564 1.00 15.20 ? 208 TYR A CD2 1 
ATOM   1422  C CE1 . TYR A 1 209 ? -10.407 30.223  -21.031 1.00 15.02 ? 208 TYR A CE1 1 
ATOM   1423  C CE2 . TYR A 1 209 ? -10.721 32.502  -21.644 1.00 14.78 ? 208 TYR A CE2 1 
ATOM   1424  C CZ  . TYR A 1 209 ? -9.895  31.454  -21.372 1.00 14.89 ? 208 TYR A CZ  1 
ATOM   1425  O OH  . TYR A 1 209 ? -8.539  31.661  -21.437 1.00 14.59 ? 208 TYR A OH  1 
ATOM   1426  N N   . SER A 1 210 ? -16.909 31.915  -20.113 1.00 11.48 ? 209 SER A N   1 
ATOM   1427  C CA  . SER A 1 210 ? -18.150 31.779  -20.870 1.00 11.10 ? 209 SER A CA  1 
ATOM   1428  C C   . SER A 1 210 ? -17.662 31.804  -22.300 1.00 10.97 ? 209 SER A C   1 
ATOM   1429  O O   . SER A 1 210 ? -17.295 32.865  -22.841 1.00 10.88 ? 209 SER A O   1 
ATOM   1430  C CB  . SER A 1 210 ? -19.103 32.929  -20.607 1.00 10.99 ? 209 SER A CB  1 
ATOM   1431  O OG  . SER A 1 210 ? -20.191 32.862  -21.523 1.00 11.44 ? 209 SER A OG  1 
ATOM   1432  N N   . ALA A 1 211 ? -17.553 30.614  -22.869 1.00 10.99 ? 210 ALA A N   1 
ATOM   1433  C CA  . ALA A 1 211 ? -17.164 30.446  -24.259 1.00 10.83 ? 210 ALA A CA  1 
ATOM   1434  C C   . ALA A 1 211 ? -18.204 31.056  -25.201 1.00 10.47 ? 210 ALA A C   1 
ATOM   1435  O O   . ALA A 1 211 ? -17.914 31.356  -26.357 1.00 10.67 ? 210 ALA A O   1 
ATOM   1436  C CB  . ALA A 1 211 ? -16.964 28.993  -24.556 1.00 10.99 ? 210 ALA A CB  1 
ATOM   1437  N N   . THR A 1 212 ? -19.412 31.255  -24.678 1.00 9.98  ? 211 THR A N   1 
ATOM   1438  C CA  . THR A 1 212 ? -20.508 31.928  -25.366 1.00 8.79  ? 211 THR A CA  1 
ATOM   1439  C C   . THR A 1 212 ? -20.150 33.293  -25.948 1.00 9.60  ? 211 THR A C   1 
ATOM   1440  O O   . THR A 1 212 ? -20.834 33.770  -26.886 1.00 8.71  ? 211 THR A O   1 
ATOM   1441  C CB  . THR A 1 212 ? -21.641 32.085  -24.373 1.00 8.58  ? 211 THR A CB  1 
ATOM   1442  O OG1 . THR A 1 212 ? -21.791 30.836  -23.683 1.00 7.65  ? 211 THR A OG1 1 
ATOM   1443  C CG2 . THR A 1 212 ? -22.958 32.516  -25.042 1.00 5.84  ? 211 THR A CG2 1 
ATOM   1444  N N   . LYS A 1 213 ? -19.094 33.910  -25.379 1.00 10.32 ? 212 LYS A N   1 
ATOM   1445  C CA  . LYS A 1 213 ? -18.646 35.246  -25.742 1.00 10.45 ? 212 LYS A CA  1 
ATOM   1446  C C   . LYS A 1 213 ? -17.505 35.156  -26.790 1.00 10.57 ? 212 LYS A C   1 
ATOM   1447  O O   . LYS A 1 213 ? -17.737 34.645  -27.897 1.00 11.46 ? 212 LYS A O   1 
ATOM   1448  C CB  . LYS A 1 213 ? -18.277 36.022  -24.459 1.00 11.28 ? 212 LYS A CB  1 
ATOM   1449  C CG  . LYS A 1 213 ? -19.307 35.871  -23.315 1.00 12.68 ? 212 LYS A CG  1 
ATOM   1450  C CD  . LYS A 1 213 ? -20.746 36.199  -23.745 1.00 11.08 ? 212 LYS A CD  1 
ATOM   1451  C CE  . LYS A 1 213 ? -21.811 35.861  -22.699 1.00 14.27 ? 212 LYS A CE  1 
ATOM   1452  N NZ  . LYS A 1 213 ? -21.519 36.368  -21.319 1.00 17.31 ? 212 LYS A NZ  1 
ATOM   1453  N N   . TYR A 1 214 ? -16.304 35.638  -26.481 1.00 10.24 ? 213 TYR A N   1 
ATOM   1454  C CA  . TYR A 1 214 ? -15.208 35.717  -27.458 1.00 9.94  ? 213 TYR A CA  1 
ATOM   1455  C C   . TYR A 1 214 ? -14.683 34.381  -27.963 1.00 9.84  ? 213 TYR A C   1 
ATOM   1456  O O   . TYR A 1 214 ? -14.303 34.268  -29.121 1.00 10.33 ? 213 TYR A O   1 
ATOM   1457  C CB  . TYR A 1 214 ? -14.027 36.522  -26.882 1.00 10.01 ? 213 TYR A CB  1 
ATOM   1458  C CG  . TYR A 1 214 ? -14.245 38.036  -26.822 1.00 9.96  ? 213 TYR A CG  1 
ATOM   1459  C CD1 . TYR A 1 214 ? -14.348 38.701  -25.605 1.00 10.41 ? 213 TYR A CD1 1 
ATOM   1460  C CD2 . TYR A 1 214 ? -14.283 38.792  -27.985 1.00 10.73 ? 213 TYR A CD2 1 
ATOM   1461  C CE1 . TYR A 1 214 ? -14.526 40.101  -25.540 1.00 10.43 ? 213 TYR A CE1 1 
ATOM   1462  C CE2 . TYR A 1 214 ? -14.447 40.192  -27.944 1.00 9.52  ? 213 TYR A CE2 1 
ATOM   1463  C CZ  . TYR A 1 214 ? -14.579 40.835  -26.713 1.00 11.43 ? 213 TYR A CZ  1 
ATOM   1464  O OH  . TYR A 1 214 ? -14.738 42.214  -26.674 1.00 10.43 ? 213 TYR A OH  1 
ATOM   1465  N N   . MET A 1 215 ? -14.634 33.378  -27.095 1.00 10.41 ? 214 MET A N   1 
ATOM   1466  C CA  . MET A 1 215 ? -13.957 32.119  -27.438 1.00 9.88  ? 214 MET A CA  1 
ATOM   1467  C C   . MET A 1 215 ? -14.583 31.506  -28.690 1.00 10.27 ? 214 MET A C   1 
ATOM   1468  O O   . MET A 1 215 ? -13.884 31.216  -29.651 1.00 10.21 ? 214 MET A O   1 
ATOM   1469  C CB  . MET A 1 215 ? -14.005 31.123  -26.285 1.00 9.93  ? 214 MET A CB  1 
ATOM   1470  C CG  . MET A 1 215 ? -13.259 31.577  -25.048 1.00 12.64 ? 214 MET A CG  1 
ATOM   1471  S SD  . MET A 1 215 ? -11.484 31.694  -25.412 1.00 16.06 ? 214 MET A SD  1 
ATOM   1472  C CE  . MET A 1 215 ? -10.996 29.982  -25.303 1.00 16.62 ? 214 MET A CE  1 
ATOM   1473  N N   . ASN A 1 216 ? -15.895 31.302  -28.660 1.00 9.95  ? 215 ASN A N   1 
ATOM   1474  C CA  . ASN A 1 216 ? -16.627 30.935  -29.879 1.00 9.63  ? 215 ASN A CA  1 
ATOM   1475  C C   . ASN A 1 216 ? -16.722 32.123  -30.838 1.00 9.29  ? 215 ASN A C   1 
ATOM   1476  O O   . ASN A 1 216 ? -16.432 32.010  -32.022 1.00 10.27 ? 215 ASN A O   1 
ATOM   1477  C CB  . ASN A 1 216 ? -18.017 30.452  -29.519 1.00 9.36  ? 215 ASN A CB  1 
ATOM   1478  C CG  . ASN A 1 216 ? -18.821 30.077  -30.728 1.00 11.06 ? 215 ASN A CG  1 
ATOM   1479  O OD1 . ASN A 1 216 ? -18.445 29.165  -31.469 1.00 11.08 ? 215 ASN A OD1 1 
ATOM   1480  N ND2 . ASN A 1 216 ? -19.949 30.787  -30.951 1.00 8.80  ? 215 ASN A ND2 1 
ATOM   1481  N N   . GLY A 1 217 ? -17.178 33.258  -30.322 1.00 10.01 ? 216 GLY A N   1 
ATOM   1482  C CA  . GLY A 1 217 ? -17.118 34.537  -31.048 1.00 9.71  ? 216 GLY A CA  1 
ATOM   1483  C C   . GLY A 1 217 ? -18.123 34.732  -32.164 1.00 9.72  ? 216 GLY A C   1 
ATOM   1484  O O   . GLY A 1 217 ? -18.093 35.749  -32.863 1.00 10.23 ? 216 GLY A O   1 
ATOM   1485  N N   . HIS A 1 218 ? -19.020 33.772  -32.334 1.00 9.29  ? 217 HIS A N   1 
ATOM   1486  C CA  . HIS A 1 218 ? -19.976 33.788  -33.437 1.00 9.82  ? 217 HIS A CA  1 
ATOM   1487  C C   . HIS A 1 218 ? -21.435 33.791  -32.969 1.00 9.85  ? 217 HIS A C   1 
ATOM   1488  O O   . HIS A 1 218 ? -22.338 33.524  -33.741 1.00 9.42  ? 217 HIS A O   1 
ATOM   1489  C CB  . HIS A 1 218 ? -19.685 32.646  -34.423 1.00 10.33 ? 217 HIS A CB  1 
ATOM   1490  C CG  . HIS A 1 218 ? -18.402 32.826  -35.177 1.00 8.96  ? 217 HIS A CG  1 
ATOM   1491  N ND1 . HIS A 1 218 ? -17.173 32.582  -34.608 1.00 9.99  ? 217 HIS A ND1 1 
ATOM   1492  C CD2 . HIS A 1 218 ? -18.152 33.267  -36.439 1.00 9.77  ? 217 HIS A CD2 1 
ATOM   1493  C CE1 . HIS A 1 218 ? -16.220 32.826  -35.503 1.00 10.46 ? 217 HIS A CE1 1 
ATOM   1494  N NE2 . HIS A 1 218 ? -16.786 33.266  -36.612 1.00 8.66  ? 217 HIS A NE2 1 
ATOM   1495  N N   . SER A 1 219 ? -21.654 34.113  -31.704 1.00 10.08 ? 218 SER A N   1 
ATOM   1496  C CA  . SER A 1 219 ? -22.983 34.395  -31.201 1.00 10.68 ? 218 SER A CA  1 
ATOM   1497  C C   . SER A 1 219 ? -23.974 33.238  -31.446 1.00 10.59 ? 218 SER A C   1 
ATOM   1498  O O   . SER A 1 219 ? -25.155 33.474  -31.587 1.00 12.11 ? 218 SER A O   1 
ATOM   1499  C CB  . SER A 1 219 ? -23.510 35.721  -31.813 1.00 10.70 ? 218 SER A CB  1 
ATOM   1500  O OG  . SER A 1 219 ? -22.532 36.784  -31.738 1.00 12.22 ? 218 SER A OG  1 
ATOM   1501  N N   . ASP A 1 220 ? -23.493 31.996  -31.493 1.00 10.15 ? 219 ASP A N   1 
ATOM   1502  C CA  . ASP A 1 220 ? -24.350 30.885  -31.801 1.00 9.60  ? 219 ASP A CA  1 
ATOM   1503  C C   . ASP A 1 220 ? -24.060 29.610  -31.019 1.00 9.66  ? 219 ASP A C   1 
ATOM   1504  O O   . ASP A 1 220 ? -24.524 28.510  -31.410 1.00 9.53  ? 219 ASP A O   1 
ATOM   1505  C CB  . ASP A 1 220 ? -24.297 30.626  -33.324 1.00 9.51  ? 219 ASP A CB  1 
ATOM   1506  C CG  . ASP A 1 220 ? -22.934 30.167  -33.811 1.00 10.54 ? 219 ASP A CG  1 
ATOM   1507  O OD1 . ASP A 1 220 ? -22.837 29.780  -35.002 1.00 11.78 ? 219 ASP A OD1 1 
ATOM   1508  O OD2 . ASP A 1 220 ? -21.975 30.176  -33.028 1.00 10.80 ? 219 ASP A OD2 1 
ATOM   1509  N N   . VAL A 1 221 ? -23.312 29.740  -29.923 1.00 9.03  ? 220 VAL A N   1 
ATOM   1510  C CA  . VAL A 1 221 ? -23.027 28.614  -29.051 1.00 8.32  ? 220 VAL A CA  1 
ATOM   1511  C C   . VAL A 1 221 ? -23.035 29.112  -27.616 1.00 9.53  ? 220 VAL A C   1 
ATOM   1512  O O   . VAL A 1 221 ? -22.369 30.113  -27.280 1.00 10.03 ? 220 VAL A O   1 
ATOM   1513  C CB  . VAL A 1 221 ? -21.645 27.939  -29.379 1.00 8.44  ? 220 VAL A CB  1 
ATOM   1514  C CG1 . VAL A 1 221 ? -21.268 26.874  -28.313 1.00 6.21  ? 220 VAL A CG1 1 
ATOM   1515  C CG2 . VAL A 1 221 ? -21.644 27.338  -30.778 1.00 7.87  ? 220 VAL A CG2 1 
ATOM   1516  N N   . VAL A 1 222 ? -23.790 28.414  -26.765 1.00 9.78  ? 221 VAL A N   1 
ATOM   1517  C CA  . VAL A 1 222 ? -23.678 28.583  -25.315 1.00 9.71  ? 221 VAL A CA  1 
ATOM   1518  C C   . VAL A 1 222 ? -22.791 27.475  -24.735 1.00 10.04 ? 221 VAL A C   1 
ATOM   1519  O O   . VAL A 1 222 ? -23.047 26.290  -24.940 1.00 10.43 ? 221 VAL A O   1 
ATOM   1520  C CB  . VAL A 1 222 ? -25.052 28.583  -24.629 1.00 9.87  ? 221 VAL A CB  1 
ATOM   1521  C CG1 . VAL A 1 222 ? -24.900 28.746  -23.126 1.00 9.74  ? 221 VAL A CG1 1 
ATOM   1522  C CG2 . VAL A 1 222 ? -25.965 29.699  -25.216 1.00 8.17  ? 221 VAL A CG2 1 
ATOM   1523  N N   . MET A 1 223 ? -21.731 27.870  -24.030 1.00 10.66 ? 222 MET A N   1 
ATOM   1524  C CA  . MET A 1 223 ? -20.741 26.915  -23.533 1.00 11.12 ? 222 MET A CA  1 
ATOM   1525  C C   . MET A 1 223 ? -19.874 27.541  -22.461 1.00 10.55 ? 222 MET A C   1 
ATOM   1526  O O   . MET A 1 223 ? -19.652 28.773  -22.442 1.00 10.90 ? 222 MET A O   1 
ATOM   1527  C CB  . MET A 1 223 ? -19.861 26.439  -24.679 1.00 11.42 ? 222 MET A CB  1 
ATOM   1528  C CG  . MET A 1 223 ? -18.816 25.348  -24.333 1.00 11.08 ? 222 MET A CG  1 
ATOM   1529  S SD  . MET A 1 223 ? -17.891 24.876  -25.807 1.00 15.11 ? 222 MET A SD  1 
ATOM   1530  C CE  . MET A 1 223 ? -19.141 23.872  -26.630 1.00 5.91  ? 222 MET A CE  1 
ATOM   1531  N N   . GLY A 1 224 ? -19.428 26.676  -21.557 1.00 10.83 ? 223 GLY A N   1 
ATOM   1532  C CA  . GLY A 1 224 ? -18.428 26.985  -20.530 1.00 11.58 ? 223 GLY A CA  1 
ATOM   1533  C C   . GLY A 1 224 ? -17.137 26.221  -20.802 1.00 11.56 ? 223 GLY A C   1 
ATOM   1534  O O   . GLY A 1 224 ? -17.164 25.159  -21.414 1.00 11.77 ? 223 GLY A O   1 
ATOM   1535  N N   . LEU A 1 225 ? -16.015 26.795  -20.381 1.00 11.47 ? 224 LEU A N   1 
ATOM   1536  C CA  . LEU A 1 225 ? -14.710 26.131  -20.482 1.00 12.29 ? 224 LEU A CA  1 
ATOM   1537  C C   . LEU A 1 225 ? -13.901 26.372  -19.206 1.00 13.01 ? 224 LEU A C   1 
ATOM   1538  O O   . LEU A 1 225 ? -13.969 27.459  -18.607 1.00 13.64 ? 224 LEU A O   1 
ATOM   1539  C CB  . LEU A 1 225 ? -13.948 26.649  -21.706 1.00 11.74 ? 224 LEU A CB  1 
ATOM   1540  C CG  . LEU A 1 225 ? -14.467 26.337  -23.099 1.00 9.98  ? 224 LEU A CG  1 
ATOM   1541  C CD1 . LEU A 1 225 ? -13.766 27.322  -24.068 1.00 10.68 ? 224 LEU A CD1 1 
ATOM   1542  C CD2 . LEU A 1 225 ? -14.217 24.880  -23.515 1.00 11.40 ? 224 LEU A CD2 1 
ATOM   1543  N N   . VAL A 1 226 ? -13.147 25.356  -18.777 1.00 13.87 ? 225 VAL A N   1 
ATOM   1544  C CA  . VAL A 1 226 ? -12.369 25.431  -17.533 1.00 13.54 ? 225 VAL A CA  1 
ATOM   1545  C C   . VAL A 1 226 ? -10.968 24.842  -17.785 1.00 14.14 ? 225 VAL A C   1 
ATOM   1546  O O   . VAL A 1 226 ? -10.841 23.663  -18.054 1.00 13.07 ? 225 VAL A O   1 
ATOM   1547  C CB  . VAL A 1 226 ? -13.097 24.695  -16.381 1.00 13.91 ? 225 VAL A CB  1 
ATOM   1548  C CG1 . VAL A 1 226 ? -12.259 24.685  -15.108 1.00 12.22 ? 225 VAL A CG1 1 
ATOM   1549  C CG2 . VAL A 1 226 ? -14.484 25.349  -16.099 1.00 12.50 ? 225 VAL A CG2 1 
ATOM   1550  N N   . SER A 1 227 ? -9.939  25.698  -17.777 1.00 14.78 ? 226 SER A N   1 
ATOM   1551  C CA  . SER A 1 227 ? -8.554  25.266  -17.993 1.00 14.73 ? 226 SER A CA  1 
ATOM   1552  C C   . SER A 1 227 ? -7.839  25.174  -16.656 1.00 15.84 ? 226 SER A C   1 
ATOM   1553  O O   . SER A 1 227 ? -7.990  26.053  -15.794 1.00 15.81 ? 226 SER A O   1 
ATOM   1554  C CB  . SER A 1 227 ? -7.800  26.194  -18.922 1.00 14.51 ? 226 SER A CB  1 
ATOM   1555  O OG  . SER A 1 227 ? -8.292  26.070  -20.247 1.00 14.87 ? 226 SER A OG  1 
ATOM   1556  N N   . VAL A 1 228 ? -7.062  24.106  -16.500 1.00 16.42 ? 227 VAL A N   1 
ATOM   1557  C CA  . VAL A 1 228 ? -6.466  23.761  -15.217 1.00 17.25 ? 227 VAL A CA  1 
ATOM   1558  C C   . VAL A 1 228 ? -5.128  23.056  -15.431 1.00 17.49 ? 227 VAL A C   1 
ATOM   1559  O O   . VAL A 1 228 ? -4.929  22.393  -16.441 1.00 16.95 ? 227 VAL A O   1 
ATOM   1560  C CB  . VAL A 1 228 ? -7.467  22.913  -14.343 1.00 17.58 ? 227 VAL A CB  1 
ATOM   1561  C CG1 . VAL A 1 228 ? -7.705  21.526  -14.943 1.00 16.51 ? 227 VAL A CG1 1 
ATOM   1562  C CG2 . VAL A 1 228 ? -6.983  22.810  -12.899 1.00 16.07 ? 227 VAL A CG2 1 
ATOM   1563  N N   . ASN A 1 229 ? -4.197  23.244  -14.491 1.00 19.06 ? 228 ASN A N   1 
ATOM   1564  C CA  . ASN A 1 229 ? -2.891  22.572  -14.534 1.00 20.00 ? 228 ASN A CA  1 
ATOM   1565  C C   . ASN A 1 229 ? -2.783  21.488  -13.465 1.00 21.53 ? 228 ASN A C   1 
ATOM   1566  O O   . ASN A 1 229 ? -2.282  20.409  -13.743 1.00 22.60 ? 228 ASN A O   1 
ATOM   1567  C CB  . ASN A 1 229 ? -1.743  23.575  -14.334 1.00 20.26 ? 228 ASN A CB  1 
ATOM   1568  C CG  . ASN A 1 229 ? -1.455  24.406  -15.561 1.00 19.66 ? 228 ASN A CG  1 
ATOM   1569  O OD1 . ASN A 1 229 ? -1.526  23.918  -16.687 1.00 23.42 ? 228 ASN A OD1 1 
ATOM   1570  N ND2 . ASN A 1 229 ? -1.092  25.670  -15.349 1.00 22.37 ? 228 ASN A ND2 1 
ATOM   1571  N N   . CYS A 1 230 ? -3.239  21.788  -12.250 1.00 23.71 ? 229 CYS A N   1 
ATOM   1572  C CA  . CYS A 1 230 ? -3.057  20.909  -11.097 1.00 24.32 ? 229 CYS A CA  1 
ATOM   1573  C C   . CYS A 1 230 ? -3.838  19.604  -11.202 1.00 24.46 ? 229 CYS A C   1 
ATOM   1574  O O   . CYS A 1 230 ? -5.035  19.579  -11.511 1.00 23.55 ? 229 CYS A O   1 
ATOM   1575  C CB  . CYS A 1 230 ? -3.465  21.608  -9.813  1.00 24.41 ? 229 CYS A CB  1 
ATOM   1576  S SG  . CYS A 1 230 ? -3.298  20.518  -8.379  1.00 28.58 ? 229 CYS A SG  1 
ATOM   1577  N N   . GLU A 1 231 ? -3.140  18.521  -10.886 1.00 25.05 ? 230 GLU A N   1 
ATOM   1578  C CA  . GLU A 1 231 ? -3.567  17.189  -11.254 1.00 25.56 ? 230 GLU A CA  1 
ATOM   1579  C C   . GLU A 1 231 ? -4.802  16.739  -10.466 1.00 25.19 ? 230 GLU A C   1 
ATOM   1580  O O   . GLU A 1 231 ? -5.767  16.198  -11.028 1.00 24.57 ? 230 GLU A O   1 
ATOM   1581  C CB  . GLU A 1 231 ? -2.402  16.234  -11.016 1.00 26.13 ? 230 GLU A CB  1 
ATOM   1582  C CG  . GLU A 1 231 ? -2.575  14.931  -11.674 1.00 28.83 ? 230 GLU A CG  1 
ATOM   1583  C CD  . GLU A 1 231 ? -2.422  15.017  -13.169 1.00 30.76 ? 230 GLU A CD  1 
ATOM   1584  O OE1 . GLU A 1 231 ? -2.958  14.110  -13.842 1.00 33.73 ? 230 GLU A OE1 1 
ATOM   1585  O OE2 . GLU A 1 231 ? -1.775  15.967  -13.669 1.00 29.63 ? 230 GLU A OE2 1 
ATOM   1586  N N   . SER A 1 232 ? -4.781  16.978  -9.163  1.00 24.80 ? 231 SER A N   1 
ATOM   1587  C CA  . SER A 1 232 ? -5.885  16.553  -8.326  1.00 24.82 ? 231 SER A CA  1 
ATOM   1588  C C   . SER A 1 232 ? -7.081  17.497  -8.478  1.00 24.07 ? 231 SER A C   1 
ATOM   1589  O O   . SER A 1 232 ? -8.222  17.087  -8.328  1.00 23.98 ? 231 SER A O   1 
ATOM   1590  C CB  . SER A 1 232 ? -5.450  16.453  -6.869  1.00 25.16 ? 231 SER A CB  1 
ATOM   1591  O OG  . SER A 1 232 ? -5.208  17.727  -6.346  1.00 26.32 ? 231 SER A OG  1 
ATOM   1592  N N   . LEU A 1 233 ? -6.814  18.759  -8.784  1.00 23.38 ? 232 LEU A N   1 
ATOM   1593  C CA  . LEU A 1 233 ? -7.884  19.689  -9.084  1.00 22.76 ? 232 LEU A CA  1 
ATOM   1594  C C   . LEU A 1 233 ? -8.601  19.287  -10.388 1.00 21.94 ? 232 LEU A C   1 
ATOM   1595  O O   . LEU A 1 233 ? -9.820  19.340  -10.461 1.00 21.68 ? 232 LEU A O   1 
ATOM   1596  C CB  . LEU A 1 233 ? -7.312  21.096  -9.188  1.00 22.80 ? 232 LEU A CB  1 
ATOM   1597  C CG  . LEU A 1 233 ? -8.326  22.228  -9.161  1.00 24.21 ? 232 LEU A CG  1 
ATOM   1598  C CD1 . LEU A 1 233 ? -9.292  22.054  -7.967  1.00 23.62 ? 232 LEU A CD1 1 
ATOM   1599  C CD2 . LEU A 1 233 ? -7.585  23.569  -9.111  1.00 23.22 ? 232 LEU A CD2 1 
ATOM   1600  N N   . HIS A 1 234 ? -7.830  18.896  -11.408 1.00 20.87 ? 233 HIS A N   1 
ATOM   1601  C CA  . HIS A 1 234 ? -8.377  18.337  -12.643 1.00 20.54 ? 233 HIS A CA  1 
ATOM   1602  C C   . HIS A 1 234 ? -9.233  17.083  -12.417 1.00 20.27 ? 233 HIS A C   1 
ATOM   1603  O O   . HIS A 1 234 ? -10.336 16.971  -12.954 1.00 19.28 ? 233 HIS A O   1 
ATOM   1604  C CB  . HIS A 1 234 ? -7.254  17.991  -13.606 1.00 20.11 ? 233 HIS A CB  1 
ATOM   1605  C CG  . HIS A 1 234 ? -7.733  17.351  -14.869 1.00 20.18 ? 233 HIS A CG  1 
ATOM   1606  N ND1 . HIS A 1 234 ? -7.262  16.138  -15.317 1.00 16.10 ? 233 HIS A ND1 1 
ATOM   1607  C CD2 . HIS A 1 234 ? -8.643  17.763  -15.781 1.00 20.41 ? 233 HIS A CD2 1 
ATOM   1608  C CE1 . HIS A 1 234 ? -7.865  15.827  -16.448 1.00 20.54 ? 233 HIS A CE1 1 
ATOM   1609  N NE2 . HIS A 1 234 ? -8.699  16.804  -16.756 1.00 20.15 ? 233 HIS A NE2 1 
ATOM   1610  N N   . ASN A 1 235 ? -8.719  16.148  -11.618 1.00 20.62 ? 234 ASN A N   1 
ATOM   1611  C CA  . ASN A 1 235 ? -9.452  14.907  -11.281 1.00 20.86 ? 234 ASN A CA  1 
ATOM   1612  C C   . ASN A 1 235 ? -10.773 15.201  -10.581 1.00 20.10 ? 234 ASN A C   1 
ATOM   1613  O O   . ASN A 1 235 ? -11.798 14.609  -10.879 1.00 20.37 ? 234 ASN A O   1 
ATOM   1614  C CB  . ASN A 1 235 ? -8.583  13.997  -10.390 1.00 21.32 ? 234 ASN A CB  1 
ATOM   1615  C CG  . ASN A 1 235 ? -7.323  13.489  -11.108 1.00 22.31 ? 234 ASN A CG  1 
ATOM   1616  O OD1 . ASN A 1 235 ? -7.331  13.272  -12.308 1.00 24.94 ? 234 ASN A OD1 1 
ATOM   1617  N ND2 . ASN A 1 235 ? -6.241  13.301  -10.359 1.00 25.46 ? 234 ASN A ND2 1 
ATOM   1618  N N   . ARG A 1 236 ? -10.734 16.133  -9.646  1.00 19.57 ? 235 ARG A N   1 
ATOM   1619  C CA  . ARG A 1 236 ? -11.933 16.594  -8.967  1.00 19.23 ? 235 ARG A CA  1 
ATOM   1620  C C   . ARG A 1 236 ? -12.979 17.250  -9.917  1.00 18.74 ? 235 ARG A C   1 
ATOM   1621  O O   . ARG A 1 236 ? -14.181 17.029  -9.776  1.00 16.92 ? 235 ARG A O   1 
ATOM   1622  C CB  . ARG A 1 236 ? -11.538 17.562  -7.871  1.00 19.36 ? 235 ARG A CB  1 
ATOM   1623  C CG  . ARG A 1 236 ? -10.902 16.879  -6.688  1.00 20.40 ? 235 ARG A CG  1 
ATOM   1624  C CD  . ARG A 1 236 ? -10.161 17.874  -5.834  1.00 20.64 ? 235 ARG A CD  1 
ATOM   1625  N NE  . ARG A 1 236 ? -11.077 18.752  -5.115  1.00 20.12 ? 235 ARG A NE  1 
ATOM   1626  C CZ  . ARG A 1 236 ? -10.716 19.891  -4.530  1.00 18.54 ? 235 ARG A CZ  1 
ATOM   1627  N NH1 . ARG A 1 236 ? -9.470  20.302  -4.579  1.00 18.75 ? 235 ARG A NH1 1 
ATOM   1628  N NH2 . ARG A 1 236 ? -11.607 20.626  -3.896  1.00 19.98 ? 235 ARG A NH2 1 
ATOM   1629  N N   . LEU A 1 237 ? -12.495 18.054  -10.868 1.00 18.76 ? 236 LEU A N   1 
ATOM   1630  C CA  . LEU A 1 237 ? -13.347 18.682  -11.868 1.00 18.48 ? 236 LEU A CA  1 
ATOM   1631  C C   . LEU A 1 237 ? -13.898 17.676  -12.865 1.00 18.53 ? 236 LEU A C   1 
ATOM   1632  O O   . LEU A 1 237 ? -15.067 17.725  -13.225 1.00 18.64 ? 236 LEU A O   1 
ATOM   1633  C CB  . LEU A 1 237 ? -12.572 19.753  -12.630 1.00 18.08 ? 236 LEU A CB  1 
ATOM   1634  C CG  . LEU A 1 237 ? -12.381 21.083  -11.897 1.00 19.56 ? 236 LEU A CG  1 
ATOM   1635  C CD1 . LEU A 1 237 ? -11.265 21.885  -12.589 1.00 18.15 ? 236 LEU A CD1 1 
ATOM   1636  C CD2 . LEU A 1 237 ? -13.706 21.883  -11.830 1.00 17.36 ? 236 LEU A CD2 1 
ATOM   1637  N N   . ARG A 1 238 ? -13.033 16.785  -13.314 1.00 18.79 ? 237 ARG A N   1 
ATOM   1638  C CA  . ARG A 1 238 ? -13.380 15.732  -14.251 1.00 19.39 ? 237 ARG A CA  1 
ATOM   1639  C C   . ARG A 1 238 ? -14.469 14.824  -13.727 1.00 19.70 ? 237 ARG A C   1 
ATOM   1640  O O   . ARG A 1 238 ? -15.346 14.346  -14.475 1.00 19.25 ? 237 ARG A O   1 
ATOM   1641  C CB  . ARG A 1 238 ? -12.145 14.880  -14.538 1.00 19.76 ? 237 ARG A CB  1 
ATOM   1642  C CG  . ARG A 1 238 ? -12.149 14.263  -15.909 1.00 22.79 ? 237 ARG A CG  1 
ATOM   1643  C CD  . ARG A 1 238 ? -11.391 15.150  -16.864 1.00 26.33 ? 237 ARG A CD  1 
ATOM   1644  N NE  . ARG A 1 238 ? -12.207 15.603  -17.967 1.00 27.74 ? 237 ARG A NE  1 
ATOM   1645  C CZ  . ARG A 1 238 ? -11.798 16.444  -18.921 1.00 27.32 ? 237 ARG A CZ  1 
ATOM   1646  N NH1 . ARG A 1 238 ? -10.546 16.939  -18.962 1.00 24.38 ? 237 ARG A NH1 1 
ATOM   1647  N NH2 . ARG A 1 238 ? -12.660 16.769  -19.867 1.00 26.87 ? 237 ARG A NH2 1 
ATOM   1648  N N   . PHE A 1 239 ? -14.382 14.554  -12.435 1.00 19.47 ? 238 PHE A N   1 
ATOM   1649  C CA  . PHE A 1 239 ? -15.384 13.801  -11.748 1.00 19.39 ? 238 PHE A CA  1 
ATOM   1650  C C   . PHE A 1 239 ? -16.721 14.530  -11.759 1.00 19.09 ? 238 PHE A C   1 
ATOM   1651  O O   . PHE A 1 239 ? -17.756 13.910  -11.996 1.00 19.09 ? 238 PHE A O   1 
ATOM   1652  C CB  . PHE A 1 239 ? -14.934 13.525  -10.314 1.00 19.81 ? 238 PHE A CB  1 
ATOM   1653  C CG  . PHE A 1 239 ? -15.948 12.789  -9.507  1.00 19.88 ? 238 PHE A CG  1 
ATOM   1654  C CD1 . PHE A 1 239 ? -16.090 11.401  -9.639  1.00 21.56 ? 238 PHE A CD1 1 
ATOM   1655  C CD2 . PHE A 1 239 ? -16.781 13.467  -8.638  1.00 20.49 ? 238 PHE A CD2 1 
ATOM   1656  C CE1 . PHE A 1 239 ? -17.034 10.705  -8.884  1.00 20.95 ? 238 PHE A CE1 1 
ATOM   1657  C CE2 . PHE A 1 239 ? -17.737 12.789  -7.898  1.00 21.20 ? 238 PHE A CE2 1 
ATOM   1658  C CZ  . PHE A 1 239 ? -17.861 11.386  -8.028  1.00 21.47 ? 238 PHE A CZ  1 
ATOM   1659  N N   . LEU A 1 240 ? -16.698 15.838  -11.515 1.00 19.11 ? 239 LEU A N   1 
ATOM   1660  C CA  . LEU A 1 240 ? -17.923 16.654  -11.543 1.00 18.94 ? 239 LEU A CA  1 
ATOM   1661  C C   . LEU A 1 240 ? -18.509 16.891  -12.948 1.00 18.92 ? 239 LEU A C   1 
ATOM   1662  O O   . LEU A 1 240 ? -19.733 16.937  -13.112 1.00 18.38 ? 239 LEU A O   1 
ATOM   1663  C CB  . LEU A 1 240 ? -17.709 17.976  -10.813 1.00 19.30 ? 239 LEU A CB  1 
ATOM   1664  C CG  . LEU A 1 240 ? -17.471 17.801  -9.305  1.00 18.90 ? 239 LEU A CG  1 
ATOM   1665  C CD1 . LEU A 1 240 ? -16.862 19.043  -8.683  1.00 19.25 ? 239 LEU A CD1 1 
ATOM   1666  C CD2 . LEU A 1 240 ? -18.780 17.412  -8.603  1.00 19.69 ? 239 LEU A CD2 1 
ATOM   1667  N N   . GLN A 1 241 ? -17.643 17.039  -13.946 1.00 19.20 ? 240 GLN A N   1 
ATOM   1668  C CA  . GLN A 1 241 ? -18.082 17.057  -15.348 1.00 19.61 ? 240 GLN A CA  1 
ATOM   1669  C C   . GLN A 1 241 ? -18.942 15.826  -15.642 1.00 20.70 ? 240 GLN A C   1 
ATOM   1670  O O   . GLN A 1 241 ? -20.025 15.921  -16.237 1.00 20.80 ? 240 GLN A O   1 
ATOM   1671  C CB  . GLN A 1 241 ? -16.888 17.093  -16.293 1.00 19.28 ? 240 GLN A CB  1 
ATOM   1672  C CG  . GLN A 1 241 ? -17.271 17.414  -17.728 1.00 18.08 ? 240 GLN A CG  1 
ATOM   1673  C CD  . GLN A 1 241 ? -16.115 17.283  -18.709 1.00 18.29 ? 240 GLN A CD  1 
ATOM   1674  O OE1 . GLN A 1 241 ? -15.256 16.406  -18.573 1.00 17.73 ? 240 GLN A OE1 1 
ATOM   1675  N NE2 . GLN A 1 241 ? -16.100 18.151  -19.720 1.00 12.57 ? 240 GLN A NE2 1 
ATOM   1676  N N   . ASN A 1 242 ? -18.436 14.675  -15.202 1.00 21.96 ? 241 ASN A N   1 
ATOM   1677  C CA  . ASN A 1 242 ? -19.116 13.395  -15.316 1.00 23.10 ? 241 ASN A CA  1 
ATOM   1678  C C   . ASN A 1 242 ? -20.389 13.277  -14.513 1.00 22.45 ? 241 ASN A C   1 
ATOM   1679  O O   . ASN A 1 242 ? -21.429 12.864  -15.024 1.00 22.61 ? 241 ASN A O   1 
ATOM   1680  C CB  . ASN A 1 242 ? -18.180 12.302  -14.809 1.00 24.63 ? 241 ASN A CB  1 
ATOM   1681  C CG  . ASN A 1 242 ? -17.683 11.450  -15.887 1.00 28.19 ? 241 ASN A CG  1 
ATOM   1682  O OD1 . ASN A 1 242 ? -18.490 10.839  -16.611 1.00 35.93 ? 241 ASN A OD1 1 
ATOM   1683  N ND2 . ASN A 1 242 ? -16.344 11.362  -16.025 1.00 32.92 ? 241 ASN A ND2 1 
ATOM   1684  N N   . SER A 1 243 ? -20.287 13.628  -13.242 1.00 21.70 ? 242 SER A N   1 
ATOM   1685  C CA  . SER A 1 243 ? -21.331 13.314  -12.263 1.00 21.15 ? 242 SER A CA  1 
ATOM   1686  C C   . SER A 1 243 ? -22.508 14.264  -12.300 1.00 19.94 ? 242 SER A C   1 
ATOM   1687  O O   . SER A 1 243 ? -23.631 13.852  -12.050 1.00 20.43 ? 242 SER A O   1 
ATOM   1688  C CB  . SER A 1 243 ? -20.737 13.321  -10.850 1.00 20.96 ? 242 SER A CB  1 
ATOM   1689  O OG  . SER A 1 243 ? -19.751 12.304  -10.764 1.00 22.20 ? 242 SER A OG  1 
ATOM   1690  N N   . LEU A 1 244 ? -22.243 15.534  -12.563 1.00 17.95 ? 243 LEU A N   1 
ATOM   1691  C CA  . LEU A 1 244 ? -23.309 16.531  -12.641 1.00 17.56 ? 243 LEU A CA  1 
ATOM   1692  C C   . LEU A 1 244 ? -23.890 16.668  -14.054 1.00 15.94 ? 243 LEU A C   1 
ATOM   1693  O O   . LEU A 1 244 ? -24.979 17.200  -14.220 1.00 13.86 ? 243 LEU A O   1 
ATOM   1694  C CB  . LEU A 1 244 ? -22.830 17.887  -12.147 1.00 17.59 ? 243 LEU A CB  1 
ATOM   1695  C CG  . LEU A 1 244 ? -22.202 17.970  -10.744 1.00 18.86 ? 243 LEU A CG  1 
ATOM   1696  C CD1 . LEU A 1 244 ? -21.670 19.399  -10.561 1.00 19.83 ? 243 LEU A CD1 1 
ATOM   1697  C CD2 . LEU A 1 244 ? -23.184 17.587  -9.641  1.00 17.29 ? 243 LEU A CD2 1 
ATOM   1698  N N   . GLY A 1 245 ? -23.143 16.213  -15.056 1.00 15.72 ? 244 GLY A N   1 
ATOM   1699  C CA  . GLY A 1 245 ? -23.665 16.082  -16.433 1.00 16.20 ? 244 GLY A CA  1 
ATOM   1700  C C   . GLY A 1 245 ? -24.046 17.368  -17.163 1.00 15.84 ? 244 GLY A C   1 
ATOM   1701  O O   . GLY A 1 245 ? -24.906 17.336  -18.048 1.00 15.99 ? 244 GLY A O   1 
ATOM   1702  N N   . ALA A 1 246 ? -23.389 18.479  -16.819 1.00 16.18 ? 245 ALA A N   1 
ATOM   1703  C CA  . ALA A 1 246 ? -23.646 19.793  -17.432 1.00 16.43 ? 245 ALA A CA  1 
ATOM   1704  C C   . ALA A 1 246 ? -22.678 19.981  -18.607 1.00 16.76 ? 245 ALA A C   1 
ATOM   1705  O O   . ALA A 1 246 ? -21.849 20.914  -18.640 1.00 16.39 ? 245 ALA A O   1 
ATOM   1706  C CB  . ALA A 1 246 ? -23.477 20.926  -16.386 1.00 16.53 ? 245 ALA A CB  1 
ATOM   1707  N N   . VAL A 1 247 ? -22.794 19.056  -19.553 1.00 16.82 ? 246 VAL A N   1 
ATOM   1708  C CA  . VAL A 1 247 ? -21.842 18.892  -20.631 1.00 17.26 ? 246 VAL A CA  1 
ATOM   1709  C C   . VAL A 1 247 ? -22.425 19.432  -21.922 1.00 17.13 ? 246 VAL A C   1 
ATOM   1710  O O   . VAL A 1 247 ? -23.647 19.437  -22.095 1.00 18.19 ? 246 VAL A O   1 
ATOM   1711  C CB  . VAL A 1 247 ? -21.455 17.407  -20.786 1.00 17.81 ? 246 VAL A CB  1 
ATOM   1712  C CG1 . VAL A 1 247 ? -20.814 16.933  -19.486 1.00 17.07 ? 246 VAL A CG1 1 
ATOM   1713  C CG2 . VAL A 1 247 ? -22.680 16.534  -21.133 1.00 16.49 ? 246 VAL A CG2 1 
ATOM   1714  N N   . PRO A 1 248 ? -21.555 19.924  -22.814 1.00 16.80 ? 247 PRO A N   1 
ATOM   1715  C CA  . PRO A 1 248 ? -21.956 20.525  -24.048 1.00 16.21 ? 247 PRO A CA  1 
ATOM   1716  C C   . PRO A 1 248 ? -22.237 19.487  -25.134 1.00 15.68 ? 247 PRO A C   1 
ATOM   1717  O O   . PRO A 1 248 ? -21.681 18.393  -25.117 1.00 16.93 ? 247 PRO A O   1 
ATOM   1718  C CB  . PRO A 1 248 ? -20.734 21.373  -24.406 1.00 16.76 ? 247 PRO A CB  1 
ATOM   1719  C CG  . PRO A 1 248 ? -19.596 20.586  -23.929 1.00 16.80 ? 247 PRO A CG  1 
ATOM   1720  C CD  . PRO A 1 248 ? -20.086 19.966  -22.646 1.00 16.77 ? 247 PRO A CD  1 
ATOM   1721  N N   . SER A 1 249 ? -23.103 19.835  -26.069 1.00 14.55 ? 248 SER A N   1 
ATOM   1722  C CA  . SER A 1 249 ? -23.332 19.018  -27.269 1.00 14.06 ? 248 SER A CA  1 
ATOM   1723  C C   . SER A 1 249 ? -22.047 18.872  -28.063 1.00 12.94 ? 248 SER A C   1 
ATOM   1724  O O   . SER A 1 249 ? -21.331 19.831  -28.242 1.00 12.42 ? 248 SER A O   1 
ATOM   1725  C CB  . SER A 1 249 ? -24.335 19.678  -28.176 1.00 13.02 ? 248 SER A CB  1 
ATOM   1726  O OG  . SER A 1 249 ? -24.643 18.834  -29.261 1.00 16.68 ? 248 SER A OG  1 
ATOM   1727  N N   . PRO A 1 250 ? -21.775 17.679  -28.568 1.00 13.25 ? 249 PRO A N   1 
ATOM   1728  C CA  . PRO A 1 250 ? -20.646 17.502  -29.495 1.00 13.11 ? 249 PRO A CA  1 
ATOM   1729  C C   . PRO A 1 250 ? -20.693 18.429  -30.727 1.00 12.87 ? 249 PRO A C   1 
ATOM   1730  O O   . PRO A 1 250 ? -19.663 18.868  -31.197 1.00 12.03 ? 249 PRO A O   1 
ATOM   1731  C CB  . PRO A 1 250 ? -20.758 16.030  -29.912 1.00 13.01 ? 249 PRO A CB  1 
ATOM   1732  C CG  . PRO A 1 250 ? -21.471 15.375  -28.775 1.00 13.36 ? 249 PRO A CG  1 
ATOM   1733  C CD  . PRO A 1 250 ? -22.465 16.403  -28.274 1.00 13.09 ? 249 PRO A CD  1 
ATOM   1734  N N   . ILE A 1 251 ? -21.875 18.731  -31.239 1.00 13.06 ? 250 ILE A N   1 
ATOM   1735  C CA  . ILE A 1 251 ? -21.970 19.646  -32.382 1.00 12.89 ? 250 ILE A CA  1 
ATOM   1736  C C   . ILE A 1 251 ? -21.553 21.088  -31.987 1.00 12.05 ? 250 ILE A C   1 
ATOM   1737  O O   . ILE A 1 251 ? -20.840 21.784  -32.734 1.00 11.16 ? 250 ILE A O   1 
ATOM   1738  C CB  . ILE A 1 251 ? -23.354 19.490  -33.127 1.00 13.46 ? 250 ILE A CB  1 
ATOM   1739  C CG1 . ILE A 1 251 ? -23.290 20.129  -34.521 1.00 15.82 ? 250 ILE A CG1 1 
ATOM   1740  C CG2 . ILE A 1 251 ? -24.477 20.008  -32.337 1.00 15.05 ? 250 ILE A CG2 1 
ATOM   1741  C CD1 . ILE A 1 251 ? -23.076 21.586  -34.506 1.00 18.76 ? 250 ILE A CD1 1 
ATOM   1742  N N   . ASP A 1 252 ? -21.952 21.510  -30.804 1.00 11.27 ? 251 ASP A N   1 
ATOM   1743  C CA  . ASP A 1 252 ? -21.522 22.790  -30.260 1.00 11.65 ? 251 ASP A CA  1 
ATOM   1744  C C   . ASP A 1 252 ? -20.024 22.826  -30.001 1.00 11.68 ? 251 ASP A C   1 
ATOM   1745  O O   . ASP A 1 252 ? -19.412 23.874  -30.184 1.00 11.16 ? 251 ASP A O   1 
ATOM   1746  C CB  . ASP A 1 252 ? -22.240 23.114  -28.948 1.00 11.89 ? 251 ASP A CB  1 
ATOM   1747  C CG  . ASP A 1 252 ? -23.710 23.507  -29.138 1.00 13.26 ? 251 ASP A CG  1 
ATOM   1748  O OD1 . ASP A 1 252 ? -24.344 23.878  -28.136 1.00 16.44 ? 251 ASP A OD1 1 
ATOM   1749  O OD2 . ASP A 1 252 ? -24.226 23.451  -30.258 1.00 17.78 ? 251 ASP A OD2 1 
ATOM   1750  N N   . CYS A 1 253 ? -19.457 21.708  -29.530 1.00 11.21 ? 252 CYS A N   1 
ATOM   1751  C CA  . CYS A 1 253 ? -17.998 21.590  -29.414 1.00 11.22 ? 252 CYS A CA  1 
ATOM   1752  C C   . CYS A 1 253 ? -17.323 21.827  -30.757 1.00 10.98 ? 252 CYS A C   1 
ATOM   1753  O O   . CYS A 1 253 ? -16.357 22.562  -30.818 1.00 9.89  ? 252 CYS A O   1 
ATOM   1754  C CB  . CYS A 1 253 ? -17.561 20.245  -28.831 1.00 11.80 ? 252 CYS A CB  1 
ATOM   1755  S SG  . CYS A 1 253 ? -18.033 20.021  -27.126 1.00 13.21 ? 252 CYS A SG  1 
ATOM   1756  N N   A TYR A 1 254 ? -17.844 21.217  -31.812 0.50 11.02 ? 253 TYR A N   1 
ATOM   1757  N N   B TYR A 1 254 ? -17.829 21.205  -31.824 0.50 11.16 ? 253 TYR A N   1 
ATOM   1758  C CA  A TYR A 1 254 ? -17.323 21.459  -33.159 0.50 11.27 ? 253 TYR A CA  1 
ATOM   1759  C CA  B TYR A 1 254 ? -17.328 21.476  -33.197 0.50 11.45 ? 253 TYR A CA  1 
ATOM   1760  C C   A TYR A 1 254 ? -17.438 22.949  -33.570 0.50 11.05 ? 253 TYR A C   1 
ATOM   1761  C C   B TYR A 1 254 ? -17.421 22.971  -33.543 0.50 11.17 ? 253 TYR A C   1 
ATOM   1762  O O   A TYR A 1 254 ? -16.503 23.536  -34.157 0.50 11.33 ? 253 TYR A O   1 
ATOM   1763  O O   B TYR A 1 254 ? -16.462 23.582  -34.061 0.50 11.37 ? 253 TYR A O   1 
ATOM   1764  C CB  A TYR A 1 254 ? -18.005 20.542  -34.192 0.50 11.14 ? 253 TYR A CB  1 
ATOM   1765  C CB  B TYR A 1 254 ? -18.054 20.631  -34.280 0.50 11.66 ? 253 TYR A CB  1 
ATOM   1766  C CG  A TYR A 1 254 ? -17.572 20.860  -35.599 0.50 11.01 ? 253 TYR A CG  1 
ATOM   1767  C CG  B TYR A 1 254 ? -18.205 21.353  -35.625 0.50 11.50 ? 253 TYR A CG  1 
ATOM   1768  C CD1 A TYR A 1 254 ? -16.423 20.296  -36.135 0.50 11.18 ? 253 TYR A CD1 1 
ATOM   1769  C CD1 B TYR A 1 254 ? -19.381 22.030  -35.942 0.50 12.24 ? 253 TYR A CD1 1 
ATOM   1770  C CD2 A TYR A 1 254 ? -18.290 21.749  -36.379 0.50 10.17 ? 253 TYR A CD2 1 
ATOM   1771  C CD2 B TYR A 1 254 ? -17.169 21.383  -36.554 0.50 11.62 ? 253 TYR A CD2 1 
ATOM   1772  C CE1 A TYR A 1 254 ? -16.013 20.609  -37.404 0.50 11.49 ? 253 TYR A CE1 1 
ATOM   1773  C CE1 B TYR A 1 254 ? -19.527 22.711  -37.158 0.50 11.58 ? 253 TYR A CE1 1 
ATOM   1774  C CE2 A TYR A 1 254 ? -17.883 22.071  -37.658 0.50 11.36 ? 253 TYR A CE2 1 
ATOM   1775  C CE2 B TYR A 1 254 ? -17.300 22.070  -37.772 0.50 12.23 ? 253 TYR A CE2 1 
ATOM   1776  C CZ  A TYR A 1 254 ? -16.743 21.499  -38.166 0.50 11.37 ? 253 TYR A CZ  1 
ATOM   1777  C CZ  B TYR A 1 254 ? -18.483 22.739  -38.060 0.50 12.22 ? 253 TYR A CZ  1 
ATOM   1778  O OH  A TYR A 1 254 ? -16.319 21.816  -39.434 0.50 10.54 ? 253 TYR A OH  1 
ATOM   1779  O OH  B TYR A 1 254 ? -18.644 23.421  -39.253 0.50 13.00 ? 253 TYR A OH  1 
ATOM   1780  N N   . LEU A 1 255 ? -18.576 23.561  -33.271 1.00 10.84 ? 254 LEU A N   1 
ATOM   1781  C CA  . LEU A 1 255 ? -18.800 24.958  -33.644 1.00 10.54 ? 254 LEU A CA  1 
ATOM   1782  C C   . LEU A 1 255 ? -17.845 25.883  -32.897 1.00 9.89  ? 254 LEU A C   1 
ATOM   1783  O O   . LEU A 1 255 ? -17.266 26.832  -33.480 1.00 9.63  ? 254 LEU A O   1 
ATOM   1784  C CB  . LEU A 1 255 ? -20.255 25.358  -33.402 1.00 10.45 ? 254 LEU A CB  1 
ATOM   1785  C CG  . LEU A 1 255 ? -21.274 24.890  -34.441 1.00 10.55 ? 254 LEU A CG  1 
ATOM   1786  C CD1 . LEU A 1 255 ? -22.661 25.244  -33.942 1.00 11.88 ? 254 LEU A CD1 1 
ATOM   1787  C CD2 . LEU A 1 255 ? -21.020 25.471  -35.863 1.00 12.87 ? 254 LEU A CD2 1 
ATOM   1788  N N   . CYS A 1 256 ? -17.680 25.626  -31.612 1.00 9.56  ? 255 CYS A N   1 
ATOM   1789  C CA  . CYS A 1 256 ? -16.725 26.429  -30.798 1.00 10.10 ? 255 CYS A CA  1 
ATOM   1790  C C   . CYS A 1 256 ? -15.270 26.243  -31.262 1.00 9.83  ? 255 CYS A C   1 
ATOM   1791  O O   . CYS A 1 256 ? -14.472 27.199  -31.384 1.00 9.28  ? 255 CYS A O   1 
ATOM   1792  C CB  . CYS A 1 256 ? -16.846 26.051  -29.322 1.00 9.54  ? 255 CYS A CB  1 
ATOM   1793  S SG  . CYS A 1 256 ? -15.942 27.179  -28.226 1.00 11.11 ? 255 CYS A SG  1 
ATOM   1794  N N   . ASN A 1 257 ? -14.912 25.000  -31.507 1.00 10.04 ? 256 ASN A N   1 
ATOM   1795  C CA  . ASN A 1 257 ? -13.556 24.698  -31.972 1.00 10.62 ? 256 ASN A CA  1 
ATOM   1796  C C   . ASN A 1 257 ? -13.279 25.356  -33.328 1.00 10.68 ? 256 ASN A C   1 
ATOM   1797  O O   . ASN A 1 257 ? -12.169 25.813  -33.598 1.00 10.37 ? 256 ASN A O   1 
ATOM   1798  C CB  . ASN A 1 257 ? -13.346 23.185  -32.020 1.00 10.22 ? 256 ASN A CB  1 
ATOM   1799  C CG  . ASN A 1 257 ? -11.850 22.765  -31.963 1.00 9.94  ? 256 ASN A CG  1 
ATOM   1800  O OD1 . ASN A 1 257 ? -11.578 21.609  -31.714 1.00 10.40 ? 256 ASN A OD1 1 
ATOM   1801  N ND2 . ASN A 1 257 ? -10.909 23.689  -32.218 1.00 10.62 ? 256 ASN A ND2 1 
ATOM   1802  N N   . ARG A 1 258 ? -14.318 25.446  -34.151 1.00 11.30 ? 257 ARG A N   1 
ATOM   1803  C CA  . ARG A 1 258 ? -14.265 26.148  -35.429 1.00 11.40 ? 257 ARG A CA  1 
ATOM   1804  C C   . ARG A 1 258 ? -14.104 27.643  -35.207 1.00 10.57 ? 257 ARG A C   1 
ATOM   1805  O O   . ARG A 1 258 ? -13.307 28.259  -35.885 1.00 11.36 ? 257 ARG A O   1 
ATOM   1806  C CB  . ARG A 1 258 ? -15.542 25.880  -36.224 1.00 10.84 ? 257 ARG A CB  1 
ATOM   1807  C CG  . ARG A 1 258 ? -15.582 26.463  -37.629 1.00 13.57 ? 257 ARG A CG  1 
ATOM   1808  C CD  . ARG A 1 258 ? -17.023 26.447  -38.141 1.00 12.56 ? 257 ARG A CD  1 
ATOM   1809  N NE  . ARG A 1 258 ? -17.175 26.286  -39.587 1.00 15.12 ? 257 ARG A NE  1 
ATOM   1810  C CZ  . ARG A 1 258 ? -17.618 27.235  -40.429 1.00 15.78 ? 257 ARG A CZ  1 
ATOM   1811  N NH1 . ARG A 1 258 ? -17.857 28.474  -40.022 1.00 16.97 ? 257 ARG A NH1 1 
ATOM   1812  N NH2 . ARG A 1 258 ? -17.790 26.958  -41.700 1.00 13.66 ? 257 ARG A NH2 1 
ATOM   1813  N N   . GLY A 1 259 ? -14.864 28.212  -34.271 1.00 10.44 ? 258 GLY A N   1 
ATOM   1814  C CA  . GLY A 1 259 ? -14.702 29.610  -33.873 1.00 11.43 ? 258 GLY A CA  1 
ATOM   1815  C C   . GLY A 1 259 ? -13.313 29.965  -33.384 1.00 10.79 ? 258 GLY A C   1 
ATOM   1816  O O   . GLY A 1 259 ? -12.778 31.044  -33.682 1.00 11.11 ? 258 GLY A O   1 
ATOM   1817  N N   . LEU A 1 260 ? -12.714 29.028  -32.661 1.00 11.78 ? 259 LEU A N   1 
ATOM   1818  C CA  . LEU A 1 260 ? -11.385 29.170  -32.068 1.00 11.45 ? 259 LEU A CA  1 
ATOM   1819  C C   . LEU A 1 260 ? -10.311 29.439  -33.089 1.00 10.26 ? 259 LEU A C   1 
ATOM   1820  O O   . LEU A 1 260 ? -9.329  30.098  -32.807 1.00 8.65  ? 259 LEU A O   1 
ATOM   1821  C CB  . LEU A 1 260 ? -11.013 27.896  -31.276 1.00 11.61 ? 259 LEU A CB  1 
ATOM   1822  C CG  . LEU A 1 260 ? -10.968 27.825  -29.732 1.00 16.23 ? 259 LEU A CG  1 
ATOM   1823  C CD1 . LEU A 1 260 ? -11.425 29.070  -28.999 1.00 13.74 ? 259 LEU A CD1 1 
ATOM   1824  C CD2 . LEU A 1 260 ? -11.740 26.635  -29.242 1.00 15.40 ? 259 LEU A CD2 1 
ATOM   1825  N N   . LYS A 1 261 ? -10.502 28.931  -34.290 1.00 11.25 ? 260 LYS A N   1 
ATOM   1826  C CA  . LYS A 1 261 ? -9.468  29.011  -35.329 1.00 11.87 ? 260 LYS A CA  1 
ATOM   1827  C C   . LYS A 1 261 ? -9.333  30.421  -35.934 1.00 10.89 ? 260 LYS A C   1 
ATOM   1828  O O   . LYS A 1 261 ? -8.366  30.705  -36.641 1.00 10.53 ? 260 LYS A O   1 
ATOM   1829  C CB  . LYS A 1 261 ? -9.714  27.936  -36.394 1.00 11.79 ? 260 LYS A CB  1 
ATOM   1830  C CG  . LYS A 1 261 ? -9.484  26.558  -35.779 1.00 13.13 ? 260 LYS A CG  1 
ATOM   1831  C CD  . LYS A 1 261 ? -9.737  25.423  -36.691 1.00 13.90 ? 260 LYS A CD  1 
ATOM   1832  C CE  . LYS A 1 261 ? -9.636  24.123  -35.896 1.00 13.70 ? 260 LYS A CE  1 
ATOM   1833  N NZ  . LYS A 1 261 ? -10.103 22.960  -36.698 1.00 14.43 ? 260 LYS A NZ  1 
ATOM   1834  N N   . THR A 1 262 ? -10.272 31.299  -35.617 1.00 10.06 ? 261 THR A N   1 
ATOM   1835  C CA  . THR A 1 262 ? -10.139 32.694  -35.976 1.00 10.08 ? 261 THR A CA  1 
ATOM   1836  C C   . THR A 1 262 ? -9.978  33.595  -34.760 1.00 9.80  ? 261 THR A C   1 
ATOM   1837  O O   . THR A 1 262 ? -9.997  34.811  -34.881 1.00 9.48  ? 261 THR A O   1 
ATOM   1838  C CB  . THR A 1 262 ? -11.347 33.153  -36.824 1.00 10.00 ? 261 THR A CB  1 
ATOM   1839  O OG1 . THR A 1 262 ? -12.553 32.880  -36.128 1.00 10.48 ? 261 THR A OG1 1 
ATOM   1840  C CG2 . THR A 1 262 ? -11.339 32.429  -38.150 1.00 9.65  ? 261 THR A CG2 1 
ATOM   1841  N N   . LEU A 1 263 ? -9.749  33.012  -33.588 1.00 9.72  ? 262 LEU A N   1 
ATOM   1842  C CA  . LEU A 1 263 ? -9.677  33.822  -32.382 1.00 9.63  ? 262 LEU A CA  1 
ATOM   1843  C C   . LEU A 1 263 ? -8.608  34.901  -32.503 1.00 10.19 ? 262 LEU A C   1 
ATOM   1844  O O   . LEU A 1 263 ? -8.873  36.067  -32.222 1.00 10.67 ? 262 LEU A O   1 
ATOM   1845  C CB  . LEU A 1 263 ? -9.425  32.956  -31.151 1.00 8.84  ? 262 LEU A CB  1 
ATOM   1846  C CG  . LEU A 1 263 ? -9.449  33.636  -29.778 1.00 9.63  ? 262 LEU A CG  1 
ATOM   1847  C CD1 . LEU A 1 263 ? -10.816 34.318  -29.448 1.00 5.89  ? 262 LEU A CD1 1 
ATOM   1848  C CD2 . LEU A 1 263 ? -9.049  32.652  -28.678 1.00 8.78  ? 262 LEU A CD2 1 
ATOM   1849  N N   . HIS A 1 264 ? -7.425  34.528  -32.985 1.00 10.41 ? 263 HIS A N   1 
ATOM   1850  C CA  . HIS A 1 264 ? -6.333  35.481  -33.119 1.00 10.54 ? 263 HIS A CA  1 
ATOM   1851  C C   . HIS A 1 264 ? -6.678  36.681  -34.000 1.00 10.45 ? 263 HIS A C   1 
ATOM   1852  O O   . HIS A 1 264 ? -6.520  37.844  -33.586 1.00 10.89 ? 263 HIS A O   1 
ATOM   1853  C CB  . HIS A 1 264 ? -5.011  34.782  -33.550 1.00 10.70 ? 263 HIS A CB  1 
ATOM   1854  C CG  . HIS A 1 264 ? -5.026  34.125  -34.903 1.00 12.24 ? 263 HIS A CG  1 
ATOM   1855  N ND1 . HIS A 1 264 ? -5.975  33.197  -35.285 1.00 12.27 ? 263 HIS A ND1 1 
ATOM   1856  C CD2 . HIS A 1 264 ? -4.139  34.195  -35.932 1.00 12.92 ? 263 HIS A CD2 1 
ATOM   1857  C CE1 . HIS A 1 264 ? -5.692  32.748  -36.497 1.00 12.81 ? 263 HIS A CE1 1 
ATOM   1858  N NE2 . HIS A 1 264 ? -4.575  33.324  -36.909 1.00 11.64 ? 263 HIS A NE2 1 
ATOM   1859  N N   . VAL A 1 265 ? -7.192  36.406  -35.195 1.00 10.73 ? 264 VAL A N   1 
ATOM   1860  C CA  . VAL A 1 265 ? -7.583  37.467  -36.129 1.00 9.62  ? 264 VAL A CA  1 
ATOM   1861  C C   . VAL A 1 265 ? -8.816  38.298  -35.683 1.00 9.75  ? 264 VAL A C   1 
ATOM   1862  O O   . VAL A 1 265 ? -8.875  39.519  -35.934 1.00 9.53  ? 264 VAL A O   1 
ATOM   1863  C CB  . VAL A 1 265 ? -7.699  36.933  -37.588 1.00 10.31 ? 264 VAL A CB  1 
ATOM   1864  C CG1 . VAL A 1 265 ? -6.270  36.469  -38.101 1.00 8.28  ? 264 VAL A CG1 1 
ATOM   1865  C CG2 . VAL A 1 265 ? -8.753  35.879  -37.730 1.00 8.66  ? 264 VAL A CG2 1 
ATOM   1866  N N   . ARG A 1 266 ? -9.771  37.659  -35.007 1.00 8.80  ? 265 ARG A N   1 
ATOM   1867  C CA  . ARG A 1 266 ? -10.898 38.375  -34.395 1.00 8.71  ? 265 ARG A CA  1 
ATOM   1868  C C   . ARG A 1 266 ? -10.466 39.283  -33.274 1.00 8.83  ? 265 ARG A C   1 
ATOM   1869  O O   . ARG A 1 266 ? -10.811 40.459  -33.270 1.00 9.48  ? 265 ARG A O   1 
ATOM   1870  C CB  . ARG A 1 266 ? -11.976 37.412  -33.904 1.00 8.31  ? 265 ARG A CB  1 
ATOM   1871  C CG  . ARG A 1 266 ? -12.647 36.614  -35.068 1.00 7.97  ? 265 ARG A CG  1 
ATOM   1872  C CD  . ARG A 1 266 ? -13.806 35.763  -34.568 1.00 7.99  ? 265 ARG A CD  1 
ATOM   1873  N NE  . ARG A 1 266 ? -13.390 34.544  -33.843 1.00 8.48  ? 265 ARG A NE  1 
ATOM   1874  C CZ  . ARG A 1 266 ? -13.428 34.373  -32.527 1.00 7.54  ? 265 ARG A CZ  1 
ATOM   1875  N NH1 . ARG A 1 266 ? -13.831 35.330  -31.726 1.00 9.81  ? 265 ARG A NH1 1 
ATOM   1876  N NH2 . ARG A 1 266 ? -13.067 33.216  -32.004 1.00 10.02 ? 265 ARG A NH2 1 
ATOM   1877  N N   . MET A 1 267 ? -9.685  38.754  -32.341 1.00 9.51  ? 266 MET A N   1 
ATOM   1878  C CA  . MET A 1 267 ? -9.272  39.526  -31.157 1.00 10.35 ? 266 MET A CA  1 
ATOM   1879  C C   . MET A 1 267 ? -8.452  40.747  -31.523 1.00 10.85 ? 266 MET A C   1 
ATOM   1880  O O   . MET A 1 267 ? -8.661  41.827  -30.945 1.00 10.87 ? 266 MET A O   1 
ATOM   1881  C CB  . MET A 1 267 ? -8.513  38.650  -30.156 1.00 9.97  ? 266 MET A CB  1 
ATOM   1882  C CG  . MET A 1 267 ? -9.407  37.567  -29.504 1.00 10.39 ? 266 MET A CG  1 
ATOM   1883  S SD  . MET A 1 267 ? -11.074 38.061  -28.967 1.00 12.55 ? 266 MET A SD  1 
ATOM   1884  C CE  . MET A 1 267 ? -10.685 39.301  -27.727 1.00 8.30  ? 266 MET A CE  1 
ATOM   1885  N N   . GLU A 1 268 ? -7.533  40.585  -32.463 1.00 11.34 ? 267 GLU A N   1 
ATOM   1886  C CA  . GLU A 1 268 ? -6.745  41.733  -32.934 1.00 12.74 ? 267 GLU A CA  1 
ATOM   1887  C C   . GLU A 1 268 ? -7.637  42.824  -33.545 1.00 12.48 ? 267 GLU A C   1 
ATOM   1888  O O   . GLU A 1 268 ? -7.394  44.025  -33.379 1.00 12.76 ? 267 GLU A O   1 
ATOM   1889  C CB  . GLU A 1 268 ? -5.711  41.291  -33.939 1.00 13.40 ? 267 GLU A CB  1 
ATOM   1890  C CG  . GLU A 1 268 ? -4.563  40.507  -33.357 1.00 16.63 ? 267 GLU A CG  1 
ATOM   1891  C CD  . GLU A 1 268 ? -3.553  41.356  -32.550 1.00 20.13 ? 267 GLU A CD  1 
ATOM   1892  O OE1 . GLU A 1 268 ? -2.521  40.792  -32.160 1.00 20.61 ? 267 GLU A OE1 1 
ATOM   1893  O OE2 . GLU A 1 268 ? -3.773  42.556  -32.279 1.00 21.71 ? 267 GLU A OE2 1 
ATOM   1894  N N   . LYS A 1 269 ? -8.681  42.423  -34.251 1.00 13.25 ? 268 LYS A N   1 
ATOM   1895  C CA  . LYS A 1 269 ? -9.607  43.406  -34.816 1.00 12.93 ? 268 LYS A CA  1 
ATOM   1896  C C   . LYS A 1 269 ? -10.468 44.038  -33.720 1.00 12.99 ? 268 LYS A C   1 
ATOM   1897  O O   . LYS A 1 269 ? -10.749 45.238  -33.796 1.00 14.02 ? 268 LYS A O   1 
ATOM   1898  C CB  . LYS A 1 269 ? -10.485 42.774  -35.891 1.00 13.40 ? 268 LYS A CB  1 
ATOM   1899  C CG  . LYS A 1 269 ? -11.517 43.717  -36.531 1.00 15.69 ? 268 LYS A CG  1 
ATOM   1900  C CD  . LYS A 1 269 ? -10.938 44.951  -37.209 1.00 18.19 ? 268 LYS A CD  1 
ATOM   1901  C CE  . LYS A 1 269 ? -10.257 44.638  -38.540 1.00 21.77 ? 268 LYS A CE  1 
ATOM   1902  N NZ  . LYS A 1 269 ? -9.565  45.842  -39.137 1.00 21.45 ? 268 LYS A NZ  1 
ATOM   1903  N N   . HIS A 1 270 ? -10.925 43.239  -32.746 1.00 11.87 ? 269 HIS A N   1 
ATOM   1904  C CA  . HIS A 1 270 ? -11.628 43.773  -31.568 1.00 11.74 ? 269 HIS A CA  1 
ATOM   1905  C C   . HIS A 1 270 ? -10.794 44.858  -30.828 1.00 11.13 ? 269 HIS A C   1 
ATOM   1906  O O   . HIS A 1 270 ? -11.340 45.855  -30.352 1.00 9.95  ? 269 HIS A O   1 
ATOM   1907  C CB  . HIS A 1 270 ? -11.984 42.660  -30.581 1.00 10.88 ? 269 HIS A CB  1 
ATOM   1908  C CG  . HIS A 1 270 ? -13.125 41.787  -31.016 1.00 11.69 ? 269 HIS A CG  1 
ATOM   1909  N ND1 . HIS A 1 270 ? -14.389 42.279  -31.263 1.00 11.44 ? 269 HIS A ND1 1 
ATOM   1910  C CD2 . HIS A 1 270 ? -13.195 40.447  -31.233 1.00 11.08 ? 269 HIS A CD2 1 
ATOM   1911  C CE1 . HIS A 1 270 ? -15.187 41.280  -31.600 1.00 11.81 ? 269 HIS A CE1 1 
ATOM   1912  N NE2 . HIS A 1 270 ? -14.493 40.156  -31.574 1.00 10.62 ? 269 HIS A NE2 1 
ATOM   1913  N N   . PHE A 1 271 ? -9.499  44.605  -30.689 1.00 10.64 ? 270 PHE A N   1 
ATOM   1914  C CA  . PHE A 1 271 ? -8.566  45.548  -30.078 1.00 11.80 ? 270 PHE A CA  1 
ATOM   1915  C C   . PHE A 1 271 ? -8.486  46.855  -30.878 1.00 11.88 ? 270 PHE A C   1 
ATOM   1916  O O   . PHE A 1 271 ? -8.657  47.916  -30.307 1.00 13.15 ? 270 PHE A O   1 
ATOM   1917  C CB  . PHE A 1 271 ? -7.177  44.884  -29.944 1.00 11.46 ? 270 PHE A CB  1 
ATOM   1918  C CG  . PHE A 1 271 ? -6.159  45.665  -29.118 1.00 11.95 ? 270 PHE A CG  1 
ATOM   1919  C CD1 . PHE A 1 271 ? -6.493  46.782  -28.358 1.00 12.73 ? 270 PHE A CD1 1 
ATOM   1920  C CD2 . PHE A 1 271 ? -4.840  45.213  -29.064 1.00 13.21 ? 270 PHE A CD2 1 
ATOM   1921  C CE1 . PHE A 1 271 ? -5.519  47.442  -27.599 1.00 12.95 ? 270 PHE A CE1 1 
ATOM   1922  C CE2 . PHE A 1 271 ? -3.877  45.882  -28.291 1.00 13.81 ? 270 PHE A CE2 1 
ATOM   1923  C CZ  . PHE A 1 271 ? -4.232  46.979  -27.562 1.00 11.60 ? 270 PHE A CZ  1 
ATOM   1924  N N   . LYS A 1 272 ? -8.267  46.776  -32.189 1.00 12.58 ? 271 LYS A N   1 
ATOM   1925  C CA  . LYS A 1 272 ? -8.174  47.983  -33.015 1.00 13.78 ? 271 LYS A CA  1 
ATOM   1926  C C   . LYS A 1 272 ? -9.489  48.781  -32.963 1.00 12.76 ? 271 LYS A C   1 
ATOM   1927  O O   . LYS A 1 272 ? -9.466  49.979  -32.809 1.00 12.17 ? 271 LYS A O   1 
ATOM   1928  C CB  . LYS A 1 272 ? -7.877  47.678  -34.486 1.00 13.28 ? 271 LYS A CB  1 
ATOM   1929  C CG  . LYS A 1 272 ? -6.564  47.039  -34.832 1.00 18.18 ? 271 LYS A CG  1 
ATOM   1930  C CD  . LYS A 1 272 ? -6.629  46.370  -36.289 1.00 18.38 ? 271 LYS A CD  1 
ATOM   1931  C CE  . LYS A 1 272 ? -6.045  44.900  -36.378 1.00 24.05 ? 271 LYS A CE  1 
ATOM   1932  N NZ  . LYS A 1 272 ? -6.882  43.871  -37.222 1.00 22.04 ? 271 LYS A NZ  1 
ATOM   1933  N N   . ASN A 1 273 ? -10.618 48.104  -33.159 1.00 11.79 ? 272 ASN A N   1 
ATOM   1934  C CA  . ASN A 1 273 ? -11.908 48.777  -33.169 1.00 11.36 ? 272 ASN A CA  1 
ATOM   1935  C C   . ASN A 1 273 ? -12.309 49.315  -31.782 1.00 10.66 ? 272 ASN A C   1 
ATOM   1936  O O   . ASN A 1 273 ? -12.871 50.395  -31.661 1.00 10.14 ? 272 ASN A O   1 
ATOM   1937  C CB  . ASN A 1 273 ? -13.010 47.842  -33.725 1.00 11.47 ? 272 ASN A CB  1 
ATOM   1938  C CG  . ASN A 1 273 ? -13.095 47.833  -35.226 1.00 11.43 ? 272 ASN A CG  1 
ATOM   1939  O OD1 . ASN A 1 273 ? -12.394 48.577  -35.925 1.00 12.85 ? 272 ASN A OD1 1 
ATOM   1940  N ND2 . ASN A 1 273 ? -13.969 46.956  -35.752 1.00 10.24 ? 272 ASN A ND2 1 
ATOM   1941  N N   . GLY A 1 274 ? -11.992 48.561  -30.736 1.00 11.41 ? 273 GLY A N   1 
ATOM   1942  C CA  . GLY A 1 274 ? -12.339 48.912  -29.380 1.00 10.92 ? 273 GLY A CA  1 
ATOM   1943  C C   . GLY A 1 274 ? -11.558 50.118  -28.916 1.00 11.11 ? 273 GLY A C   1 
ATOM   1944  O O   . GLY A 1 274 ? -12.100 51.005  -28.266 1.00 10.89 ? 273 GLY A O   1 
ATOM   1945  N N   . MET A 1 275 ? -10.294 50.181  -29.309 1.00 11.59 ? 274 MET A N   1 
ATOM   1946  C CA  . MET A 1 275 ? -9.444  51.311  -28.972 1.00 12.26 ? 274 MET A CA  1 
ATOM   1947  C C   . MET A 1 275 ? -9.916  52.587  -29.708 1.00 11.64 ? 274 MET A C   1 
ATOM   1948  O O   . MET A 1 275 ? -9.994  53.653  -29.117 1.00 12.78 ? 274 MET A O   1 
ATOM   1949  C CB  . MET A 1 275 ? -7.981  50.963  -29.293 1.00 12.45 ? 274 MET A CB  1 
ATOM   1950  C CG  . MET A 1 275 ? -6.988  52.030  -28.926 1.00 16.47 ? 274 MET A CG  1 
ATOM   1951  S SD  . MET A 1 275 ? -6.721  52.169  -27.166 1.00 18.61 ? 274 MET A SD  1 
ATOM   1952  C CE  . MET A 1 275 ? -5.705  50.769  -26.897 1.00 24.23 ? 274 MET A CE  1 
ATOM   1953  N N   . ALA A 1 276 ? -10.213 52.482  -30.996 1.00 11.67 ? 275 ALA A N   1 
ATOM   1954  C CA  . ALA A 1 276 ? -10.780 53.598  -31.755 1.00 10.77 ? 275 ALA A CA  1 
ATOM   1955  C C   . ALA A 1 276 ? -12.090 54.090  -31.127 1.00 10.24 ? 275 ALA A C   1 
ATOM   1956  O O   . ALA A 1 276 ? -12.313 55.290  -31.013 1.00 9.83  ? 275 ALA A O   1 
ATOM   1957  C CB  . ALA A 1 276 ? -11.004 53.209  -33.209 1.00 9.93  ? 275 ALA A CB  1 
ATOM   1958  N N   . VAL A 1 277 ? -12.948 53.160  -30.720 1.00 10.10 ? 276 VAL A N   1 
ATOM   1959  C CA  . VAL A 1 277 ? -14.211 53.518  -30.090 1.00 9.32  ? 276 VAL A CA  1 
ATOM   1960  C C   . VAL A 1 277 ? -13.980 54.233  -28.773 1.00 9.77  ? 276 VAL A C   1 
ATOM   1961  O O   . VAL A 1 277 ? -14.610 55.253  -28.510 1.00 9.81  ? 276 VAL A O   1 
ATOM   1962  C CB  . VAL A 1 277 ? -15.160 52.301  -29.896 1.00 8.82  ? 276 VAL A CB  1 
ATOM   1963  C CG1 . VAL A 1 277 ? -16.276 52.648  -28.912 1.00 7.66  ? 276 VAL A CG1 1 
ATOM   1964  C CG2 . VAL A 1 277 ? -15.722 51.856  -31.246 1.00 8.02  ? 276 VAL A CG2 1 
ATOM   1965  N N   . ALA A 1 278 ? -13.083 53.697  -27.945 1.00 10.73 ? 277 ALA A N   1 
ATOM   1966  C CA  . ALA A 1 278 ? -12.775 54.261  -26.640 1.00 10.66 ? 277 ALA A CA  1 
ATOM   1967  C C   . ALA A 1 278 ? -12.227 55.684  -26.758 1.00 11.98 ? 277 ALA A C   1 
ATOM   1968  O O   . ALA A 1 278 ? -12.646 56.602  -26.032 1.00 11.65 ? 277 ALA A O   1 
ATOM   1969  C CB  . ALA A 1 278 ? -11.775 53.368  -25.897 1.00 10.36 ? 277 ALA A CB  1 
ATOM   1970  N N   . GLN A 1 279 ? -11.281 55.858  -27.676 1.00 12.98 ? 278 GLN A N   1 
ATOM   1971  C CA  . GLN A 1 279 ? -10.632 57.146  -27.881 1.00 14.49 ? 278 GLN A CA  1 
ATOM   1972  C C   . GLN A 1 279 ? -11.637 58.164  -28.384 1.00 13.22 ? 278 GLN A C   1 
ATOM   1973  O O   . GLN A 1 279 ? -11.688 59.292  -27.882 1.00 10.98 ? 278 GLN A O   1 
ATOM   1974  C CB  . GLN A 1 279 ? -9.452  57.003  -28.849 1.00 14.55 ? 278 GLN A CB  1 
ATOM   1975  C CG  . GLN A 1 279 ? -8.370  56.105  -28.258 1.00 18.71 ? 278 GLN A CG  1 
ATOM   1976  C CD  . GLN A 1 279 ? -7.156  55.955  -29.138 1.00 20.39 ? 278 GLN A CD  1 
ATOM   1977  O OE1 . GLN A 1 279 ? -7.215  55.367  -30.241 1.00 24.14 ? 278 GLN A OE1 1 
ATOM   1978  N NE2 . GLN A 1 279 ? -6.016  56.468  -28.640 1.00 25.88 ? 278 GLN A NE2 1 
ATOM   1979  N N   . PHE A 1 280 ? -12.462 57.741  -29.344 1.00 12.43 ? 279 PHE A N   1 
ATOM   1980  C CA  . PHE A 1 280 ? -13.553 58.578  -29.846 1.00 12.10 ? 279 PHE A CA  1 
ATOM   1981  C C   . PHE A 1 280 ? -14.504 59.055  -28.728 1.00 11.96 ? 279 PHE A C   1 
ATOM   1982  O O   . PHE A 1 280 ? -14.883 60.237  -28.686 1.00 13.21 ? 279 PHE A O   1 
ATOM   1983  C CB  . PHE A 1 280 ? -14.363 57.880  -30.956 1.00 11.95 ? 279 PHE A CB  1 
ATOM   1984  C CG  . PHE A 1 280 ? -15.655 58.582  -31.270 1.00 11.49 ? 279 PHE A CG  1 
ATOM   1985  C CD1 . PHE A 1 280 ? -15.692 59.620  -32.181 1.00 13.97 ? 279 PHE A CD1 1 
ATOM   1986  C CD2 . PHE A 1 280 ? -16.819 58.262  -30.580 1.00 12.37 ? 279 PHE A CD2 1 
ATOM   1987  C CE1 . PHE A 1 280 ? -16.877 60.310  -32.420 1.00 13.85 ? 279 PHE A CE1 1 
ATOM   1988  C CE2 . PHE A 1 280 ? -18.007 58.941  -30.806 1.00 12.99 ? 279 PHE A CE2 1 
ATOM   1989  C CZ  . PHE A 1 280 ? -18.041 59.956  -31.729 1.00 14.34 ? 279 PHE A CZ  1 
ATOM   1990  N N   . LEU A 1 281 ? -14.920 58.137  -27.864 1.00 11.50 ? 280 LEU A N   1 
ATOM   1991  C CA  . LEU A 1 281 ? -15.858 58.450  -26.762 1.00 11.01 ? 280 LEU A CA  1 
ATOM   1992  C C   . LEU A 1 281 ? -15.244 59.381  -25.728 1.00 11.32 ? 280 LEU A C   1 
ATOM   1993  O O   . LEU A 1 281 ? -15.875 60.346  -25.267 1.00 9.72  ? 280 LEU A O   1 
ATOM   1994  C CB  . LEU A 1 281 ? -16.342 57.162  -26.092 1.00 10.46 ? 280 LEU A CB  1 
ATOM   1995  C CG  . LEU A 1 281 ? -17.304 56.292  -26.911 1.00 11.06 ? 280 LEU A CG  1 
ATOM   1996  C CD1 . LEU A 1 281 ? -17.479 54.895  -26.305 1.00 10.23 ? 280 LEU A CD1 1 
ATOM   1997  C CD2 . LEU A 1 281 ? -18.672 57.022  -27.079 1.00 9.61  ? 280 LEU A CD2 1 
ATOM   1998  N N   . GLU A 1 282 ? -13.995 59.123  -25.362 1.00 11.96 ? 281 GLU A N   1 
ATOM   1999  C CA  . GLU A 1 282 ? -13.360 59.970  -24.368 1.00 12.94 ? 281 GLU A CA  1 
ATOM   2000  C C   . GLU A 1 282 ? -13.132 61.427  -24.857 1.00 13.05 ? 281 GLU A C   1 
ATOM   2001  O O   . GLU A 1 282 ? -13.106 62.349  -24.047 1.00 14.51 ? 281 GLU A O   1 
ATOM   2002  C CB  . GLU A 1 282 ? -12.068 59.353  -23.870 1.00 12.87 ? 281 GLU A CB  1 
ATOM   2003  C CG  . GLU A 1 282 ? -11.671 59.870  -22.517 1.00 13.33 ? 281 GLU A CG  1 
ATOM   2004  C CD  . GLU A 1 282 ? -10.514 59.115  -21.904 1.00 13.91 ? 281 GLU A CD  1 
ATOM   2005  O OE1 . GLU A 1 282 ? -10.723 58.457  -20.859 1.00 14.17 ? 281 GLU A OE1 1 
ATOM   2006  O OE2 . GLU A 1 282 ? -9.406  59.208  -22.435 1.00 14.16 ? 281 GLU A OE2 1 
ATOM   2007  N N   . SER A 1 283 ? -12.978 61.607  -26.158 1.00 13.29 ? 282 SER A N   1 
ATOM   2008  C CA  . SER A 1 283 ? -12.827 62.938  -26.775 1.00 14.06 ? 282 SER A CA  1 
ATOM   2009  C C   . SER A 1 283 ? -14.166 63.595  -27.104 1.00 13.98 ? 282 SER A C   1 
ATOM   2010  O O   . SER A 1 283 ? -14.190 64.674  -27.649 1.00 13.95 ? 282 SER A O   1 
ATOM   2011  C CB  . SER A 1 283 ? -11.991 62.837  -28.048 1.00 14.33 ? 282 SER A CB  1 
ATOM   2012  O OG  . SER A 1 283 ? -10.631 62.595  -27.721 1.00 18.23 ? 282 SER A OG  1 
ATOM   2013  N N   . ASN A 1 284 ? -15.264 62.931  -26.760 1.00 14.61 ? 283 ASN A N   1 
ATOM   2014  C CA  . ASN A 1 284 ? -16.606 63.390  -27.080 1.00 15.92 ? 283 ASN A CA  1 
ATOM   2015  C C   . ASN A 1 284 ? -17.162 64.110  -25.850 1.00 16.66 ? 283 ASN A C   1 
ATOM   2016  O O   . ASN A 1 284 ? -17.120 63.569  -24.744 1.00 16.49 ? 283 ASN A O   1 
ATOM   2017  C CB  . ASN A 1 284 ? -17.488 62.199  -27.506 1.00 16.11 ? 283 ASN A CB  1 
ATOM   2018  C CG  . ASN A 1 284 ? -18.818 62.631  -28.092 1.00 16.41 ? 283 ASN A CG  1 
ATOM   2019  O OD1 . ASN A 1 284 ? -19.665 63.200  -27.402 1.00 18.04 ? 283 ASN A OD1 1 
ATOM   2020  N ND2 . ASN A 1 284 ? -19.024 62.324  -29.353 1.00 18.26 ? 283 ASN A ND2 1 
ATOM   2021  N N   . PRO A 1 285 ? -17.618 65.358  -26.024 1.00 17.97 ? 284 PRO A N   1 
ATOM   2022  C CA  . PRO A 1 285 ? -18.027 66.125  -24.854 1.00 19.30 ? 284 PRO A CA  1 
ATOM   2023  C C   . PRO A 1 285 ? -19.390 65.711  -24.252 1.00 19.08 ? 284 PRO A C   1 
ATOM   2024  O O   . PRO A 1 285 ? -19.719 66.197  -23.180 1.00 19.34 ? 284 PRO A O   1 
ATOM   2025  C CB  . PRO A 1 285 ? -18.099 67.554  -25.391 1.00 19.34 ? 284 PRO A CB  1 
ATOM   2026  C CG  . PRO A 1 285 ? -18.477 67.370  -26.806 1.00 19.15 ? 284 PRO A CG  1 
ATOM   2027  C CD  . PRO A 1 285 ? -17.794 66.132  -27.266 1.00 18.31 ? 284 PRO A CD  1 
ATOM   2028  N N   . TRP A 1 286 ? -20.152 64.837  -24.915 1.00 19.03 ? 285 TRP A N   1 
ATOM   2029  C CA  . TRP A 1 286 ? -21.364 64.269  -24.303 1.00 19.38 ? 285 TRP A CA  1 
ATOM   2030  C C   . TRP A 1 286 ? -21.079 63.010  -23.439 1.00 18.05 ? 285 TRP A C   1 
ATOM   2031  O O   . TRP A 1 286 ? -21.996 62.427  -22.845 1.00 17.30 ? 285 TRP A O   1 
ATOM   2032  C CB  . TRP A 1 286 ? -22.404 63.905  -25.353 1.00 21.15 ? 285 TRP A CB  1 
ATOM   2033  C CG  . TRP A 1 286 ? -22.643 64.901  -26.453 1.00 23.11 ? 285 TRP A CG  1 
ATOM   2034  C CD1 . TRP A 1 286 ? -22.511 64.686  -27.822 1.00 24.81 ? 285 TRP A CD1 1 
ATOM   2035  C CD2 . TRP A 1 286 ? -23.077 66.243  -26.306 1.00 23.51 ? 285 TRP A CD2 1 
ATOM   2036  N NE1 . TRP A 1 286 ? -22.830 65.834  -28.515 1.00 25.32 ? 285 TRP A NE1 1 
ATOM   2037  C CE2 . TRP A 1 286 ? -23.178 66.802  -27.606 1.00 24.78 ? 285 TRP A CE2 1 
ATOM   2038  C CE3 . TRP A 1 286 ? -23.375 67.033  -25.209 1.00 24.71 ? 285 TRP A CE3 1 
ATOM   2039  C CZ2 . TRP A 1 286 ? -23.574 68.112  -27.819 1.00 26.35 ? 285 TRP A CZ2 1 
ATOM   2040  C CZ3 . TRP A 1 286 ? -23.768 68.332  -25.418 1.00 24.28 ? 285 TRP A CZ3 1 
ATOM   2041  C CH2 . TRP A 1 286 ? -23.862 68.865  -26.710 1.00 25.83 ? 285 TRP A CH2 1 
ATOM   2042  N N   . VAL A 1 287 ? -19.822 62.593  -23.367 1.00 16.03 ? 286 VAL A N   1 
ATOM   2043  C CA  . VAL A 1 287 ? -19.451 61.426  -22.604 1.00 15.23 ? 286 VAL A CA  1 
ATOM   2044  C C   . VAL A 1 287 ? -18.778 61.842  -21.302 1.00 15.30 ? 286 VAL A C   1 
ATOM   2045  O O   . VAL A 1 287 ? -17.747 62.513  -21.303 1.00 14.97 ? 286 VAL A O   1 
ATOM   2046  C CB  . VAL A 1 287 ? -18.508 60.493  -23.433 1.00 15.48 ? 286 VAL A CB  1 
ATOM   2047  C CG1 . VAL A 1 287 ? -18.043 59.318  -22.599 1.00 13.67 ? 286 VAL A CG1 1 
ATOM   2048  C CG2 . VAL A 1 287 ? -19.207 60.028  -24.655 1.00 13.91 ? 286 VAL A CG2 1 
ATOM   2049  N N   . GLU A 1 288 ? -19.345 61.398  -20.191 1.00 15.44 ? 287 GLU A N   1 
ATOM   2050  C CA  . GLU A 1 288 ? -18.857 61.783  -18.889 1.00 15.59 ? 287 GLU A CA  1 
ATOM   2051  C C   . GLU A 1 288 ? -17.516 61.113  -18.545 1.00 15.60 ? 287 GLU A C   1 
ATOM   2052  O O   . GLU A 1 288 ? -16.606 61.741  -17.987 1.00 15.38 ? 287 GLU A O   1 
ATOM   2053  C CB  . GLU A 1 288 ? -19.911 61.419  -17.854 1.00 16.51 ? 287 GLU A CB  1 
ATOM   2054  C CG  . GLU A 1 288 ? -19.557 61.790  -16.428 1.00 18.50 ? 287 GLU A CG  1 
ATOM   2055  C CD  . GLU A 1 288 ? -19.444 63.286  -16.206 1.00 20.61 ? 287 GLU A CD  1 
ATOM   2056  O OE1 . GLU A 1 288 ? -20.130 64.076  -16.884 1.00 25.26 ? 287 GLU A OE1 1 
ATOM   2057  O OE2 . GLU A 1 288 ? -18.664 63.676  -15.322 1.00 25.52 ? 287 GLU A OE2 1 
ATOM   2058  N N   . LYS A 1 289 ? -17.398 59.836  -18.887 1.00 14.94 ? 288 LYS A N   1 
ATOM   2059  C CA  . LYS A 1 289 ? -16.235 59.036  -18.498 1.00 14.30 ? 288 LYS A CA  1 
ATOM   2060  C C   . LYS A 1 289 ? -16.215 57.757  -19.312 1.00 13.27 ? 288 LYS A C   1 
ATOM   2061  O O   . LYS A 1 289 ? -17.259 57.141  -19.533 1.00 12.04 ? 288 LYS A O   1 
ATOM   2062  C CB  . LYS A 1 289 ? -16.319 58.696  -17.023 1.00 14.82 ? 288 LYS A CB  1 
ATOM   2063  C CG  . LYS A 1 289 ? -15.043 58.089  -16.457 1.00 16.36 ? 288 LYS A CG  1 
ATOM   2064  C CD  . LYS A 1 289 ? -15.343 57.479  -15.138 1.00 20.79 ? 288 LYS A CD  1 
ATOM   2065  C CE  . LYS A 1 289 ? -14.113 57.313  -14.287 1.00 23.04 ? 288 LYS A CE  1 
ATOM   2066  N NZ  . LYS A 1 289 ? -14.574 57.067  -12.889 1.00 27.83 ? 288 LYS A NZ  1 
ATOM   2067  N N   . VAL A 1 290 ? -15.035 57.395  -19.793 1.00 13.00 ? 289 VAL A N   1 
ATOM   2068  C CA  . VAL A 1 290 ? -14.836 56.148  -20.516 1.00 13.39 ? 289 VAL A CA  1 
ATOM   2069  C C   . VAL A 1 290 ? -13.982 55.217  -19.657 1.00 14.00 ? 289 VAL A C   1 
ATOM   2070  O O   . VAL A 1 290 ? -13.002 55.635  -19.040 1.00 14.16 ? 289 VAL A O   1 
ATOM   2071  C CB  . VAL A 1 290 ? -14.154 56.389  -21.877 1.00 13.04 ? 289 VAL A CB  1 
ATOM   2072  C CG1 . VAL A 1 290 ? -13.839 55.071  -22.615 1.00 12.48 ? 289 VAL A CG1 1 
ATOM   2073  C CG2 . VAL A 1 290 ? -15.020 57.287  -22.728 1.00 14.19 ? 289 VAL A CG2 1 
ATOM   2074  N N   . ILE A 1 291 ? -14.366 53.948  -19.605 1.00 14.85 ? 290 ILE A N   1 
ATOM   2075  C CA  . ILE A 1 291 ? -13.548 52.938  -18.928 1.00 14.73 ? 290 ILE A CA  1 
ATOM   2076  C C   . ILE A 1 291 ? -13.118 51.890  -19.951 1.00 14.31 ? 290 ILE A C   1 
ATOM   2077  O O   . ILE A 1 291 ? -13.914 51.059  -20.376 1.00 14.13 ? 290 ILE A O   1 
ATOM   2078  C CB  . ILE A 1 291 ? -14.282 52.264  -17.765 1.00 15.53 ? 290 ILE A CB  1 
ATOM   2079  C CG1 . ILE A 1 291 ? -14.720 53.311  -16.721 1.00 16.51 ? 290 ILE A CG1 1 
ATOM   2080  C CG2 . ILE A 1 291 ? -13.375 51.184  -17.134 1.00 13.04 ? 290 ILE A CG2 1 
ATOM   2081  C CD1 . ILE A 1 291 ? -15.949 52.904  -15.948 1.00 17.86 ? 290 ILE A CD1 1 
ATOM   2082  N N   . TYR A 1 292 ? -11.852 51.966  -20.344 1.00 13.85 ? 291 TYR A N   1 
ATOM   2083  C CA  . TYR A 1 292 ? -11.259 51.042  -21.311 1.00 13.31 ? 291 TYR A CA  1 
ATOM   2084  C C   . TYR A 1 292 ? -9.790  50.794  -20.961 1.00 13.87 ? 291 TYR A C   1 
ATOM   2085  O O   . TYR A 1 292 ? -8.979  51.729  -20.984 1.00 13.72 ? 291 TYR A O   1 
ATOM   2086  C CB  . TYR A 1 292 ? -11.323 51.592  -22.717 1.00 12.42 ? 291 TYR A CB  1 
ATOM   2087  C CG  . TYR A 1 292 ? -10.840 50.595  -23.746 1.00 11.36 ? 291 TYR A CG  1 
ATOM   2088  C CD1 . TYR A 1 292 ? -11.513 49.399  -23.949 1.00 11.96 ? 291 TYR A CD1 1 
ATOM   2089  C CD2 . TYR A 1 292 ? -9.725  50.860  -24.539 1.00 12.62 ? 291 TYR A CD2 1 
ATOM   2090  C CE1 . TYR A 1 292 ? -11.069 48.480  -24.916 1.00 12.13 ? 291 TYR A CE1 1 
ATOM   2091  C CE2 . TYR A 1 292 ? -9.276  49.961  -25.485 1.00 11.19 ? 291 TYR A CE2 1 
ATOM   2092  C CZ  . TYR A 1 292 ? -9.944  48.768  -25.670 1.00 11.59 ? 291 TYR A CZ  1 
ATOM   2093  O OH  . TYR A 1 292 ? -9.474  47.892  -26.631 1.00 10.57 ? 291 TYR A OH  1 
ATOM   2094  N N   . PRO A 1 293 ? -9.447  49.541  -20.638 1.00 14.58 ? 292 PRO A N   1 
ATOM   2095  C CA  . PRO A 1 293 ? -8.096  49.201  -20.208 1.00 15.00 ? 292 PRO A CA  1 
ATOM   2096  C C   . PRO A 1 293 ? -6.971  49.691  -21.109 1.00 14.91 ? 292 PRO A C   1 
ATOM   2097  O O   . PRO A 1 293 ? -5.869  49.841  -20.636 1.00 15.11 ? 292 PRO A O   1 
ATOM   2098  C CB  . PRO A 1 293 ? -8.124  47.662  -20.195 1.00 15.23 ? 292 PRO A CB  1 
ATOM   2099  C CG  . PRO A 1 293 ? -9.516  47.354  -19.827 1.00 15.26 ? 292 PRO A CG  1 
ATOM   2100  C CD  . PRO A 1 293 ? -10.337 48.369  -20.565 1.00 14.94 ? 292 PRO A CD  1 
ATOM   2101  N N   . GLY A 1 294 ? -7.249  49.874  -22.395 1.00 15.11 ? 293 GLY A N   1 
ATOM   2102  C CA  . GLY A 1 294 ? -6.261  50.336  -23.349 1.00 14.90 ? 293 GLY A CA  1 
ATOM   2103  C C   . GLY A 1 294 ? -6.020  51.821  -23.396 1.00 14.48 ? 293 GLY A C   1 
ATOM   2104  O O   . GLY A 1 294 ? -5.092  52.246  -24.046 1.00 14.84 ? 293 GLY A O   1 
ATOM   2105  N N   . LEU A 1 295 ? -6.854  52.615  -22.727 1.00 14.73 ? 294 LEU A N   1 
ATOM   2106  C CA  . LEU A 1 295 ? -6.629  54.065  -22.597 1.00 14.43 ? 294 LEU A CA  1 
ATOM   2107  C C   . LEU A 1 295 ? -5.757  54.358  -21.378 1.00 14.22 ? 294 LEU A C   1 
ATOM   2108  O O   . LEU A 1 295 ? -5.938  53.746  -20.329 1.00 13.68 ? 294 LEU A O   1 
ATOM   2109  C CB  . LEU A 1 295 ? -7.961  54.827  -22.437 1.00 14.62 ? 294 LEU A CB  1 
ATOM   2110  C CG  . LEU A 1 295 ? -8.938  54.874  -23.621 1.00 14.11 ? 294 LEU A CG  1 
ATOM   2111  C CD1 . LEU A 1 295 ? -10.199 55.662  -23.194 1.00 15.11 ? 294 LEU A CD1 1 
ATOM   2112  C CD2 . LEU A 1 295 ? -8.304  55.465  -24.839 1.00 16.30 ? 294 LEU A CD2 1 
ATOM   2113  N N   . PRO A 1 296 ? -4.805  55.295  -21.507 1.00 14.92 ? 295 PRO A N   1 
ATOM   2114  C CA  . PRO A 1 296 ? -3.996  55.709  -20.349 1.00 15.06 ? 295 PRO A CA  1 
ATOM   2115  C C   . PRO A 1 296 ? -4.787  56.263  -19.176 1.00 15.16 ? 295 PRO A C   1 
ATOM   2116  O O   . PRO A 1 296 ? -4.277  56.310  -18.043 1.00 16.00 ? 295 PRO A O   1 
ATOM   2117  C CB  . PRO A 1 296 ? -3.089  56.808  -20.923 1.00 14.82 ? 295 PRO A CB  1 
ATOM   2118  C CG  . PRO A 1 296 ? -3.093  56.594  -22.368 1.00 16.79 ? 295 PRO A CG  1 
ATOM   2119  C CD  . PRO A 1 296 ? -4.386  55.968  -22.748 1.00 14.71 ? 295 PRO A CD  1 
ATOM   2120  N N   . SER A 1 297 ? -6.007  56.715  -19.443 1.00 15.01 ? 296 SER A N   1 
ATOM   2121  C CA  . SER A 1 297 ? -6.900  57.181  -18.400 1.00 15.21 ? 296 SER A CA  1 
ATOM   2122  C C   . SER A 1 297 ? -7.346  56.054  -17.490 1.00 15.76 ? 296 SER A C   1 
ATOM   2123  O O   . SER A 1 297 ? -7.787  56.309  -16.379 1.00 16.75 ? 296 SER A O   1 
ATOM   2124  C CB  . SER A 1 297 ? -8.139  57.852  -19.002 1.00 15.24 ? 296 SER A CB  1 
ATOM   2125  O OG  . SER A 1 297 ? -8.865  56.918  -19.787 1.00 14.02 ? 296 SER A OG  1 
ATOM   2126  N N   . HIS A 1 298 ? -7.266  54.797  -17.934 1.00 15.85 ? 297 HIS A N   1 
ATOM   2127  C CA  . HIS A 1 298 ? -7.758  53.720  -17.079 1.00 15.37 ? 297 HIS A CA  1 
ATOM   2128  C C   . HIS A 1 298 ? -6.866  53.617  -15.861 1.00 15.70 ? 297 HIS A C   1 
ATOM   2129  O O   . HIS A 1 298 ? -5.660  53.628  -16.000 1.00 15.95 ? 297 HIS A O   1 
ATOM   2130  C CB  . HIS A 1 298 ? -7.749  52.380  -17.792 1.00 15.48 ? 297 HIS A CB  1 
ATOM   2131  C CG  . HIS A 1 298 ? -8.482  51.311  -17.052 1.00 14.17 ? 297 HIS A CG  1 
ATOM   2132  N ND1 . HIS A 1 298 ? -7.942  50.637  -15.979 1.00 15.69 ? 297 HIS A ND1 1 
ATOM   2133  C CD2 . HIS A 1 298 ? -9.711  50.779  -17.255 1.00 14.42 ? 297 HIS A CD2 1 
ATOM   2134  C CE1 . HIS A 1 298 ? -8.822  49.749  -15.541 1.00 16.23 ? 297 HIS A CE1 1 
ATOM   2135  N NE2 . HIS A 1 298 ? -9.900  49.812  -16.305 1.00 14.75 ? 297 HIS A NE2 1 
ATOM   2136  N N   . PRO A 1 299 ? -7.448  53.510  -14.672 1.00 16.76 ? 298 PRO A N   1 
ATOM   2137  C CA  . PRO A 1 299 ? -6.634  53.480  -13.453 1.00 17.79 ? 298 PRO A CA  1 
ATOM   2138  C C   . PRO A 1 299 ? -5.607  52.377  -13.378 1.00 18.11 ? 298 PRO A C   1 
ATOM   2139  O O   . PRO A 1 299 ? -4.577  52.547  -12.734 1.00 19.06 ? 298 PRO A O   1 
ATOM   2140  C CB  . PRO A 1 299 ? -7.672  53.274  -12.352 1.00 18.30 ? 298 PRO A CB  1 
ATOM   2141  C CG  . PRO A 1 299 ? -8.898  53.797  -12.904 1.00 18.39 ? 298 PRO A CG  1 
ATOM   2142  C CD  . PRO A 1 299 ? -8.880  53.504  -14.362 1.00 16.82 ? 298 PRO A CD  1 
ATOM   2143  N N   . GLN A 1 300 ? -5.874  51.242  -14.020 1.00 18.30 ? 299 GLN A N   1 
ATOM   2144  C CA  . GLN A 1 300 ? -4.933  50.117  -14.012 1.00 17.71 ? 299 GLN A CA  1 
ATOM   2145  C C   . GLN A 1 300 ? -4.235  49.930  -15.355 1.00 17.62 ? 299 GLN A C   1 
ATOM   2146  O O   . GLN A 1 300 ? -3.765  48.848  -15.627 1.00 18.07 ? 299 GLN A O   1 
ATOM   2147  C CB  . GLN A 1 300 ? -5.642  48.811  -13.614 1.00 17.57 ? 299 GLN A CB  1 
ATOM   2148  C CG  . GLN A 1 300 ? -5.975  48.701  -12.144 1.00 17.71 ? 299 GLN A CG  1 
ATOM   2149  C CD  . GLN A 1 300 ? -7.309  49.317  -11.803 1.00 20.02 ? 299 GLN A CD  1 
ATOM   2150  O OE1 . GLN A 1 300 ? -8.334  49.066  -12.470 1.00 20.63 ? 299 GLN A OE1 1 
ATOM   2151  N NE2 . GLN A 1 300 ? -7.333  50.082  -10.721 1.00 18.53 ? 299 GLN A NE2 1 
ATOM   2152  N N   . HIS A 1 301 ? -4.170  50.973  -16.185 1.00 16.98 ? 300 HIS A N   1 
ATOM   2153  C CA  . HIS A 1 301 ? -3.578  50.863  -17.509 1.00 16.73 ? 300 HIS A CA  1 
ATOM   2154  C C   . HIS A 1 301 ? -2.167  50.219  -17.543 1.00 17.19 ? 300 HIS A C   1 
ATOM   2155  O O   . HIS A 1 301 ? -1.866  49.374  -18.375 1.00 17.86 ? 300 HIS A O   1 
ATOM   2156  C CB  . HIS A 1 301 ? -3.561  52.243  -18.194 1.00 16.67 ? 300 HIS A CB  1 
ATOM   2157  C CG  . HIS A 1 301 ? -3.028  52.211  -19.591 1.00 15.11 ? 300 HIS A CG  1 
ATOM   2158  N ND1 . HIS A 1 301 ? -3.648  51.510  -20.607 1.00 13.27 ? 300 HIS A ND1 1 
ATOM   2159  C CD2 . HIS A 1 301 ? -1.928  52.777  -20.141 1.00 15.34 ? 300 HIS A CD2 1 
ATOM   2160  C CE1 . HIS A 1 301 ? -2.946  51.639  -21.718 1.00 15.77 ? 300 HIS A CE1 1 
ATOM   2161  N NE2 . HIS A 1 301 ? -1.910  52.420  -21.471 1.00 14.31 ? 300 HIS A NE2 1 
ATOM   2162  N N   . GLU A 1 302 ? -1.292  50.651  -16.659 1.00 18.04 ? 301 GLU A N   1 
ATOM   2163  C CA  . GLU A 1 302 ? 0.063   50.104  -16.602 1.00 18.35 ? 301 GLU A CA  1 
ATOM   2164  C C   . GLU A 1 302 ? 0.080   48.636  -16.138 1.00 17.42 ? 301 GLU A C   1 
ATOM   2165  O O   . GLU A 1 302 ? 0.877   47.850  -16.623 1.00 18.17 ? 301 GLU A O   1 
ATOM   2166  C CB  . GLU A 1 302 ? 0.977   51.017  -15.742 1.00 19.21 ? 301 GLU A CB  1 
ATOM   2167  C CG  . GLU A 1 302 ? 1.259   52.415  -16.372 1.00 21.76 ? 301 GLU A CG  1 
ATOM   2168  C CD  . GLU A 1 302 ? 1.930   52.342  -17.761 1.00 24.59 ? 301 GLU A CD  1 
ATOM   2169  O OE1 . GLU A 1 302 ? 2.635   51.358  -18.051 1.00 27.61 ? 301 GLU A OE1 1 
ATOM   2170  O OE2 . GLU A 1 302 ? 1.731   53.261  -18.583 1.00 28.27 ? 301 GLU A OE2 1 
ATOM   2171  N N   . LEU A 1 303 ? -0.810  48.268  -15.234 1.00 16.87 ? 302 LEU A N   1 
ATOM   2172  C CA  . LEU A 1 303 ? -0.958  46.883  -14.817 1.00 17.43 ? 302 LEU A CA  1 
ATOM   2173  C C   . LEU A 1 303 ? -1.427  46.022  -15.984 1.00 16.97 ? 302 LEU A C   1 
ATOM   2174  O O   . LEU A 1 303 ? -0.934  44.919  -16.181 1.00 17.03 ? 302 LEU A O   1 
ATOM   2175  C CB  . LEU A 1 303 ? -1.952  46.761  -13.654 1.00 16.71 ? 302 LEU A CB  1 
ATOM   2176  C CG  . LEU A 1 303 ? -2.360  45.347  -13.217 1.00 16.73 ? 302 LEU A CG  1 
ATOM   2177  C CD1 . LEU A 1 303 ? -1.151  44.445  -12.779 1.00 14.71 ? 302 LEU A CD1 1 
ATOM   2178  C CD2 . LEU A 1 303 ? -3.405  45.460  -12.134 1.00 14.81 ? 302 LEU A CD2 1 
ATOM   2179  N N   . VAL A 1 304 ? -2.412  46.528  -16.718 1.00 17.59 ? 303 VAL A N   1 
ATOM   2180  C CA  . VAL A 1 304 ? -2.913  45.876  -17.929 1.00 17.59 ? 303 VAL A CA  1 
ATOM   2181  C C   . VAL A 1 304 ? -1.783  45.565  -18.908 1.00 18.20 ? 303 VAL A C   1 
ATOM   2182  O O   . VAL A 1 304 ? -1.645  44.427  -19.367 1.00 17.83 ? 303 VAL A O   1 
ATOM   2183  C CB  . VAL A 1 304 ? -4.012  46.741  -18.615 1.00 18.10 ? 303 VAL A CB  1 
ATOM   2184  C CG1 . VAL A 1 304 ? -4.295  46.258  -20.005 1.00 16.00 ? 303 VAL A CG1 1 
ATOM   2185  C CG2 . VAL A 1 304 ? -5.305  46.760  -17.754 1.00 17.34 ? 303 VAL A CG2 1 
ATOM   2186  N N   . LYS A 1 305 ? -0.940  46.548  -19.205 1.00 18.65 ? 304 LYS A N   1 
ATOM   2187  C CA  . LYS A 1 305 ? 0.210   46.287  -20.076 1.00 19.15 ? 304 LYS A CA  1 
ATOM   2188  C C   . LYS A 1 305 ? 1.223   45.266  -19.512 1.00 18.81 ? 304 LYS A C   1 
ATOM   2189  O O   . LYS A 1 305 ? 1.898   44.602  -20.280 1.00 18.01 ? 304 LYS A O   1 
ATOM   2190  C CB  . LYS A 1 305 ? 0.913   47.583  -20.484 1.00 19.60 ? 304 LYS A CB  1 
ATOM   2191  C CG  . LYS A 1 305 ? -0.014  48.535  -21.170 1.00 22.06 ? 304 LYS A CG  1 
ATOM   2192  C CD  . LYS A 1 305 ? 0.688   49.566  -21.999 1.00 25.91 ? 304 LYS A CD  1 
ATOM   2193  C CE  . LYS A 1 305 ? 1.441   50.557  -21.171 1.00 28.57 ? 304 LYS A CE  1 
ATOM   2194  N NZ  . LYS A 1 305 ? 2.240   51.440  -22.081 1.00 32.01 ? 304 LYS A NZ  1 
ATOM   2195  N N   . ARG A 1 306 ? 1.302   45.114  -18.191 1.00 19.02 ? 305 ARG A N   1 
ATOM   2196  C CA  . ARG A 1 306 ? 2.217   44.126  -17.597 1.00 19.70 ? 305 ARG A CA  1 
ATOM   2197  C C   . ARG A 1 306 ? 1.664   42.708  -17.671 1.00 18.86 ? 305 ARG A C   1 
ATOM   2198  O O   . ARG A 1 306 ? 2.424   41.749  -17.756 1.00 19.03 ? 305 ARG A O   1 
ATOM   2199  C CB  . ARG A 1 306 ? 2.516   44.440  -16.123 1.00 20.02 ? 305 ARG A CB  1 
ATOM   2200  C CG  . ARG A 1 306 ? 3.372   45.687  -15.882 1.00 21.61 ? 305 ARG A CG  1 
ATOM   2201  C CD  . ARG A 1 306 ? 3.932   45.732  -14.452 1.00 22.03 ? 305 ARG A CD  1 
ATOM   2202  N NE  . ARG A 1 306 ? 2.922   45.794  -13.389 1.00 23.97 ? 305 ARG A NE  1 
ATOM   2203  C CZ  . ARG A 1 306 ? 2.253   46.892  -13.023 1.00 24.56 ? 305 ARG A CZ  1 
ATOM   2204  N NH1 . ARG A 1 306 ? 2.410   48.047  -13.659 1.00 26.74 ? 305 ARG A NH1 1 
ATOM   2205  N NH2 . ARG A 1 306 ? 1.376   46.819  -12.035 1.00 25.47 ? 305 ARG A NH2 1 
ATOM   2206  N N   . GLN A 1 307 ? 0.345   42.566  -17.582 1.00 18.12 ? 306 GLN A N   1 
ATOM   2207  C CA  . GLN A 1 307 ? -0.246  41.230  -17.474 1.00 17.71 ? 306 GLN A CA  1 
ATOM   2208  C C   . GLN A 1 307 ? -1.069  40.831  -18.697 1.00 17.24 ? 306 GLN A C   1 
ATOM   2209  O O   . GLN A 1 307 ? -1.595  39.729  -18.737 1.00 16.67 ? 306 GLN A O   1 
ATOM   2210  C CB  . GLN A 1 307 ? -1.041  41.083  -16.177 1.00 18.10 ? 306 GLN A CB  1 
ATOM   2211  C CG  . GLN A 1 307 ? -2.397  41.739  -16.164 1.00 17.75 ? 306 GLN A CG  1 
ATOM   2212  C CD  . GLN A 1 307 ? -3.199  41.461  -14.906 1.00 16.62 ? 306 GLN A CD  1 
ATOM   2213  O OE1 . GLN A 1 307 ? -2.680  40.981  -13.901 1.00 16.46 ? 306 GLN A OE1 1 
ATOM   2214  N NE2 . GLN A 1 307 ? -4.481  41.782  -14.957 1.00 13.88 ? 306 GLN A NE2 1 
ATOM   2215  N N   . CYS A 1 308 ? -1.128  41.709  -19.698 1.00 17.13 ? 307 CYS A N   1 
ATOM   2216  C CA  . CYS A 1 308 ? -1.874  41.430  -20.906 1.00 16.98 ? 307 CYS A CA  1 
ATOM   2217  C C   . CYS A 1 308 ? -1.052  41.688  -22.136 1.00 16.27 ? 307 CYS A C   1 
ATOM   2218  O O   . CYS A 1 308 ? -0.139  42.523  -22.109 1.00 16.36 ? 307 CYS A O   1 
ATOM   2219  C CB  . CYS A 1 308 ? -3.164  42.272  -20.950 1.00 17.36 ? 307 CYS A CB  1 
ATOM   2220  S SG  . CYS A 1 308 ? -4.217  42.064  -19.518 1.00 17.84 ? 307 CYS A SG  1 
ATOM   2221  N N   . THR A 1 309 ? -1.386  40.977  -23.222 1.00 15.48 ? 308 THR A N   1 
ATOM   2222  C CA  . THR A 1 309 ? -0.777  41.227  -24.544 1.00 14.54 ? 308 THR A CA  1 
ATOM   2223  C C   . THR A 1 309 ? -1.544  42.276  -25.405 1.00 14.51 ? 308 THR A C   1 
ATOM   2224  O O   . THR A 1 309 ? -1.085  42.669  -26.451 1.00 13.95 ? 308 THR A O   1 
ATOM   2225  C CB  . THR A 1 309 ? -0.603  39.922  -25.375 1.00 15.06 ? 308 THR A CB  1 
ATOM   2226  O OG1 . THR A 1 309 ? -1.883  39.411  -25.764 1.00 14.78 ? 308 THR A OG1 1 
ATOM   2227  C CG2 . THR A 1 309 ? 0.168   38.815  -24.593 1.00 12.79 ? 308 THR A CG2 1 
ATOM   2228  N N   . GLY A 1 310 ? -2.689  42.744  -24.937 1.00 14.01 ? 309 GLY A N   1 
ATOM   2229  C CA  . GLY A 1 310 ? -3.519  43.663  -25.710 1.00 14.19 ? 309 GLY A CA  1 
ATOM   2230  C C   . GLY A 1 310 ? -4.851  43.803  -25.002 1.00 13.30 ? 309 GLY A C   1 
ATOM   2231  O O   . GLY A 1 310 ? -4.998  43.314  -23.900 1.00 12.88 ? 309 GLY A O   1 
ATOM   2232  N N   . CYS A 1 311 ? -5.812  44.465  -25.636 1.00 13.28 ? 310 CYS A N   1 
ATOM   2233  C CA  . CYS A 1 311 ? -7.132  44.709  -25.032 1.00 13.39 ? 310 CYS A CA  1 
ATOM   2234  C C   . CYS A 1 311 ? -8.247  44.263  -25.968 1.00 12.96 ? 310 CYS A C   1 
ATOM   2235  O O   . CYS A 1 311 ? -8.029  44.050  -27.171 1.00 11.91 ? 310 CYS A O   1 
ATOM   2236  C CB  . CYS A 1 311 ? -7.285  46.207  -24.675 1.00 13.76 ? 310 CYS A CB  1 
ATOM   2237  S SG  . CYS A 1 311 ? -6.022  46.861  -23.555 1.00 15.33 ? 310 CYS A SG  1 
ATOM   2238  N N   . THR A 1 312 ? -9.456  44.126  -25.440 1.00 14.28 ? 311 THR A N   1 
ATOM   2239  C CA  . THR A 1 312 ? -10.586 43.558  -26.246 1.00 13.91 ? 311 THR A CA  1 
ATOM   2240  C C   . THR A 1 312 ? -11.564 44.625  -26.742 1.00 13.35 ? 311 THR A C   1 
ATOM   2241  O O   . THR A 1 312 ? -11.243 45.823  -26.778 1.00 13.76 ? 311 THR A O   1 
ATOM   2242  C CB  . THR A 1 312 ? -11.318 42.449  -25.468 1.00 14.00 ? 311 THR A CB  1 
ATOM   2243  O OG1 . THR A 1 312 ? -12.091 43.025  -24.409 1.00 16.14 ? 311 THR A OG1 1 
ATOM   2244  C CG2 . THR A 1 312 ? -10.316 41.518  -24.889 1.00 16.53 ? 311 THR A CG2 1 
ATOM   2245  N N   . GLY A 1 313 ? -12.752 44.197  -27.162 1.00 12.63 ? 312 GLY A N   1 
ATOM   2246  C CA  . GLY A 1 313 ? -13.729 45.098  -27.768 1.00 11.37 ? 312 GLY A CA  1 
ATOM   2247  C C   . GLY A 1 313 ? -14.687 45.690  -26.774 1.00 10.89 ? 312 GLY A C   1 
ATOM   2248  O O   . GLY A 1 313 ? -15.581 46.449  -27.138 1.00 10.35 ? 312 GLY A O   1 
ATOM   2249  N N   . MET A 1 314 ? -14.530 45.321  -25.517 1.00 10.36 ? 313 MET A N   1 
ATOM   2250  C CA  . MET A 1 314 ? -15.419 45.784  -24.473 1.00 10.15 ? 313 MET A CA  1 
ATOM   2251  C C   . MET A 1 314 ? -15.063 47.195  -24.014 1.00 10.13 ? 313 MET A C   1 
ATOM   2252  O O   . MET A 1 314 ? -13.968 47.429  -23.522 1.00 10.57 ? 313 MET A O   1 
ATOM   2253  C CB  . MET A 1 314 ? -15.367 44.824  -23.291 1.00 9.71  ? 313 MET A CB  1 
ATOM   2254  C CG  . MET A 1 314 ? -15.777 43.405  -23.625 1.00 11.43 ? 313 MET A CG  1 
ATOM   2255  S SD  . MET A 1 314 ? -17.354 43.243  -24.549 1.00 11.61 ? 313 MET A SD  1 
ATOM   2256  C CE  . MET A 1 314 ? -18.477 43.972  -23.375 1.00 9.49  ? 313 MET A CE  1 
ATOM   2257  N N   . VAL A 1 315 ? -16.001 48.122  -24.193 1.00 9.72  ? 314 VAL A N   1 
ATOM   2258  C CA  . VAL A 1 315 ? -15.812 49.524  -23.819 1.00 9.49  ? 314 VAL A CA  1 
ATOM   2259  C C   . VAL A 1 315 ? -16.982 49.961  -22.989 1.00 10.02 ? 314 VAL A C   1 
ATOM   2260  O O   . VAL A 1 315 ? -18.138 49.876  -23.404 1.00 9.04  ? 314 VAL A O   1 
ATOM   2261  C CB  . VAL A 1 315 ? -15.710 50.474  -25.061 1.00 9.25  ? 314 VAL A CB  1 
ATOM   2262  C CG1 . VAL A 1 315 ? -15.422 51.916  -24.615 1.00 9.46  ? 314 VAL A CG1 1 
ATOM   2263  C CG2 . VAL A 1 315 ? -14.654 49.961  -26.035 1.00 7.31  ? 314 VAL A CG2 1 
ATOM   2264  N N   . THR A 1 316 ? -16.685 50.402  -21.774 1.00 11.07 ? 315 THR A N   1 
ATOM   2265  C CA  . THR A 1 316 ? -17.718 50.920  -20.895 1.00 11.77 ? 315 THR A CA  1 
ATOM   2266  C C   . THR A 1 316 ? -17.613 52.440  -20.854 1.00 12.48 ? 315 THR A C   1 
ATOM   2267  O O   . THR A 1 316 ? -16.514 53.001  -20.781 1.00 11.66 ? 315 THR A O   1 
ATOM   2268  C CB  . THR A 1 316 ? -17.548 50.335  -19.486 1.00 11.91 ? 315 THR A CB  1 
ATOM   2269  O OG1 . THR A 1 316 ? -17.771 48.929  -19.570 1.00 14.43 ? 315 THR A OG1 1 
ATOM   2270  C CG2 . THR A 1 316 ? -18.520 50.967  -18.501 1.00 11.73 ? 315 THR A CG2 1 
ATOM   2271  N N   . PHE A 1 317 ? -18.765 53.108  -20.916 1.00 12.79 ? 316 PHE A N   1 
ATOM   2272  C CA  . PHE A 1 317 ? -18.800 54.539  -20.716 1.00 12.15 ? 316 PHE A CA  1 
ATOM   2273  C C   . PHE A 1 317 ? -20.045 54.989  -19.972 1.00 12.58 ? 316 PHE A C   1 
ATOM   2274  O O   . PHE A 1 317 ? -21.045 54.268  -19.862 1.00 11.59 ? 316 PHE A O   1 
ATOM   2275  C CB  . PHE A 1 317 ? -18.595 55.308  -22.036 1.00 12.29 ? 316 PHE A CB  1 
ATOM   2276  C CG  . PHE A 1 317 ? -19.813 55.376  -22.931 1.00 12.18 ? 316 PHE A CG  1 
ATOM   2277  C CD1 . PHE A 1 317 ? -20.582 56.546  -23.013 1.00 11.71 ? 316 PHE A CD1 1 
ATOM   2278  C CD2 . PHE A 1 317 ? -20.168 54.297  -23.712 1.00 13.63 ? 316 PHE A CD2 1 
ATOM   2279  C CE1 . PHE A 1 317 ? -21.696 56.618  -23.836 1.00 12.38 ? 316 PHE A CE1 1 
ATOM   2280  C CE2 . PHE A 1 317 ? -21.278 54.359  -24.571 1.00 12.60 ? 316 PHE A CE2 1 
ATOM   2281  C CZ  . PHE A 1 317 ? -22.032 55.518  -24.645 1.00 13.73 ? 316 PHE A CZ  1 
ATOM   2282  N N   . TYR A 1 318 ? -19.916 56.174  -19.390 1.00 13.16 ? 317 TYR A N   1 
ATOM   2283  C CA  . TYR A 1 318 ? -21.009 56.882  -18.769 1.00 13.15 ? 317 TYR A CA  1 
ATOM   2284  C C   . TYR A 1 318 ? -21.395 58.037  -19.663 1.00 12.42 ? 317 TYR A C   1 
ATOM   2285  O O   . TYR A 1 318 ? -20.579 58.868  -19.987 1.00 11.95 ? 317 TYR A O   1 
ATOM   2286  C CB  . TYR A 1 318 ? -20.618 57.423  -17.406 1.00 13.68 ? 317 TYR A CB  1 
ATOM   2287  C CG  . TYR A 1 318 ? -20.389 56.392  -16.344 1.00 15.13 ? 317 TYR A CG  1 
ATOM   2288  C CD1 . TYR A 1 318 ? -19.136 55.805  -16.169 1.00 15.52 ? 317 TYR A CD1 1 
ATOM   2289  C CD2 . TYR A 1 318 ? -21.408 56.041  -15.464 1.00 15.58 ? 317 TYR A CD2 1 
ATOM   2290  C CE1 . TYR A 1 318 ? -18.922 54.864  -15.158 1.00 16.06 ? 317 TYR A CE1 1 
ATOM   2291  C CE2 . TYR A 1 318 ? -21.207 55.101  -14.470 1.00 16.43 ? 317 TYR A CE2 1 
ATOM   2292  C CZ  . TYR A 1 318 ? -19.970 54.533  -14.304 1.00 15.68 ? 317 TYR A CZ  1 
ATOM   2293  O OH  . TYR A 1 318 ? -19.813 53.616  -13.283 1.00 17.83 ? 317 TYR A OH  1 
ATOM   2294  N N   . ILE A 1 319 ? -22.653 58.066  -20.062 1.00 12.34 ? 318 ILE A N   1 
ATOM   2295  C CA  . ILE A 1 319 ? -23.192 59.189  -20.793 1.00 13.30 ? 318 ILE A CA  1 
ATOM   2296  C C   . ILE A 1 319 ? -23.475 60.335  -19.789 1.00 14.19 ? 318 ILE A C   1 
ATOM   2297  O O   . ILE A 1 319 ? -23.787 60.108  -18.596 1.00 14.53 ? 318 ILE A O   1 
ATOM   2298  C CB  . ILE A 1 319 ? -24.436 58.760  -21.625 1.00 13.76 ? 318 ILE A CB  1 
ATOM   2299  C CG1 . ILE A 1 319 ? -24.732 59.790  -22.727 1.00 12.65 ? 318 ILE A CG1 1 
ATOM   2300  C CG2 . ILE A 1 319 ? -25.630 58.447  -20.713 1.00 11.56 ? 318 ILE A CG2 1 
ATOM   2301  C CD1 . ILE A 1 319 ? -25.697 59.326  -23.842 1.00 13.51 ? 318 ILE A CD1 1 
ATOM   2302  N N   . LYS A 1 320 ? -23.269 61.557  -20.246 1.00 15.34 ? 319 LYS A N   1 
ATOM   2303  C CA  . LYS A 1 320 ? -23.685 62.732  -19.493 1.00 16.17 ? 319 LYS A CA  1 
ATOM   2304  C C   . LYS A 1 320 ? -25.197 62.792  -19.479 1.00 16.36 ? 319 LYS A C   1 
ATOM   2305  O O   . LYS A 1 320 ? -25.857 62.328  -20.407 1.00 16.94 ? 319 LYS A O   1 
ATOM   2306  C CB  . LYS A 1 320 ? -23.110 64.012  -20.114 1.00 16.56 ? 319 LYS A CB  1 
ATOM   2307  C CG  . LYS A 1 320 ? -21.691 64.258  -19.683 1.00 18.03 ? 319 LYS A CG  1 
ATOM   2308  C CD  . LYS A 1 320 ? -21.041 65.431  -20.381 1.00 17.00 ? 319 LYS A CD  1 
ATOM   2309  C CE  . LYS A 1 320 ? -19.564 65.500  -20.048 1.00 18.48 ? 319 LYS A CE  1 
ATOM   2310  N NZ  . LYS A 1 320 ? -18.840 66.413  -20.971 1.00 22.83 ? 319 LYS A NZ  1 
ATOM   2311  N N   . GLY A 1 321 ? -25.740 63.389  -18.434 1.00 16.81 ? 320 GLY A N   1 
ATOM   2312  C CA  . GLY A 1 321 ? -27.193 63.526  -18.295 1.00 16.80 ? 320 GLY A CA  1 
ATOM   2313  C C   . GLY A 1 321 ? -27.767 62.411  -17.412 1.00 16.40 ? 320 GLY A C   1 
ATOM   2314  O O   . GLY A 1 321 ? -27.211 62.082  -16.377 1.00 15.91 ? 320 GLY A O   1 
ATOM   2315  N N   . THR A 1 322 ? -28.860 61.811  -17.861 1.00 17.21 ? 321 THR A N   1 
ATOM   2316  C CA  . THR A 1 322 ? -29.651 60.887  -17.038 1.00 17.72 ? 321 THR A CA  1 
ATOM   2317  C C   . THR A 1 322 ? -29.989 59.631  -17.821 1.00 18.08 ? 321 THR A C   1 
ATOM   2318  O O   . THR A 1 322 ? -29.579 59.478  -18.990 1.00 17.65 ? 321 THR A O   1 
ATOM   2319  C CB  . THR A 1 322 ? -30.971 61.585  -16.623 1.00 17.41 ? 321 THR A CB  1 
ATOM   2320  O OG1 . THR A 1 322 ? -31.736 61.861  -17.788 1.00 17.06 ? 321 THR A OG1 1 
ATOM   2321  C CG2 . THR A 1 322 ? -30.674 62.929  -15.935 1.00 18.55 ? 321 THR A CG2 1 
ATOM   2322  N N   . LEU A 1 323 ? -30.763 58.744  -17.198 1.00 18.09 ? 322 LEU A N   1 
ATOM   2323  C CA  . LEU A 1 323 ? -31.308 57.568  -17.886 1.00 18.49 ? 322 LEU A CA  1 
ATOM   2324  C C   . LEU A 1 323 ? -31.900 57.903  -19.251 1.00 18.34 ? 322 LEU A C   1 
ATOM   2325  O O   . LEU A 1 323 ? -31.693 57.166  -20.232 1.00 17.46 ? 322 LEU A O   1 
ATOM   2326  C CB  . LEU A 1 323 ? -32.391 56.894  -17.015 1.00 18.84 ? 322 LEU A CB  1 
ATOM   2327  C CG  . LEU A 1 323 ? -33.044 55.640  -17.605 1.00 18.53 ? 322 LEU A CG  1 
ATOM   2328  C CD1 . LEU A 1 323 ? -32.014 54.522  -17.705 1.00 20.24 ? 322 LEU A CD1 1 
ATOM   2329  C CD2 . LEU A 1 323 ? -34.272 55.234  -16.786 1.00 19.02 ? 322 LEU A CD2 1 
ATOM   2330  N N   . GLN A 1 324 ? -32.651 59.008  -19.319 1.00 18.36 ? 323 GLN A N   1 
ATOM   2331  C CA  . GLN A 1 324 ? -33.277 59.423  -20.576 1.00 18.18 ? 323 GLN A CA  1 
ATOM   2332  C C   . GLN A 1 324 ? -32.278 59.566  -21.729 1.00 16.88 ? 323 GLN A C   1 
ATOM   2333  O O   . GLN A 1 324 ? -32.542 59.134  -22.857 1.00 16.06 ? 323 GLN A O   1 
ATOM   2334  C CB  . GLN A 1 324 ? -34.024 60.752  -20.427 1.00 18.40 ? 323 GLN A CB  1 
ATOM   2335  C CG  . GLN A 1 324 ? -34.658 61.214  -21.773 1.00 19.37 ? 323 GLN A CG  1 
ATOM   2336  C CD  . GLN A 1 324 ? -35.314 62.599  -21.710 1.00 21.17 ? 323 GLN A CD  1 
ATOM   2337  O OE1 . GLN A 1 324 ? -35.135 63.336  -20.731 1.00 27.77 ? 323 GLN A OE1 1 
ATOM   2338  N NE2 . GLN A 1 324 ? -36.072 62.949  -22.760 1.00 23.35 ? 323 GLN A NE2 1 
ATOM   2339  N N   . HIS A 1 325 ? -31.150 60.214  -21.459 1.00 16.20 ? 324 HIS A N   1 
ATOM   2340  C CA  . HIS A 1 325 ? -30.120 60.401  -22.482 1.00 15.67 ? 324 HIS A CA  1 
ATOM   2341  C C   . HIS A 1 325 ? -29.517 59.050  -22.910 1.00 15.16 ? 324 HIS A C   1 
ATOM   2342  O O   . HIS A 1 325 ? -29.310 58.797  -24.095 1.00 14.82 ? 324 HIS A O   1 
ATOM   2343  C CB  . HIS A 1 325 ? -29.050 61.357  -21.968 1.00 15.75 ? 324 HIS A CB  1 
ATOM   2344  C CG  . HIS A 1 325 ? -29.603 62.688  -21.597 1.00 16.44 ? 324 HIS A CG  1 
ATOM   2345  N ND1 . HIS A 1 325 ? -29.842 63.051  -20.296 1.00 16.92 ? 324 HIS A ND1 1 
ATOM   2346  C CD2 . HIS A 1 325 ? -30.037 63.716  -22.361 1.00 14.96 ? 324 HIS A CD2 1 
ATOM   2347  C CE1 . HIS A 1 325 ? -30.374 64.258  -20.267 1.00 16.10 ? 324 HIS A CE1 1 
ATOM   2348  N NE2 . HIS A 1 325 ? -30.504 64.683  -21.508 1.00 13.24 ? 324 HIS A NE2 1 
ATOM   2349  N N   . ALA A 1 326 ? -29.275 58.186  -21.937 1.00 14.89 ? 325 ALA A N   1 
ATOM   2350  C CA  . ALA A 1 326 ? -28.827 56.823  -22.215 1.00 14.91 ? 325 ALA A CA  1 
ATOM   2351  C C   . ALA A 1 326 ? -29.827 56.090  -23.115 1.00 15.04 ? 325 ALA A C   1 
ATOM   2352  O O   . ALA A 1 326 ? -29.455 55.477  -24.111 1.00 14.99 ? 325 ALA A O   1 
ATOM   2353  C CB  . ALA A 1 326 ? -28.639 56.091  -20.912 1.00 14.97 ? 325 ALA A CB  1 
ATOM   2354  N N   . GLU A 1 327 ? -31.113 56.203  -22.788 1.00 15.12 ? 326 GLU A N   1 
ATOM   2355  C CA  . GLU A 1 327 ? -32.141 55.512  -23.524 1.00 15.50 ? 326 GLU A CA  1 
ATOM   2356  C C   . GLU A 1 327 ? -32.290 56.070  -24.930 1.00 14.15 ? 326 GLU A C   1 
ATOM   2357  O O   . GLU A 1 327 ? -32.361 55.292  -25.885 1.00 13.37 ? 326 GLU A O   1 
ATOM   2358  C CB  . GLU A 1 327 ? -33.457 55.500  -22.721 1.00 15.75 ? 326 GLU A CB  1 
ATOM   2359  C CG  . GLU A 1 327 ? -33.350 54.555  -21.521 1.00 17.49 ? 326 GLU A CG  1 
ATOM   2360  C CD  . GLU A 1 327 ? -34.659 54.326  -20.765 1.00 20.44 ? 326 GLU A CD  1 
ATOM   2361  O OE1 . GLU A 1 327 ? -35.519 55.248  -20.700 1.00 25.02 ? 326 GLU A OE1 1 
ATOM   2362  O OE2 . GLU A 1 327 ? -34.808 53.197  -20.240 1.00 25.74 ? 326 GLU A OE2 1 
ATOM   2363  N N   . ILE A 1 328 ? -32.309 57.401  -25.067 1.00 13.27 ? 327 ILE A N   1 
ATOM   2364  C CA  . ILE A 1 328 ? -32.333 58.033  -26.414 1.00 13.46 ? 327 ILE A CA  1 
ATOM   2365  C C   . ILE A 1 328 ? -31.104 57.639  -27.262 1.00 12.26 ? 327 ILE A C   1 
ATOM   2366  O O   . ILE A 1 328 ? -31.227 57.328  -28.454 1.00 13.26 ? 327 ILE A O   1 
ATOM   2367  C CB  . ILE A 1 328 ? -32.450 59.573  -26.342 1.00 12.90 ? 327 ILE A CB  1 
ATOM   2368  C CG1 . ILE A 1 328 ? -33.786 59.968  -25.706 1.00 14.27 ? 327 ILE A CG1 1 
ATOM   2369  C CG2 . ILE A 1 328 ? -32.315 60.198  -27.763 1.00 12.57 ? 327 ILE A CG2 1 
ATOM   2370  C CD1 . ILE A 1 328 ? -33.850 61.412  -25.227 1.00 14.90 ? 327 ILE A CD1 1 
ATOM   2371  N N   . PHE A 1 329 ? -29.934 57.644  -26.632 1.00 12.63 ? 328 PHE A N   1 
ATOM   2372  C CA  . PHE A 1 329 ? -28.688 57.197  -27.263 1.00 11.78 ? 328 PHE A CA  1 
ATOM   2373  C C   . PHE A 1 329 ? -28.887 55.810  -27.831 1.00 12.06 ? 328 PHE A C   1 
ATOM   2374  O O   . PHE A 1 329 ? -28.717 55.617  -29.044 1.00 11.41 ? 328 PHE A O   1 
ATOM   2375  C CB  . PHE A 1 329 ? -27.508 57.229  -26.275 1.00 11.80 ? 328 PHE A CB  1 
ATOM   2376  C CG  . PHE A 1 329 ? -26.298 56.466  -26.760 1.00 10.70 ? 328 PHE A CG  1 
ATOM   2377  C CD1 . PHE A 1 329 ? -25.420 57.037  -27.652 1.00 11.00 ? 328 PHE A CD1 1 
ATOM   2378  C CD2 . PHE A 1 329 ? -26.067 55.172  -26.339 1.00 11.04 ? 328 PHE A CD2 1 
ATOM   2379  C CE1 . PHE A 1 329 ? -24.323 56.336  -28.110 1.00 11.61 ? 328 PHE A CE1 1 
ATOM   2380  C CE2 . PHE A 1 329 ? -24.987 54.445  -26.821 1.00 11.50 ? 328 PHE A CE2 1 
ATOM   2381  C CZ  . PHE A 1 329 ? -24.113 55.027  -27.699 1.00 9.78  ? 328 PHE A CZ  1 
ATOM   2382  N N   . LEU A 1 330 ? -29.312 54.866  -26.981 1.00 12.26 ? 329 LEU A N   1 
ATOM   2383  C CA  . LEU A 1 330 ? -29.513 53.475  -27.413 1.00 12.81 ? 329 LEU A CA  1 
ATOM   2384  C C   . LEU A 1 330 ? -30.567 53.322  -28.510 1.00 13.28 ? 329 LEU A C   1 
ATOM   2385  O O   . LEU A 1 330 ? -30.357 52.571  -29.469 1.00 13.40 ? 329 LEU A O   1 
ATOM   2386  C CB  . LEU A 1 330 ? -29.811 52.541  -26.225 1.00 12.34 ? 329 LEU A CB  1 
ATOM   2387  C CG  . LEU A 1 330 ? -28.672 52.358  -25.224 1.00 12.63 ? 329 LEU A CG  1 
ATOM   2388  C CD1 . LEU A 1 330 ? -29.176 51.784  -23.900 1.00 12.38 ? 329 LEU A CD1 1 
ATOM   2389  C CD2 . LEU A 1 330 ? -27.520 51.499  -25.766 1.00 11.13 ? 329 LEU A CD2 1 
ATOM   2390  N N   . LYS A 1 331 ? -31.681 54.046  -28.395 1.00 13.78 ? 330 LYS A N   1 
ATOM   2391  C CA  . LYS A 1 331 ? -32.738 54.011  -29.433 1.00 14.30 ? 330 LYS A CA  1 
ATOM   2392  C C   . LYS A 1 331 ? -32.271 54.447  -30.817 1.00 13.29 ? 330 LYS A C   1 
ATOM   2393  O O   . LYS A 1 331 ? -32.788 54.013  -31.847 1.00 12.76 ? 330 LYS A O   1 
ATOM   2394  C CB  . LYS A 1 331 ? -33.902 54.914  -29.013 1.00 15.29 ? 330 LYS A CB  1 
ATOM   2395  C CG  . LYS A 1 331 ? -35.177 54.654  -29.807 1.00 17.82 ? 330 LYS A CG  1 
ATOM   2396  C CD  . LYS A 1 331 ? -36.271 55.611  -29.437 1.00 18.89 ? 330 LYS A CD  1 
ATOM   2397  C CE  . LYS A 1 331 ? -37.417 55.547  -30.445 1.00 22.62 ? 330 LYS A CE  1 
ATOM   2398  N NZ  . LYS A 1 331 ? -37.043 56.188  -31.773 1.00 28.79 ? 330 LYS A NZ  1 
ATOM   2399  N N   . ASN A 1 332 ? -31.283 55.319  -30.837 1.00 12.04 ? 331 ASN A N   1 
ATOM   2400  C CA  . ASN A 1 332 ? -30.831 55.936  -32.050 1.00 12.51 ? 331 ASN A CA  1 
ATOM   2401  C C   . ASN A 1 332 ? -29.723 55.210  -32.797 1.00 12.23 ? 331 ASN A C   1 
ATOM   2402  O O   . ASN A 1 332 ? -29.433 55.549  -33.949 1.00 11.72 ? 331 ASN A O   1 
ATOM   2403  C CB  . ASN A 1 332 ? -30.459 57.386  -31.747 1.00 12.29 ? 331 ASN A CB  1 
ATOM   2404  C CG  . ASN A 1 332 ? -31.692 58.274  -31.706 1.00 12.88 ? 331 ASN A CG  1 
ATOM   2405  O OD1 . ASN A 1 332 ? -32.154 58.710  -32.738 1.00 14.72 ? 331 ASN A OD1 1 
ATOM   2406  N ND2 . ASN A 1 332 ? -32.257 58.484  -30.519 1.00 16.34 ? 331 ASN A ND2 1 
ATOM   2407  N N   . LEU A 1 333 ? -29.136 54.200  -32.164 1.00 12.15 ? 332 LEU A N   1 
ATOM   2408  C CA  . LEU A 1 333 ? -28.101 53.385  -32.799 1.00 11.42 ? 332 LEU A CA  1 
ATOM   2409  C C   . LEU A 1 333 ? -28.702 52.622  -33.962 1.00 12.47 ? 332 LEU A C   1 
ATOM   2410  O O   . LEU A 1 333 ? -29.814 52.063  -33.855 1.00 12.08 ? 332 LEU A O   1 
ATOM   2411  C CB  . LEU A 1 333 ? -27.480 52.438  -31.772 1.00 11.54 ? 332 LEU A CB  1 
ATOM   2412  C CG  . LEU A 1 333 ? -26.653 53.057  -30.622 1.00 9.20  ? 332 LEU A CG  1 
ATOM   2413  C CD1 . LEU A 1 333 ? -26.334 52.000  -29.588 1.00 8.79  ? 332 LEU A CD1 1 
ATOM   2414  C CD2 . LEU A 1 333 ? -25.349 53.682  -31.121 1.00 7.76  ? 332 LEU A CD2 1 
ATOM   2415  N N   . LYS A 1 334 ? -28.008 52.644  -35.100 1.00 12.68 ? 333 LYS A N   1 
ATOM   2416  C CA  . LYS A 1 334 ? -28.468 51.931  -36.271 1.00 13.82 ? 333 LYS A CA  1 
ATOM   2417  C C   . LYS A 1 334 ? -27.546 50.806  -36.739 1.00 13.12 ? 333 LYS A C   1 
ATOM   2418  O O   . LYS A 1 334 ? -27.884 50.146  -37.700 1.00 13.59 ? 333 LYS A O   1 
ATOM   2419  C CB  . LYS A 1 334 ? -28.675 52.897  -37.429 1.00 14.55 ? 333 LYS A CB  1 
ATOM   2420  C CG  . LYS A 1 334 ? -29.624 54.037  -37.142 1.00 16.33 ? 333 LYS A CG  1 
ATOM   2421  C CD  . LYS A 1 334 ? -29.579 54.971  -38.356 1.00 18.21 ? 333 LYS A CD  1 
ATOM   2422  C CE  . LYS A 1 334 ? -30.447 56.216  -38.174 1.00 22.20 ? 333 LYS A CE  1 
ATOM   2423  N NZ  . LYS A 1 334 ? -30.023 57.256  -39.163 1.00 27.20 ? 333 LYS A NZ  1 
ATOM   2424  N N   . LEU A 1 335 ? -26.417 50.592  -36.064 1.00 12.31 ? 334 LEU A N   1 
ATOM   2425  C CA  . LEU A 1 335 ? -25.449 49.547  -36.425 1.00 12.00 ? 334 LEU A CA  1 
ATOM   2426  C C   . LEU A 1 335 ? -25.150 48.659  -35.222 1.00 11.95 ? 334 LEU A C   1 
ATOM   2427  O O   . LEU A 1 335 ? -25.266 47.435  -35.274 1.00 11.95 ? 334 LEU A O   1 
ATOM   2428  C CB  . LEU A 1 335 ? -24.173 50.188  -36.957 1.00 11.89 ? 334 LEU A CB  1 
ATOM   2429  C CG  . LEU A 1 335 ? -23.073 49.237  -37.471 1.00 12.30 ? 334 LEU A CG  1 
ATOM   2430  C CD1 . LEU A 1 335 ? -23.631 48.277  -38.505 1.00 11.57 ? 334 LEU A CD1 1 
ATOM   2431  C CD2 . LEU A 1 335 ? -21.897 50.034  -38.067 1.00 11.99 ? 334 LEU A CD2 1 
ATOM   2432  N N   . PHE A 1 336 ? -24.763 49.290  -34.126 1.00 11.04 ? 335 PHE A N   1 
ATOM   2433  C CA  . PHE A 1 336 ? -24.788 48.640  -32.853 1.00 11.17 ? 335 PHE A CA  1 
ATOM   2434  C C   . PHE A 1 336 ? -26.216 48.163  -32.666 1.00 11.47 ? 335 PHE A C   1 
ATOM   2435  O O   . PHE A 1 336 ? -27.173 48.862  -33.052 1.00 10.85 ? 335 PHE A O   1 
ATOM   2436  C CB  . PHE A 1 336 ? -24.403 49.618  -31.742 1.00 10.55 ? 335 PHE A CB  1 
ATOM   2437  C CG  . PHE A 1 336 ? -22.928 49.865  -31.635 1.00 10.71 ? 335 PHE A CG  1 
ATOM   2438  C CD1 . PHE A 1 336 ? -22.289 50.778  -32.468 1.00 11.34 ? 335 PHE A CD1 1 
ATOM   2439  C CD2 . PHE A 1 336 ? -22.170 49.229  -30.658 1.00 12.47 ? 335 PHE A CD2 1 
ATOM   2440  C CE1 . PHE A 1 336 ? -20.906 51.030  -32.353 1.00 8.70  ? 335 PHE A CE1 1 
ATOM   2441  C CE2 . PHE A 1 336 ? -20.793 49.473  -30.540 1.00 10.52 ? 335 PHE A CE2 1 
ATOM   2442  C CZ  . PHE A 1 336 ? -20.172 50.378  -31.376 1.00 10.15 ? 335 PHE A CZ  1 
ATOM   2443  N N   . THR A 1 337 ? -26.358 46.964  -32.128 1.00 10.54 ? 336 THR A N   1 
ATOM   2444  C CA  . THR A 1 337 ? -27.668 46.420  -31.827 1.00 10.20 ? 336 THR A CA  1 
ATOM   2445  C C   . THR A 1 337 ? -27.871 46.397  -30.335 1.00 10.44 ? 336 THR A C   1 
ATOM   2446  O O   . THR A 1 337 ? -26.980 46.005  -29.590 1.00 10.78 ? 336 THR A O   1 
ATOM   2447  C CB  . THR A 1 337 ? -27.808 44.985  -32.343 1.00 10.65 ? 336 THR A CB  1 
ATOM   2448  O OG1 . THR A 1 337 ? -27.657 44.974  -33.774 1.00 9.27  ? 336 THR A OG1 1 
ATOM   2449  C CG2 . THR A 1 337 ? -29.145 44.360  -31.931 1.00 10.13 ? 336 THR A CG2 1 
ATOM   2450  N N   . LEU A 1 338 ? -29.070 46.776  -29.904 1.00 10.97 ? 337 LEU A N   1 
ATOM   2451  C CA  . LEU A 1 338 ? -29.443 46.714  -28.497 1.00 10.34 ? 337 LEU A CA  1 
ATOM   2452  C C   . LEU A 1 338 ? -29.746 45.251  -28.143 1.00 11.46 ? 337 LEU A C   1 
ATOM   2453  O O   . LEU A 1 338 ? -30.726 44.666  -28.623 1.00 10.23 ? 337 LEU A O   1 
ATOM   2454  C CB  . LEU A 1 338 ? -30.644 47.618  -28.218 1.00 10.63 ? 337 LEU A CB  1 
ATOM   2455  C CG  . LEU A 1 338 ? -31.152 47.557  -26.768 1.00 10.49 ? 337 LEU A CG  1 
ATOM   2456  C CD1 . LEU A 1 338 ? -30.053 48.102  -25.833 1.00 11.63 ? 337 LEU A CD1 1 
ATOM   2457  C CD2 . LEU A 1 338 ? -32.458 48.314  -26.578 1.00 9.76  ? 337 LEU A CD2 1 
ATOM   2458  N N   . ALA A 1 339 ? -28.887 44.661  -27.316 1.00 12.29 ? 338 ALA A N   1 
ATOM   2459  C CA  . ALA A 1 339 ? -28.994 43.256  -26.967 1.00 12.38 ? 338 ALA A CA  1 
ATOM   2460  C C   . ALA A 1 339 ? -28.032 42.887  -25.849 1.00 13.30 ? 338 ALA A C   1 
ATOM   2461  O O   . ALA A 1 339 ? -27.029 43.556  -25.628 1.00 13.45 ? 338 ALA A O   1 
ATOM   2462  C CB  . ALA A 1 339 ? -28.760 42.343  -28.213 1.00 12.28 ? 338 ALA A CB  1 
ATOM   2463  N N   . GLU A 1 340 ? -28.347 41.814  -25.131 1.00 13.94 ? 339 GLU A N   1 
ATOM   2464  C CA  . GLU A 1 340 ? -27.428 41.258  -24.160 1.00 14.27 ? 339 GLU A CA  1 
ATOM   2465  C C   . GLU A 1 340 ? -26.371 40.367  -24.850 1.00 13.31 ? 339 GLU A C   1 
ATOM   2466  O O   . GLU A 1 340 ? -26.449 40.061  -26.039 1.00 12.63 ? 339 GLU A O   1 
ATOM   2467  C CB  . GLU A 1 340 ? -28.179 40.430  -23.111 1.00 15.35 ? 339 GLU A CB  1 
ATOM   2468  C CG  . GLU A 1 340 ? -29.242 41.167  -22.302 1.00 16.00 ? 339 GLU A CG  1 
ATOM   2469  C CD  . GLU A 1 340 ? -29.809 40.288  -21.187 1.00 18.13 ? 339 GLU A CD  1 
ATOM   2470  O OE1 . GLU A 1 340 ? -29.459 39.078  -21.122 1.00 22.75 ? 339 GLU A OE1 1 
ATOM   2471  O OE2 . GLU A 1 340 ? -30.578 40.798  -20.363 1.00 22.61 ? 339 GLU A OE2 1 
ATOM   2472  N N   . SER A 1 341 ? -25.391 39.938  -24.074 1.00 13.14 ? 340 SER A N   1 
ATOM   2473  C CA  . SER A 1 341 ? -24.231 39.149  -24.561 1.00 12.68 ? 340 SER A CA  1 
ATOM   2474  C C   . SER A 1 341 ? -23.149 40.065  -25.146 1.00 12.15 ? 340 SER A C   1 
ATOM   2475  O O   . SER A 1 341 ? -23.286 41.293  -25.133 1.00 12.18 ? 340 SER A O   1 
ATOM   2476  C CB  . SER A 1 341 ? -24.613 38.004  -25.527 1.00 13.12 ? 340 SER A CB  1 
ATOM   2477  O OG  . SER A 1 341 ? -23.647 36.936  -25.406 1.00 12.42 ? 340 SER A OG  1 
ATOM   2478  N N   . LEU A 1 342 ? -22.052 39.456  -25.612 1.00 11.75 ? 341 LEU A N   1 
ATOM   2479  C CA  . LEU A 1 342 ? -20.822 40.179  -25.976 1.00 11.14 ? 341 LEU A CA  1 
ATOM   2480  C C   . LEU A 1 342 ? -19.887 39.194  -26.645 1.00 11.37 ? 341 LEU A C   1 
ATOM   2481  O O   . LEU A 1 342 ? -20.120 37.998  -26.590 1.00 10.46 ? 341 LEU A O   1 
ATOM   2482  C CB  . LEU A 1 342 ? -20.139 40.775  -24.727 1.00 11.43 ? 341 LEU A CB  1 
ATOM   2483  C CG  . LEU A 1 342 ? -19.688 39.816  -23.595 1.00 10.44 ? 341 LEU A CG  1 
ATOM   2484  C CD1 . LEU A 1 342 ? -18.169 39.630  -23.560 1.00 8.71  ? 341 LEU A CD1 1 
ATOM   2485  C CD2 . LEU A 1 342 ? -20.164 40.316  -22.229 1.00 7.50  ? 341 LEU A CD2 1 
ATOM   2486  N N   . GLY A 1 343 ? -18.832 39.691  -27.287 1.00 11.10 ? 342 GLY A N   1 
ATOM   2487  C CA  . GLY A 1 343 ? -17.756 38.818  -27.753 1.00 11.02 ? 342 GLY A CA  1 
ATOM   2488  C C   . GLY A 1 343 ? -17.937 38.286  -29.157 1.00 11.36 ? 342 GLY A C   1 
ATOM   2489  O O   . GLY A 1 343 ? -17.102 37.521  -29.646 1.00 10.97 ? 342 GLY A O   1 
ATOM   2490  N N   . GLY A 1 344 ? -19.021 38.696  -29.804 1.00 10.69 ? 343 GLY A N   1 
ATOM   2491  C CA  . GLY A 1 344 ? -19.363 38.226  -31.117 1.00 10.79 ? 343 GLY A CA  1 
ATOM   2492  C C   . GLY A 1 344 ? -18.848 39.171  -32.165 1.00 11.89 ? 343 GLY A C   1 
ATOM   2493  O O   . GLY A 1 344 ? -18.318 40.237  -31.847 1.00 12.16 ? 343 GLY A O   1 
ATOM   2494  N N   . PHE A 1 345 ? -19.012 38.775  -33.425 1.00 12.04 ? 344 PHE A N   1 
ATOM   2495  C CA  . PHE A 1 345 ? -18.567 39.575  -34.553 1.00 12.97 ? 344 PHE A CA  1 
ATOM   2496  C C   . PHE A 1 345 ? -19.356 40.884  -34.703 1.00 12.78 ? 344 PHE A C   1 
ATOM   2497  O O   . PHE A 1 345 ? -18.854 41.858  -35.262 1.00 13.59 ? 344 PHE A O   1 
ATOM   2498  C CB  . PHE A 1 345 ? -18.610 38.773  -35.868 1.00 13.04 ? 344 PHE A CB  1 
ATOM   2499  C CG  . PHE A 1 345 ? -19.818 37.879  -36.013 1.00 14.05 ? 344 PHE A CG  1 
ATOM   2500  C CD1 . PHE A 1 345 ? -19.668 36.504  -36.039 1.00 12.61 ? 344 PHE A CD1 1 
ATOM   2501  C CD2 . PHE A 1 345 ? -21.093 38.404  -36.132 1.00 15.22 ? 344 PHE A CD2 1 
ATOM   2502  C CE1 . PHE A 1 345 ? -20.755 35.674  -36.192 1.00 13.03 ? 344 PHE A CE1 1 
ATOM   2503  C CE2 . PHE A 1 345 ? -22.206 37.543  -36.256 1.00 14.15 ? 344 PHE A CE2 1 
ATOM   2504  C CZ  . PHE A 1 345 ? -22.026 36.201  -36.278 1.00 13.26 ? 344 PHE A CZ  1 
ATOM   2505  N N   . GLU A 1 346 ? -20.583 40.895  -34.204 1.00 12.48 ? 345 GLU A N   1 
ATOM   2506  C CA  . GLU A 1 346 ? -21.460 42.056  -34.354 1.00 12.51 ? 345 GLU A CA  1 
ATOM   2507  C C   . GLU A 1 346 ? -21.342 42.986  -33.154 1.00 11.96 ? 345 GLU A C   1 
ATOM   2508  O O   . GLU A 1 346 ? -21.162 42.531  -32.015 1.00 11.31 ? 345 GLU A O   1 
ATOM   2509  C CB  . GLU A 1 346 ? -22.917 41.620  -34.574 1.00 12.96 ? 345 GLU A CB  1 
ATOM   2510  C CG  . GLU A 1 346 ? -23.627 40.953  -33.390 1.00 14.98 ? 345 GLU A CG  1 
ATOM   2511  C CD  . GLU A 1 346 ? -23.180 39.502  -33.141 1.00 17.52 ? 345 GLU A CD  1 
ATOM   2512  O OE1 . GLU A 1 346 ? -23.884 38.565  -33.579 1.00 24.34 ? 345 GLU A OE1 1 
ATOM   2513  O OE2 . GLU A 1 346 ? -22.126 39.297  -32.538 1.00 18.08 ? 345 GLU A OE2 1 
ATOM   2514  N N   . SER A 1 347 ? -21.467 44.285  -33.410 1.00 10.78 ? 346 SER A N   1 
ATOM   2515  C CA  . SER A 1 347 ? -21.390 45.276  -32.325 1.00 9.96  ? 346 SER A CA  1 
ATOM   2516  C C   . SER A 1 347 ? -22.712 45.342  -31.549 1.00 10.42 ? 346 SER A C   1 
ATOM   2517  O O   . SER A 1 347 ? -23.791 45.396  -32.135 1.00 10.30 ? 346 SER A O   1 
ATOM   2518  C CB  . SER A 1 347 ? -20.994 46.666  -32.851 1.00 9.10  ? 346 SER A CB  1 
ATOM   2519  O OG  . SER A 1 347 ? -19.625 46.688  -33.305 1.00 7.80  ? 346 SER A OG  1 
ATOM   2520  N N   . LEU A 1 348 ? -22.609 45.316  -30.224 1.00 11.04 ? 347 LEU A N   1 
ATOM   2521  C CA  . LEU A 1 348 ? -23.781 45.325  -29.359 1.00 10.95 ? 347 LEU A CA  1 
ATOM   2522  C C   . LEU A 1 348 ? -23.662 46.449  -28.377 1.00 10.93 ? 347 LEU A C   1 
ATOM   2523  O O   . LEU A 1 348 ? -22.558 46.861  -28.023 1.00 9.97  ? 347 LEU A O   1 
ATOM   2524  C CB  . LEU A 1 348 ? -23.889 44.011  -28.605 1.00 10.76 ? 347 LEU A CB  1 
ATOM   2525  C CG  . LEU A 1 348 ? -24.014 42.750  -29.465 1.00 10.93 ? 347 LEU A CG  1 
ATOM   2526  C CD1 . LEU A 1 348 ? -24.070 41.524  -28.529 1.00 11.69 ? 347 LEU A CD1 1 
ATOM   2527  C CD2 . LEU A 1 348 ? -25.231 42.791  -30.402 1.00 10.01 ? 347 LEU A CD2 1 
ATOM   2528  N N   . ALA A 1 349 ? -24.804 46.976  -27.958 1.00 10.98 ? 348 ALA A N   1 
ATOM   2529  C CA  . ALA A 1 349 ? -24.819 47.932  -26.855 1.00 11.57 ? 348 ALA A CA  1 
ATOM   2530  C C   . ALA A 1 349 ? -25.869 47.529  -25.839 1.00 11.95 ? 348 ALA A C   1 
ATOM   2531  O O   . ALA A 1 349 ? -26.898 46.986  -26.192 1.00 12.17 ? 348 ALA A O   1 
ATOM   2532  C CB  . ALA A 1 349 ? -25.070 49.370  -27.365 1.00 10.68 ? 348 ALA A CB  1 
ATOM   2533  N N   . GLU A 1 350 ? -25.621 47.837  -24.573 1.00 12.92 ? 349 GLU A N   1 
ATOM   2534  C CA  . GLU A 1 350 ? -26.609 47.603  -23.542 1.00 13.59 ? 349 GLU A CA  1 
ATOM   2535  C C   . GLU A 1 350 ? -26.491 48.566  -22.355 1.00 14.03 ? 349 GLU A C   1 
ATOM   2536  O O   . GLU A 1 350 ? -25.505 49.294  -22.204 1.00 13.13 ? 349 GLU A O   1 
ATOM   2537  C CB  . GLU A 1 350 ? -26.541 46.160  -23.055 1.00 13.91 ? 349 GLU A CB  1 
ATOM   2538  C CG  . GLU A 1 350 ? -25.320 45.834  -22.181 1.00 14.85 ? 349 GLU A CG  1 
ATOM   2539  C CD  . GLU A 1 350 ? -25.652 45.031  -20.919 1.00 17.51 ? 349 GLU A CD  1 
ATOM   2540  O OE1 . GLU A 1 350 ? -24.701 44.604  -20.207 1.00 18.20 ? 349 GLU A OE1 1 
ATOM   2541  O OE2 . GLU A 1 350 ? -26.850 44.841  -20.621 1.00 19.74 ? 349 GLU A OE2 1 
ATOM   2542  N N   . LEU A 1 351 ? -27.534 48.544  -21.526 1.00 14.91 ? 350 LEU A N   1 
ATOM   2543  C CA  . LEU A 1 351 ? -27.617 49.332  -20.318 1.00 15.70 ? 350 LEU A CA  1 
ATOM   2544  C C   . LEU A 1 351 ? -27.669 48.286  -19.185 1.00 16.77 ? 350 LEU A C   1 
ATOM   2545  O O   . LEU A 1 351 ? -28.748 47.749  -18.862 1.00 16.04 ? 350 LEU A O   1 
ATOM   2546  C CB  . LEU A 1 351 ? -28.879 50.199  -20.362 1.00 15.97 ? 350 LEU A CB  1 
ATOM   2547  C CG  . LEU A 1 351 ? -29.023 51.423  -19.445 1.00 16.66 ? 350 LEU A CG  1 
ATOM   2548  C CD1 . LEU A 1 351 ? -27.956 52.418  -19.745 1.00 20.05 ? 350 LEU A CD1 1 
ATOM   2549  C CD2 . LEU A 1 351 ? -30.391 52.058  -19.640 1.00 16.30 ? 350 LEU A CD2 1 
ATOM   2550  N N   . PRO A 1 352 ? -26.494 47.949  -18.623 1.00 17.31 ? 351 PRO A N   1 
ATOM   2551  C CA  . PRO A 1 352 ? -26.404 46.833  -17.700 1.00 18.06 ? 351 PRO A CA  1 
ATOM   2552  C C   . PRO A 1 352 ? -27.389 46.858  -16.544 1.00 19.21 ? 351 PRO A C   1 
ATOM   2553  O O   . PRO A 1 352 ? -27.924 45.817  -16.181 1.00 19.09 ? 351 PRO A O   1 
ATOM   2554  C CB  . PRO A 1 352 ? -24.978 46.948  -17.173 1.00 17.98 ? 351 PRO A CB  1 
ATOM   2555  C CG  . PRO A 1 352 ? -24.220 47.502  -18.326 1.00 18.03 ? 351 PRO A CG  1 
ATOM   2556  C CD  . PRO A 1 352 ? -25.162 48.526  -18.890 1.00 17.90 ? 351 PRO A CD  1 
ATOM   2557  N N   . ALA A 1 353 ? -27.618 48.036  -15.975 1.00 20.37 ? 352 ALA A N   1 
ATOM   2558  C CA  . ALA A 1 353 ? -28.494 48.159  -14.803 1.00 21.34 ? 352 ALA A CA  1 
ATOM   2559  C C   . ALA A 1 353 ? -29.911 47.632  -15.035 1.00 21.67 ? 352 ALA A C   1 
ATOM   2560  O O   . ALA A 1 353 ? -30.575 47.233  -14.075 1.00 22.26 ? 352 ALA A O   1 
ATOM   2561  C CB  . ALA A 1 353 ? -28.554 49.614  -14.315 1.00 21.02 ? 352 ALA A CB  1 
ATOM   2562  N N   . ILE A 1 354 ? -30.356 47.648  -16.295 1.00 21.61 ? 353 ILE A N   1 
ATOM   2563  C CA  . ILE A 1 354 ? -31.700 47.241  -16.679 1.00 21.97 ? 353 ILE A CA  1 
ATOM   2564  C C   . ILE A 1 354 ? -31.694 45.928  -17.438 1.00 22.05 ? 353 ILE A C   1 
ATOM   2565  O O   . ILE A 1 354 ? -32.718 45.251  -17.524 1.00 22.31 ? 353 ILE A O   1 
ATOM   2566  C CB  . ILE A 1 354 ? -32.325 48.317  -17.595 1.00 22.79 ? 353 ILE A CB  1 
ATOM   2567  C CG1 . ILE A 1 354 ? -32.467 49.639  -16.849 1.00 22.98 ? 353 ILE A CG1 1 
ATOM   2568  C CG2 . ILE A 1 354 ? -33.670 47.902  -18.095 1.00 22.27 ? 353 ILE A CG2 1 
ATOM   2569  C CD1 . ILE A 1 354 ? -32.901 50.777  -17.809 1.00 23.31 ? 353 ILE A CD1 1 
ATOM   2570  N N   . MET A 1 355 ? -30.533 45.544  -17.973 1.00 21.27 ? 354 MET A N   1 
ATOM   2571  C CA  . MET A 1 355 ? -30.445 44.377  -18.823 1.00 20.48 ? 354 MET A CA  1 
ATOM   2572  C C   . MET A 1 355 ? -29.630 43.255  -18.138 1.00 20.88 ? 354 MET A C   1 
ATOM   2573  O O   . MET A 1 355 ? -30.161 42.589  -17.222 1.00 20.04 ? 354 MET A O   1 
ATOM   2574  C CB  . MET A 1 355 ? -29.923 44.824  -20.196 1.00 20.36 ? 354 MET A CB  1 
ATOM   2575  C CG  . MET A 1 355 ? -30.959 45.690  -20.917 1.00 19.95 ? 354 MET A CG  1 
ATOM   2576  S SD  . MET A 1 355 ? -30.385 46.533  -22.415 1.00 18.25 ? 354 MET A SD  1 
ATOM   2577  C CE  . MET A 1 355 ? -30.209 45.098  -23.499 1.00 17.53 ? 354 MET A CE  1 
ATOM   2578  N N   . THR A 1 356 ? -28.364 43.064  -18.523 1.00 20.36 ? 355 THR A N   1 
ATOM   2579  C CA  . THR A 1 356 ? -27.576 41.916  -18.029 1.00 20.90 ? 355 THR A CA  1 
ATOM   2580  C C   . THR A 1 356 ? -27.347 41.907  -16.521 1.00 21.39 ? 355 THR A C   1 
ATOM   2581  O O   . THR A 1 356 ? -27.056 40.866  -15.955 1.00 22.46 ? 355 THR A O   1 
ATOM   2582  C CB  . THR A 1 356 ? -26.165 41.850  -18.652 1.00 20.75 ? 355 THR A CB  1 
ATOM   2583  O OG1 . THR A 1 356 ? -25.482 43.083  -18.387 1.00 20.06 ? 355 THR A OG1 1 
ATOM   2584  C CG2 . THR A 1 356 ? -26.227 41.560  -20.148 1.00 20.48 ? 355 THR A CG2 1 
ATOM   2585  N N   . HIS A 1 357 ? -27.432 43.067  -15.881 1.00 21.87 ? 356 HIS A N   1 
ATOM   2586  C CA  . HIS A 1 357 ? -27.173 43.169  -14.453 1.00 22.17 ? 356 HIS A CA  1 
ATOM   2587  C C   . HIS A 1 357 ? -28.412 43.596  -13.657 1.00 22.81 ? 356 HIS A C   1 
ATOM   2588  O O   . HIS A 1 357 ? -28.278 44.054  -12.532 1.00 22.90 ? 356 HIS A O   1 
ATOM   2589  C CB  . HIS A 1 357 ? -25.990 44.114  -14.207 1.00 22.60 ? 356 HIS A CB  1 
ATOM   2590  C CG  . HIS A 1 357 ? -24.666 43.513  -14.547 1.00 21.69 ? 356 HIS A CG  1 
ATOM   2591  N ND1 . HIS A 1 357 ? -24.269 43.278  -15.844 1.00 22.61 ? 356 HIS A ND1 1 
ATOM   2592  C CD2 . HIS A 1 357 ? -23.664 43.058  -13.756 1.00 22.90 ? 356 HIS A CD2 1 
ATOM   2593  C CE1 . HIS A 1 357 ? -23.062 42.734  -15.839 1.00 24.79 ? 356 HIS A CE1 1 
ATOM   2594  N NE2 . HIS A 1 357 ? -22.679 42.575  -14.584 1.00 22.43 ? 356 HIS A NE2 1 
ATOM   2595  N N   . ALA A 1 358 ? -29.607 43.395  -14.225 1.00 23.47 ? 357 ALA A N   1 
ATOM   2596  C CA  . ALA A 1 358 ? -30.867 43.546  -13.475 1.00 24.57 ? 357 ALA A CA  1 
ATOM   2597  C C   . ALA A 1 358 ? -30.901 42.575  -12.274 1.00 24.80 ? 357 ALA A C   1 
ATOM   2598  O O   . ALA A 1 358 ? -31.523 42.851  -11.248 1.00 25.61 ? 357 ALA A O   1 
ATOM   2599  C CB  . ALA A 1 358 ? -32.085 43.325  -14.404 1.00 23.84 ? 357 ALA A CB  1 
ATOM   2600  N N   . SER A 1 359 ? -30.190 41.458  -12.422 1.00 25.47 ? 358 SER A N   1 
ATOM   2601  C CA  . SER A 1 359 ? -30.033 40.413  -11.389 1.00 25.68 ? 358 SER A CA  1 
ATOM   2602  C C   . SER A 1 359 ? -29.126 40.808  -10.222 1.00 26.06 ? 358 SER A C   1 
ATOM   2603  O O   . SER A 1 359 ? -29.038 40.086  -9.226  1.00 26.08 ? 358 SER A O   1 
ATOM   2604  C CB  . SER A 1 359 ? -29.466 39.144  -12.054 1.00 25.95 ? 358 SER A CB  1 
ATOM   2605  O OG  . SER A 1 359 ? -28.430 39.484  -12.981 1.00 26.13 ? 358 SER A OG  1 
ATOM   2606  N N   . VAL A 1 360 ? -28.425 41.930  -10.349 1.00 26.46 ? 359 VAL A N   1 
ATOM   2607  C CA  . VAL A 1 360 ? -27.678 42.481  -9.230  1.00 26.25 ? 359 VAL A CA  1 
ATOM   2608  C C   . VAL A 1 360 ? -28.614 43.419  -8.454  1.00 27.23 ? 359 VAL A C   1 
ATOM   2609  O O   . VAL A 1 360 ? -29.304 44.268  -9.038  1.00 26.73 ? 359 VAL A O   1 
ATOM   2610  C CB  . VAL A 1 360 ? -26.391 43.219  -9.697  1.00 26.61 ? 359 VAL A CB  1 
ATOM   2611  C CG1 . VAL A 1 360 ? -25.570 43.730  -8.480  1.00 26.03 ? 359 VAL A CG1 1 
ATOM   2612  C CG2 . VAL A 1 360 ? -25.543 42.317  -10.625 1.00 24.76 ? 359 VAL A CG2 1 
ATOM   2613  N N   . LEU A 1 361 ? -28.658 43.236  -7.134  1.00 28.01 ? 360 LEU A N   1 
ATOM   2614  C CA  . LEU A 1 361 ? -29.441 44.110  -6.260  1.00 28.47 ? 360 LEU A CA  1 
ATOM   2615  C C   . LEU A 1 361 ? -29.139 45.590  -6.517  1.00 29.15 ? 360 LEU A C   1 
ATOM   2616  O O   . LEU A 1 361 ? -27.988 45.978  -6.733  1.00 28.74 ? 360 LEU A O   1 
ATOM   2617  C CB  . LEU A 1 361 ? -29.175 43.763  -4.795  1.00 28.42 ? 360 LEU A CB  1 
ATOM   2618  C CG  . LEU A 1 361 ? -29.757 42.445  -4.283  1.00 28.98 ? 360 LEU A CG  1 
ATOM   2619  C CD1 . LEU A 1 361 ? -29.278 42.187  -2.872  1.00 29.95 ? 360 LEU A CD1 1 
ATOM   2620  C CD2 . LEU A 1 361 ? -31.285 42.453  -4.328  1.00 29.75 ? 360 LEU A CD2 1 
ATOM   2621  N N   . LYS A 1 362 ? -30.192 46.407  -6.498  1.00 30.50 ? 361 LYS A N   1 
ATOM   2622  C CA  . LYS A 1 362 ? -30.086 47.864  -6.728  1.00 31.72 ? 361 LYS A CA  1 
ATOM   2623  C C   . LYS A 1 362 ? -28.944 48.490  -5.924  1.00 31.84 ? 361 LYS A C   1 
ATOM   2624  O O   . LYS A 1 362 ? -28.083 49.172  -6.485  1.00 31.84 ? 361 LYS A O   1 
ATOM   2625  C CB  . LYS A 1 362 ? -31.407 48.555  -6.359  1.00 32.24 ? 361 LYS A CB  1 
ATOM   2626  C CG  . LYS A 1 362 ? -31.769 49.811  -7.147  1.00 33.57 ? 361 LYS A CG  1 
ATOM   2627  C CD  . LYS A 1 362 ? -30.596 50.725  -7.431  1.00 35.61 ? 361 LYS A CD  1 
ATOM   2628  C CE  . LYS A 1 362 ? -31.070 52.055  -8.047  1.00 36.08 ? 361 LYS A CE  1 
ATOM   2629  N NZ  . LYS A 1 362 ? -29.999 52.744  -8.852  1.00 36.34 ? 361 LYS A NZ  1 
ATOM   2630  N N   . ASN A 1 363 ? -28.945 48.258  -4.609  1.00 32.59 ? 362 ASN A N   1 
ATOM   2631  C CA  . ASN A 1 363 ? -27.931 48.835  -3.706  1.00 32.52 ? 362 ASN A CA  1 
ATOM   2632  C C   . ASN A 1 363 ? -26.515 48.411  -4.080  1.00 32.17 ? 362 ASN A C   1 
ATOM   2633  O O   . ASN A 1 363 ? -25.583 49.211  -3.997  1.00 31.88 ? 362 ASN A O   1 
ATOM   2634  C CB  . ASN A 1 363 ? -28.208 48.465  -2.238  1.00 32.77 ? 362 ASN A CB  1 
ATOM   2635  C CG  . ASN A 1 363 ? -27.178 49.083  -1.262  1.00 34.06 ? 362 ASN A CG  1 
ATOM   2636  O OD1 . ASN A 1 363 ? -27.036 50.316  -1.166  1.00 38.73 ? 362 ASN A OD1 1 
ATOM   2637  N ND2 . ASN A 1 363 ? -26.458 48.225  -0.543  1.00 35.75 ? 362 ASN A ND2 1 
ATOM   2638  N N   . ASP A 1 364 ? -26.362 47.148  -4.482  1.00 32.26 ? 363 ASP A N   1 
ATOM   2639  C CA  . ASP A 1 364 ? -25.060 46.634  -4.915  1.00 32.42 ? 363 ASP A CA  1 
ATOM   2640  C C   . ASP A 1 364 ? -24.621 47.377  -6.177  1.00 31.94 ? 363 ASP A C   1 
ATOM   2641  O O   . ASP A 1 364 ? -23.482 47.843  -6.274  1.00 31.73 ? 363 ASP A O   1 
ATOM   2642  C CB  . ASP A 1 364 ? -25.103 45.108  -5.135  1.00 32.55 ? 363 ASP A CB  1 
ATOM   2643  C CG  . ASP A 1 364 ? -25.363 44.324  -3.829  1.00 34.34 ? 363 ASP A CG  1 
ATOM   2644  O OD1 . ASP A 1 364 ? -25.105 44.888  -2.744  1.00 34.18 ? 363 ASP A OD1 1 
ATOM   2645  O OD2 . ASP A 1 364 ? -25.829 43.151  -3.884  1.00 34.33 ? 363 ASP A OD2 1 
ATOM   2646  N N   . ARG A 1 365 ? -25.551 47.508  -7.122  1.00 31.75 ? 364 ARG A N   1 
ATOM   2647  C CA  . ARG A 1 365 ? -25.330 48.283  -8.358  1.00 31.36 ? 364 ARG A CA  1 
ATOM   2648  C C   . ARG A 1 365 ? -24.830 49.696  -8.090  1.00 30.65 ? 364 ARG A C   1 
ATOM   2649  O O   . ARG A 1 365 ? -23.853 50.132  -8.680  1.00 30.86 ? 364 ARG A O   1 
ATOM   2650  C CB  . ARG A 1 365 ? -26.620 48.370  -9.176  1.00 31.19 ? 364 ARG A CB  1 
ATOM   2651  C CG  . ARG A 1 365 ? -26.782 47.271  -10.213 1.00 31.65 ? 364 ARG A CG  1 
ATOM   2652  C CD  . ARG A 1 365 ? -27.901 47.582  -11.172 1.00 32.55 ? 364 ARG A CD  1 
ATOM   2653  N NE  . ARG A 1 365 ? -29.047 46.738  -10.893 1.00 35.59 ? 364 ARG A NE  1 
ATOM   2654  C CZ  . ARG A 1 365 ? -30.272 47.133  -10.545 1.00 34.48 ? 364 ARG A CZ  1 
ATOM   2655  N NH1 . ARG A 1 365 ? -30.615 48.414  -10.440 1.00 34.14 ? 364 ARG A NH1 1 
ATOM   2656  N NH2 . ARG A 1 365 ? -31.178 46.197  -10.317 1.00 34.48 ? 364 ARG A NH2 1 
ATOM   2657  N N   . ASP A 1 366 ? -25.513 50.403  -7.195  1.00 30.07 ? 365 ASP A N   1 
ATOM   2658  C CA  . ASP A 1 366 ? -25.191 51.797  -6.903  1.00 29.22 ? 365 ASP A CA  1 
ATOM   2659  C C   . ASP A 1 366 ? -23.787 51.936  -6.326  1.00 28.24 ? 365 ASP A C   1 
ATOM   2660  O O   . ASP A 1 366 ? -23.030 52.800  -6.757  1.00 28.22 ? 365 ASP A O   1 
ATOM   2661  C CB  . ASP A 1 366 ? -26.258 52.415  -5.980  1.00 29.19 ? 365 ASP A CB  1 
ATOM   2662  C CG  . ASP A 1 366 ? -27.627 52.553  -6.665  1.00 30.34 ? 365 ASP A CG  1 
ATOM   2663  O OD1 . ASP A 1 366 ? -27.659 52.717  -7.916  1.00 31.79 ? 365 ASP A OD1 1 
ATOM   2664  O OD2 . ASP A 1 366 ? -28.678 52.520  -5.957  1.00 29.00 ? 365 ASP A OD2 1 
ATOM   2665  N N   . VAL A 1 367 ? -23.437 51.069  -5.371  1.00 27.50 ? 366 VAL A N   1 
ATOM   2666  C CA  . VAL A 1 367 ? -22.090 51.019  -4.790  1.00 26.51 ? 366 VAL A CA  1 
ATOM   2667  C C   . VAL A 1 367 ? -21.062 50.715  -5.878  1.00 25.57 ? 366 VAL A C   1 
ATOM   2668  O O   . VAL A 1 367 ? -19.987 51.302  -5.898  1.00 25.77 ? 366 VAL A O   1 
ATOM   2669  C CB  . VAL A 1 367 ? -21.995 49.945  -3.652  1.00 26.57 ? 366 VAL A CB  1 
ATOM   2670  C CG1 . VAL A 1 367 ? -20.548 49.706  -3.218  1.00 27.35 ? 366 VAL A CG1 1 
ATOM   2671  C CG2 . VAL A 1 367 ? -22.875 50.341  -2.423  1.00 27.33 ? 366 VAL A CG2 1 
ATOM   2672  N N   . LEU A 1 368 ? -21.403 49.792  -6.778  1.00 24.43 ? 367 LEU A N   1 
ATOM   2673  C CA  . LEU A 1 368 ? -20.481 49.338  -7.840  1.00 23.52 ? 367 LEU A CA  1 
ATOM   2674  C C   . LEU A 1 368 ? -20.266 50.363  -8.971  1.00 23.18 ? 367 LEU A C   1 
ATOM   2675  O O   . LEU A 1 368 ? -19.273 50.288  -9.700  1.00 23.68 ? 367 LEU A O   1 
ATOM   2676  C CB  . LEU A 1 368 ? -20.973 48.009  -8.450  1.00 23.34 ? 367 LEU A CB  1 
ATOM   2677  C CG  . LEU A 1 368 ? -20.814 46.726  -7.617  1.00 22.12 ? 367 LEU A CG  1 
ATOM   2678  C CD1 . LEU A 1 368 ? -21.536 45.565  -8.307  1.00 20.31 ? 367 LEU A CD1 1 
ATOM   2679  C CD2 . LEU A 1 368 ? -19.345 46.396  -7.375  1.00 20.62 ? 367 LEU A CD2 1 
ATOM   2680  N N   . GLY A 1 369 ? -21.191 51.308  -9.110  1.00 22.85 ? 368 GLY A N   1 
ATOM   2681  C CA  . GLY A 1 369 ? -21.151 52.306  -10.185 1.00 22.55 ? 368 GLY A CA  1 
ATOM   2682  C C   . GLY A 1 369 ? -21.959 51.906  -11.407 1.00 21.93 ? 368 GLY A C   1 
ATOM   2683  O O   . GLY A 1 369 ? -21.844 52.535  -12.460 1.00 22.51 ? 368 GLY A O   1 
ATOM   2684  N N   . ILE A 1 370 ? -22.780 50.866  -11.276 1.00 21.42 ? 369 ILE A N   1 
ATOM   2685  C CA  . ILE A 1 370 ? -23.628 50.408  -12.373 1.00 21.21 ? 369 ILE A CA  1 
ATOM   2686  C C   . ILE A 1 370 ? -24.920 51.213  -12.326 1.00 21.26 ? 369 ILE A C   1 
ATOM   2687  O O   . ILE A 1 370 ? -25.986 50.707  -11.933 1.00 20.13 ? 369 ILE A O   1 
ATOM   2688  C CB  . ILE A 1 370 ? -23.920 48.886  -12.305 1.00 21.32 ? 369 ILE A CB  1 
ATOM   2689  C CG1 . ILE A 1 370 ? -22.638 48.073  -12.205 1.00 20.45 ? 369 ILE A CG1 1 
ATOM   2690  C CG2 . ILE A 1 370 ? -24.722 48.431  -13.537 1.00 21.03 ? 369 ILE A CG2 1 
ATOM   2691  C CD1 . ILE A 1 370 ? -22.908 46.586  -11.944 1.00 21.93 ? 369 ILE A CD1 1 
ATOM   2692  N N   . SER A 1 371 ? -24.791 52.477  -12.747 1.00 21.15 ? 370 SER A N   1 
ATOM   2693  C CA  . SER A 1 371 ? -25.850 53.481  -12.667 1.00 20.98 ? 370 SER A CA  1 
ATOM   2694  C C   . SER A 1 371 ? -26.753 53.465  -13.898 1.00 20.95 ? 370 SER A C   1 
ATOM   2695  O O   . SER A 1 371 ? -26.557 52.663  -14.824 1.00 21.78 ? 370 SER A O   1 
ATOM   2696  C CB  . SER A 1 371 ? -25.232 54.877  -12.493 1.00 20.76 ? 370 SER A CB  1 
ATOM   2697  O OG  . SER A 1 371 ? -24.550 55.285  -13.674 1.00 20.61 ? 370 SER A OG  1 
ATOM   2698  N N   . ASP A 1 372 ? -27.744 54.355  -13.881 1.00 20.36 ? 371 ASP A N   1 
ATOM   2699  C CA  . ASP A 1 372 ? -28.638 54.613  -14.997 1.00 20.84 ? 371 ASP A CA  1 
ATOM   2700  C C   . ASP A 1 372 ? -27.944 55.131  -16.261 1.00 18.68 ? 371 ASP A C   1 
ATOM   2701  O O   . ASP A 1 372 ? -28.550 55.124  -17.330 1.00 19.23 ? 371 ASP A O   1 
ATOM   2702  C CB  . ASP A 1 372 ? -29.661 55.699  -14.604 1.00 22.04 ? 371 ASP A CB  1 
ATOM   2703  C CG  . ASP A 1 372 ? -30.803 55.178  -13.739 1.00 26.46 ? 371 ASP A CG  1 
ATOM   2704  O OD1 . ASP A 1 372 ? -30.907 53.946  -13.530 1.00 31.34 ? 371 ASP A OD1 1 
ATOM   2705  O OD2 . ASP A 1 372 ? -31.599 56.040  -13.273 1.00 31.80 ? 371 ASP A OD2 1 
ATOM   2706  N N   . THR A 1 373 ? -26.713 55.621  -16.139 1.00 17.12 ? 372 THR A N   1 
ATOM   2707  C CA  . THR A 1 373 ? -25.988 56.161  -17.285 1.00 16.13 ? 372 THR A CA  1 
ATOM   2708  C C   . THR A 1 373 ? -24.734 55.390  -17.696 1.00 14.66 ? 372 THR A C   1 
ATOM   2709  O O   . THR A 1 373 ? -24.018 55.813  -18.599 1.00 13.64 ? 372 THR A O   1 
ATOM   2710  C CB  . THR A 1 373 ? -25.618 57.623  -17.068 1.00 15.68 ? 372 THR A CB  1 
ATOM   2711  O OG1 . THR A 1 373 ? -24.842 57.736  -15.872 1.00 18.21 ? 372 THR A OG1 1 
ATOM   2712  C CG2 . THR A 1 373 ? -26.900 58.477  -16.990 1.00 16.17 ? 372 THR A CG2 1 
ATOM   2713  N N   . LEU A 1 374 ? -24.501 54.253  -17.070 1.00 14.13 ? 373 LEU A N   1 
ATOM   2714  C CA  . LEU A 1 374 ? -23.448 53.325  -17.503 1.00 13.50 ? 373 LEU A CA  1 
ATOM   2715  C C   . LEU A 1 374 ? -23.966 52.544  -18.707 1.00 12.99 ? 373 LEU A C   1 
ATOM   2716  O O   . LEU A 1 374 ? -24.983 51.812  -18.639 1.00 12.66 ? 373 LEU A O   1 
ATOM   2717  C CB  . LEU A 1 374 ? -23.033 52.377  -16.375 1.00 13.49 ? 373 LEU A CB  1 
ATOM   2718  C CG  . LEU A 1 374 ? -21.832 51.449  -16.632 1.00 13.57 ? 373 LEU A CG  1 
ATOM   2719  C CD1 . LEU A 1 374 ? -21.118 51.085  -15.323 1.00 15.69 ? 373 LEU A CD1 1 
ATOM   2720  C CD2 . LEU A 1 374 ? -22.280 50.172  -17.383 1.00 14.57 ? 373 LEU A CD2 1 
ATOM   2721  N N   . ILE A 1 375 ? -23.255 52.711  -19.818 1.00 11.76 ? 374 ILE A N   1 
ATOM   2722  C CA  . ILE A 1 375 ? -23.520 51.964  -21.044 1.00 10.61 ? 374 ILE A CA  1 
ATOM   2723  C C   . ILE A 1 375 ? -22.363 50.999  -21.297 1.00 10.91 ? 374 ILE A C   1 
ATOM   2724  O O   . ILE A 1 375 ? -21.195 51.368  -21.167 1.00 10.60 ? 374 ILE A O   1 
ATOM   2725  C CB  . ILE A 1 375 ? -23.700 52.949  -22.226 1.00 10.19 ? 374 ILE A CB  1 
ATOM   2726  C CG1 . ILE A 1 375 ? -25.050 53.658  -22.053 1.00 9.67  ? 374 ILE A CG1 1 
ATOM   2727  C CG2 . ILE A 1 375 ? -23.677 52.227  -23.544 1.00 8.29  ? 374 ILE A CG2 1 
ATOM   2728  C CD1 . ILE A 1 375 ? -25.277 54.846  -22.937 1.00 11.74 ? 374 ILE A CD1 1 
ATOM   2729  N N   . ARG A 1 376 ? -22.665 49.755  -21.651 1.00 10.55 ? 375 ARG A N   1 
ATOM   2730  C CA  . ARG A 1 376 ? -21.606 48.843  -22.065 1.00 11.21 ? 375 ARG A CA  1 
ATOM   2731  C C   . ARG A 1 376 ? -21.692 48.491  -23.572 1.00 10.68 ? 375 ARG A C   1 
ATOM   2732  O O   . ARG A 1 376 ? -22.764 48.138  -24.089 1.00 10.29 ? 375 ARG A O   1 
ATOM   2733  C CB  . ARG A 1 376 ? -21.635 47.592  -21.205 1.00 11.81 ? 375 ARG A CB  1 
ATOM   2734  C CG  . ARG A 1 376 ? -20.396 46.720  -21.381 1.00 11.97 ? 375 ARG A CG  1 
ATOM   2735  C CD  . ARG A 1 376 ? -20.681 45.312  -20.868 1.00 13.67 ? 375 ARG A CD  1 
ATOM   2736  N NE  . ARG A 1 376 ? -21.563 44.599  -21.793 1.00 14.25 ? 375 ARG A NE  1 
ATOM   2737  C CZ  . ARG A 1 376 ? -22.192 43.472  -21.504 1.00 15.47 ? 375 ARG A CZ  1 
ATOM   2738  N NH1 . ARG A 1 376 ? -22.051 42.899  -20.307 1.00 16.50 ? 375 ARG A NH1 1 
ATOM   2739  N NH2 . ARG A 1 376 ? -22.979 42.924  -22.414 1.00 15.67 ? 375 ARG A NH2 1 
ATOM   2740  N N   . LEU A 1 377 ? -20.559 48.646  -24.267 1.00 10.35 ? 376 LEU A N   1 
ATOM   2741  C CA  . LEU A 1 377 ? -20.433 48.287  -25.672 1.00 10.37 ? 376 LEU A CA  1 
ATOM   2742  C C   . LEU A 1 377 ? -19.573 47.059  -25.832 1.00 10.19 ? 376 LEU A C   1 
ATOM   2743  O O   . LEU A 1 377 ? -18.534 46.942  -25.206 1.00 9.14  ? 376 LEU A O   1 
ATOM   2744  C CB  . LEU A 1 377 ? -19.807 49.428  -26.477 1.00 10.45 ? 376 LEU A CB  1 
ATOM   2745  C CG  . LEU A 1 377 ? -20.448 50.800  -26.336 1.00 10.50 ? 376 LEU A CG  1 
ATOM   2746  C CD1 . LEU A 1 377 ? -19.620 51.842  -27.117 1.00 6.63  ? 376 LEU A CD1 1 
ATOM   2747  C CD2 . LEU A 1 377 ? -21.935 50.725  -26.796 1.00 8.34  ? 376 LEU A CD2 1 
ATOM   2748  N N   . SER A 1 378 ? -20.042 46.137  -26.671 1.00 10.59 ? 377 SER A N   1 
ATOM   2749  C CA  . SER A 1 378 ? -19.209 45.066  -27.167 1.00 9.64  ? 377 SER A CA  1 
ATOM   2750  C C   . SER A 1 378 ? -18.926 45.430  -28.612 1.00 8.64  ? 377 SER A C   1 
ATOM   2751  O O   . SER A 1 378 ? -19.770 45.218  -29.471 1.00 8.91  ? 377 SER A O   1 
ATOM   2752  C CB  . SER A 1 378 ? -19.943 43.722  -27.117 1.00 9.74  ? 377 SER A CB  1 
ATOM   2753  O OG  . SER A 1 378 ? -19.170 42.693  -27.753 1.00 10.37 ? 377 SER A OG  1 
ATOM   2754  N N   . VAL A 1 379 ? -17.748 45.979  -28.880 1.00 7.82  ? 378 VAL A N   1 
ATOM   2755  C CA  . VAL A 1 379 ? -17.396 46.433  -30.220 1.00 7.64  ? 378 VAL A CA  1 
ATOM   2756  C C   . VAL A 1 379 ? -17.005 45.211  -31.077 1.00 8.81  ? 378 VAL A C   1 
ATOM   2757  O O   . VAL A 1 379 ? -16.162 44.422  -30.667 1.00 9.58  ? 378 VAL A O   1 
ATOM   2758  C CB  . VAL A 1 379 ? -16.253 47.469  -30.185 1.00 7.84  ? 378 VAL A CB  1 
ATOM   2759  C CG1 . VAL A 1 379 ? -15.965 47.963  -31.560 1.00 6.45  ? 378 VAL A CG1 1 
ATOM   2760  C CG2 . VAL A 1 379 ? -16.659 48.639  -29.280 1.00 6.66  ? 378 VAL A CG2 1 
ATOM   2761  N N   . GLY A 1 380 ? -17.665 45.057  -32.220 1.00 8.59  ? 379 GLY A N   1 
ATOM   2762  C CA  . GLY A 1 380 ? -17.521 43.900  -33.092 1.00 9.09  ? 379 GLY A CA  1 
ATOM   2763  C C   . GLY A 1 380 ? -16.532 44.177  -34.208 1.00 9.43  ? 379 GLY A C   1 
ATOM   2764  O O   . GLY A 1 380 ? -15.669 45.021  -34.065 1.00 11.36 ? 379 GLY A O   1 
ATOM   2765  N N   . LEU A 1 381 ? -16.677 43.481  -35.326 1.00 9.97  ? 380 LEU A N   1 
ATOM   2766  C CA  . LEU A 1 381 ? -15.647 43.466  -36.368 1.00 9.62  ? 380 LEU A CA  1 
ATOM   2767  C C   . LEU A 1 381 ? -15.979 44.287  -37.606 1.00 8.97  ? 380 LEU A C   1 
ATOM   2768  O O   . LEU A 1 381 ? -15.292 44.191  -38.633 1.00 8.35  ? 380 LEU A O   1 
ATOM   2769  C CB  . LEU A 1 381 ? -15.322 42.014  -36.750 1.00 9.26  ? 380 LEU A CB  1 
ATOM   2770  C CG  . LEU A 1 381 ? -14.945 41.138  -35.560 1.00 10.44 ? 380 LEU A CG  1 
ATOM   2771  C CD1 . LEU A 1 381 ? -14.737 39.688  -35.976 1.00 11.08 ? 380 LEU A CD1 1 
ATOM   2772  C CD2 . LEU A 1 381 ? -13.694 41.668  -34.838 1.00 9.66  ? 380 LEU A CD2 1 
ATOM   2773  N N   . GLU A 1 382 ? -17.004 45.120  -37.498 1.00 9.23  ? 381 GLU A N   1 
ATOM   2774  C CA  . GLU A 1 382 ? -17.428 45.985  -38.592 1.00 8.48  ? 381 GLU A CA  1 
ATOM   2775  C C   . GLU A 1 382 ? -16.359 47.041  -38.888 1.00 8.87  ? 381 GLU A C   1 
ATOM   2776  O O   . GLU A 1 382 ? -15.398 47.228  -38.121 1.00 8.82  ? 381 GLU A O   1 
ATOM   2777  C CB  . GLU A 1 382 ? -18.760 46.701  -38.255 1.00 8.90  ? 381 GLU A CB  1 
ATOM   2778  C CG  . GLU A 1 382 ? -19.968 45.777  -37.992 1.00 9.28  ? 381 GLU A CG  1 
ATOM   2779  C CD  . GLU A 1 382 ? -20.200 45.436  -36.510 1.00 10.58 ? 381 GLU A CD  1 
ATOM   2780  O OE1 . GLU A 1 382 ? -21.340 45.067  -36.121 1.00 14.04 ? 381 GLU A OE1 1 
ATOM   2781  O OE2 . GLU A 1 382 ? -19.243 45.499  -35.724 1.00 8.61  ? 381 GLU A OE2 1 
ATOM   2782  N N   . ASP A 1 383 ? -16.524 47.726  -40.008 1.00 8.98  ? 382 ASP A N   1 
ATOM   2783  C CA  . ASP A 1 383 ? -15.627 48.822  -40.371 1.00 9.77  ? 382 ASP A CA  1 
ATOM   2784  C C   . ASP A 1 383 ? -15.603 49.906  -39.305 1.00 10.83 ? 382 ASP A C   1 
ATOM   2785  O O   . ASP A 1 383 ? -16.655 50.382  -38.853 1.00 9.86  ? 382 ASP A O   1 
ATOM   2786  C CB  . ASP A 1 383 ? -16.056 49.397  -41.705 1.00 10.22 ? 382 ASP A CB  1 
ATOM   2787  C CG  . ASP A 1 383 ? -15.780 48.450  -42.829 1.00 12.01 ? 382 ASP A CG  1 
ATOM   2788  O OD1 . ASP A 1 383 ? -14.597 48.378  -43.241 1.00 17.66 ? 382 ASP A OD1 1 
ATOM   2789  O OD2 . ASP A 1 383 ? -16.726 47.747  -43.254 1.00 11.05 ? 382 ASP A OD2 1 
ATOM   2790  N N   . GLU A 1 384 ? -14.403 50.282  -38.893 1.00 11.33 ? 383 GLU A N   1 
ATOM   2791  C CA  . GLU A 1 384 ? -14.224 51.291  -37.856 1.00 12.00 ? 383 GLU A CA  1 
ATOM   2792  C C   . GLU A 1 384 ? -15.042 52.583  -38.092 1.00 12.70 ? 383 GLU A C   1 
ATOM   2793  O O   . GLU A 1 384 ? -15.672 53.076  -37.179 1.00 11.33 ? 383 GLU A O   1 
ATOM   2794  C CB  . GLU A 1 384 ? -12.731 51.618  -37.708 1.00 11.99 ? 383 GLU A CB  1 
ATOM   2795  C CG  . GLU A 1 384 ? -12.428 52.604  -36.615 1.00 12.14 ? 383 GLU A CG  1 
ATOM   2796  C CD  . GLU A 1 384 ? -11.007 53.149  -36.668 1.00 13.44 ? 383 GLU A CD  1 
ATOM   2797  O OE1 . GLU A 1 384 ? -10.830 54.383  -36.789 1.00 16.58 ? 383 GLU A OE1 1 
ATOM   2798  O OE2 . GLU A 1 384 ? -10.076 52.346  -36.594 1.00 15.91 ? 383 GLU A OE2 1 
ATOM   2799  N N   . GLU A 1 385 ? -15.008 53.125  -39.309 1.00 13.63 ? 384 GLU A N   1 
ATOM   2800  C CA  . GLU A 1 385 ? -15.691 54.376  -39.604 1.00 15.31 ? 384 GLU A CA  1 
ATOM   2801  C C   . GLU A 1 385 ? -17.225 54.258  -39.427 1.00 14.28 ? 384 GLU A C   1 
ATOM   2802  O O   . GLU A 1 385 ? -17.866 55.188  -38.921 1.00 12.53 ? 384 GLU A O   1 
ATOM   2803  C CB  . GLU A 1 385 ? -15.246 54.887  -40.996 1.00 17.08 ? 384 GLU A CB  1 
ATOM   2804  C CG  . GLU A 1 385 ? -16.242 55.661  -41.871 1.00 23.78 ? 384 GLU A CG  1 
ATOM   2805  C CD  . GLU A 1 385 ? -16.779 54.854  -43.126 1.00 31.64 ? 384 GLU A CD  1 
ATOM   2806  O OE1 . GLU A 1 385 ? -18.027 54.899  -43.354 1.00 34.42 ? 384 GLU A OE1 1 
ATOM   2807  O OE2 . GLU A 1 385 ? -15.972 54.222  -43.881 1.00 34.71 ? 384 GLU A OE2 1 
ATOM   2808  N N   . ASP A 1 386 ? -17.787 53.096  -39.781 1.00 12.77 ? 385 ASP A N   1 
ATOM   2809  C CA  . ASP A 1 386 ? -19.210 52.843  -39.616 1.00 12.24 ? 385 ASP A CA  1 
ATOM   2810  C C   . ASP A 1 386 ? -19.601 52.848  -38.141 1.00 12.21 ? 385 ASP A C   1 
ATOM   2811  O O   . ASP A 1 386 ? -20.604 53.454  -37.762 1.00 12.21 ? 385 ASP A O   1 
ATOM   2812  C CB  . ASP A 1 386 ? -19.619 51.535  -40.309 1.00 11.87 ? 385 ASP A CB  1 
ATOM   2813  C CG  . ASP A 1 386 ? -19.433 51.611  -41.804 1.00 13.76 ? 385 ASP A CG  1 
ATOM   2814  O OD1 . ASP A 1 386 ? -19.548 52.750  -42.333 1.00 15.54 ? 385 ASP A OD1 1 
ATOM   2815  O OD2 . ASP A 1 386 ? -19.165 50.583  -42.468 1.00 11.67 ? 385 ASP A OD2 1 
ATOM   2816  N N   . LEU A 1 387 ? -18.781 52.223  -37.309 1.00 12.25 ? 386 LEU A N   1 
ATOM   2817  C CA  . LEU A 1 387 ? -19.045 52.190  -35.874 1.00 12.00 ? 386 LEU A CA  1 
ATOM   2818  C C   . LEU A 1 387 ? -18.940 53.587  -35.203 1.00 12.21 ? 386 LEU A C   1 
ATOM   2819  O O   . LEU A 1 387 ? -19.757 53.932  -34.338 1.00 12.59 ? 386 LEU A O   1 
ATOM   2820  C CB  . LEU A 1 387 ? -18.088 51.186  -35.216 1.00 12.46 ? 386 LEU A CB  1 
ATOM   2821  C CG  . LEU A 1 387 ? -18.234 49.706  -35.622 1.00 12.47 ? 386 LEU A CG  1 
ATOM   2822  C CD1 . LEU A 1 387 ? -17.140 48.835  -34.977 1.00 11.71 ? 386 LEU A CD1 1 
ATOM   2823  C CD2 . LEU A 1 387 ? -19.628 49.164  -35.266 1.00 13.49 ? 386 LEU A CD2 1 
ATOM   2824  N N   . LEU A 1 388 ? -17.932 54.377  -35.579 1.00 11.72 ? 387 LEU A N   1 
ATOM   2825  C CA  . LEU A 1 388 ? -17.733 55.694  -34.963 1.00 11.49 ? 387 LEU A CA  1 
ATOM   2826  C C   . LEU A 1 388 ? -18.869 56.651  -35.383 1.00 12.00 ? 387 LEU A C   1 
ATOM   2827  O O   . LEU A 1 388 ? -19.338 57.477  -34.597 1.00 11.56 ? 387 LEU A O   1 
ATOM   2828  C CB  . LEU A 1 388 ? -16.358 56.251  -35.349 1.00 11.33 ? 387 LEU A CB  1 
ATOM   2829  C CG  . LEU A 1 388 ? -15.132 55.490  -34.814 1.00 10.18 ? 387 LEU A CG  1 
ATOM   2830  C CD1 . LEU A 1 388 ? -13.856 56.272  -34.987 1.00 10.96 ? 387 LEU A CD1 1 
ATOM   2831  C CD2 . LEU A 1 388 ? -15.325 55.068  -33.352 1.00 7.53  ? 387 LEU A CD2 1 
ATOM   2832  N N   . GLU A 1 389 ? -19.318 56.500  -36.626 1.00 12.15 ? 388 GLU A N   1 
ATOM   2833  C CA  . GLU A 1 389 ? -20.412 57.294  -37.175 1.00 13.93 ? 388 GLU A CA  1 
ATOM   2834  C C   . GLU A 1 389 ? -21.706 57.012  -36.420 1.00 12.84 ? 388 GLU A C   1 
ATOM   2835  O O   . GLU A 1 389 ? -22.478 57.929  -36.122 1.00 12.14 ? 388 GLU A O   1 
ATOM   2836  C CB  . GLU A 1 389 ? -20.596 56.944  -38.649 1.00 14.34 ? 388 GLU A CB  1 
ATOM   2837  C CG  . GLU A 1 389 ? -21.302 57.956  -39.497 1.00 21.76 ? 388 GLU A CG  1 
ATOM   2838  C CD  . GLU A 1 389 ? -22.760 58.121  -39.171 1.00 29.75 ? 388 GLU A CD  1 
ATOM   2839  O OE1 . GLU A 1 389 ? -23.208 59.303  -39.067 1.00 35.99 ? 388 GLU A OE1 1 
ATOM   2840  O OE2 . GLU A 1 389 ? -23.447 57.074  -39.021 1.00 35.45 ? 388 GLU A OE2 1 
ATOM   2841  N N   . ASP A 1 390 ? -21.942 55.738  -36.128 1.00 11.82 ? 389 ASP A N   1 
ATOM   2842  C CA  . ASP A 1 390 ? -23.153 55.331  -35.410 1.00 11.75 ? 389 ASP A CA  1 
ATOM   2843  C C   . ASP A 1 390 ? -23.182 55.962  -34.030 1.00 11.44 ? 389 ASP A C   1 
ATOM   2844  O O   . ASP A 1 390 ? -24.210 56.513  -33.596 1.00 9.45  ? 389 ASP A O   1 
ATOM   2845  C CB  . ASP A 1 390 ? -23.232 53.800  -35.299 1.00 11.67 ? 389 ASP A CB  1 
ATOM   2846  C CG  . ASP A 1 390 ? -24.614 53.312  -34.963 1.00 11.41 ? 389 ASP A CG  1 
ATOM   2847  O OD1 . ASP A 1 390 ? -25.586 53.995  -35.350 1.00 10.75 ? 389 ASP A OD1 1 
ATOM   2848  O OD2 . ASP A 1 390 ? -24.742 52.257  -34.280 1.00 10.61 ? 389 ASP A OD2 1 
ATOM   2849  N N   . LEU A 1 391 ? -22.039 55.883  -33.349 1.00 11.37 ? 390 LEU A N   1 
ATOM   2850  C CA  . LEU A 1 391 ? -21.918 56.422  -32.005 1.00 11.73 ? 390 LEU A CA  1 
ATOM   2851  C C   . LEU A 1 391 ? -22.076 57.932  -32.007 1.00 11.86 ? 390 LEU A C   1 
ATOM   2852  O O   . LEU A 1 391 ? -22.828 58.470  -31.201 1.00 11.27 ? 390 LEU A O   1 
ATOM   2853  C CB  . LEU A 1 391 ? -20.599 56.007  -31.344 1.00 11.81 ? 390 LEU A CB  1 
ATOM   2854  C CG  . LEU A 1 391 ? -20.421 54.511  -31.014 1.00 11.80 ? 390 LEU A CG  1 
ATOM   2855  C CD1 . LEU A 1 391 ? -18.934 54.270  -30.648 1.00 12.96 ? 390 LEU A CD1 1 
ATOM   2856  C CD2 . LEU A 1 391 ? -21.364 53.972  -29.904 1.00 11.77 ? 390 LEU A CD2 1 
ATOM   2857  N N   . ASP A 1 392 ? -21.421 58.600  -32.957 1.00 12.08 ? 391 ASP A N   1 
ATOM   2858  C CA  . ASP A 1 392 ? -21.543 60.039  -33.107 1.00 12.38 ? 391 ASP A CA  1 
ATOM   2859  C C   . ASP A 1 392 ? -23.003 60.518  -33.256 1.00 13.02 ? 391 ASP A C   1 
ATOM   2860  O O   . ASP A 1 392 ? -23.432 61.415  -32.525 1.00 12.99 ? 391 ASP A O   1 
ATOM   2861  C CB  . ASP A 1 392 ? -20.710 60.529  -34.310 1.00 12.64 ? 391 ASP A CB  1 
ATOM   2862  C CG  . ASP A 1 392 ? -20.456 62.039  -34.271 1.00 13.58 ? 391 ASP A CG  1 
ATOM   2863  O OD1 . ASP A 1 392 ? -20.287 62.589  -33.174 1.00 14.26 ? 391 ASP A OD1 1 
ATOM   2864  O OD2 . ASP A 1 392 ? -20.429 62.672  -35.336 1.00 21.11 ? 391 ASP A OD2 1 
ATOM   2865  N N   . GLN A 1 393 ? -23.745 59.943  -34.205 1.00 13.01 ? 392 GLN A N   1 
ATOM   2866  C CA  . GLN A 1 393 ? -25.099 60.417  -34.490 1.00 13.19 ? 392 GLN A CA  1 
ATOM   2867  C C   . GLN A 1 393 ? -26.039 60.110  -33.325 1.00 12.51 ? 392 GLN A C   1 
ATOM   2868  O O   . GLN A 1 393 ? -26.906 60.915  -32.989 1.00 12.64 ? 392 GLN A O   1 
ATOM   2869  C CB  . GLN A 1 393 ? -25.639 59.872  -35.837 1.00 13.23 ? 392 GLN A CB  1 
ATOM   2870  C CG  . GLN A 1 393 ? -25.755 58.331  -35.973 1.00 12.87 ? 392 GLN A CG  1 
ATOM   2871  C CD  . GLN A 1 393 ? -27.052 57.780  -35.438 1.00 12.14 ? 392 GLN A CD  1 
ATOM   2872  O OE1 . GLN A 1 393 ? -28.051 58.494  -35.382 1.00 11.42 ? 392 GLN A OE1 1 
ATOM   2873  N NE2 . GLN A 1 393 ? -27.043 56.515  -35.019 1.00 10.35 ? 392 GLN A NE2 1 
ATOM   2874  N N   . ALA A 1 394 ? -25.831 58.971  -32.679 1.00 11.41 ? 393 ALA A N   1 
ATOM   2875  C CA  . ALA A 1 394 ? -26.647 58.589  -31.562 1.00 12.02 ? 393 ALA A CA  1 
ATOM   2876  C C   . ALA A 1 394 ? -26.437 59.510  -30.348 1.00 12.38 ? 393 ALA A C   1 
ATOM   2877  O O   . ALA A 1 394 ? -27.419 59.902  -29.683 1.00 12.79 ? 393 ALA A O   1 
ATOM   2878  C CB  . ALA A 1 394 ? -26.410 57.099  -31.217 1.00 10.45 ? 393 ALA A CB  1 
ATOM   2879  N N   . LEU A 1 395 ? -25.184 59.879  -30.056 1.00 12.77 ? 394 LEU A N   1 
ATOM   2880  C CA  . LEU A 1 395 ? -24.914 60.835  -28.961 1.00 13.03 ? 394 LEU A CA  1 
ATOM   2881  C C   . LEU A 1 395 ? -25.507 62.205  -29.258 1.00 13.99 ? 394 LEU A C   1 
ATOM   2882  O O   . LEU A 1 395 ? -26.058 62.834  -28.388 1.00 13.95 ? 394 LEU A O   1 
ATOM   2883  C CB  . LEU A 1 395 ? -23.415 60.995  -28.683 1.00 13.13 ? 394 LEU A CB  1 
ATOM   2884  C CG  . LEU A 1 395 ? -22.734 59.870  -27.893 1.00 13.43 ? 394 LEU A CG  1 
ATOM   2885  C CD1 . LEU A 1 395 ? -21.217 59.994  -28.029 1.00 12.81 ? 394 LEU A CD1 1 
ATOM   2886  C CD2 . LEU A 1 395 ? -23.158 59.891  -26.427 1.00 13.87 ? 394 LEU A CD2 1 
ATOM   2887  N N   . LYS A 1 396 ? -25.352 62.652  -30.497 1.00 15.40 ? 395 LYS A N   1 
ATOM   2888  C CA  . LYS A 1 396 ? -25.994 63.856  -31.001 1.00 16.61 ? 395 LYS A CA  1 
ATOM   2889  C C   . LYS A 1 396 ? -27.522 63.878  -30.848 1.00 17.09 ? 395 LYS A C   1 
ATOM   2890  O O   . LYS A 1 396 ? -28.106 64.927  -30.526 1.00 17.32 ? 395 LYS A O   1 
ATOM   2891  C CB  . LYS A 1 396 ? -25.627 64.032  -32.468 1.00 16.63 ? 395 LYS A CB  1 
ATOM   2892  C CG  . LYS A 1 396 ? -24.278 64.652  -32.697 1.00 18.26 ? 395 LYS A CG  1 
ATOM   2893  C CD  . LYS A 1 396 ? -23.938 64.590  -34.181 1.00 19.91 ? 395 LYS A CD  1 
ATOM   2894  C CE  . LYS A 1 396 ? -22.852 65.549  -34.570 1.00 23.07 ? 395 LYS A CE  1 
ATOM   2895  N NZ  . LYS A 1 396 ? -21.543 65.249  -33.948 1.00 26.03 ? 395 LYS A NZ  1 
ATOM   2896  N N   . ALA A 1 397 ? -28.175 62.741  -31.074 1.00 17.48 ? 396 ALA A N   1 
ATOM   2897  C CA  . ALA A 1 397 ? -29.614 62.662  -30.907 1.00 17.60 ? 396 ALA A CA  1 
ATOM   2898  C C   . ALA A 1 397 ? -30.007 62.840  -29.422 1.00 17.88 ? 396 ALA A C   1 
ATOM   2899  O O   . ALA A 1 397 ? -31.049 63.422  -29.122 1.00 17.70 ? 396 ALA A O   1 
ATOM   2900  C CB  . ALA A 1 397 ? -30.155 61.340  -31.482 1.00 17.00 ? 396 ALA A CB  1 
ATOM   2901  N N   . ALA A 1 398 ? -29.179 62.346  -28.504 1.00 18.37 ? 397 ALA A N   1 
ATOM   2902  C CA  . ALA A 1 398 ? -29.456 62.441  -27.071 1.00 18.76 ? 397 ALA A CA  1 
ATOM   2903  C C   . ALA A 1 398 ? -29.119 63.828  -26.502 1.00 20.13 ? 397 ALA A C   1 
ATOM   2904  O O   . ALA A 1 398 ? -29.702 64.256  -25.519 1.00 20.10 ? 397 ALA A O   1 
ATOM   2905  C CB  . ALA A 1 398 ? -28.681 61.363  -26.302 1.00 18.66 ? 397 ALA A CB  1 
ATOM   2906  N N   . HIS A 1 399 ? -28.134 64.493  -27.090 1.00 21.35 ? 398 HIS A N   1 
ATOM   2907  C CA  . HIS A 1 399 ? -27.698 65.803  -26.644 1.00 23.08 ? 398 HIS A CA  1 
ATOM   2908  C C   . HIS A 1 399 ? -27.641 66.718  -27.852 1.00 24.72 ? 398 HIS A C   1 
ATOM   2909  O O   . HIS A 1 399 ? -26.583 66.902  -28.448 1.00 25.85 ? 398 HIS A O   1 
ATOM   2910  C CB  . HIS A 1 399 ? -26.323 65.691  -26.014 1.00 23.30 ? 398 HIS A CB  1 
ATOM   2911  C CG  . HIS A 1 399 ? -26.305 64.962  -24.707 1.00 22.76 ? 398 HIS A CG  1 
ATOM   2912  N ND1 . HIS A 1 399 ? -26.777 65.520  -23.539 1.00 23.64 ? 398 HIS A ND1 1 
ATOM   2913  C CD2 . HIS A 1 399 ? -25.832 63.739  -24.375 1.00 23.49 ? 398 HIS A CD2 1 
ATOM   2914  C CE1 . HIS A 1 399 ? -26.597 64.669  -22.544 1.00 23.75 ? 398 HIS A CE1 1 
ATOM   2915  N NE2 . HIS A 1 399 ? -26.020 63.582  -23.024 1.00 23.00 ? 398 HIS A NE2 1 
ATOM   2916  N N   . PRO A 1 400 ? -28.786 67.288  -28.249 1.00 26.07 ? 399 PRO A N   1 
ATOM   2917  C CA  . PRO A 1 400 ? -28.770 68.047  -29.505 1.00 27.07 ? 399 PRO A CA  1 
ATOM   2918  C C   . PRO A 1 400 ? -28.034 69.416  -29.419 1.00 27.93 ? 399 PRO A C   1 
ATOM   2919  O O   . PRO A 1 400 ? -27.674 69.871  -28.310 1.00 29.07 ? 399 PRO A O   1 
ATOM   2920  C CB  . PRO A 1 400 ? -30.269 68.233  -29.818 1.00 27.05 ? 399 PRO A CB  1 
ATOM   2921  C CG  . PRO A 1 400 ? -31.002 67.388  -28.815 1.00 26.50 ? 399 PRO A CG  1 
ATOM   2922  C CD  . PRO A 1 400 ? -30.116 67.305  -27.625 1.00 25.90 ? 399 PRO A CD  1 
ATOM   2923  N N   . GLY B 1 11  ? -55.260 -5.860  -21.760 1.00 26.23 ? 10  GLY B N   1 
ATOM   2924  C CA  . GLY B 1 11  ? -55.861 -5.274  -20.528 1.00 26.27 ? 10  GLY B CA  1 
ATOM   2925  C C   . GLY B 1 11  ? -55.037 -4.157  -19.921 1.00 26.14 ? 10  GLY B C   1 
ATOM   2926  O O   . GLY B 1 11  ? -55.210 -3.819  -18.762 1.00 26.04 ? 10  GLY B O   1 
ATOM   2927  N N   . PHE B 1 12  ? -54.143 -3.571  -20.713 1.00 25.52 ? 11  PHE B N   1 
ATOM   2928  C CA  . PHE B 1 12  ? -53.402 -2.390  -20.275 1.00 25.22 ? 11  PHE B CA  1 
ATOM   2929  C C   . PHE B 1 12  ? -54.323 -1.145  -20.269 1.00 24.73 ? 11  PHE B C   1 
ATOM   2930  O O   . PHE B 1 12  ? -55.376 -1.136  -20.911 1.00 24.33 ? 11  PHE B O   1 
ATOM   2931  C CB  . PHE B 1 12  ? -52.201 -2.169  -21.205 1.00 24.87 ? 11  PHE B CB  1 
ATOM   2932  C CG  . PHE B 1 12  ? -51.140 -3.235  -21.104 1.00 24.80 ? 11  PHE B CG  1 
ATOM   2933  C CD1 . PHE B 1 12  ? -50.013 -3.039  -20.313 1.00 25.48 ? 11  PHE B CD1 1 
ATOM   2934  C CD2 . PHE B 1 12  ? -51.242 -4.420  -21.827 1.00 25.90 ? 11  PHE B CD2 1 
ATOM   2935  C CE1 . PHE B 1 12  ? -49.018 -4.014  -20.227 1.00 24.50 ? 11  PHE B CE1 1 
ATOM   2936  C CE2 . PHE B 1 12  ? -50.252 -5.393  -21.739 1.00 25.07 ? 11  PHE B CE2 1 
ATOM   2937  C CZ  . PHE B 1 12  ? -49.143 -5.186  -20.935 1.00 24.61 ? 11  PHE B CZ  1 
ATOM   2938  N N   . LEU B 1 13  ? -53.935 -0.103  -19.534 1.00 24.78 ? 12  LEU B N   1 
ATOM   2939  C CA  . LEU B 1 13  ? -54.555 1.223   -19.697 1.00 24.64 ? 12  LEU B CA  1 
ATOM   2940  C C   . LEU B 1 13  ? -54.708 1.491   -21.179 1.00 24.30 ? 12  LEU B C   1 
ATOM   2941  O O   . LEU B 1 13  ? -53.779 1.230   -21.943 1.00 24.46 ? 12  LEU B O   1 
ATOM   2942  C CB  . LEU B 1 13  ? -53.663 2.338   -19.145 1.00 25.09 ? 12  LEU B CB  1 
ATOM   2943  C CG  . LEU B 1 13  ? -53.492 2.515   -17.652 1.00 26.01 ? 12  LEU B CG  1 
ATOM   2944  C CD1 . LEU B 1 13  ? -52.542 3.688   -17.399 1.00 26.20 ? 12  LEU B CD1 1 
ATOM   2945  C CD2 . LEU B 1 13  ? -54.851 2.765   -17.019 1.00 28.89 ? 12  LEU B CD2 1 
ATOM   2946  N N   . PRO B 1 14  ? -55.864 2.029   -21.600 1.00 24.04 ? 13  PRO B N   1 
ATOM   2947  C CA  . PRO B 1 14  ? -56.018 2.346   -23.023 1.00 23.17 ? 13  PRO B CA  1 
ATOM   2948  C C   . PRO B 1 14  ? -54.976 3.403   -23.458 1.00 21.94 ? 13  PRO B C   1 
ATOM   2949  O O   . PRO B 1 14  ? -54.572 4.244   -22.666 1.00 21.24 ? 13  PRO B O   1 
ATOM   2950  C CB  . PRO B 1 14  ? -57.447 2.913   -23.112 1.00 23.30 ? 13  PRO B CB  1 
ATOM   2951  C CG  . PRO B 1 14  ? -58.134 2.484   -21.876 1.00 24.24 ? 13  PRO B CG  1 
ATOM   2952  C CD  . PRO B 1 14  ? -57.068 2.390   -20.822 1.00 24.24 ? 13  PRO B CD  1 
ATOM   2953  N N   . HIS B 1 15  ? -54.524 3.327   -24.697 1.00 21.30 ? 14  HIS B N   1 
ATOM   2954  C CA  . HIS B 1 15  ? -53.521 4.260   -25.202 1.00 20.72 ? 14  HIS B CA  1 
ATOM   2955  C C   . HIS B 1 15  ? -54.005 5.708   -25.120 1.00 20.54 ? 14  HIS B C   1 
ATOM   2956  O O   . HIS B 1 15  ? -55.193 5.976   -25.293 1.00 19.90 ? 14  HIS B O   1 
ATOM   2957  C CB  . HIS B 1 15  ? -53.173 3.906   -26.642 1.00 21.33 ? 14  HIS B CB  1 
ATOM   2958  C CG  . HIS B 1 15  ? -52.217 2.766   -26.756 1.00 21.86 ? 14  HIS B CG  1 
ATOM   2959  N ND1 . HIS B 1 15  ? -50.924 2.842   -26.283 1.00 21.58 ? 14  HIS B ND1 1 
ATOM   2960  C CD2 . HIS B 1 15  ? -52.353 1.530   -27.291 1.00 23.00 ? 14  HIS B CD2 1 
ATOM   2961  C CE1 . HIS B 1 15  ? -50.304 1.699   -26.523 1.00 22.01 ? 14  HIS B CE1 1 
ATOM   2962  N NE2 . HIS B 1 15  ? -51.152 0.883   -27.125 1.00 22.63 ? 14  HIS B NE2 1 
ATOM   2963  N N   . PHE B 1 16  ? -53.074 6.622   -24.856 1.00 19.72 ? 15  PHE B N   1 
ATOM   2964  C CA  . PHE B 1 16  ? -53.395 8.030   -24.624 1.00 19.52 ? 15  PHE B CA  1 
ATOM   2965  C C   . PHE B 1 16  ? -53.876 8.670   -25.924 1.00 18.89 ? 15  PHE B C   1 
ATOM   2966  O O   . PHE B 1 16  ? -53.254 8.537   -26.972 1.00 18.91 ? 15  PHE B O   1 
ATOM   2967  C CB  . PHE B 1 16  ? -52.194 8.775   -24.037 1.00 19.65 ? 15  PHE B CB  1 
ATOM   2968  C CG  . PHE B 1 16  ? -51.644 8.140   -22.788 1.00 19.83 ? 15  PHE B CG  1 
ATOM   2969  C CD1 . PHE B 1 16  ? -50.309 7.756   -22.708 1.00 19.21 ? 15  PHE B CD1 1 
ATOM   2970  C CD2 . PHE B 1 16  ? -52.476 7.891   -21.702 1.00 20.04 ? 15  PHE B CD2 1 
ATOM   2971  C CE1 . PHE B 1 16  ? -49.806 7.148   -21.549 1.00 18.98 ? 15  PHE B CE1 1 
ATOM   2972  C CE2 . PHE B 1 16  ? -51.975 7.288   -20.529 1.00 21.05 ? 15  PHE B CE2 1 
ATOM   2973  C CZ  . PHE B 1 16  ? -50.642 6.911   -20.464 1.00 19.50 ? 15  PHE B CZ  1 
ATOM   2974  N N   . GLN B 1 17  ? -55.033 9.303   -25.851 1.00 18.20 ? 16  GLN B N   1 
ATOM   2975  C CA  . GLN B 1 17  ? -55.668 9.894   -27.022 1.00 18.24 ? 16  GLN B CA  1 
ATOM   2976  C C   . GLN B 1 17  ? -54.831 11.023  -27.611 1.00 16.72 ? 16  GLN B C   1 
ATOM   2977  O O   . GLN B 1 17  ? -54.231 11.820  -26.878 1.00 16.05 ? 16  GLN B O   1 
ATOM   2978  C CB  . GLN B 1 17  ? -57.077 10.396  -26.677 1.00 19.25 ? 16  GLN B CB  1 
ATOM   2979  C CG  . GLN B 1 17  ? -58.224 9.508   -27.171 1.00 24.31 ? 16  GLN B CG  1 
ATOM   2980  C CD  . GLN B 1 17  ? -59.349 10.330  -27.815 1.00 30.48 ? 16  GLN B CD  1 
ATOM   2981  O OE1 . GLN B 1 17  ? -59.797 10.035  -28.942 1.00 35.26 ? 16  GLN B OE1 1 
ATOM   2982  N NE2 . GLN B 1 17  ? -59.800 11.378  -27.114 1.00 32.32 ? 16  GLN B NE2 1 
ATOM   2983  N N   . HIS B 1 18  ? -54.794 11.071  -28.945 1.00 15.66 ? 17  HIS B N   1 
ATOM   2984  C CA  . HIS B 1 18  ? -54.139 12.148  -29.710 1.00 14.44 ? 17  HIS B CA  1 
ATOM   2985  C C   . HIS B 1 18  ? -52.643 12.214  -29.536 1.00 13.53 ? 17  HIS B C   1 
ATOM   2986  O O   . HIS B 1 18  ? -52.034 13.232  -29.884 1.00 13.46 ? 17  HIS B O   1 
ATOM   2987  C CB  . HIS B 1 18  ? -54.735 13.524  -29.364 1.00 14.21 ? 17  HIS B CB  1 
ATOM   2988  C CG  . HIS B 1 18  ? -56.226 13.547  -29.415 1.00 15.98 ? 17  HIS B CG  1 
ATOM   2989  N ND1 . HIS B 1 18  ? -56.927 13.360  -30.586 1.00 17.09 ? 17  HIS B ND1 1 
ATOM   2990  C CD2 . HIS B 1 18  ? -57.151 13.683  -28.436 1.00 17.73 ? 17  HIS B CD2 1 
ATOM   2991  C CE1 . HIS B 1 18  ? -58.226 13.408  -30.327 1.00 19.24 ? 17  HIS B CE1 1 
ATOM   2992  N NE2 . HIS B 1 18  ? -58.386 13.581  -29.027 1.00 17.52 ? 17  HIS B NE2 1 
ATOM   2993  N N   . PHE B 1 19  ? -52.047 11.149  -29.010 1.00 13.14 ? 18  PHE B N   1 
ATOM   2994  C CA  . PHE B 1 19  ? -50.625 11.153  -28.684 1.00 12.80 ? 18  PHE B CA  1 
ATOM   2995  C C   . PHE B 1 19  ? -49.796 11.367  -29.972 1.00 12.34 ? 18  PHE B C   1 
ATOM   2996  O O   . PHE B 1 19  ? -48.939 12.238  -30.022 1.00 13.32 ? 18  PHE B O   1 
ATOM   2997  C CB  . PHE B 1 19  ? -50.216 9.857   -27.942 1.00 12.72 ? 18  PHE B CB  1 
ATOM   2998  C CG  . PHE B 1 19  ? -48.771 9.869   -27.447 1.00 12.92 ? 18  PHE B CG  1 
ATOM   2999  C CD1 . PHE B 1 19  ? -48.481 10.095  -26.112 1.00 13.00 ? 18  PHE B CD1 1 
ATOM   3000  C CD2 . PHE B 1 19  ? -47.702 9.677   -28.345 1.00 13.27 ? 18  PHE B CD2 1 
ATOM   3001  C CE1 . PHE B 1 19  ? -47.160 10.119  -25.669 1.00 12.56 ? 18  PHE B CE1 1 
ATOM   3002  C CE2 . PHE B 1 19  ? -46.400 9.676   -27.907 1.00 14.13 ? 18  PHE B CE2 1 
ATOM   3003  C CZ  . PHE B 1 19  ? -46.127 9.919   -26.552 1.00 12.07 ? 18  PHE B CZ  1 
ATOM   3004  N N   . ALA B 1 20  ? -50.109 10.638  -31.035 1.00 12.12 ? 19  ALA B N   1 
ATOM   3005  C CA  . ALA B 1 20  ? -49.356 10.778  -32.288 1.00 12.27 ? 19  ALA B CA  1 
ATOM   3006  C C   . ALA B 1 20  ? -49.571 12.147  -32.924 1.00 12.43 ? 19  ALA B C   1 
ATOM   3007  O O   . ALA B 1 20  ? -48.609 12.785  -33.355 1.00 12.49 ? 19  ALA B O   1 
ATOM   3008  C CB  . ALA B 1 20  ? -49.715 9.673   -33.273 1.00 11.88 ? 19  ALA B CB  1 
ATOM   3009  N N   . THR B 1 21  ? -50.816 12.617  -32.934 1.00 12.37 ? 20  THR B N   1 
ATOM   3010  C CA  . THR B 1 21  ? -51.126 13.959  -33.403 1.00 12.17 ? 20  THR B CA  1 
ATOM   3011  C C   . THR B 1 21  ? -50.337 15.031  -32.635 1.00 12.94 ? 20  THR B C   1 
ATOM   3012  O O   . THR B 1 21  ? -49.759 15.960  -33.227 1.00 12.89 ? 20  THR B O   1 
ATOM   3013  C CB  . THR B 1 21  ? -52.633 14.236  -33.291 1.00 12.42 ? 20  THR B CB  1 
ATOM   3014  O OG1 . THR B 1 21  ? -53.343 13.206  -33.991 1.00 11.19 ? 20  THR B OG1 1 
ATOM   3015  C CG2 . THR B 1 21  ? -53.005 15.616  -33.890 1.00 9.88  ? 20  THR B CG2 1 
ATOM   3016  N N   . GLN B 1 22  ? -50.295 14.893  -31.316 1.00 12.54 ? 21  GLN B N   1 
ATOM   3017  C CA  . GLN B 1 22  ? -49.618 15.874  -30.493 1.00 13.22 ? 21  GLN B CA  1 
ATOM   3018  C C   . GLN B 1 22  ? -48.104 15.788  -30.661 1.00 12.46 ? 21  GLN B C   1 
ATOM   3019  O O   . GLN B 1 22  ? -47.446 16.817  -30.768 1.00 12.11 ? 21  GLN B O   1 
ATOM   3020  C CB  . GLN B 1 22  ? -50.067 15.731  -29.043 1.00 12.99 ? 21  GLN B CB  1 
ATOM   3021  C CG  . GLN B 1 22  ? -51.519 16.194  -28.924 1.00 14.51 ? 21  GLN B CG  1 
ATOM   3022  C CD  . GLN B 1 22  ? -52.117 15.984  -27.566 1.00 16.06 ? 21  GLN B CD  1 
ATOM   3023  O OE1 . GLN B 1 22  ? -51.502 15.412  -26.670 1.00 17.93 ? 21  GLN B OE1 1 
ATOM   3024  N NE2 . GLN B 1 22  ? -53.356 16.433  -27.413 1.00 23.95 ? 21  GLN B NE2 1 
ATOM   3025  N N   . ALA B 1 23  ? -47.561 14.571  -30.740 1.00 11.98 ? 22  ALA B N   1 
ATOM   3026  C CA  . ALA B 1 23  ? -46.121 14.377  -30.994 1.00 11.86 ? 22  ALA B CA  1 
ATOM   3027  C C   . ALA B 1 23  ? -45.614 15.143  -32.225 1.00 12.43 ? 22  ALA B C   1 
ATOM   3028  O O   . ALA B 1 23  ? -44.483 15.713  -32.235 1.00 11.76 ? 22  ALA B O   1 
ATOM   3029  C CB  . ALA B 1 23  ? -45.803 12.887  -31.153 1.00 11.38 ? 22  ALA B CB  1 
ATOM   3030  N N   . ILE B 1 24  ? -46.454 15.136  -33.258 1.00 11.87 ? 23  ILE B N   1 
ATOM   3031  C CA  . ILE B 1 24  ? -46.109 15.711  -34.545 1.00 11.55 ? 23  ILE B CA  1 
ATOM   3032  C C   . ILE B 1 24  ? -46.396 17.210  -34.595 1.00 12.03 ? 23  ILE B C   1 
ATOM   3033  O O   . ILE B 1 24  ? -45.694 17.935  -35.294 1.00 13.32 ? 23  ILE B O   1 
ATOM   3034  C CB  . ILE B 1 24  ? -46.788 14.882  -35.706 1.00 11.25 ? 23  ILE B CB  1 
ATOM   3035  C CG1 . ILE B 1 24  ? -46.152 13.495  -35.757 1.00 11.21 ? 23  ILE B CG1 1 
ATOM   3036  C CG2 . ILE B 1 24  ? -46.697 15.612  -37.070 1.00 11.17 ? 23  ILE B CG2 1 
ATOM   3037  C CD1 . ILE B 1 24  ? -47.035 12.348  -36.351 1.00 9.23  ? 23  ILE B CD1 1 
ATOM   3038  N N   . HIS B 1 25  ? -47.399 17.694  -33.868 1.00 11.75 ? 24  HIS B N   1 
ATOM   3039  C CA  . HIS B 1 25  ? -47.876 19.081  -34.074 1.00 11.05 ? 24  HIS B CA  1 
ATOM   3040  C C   . HIS B 1 25  ? -47.658 20.074  -32.957 1.00 11.11 ? 24  HIS B C   1 
ATOM   3041  O O   . HIS B 1 25  ? -47.555 21.281  -33.227 1.00 10.03 ? 24  HIS B O   1 
ATOM   3042  C CB  . HIS B 1 25  ? -49.355 19.068  -34.499 1.00 11.63 ? 24  HIS B CB  1 
ATOM   3043  C CG  . HIS B 1 25  ? -49.563 18.448  -35.849 1.00 9.38  ? 24  HIS B CG  1 
ATOM   3044  N ND1 . HIS B 1 25  ? -49.336 19.131  -37.020 1.00 9.08  ? 24  HIS B ND1 1 
ATOM   3045  C CD2 . HIS B 1 25  ? -49.903 17.189  -36.209 1.00 10.10 ? 24  HIS B CD2 1 
ATOM   3046  C CE1 . HIS B 1 25  ? -49.580 18.336  -38.044 1.00 10.83 ? 24  HIS B CE1 1 
ATOM   3047  N NE2 . HIS B 1 25  ? -49.909 17.145  -37.579 1.00 8.53  ? 24  HIS B NE2 1 
ATOM   3048  N N   . VAL B 1 26  ? -47.571 19.603  -31.708 1.00 11.12 ? 25  VAL B N   1 
ATOM   3049  C CA  . VAL B 1 26  ? -47.450 20.516  -30.570 1.00 10.65 ? 25  VAL B CA  1 
ATOM   3050  C C   . VAL B 1 26  ? -46.069 21.164  -30.539 1.00 10.83 ? 25  VAL B C   1 
ATOM   3051  O O   . VAL B 1 26  ? -45.050 20.476  -30.586 1.00 10.51 ? 25  VAL B O   1 
ATOM   3052  C CB  . VAL B 1 26  ? -47.733 19.806  -29.224 1.00 10.87 ? 25  VAL B CB  1 
ATOM   3053  C CG1 . VAL B 1 26  ? -47.461 20.768  -28.016 1.00 11.14 ? 25  VAL B CG1 1 
ATOM   3054  C CG2 . VAL B 1 26  ? -49.169 19.294  -29.204 1.00 10.91 ? 25  VAL B CG2 1 
ATOM   3055  N N   . GLY B 1 27  ? -46.057 22.495  -30.451 1.00 11.38 ? 26  GLY B N   1 
ATOM   3056  C CA  . GLY B 1 27  ? -44.839 23.312  -30.562 1.00 11.20 ? 26  GLY B CA  1 
ATOM   3057  C C   . GLY B 1 27  ? -44.389 23.589  -31.993 1.00 10.96 ? 26  GLY B C   1 
ATOM   3058  O O   . GLY B 1 27  ? -43.426 24.343  -32.225 1.00 11.49 ? 26  GLY B O   1 
ATOM   3059  N N   . GLN B 1 28  ? -45.052 22.971  -32.957 1.00 10.83 ? 27  GLN B N   1 
ATOM   3060  C CA  . GLN B 1 28  ? -44.563 22.964  -34.342 1.00 10.96 ? 27  GLN B CA  1 
ATOM   3061  C C   . GLN B 1 28  ? -45.425 23.789  -35.285 1.00 11.62 ? 27  GLN B C   1 
ATOM   3062  O O   . GLN B 1 28  ? -45.373 23.616  -36.508 1.00 11.96 ? 27  GLN B O   1 
ATOM   3063  C CB  . GLN B 1 28  ? -44.480 21.529  -34.868 1.00 11.20 ? 27  GLN B CB  1 
ATOM   3064  C CG  . GLN B 1 28  ? -43.996 20.493  -33.890 1.00 11.24 ? 27  GLN B CG  1 
ATOM   3065  C CD  . GLN B 1 28  ? -42.549 20.658  -33.436 1.00 10.74 ? 27  GLN B CD  1 
ATOM   3066  O OE1 . GLN B 1 28  ? -41.618 20.455  -34.219 1.00 12.56 ? 27  GLN B OE1 1 
ATOM   3067  N NE2 . GLN B 1 28  ? -42.357 20.974  -32.154 1.00 9.37  ? 27  GLN B NE2 1 
ATOM   3068  N N   . ASP B 1 29  ? -46.219 24.701  -34.721 1.00 12.28 ? 28  ASP B N   1 
ATOM   3069  C CA  . ASP B 1 29  ? -47.152 25.494  -35.492 1.00 12.82 ? 28  ASP B CA  1 
ATOM   3070  C C   . ASP B 1 29  ? -46.372 26.450  -36.410 1.00 12.25 ? 28  ASP B C   1 
ATOM   3071  O O   . ASP B 1 29  ? -45.543 27.237  -35.941 1.00 11.65 ? 28  ASP B O   1 
ATOM   3072  C CB  . ASP B 1 29  ? -48.071 26.282  -34.547 1.00 13.53 ? 28  ASP B CB  1 
ATOM   3073  C CG  . ASP B 1 29  ? -49.088 27.160  -35.290 1.00 17.57 ? 28  ASP B CG  1 
ATOM   3074  O OD1 . ASP B 1 29  ? -49.116 27.231  -36.542 1.00 17.82 ? 28  ASP B OD1 1 
ATOM   3075  O OD2 . ASP B 1 29  ? -49.873 27.814  -34.593 1.00 23.57 ? 28  ASP B OD2 1 
ATOM   3076  N N   . PRO B 1 30  ? -46.641 26.380  -37.726 1.00 12.19 ? 29  PRO B N   1 
ATOM   3077  C CA  . PRO B 1 30  ? -45.956 27.221  -38.719 1.00 12.13 ? 29  PRO B CA  1 
ATOM   3078  C C   . PRO B 1 30  ? -46.194 28.705  -38.531 1.00 12.76 ? 29  PRO B C   1 
ATOM   3079  O O   . PRO B 1 30  ? -45.393 29.506  -39.002 1.00 11.31 ? 29  PRO B O   1 
ATOM   3080  C CB  . PRO B 1 30  ? -46.579 26.783  -40.043 1.00 12.06 ? 29  PRO B CB  1 
ATOM   3081  C CG  . PRO B 1 30  ? -47.136 25.438  -39.787 1.00 12.48 ? 29  PRO B CG  1 
ATOM   3082  C CD  . PRO B 1 30  ? -47.603 25.458  -38.368 1.00 11.63 ? 29  PRO B CD  1 
ATOM   3083  N N   . GLU B 1 31  ? -47.275 29.066  -37.843 1.00 13.62 ? 30  GLU B N   1 
ATOM   3084  C CA  . GLU B 1 31  ? -47.584 30.485  -37.576 1.00 14.32 ? 30  GLU B CA  1 
ATOM   3085  C C   . GLU B 1 31  ? -46.577 31.155  -36.651 1.00 14.11 ? 30  GLU B C   1 
ATOM   3086  O O   . GLU B 1 31  ? -46.551 32.373  -36.545 1.00 14.13 ? 30  GLU B O   1 
ATOM   3087  C CB  . GLU B 1 31  ? -49.006 30.636  -37.025 1.00 15.50 ? 30  GLU B CB  1 
ATOM   3088  C CG  . GLU B 1 31  ? -50.091 30.123  -37.990 1.00 18.42 ? 30  GLU B CG  1 
ATOM   3089  C CD  . GLU B 1 31  ? -50.173 30.885  -39.312 1.00 24.42 ? 30  GLU B CD  1 
ATOM   3090  O OE1 . GLU B 1 31  ? -49.977 32.126  -39.302 1.00 28.58 ? 30  GLU B OE1 1 
ATOM   3091  O OE2 . GLU B 1 31  ? -50.475 30.254  -40.366 1.00 27.93 ? 30  GLU B OE2 1 
ATOM   3092  N N   . GLN B 1 32  ? -45.719 30.367  -36.008 1.00 13.84 ? 31  GLN B N   1 
ATOM   3093  C CA  . GLN B 1 32  ? -44.676 30.900  -35.150 1.00 13.92 ? 31  GLN B CA  1 
ATOM   3094  C C   . GLN B 1 32  ? -43.589 31.629  -35.908 1.00 13.01 ? 31  GLN B C   1 
ATOM   3095  O O   . GLN B 1 32  ? -42.882 32.449  -35.341 1.00 12.35 ? 31  GLN B O   1 
ATOM   3096  C CB  . GLN B 1 32  ? -44.012 29.755  -34.394 1.00 14.58 ? 31  GLN B CB  1 
ATOM   3097  C CG  . GLN B 1 32  ? -44.910 29.089  -33.387 1.00 16.10 ? 31  GLN B CG  1 
ATOM   3098  C CD  . GLN B 1 32  ? -44.254 27.889  -32.800 1.00 15.32 ? 31  GLN B CD  1 
ATOM   3099  O OE1 . GLN B 1 32  ? -43.661 27.978  -31.722 1.00 17.28 ? 31  GLN B OE1 1 
ATOM   3100  N NE2 . GLN B 1 32  ? -44.297 26.759  -33.524 1.00 14.28 ? 31  GLN B NE2 1 
ATOM   3101  N N   . TRP B 1 33  ? -43.437 31.282  -37.186 1.00 12.51 ? 32  TRP B N   1 
ATOM   3102  C CA  . TRP B 1 33  ? -42.282 31.685  -37.972 1.00 11.81 ? 32  TRP B CA  1 
ATOM   3103  C C   . TRP B 1 33  ? -42.769 32.564  -39.094 1.00 11.92 ? 32  TRP B C   1 
ATOM   3104  O O   . TRP B 1 33  ? -43.803 32.297  -39.713 1.00 10.27 ? 32  TRP B O   1 
ATOM   3105  C CB  . TRP B 1 33  ? -41.531 30.462  -38.541 1.00 11.65 ? 32  TRP B CB  1 
ATOM   3106  C CG  . TRP B 1 33  ? -41.543 29.294  -37.597 1.00 11.07 ? 32  TRP B CG  1 
ATOM   3107  C CD1 . TRP B 1 33  ? -42.140 28.104  -37.804 1.00 10.92 ? 32  TRP B CD1 1 
ATOM   3108  C CD2 . TRP B 1 33  ? -41.022 29.252  -36.254 1.00 11.30 ? 32  TRP B CD2 1 
ATOM   3109  N NE1 . TRP B 1 33  ? -41.989 27.294  -36.714 1.00 10.04 ? 32  TRP B NE1 1 
ATOM   3110  C CE2 . TRP B 1 33  ? -41.315 27.979  -35.740 1.00 10.60 ? 32  TRP B CE2 1 
ATOM   3111  C CE3 . TRP B 1 33  ? -40.332 30.165  -35.445 1.00 12.16 ? 32  TRP B CE3 1 
ATOM   3112  C CZ2 . TRP B 1 33  ? -40.943 27.582  -34.454 1.00 11.28 ? 32  TRP B CZ2 1 
ATOM   3113  C CZ3 . TRP B 1 33  ? -39.965 29.772  -34.159 1.00 11.74 ? 32  TRP B CZ3 1 
ATOM   3114  C CH2 . TRP B 1 33  ? -40.273 28.493  -33.681 1.00 11.84 ? 32  TRP B CH2 1 
ATOM   3115  N N   . THR B 1 34  ? -42.004 33.605  -39.375 1.00 11.85 ? 33  THR B N   1 
ATOM   3116  C CA  . THR B 1 34  ? -42.308 34.471  -40.486 1.00 12.82 ? 33  THR B CA  1 
ATOM   3117  C C   . THR B 1 34  ? -42.342 33.718  -41.806 1.00 12.14 ? 33  THR B C   1 
ATOM   3118  O O   . THR B 1 34  ? -43.129 34.065  -42.681 1.00 11.72 ? 33  THR B O   1 
ATOM   3119  C CB  . THR B 1 34  ? -41.316 35.683  -40.553 1.00 13.94 ? 33  THR B CB  1 
ATOM   3120  O OG1 . THR B 1 34  ? -39.975 35.224  -40.695 1.00 17.79 ? 33  THR B OG1 1 
ATOM   3121  C CG2 . THR B 1 34  ? -41.401 36.467  -39.296 1.00 14.51 ? 33  THR B CG2 1 
ATOM   3122  N N   . SER B 1 35  ? -41.523 32.665  -41.909 1.00 11.24 ? 34  SER B N   1 
ATOM   3123  C CA  . SER B 1 35  ? -41.426 31.795  -43.086 1.00 11.26 ? 34  SER B CA  1 
ATOM   3124  C C   . SER B 1 35  ? -42.604 30.812  -43.265 1.00 11.74 ? 34  SER B C   1 
ATOM   3125  O O   . SER B 1 35  ? -42.748 30.229  -44.319 1.00 12.18 ? 34  SER B O   1 
ATOM   3126  C CB  . SER B 1 35  ? -40.153 30.966  -42.977 1.00 10.87 ? 34  SER B CB  1 
ATOM   3127  O OG  . SER B 1 35  ? -40.260 30.033  -41.902 1.00 10.28 ? 34  SER B OG  1 
ATOM   3128  N N   . ARG B 1 36  ? -43.388 30.593  -42.215 1.00 11.44 ? 35  ARG B N   1 
ATOM   3129  C CA  . ARG B 1 36  ? -44.411 29.545  -42.174 1.00 12.32 ? 35  ARG B CA  1 
ATOM   3130  C C   . ARG B 1 36  ? -43.857 28.136  -42.387 1.00 11.59 ? 35  ARG B C   1 
ATOM   3131  O O   . ARG B 1 36  ? -44.543 27.249  -42.901 1.00 12.57 ? 35  ARG B O   1 
ATOM   3132  C CB  . ARG B 1 36  ? -45.554 29.812  -43.163 1.00 13.39 ? 35  ARG B CB  1 
ATOM   3133  C CG  . ARG B 1 36  ? -46.243 31.168  -42.999 1.00 17.40 ? 35  ARG B CG  1 
ATOM   3134  C CD  . ARG B 1 36  ? -47.162 31.248  -41.791 1.00 25.37 ? 35  ARG B CD  1 
ATOM   3135  N NE  . ARG B 1 36  ? -46.570 32.088  -40.757 1.00 31.49 ? 35  ARG B NE  1 
ATOM   3136  C CZ  . ARG B 1 36  ? -46.889 33.359  -40.486 1.00 32.70 ? 35  ARG B CZ  1 
ATOM   3137  N NH1 . ARG B 1 36  ? -47.852 34.005  -41.135 1.00 35.50 ? 35  ARG B NH1 1 
ATOM   3138  N NH2 . ARG B 1 36  ? -46.238 33.990  -39.519 1.00 32.81 ? 35  ARG B NH2 1 
ATOM   3139  N N   . ALA B 1 37  ? -42.621 27.922  -41.978 1.00 11.55 ? 36  ALA B N   1 
ATOM   3140  C CA  . ALA B 1 37  ? -42.009 26.595  -42.077 1.00 10.80 ? 36  ALA B CA  1 
ATOM   3141  C C   . ALA B 1 37  ? -42.835 25.586  -41.299 1.00 10.92 ? 36  ALA B C   1 
ATOM   3142  O O   . ALA B 1 37  ? -43.266 25.840  -40.180 1.00 10.98 ? 36  ALA B O   1 
ATOM   3143  C CB  . ALA B 1 37  ? -40.593 26.616  -41.556 1.00 10.07 ? 36  ALA B CB  1 
ATOM   3144  N N   . VAL B 1 38  ? -43.037 24.431  -41.913 1.00 11.25 ? 37  VAL B N   1 
ATOM   3145  C CA  . VAL B 1 38  ? -43.772 23.353  -41.314 1.00 11.05 ? 37  VAL B CA  1 
ATOM   3146  C C   . VAL B 1 38  ? -42.967 22.689  -40.168 1.00 11.38 ? 37  VAL B C   1 
ATOM   3147  O O   . VAL B 1 38  ? -43.551 22.194  -39.223 1.00 11.01 ? 37  VAL B O   1 
ATOM   3148  C CB  . VAL B 1 38  ? -44.224 22.370  -42.440 1.00 11.88 ? 37  VAL B CB  1 
ATOM   3149  C CG1 . VAL B 1 38  ? -44.565 21.066  -41.911 1.00 14.59 ? 37  VAL B CG1 1 
ATOM   3150  C CG2 . VAL B 1 38  ? -45.413 22.988  -43.243 1.00 9.62  ? 37  VAL B CG2 1 
ATOM   3151  N N   . VAL B 1 39  ? -41.630 22.761  -40.224 1.00 10.77 ? 38  VAL B N   1 
ATOM   3152  C CA  . VAL B 1 39  ? -40.761 22.285  -39.167 1.00 10.25 ? 38  VAL B CA  1 
ATOM   3153  C C   . VAL B 1 39  ? -40.073 23.486  -38.516 1.00 9.75  ? 38  VAL B C   1 
ATOM   3154  O O   . VAL B 1 39  ? -39.585 24.357  -39.218 1.00 9.09  ? 38  VAL B O   1 
ATOM   3155  C CB  . VAL B 1 39  ? -39.688 21.299  -39.750 1.00 10.71 ? 38  VAL B CB  1 
ATOM   3156  C CG1 . VAL B 1 39  ? -38.745 20.796  -38.660 1.00 9.81  ? 38  VAL B CG1 1 
ATOM   3157  C CG2 . VAL B 1 39  ? -40.376 20.120  -40.476 1.00 10.87 ? 38  VAL B CG2 1 
ATOM   3158  N N   . PRO B 1 40  ? -40.063 23.575  -37.165 1.00 9.63  ? 39  PRO B N   1 
ATOM   3159  C CA  . PRO B 1 40  ? -39.323 24.678  -36.545 1.00 9.64  ? 39  PRO B CA  1 
ATOM   3160  C C   . PRO B 1 40  ? -37.880 24.803  -36.994 1.00 9.56  ? 39  PRO B C   1 
ATOM   3161  O O   . PRO B 1 40  ? -37.184 23.808  -37.057 1.00 10.49 ? 39  PRO B O   1 
ATOM   3162  C CB  . PRO B 1 40  ? -39.374 24.321  -35.036 1.00 10.10 ? 39  PRO B CB  1 
ATOM   3163  C CG  . PRO B 1 40  ? -40.665 23.672  -34.886 1.00 9.60  ? 39  PRO B CG  1 
ATOM   3164  C CD  . PRO B 1 40  ? -40.758 22.779  -36.147 1.00 9.57  ? 39  PRO B CD  1 
ATOM   3165  N N   . PRO B 1 41  ? -37.427 26.023  -37.317 1.00 10.42 ? 40  PRO B N   1 
ATOM   3166  C CA  . PRO B 1 41  ? -36.001 26.288  -37.517 1.00 10.32 ? 40  PRO B CA  1 
ATOM   3167  C C   . PRO B 1 41  ? -35.164 26.033  -36.272 1.00 10.00 ? 40  PRO B C   1 
ATOM   3168  O O   . PRO B 1 41  ? -35.668 26.138  -35.139 1.00 11.57 ? 40  PRO B O   1 
ATOM   3169  C CB  . PRO B 1 41  ? -35.953 27.791  -37.839 1.00 10.67 ? 40  PRO B CB  1 
ATOM   3170  C CG  . PRO B 1 41  ? -37.303 28.173  -38.165 1.00 12.38 ? 40  PRO B CG  1 
ATOM   3171  C CD  . PRO B 1 41  ? -38.251 27.215  -37.556 1.00 10.29 ? 40  PRO B CD  1 
ATOM   3172  N N   . ILE B 1 42  ? -33.894 25.724  -36.497 1.00 9.66  ? 41  ILE B N   1 
ATOM   3173  C CA  . ILE B 1 42  ? -32.910 25.588  -35.453 1.00 8.64  ? 41  ILE B CA  1 
ATOM   3174  C C   . ILE B 1 42  ? -32.317 26.970  -35.245 1.00 8.97  ? 41  ILE B C   1 
ATOM   3175  O O   . ILE B 1 42  ? -31.591 27.458  -36.098 1.00 8.41  ? 41  ILE B O   1 
ATOM   3176  C CB  . ILE B 1 42  ? -31.779 24.574  -35.799 1.00 8.57  ? 41  ILE B CB  1 
ATOM   3177  C CG1 . ILE B 1 42  ? -32.362 23.224  -36.226 1.00 9.02  ? 41  ILE B CG1 1 
ATOM   3178  C CG2 . ILE B 1 42  ? -30.856 24.420  -34.583 1.00 8.76  ? 41  ILE B CG2 1 
ATOM   3179  C CD1 . ILE B 1 42  ? -31.366 22.233  -36.838 1.00 6.85  ? 41  ILE B CD1 1 
ATOM   3180  N N   . SER B 1 43  ? -32.691 27.626  -34.138 1.00 9.06  ? 42  SER B N   1 
ATOM   3181  C CA  . SER B 1 43  ? -32.191 28.956  -33.835 1.00 10.25 ? 42  SER B CA  1 
ATOM   3182  C C   . SER B 1 43  ? -30.998 28.865  -32.894 1.00 10.25 ? 42  SER B C   1 
ATOM   3183  O O   . SER B 1 43  ? -31.148 28.551  -31.725 1.00 10.84 ? 42  SER B O   1 
ATOM   3184  C CB  . SER B 1 43  ? -33.301 29.831  -33.238 1.00 10.77 ? 42  SER B CB  1 
ATOM   3185  O OG  . SER B 1 43  ? -32.846 31.132  -32.981 1.00 11.35 ? 42  SER B OG  1 
ATOM   3186  N N   . LEU B 1 44  ? -29.811 29.117  -33.426 1.00 10.66 ? 43  LEU B N   1 
ATOM   3187  C CA  . LEU B 1 44  ? -28.559 29.046  -32.625 1.00 10.21 ? 43  LEU B CA  1 
ATOM   3188  C C   . LEU B 1 44  ? -28.219 30.364  -31.955 1.00 9.91  ? 43  LEU B C   1 
ATOM   3189  O O   . LEU B 1 44  ? -27.436 30.404  -30.997 1.00 9.02  ? 43  LEU B O   1 
ATOM   3190  C CB  . LEU B 1 44  ? -27.387 28.639  -33.510 1.00 10.25 ? 43  LEU B CB  1 
ATOM   3191  C CG  . LEU B 1 44  ? -27.511 27.320  -34.263 1.00 11.29 ? 43  LEU B CG  1 
ATOM   3192  C CD1 . LEU B 1 44  ? -26.159 27.007  -34.968 1.00 10.79 ? 43  LEU B CD1 1 
ATOM   3193  C CD2 . LEU B 1 44  ? -27.906 26.224  -33.271 1.00 9.78  ? 43  LEU B CD2 1 
ATOM   3194  N N   . SER B 1 45  ? -28.765 31.455  -32.485 1.00 10.22 ? 44  SER B N   1 
ATOM   3195  C CA  . SER B 1 45  ? -28.496 32.791  -31.920 1.00 11.17 ? 44  SER B CA  1 
ATOM   3196  C C   . SER B 1 45  ? -28.498 32.790  -30.397 1.00 11.34 ? 44  SER B C   1 
ATOM   3197  O O   . SER B 1 45  ? -29.464 32.366  -29.767 1.00 13.36 ? 44  SER B O   1 
ATOM   3198  C CB  . SER B 1 45  ? -29.507 33.824  -32.420 1.00 11.14 ? 44  SER B CB  1 
ATOM   3199  O OG  . SER B 1 45  ? -29.084 35.131  -32.110 1.00 12.83 ? 44  SER B OG  1 
ATOM   3200  N N   . THR B 1 46  ? -27.414 33.291  -29.808 1.00 11.28 ? 45  THR B N   1 
ATOM   3201  C CA  . THR B 1 46  ? -27.303 33.417  -28.351 1.00 10.27 ? 45  THR B CA  1 
ATOM   3202  C C   . THR B 1 46  ? -28.057 34.634  -27.881 1.00 10.32 ? 45  THR B C   1 
ATOM   3203  O O   . THR B 1 46  ? -28.500 34.693  -26.746 1.00 8.68  ? 45  THR B O   1 
ATOM   3204  C CB  . THR B 1 46  ? -25.834 33.502  -27.920 1.00 10.54 ? 45  THR B CB  1 
ATOM   3205  O OG1 . THR B 1 46  ? -25.201 34.623  -28.562 1.00 10.65 ? 45  THR B OG1 1 
ATOM   3206  C CG2 . THR B 1 46  ? -25.103 32.201  -28.329 1.00 11.39 ? 45  THR B CG2 1 
ATOM   3207  N N   . THR B 1 47  ? -28.259 35.607  -28.766 1.00 10.51 ? 46  THR B N   1 
ATOM   3208  C CA  . THR B 1 47  ? -28.904 36.827  -28.345 1.00 10.52 ? 46  THR B CA  1 
ATOM   3209  C C   . THR B 1 47  ? -29.906 37.352  -29.382 1.00 10.73 ? 46  THR B C   1 
ATOM   3210  O O   . THR B 1 47  ? -30.048 36.813  -30.493 1.00 10.24 ? 46  THR B O   1 
ATOM   3211  C CB  . THR B 1 47  ? -27.828 37.852  -27.886 1.00 10.97 ? 46  THR B CB  1 
ATOM   3212  O OG1 . THR B 1 47  ? -28.432 38.896  -27.113 1.00 11.54 ? 46  THR B OG1 1 
ATOM   3213  C CG2 . THR B 1 47  ? -27.068 38.415  -29.040 1.00 9.89  ? 46  THR B CG2 1 
ATOM   3214  N N   . PHE B 1 48  ? -30.664 38.350  -28.945 1.00 11.58 ? 47  PHE B N   1 
ATOM   3215  C CA  . PHE B 1 48  ? -31.875 38.796  -29.635 1.00 12.21 ? 47  PHE B CA  1 
ATOM   3216  C C   . PHE B 1 48  ? -31.985 40.302  -29.473 1.00 13.26 ? 47  PHE B C   1 
ATOM   3217  O O   . PHE B 1 48  ? -31.717 40.836  -28.393 1.00 13.34 ? 47  PHE B O   1 
ATOM   3218  C CB  . PHE B 1 48  ? -33.125 38.122  -29.031 1.00 12.54 ? 47  PHE B CB  1 
ATOM   3219  C CG  . PHE B 1 48  ? -33.004 36.623  -28.904 1.00 12.26 ? 47  PHE B CG  1 
ATOM   3220  C CD1 . PHE B 1 48  ? -32.434 36.061  -27.777 1.00 12.47 ? 47  PHE B CD1 1 
ATOM   3221  C CD2 . PHE B 1 48  ? -33.441 35.783  -29.934 1.00 11.70 ? 47  PHE B CD2 1 
ATOM   3222  C CE1 . PHE B 1 48  ? -32.302 34.670  -27.661 1.00 11.83 ? 47  PHE B CE1 1 
ATOM   3223  C CE2 . PHE B 1 48  ? -33.307 34.405  -29.834 1.00 12.74 ? 47  PHE B CE2 1 
ATOM   3224  C CZ  . PHE B 1 48  ? -32.752 33.849  -28.679 1.00 13.14 ? 47  PHE B CZ  1 
ATOM   3225  N N   . LYS B 1 49  ? -32.372 40.975  -30.549 1.00 14.46 ? 48  LYS B N   1 
ATOM   3226  C CA  . LYS B 1 49  ? -32.517 42.421  -30.545 1.00 15.48 ? 48  LYS B CA  1 
ATOM   3227  C C   . LYS B 1 49  ? -33.673 42.838  -29.640 1.00 15.86 ? 48  LYS B C   1 
ATOM   3228  O O   . LYS B 1 49  ? -34.751 42.254  -29.697 1.00 15.08 ? 48  LYS B O   1 
ATOM   3229  C CB  . LYS B 1 49  ? -32.750 42.912  -31.978 1.00 15.64 ? 48  LYS B CB  1 
ATOM   3230  C CG  . LYS B 1 49  ? -33.111 44.362  -32.106 1.00 16.57 ? 48  LYS B CG  1 
ATOM   3231  C CD  . LYS B 1 49  ? -32.996 44.815  -33.549 1.00 18.51 ? 48  LYS B CD  1 
ATOM   3232  C CE  . LYS B 1 49  ? -33.247 46.306  -33.695 1.00 21.95 ? 48  LYS B CE  1 
ATOM   3233  N NZ  . LYS B 1 49  ? -34.455 46.609  -34.463 1.00 24.47 ? 48  LYS B NZ  1 
ATOM   3234  N N   . GLN B 1 50  ? -33.442 43.835  -28.792 1.00 16.23 ? 49  GLN B N   1 
ATOM   3235  C CA  . GLN B 1 50  ? -34.527 44.446  -27.996 1.00 17.45 ? 49  GLN B CA  1 
ATOM   3236  C C   . GLN B 1 50  ? -34.964 45.807  -28.558 1.00 17.51 ? 49  GLN B C   1 
ATOM   3237  O O   . GLN B 1 50  ? -34.158 46.548  -29.108 1.00 16.69 ? 49  GLN B O   1 
ATOM   3238  C CB  . GLN B 1 50  ? -34.071 44.570  -26.542 1.00 17.12 ? 49  GLN B CB  1 
ATOM   3239  C CG  . GLN B 1 50  ? -33.681 43.214  -25.960 1.00 18.37 ? 49  GLN B CG  1 
ATOM   3240  C CD  . GLN B 1 50  ? -33.371 43.243  -24.493 1.00 18.99 ? 49  GLN B CD  1 
ATOM   3241  O OE1 . GLN B 1 50  ? -33.780 44.170  -23.771 1.00 21.14 ? 49  GLN B OE1 1 
ATOM   3242  N NE2 . GLN B 1 50  ? -32.649 42.216  -24.020 1.00 19.44 ? 49  GLN B NE2 1 
ATOM   3243  N N   . GLY B 1 51  ? -36.243 46.144  -28.399 1.00 18.85 ? 50  GLY B N   1 
ATOM   3244  C CA  . GLY B 1 51  ? -36.751 47.477  -28.777 1.00 19.86 ? 50  GLY B CA  1 
ATOM   3245  C C   . GLY B 1 51  ? -36.330 48.602  -27.835 1.00 21.01 ? 50  GLY B C   1 
ATOM   3246  O O   . GLY B 1 51  ? -36.068 49.724  -28.254 1.00 20.79 ? 50  GLY B O   1 
ATOM   3247  N N   . ALA B 1 52  ? -36.276 48.294  -26.550 1.00 22.36 ? 51  ALA B N   1 
ATOM   3248  C CA  . ALA B 1 52  ? -35.886 49.249  -25.524 1.00 23.94 ? 51  ALA B CA  1 
ATOM   3249  C C   . ALA B 1 52  ? -35.304 48.418  -24.388 1.00 25.53 ? 51  ALA B C   1 
ATOM   3250  O O   . ALA B 1 52  ? -35.662 47.253  -24.241 1.00 25.24 ? 51  ALA B O   1 
ATOM   3251  C CB  . ALA B 1 52  ? -37.121 50.047  -25.032 1.00 23.61 ? 51  ALA B CB  1 
ATOM   3252  N N   . PRO B 1 53  ? -34.413 49.005  -23.580 1.00 28.01 ? 52  PRO B N   1 
ATOM   3253  C CA  . PRO B 1 53  ? -33.893 48.228  -22.466 1.00 29.76 ? 52  PRO B CA  1 
ATOM   3254  C C   . PRO B 1 53  ? -34.997 47.696  -21.544 1.00 31.97 ? 52  PRO B C   1 
ATOM   3255  O O   . PRO B 1 53  ? -36.017 48.351  -21.353 1.00 32.18 ? 52  PRO B O   1 
ATOM   3256  C CB  . PRO B 1 53  ? -32.996 49.232  -21.724 1.00 29.59 ? 52  PRO B CB  1 
ATOM   3257  C CG  . PRO B 1 53  ? -32.626 50.258  -22.751 1.00 28.65 ? 52  PRO B CG  1 
ATOM   3258  C CD  . PRO B 1 53  ? -33.816 50.357  -23.648 1.00 28.23 ? 52  PRO B CD  1 
ATOM   3259  N N   . GLY B 1 54  ? -34.800 46.497  -21.011 1.00 34.77 ? 53  GLY B N   1 
ATOM   3260  C CA  . GLY B 1 54  ? -35.651 45.984  -19.927 1.00 36.74 ? 53  GLY B CA  1 
ATOM   3261  C C   . GLY B 1 54  ? -37.161 46.045  -20.123 1.00 38.39 ? 53  GLY B C   1 
ATOM   3262  O O   . GLY B 1 54  ? -37.909 46.382  -19.186 1.00 38.70 ? 53  GLY B O   1 
ATOM   3263  N N   . GLN B 1 55  ? -37.613 45.711  -21.331 1.00 39.51 ? 54  GLN B N   1 
ATOM   3264  C CA  A GLN B 1 55  ? -39.044 45.588  -21.620 0.50 40.08 ? 54  GLN B CA  1 
ATOM   3265  C CA  B GLN B 1 55  ? -39.051 45.590  -21.592 0.50 40.01 ? 54  GLN B CA  1 
ATOM   3266  C C   . GLN B 1 55  ? -39.513 44.150  -21.305 1.00 40.68 ? 54  GLN B C   1 
ATOM   3267  O O   . GLN B 1 55  ? -38.691 43.248  -21.082 1.00 41.14 ? 54  GLN B O   1 
ATOM   3268  C CB  A GLN B 1 55  ? -39.363 46.034  -23.068 0.50 39.89 ? 54  GLN B CB  1 
ATOM   3269  C CB  B GLN B 1 55  ? -39.391 46.033  -23.021 0.50 39.79 ? 54  GLN B CB  1 
ATOM   3270  C CG  A GLN B 1 55  ? -39.203 44.989  -24.182 0.50 39.38 ? 54  GLN B CG  1 
ATOM   3271  C CG  B GLN B 1 55  ? -39.186 47.530  -23.273 0.50 38.92 ? 54  GLN B CG  1 
ATOM   3272  C CD  A GLN B 1 55  ? -37.812 44.934  -24.776 0.50 38.04 ? 54  GLN B CD  1 
ATOM   3273  C CD  B GLN B 1 55  ? -40.072 48.445  -22.416 0.50 37.42 ? 54  GLN B CD  1 
ATOM   3274  O OE1 A GLN B 1 55  ? -37.649 44.876  -25.993 0.50 36.09 ? 54  GLN B OE1 1 
ATOM   3275  O OE1 B GLN B 1 55  ? -39.708 49.588  -22.142 0.50 35.89 ? 54  GLN B OE1 1 
ATOM   3276  N NE2 A GLN B 1 55  ? -36.802 44.945  -23.923 0.50 37.48 ? 54  GLN B NE2 1 
ATOM   3277  N NE2 B GLN B 1 55  ? -41.239 47.951  -22.010 0.50 36.60 ? 54  GLN B NE2 1 
ATOM   3278  N N   . HIS B 1 56  ? -40.828 43.934  -21.281 1.00 41.47 ? 55  HIS B N   1 
ATOM   3279  C CA  . HIS B 1 56  ? -41.382 42.654  -20.809 1.00 41.83 ? 55  HIS B CA  1 
ATOM   3280  C C   . HIS B 1 56  ? -41.690 41.622  -21.910 1.00 42.19 ? 55  HIS B C   1 
ATOM   3281  O O   . HIS B 1 56  ? -42.638 40.826  -21.754 1.00 43.18 ? 55  HIS B O   1 
ATOM   3282  C CB  . HIS B 1 56  ? -42.660 42.919  -19.995 1.00 41.98 ? 55  HIS B CB  1 
ATOM   3283  N N   . SER B 1 57  ? -40.901 41.600  -22.992 1.00 41.61 ? 56  SER B N   1 
ATOM   3284  C CA  . SER B 1 57  ? -41.227 40.733  -24.142 1.00 41.02 ? 56  SER B CA  1 
ATOM   3285  C C   . SER B 1 57  ? -40.031 40.070  -24.861 1.00 39.24 ? 56  SER B C   1 
ATOM   3286  O O   . SER B 1 57  ? -38.890 40.548  -24.812 1.00 39.58 ? 56  SER B O   1 
ATOM   3287  C CB  . SER B 1 57  ? -42.063 41.512  -25.170 1.00 41.18 ? 56  SER B CB  1 
ATOM   3288  O OG  . SER B 1 57  ? -42.640 40.622  -26.125 1.00 42.88 ? 56  SER B OG  1 
ATOM   3289  N N   . GLY B 1 58  ? -40.334 38.949  -25.510 1.00 36.98 ? 57  GLY B N   1 
ATOM   3290  C CA  . GLY B 1 58  ? -39.418 38.280  -26.424 1.00 35.02 ? 57  GLY B CA  1 
ATOM   3291  C C   . GLY B 1 58  ? -38.232 37.597  -25.777 1.00 33.34 ? 57  GLY B C   1 
ATOM   3292  O O   . GLY B 1 58  ? -37.976 37.734  -24.556 1.00 33.07 ? 57  GLY B O   1 
ATOM   3293  N N   . PHE B 1 59  ? -37.494 36.855  -26.597 1.00 30.27 ? 58  PHE B N   1 
ATOM   3294  C CA  . PHE B 1 59  ? -36.273 36.220  -26.120 1.00 28.05 ? 58  PHE B CA  1 
ATOM   3295  C C   . PHE B 1 59  ? -35.237 37.306  -25.886 1.00 26.56 ? 58  PHE B C   1 
ATOM   3296  O O   . PHE B 1 59  ? -35.217 38.325  -26.580 1.00 26.14 ? 58  PHE B O   1 
ATOM   3297  C CB  . PHE B 1 59  ? -35.754 35.169  -27.107 1.00 27.49 ? 58  PHE B CB  1 
ATOM   3298  C CG  . PHE B 1 59  ? -36.744 34.087  -27.428 1.00 26.14 ? 58  PHE B CG  1 
ATOM   3299  C CD1 . PHE B 1 59  ? -36.975 33.052  -26.540 1.00 25.35 ? 58  PHE B CD1 1 
ATOM   3300  C CD2 . PHE B 1 59  ? -37.435 34.094  -28.620 1.00 26.03 ? 58  PHE B CD2 1 
ATOM   3301  C CE1 . PHE B 1 59  ? -37.879 32.036  -26.841 1.00 25.22 ? 58  PHE B CE1 1 
ATOM   3302  C CE2 . PHE B 1 59  ? -38.346 33.083  -28.918 1.00 25.52 ? 58  PHE B CE2 1 
ATOM   3303  C CZ  . PHE B 1 59  ? -38.571 32.062  -28.018 1.00 24.31 ? 58  PHE B CZ  1 
ATOM   3304  N N   . GLU B 1 60  ? -34.401 37.103  -24.883 1.00 25.53 ? 59  GLU B N   1 
ATOM   3305  C CA  . GLU B 1 60  ? -33.319 38.044  -24.601 1.00 25.44 ? 59  GLU B CA  1 
ATOM   3306  C C   . GLU B 1 60  ? -31.950 37.387  -24.574 1.00 23.08 ? 59  GLU B C   1 
ATOM   3307  O O   . GLU B 1 60  ? -30.956 38.013  -24.925 1.00 21.93 ? 59  GLU B O   1 
ATOM   3308  C CB  . GLU B 1 60  ? -33.591 38.824  -23.299 1.00 25.62 ? 59  GLU B CB  1 
ATOM   3309  C CG  . GLU B 1 60  ? -34.141 38.022  -22.181 1.00 28.11 ? 59  GLU B CG  1 
ATOM   3310  C CD  . GLU B 1 60  ? -34.430 38.857  -20.924 1.00 29.06 ? 59  GLU B CD  1 
ATOM   3311  O OE1 . GLU B 1 60  ? -34.717 40.072  -21.045 1.00 33.25 ? 59  GLU B OE1 1 
ATOM   3312  O OE2 . GLU B 1 60  ? -34.376 38.276  -19.814 1.00 34.27 ? 59  GLU B OE2 1 
ATOM   3313  N N   . TYR B 1 61  ? -31.913 36.120  -24.178 1.00 21.82 ? 60  TYR B N   1 
ATOM   3314  C CA  . TYR B 1 61  ? -30.671 35.379  -24.076 1.00 21.33 ? 60  TYR B CA  1 
ATOM   3315  C C   . TYR B 1 61  ? -30.967 33.880  -24.141 1.00 20.37 ? 60  TYR B C   1 
ATOM   3316  O O   . TYR B 1 61  ? -31.849 33.384  -23.422 1.00 19.87 ? 60  TYR B O   1 
ATOM   3317  C CB  . TYR B 1 61  ? -29.974 35.727  -22.773 1.00 21.11 ? 60  TYR B CB  1 
ATOM   3318  C CG  . TYR B 1 61  ? -28.566 35.236  -22.690 1.00 22.26 ? 60  TYR B CG  1 
ATOM   3319  C CD1 . TYR B 1 61  ? -28.200 34.226  -21.796 1.00 22.04 ? 60  TYR B CD1 1 
ATOM   3320  C CD2 . TYR B 1 61  ? -27.582 35.778  -23.513 1.00 22.19 ? 60  TYR B CD2 1 
ATOM   3321  C CE1 . TYR B 1 61  ? -26.864 33.770  -21.733 1.00 22.56 ? 60  TYR B CE1 1 
ATOM   3322  C CE2 . TYR B 1 61  ? -26.261 35.345  -23.448 1.00 23.16 ? 60  TYR B CE2 1 
ATOM   3323  C CZ  . TYR B 1 61  ? -25.911 34.347  -22.559 1.00 22.08 ? 60  TYR B CZ  1 
ATOM   3324  O OH  . TYR B 1 61  ? -24.610 33.961  -22.509 1.00 22.48 ? 60  TYR B OH  1 
ATOM   3325  N N   . SER B 1 62  ? -30.197 33.181  -24.972 1.00 19.26 ? 61  SER B N   1 
ATOM   3326  C CA  . SER B 1 62  ? -30.461 31.777  -25.342 1.00 18.95 ? 61  SER B CA  1 
ATOM   3327  C C   . SER B 1 62  ? -30.581 30.830  -24.147 1.00 18.42 ? 61  SER B C   1 
ATOM   3328  O O   . SER B 1 62  ? -31.485 29.992  -24.100 1.00 18.10 ? 61  SER B O   1 
ATOM   3329  C CB  . SER B 1 62  ? -29.360 31.264  -26.284 1.00 18.80 ? 61  SER B CB  1 
ATOM   3330  O OG  . SER B 1 62  ? -29.562 29.905  -26.649 1.00 17.87 ? 61  SER B OG  1 
ATOM   3331  N N   . ARG B 1 63  ? -29.673 30.973  -23.187 1.00 18.08 ? 62  ARG B N   1 
ATOM   3332  C CA  . ARG B 1 63  ? -29.667 30.113  -22.013 1.00 18.17 ? 62  ARG B CA  1 
ATOM   3333  C C   . ARG B 1 63  ? -30.990 30.214  -21.254 1.00 18.02 ? 62  ARG B C   1 
ATOM   3334  O O   . ARG B 1 63  ? -31.485 29.205  -20.715 1.00 17.48 ? 62  ARG B O   1 
ATOM   3335  C CB  . ARG B 1 63  ? -28.488 30.447  -21.096 1.00 18.09 ? 62  ARG B CB  1 
ATOM   3336  C CG  . ARG B 1 63  ? -28.560 29.738  -19.765 1.00 18.30 ? 62  ARG B CG  1 
ATOM   3337  C CD  . ARG B 1 63  ? -27.235 29.709  -18.973 1.00 19.59 ? 62  ARG B CD  1 
ATOM   3338  N NE  . ARG B 1 63  ? -26.483 30.972  -18.981 1.00 20.31 ? 62  ARG B NE  1 
ATOM   3339  C CZ  . ARG B 1 63  ? -26.933 32.108  -18.461 1.00 20.81 ? 62  ARG B CZ  1 
ATOM   3340  N NH1 . ARG B 1 63  ? -28.144 32.179  -17.925 1.00 24.69 ? 62  ARG B NH1 1 
ATOM   3341  N NH2 . ARG B 1 63  ? -26.190 33.197  -18.514 1.00 22.13 ? 62  ARG B NH2 1 
ATOM   3342  N N   . SER B 1 64  ? -31.559 31.422  -21.230 1.00 17.34 ? 63  SER B N   1 
ATOM   3343  C CA  . SER B 1 64  ? -32.804 31.696  -20.515 1.00 17.40 ? 63  SER B CA  1 
ATOM   3344  C C   . SER B 1 64  ? -34.008 31.109  -21.233 1.00 16.39 ? 63  SER B C   1 
ATOM   3345  O O   . SER B 1 64  ? -34.963 30.686  -20.602 1.00 15.93 ? 63  SER B O   1 
ATOM   3346  C CB  . SER B 1 64  ? -33.011 33.208  -20.385 1.00 17.10 ? 63  SER B CB  1 
ATOM   3347  O OG  . SER B 1 64  ? -31.756 33.846  -20.166 1.00 21.50 ? 63  SER B OG  1 
ATOM   3348  N N   . GLY B 1 65  ? -33.963 31.134  -22.558 1.00 15.72 ? 64  GLY B N   1 
ATOM   3349  C CA  . GLY B 1 65  ? -35.020 30.589  -23.379 1.00 15.13 ? 64  GLY B CA  1 
ATOM   3350  C C   . GLY B 1 65  ? -34.681 30.869  -24.818 1.00 15.08 ? 64  GLY B C   1 
ATOM   3351  O O   . GLY B 1 65  ? -34.028 31.881  -25.108 1.00 15.01 ? 64  GLY B O   1 
ATOM   3352  N N   . ASN B 1 66  ? -35.082 29.949  -25.703 1.00 14.47 ? 65  ASN B N   1 
ATOM   3353  C CA  . ASN B 1 66  ? -34.835 30.081  -27.139 1.00 14.17 ? 65  ASN B CA  1 
ATOM   3354  C C   . ASN B 1 66  ? -35.871 29.303  -27.955 1.00 13.26 ? 65  ASN B C   1 
ATOM   3355  O O   . ASN B 1 66  ? -36.462 28.354  -27.455 1.00 13.36 ? 65  ASN B O   1 
ATOM   3356  C CB  . ASN B 1 66  ? -33.398 29.690  -27.495 1.00 14.19 ? 65  ASN B CB  1 
ATOM   3357  C CG  . ASN B 1 66  ? -33.065 28.259  -27.136 1.00 14.12 ? 65  ASN B CG  1 
ATOM   3358  O OD1 . ASN B 1 66  ? -33.376 27.344  -27.885 1.00 9.76  ? 65  ASN B OD1 1 
ATOM   3359  N ND2 . ASN B 1 66  ? -32.365 28.073  -26.019 1.00 12.55 ? 65  ASN B ND2 1 
ATOM   3360  N N   . PRO B 1 67  ? -36.148 29.748  -29.187 1.00 12.95 ? 66  PRO B N   1 
ATOM   3361  C CA  . PRO B 1 67  ? -37.225 29.175  -29.991 1.00 12.60 ? 66  PRO B CA  1 
ATOM   3362  C C   . PRO B 1 67  ? -37.270 27.650  -30.061 1.00 12.03 ? 66  PRO B C   1 
ATOM   3363  O O   . PRO B 1 67  ? -38.299 27.048  -29.755 1.00 11.97 ? 66  PRO B O   1 
ATOM   3364  C CB  . PRO B 1 67  ? -36.963 29.766  -31.376 1.00 12.67 ? 66  PRO B CB  1 
ATOM   3365  C CG  . PRO B 1 67  ? -36.370 31.081  -31.083 1.00 13.36 ? 66  PRO B CG  1 
ATOM   3366  C CD  . PRO B 1 67  ? -35.488 30.854  -29.900 1.00 13.32 ? 66  PRO B CD  1 
ATOM   3367  N N   . THR B 1 68  ? -36.154 27.034  -30.444 1.00 11.30 ? 67  THR B N   1 
ATOM   3368  C CA  . THR B 1 68  ? -36.098 25.583  -30.643 1.00 11.14 ? 67  THR B CA  1 
ATOM   3369  C C   . THR B 1 68  ? -36.262 24.750  -29.358 1.00 11.37 ? 67  THR B C   1 
ATOM   3370  O O   . THR B 1 68  ? -36.987 23.740  -29.355 1.00 11.39 ? 67  THR B O   1 
ATOM   3371  C CB  . THR B 1 68  ? -34.792 25.185  -31.353 1.00 10.75 ? 67  THR B CB  1 
ATOM   3372  O OG1 . THR B 1 68  ? -34.657 25.944  -32.562 1.00 10.12 ? 67  THR B OG1 1 
ATOM   3373  C CG2 . THR B 1 68  ? -34.776 23.678  -31.669 1.00 10.85 ? 67  THR B CG2 1 
ATOM   3374  N N   . ARG B 1 69  ? -35.601 25.162  -28.275 1.00 11.03 ? 68  ARG B N   1 
ATOM   3375  C CA  . ARG B 1 69  ? -35.794 24.506  -26.994 1.00 11.61 ? 68  ARG B CA  1 
ATOM   3376  C C   . ARG B 1 69  ? -37.220 24.671  -26.513 1.00 11.74 ? 68  ARG B C   1 
ATOM   3377  O O   . ARG B 1 69  ? -37.830 23.716  -26.018 1.00 11.77 ? 68  ARG B O   1 
ATOM   3378  C CB  . ARG B 1 69  ? -34.862 25.072  -25.928 1.00 11.68 ? 68  ARG B CB  1 
ATOM   3379  C CG  . ARG B 1 69  ? -34.901 24.274  -24.636 1.00 12.31 ? 68  ARG B CG  1 
ATOM   3380  C CD  . ARG B 1 69  ? -33.877 24.829  -23.663 1.00 13.36 ? 68  ARG B CD  1 
ATOM   3381  N NE  . ARG B 1 69  ? -34.415 25.940  -22.854 1.00 13.32 ? 68  ARG B NE  1 
ATOM   3382  C CZ  . ARG B 1 69  ? -33.658 26.834  -22.228 1.00 13.61 ? 68  ARG B CZ  1 
ATOM   3383  N NH1 . ARG B 1 69  ? -32.347 26.815  -22.362 1.00 12.95 ? 68  ARG B NH1 1 
ATOM   3384  N NH2 . ARG B 1 69  ? -34.211 27.766  -21.476 1.00 15.35 ? 68  ARG B NH2 1 
ATOM   3385  N N   . ASN B 1 70  ? -37.752 25.880  -26.641 1.00 11.72 ? 69  ASN B N   1 
ATOM   3386  C CA  . ASN B 1 70  ? -39.092 26.123  -26.169 1.00 12.78 ? 69  ASN B CA  1 
ATOM   3387  C C   . ASN B 1 70  ? -40.111 25.265  -26.934 1.00 12.83 ? 69  ASN B C   1 
ATOM   3388  O O   . ASN B 1 70  ? -41.058 24.768  -26.338 1.00 13.21 ? 69  ASN B O   1 
ATOM   3389  C CB  . ASN B 1 70  ? -39.416 27.613  -26.231 1.00 14.27 ? 69  ASN B CB  1 
ATOM   3390  C CG  . ASN B 1 70  ? -38.698 28.426  -25.151 1.00 15.93 ? 69  ASN B CG  1 
ATOM   3391  O OD1 . ASN B 1 70  ? -37.598 28.082  -24.657 1.00 18.30 ? 69  ASN B OD1 1 
ATOM   3392  N ND2 . ASN B 1 70  ? -39.314 29.522  -24.789 1.00 18.69 ? 69  ASN B ND2 1 
ATOM   3393  N N   . CYS B 1 71  ? -39.912 25.049  -28.239 1.00 12.40 ? 70  CYS B N   1 
ATOM   3394  C CA  . CYS B 1 71  ? -40.854 24.195  -29.009 1.00 12.44 ? 70  CYS B CA  1 
ATOM   3395  C C   . CYS B 1 71  ? -40.813 22.765  -28.529 1.00 11.99 ? 70  CYS B C   1 
ATOM   3396  O O   . CYS B 1 71  ? -41.840 22.103  -28.476 1.00 10.82 ? 70  CYS B O   1 
ATOM   3397  C CB  . CYS B 1 71  ? -40.551 24.219  -30.514 1.00 12.78 ? 70  CYS B CB  1 
ATOM   3398  S SG  . CYS B 1 71  ? -40.793 25.829  -31.289 1.00 15.24 ? 70  CYS B SG  1 
ATOM   3399  N N   . LEU B 1 72  ? -39.604 22.288  -28.216 1.00 11.98 ? 71  LEU B N   1 
ATOM   3400  C CA  . LEU B 1 72  ? -39.409 20.947  -27.668 1.00 11.90 ? 71  LEU B CA  1 
ATOM   3401  C C   . LEU B 1 72  ? -40.113 20.788  -26.329 1.00 12.02 ? 71  LEU B C   1 
ATOM   3402  O O   . LEU B 1 72  ? -40.797 19.792  -26.098 1.00 11.49 ? 71  LEU B O   1 
ATOM   3403  C CB  . LEU B 1 72  ? -37.917 20.643  -27.522 1.00 11.17 ? 71  LEU B CB  1 
ATOM   3404  C CG  . LEU B 1 72  ? -37.537 19.321  -26.833 1.00 12.75 ? 71  LEU B CG  1 
ATOM   3405  C CD1 . LEU B 1 72  ? -38.133 18.069  -27.555 1.00 10.30 ? 71  LEU B CD1 1 
ATOM   3406  C CD2 . LEU B 1 72  ? -36.020 19.222  -26.689 1.00 11.00 ? 71  LEU B CD2 1 
ATOM   3407  N N   . GLU B 1 73  ? -39.923 21.764  -25.431 1.00 12.72 ? 72  GLU B N   1 
ATOM   3408  C CA  . GLU B 1 73  ? -40.523 21.695  -24.095 1.00 12.84 ? 72  GLU B CA  1 
ATOM   3409  C C   . GLU B 1 73  ? -42.051 21.656  -24.223 1.00 13.96 ? 72  GLU B C   1 
ATOM   3410  O O   . GLU B 1 73  ? -42.711 20.858  -23.584 1.00 14.10 ? 72  GLU B O   1 
ATOM   3411  C CB  . GLU B 1 73  ? -40.049 22.867  -23.230 1.00 12.98 ? 72  GLU B CB  1 
ATOM   3412  C CG  . GLU B 1 73  ? -38.559 22.811  -22.932 1.00 12.85 ? 72  GLU B CG  1 
ATOM   3413  C CD  . GLU B 1 73  ? -38.011 24.007  -22.175 1.00 13.37 ? 72  GLU B CD  1 
ATOM   3414  O OE1 . GLU B 1 73  ? -38.669 25.065  -22.124 1.00 12.37 ? 72  GLU B OE1 1 
ATOM   3415  O OE2 . GLU B 1 73  ? -36.892 23.870  -21.632 1.00 12.40 ? 72  GLU B OE2 1 
ATOM   3416  N N   . LYS B 1 74  ? -42.599 22.500  -25.082 1.00 14.64 ? 73  LYS B N   1 
ATOM   3417  C CA  . LYS B 1 74  ? -44.026 22.451  -25.389 1.00 15.67 ? 73  LYS B CA  1 
ATOM   3418  C C   . LYS B 1 74  ? -44.483 21.031  -25.760 1.00 14.39 ? 73  LYS B C   1 
ATOM   3419  O O   . LYS B 1 74  ? -45.459 20.536  -25.206 1.00 13.54 ? 73  LYS B O   1 
ATOM   3420  C CB  . LYS B 1 74  ? -44.374 23.406  -26.538 1.00 16.57 ? 73  LYS B CB  1 
ATOM   3421  C CG  . LYS B 1 74  ? -44.576 24.878  -26.172 1.00 22.97 ? 73  LYS B CG  1 
ATOM   3422  C CD  . LYS B 1 74  ? -46.066 25.325  -26.300 1.00 27.47 ? 73  LYS B CD  1 
ATOM   3423  C CE  . LYS B 1 74  ? -46.417 25.910  -27.679 1.00 29.49 ? 73  LYS B CE  1 
ATOM   3424  N NZ  . LYS B 1 74  ? -47.800 26.530  -27.755 1.00 30.13 ? 73  LYS B NZ  1 
ATOM   3425  N N   . ALA B 1 75  ? -43.785 20.387  -26.696 1.00 13.97 ? 74  ALA B N   1 
ATOM   3426  C CA  . ALA B 1 75  ? -44.177 19.054  -27.181 1.00 13.95 ? 74  ALA B CA  1 
ATOM   3427  C C   . ALA B 1 75  ? -44.083 17.973  -26.106 1.00 13.51 ? 74  ALA B C   1 
ATOM   3428  O O   . ALA B 1 75  ? -45.021 17.154  -25.901 1.00 12.57 ? 74  ALA B O   1 
ATOM   3429  C CB  . ALA B 1 75  ? -43.298 18.663  -28.385 1.00 14.47 ? 74  ALA B CB  1 
ATOM   3430  N N   . VAL B 1 76  ? -42.939 17.934  -25.432 1.00 12.80 ? 75  VAL B N   1 
ATOM   3431  C CA  . VAL B 1 76  ? -42.762 16.945  -24.367 1.00 12.49 ? 75  VAL B CA  1 
ATOM   3432  C C   . VAL B 1 76  ? -43.813 17.143  -23.263 1.00 13.09 ? 75  VAL B C   1 
ATOM   3433  O O   . VAL B 1 76  ? -44.384 16.179  -22.794 1.00 12.52 ? 75  VAL B O   1 
ATOM   3434  C CB  . VAL B 1 76  ? -41.361 16.993  -23.748 1.00 12.50 ? 75  VAL B CB  1 
ATOM   3435  C CG1 . VAL B 1 76  ? -41.246 15.964  -22.598 1.00 11.22 ? 75  VAL B CG1 1 
ATOM   3436  C CG2 . VAL B 1 76  ? -40.314 16.734  -24.819 1.00 11.12 ? 75  VAL B CG2 1 
ATOM   3437  N N   . ALA B 1 77  ? -44.076 18.391  -22.881 1.00 13.63 ? 76  ALA B N   1 
ATOM   3438  C CA  . ALA B 1 77  ? -45.128 18.664  -21.881 1.00 14.37 ? 76  ALA B CA  1 
ATOM   3439  C C   . ALA B 1 77  ? -46.473 17.992  -22.276 1.00 14.33 ? 76  ALA B C   1 
ATOM   3440  O O   . ALA B 1 77  ? -47.098 17.288  -21.480 1.00 14.97 ? 76  ALA B O   1 
ATOM   3441  C CB  . ALA B 1 77  ? -45.280 20.150  -21.676 1.00 13.80 ? 76  ALA B CB  1 
ATOM   3442  N N   . ALA B 1 78  ? -46.898 18.187  -23.516 1.00 14.30 ? 77  ALA B N   1 
ATOM   3443  C CA  . ALA B 1 78  ? -48.125 17.575  -24.030 1.00 14.41 ? 77  ALA B CA  1 
ATOM   3444  C C   . ALA B 1 78  ? -48.081 16.063  -23.987 1.00 14.75 ? 77  ALA B C   1 
ATOM   3445  O O   . ALA B 1 78  ? -49.057 15.414  -23.636 1.00 15.10 ? 77  ALA B O   1 
ATOM   3446  C CB  . ALA B 1 78  ? -48.394 18.031  -25.451 1.00 13.92 ? 77  ALA B CB  1 
ATOM   3447  N N   . LEU B 1 79  ? -46.949 15.479  -24.339 1.00 14.88 ? 78  LEU B N   1 
ATOM   3448  C CA  . LEU B 1 79  ? -46.850 14.028  -24.334 1.00 14.95 ? 78  LEU B CA  1 
ATOM   3449  C C   . LEU B 1 79  ? -46.912 13.448  -22.906 1.00 14.79 ? 78  LEU B C   1 
ATOM   3450  O O   . LEU B 1 79  ? -47.383 12.330  -22.716 1.00 14.40 ? 78  LEU B O   1 
ATOM   3451  C CB  . LEU B 1 79  ? -45.577 13.593  -25.095 1.00 14.90 ? 78  LEU B CB  1 
ATOM   3452  C CG  . LEU B 1 79  ? -45.515 13.957  -26.604 1.00 14.94 ? 78  LEU B CG  1 
ATOM   3453  C CD1 . LEU B 1 79  ? -44.257 13.397  -27.287 1.00 14.73 ? 78  LEU B CD1 1 
ATOM   3454  C CD2 . LEU B 1 79  ? -46.754 13.486  -27.347 1.00 11.48 ? 78  LEU B CD2 1 
ATOM   3455  N N   . ASP B 1 80  ? -46.473 14.220  -21.908 1.00 15.27 ? 79  ASP B N   1 
ATOM   3456  C CA  . ASP B 1 80  ? -46.623 13.861  -20.492 1.00 16.01 ? 79  ASP B CA  1 
ATOM   3457  C C   . ASP B 1 80  ? -47.996 14.197  -19.901 1.00 16.19 ? 79  ASP B C   1 
ATOM   3458  O O   . ASP B 1 80  ? -48.304 13.775  -18.777 1.00 17.17 ? 79  ASP B O   1 
ATOM   3459  C CB  . ASP B 1 80  ? -45.551 14.555  -19.637 1.00 16.32 ? 79  ASP B CB  1 
ATOM   3460  C CG  . ASP B 1 80  ? -44.301 13.739  -19.494 1.00 16.73 ? 79  ASP B CG  1 
ATOM   3461  O OD1 . ASP B 1 80  ? -44.404 12.597  -19.021 1.00 20.63 ? 79  ASP B OD1 1 
ATOM   3462  O OD2 . ASP B 1 80  ? -43.215 14.258  -19.811 1.00 17.68 ? 79  ASP B OD2 1 
ATOM   3463  N N   . GLY B 1 81  ? -48.828 14.903  -20.659 1.00 17.17 ? 80  GLY B N   1 
ATOM   3464  C CA  . GLY B 1 81  ? -50.071 15.449  -20.141 1.00 16.63 ? 80  GLY B CA  1 
ATOM   3465  C C   . GLY B 1 81  ? -49.807 16.546  -19.135 1.00 17.42 ? 80  GLY B C   1 
ATOM   3466  O O   . GLY B 1 81  ? -50.614 16.770  -18.226 1.00 17.84 ? 80  GLY B O   1 
ATOM   3467  N N   . ALA B 1 82  ? -48.686 17.241  -19.310 1.00 16.79 ? 81  ALA B N   1 
ATOM   3468  C CA  . ALA B 1 82  ? -48.193 18.211  -18.353 1.00 17.24 ? 81  ALA B CA  1 
ATOM   3469  C C   . ALA B 1 82  ? -48.418 19.628  -18.821 1.00 17.69 ? 81  ALA B C   1 
ATOM   3470  O O   . ALA B 1 82  ? -48.486 19.893  -20.025 1.00 17.07 ? 81  ALA B O   1 
ATOM   3471  C CB  . ALA B 1 82  ? -46.719 17.994  -18.130 1.00 17.30 ? 81  ALA B CB  1 
ATOM   3472  N N   . LYS B 1 83  ? -48.495 20.550  -17.865 1.00 18.33 ? 82  LYS B N   1 
ATOM   3473  C CA  . LYS B 1 83  ? -48.557 21.980  -18.190 1.00 19.11 ? 82  LYS B CA  1 
ATOM   3474  C C   . LYS B 1 83  ? -47.222 22.477  -18.721 1.00 18.03 ? 82  LYS B C   1 
ATOM   3475  O O   . LYS B 1 83  ? -47.191 23.325  -19.595 1.00 17.33 ? 82  LYS B O   1 
ATOM   3476  C CB  . LYS B 1 83  ? -48.923 22.823  -16.963 1.00 19.03 ? 82  LYS B CB  1 
ATOM   3477  C CG  . LYS B 1 83  ? -50.372 22.736  -16.521 1.00 22.39 ? 82  LYS B CG  1 
ATOM   3478  C CD  . LYS B 1 83  ? -50.693 23.801  -15.433 1.00 22.86 ? 82  LYS B CD  1 
ATOM   3479  C CE  . LYS B 1 83  ? -50.605 25.221  -16.021 1.00 26.30 ? 82  LYS B CE  1 
ATOM   3480  N NZ  . LYS B 1 83  ? -51.088 26.335  -15.127 1.00 29.02 ? 82  LYS B NZ  1 
ATOM   3481  N N   . TYR B 1 84  ? -46.121 21.973  -18.166 1.00 17.31 ? 83  TYR B N   1 
ATOM   3482  C CA  . TYR B 1 84  ? -44.807 22.526  -18.466 1.00 16.65 ? 83  TYR B CA  1 
ATOM   3483  C C   . TYR B 1 84  ? -43.731 21.466  -18.600 1.00 15.57 ? 83  TYR B C   1 
ATOM   3484  O O   . TYR B 1 84  ? -43.814 20.370  -18.023 1.00 14.34 ? 83  TYR B O   1 
ATOM   3485  C CB  . TYR B 1 84  ? -44.351 23.488  -17.372 1.00 17.80 ? 83  TYR B CB  1 
ATOM   3486  C CG  . TYR B 1 84  ? -45.336 24.551  -16.991 1.00 18.95 ? 83  TYR B CG  1 
ATOM   3487  C CD1 . TYR B 1 84  ? -46.104 24.435  -15.837 1.00 18.99 ? 83  TYR B CD1 1 
ATOM   3488  C CD2 . TYR B 1 84  ? -45.488 25.691  -17.782 1.00 19.45 ? 83  TYR B CD2 1 
ATOM   3489  C CE1 . TYR B 1 84  ? -46.991 25.427  -15.479 1.00 19.95 ? 83  TYR B CE1 1 
ATOM   3490  C CE2 . TYR B 1 84  ? -46.375 26.674  -17.440 1.00 19.98 ? 83  TYR B CE2 1 
ATOM   3491  C CZ  . TYR B 1 84  ? -47.126 26.546  -16.284 1.00 20.41 ? 83  TYR B CZ  1 
ATOM   3492  O OH  . TYR B 1 84  ? -48.014 27.564  -15.948 1.00 20.69 ? 83  TYR B OH  1 
ATOM   3493  N N   . CYS B 1 85  ? -42.706 21.811  -19.369 1.00 14.35 ? 84  CYS B N   1 
ATOM   3494  C CA  . CYS B 1 85  ? -41.534 20.959  -19.458 1.00 14.18 ? 84  CYS B CA  1 
ATOM   3495  C C   . CYS B 1 85  ? -40.285 21.824  -19.540 1.00 13.30 ? 84  CYS B C   1 
ATOM   3496  O O   . CYS B 1 85  ? -40.327 22.947  -20.068 1.00 11.17 ? 84  CYS B O   1 
ATOM   3497  C CB  . CYS B 1 85  ? -41.642 19.973  -20.621 1.00 14.23 ? 84  CYS B CB  1 
ATOM   3498  S SG  . CYS B 1 85  ? -40.209 18.868  -20.749 1.00 14.79 ? 84  CYS B SG  1 
ATOM   3499  N N   . LEU B 1 86  ? -39.199 21.308  -18.956 1.00 12.69 ? 85  LEU B N   1 
ATOM   3500  C CA  . LEU B 1 86  ? -37.907 21.978  -18.967 1.00 13.21 ? 85  LEU B CA  1 
ATOM   3501  C C   . LEU B 1 86  ? -36.877 21.011  -19.524 1.00 12.82 ? 85  LEU B C   1 
ATOM   3502  O O   . LEU B 1 86  ? -36.788 19.879  -19.055 1.00 12.44 ? 85  LEU B O   1 
ATOM   3503  C CB  . LEU B 1 86  ? -37.479 22.454  -17.561 1.00 13.47 ? 85  LEU B CB  1 
ATOM   3504  C CG  . LEU B 1 86  ? -38.465 23.279  -16.727 1.00 13.59 ? 85  LEU B CG  1 
ATOM   3505  C CD1 . LEU B 1 86  ? -39.325 22.413  -15.801 1.00 12.93 ? 85  LEU B CD1 1 
ATOM   3506  C CD2 . LEU B 1 86  ? -37.722 24.290  -15.943 1.00 12.81 ? 85  LEU B CD2 1 
ATOM   3507  N N   . ALA B 1 87  ? -36.102 21.473  -20.513 1.00 13.07 ? 86  ALA B N   1 
ATOM   3508  C CA  . ALA B 1 87  ? -35.029 20.672  -21.110 1.00 12.82 ? 86  ALA B CA  1 
ATOM   3509  C C   . ALA B 1 87  ? -33.662 21.040  -20.541 1.00 12.89 ? 86  ALA B C   1 
ATOM   3510  O O   . ALA B 1 87  ? -33.379 22.234  -20.288 1.00 13.03 ? 86  ALA B O   1 
ATOM   3511  C CB  . ALA B 1 87  ? -35.045 20.832  -22.629 1.00 12.28 ? 86  ALA B CB  1 
ATOM   3512  N N   . PHE B 1 88  ? -32.820 20.012  -20.376 1.00 12.93 ? 87  PHE B N   1 
ATOM   3513  C CA  . PHE B 1 88  ? -31.481 20.102  -19.781 1.00 12.94 ? 87  PHE B CA  1 
ATOM   3514  C C   . PHE B 1 88  ? -30.448 19.365  -20.623 1.00 13.20 ? 87  PHE B C   1 
ATOM   3515  O O   . PHE B 1 88  ? -30.783 18.518  -21.458 1.00 11.90 ? 87  PHE B O   1 
ATOM   3516  C CB  . PHE B 1 88  ? -31.486 19.510  -18.361 1.00 13.38 ? 87  PHE B CB  1 
ATOM   3517  C CG  . PHE B 1 88  ? -32.376 20.274  -17.411 1.00 14.39 ? 87  PHE B CG  1 
ATOM   3518  C CD1 . PHE B 1 88  ? -33.719 19.937  -17.280 1.00 14.91 ? 87  PHE B CD1 1 
ATOM   3519  C CD2 . PHE B 1 88  ? -31.895 21.394  -16.748 1.00 14.53 ? 87  PHE B CD2 1 
ATOM   3520  C CE1 . PHE B 1 88  ? -34.566 20.670  -16.471 1.00 14.21 ? 87  PHE B CE1 1 
ATOM   3521  C CE2 . PHE B 1 88  ? -32.738 22.143  -15.933 1.00 16.33 ? 87  PHE B CE2 1 
ATOM   3522  C CZ  . PHE B 1 88  ? -34.083 21.773  -15.794 1.00 14.49 ? 87  PHE B CZ  1 
ATOM   3523  N N   . ALA B 1 89  ? -29.188 19.683  -20.359 1.00 12.90 ? 88  ALA B N   1 
ATOM   3524  C CA  . ALA B 1 89  ? -28.041 19.124  -21.053 1.00 13.27 ? 88  ALA B CA  1 
ATOM   3525  C C   . ALA B 1 89  ? -27.909 17.597  -20.949 1.00 13.53 ? 88  ALA B C   1 
ATOM   3526  O O   . ALA B 1 89  ? -27.233 16.994  -21.767 1.00 13.71 ? 88  ALA B O   1 
ATOM   3527  C CB  . ALA B 1 89  ? -26.769 19.784  -20.488 1.00 13.13 ? 88  ALA B CB  1 
ATOM   3528  N N   . SER B 1 90  ? -28.485 17.017  -19.894 1.00 13.70 ? 89  SER B N   1 
ATOM   3529  C CA  . SER B 1 90  ? -28.442 15.590  -19.627 1.00 13.66 ? 89  SER B CA  1 
ATOM   3530  C C   . SER B 1 90  ? -29.469 15.213  -18.557 1.00 13.72 ? 89  SER B C   1 
ATOM   3531  O O   . SER B 1 90  ? -30.014 16.080  -17.852 1.00 12.48 ? 89  SER B O   1 
ATOM   3532  C CB  . SER B 1 90  ? -27.028 15.177  -19.178 1.00 13.81 ? 89  SER B CB  1 
ATOM   3533  O OG  . SER B 1 90  ? -26.722 15.667  -17.872 1.00 13.92 ? 89  SER B OG  1 
ATOM   3534  N N   . GLY B 1 91  ? -29.741 13.914  -18.440 1.00 14.22 ? 90  GLY B N   1 
ATOM   3535  C CA  . GLY B 1 91  ? -30.576 13.396  -17.357 1.00 14.06 ? 90  GLY B CA  1 
ATOM   3536  C C   . GLY B 1 91  ? -29.973 13.752  -16.008 1.00 14.70 ? 90  GLY B C   1 
ATOM   3537  O O   . GLY B 1 91  ? -30.673 14.200  -15.093 1.00 15.16 ? 90  GLY B O   1 
ATOM   3538  N N   . LEU B 1 92  ? -28.669 13.541  -15.880 1.00 14.79 ? 91  LEU B N   1 
ATOM   3539  C CA  . LEU B 1 92  ? -27.928 13.969  -14.695 1.00 15.04 ? 91  LEU B CA  1 
ATOM   3540  C C   . LEU B 1 92  ? -28.058 15.475  -14.410 1.00 14.60 ? 91  LEU B C   1 
ATOM   3541  O O   . LEU B 1 92  ? -28.241 15.866  -13.268 1.00 14.83 ? 91  LEU B O   1 
ATOM   3542  C CB  . LEU B 1 92  ? -26.447 13.556  -14.812 1.00 15.24 ? 91  LEU B CB  1 
ATOM   3543  C CG  . LEU B 1 92  ? -26.186 12.075  -14.568 1.00 16.55 ? 91  LEU B CG  1 
ATOM   3544  C CD1 . LEU B 1 92  ? -24.753 11.688  -14.902 1.00 17.96 ? 91  LEU B CD1 1 
ATOM   3545  C CD2 . LEU B 1 92  ? -26.491 11.783  -13.135 1.00 17.10 ? 91  LEU B CD2 1 
ATOM   3546  N N   . ALA B 1 93  ? -27.966 16.329  -15.427 1.00 14.49 ? 92  ALA B N   1 
ATOM   3547  C CA  . ALA B 1 93  ? -28.131 17.762  -15.191 1.00 14.78 ? 92  ALA B CA  1 
ATOM   3548  C C   . ALA B 1 93  ? -29.550 18.107  -14.754 1.00 14.96 ? 92  ALA B C   1 
ATOM   3549  O O   . ALA B 1 93  ? -29.739 19.053  -14.017 1.00 15.24 ? 92  ALA B O   1 
ATOM   3550  C CB  . ALA B 1 93  ? -27.725 18.607  -16.422 1.00 15.78 ? 92  ALA B CB  1 
ATOM   3551  N N   . ALA B 1 94  ? -30.539 17.354  -15.241 1.00 15.03 ? 93  ALA B N   1 
ATOM   3552  C CA  . ALA B 1 94  ? -31.923 17.475  -14.803 1.00 15.15 ? 93  ALA B CA  1 
ATOM   3553  C C   . ALA B 1 94  ? -32.007 17.146  -13.310 1.00 15.88 ? 93  ALA B C   1 
ATOM   3554  O O   . ALA B 1 94  ? -32.603 17.889  -12.528 1.00 16.43 ? 93  ALA B O   1 
ATOM   3555  C CB  . ALA B 1 94  ? -32.855 16.509  -15.627 1.00 14.76 ? 93  ALA B CB  1 
ATOM   3556  N N   . THR B 1 95  ? -31.425 16.014  -12.936 1.00 16.56 ? 94  THR B N   1 
ATOM   3557  C CA  . THR B 1 95  ? -31.405 15.547  -11.544 1.00 17.04 ? 94  THR B CA  1 
ATOM   3558  C C   . THR B 1 95  ? -30.747 16.567  -10.599 1.00 17.49 ? 94  THR B C   1 
ATOM   3559  O O   . THR B 1 95  ? -31.322 16.931  -9.589  1.00 18.57 ? 94  THR B O   1 
ATOM   3560  C CB  . THR B 1 95  ? -30.689 14.184  -11.462 1.00 17.42 ? 94  THR B CB  1 
ATOM   3561  O OG1 . THR B 1 95  ? -31.323 13.290  -12.382 1.00 16.43 ? 94  THR B OG1 1 
ATOM   3562  C CG2 . THR B 1 95  ? -30.725 13.617  -10.053 1.00 15.58 ? 94  THR B CG2 1 
ATOM   3563  N N   . VAL B 1 96  ? -29.585 17.078  -10.983 1.00 17.50 ? 95  VAL B N   1 
ATOM   3564  C CA  . VAL B 1 96  ? -28.891 18.099  -10.211 1.00 17.03 ? 95  VAL B CA  1 
ATOM   3565  C C   . VAL B 1 96  ? -29.753 19.361  -10.076 1.00 17.53 ? 95  VAL B C   1 
ATOM   3566  O O   . VAL B 1 96  ? -29.857 19.959  -8.999  1.00 17.11 ? 95  VAL B O   1 
ATOM   3567  C CB  . VAL B 1 96  ? -27.549 18.443  -10.871 1.00 17.01 ? 95  VAL B CB  1 
ATOM   3568  C CG1 . VAL B 1 96  ? -26.884 19.588  -10.167 1.00 16.65 ? 95  VAL B CG1 1 
ATOM   3569  C CG2 . VAL B 1 96  ? -26.633 17.219  -10.890 1.00 15.88 ? 95  VAL B CG2 1 
ATOM   3570  N N   . THR B 1 97  ? -30.382 19.756  -11.176 1.00 17.36 ? 96  THR B N   1 
ATOM   3571  C CA  . THR B 1 97  ? -31.216 20.936  -11.179 1.00 17.67 ? 96  THR B CA  1 
ATOM   3572  C C   . THR B 1 97  ? -32.400 20.720  -10.242 1.00 17.90 ? 96  THR B C   1 
ATOM   3573  O O   . THR B 1 97  ? -32.749 21.600  -9.454  1.00 18.08 ? 96  THR B O   1 
ATOM   3574  C CB  . THR B 1 97  ? -31.668 21.315  -12.617 1.00 17.09 ? 96  THR B CB  1 
ATOM   3575  O OG1 . THR B 1 97  ? -30.512 21.659  -13.398 1.00 17.28 ? 96  THR B OG1 1 
ATOM   3576  C CG2 . THR B 1 97  ? -32.620 22.514  -12.623 1.00 17.24 ? 96  THR B CG2 1 
ATOM   3577  N N   . ILE B 1 98  ? -33.013 19.544  -10.321 1.00 18.50 ? 97  ILE B N   1 
ATOM   3578  C CA  . ILE B 1 98  ? -34.136 19.233  -9.457  1.00 17.91 ? 97  ILE B CA  1 
ATOM   3579  C C   . ILE B 1 98  ? -33.690 19.309  -7.983  1.00 19.25 ? 97  ILE B C   1 
ATOM   3580  O O   . ILE B 1 98  ? -34.413 19.823  -7.106  1.00 19.80 ? 97  ILE B O   1 
ATOM   3581  C CB  . ILE B 1 98  ? -34.709 17.837  -9.780  1.00 18.16 ? 97  ILE B CB  1 
ATOM   3582  C CG1 . ILE B 1 98  ? -35.578 17.890  -11.048 1.00 17.83 ? 97  ILE B CG1 1 
ATOM   3583  C CG2 . ILE B 1 98  ? -35.561 17.321  -8.625  1.00 16.01 ? 97  ILE B CG2 1 
ATOM   3584  C CD1 . ILE B 1 98  ? -35.929 16.492  -11.632 1.00 16.74 ? 97  ILE B CD1 1 
ATOM   3585  N N   . THR B 1 99  ? -32.494 18.795  -7.718  1.00 19.83 ? 98  THR B N   1 
ATOM   3586  C CA  . THR B 1 99  ? -31.992 18.708  -6.351  1.00 20.75 ? 98  THR B CA  1 
ATOM   3587  C C   . THR B 1 99  ? -31.751 20.101  -5.799  1.00 20.82 ? 98  THR B C   1 
ATOM   3588  O O   . THR B 1 99  ? -31.967 20.329  -4.624  1.00 20.61 ? 98  THR B O   1 
ATOM   3589  C CB  . THR B 1 99  ? -30.738 17.798  -6.284  1.00 20.95 ? 98  THR B CB  1 
ATOM   3590  O OG1 . THR B 1 99  ? -31.131 16.445  -6.591  1.00 21.09 ? 98  THR B OG1 1 
ATOM   3591  C CG2 . THR B 1 99  ? -30.088 17.840  -4.902  1.00 21.57 ? 98  THR B CG2 1 
ATOM   3592  N N   . HIS B 1 100 ? -31.382 21.046  -6.665  1.00 21.07 ? 99  HIS B N   1 
ATOM   3593  C CA  . HIS B 1 100 ? -31.285 22.449  -6.261  1.00 21.42 ? 99  HIS B CA  1 
ATOM   3594  C C   . HIS B 1 100 ? -32.611 23.144  -5.880  1.00 21.47 ? 99  HIS B C   1 
ATOM   3595  O O   . HIS B 1 100 ? -32.583 24.297  -5.461  1.00 21.57 ? 99  HIS B O   1 
ATOM   3596  C CB  . HIS B 1 100 ? -30.521 23.268  -7.315  1.00 20.93 ? 99  HIS B CB  1 
ATOM   3597  C CG  . HIS B 1 100 ? -29.035 23.156  -7.189  1.00 21.55 ? 99  HIS B CG  1 
ATOM   3598  N ND1 . HIS B 1 100 ? -28.335 22.037  -7.581  1.00 20.21 ? 99  HIS B ND1 1 
ATOM   3599  C CD2 . HIS B 1 100 ? -28.117 24.025  -6.704  1.00 21.73 ? 99  HIS B CD2 1 
ATOM   3600  C CE1 . HIS B 1 100 ? -27.047 22.228  -7.354  1.00 22.66 ? 99  HIS B CE1 1 
ATOM   3601  N NE2 . HIS B 1 100 ? -26.890 23.422  -6.811  1.00 22.31 ? 99  HIS B NE2 1 
ATOM   3602  N N   . LEU B 1 101 ? -33.754 22.467  -6.032  1.00 21.94 ? 100 LEU B N   1 
ATOM   3603  C CA  . LEU B 1 101 ? -35.009 22.909  -5.406  1.00 22.27 ? 100 LEU B CA  1 
ATOM   3604  C C   . LEU B 1 101 ? -34.939 22.929  -3.868  1.00 23.29 ? 100 LEU B C   1 
ATOM   3605  O O   . LEU B 1 101 ? -35.676 23.668  -3.225  1.00 23.71 ? 100 LEU B O   1 
ATOM   3606  C CB  . LEU B 1 101 ? -36.190 22.004  -5.811  1.00 22.25 ? 100 LEU B CB  1 
ATOM   3607  C CG  . LEU B 1 101 ? -36.647 22.036  -7.278  1.00 22.00 ? 100 LEU B CG  1 
ATOM   3608  C CD1 . LEU B 1 101 ? -37.740 20.996  -7.539  1.00 21.39 ? 100 LEU B CD1 1 
ATOM   3609  C CD2 . LEU B 1 101 ? -37.097 23.438  -7.684  1.00 21.92 ? 100 LEU B CD2 1 
ATOM   3610  N N   . LEU B 1 102 ? -34.086 22.096  -3.286  1.00 24.09 ? 101 LEU B N   1 
ATOM   3611  C CA  . LEU B 1 102 ? -34.029 21.940  -1.834  1.00 24.53 ? 101 LEU B CA  1 
ATOM   3612  C C   . LEU B 1 102 ? -33.052 22.965  -1.254  1.00 25.50 ? 101 LEU B C   1 
ATOM   3613  O O   . LEU B 1 102 ? -32.632 23.895  -1.935  1.00 24.68 ? 101 LEU B O   1 
ATOM   3614  C CB  . LEU B 1 102 ? -33.636 20.506  -1.466  1.00 24.45 ? 101 LEU B CB  1 
ATOM   3615  C CG  . LEU B 1 102 ? -34.363 19.382  -2.231  1.00 24.33 ? 101 LEU B CG  1 
ATOM   3616  C CD1 . LEU B 1 102 ? -34.044 18.017  -1.635  1.00 24.44 ? 101 LEU B CD1 1 
ATOM   3617  C CD2 . LEU B 1 102 ? -35.867 19.615  -2.279  1.00 22.45 ? 101 LEU B CD2 1 
ATOM   3618  N N   . LYS B 1 103 ? -32.717 22.802  0.017   1.00 26.94 ? 102 LYS B N   1 
ATOM   3619  C CA  . LYS B 1 103 ? -31.731 23.646  0.685   1.00 28.11 ? 102 LYS B CA  1 
ATOM   3620  C C   . LYS B 1 103 ? -31.023 22.818  1.761   1.00 28.12 ? 102 LYS B C   1 
ATOM   3621  O O   . LYS B 1 103 ? -31.503 21.736  2.163   1.00 27.66 ? 102 LYS B O   1 
ATOM   3622  C CB  . LYS B 1 103 ? -32.409 24.866  1.321   1.00 28.61 ? 102 LYS B CB  1 
ATOM   3623  C CG  . LYS B 1 103 ? -33.589 24.495  2.230   1.00 29.15 ? 102 LYS B CG  1 
ATOM   3624  C CD  . LYS B 1 103 ? -34.255 25.714  2.845   1.00 30.50 ? 102 LYS B CD  1 
ATOM   3625  C CE  . LYS B 1 103 ? -35.629 25.362  3.421   1.00 32.65 ? 102 LYS B CE  1 
ATOM   3626  N NZ  . LYS B 1 103 ? -35.694 23.994  4.056   1.00 35.06 ? 102 LYS B NZ  1 
ATOM   3627  N N   . ALA B 1 104 ? -29.871 23.322  2.203   1.00 28.24 ? 103 ALA B N   1 
ATOM   3628  C CA  . ALA B 1 104 ? -29.126 22.694  3.303   1.00 28.33 ? 103 ALA B CA  1 
ATOM   3629  C C   . ALA B 1 104 ? -30.116 22.361  4.408   1.00 27.93 ? 103 ALA B C   1 
ATOM   3630  O O   . ALA B 1 104 ? -30.919 23.210  4.798   1.00 27.62 ? 103 ALA B O   1 
ATOM   3631  C CB  . ALA B 1 104 ? -28.022 23.637  3.821   1.00 28.38 ? 103 ALA B CB  1 
ATOM   3632  N N   . GLY B 1 105 ? -30.094 21.113  4.868   1.00 28.28 ? 104 GLY B N   1 
ATOM   3633  C CA  . GLY B 1 105 ? -30.983 20.671  5.948   1.00 28.30 ? 104 GLY B CA  1 
ATOM   3634  C C   . GLY B 1 105 ? -32.106 19.744  5.530   1.00 28.50 ? 104 GLY B C   1 
ATOM   3635  O O   . GLY B 1 105 ? -32.628 19.001  6.364   1.00 29.30 ? 104 GLY B O   1 
ATOM   3636  N N   . ASP B 1 106 ? -32.499 19.778  4.254   1.00 28.14 ? 105 ASP B N   1 
ATOM   3637  C CA  . ASP B 1 106 ? -33.571 18.904  3.768   1.00 27.77 ? 105 ASP B CA  1 
ATOM   3638  C C   . ASP B 1 106 ? -33.073 17.471  3.622   1.00 27.29 ? 105 ASP B C   1 
ATOM   3639  O O   . ASP B 1 106 ? -31.874 17.234  3.537   1.00 27.04 ? 105 ASP B O   1 
ATOM   3640  C CB  . ASP B 1 106 ? -34.098 19.380  2.410   1.00 27.70 ? 105 ASP B CB  1 
ATOM   3641  C CG  . ASP B 1 106 ? -34.748 20.744  2.473   1.00 27.80 ? 105 ASP B CG  1 
ATOM   3642  O OD1 . ASP B 1 106 ? -35.021 21.262  3.578   1.00 26.72 ? 105 ASP B OD1 1 
ATOM   3643  O OD2 . ASP B 1 106 ? -34.990 21.315  1.395   1.00 28.52 ? 105 ASP B OD2 1 
ATOM   3644  N N   . GLN B 1 107 ? -34.021 16.536  3.585   1.00 26.96 ? 106 GLN B N   1 
ATOM   3645  C CA  . GLN B 1 107 ? -33.762 15.142  3.282   1.00 26.56 ? 106 GLN B CA  1 
ATOM   3646  C C   . GLN B 1 107 ? -34.322 14.742  1.912   1.00 26.44 ? 106 GLN B C   1 
ATOM   3647  O O   . GLN B 1 107 ? -35.459 15.118  1.521   1.00 26.02 ? 106 GLN B O   1 
ATOM   3648  C CB  . GLN B 1 107 ? -34.409 14.223  4.320   1.00 26.52 ? 106 GLN B CB  1 
ATOM   3649  C CG  . GLN B 1 107 ? -34.263 12.731  3.984   1.00 26.61 ? 106 GLN B CG  1 
ATOM   3650  C CD  . GLN B 1 107 ? -34.992 11.831  4.954   1.00 27.38 ? 106 GLN B CD  1 
ATOM   3651  O OE1 . GLN B 1 107 ? -36.073 12.161  5.441   1.00 29.99 ? 106 GLN B OE1 1 
ATOM   3652  N NE2 . GLN B 1 107 ? -34.408 10.679  5.230   1.00 27.60 ? 106 GLN B NE2 1 
ATOM   3653  N N   . ILE B 1 108 ? -33.542 13.912  1.230   1.00 25.99 ? 107 ILE B N   1 
ATOM   3654  C CA  . ILE B 1 108 ? -33.992 13.205  0.042   1.00 26.06 ? 107 ILE B CA  1 
ATOM   3655  C C   . ILE B 1 108 ? -34.144 11.735  0.378   1.00 25.85 ? 107 ILE B C   1 
ATOM   3656  O O   . ILE B 1 108 ? -33.235 11.136  0.957   1.00 25.96 ? 107 ILE B O   1 
ATOM   3657  C CB  . ILE B 1 108 ? -32.953 13.347  -1.094  1.00 25.73 ? 107 ILE B CB  1 
ATOM   3658  C CG1 . ILE B 1 108 ? -32.867 14.822  -1.536  1.00 26.18 ? 107 ILE B CG1 1 
ATOM   3659  C CG2 . ILE B 1 108 ? -33.287 12.373  -2.243  1.00 26.49 ? 107 ILE B CG2 1 
ATOM   3660  C CD1 . ILE B 1 108 ? -31.543 15.209  -2.206  1.00 25.41 ? 107 ILE B CD1 1 
ATOM   3661  N N   . ILE B 1 109 ? -35.285 11.153  0.020   1.00 25.87 ? 108 ILE B N   1 
ATOM   3662  C CA  . ILE B 1 109 ? -35.439 9.712   0.075   1.00 25.99 ? 108 ILE B CA  1 
ATOM   3663  C C   . ILE B 1 109 ? -35.302 9.204   -1.338  1.00 25.90 ? 108 ILE B C   1 
ATOM   3664  O O   . ILE B 1 109 ? -36.078 9.574   -2.199  1.00 26.20 ? 108 ILE B O   1 
ATOM   3665  C CB  . ILE B 1 109 ? -36.810 9.266   0.610   1.00 26.10 ? 108 ILE B CB  1 
ATOM   3666  C CG1 . ILE B 1 109 ? -36.983 9.718   2.071   1.00 26.73 ? 108 ILE B CG1 1 
ATOM   3667  C CG2 . ILE B 1 109 ? -36.967 7.727   0.447   1.00 26.32 ? 108 ILE B CG2 1 
ATOM   3668  C CD1 . ILE B 1 109 ? -38.212 9.130   2.763   1.00 25.64 ? 108 ILE B CD1 1 
ATOM   3669  N N   . CYS B 1 110 ? -34.326 8.346   -1.578  1.00 26.41 ? 109 CYS B N   1 
ATOM   3670  C CA  . CYS B 1 110 ? -34.160 7.758   -2.899  1.00 27.04 ? 109 CYS B CA  1 
ATOM   3671  C C   . CYS B 1 110 ? -34.362 6.233   -2.881  1.00 28.30 ? 109 CYS B C   1 
ATOM   3672  O O   . CYS B 1 110 ? -33.945 5.559   -1.956  1.00 27.86 ? 109 CYS B O   1 
ATOM   3673  C CB  . CYS B 1 110 ? -32.785 8.126   -3.438  1.00 26.47 ? 109 CYS B CB  1 
ATOM   3674  S SG  . CYS B 1 110 ? -32.496 7.584   -5.122  1.00 25.44 ? 109 CYS B SG  1 
ATOM   3675  N N   . MET B 1 111 ? -35.028 5.707   -3.908  1.00 30.20 ? 110 MET B N   1 
ATOM   3676  C CA  . MET B 1 111 ? -35.111 4.262   -4.150  1.00 32.00 ? 110 MET B CA  1 
ATOM   3677  C C   . MET B 1 111 ? -33.747 3.621   -4.183  1.00 32.48 ? 110 MET B C   1 
ATOM   3678  O O   . MET B 1 111 ? -32.804 4.210   -4.705  1.00 32.12 ? 110 MET B O   1 
ATOM   3679  C CB  . MET B 1 111 ? -35.722 3.982   -5.511  1.00 32.05 ? 110 MET B CB  1 
ATOM   3680  C CG  . MET B 1 111 ? -37.161 3.663   -5.483  1.00 33.26 ? 110 MET B CG  1 
ATOM   3681  S SD  . MET B 1 111 ? -37.673 3.204   -7.139  1.00 35.77 ? 110 MET B SD  1 
ATOM   3682  C CE  . MET B 1 111 ? -36.558 1.846   -7.497  1.00 32.15 ? 110 MET B CE  1 
ATOM   3683  N N   . ASP B 1 112 ? -33.661 2.393   -3.678  1.00 33.79 ? 111 ASP B N   1 
ATOM   3684  C CA  . ASP B 1 112 ? -32.401 1.659   -3.643  1.00 35.03 ? 111 ASP B CA  1 
ATOM   3685  C C   . ASP B 1 112 ? -31.922 1.292   -5.044  1.00 35.52 ? 111 ASP B C   1 
ATOM   3686  O O   . ASP B 1 112 ? -30.744 1.459   -5.349  1.00 36.31 ? 111 ASP B O   1 
ATOM   3687  C CB  . ASP B 1 112 ? -32.525 0.364   -2.826  1.00 35.51 ? 111 ASP B CB  1 
ATOM   3688  C CG  . ASP B 1 112 ? -32.786 0.610   -1.351  1.00 36.98 ? 111 ASP B CG  1 
ATOM   3689  O OD1 . ASP B 1 112 ? -32.151 1.511   -0.753  1.00 39.08 ? 111 ASP B OD1 1 
ATOM   3690  O OD2 . ASP B 1 112 ? -33.631 -0.120  -0.791  1.00 39.08 ? 111 ASP B OD2 1 
ATOM   3691  N N   . ASP B 1 113 ? -32.821 0.773   -5.881  1.00 35.88 ? 112 ASP B N   1 
ATOM   3692  C CA  . ASP B 1 113 ? -32.443 0.270   -7.206  1.00 36.23 ? 112 ASP B CA  1 
ATOM   3693  C C   . ASP B 1 113 ? -32.583 1.370   -8.249  1.00 35.41 ? 112 ASP B C   1 
ATOM   3694  O O   . ASP B 1 113 ? -33.336 1.244   -9.217  1.00 36.02 ? 112 ASP B O   1 
ATOM   3695  C CB  . ASP B 1 113 ? -33.313 -0.920  -7.605  1.00 36.91 ? 112 ASP B CB  1 
ATOM   3696  C CG  . ASP B 1 113 ? -33.219 -2.053  -6.625  1.00 39.93 ? 112 ASP B CG  1 
ATOM   3697  O OD1 . ASP B 1 113 ? -34.004 -2.072  -5.638  1.00 44.27 ? 112 ASP B OD1 1 
ATOM   3698  O OD2 . ASP B 1 113 ? -32.354 -2.925  -6.846  1.00 43.88 ? 112 ASP B OD2 1 
ATOM   3699  N N   . VAL B 1 114 ? -31.853 2.452   -8.041  1.00 34.25 ? 113 VAL B N   1 
ATOM   3700  C CA  . VAL B 1 114 ? -31.929 3.606   -8.917  1.00 33.21 ? 113 VAL B CA  1 
ATOM   3701  C C   . VAL B 1 114 ? -30.796 3.538   -9.966  1.00 32.31 ? 113 VAL B C   1 
ATOM   3702  O O   . VAL B 1 114 ? -29.856 2.742   -9.841  1.00 31.48 ? 113 VAL B O   1 
ATOM   3703  C CB  . VAL B 1 114 ? -31.872 4.913   -8.086  1.00 33.03 ? 113 VAL B CB  1 
ATOM   3704  C CG1 . VAL B 1 114 ? -30.456 5.166   -7.542  1.00 32.44 ? 113 VAL B CG1 1 
ATOM   3705  C CG2 . VAL B 1 114 ? -32.372 6.084   -8.899  1.00 32.98 ? 113 VAL B CG2 1 
ATOM   3706  N N   . TYR B 1 115 ? -30.918 4.352   -11.009 1.00 30.78 ? 114 TYR B N   1 
ATOM   3707  C CA  . TYR B 1 115 ? -29.833 4.549   -11.971 1.00 29.90 ? 114 TYR B CA  1 
ATOM   3708  C C   . TYR B 1 115 ? -28.527 4.937   -11.237 1.00 28.38 ? 114 TYR B C   1 
ATOM   3709  O O   . TYR B 1 115 ? -28.518 5.814   -10.368 1.00 26.96 ? 114 TYR B O   1 
ATOM   3710  C CB  . TYR B 1 115 ? -30.268 5.603   -13.004 1.00 30.45 ? 114 TYR B CB  1 
ATOM   3711  C CG  . TYR B 1 115 ? -29.192 6.155   -13.899 1.00 31.15 ? 114 TYR B CG  1 
ATOM   3712  C CD1 . TYR B 1 115 ? -28.428 5.318   -14.697 1.00 31.53 ? 114 TYR B CD1 1 
ATOM   3713  C CD2 . TYR B 1 115 ? -28.970 7.533   -13.987 1.00 32.88 ? 114 TYR B CD2 1 
ATOM   3714  C CE1 . TYR B 1 115 ? -27.441 5.821   -15.524 1.00 31.41 ? 114 TYR B CE1 1 
ATOM   3715  C CE2 . TYR B 1 115 ? -27.989 8.050   -14.823 1.00 32.40 ? 114 TYR B CE2 1 
ATOM   3716  C CZ  . TYR B 1 115 ? -27.225 7.183   -15.589 1.00 32.61 ? 114 TYR B CZ  1 
ATOM   3717  O OH  . TYR B 1 115 ? -26.248 7.675   -16.440 1.00 32.49 ? 114 TYR B OH  1 
ATOM   3718  N N   . GLY B 1 116 ? -27.437 4.262   -11.584 1.00 26.64 ? 115 GLY B N   1 
ATOM   3719  C CA  . GLY B 1 116 ? -26.153 4.495   -10.944 1.00 26.11 ? 115 GLY B CA  1 
ATOM   3720  C C   . GLY B 1 116 ? -25.733 5.957   -10.918 1.00 25.70 ? 115 GLY B C   1 
ATOM   3721  O O   . GLY B 1 116 ? -25.183 6.430   -9.926  1.00 25.62 ? 115 GLY B O   1 
ATOM   3722  N N   . GLY B 1 117 ? -25.977 6.669   -12.015 1.00 25.32 ? 116 GLY B N   1 
ATOM   3723  C CA  . GLY B 1 117 ? -25.734 8.117   -12.074 1.00 24.89 ? 116 GLY B CA  1 
ATOM   3724  C C   . GLY B 1 117 ? -26.469 8.904   -11.000 1.00 24.21 ? 116 GLY B C   1 
ATOM   3725  O O   . GLY B 1 117 ? -25.928 9.857   -10.433 1.00 24.32 ? 116 GLY B O   1 
ATOM   3726  N N   . THR B 1 118 ? -27.703 8.513   -10.720 1.00 23.92 ? 117 THR B N   1 
ATOM   3727  C CA  . THR B 1 118 ? -28.519 9.193   -9.721  1.00 23.64 ? 117 THR B CA  1 
ATOM   3728  C C   . THR B 1 118 ? -27.985 8.897   -8.325  1.00 24.31 ? 117 THR B C   1 
ATOM   3729  O O   . THR B 1 118 ? -27.738 9.808   -7.509  1.00 23.34 ? 117 THR B O   1 
ATOM   3730  C CB  . THR B 1 118 ? -29.989 8.740   -9.815  1.00 23.95 ? 117 THR B CB  1 
ATOM   3731  O OG1 . THR B 1 118 ? -30.497 9.018   -11.132 1.00 21.48 ? 117 THR B OG1 1 
ATOM   3732  C CG2 . THR B 1 118 ? -30.852 9.411   -8.746  1.00 22.72 ? 117 THR B CG2 1 
ATOM   3733  N N   . ASN B 1 119 ? -27.808 7.609   -8.063  1.00 24.65 ? 118 ASN B N   1 
ATOM   3734  C CA  . ASN B 1 119 ? -27.169 7.159   -6.839  1.00 25.57 ? 118 ASN B CA  1 
ATOM   3735  C C   . ASN B 1 119 ? -25.851 7.895   -6.612  1.00 25.56 ? 118 ASN B C   1 
ATOM   3736  O O   . ASN B 1 119 ? -25.640 8.471   -5.546  1.00 26.11 ? 118 ASN B O   1 
ATOM   3737  C CB  . ASN B 1 119 ? -26.945 5.649   -6.901  1.00 25.61 ? 118 ASN B CB  1 
ATOM   3738  C CG  . ASN B 1 119 ? -26.344 5.108   -5.647  1.00 27.33 ? 118 ASN B CG  1 
ATOM   3739  O OD1 . ASN B 1 119 ? -27.050 4.888   -4.668  1.00 29.95 ? 118 ASN B OD1 1 
ATOM   3740  N ND2 . ASN B 1 119 ? -25.030 4.896   -5.655  1.00 27.43 ? 118 ASN B ND2 1 
ATOM   3741  N N   . ARG B 1 120 ? -24.981 7.906   -7.621  1.00 25.64 ? 119 ARG B N   1 
ATOM   3742  C CA  . ARG B 1 120 ? -23.650 8.497   -7.459  1.00 26.08 ? 119 ARG B CA  1 
ATOM   3743  C C   . ARG B 1 120 ? -23.711 9.988   -7.116  1.00 25.61 ? 119 ARG B C   1 
ATOM   3744  O O   . ARG B 1 120 ? -22.967 10.457  -6.233  1.00 25.81 ? 119 ARG B O   1 
ATOM   3745  C CB  . ARG B 1 120 ? -22.776 8.272   -8.705  1.00 26.45 ? 119 ARG B CB  1 
ATOM   3746  C CG  . ARG B 1 120 ? -21.433 9.063   -8.717  1.00 26.89 ? 119 ARG B CG  1 
ATOM   3747  C CD  . ARG B 1 120 ? -20.595 8.789   -9.994  1.00 28.62 ? 119 ARG B CD  1 
ATOM   3748  N NE  . ARG B 1 120 ? -21.162 9.416   -11.199 1.00 32.46 ? 119 ARG B NE  1 
ATOM   3749  C CZ  . ARG B 1 120 ? -21.815 8.782   -12.188 1.00 35.10 ? 119 ARG B CZ  1 
ATOM   3750  N NH1 . ARG B 1 120 ? -22.029 7.450   -12.164 1.00 37.75 ? 119 ARG B NH1 1 
ATOM   3751  N NH2 . ARG B 1 120 ? -22.278 9.487   -13.221 1.00 33.66 ? 119 ARG B NH2 1 
ATOM   3752  N N   . TYR B 1 121 ? -24.579 10.725  -7.813  1.00 24.66 ? 120 TYR B N   1 
ATOM   3753  C CA  . TYR B 1 121 ? -24.752 12.152  -7.554  1.00 24.32 ? 120 TYR B CA  1 
ATOM   3754  C C   . TYR B 1 121 ? -25.232 12.423  -6.120  1.00 23.94 ? 120 TYR B C   1 
ATOM   3755  O O   . TYR B 1 121 ? -24.621 13.223  -5.425  1.00 23.56 ? 120 TYR B O   1 
ATOM   3756  C CB  . TYR B 1 121 ? -25.702 12.811  -8.563  1.00 23.52 ? 120 TYR B CB  1 
ATOM   3757  C CG  . TYR B 1 121 ? -26.159 14.180  -8.099  1.00 22.64 ? 120 TYR B CG  1 
ATOM   3758  C CD1 . TYR B 1 121 ? -25.243 15.217  -7.914  1.00 22.38 ? 120 TYR B CD1 1 
ATOM   3759  C CD2 . TYR B 1 121 ? -27.510 14.428  -7.815  1.00 22.54 ? 120 TYR B CD2 1 
ATOM   3760  C CE1 . TYR B 1 121 ? -25.671 16.487  -7.467  1.00 22.25 ? 120 TYR B CE1 1 
ATOM   3761  C CE2 . TYR B 1 121 ? -27.943 15.674  -7.376  1.00 22.26 ? 120 TYR B CE2 1 
ATOM   3762  C CZ  . TYR B 1 121 ? -27.020 16.697  -7.207  1.00 21.26 ? 120 TYR B CZ  1 
ATOM   3763  O OH  . TYR B 1 121 ? -27.455 17.903  -6.758  1.00 21.97 ? 120 TYR B OH  1 
ATOM   3764  N N   . PHE B 1 122 ? -26.316 11.763  -5.696  1.00 24.62 ? 121 PHE B N   1 
ATOM   3765  C CA  . PHE B 1 122 ? -26.844 11.931  -4.331  1.00 25.16 ? 121 PHE B CA  1 
ATOM   3766  C C   . PHE B 1 122 ? -25.813 11.566  -3.249  1.00 26.33 ? 121 PHE B C   1 
ATOM   3767  O O   . PHE B 1 122 ? -25.574 12.337  -2.309  1.00 25.62 ? 121 PHE B O   1 
ATOM   3768  C CB  . PHE B 1 122 ? -28.093 11.062  -4.092  1.00 24.82 ? 121 PHE B CB  1 
ATOM   3769  C CG  . PHE B 1 122 ? -29.333 11.480  -4.871  1.00 24.05 ? 121 PHE B CG  1 
ATOM   3770  C CD1 . PHE B 1 122 ? -29.619 12.815  -5.144  1.00 23.39 ? 121 PHE B CD1 1 
ATOM   3771  C CD2 . PHE B 1 122 ? -30.248 10.520  -5.273  1.00 23.01 ? 121 PHE B CD2 1 
ATOM   3772  C CE1 . PHE B 1 122 ? -30.781 13.172  -5.831  1.00 23.29 ? 121 PHE B CE1 1 
ATOM   3773  C CE2 . PHE B 1 122 ? -31.403 10.874  -5.971  1.00 23.79 ? 121 PHE B CE2 1 
ATOM   3774  C CZ  . PHE B 1 122 ? -31.669 12.198  -6.238  1.00 23.67 ? 121 PHE B CZ  1 
ATOM   3775  N N   . ARG B 1 123 ? -25.224 10.381  -3.380  1.00 28.03 ? 122 ARG B N   1 
ATOM   3776  C CA  . ARG B 1 123 ? -24.324 9.860   -2.356  1.00 29.61 ? 122 ARG B CA  1 
ATOM   3777  C C   . ARG B 1 123 ? -23.039 10.666  -2.256  1.00 29.13 ? 122 ARG B C   1 
ATOM   3778  O O   . ARG B 1 123 ? -22.622 11.056  -1.170  1.00 29.03 ? 122 ARG B O   1 
ATOM   3779  C CB  . ARG B 1 123 ? -23.945 8.408   -2.650  1.00 29.89 ? 122 ARG B CB  1 
ATOM   3780  C CG  . ARG B 1 123 ? -24.970 7.370   -2.269  1.00 31.88 ? 122 ARG B CG  1 
ATOM   3781  C CD  . ARG B 1 123 ? -24.344 5.987   -2.441  1.00 33.75 ? 122 ARG B CD  1 
ATOM   3782  N NE  . ARG B 1 123 ? -25.298 4.881   -2.290  1.00 37.78 ? 122 ARG B NE  1 
ATOM   3783  C CZ  . ARG B 1 123 ? -25.662 4.338   -1.129  1.00 38.48 ? 122 ARG B CZ  1 
ATOM   3784  N NH1 . ARG B 1 123 ? -26.533 3.339   -1.131  1.00 38.33 ? 122 ARG B NH1 1 
ATOM   3785  N NH2 . ARG B 1 123 ? -25.177 4.781   0.026   1.00 39.22 ? 122 ARG B NH2 1 
ATOM   3786  N N   . GLN B 1 124 ? -22.412 10.895  -3.405  1.00 29.08 ? 123 GLN B N   1 
ATOM   3787  C CA  . GLN B 1 124 ? -21.051 11.431  -3.465  1.00 28.83 ? 123 GLN B CA  1 
ATOM   3788  C C   . GLN B 1 124 ? -20.979 12.963  -3.518  1.00 28.08 ? 123 GLN B C   1 
ATOM   3789  O O   . GLN B 1 124 ? -19.958 13.544  -3.123  1.00 28.41 ? 123 GLN B O   1 
ATOM   3790  C CB  . GLN B 1 124 ? -20.321 10.853  -4.684  1.00 29.77 ? 123 GLN B CB  1 
ATOM   3791  C CG  . GLN B 1 124 ? -20.347 9.327   -4.786  1.00 32.30 ? 123 GLN B CG  1 
ATOM   3792  C CD  . GLN B 1 124 ? -19.532 8.655   -3.691  1.00 36.58 ? 123 GLN B CD  1 
ATOM   3793  O OE1 . GLN B 1 124 ? -18.570 9.229   -3.174  1.00 41.07 ? 123 GLN B OE1 1 
ATOM   3794  N NE2 . GLN B 1 124 ? -19.915 7.435   -3.329  1.00 37.80 ? 123 GLN B NE2 1 
ATOM   3795  N N   . VAL B 1 125 ? -22.031 13.612  -4.019  1.00 26.97 ? 124 VAL B N   1 
ATOM   3796  C CA  . VAL B 1 125 ? -22.011 15.074  -4.229  1.00 26.66 ? 124 VAL B CA  1 
ATOM   3797  C C   . VAL B 1 125 ? -23.076 15.807  -3.386  1.00 26.20 ? 124 VAL B C   1 
ATOM   3798  O O   . VAL B 1 125 ? -22.736 16.578  -2.495  1.00 25.34 ? 124 VAL B O   1 
ATOM   3799  C CB  . VAL B 1 125 ? -22.131 15.428  -5.765  1.00 26.44 ? 124 VAL B CB  1 
ATOM   3800  C CG1 . VAL B 1 125 ? -21.932 16.927  -6.015  1.00 25.46 ? 124 VAL B CG1 1 
ATOM   3801  C CG2 . VAL B 1 125 ? -21.108 14.622  -6.575  1.00 26.40 ? 124 VAL B CG2 1 
ATOM   3802  N N   . ALA B 1 126 ? -24.359 15.560  -3.658  1.00 26.28 ? 125 ALA B N   1 
ATOM   3803  C CA  . ALA B 1 126 ? -25.449 16.248  -2.936  1.00 26.38 ? 125 ALA B CA  1 
ATOM   3804  C C   . ALA B 1 126 ? -25.309 16.161  -1.417  1.00 26.64 ? 125 ALA B C   1 
ATOM   3805  O O   . ALA B 1 126 ? -25.575 17.125  -0.717  1.00 25.96 ? 125 ALA B O   1 
ATOM   3806  C CB  . ALA B 1 126 ? -26.816 15.711  -3.353  1.00 25.69 ? 125 ALA B CB  1 
ATOM   3807  N N   . SER B 1 127 ? -24.895 14.994  -0.929  1.00 27.37 ? 126 SER B N   1 
ATOM   3808  C CA  . SER B 1 127 ? -24.739 14.750  0.510   1.00 28.06 ? 126 SER B CA  1 
ATOM   3809  C C   . SER B 1 127 ? -23.736 15.697  1.183   1.00 28.57 ? 126 SER B C   1 
ATOM   3810  O O   . SER B 1 127 ? -23.816 15.928  2.389   1.00 28.74 ? 126 SER B O   1 
ATOM   3811  C CB  . SER B 1 127 ? -24.305 13.311  0.737   1.00 27.70 ? 126 SER B CB  1 
ATOM   3812  O OG  . SER B 1 127 ? -23.056 13.075  0.112   1.00 27.12 ? 126 SER B OG  1 
ATOM   3813  N N   . GLU B 1 128 ? -22.803 16.246  0.397   1.00 28.65 ? 127 GLU B N   1 
ATOM   3814  C CA  . GLU B 1 128 ? -21.762 17.162  0.904   1.00 28.60 ? 127 GLU B CA  1 
ATOM   3815  C C   . GLU B 1 128 ? -22.213 18.611  1.030   1.00 28.36 ? 127 GLU B C   1 
ATOM   3816  O O   . GLU B 1 128 ? -21.458 19.448  1.519   1.00 28.21 ? 127 GLU B O   1 
ATOM   3817  C CB  . GLU B 1 128 ? -20.539 17.121  -0.020  1.00 28.69 ? 127 GLU B CB  1 
ATOM   3818  C CG  . GLU B 1 128 ? -19.880 15.775  -0.066  1.00 29.27 ? 127 GLU B CG  1 
ATOM   3819  C CD  . GLU B 1 128 ? -19.160 15.454  1.234   1.00 30.75 ? 127 GLU B CD  1 
ATOM   3820  O OE1 . GLU B 1 128 ? -19.224 14.300  1.666   1.00 32.81 ? 127 GLU B OE1 1 
ATOM   3821  O OE2 . GLU B 1 128 ? -18.555 16.355  1.837   1.00 33.03 ? 127 GLU B OE2 1 
ATOM   3822  N N   . PHE B 1 129 ? -23.440 18.898  0.599   1.00 28.35 ? 128 PHE B N   1 
ATOM   3823  C CA  . PHE B 1 129 ? -23.938 20.265  0.556   1.00 28.45 ? 128 PHE B CA  1 
ATOM   3824  C C   . PHE B 1 129 ? -25.175 20.455  1.431   1.00 28.80 ? 128 PHE B C   1 
ATOM   3825  O O   . PHE B 1 129 ? -26.102 21.200  1.094   1.00 28.93 ? 128 PHE B O   1 
ATOM   3826  C CB  . PHE B 1 129 ? -24.146 20.663  -0.909  1.00 28.55 ? 128 PHE B CB  1 
ATOM   3827  C CG  . PHE B 1 129 ? -22.848 20.883  -1.636  1.00 27.58 ? 128 PHE B CG  1 
ATOM   3828  C CD1 . PHE B 1 129 ? -22.334 19.910  -2.495  1.00 27.16 ? 128 PHE B CD1 1 
ATOM   3829  C CD2 . PHE B 1 129 ? -22.103 22.035  -1.400  1.00 27.19 ? 128 PHE B CD2 1 
ATOM   3830  C CE1 . PHE B 1 129 ? -21.124 20.104  -3.137  1.00 27.93 ? 128 PHE B CE1 1 
ATOM   3831  C CE2 . PHE B 1 129 ? -20.883 22.235  -2.037  1.00 27.62 ? 128 PHE B CE2 1 
ATOM   3832  C CZ  . PHE B 1 129 ? -20.392 21.270  -2.900  1.00 26.99 ? 128 PHE B CZ  1 
ATOM   3833  N N   . GLY B 1 130 ? -25.154 19.782  2.579   1.00 29.00 ? 129 GLY B N   1 
ATOM   3834  C CA  . GLY B 1 130 ? -26.199 19.921  3.595   1.00 29.65 ? 129 GLY B CA  1 
ATOM   3835  C C   . GLY B 1 130 ? -27.443 19.059  3.405   1.00 29.51 ? 129 GLY B C   1 
ATOM   3836  O O   . GLY B 1 130 ? -28.417 19.216  4.147   1.00 29.33 ? 129 GLY B O   1 
ATOM   3837  N N   . LEU B 1 131 ? -27.421 18.166  2.418   1.00 29.88 ? 130 LEU B N   1 
ATOM   3838  C CA  . LEU B 1 131 ? -28.600 17.379  2.076   1.00 30.45 ? 130 LEU B CA  1 
ATOM   3839  C C   . LEU B 1 131 ? -28.445 15.979  2.640   1.00 30.78 ? 130 LEU B C   1 
ATOM   3840  O O   . LEU B 1 131 ? -27.413 15.337  2.461   1.00 31.16 ? 130 LEU B O   1 
ATOM   3841  C CB  . LEU B 1 131 ? -28.829 17.355  0.554   1.00 30.54 ? 130 LEU B CB  1 
ATOM   3842  C CG  . LEU B 1 131 ? -29.342 18.684  -0.043  1.00 30.42 ? 130 LEU B CG  1 
ATOM   3843  C CD1 . LEU B 1 131 ? -29.084 18.791  -1.541  1.00 31.28 ? 130 LEU B CD1 1 
ATOM   3844  C CD2 . LEU B 1 131 ? -30.822 18.899  0.239   1.00 30.31 ? 130 LEU B CD2 1 
ATOM   3845  N N   . LYS B 1 132 ? -29.467 15.528  3.358   1.00 31.42 ? 131 LYS B N   1 
ATOM   3846  C CA  . LYS B 1 132 ? -29.483 14.194  3.923   1.00 31.88 ? 131 LYS B CA  1 
ATOM   3847  C C   . LYS B 1 132 ? -30.099 13.253  2.906   1.00 31.54 ? 131 LYS B C   1 
ATOM   3848  O O   . LYS B 1 132 ? -31.252 13.420  2.536   1.00 30.93 ? 131 LYS B O   1 
ATOM   3849  C CB  . LYS B 1 132 ? -30.300 14.179  5.215   1.00 32.28 ? 131 LYS B CB  1 
ATOM   3850  C CG  . LYS B 1 132 ? -30.258 12.851  5.961   1.00 33.04 ? 131 LYS B CG  1 
ATOM   3851  C CD  . LYS B 1 132 ? -31.322 12.813  7.073   1.00 34.01 ? 131 LYS B CD  1 
ATOM   3852  C CE  . LYS B 1 132 ? -31.013 11.756  8.119   1.00 35.81 ? 131 LYS B CE  1 
ATOM   3853  N NZ  . LYS B 1 132 ? -30.099 10.697  7.599   1.00 38.29 ? 131 LYS B NZ  1 
ATOM   3854  N N   . ILE B 1 133 ? -29.328 12.278  2.436   1.00 31.71 ? 132 ILE B N   1 
ATOM   3855  C CA  . ILE B 1 133 ? -29.852 11.297  1.492   1.00 32.35 ? 132 ILE B CA  1 
ATOM   3856  C C   . ILE B 1 133 ? -30.101 9.986   2.213   1.00 32.28 ? 132 ILE B C   1 
ATOM   3857  O O   . ILE B 1 133 ? -29.218 9.469   2.903   1.00 32.53 ? 132 ILE B O   1 
ATOM   3858  C CB  . ILE B 1 133 ? -28.893 11.031  0.298   1.00 33.00 ? 132 ILE B CB  1 
ATOM   3859  C CG1 . ILE B 1 133 ? -28.318 12.351  -0.256  1.00 33.30 ? 132 ILE B CG1 1 
ATOM   3860  C CG2 . ILE B 1 133 ? -29.618 10.216  -0.784  1.00 33.35 ? 132 ILE B CG2 1 
ATOM   3861  C CD1 . ILE B 1 133 ? -29.348 13.431  -0.493  1.00 33.63 ? 132 ILE B CD1 1 
ATOM   3862  N N   . SER B 1 134 ? -31.306 9.462   2.058   1.00 32.09 ? 133 SER B N   1 
ATOM   3863  C CA  . SER B 1 134 ? -31.677 8.199   2.660   1.00 32.22 ? 133 SER B CA  1 
ATOM   3864  C C   . SER B 1 134 ? -32.185 7.274   1.574   1.00 32.25 ? 133 SER B C   1 
ATOM   3865  O O   . SER B 1 134 ? -33.174 7.587   0.903   1.00 32.51 ? 133 SER B O   1 
ATOM   3866  C CB  . SER B 1 134 ? -32.773 8.421   3.702   1.00 32.00 ? 133 SER B CB  1 
ATOM   3867  O OG  . SER B 1 134 ? -32.349 9.352   4.687   1.00 31.80 ? 133 SER B OG  1 
ATOM   3868  N N   . PHE B 1 135 ? -31.517 6.141   1.396   1.00 32.44 ? 134 PHE B N   1 
ATOM   3869  C CA  . PHE B 1 135 ? -31.963 5.148   0.418   1.00 32.35 ? 134 PHE B CA  1 
ATOM   3870  C C   . PHE B 1 135 ? -32.941 4.194   1.075   1.00 32.50 ? 134 PHE B C   1 
ATOM   3871  O O   . PHE B 1 135 ? -32.727 3.785   2.208   1.00 32.51 ? 134 PHE B O   1 
ATOM   3872  C CB  . PHE B 1 135 ? -30.770 4.422   -0.197  1.00 32.23 ? 134 PHE B CB  1 
ATOM   3873  C CG  . PHE B 1 135 ? -29.980 5.281   -1.127  1.00 32.54 ? 134 PHE B CG  1 
ATOM   3874  C CD1 . PHE B 1 135 ? -30.264 5.296   -2.483  1.00 31.25 ? 134 PHE B CD1 1 
ATOM   3875  C CD2 . PHE B 1 135 ? -28.982 6.115   -0.646  1.00 31.94 ? 134 PHE B CD2 1 
ATOM   3876  C CE1 . PHE B 1 135 ? -29.568 6.111   -3.330  1.00 31.88 ? 134 PHE B CE1 1 
ATOM   3877  C CE2 . PHE B 1 135 ? -28.264 6.936   -1.514  1.00 32.57 ? 134 PHE B CE2 1 
ATOM   3878  C CZ  . PHE B 1 135 ? -28.562 6.933   -2.846  1.00 31.79 ? 134 PHE B CZ  1 
ATOM   3879  N N   . VAL B 1 136 ? -34.027 3.875   0.377   1.00 32.98 ? 135 VAL B N   1 
ATOM   3880  C CA  . VAL B 1 136 ? -35.129 3.086   0.936   1.00 33.62 ? 135 VAL B CA  1 
ATOM   3881  C C   . VAL B 1 136 ? -35.726 2.197   -0.139  1.00 34.44 ? 135 VAL B C   1 
ATOM   3882  O O   . VAL B 1 136 ? -35.733 2.576   -1.307  1.00 34.82 ? 135 VAL B O   1 
ATOM   3883  C CB  . VAL B 1 136 ? -36.278 3.985   1.500   1.00 33.66 ? 135 VAL B CB  1 
ATOM   3884  C CG1 . VAL B 1 136 ? -37.356 3.137   2.179   1.00 32.62 ? 135 VAL B CG1 1 
ATOM   3885  C CG2 . VAL B 1 136 ? -35.735 5.049   2.465   1.00 33.27 ? 135 VAL B CG2 1 
ATOM   3886  N N   . ASP B 1 137 ? -36.230 1.028   0.251   1.00 35.30 ? 136 ASP B N   1 
ATOM   3887  C CA  . ASP B 1 137 ? -36.902 0.135   -0.683  1.00 36.08 ? 136 ASP B CA  1 
ATOM   3888  C C   . ASP B 1 137 ? -38.337 0.585   -0.858  1.00 36.18 ? 136 ASP B C   1 
ATOM   3889  O O   . ASP B 1 137 ? -39.178 0.342   0.009   1.00 36.56 ? 136 ASP B O   1 
ATOM   3890  C CB  . ASP B 1 137 ? -36.885 -1.312  -0.188  1.00 36.77 ? 136 ASP B CB  1 
ATOM   3891  C CG  . ASP B 1 137 ? -37.665 -2.253  -1.108  1.00 38.23 ? 136 ASP B CG  1 
ATOM   3892  O OD1 . ASP B 1 137 ? -37.243 -3.413  -1.296  1.00 41.09 ? 136 ASP B OD1 1 
ATOM   3893  O OD2 . ASP B 1 137 ? -38.699 -1.832  -1.661  1.00 40.59 ? 136 ASP B OD2 1 
ATOM   3894  N N   . CYS B 1 138 ? -38.621 1.215   -1.995  1.00 36.11 ? 137 CYS B N   1 
ATOM   3895  C CA  . CYS B 1 138 ? -39.957 1.742   -2.280  1.00 35.90 ? 137 CYS B CA  1 
ATOM   3896  C C   . CYS B 1 138 ? -40.865 0.747   -3.006  1.00 36.60 ? 137 CYS B C   1 
ATOM   3897  O O   . CYS B 1 138 ? -41.976 1.101   -3.385  1.00 36.63 ? 137 CYS B O   1 
ATOM   3898  C CB  . CYS B 1 138 ? -39.852 3.047   -3.059  1.00 35.70 ? 137 CYS B CB  1 
ATOM   3899  S SG  . CYS B 1 138 ? -38.777 4.264   -2.266  1.00 33.39 ? 137 CYS B SG  1 
ATOM   3900  N N   . SER B 1 139 ? -40.411 -0.495  -3.186  1.00 37.43 ? 138 SER B N   1 
ATOM   3901  C CA  . SER B 1 139 ? -41.310 -1.570  -3.626  1.00 38.48 ? 138 SER B CA  1 
ATOM   3902  C C   . SER B 1 139 ? -42.221 -2.028  -2.468  1.00 39.43 ? 138 SER B C   1 
ATOM   3903  O O   . SER B 1 139 ? -43.228 -2.716  -2.685  1.00 39.55 ? 138 SER B O   1 
ATOM   3904  C CB  . SER B 1 139 ? -40.518 -2.762  -4.174  1.00 38.45 ? 138 SER B CB  1 
ATOM   3905  O OG  . SER B 1 139 ? -39.542 -3.207  -3.249  1.00 38.62 ? 138 SER B OG  1 
ATOM   3906  N N   . LYS B 1 140 ? -41.843 -1.655  -1.242  1.00 40.52 ? 139 LYS B N   1 
ATOM   3907  C CA  . LYS B 1 140 ? -42.653 -1.870  -0.052  1.00 41.21 ? 139 LYS B CA  1 
ATOM   3908  C C   . LYS B 1 140 ? -43.128 -0.528  0.510   1.00 41.40 ? 139 LYS B C   1 
ATOM   3909  O O   . LYS B 1 140 ? -42.368 0.213   1.139   1.00 41.23 ? 139 LYS B O   1 
ATOM   3910  C CB  . LYS B 1 140 ? -41.831 -2.628  0.981   1.00 41.94 ? 139 LYS B CB  1 
ATOM   3911  C CG  . LYS B 1 140 ? -41.461 -4.034  0.504   1.00 42.61 ? 139 LYS B CG  1 
ATOM   3912  C CD  . LYS B 1 140 ? -40.165 -4.519  1.112   1.00 43.93 ? 139 LYS B CD  1 
ATOM   3913  C CE  . LYS B 1 140 ? -39.868 -5.942  0.671   1.00 44.70 ? 139 LYS B CE  1 
ATOM   3914  N NZ  . LYS B 1 140 ? -38.817 -6.553  1.528   1.00 46.75 ? 139 LYS B NZ  1 
ATOM   3915  N N   . ILE B 1 141 ? -44.406 -0.242  0.302   1.00 41.65 ? 140 ILE B N   1 
ATOM   3916  C CA  . ILE B 1 141 ? -44.965 1.085   0.566   1.00 41.93 ? 140 ILE B CA  1 
ATOM   3917  C C   . ILE B 1 141 ? -44.836 1.514   2.051   1.00 41.53 ? 140 ILE B C   1 
ATOM   3918  O O   . ILE B 1 141 ? -44.674 2.701   2.353   1.00 40.86 ? 140 ILE B O   1 
ATOM   3919  C CB  . ILE B 1 141 ? -46.448 1.173   0.088   1.00 42.34 ? 140 ILE B CB  1 
ATOM   3920  C CG1 . ILE B 1 141 ? -46.633 0.564   -1.326  1.00 43.34 ? 140 ILE B CG1 1 
ATOM   3921  C CG2 . ILE B 1 141 ? -46.906 2.633   0.080   1.00 43.04 ? 140 ILE B CG2 1 
ATOM   3922  C CD1 . ILE B 1 141 ? -46.770 -1.006  -1.393  1.00 42.28 ? 140 ILE B CD1 1 
ATOM   3923  N N   . LYS B 1 142 ? -44.873 0.546   2.968   1.00 41.47 ? 141 LYS B N   1 
ATOM   3924  C CA  . LYS B 1 142 ? -44.738 0.832   4.405   1.00 41.46 ? 141 LYS B CA  1 
ATOM   3925  C C   . LYS B 1 142 ? -43.309 1.207   4.802   1.00 40.71 ? 141 LYS B C   1 
ATOM   3926  O O   . LYS B 1 142 ? -43.109 1.923   5.784   1.00 40.62 ? 141 LYS B O   1 
ATOM   3927  C CB  . LYS B 1 142 ? -45.239 -0.343  5.252   1.00 41.98 ? 141 LYS B CB  1 
ATOM   3928  C CG  . LYS B 1 142 ? -46.661 -0.792  4.872   1.00 43.67 ? 141 LYS B CG  1 
ATOM   3929  C CD  . LYS B 1 142 ? -47.496 -1.235  6.071   1.00 45.32 ? 141 LYS B CD  1 
ATOM   3930  C CE  . LYS B 1 142 ? -47.094 -2.600  6.597   1.00 46.03 ? 141 LYS B CE  1 
ATOM   3931  N NZ  . LYS B 1 142 ? -48.056 -3.106  7.650   1.00 46.39 ? 141 LYS B NZ  1 
ATOM   3932  N N   . LEU B 1 143 ? -42.323 0.729   4.043   1.00 39.87 ? 142 LEU B N   1 
ATOM   3933  C CA  . LEU B 1 143 ? -40.932 1.167   4.221   1.00 39.32 ? 142 LEU B CA  1 
ATOM   3934  C C   . LEU B 1 143 ? -40.811 2.645   3.882   1.00 38.56 ? 142 LEU B C   1 
ATOM   3935  O O   . LEU B 1 143 ? -40.234 3.438   4.649   1.00 38.55 ? 142 LEU B O   1 
ATOM   3936  C CB  . LEU B 1 143 ? -39.975 0.357   3.333   1.00 39.61 ? 142 LEU B CB  1 
ATOM   3937  C CG  . LEU B 1 143 ? -39.325 -0.889  3.949   1.00 40.08 ? 142 LEU B CG  1 
ATOM   3938  C CD1 . LEU B 1 143 ? -39.129 -1.984  2.917   1.00 39.74 ? 142 LEU B CD1 1 
ATOM   3939  C CD2 . LEU B 1 143 ? -38.001 -0.518  4.589   1.00 41.11 ? 142 LEU B CD2 1 
ATOM   3940  N N   . LEU B 1 144 ? -41.355 3.015   2.726   1.00 37.73 ? 143 LEU B N   1 
ATOM   3941  C CA  . LEU B 1 144 ? -41.346 4.412   2.303   1.00 37.25 ? 143 LEU B CA  1 
ATOM   3942  C C   . LEU B 1 144 ? -42.004 5.289   3.377   1.00 36.89 ? 143 LEU B C   1 
ATOM   3943  O O   . LEU B 1 144 ? -41.416 6.280   3.813   1.00 36.32 ? 143 LEU B O   1 
ATOM   3944  C CB  . LEU B 1 144 ? -42.057 4.592   0.950   1.00 37.06 ? 143 LEU B CB  1 
ATOM   3945  C CG  . LEU B 1 144 ? -42.120 6.038   0.444   1.00 37.11 ? 143 LEU B CG  1 
ATOM   3946  C CD1 . LEU B 1 144 ? -40.739 6.719   0.510   1.00 34.83 ? 143 LEU B CD1 1 
ATOM   3947  C CD2 . LEU B 1 144 ? -42.713 6.086   -0.960  1.00 37.05 ? 143 LEU B CD2 1 
ATOM   3948  N N   . GLU B 1 145 ? -43.212 4.900   3.792   1.00 36.91 ? 144 GLU B N   1 
ATOM   3949  C CA  . GLU B 1 145 ? -43.961 5.572   4.875   1.00 37.31 ? 144 GLU B CA  1 
ATOM   3950  C C   . GLU B 1 145 ? -43.082 5.903   6.080   1.00 36.70 ? 144 GLU B C   1 
ATOM   3951  O O   . GLU B 1 145 ? -42.966 7.062   6.497   1.00 36.21 ? 144 GLU B O   1 
ATOM   3952  C CB  . GLU B 1 145 ? -45.087 4.661   5.377   1.00 37.80 ? 144 GLU B CB  1 
ATOM   3953  C CG  . GLU B 1 145 ? -46.454 4.890   4.770   1.00 39.72 ? 144 GLU B CG  1 
ATOM   3954  C CD  . GLU B 1 145 ? -47.257 5.930   5.532   1.00 42.05 ? 144 GLU B CD  1 
ATOM   3955  O OE1 . GLU B 1 145 ? -46.642 6.908   5.999   1.00 44.03 ? 144 GLU B OE1 1 
ATOM   3956  O OE2 . GLU B 1 145 ? -48.489 5.770   5.659   1.00 42.59 ? 144 GLU B OE2 1 
ATOM   3957  N N   . ALA B 1 146 ? -42.470 4.852   6.621   1.00 36.05 ? 145 ALA B N   1 
ATOM   3958  C CA  . ALA B 1 146 ? -41.732 4.923   7.874   1.00 35.50 ? 145 ALA B CA  1 
ATOM   3959  C C   . ALA B 1 146 ? -40.384 5.643   7.755   1.00 34.93 ? 145 ALA B C   1 
ATOM   3960  O O   . ALA B 1 146 ? -39.779 5.988   8.780   1.00 34.81 ? 145 ALA B O   1 
ATOM   3961  C CB  . ALA B 1 146 ? -41.541 3.508   8.434   1.00 35.19 ? 145 ALA B CB  1 
ATOM   3962  N N   . ALA B 1 147 ? -39.906 5.862   6.526   1.00 34.35 ? 146 ALA B N   1 
ATOM   3963  C CA  . ALA B 1 147 ? -38.676 6.644   6.313   1.00 33.59 ? 146 ALA B CA  1 
ATOM   3964  C C   . ALA B 1 147 ? -38.924 8.173   6.275   1.00 33.27 ? 146 ALA B C   1 
ATOM   3965  O O   . ALA B 1 147 ? -37.988 8.961   6.412   1.00 32.71 ? 146 ALA B O   1 
ATOM   3966  C CB  . ALA B 1 147 ? -37.955 6.174   5.040   1.00 33.61 ? 146 ALA B CB  1 
ATOM   3967  N N   . ILE B 1 148 ? -40.181 8.590   6.117   1.00 33.03 ? 147 ILE B N   1 
ATOM   3968  C CA  . ILE B 1 148 ? -40.503 10.012  6.002   1.00 32.80 ? 147 ILE B CA  1 
ATOM   3969  C C   . ILE B 1 148 ? -40.274 10.691  7.356   1.00 32.82 ? 147 ILE B C   1 
ATOM   3970  O O   . ILE B 1 148 ? -40.577 10.123  8.417   1.00 32.25 ? 147 ILE B O   1 
ATOM   3971  C CB  . ILE B 1 148 ? -41.955 10.250  5.493   1.00 32.81 ? 147 ILE B CB  1 
ATOM   3972  C CG1 . ILE B 1 148 ? -42.167 9.584   4.128   1.00 33.30 ? 147 ILE B CG1 1 
ATOM   3973  C CG2 . ILE B 1 148 ? -42.256 11.753  5.388   1.00 32.94 ? 147 ILE B CG2 1 
ATOM   3974  C CD1 . ILE B 1 148 ? -43.600 9.676   3.585   1.00 33.09 ? 147 ILE B CD1 1 
ATOM   3975  N N   . THR B 1 149 ? -39.691 11.889  7.293   1.00 32.50 ? 148 THR B N   1 
ATOM   3976  C CA  . THR B 1 149 ? -39.363 12.704  8.455   1.00 32.30 ? 148 THR B CA  1 
ATOM   3977  C C   . THR B 1 149 ? -39.857 14.120  8.194   1.00 31.72 ? 148 THR B C   1 
ATOM   3978  O O   . THR B 1 149 ? -40.224 14.441  7.075   1.00 31.74 ? 148 THR B O   1 
ATOM   3979  C CB  . THR B 1 149 ? -37.843 12.739  8.677   1.00 32.31 ? 148 THR B CB  1 
ATOM   3980  O OG1 . THR B 1 149 ? -37.254 13.704  7.798   1.00 32.38 ? 148 THR B OG1 1 
ATOM   3981  C CG2 . THR B 1 149 ? -37.240 11.365  8.422   1.00 33.12 ? 148 THR B CG2 1 
ATOM   3982  N N   . PRO B 1 150 ? -39.891 14.975  9.226   1.00 31.56 ? 149 PRO B N   1 
ATOM   3983  C CA  . PRO B 1 150 ? -40.238 16.370  8.937   1.00 31.20 ? 149 PRO B CA  1 
ATOM   3984  C C   . PRO B 1 150 ? -39.280 17.072  7.962   1.00 30.39 ? 149 PRO B C   1 
ATOM   3985  O O   . PRO B 1 150 ? -39.655 18.070  7.362   1.00 30.61 ? 149 PRO B O   1 
ATOM   3986  C CB  . PRO B 1 150 ? -40.221 17.047  10.316  1.00 31.15 ? 149 PRO B CB  1 
ATOM   3987  C CG  . PRO B 1 150 ? -39.520 16.097  11.235  1.00 31.97 ? 149 PRO B CG  1 
ATOM   3988  C CD  . PRO B 1 150 ? -39.669 14.734  10.668  1.00 32.05 ? 149 PRO B CD  1 
ATOM   3989  N N   . GLU B 1 151 ? -38.073 16.546  7.799   1.00 29.99 ? 150 GLU B N   1 
ATOM   3990  C CA  . GLU B 1 151 ? -37.078 17.119  6.890   1.00 29.71 ? 150 GLU B CA  1 
ATOM   3991  C C   . GLU B 1 151 ? -37.194 16.595  5.444   1.00 28.88 ? 150 GLU B C   1 
ATOM   3992  O O   . GLU B 1 151 ? -36.508 17.089  4.553   1.00 28.85 ? 150 GLU B O   1 
ATOM   3993  C CB  . GLU B 1 151 ? -35.667 16.852  7.420   1.00 30.50 ? 150 GLU B CB  1 
ATOM   3994  C CG  . GLU B 1 151 ? -35.375 17.475  8.793   1.00 33.27 ? 150 GLU B CG  1 
ATOM   3995  C CD  . GLU B 1 151 ? -36.117 16.795  9.956   1.00 35.64 ? 150 GLU B CD  1 
ATOM   3996  O OE1 . GLU B 1 151 ? -36.441 17.499  10.933  1.00 38.18 ? 150 GLU B OE1 1 
ATOM   3997  O OE2 . GLU B 1 151 ? -36.387 15.572  9.887   1.00 37.28 ? 150 GLU B OE2 1 
ATOM   3998  N N   . THR B 1 152 ? -38.058 15.606  5.210   1.00 28.01 ? 151 THR B N   1 
ATOM   3999  C CA  . THR B 1 152 ? -38.223 15.019  3.870   1.00 27.54 ? 151 THR B CA  1 
ATOM   4000  C C   . THR B 1 152 ? -38.866 16.030  2.913   1.00 26.91 ? 151 THR B C   1 
ATOM   4001  O O   . THR B 1 152 ? -40.001 16.461  3.149   1.00 26.53 ? 151 THR B O   1 
ATOM   4002  C CB  . THR B 1 152 ? -39.091 13.724  3.875   1.00 27.50 ? 151 THR B CB  1 
ATOM   4003  O OG1 . THR B 1 152 ? -38.541 12.748  4.772   1.00 26.00 ? 151 THR B OG1 1 
ATOM   4004  C CG2 . THR B 1 152 ? -39.158 13.133  2.446   1.00 27.55 ? 151 THR B CG2 1 
ATOM   4005  N N   . LYS B 1 153 ? -38.148 16.409  1.849   1.00 25.92 ? 152 LYS B N   1 
ATOM   4006  C CA  . LYS B 1 153 ? -38.699 17.322  0.816   1.00 25.84 ? 152 LYS B CA  1 
ATOM   4007  C C   . LYS B 1 153 ? -38.802 16.718  -0.598  1.00 24.63 ? 152 LYS B C   1 
ATOM   4008  O O   . LYS B 1 153 ? -39.478 17.276  -1.474  1.00 23.98 ? 152 LYS B O   1 
ATOM   4009  C CB  . LYS B 1 153 ? -37.867 18.611  0.740   1.00 26.78 ? 152 LYS B CB  1 
ATOM   4010  C CG  . LYS B 1 153 ? -37.901 19.496  1.996   1.00 27.08 ? 152 LYS B CG  1 
ATOM   4011  C CD  . LYS B 1 153 ? -39.326 19.759  2.468   1.00 29.10 ? 152 LYS B CD  1 
ATOM   4012  C CE  . LYS B 1 153 ? -39.419 20.962  3.386   1.00 30.27 ? 152 LYS B CE  1 
ATOM   4013  N NZ  . LYS B 1 153 ? -38.139 21.190  4.136   1.00 34.01 ? 152 LYS B NZ  1 
ATOM   4014  N N   . LEU B 1 154 ? -38.129 15.587  -0.819  1.00 23.49 ? 153 LEU B N   1 
ATOM   4015  C CA  . LEU B 1 154 ? -38.079 14.954  -2.135  1.00 22.98 ? 153 LEU B CA  1 
ATOM   4016  C C   . LEU B 1 154 ? -37.989 13.444  -1.990  1.00 22.21 ? 153 LEU B C   1 
ATOM   4017  O O   . LEU B 1 154 ? -37.154 12.938  -1.234  1.00 22.56 ? 153 LEU B O   1 
ATOM   4018  C CB  . LEU B 1 154 ? -36.854 15.447  -2.936  1.00 22.35 ? 153 LEU B CB  1 
ATOM   4019  C CG  . LEU B 1 154 ? -36.632 14.777  -4.318  1.00 22.89 ? 153 LEU B CG  1 
ATOM   4020  C CD1 . LEU B 1 154 ? -37.500 15.428  -5.369  1.00 21.00 ? 153 LEU B CD1 1 
ATOM   4021  C CD2 . LEU B 1 154 ? -35.160 14.809  -4.742  1.00 23.31 ? 153 LEU B CD2 1 
ATOM   4022  N N   . VAL B 1 155 ? -38.844 12.753  -2.726  1.00 21.35 ? 154 VAL B N   1 
ATOM   4023  C CA  . VAL B 1 155 ? -38.780 11.312  -2.880  1.00 21.06 ? 154 VAL B CA  1 
ATOM   4024  C C   . VAL B 1 155 ? -38.565 11.005  -4.363  1.00 20.70 ? 154 VAL B C   1 
ATOM   4025  O O   . VAL B 1 155 ? -39.328 11.466  -5.214  1.00 19.44 ? 154 VAL B O   1 
ATOM   4026  C CB  . VAL B 1 155 ? -40.066 10.634  -2.413  1.00 20.85 ? 154 VAL B CB  1 
ATOM   4027  C CG1 . VAL B 1 155 ? -40.024 9.127   -2.716  1.00 18.69 ? 154 VAL B CG1 1 
ATOM   4028  C CG2 . VAL B 1 155 ? -40.277 10.922  -0.911  1.00 21.04 ? 154 VAL B CG2 1 
ATOM   4029  N N   . TRP B 1 156 ? -37.520 10.228  -4.649  1.00 20.33 ? 155 TRP B N   1 
ATOM   4030  C CA  . TRP B 1 156 ? -37.109 9.933   -6.023  1.00 20.20 ? 155 TRP B CA  1 
ATOM   4031  C C   . TRP B 1 156 ? -37.303 8.462   -6.347  1.00 20.09 ? 155 TRP B C   1 
ATOM   4032  O O   . TRP B 1 156 ? -36.594 7.621   -5.795  1.00 20.74 ? 155 TRP B O   1 
ATOM   4033  C CB  . TRP B 1 156 ? -35.637 10.320  -6.229  1.00 19.92 ? 155 TRP B CB  1 
ATOM   4034  C CG  . TRP B 1 156 ? -35.195 10.262  -7.665  1.00 20.07 ? 155 TRP B CG  1 
ATOM   4035  C CD1 . TRP B 1 156 ? -34.972 9.130   -8.436  1.00 20.09 ? 155 TRP B CD1 1 
ATOM   4036  C CD2 . TRP B 1 156 ? -34.898 11.377  -8.502  1.00 19.31 ? 155 TRP B CD2 1 
ATOM   4037  N NE1 . TRP B 1 156 ? -34.563 9.497   -9.700  1.00 20.35 ? 155 TRP B NE1 1 
ATOM   4038  C CE2 . TRP B 1 156 ? -34.509 10.866  -9.767  1.00 19.06 ? 155 TRP B CE2 1 
ATOM   4039  C CE3 . TRP B 1 156 ? -34.912 12.766  -8.307  1.00 19.40 ? 155 TRP B CE3 1 
ATOM   4040  C CZ2 . TRP B 1 156 ? -34.133 11.699  -10.823 1.00 18.70 ? 155 TRP B CZ2 1 
ATOM   4041  C CZ3 . TRP B 1 156 ? -34.553 13.595  -9.361  1.00 19.81 ? 155 TRP B CZ3 1 
ATOM   4042  C CH2 . TRP B 1 156 ? -34.178 13.052  -10.614 1.00 19.82 ? 155 TRP B CH2 1 
ATOM   4043  N N   . ILE B 1 157 ? -38.256 8.156   -7.238  1.00 20.30 ? 156 ILE B N   1 
ATOM   4044  C CA  . ILE B 1 157 ? -38.452 6.786   -7.732  1.00 20.82 ? 156 ILE B CA  1 
ATOM   4045  C C   . ILE B 1 157 ? -38.296 6.656   -9.251  1.00 20.95 ? 156 ILE B C   1 
ATOM   4046  O O   . ILE B 1 157 ? -38.254 7.644   -9.993  1.00 19.06 ? 156 ILE B O   1 
ATOM   4047  C CB  . ILE B 1 157 ? -39.802 6.140   -7.283  1.00 21.20 ? 156 ILE B CB  1 
ATOM   4048  C CG1 . ILE B 1 157 ? -41.016 6.766   -7.984  1.00 22.37 ? 156 ILE B CG1 1 
ATOM   4049  C CG2 . ILE B 1 157 ? -39.972 6.187   -5.746  1.00 21.63 ? 156 ILE B CG2 1 
ATOM   4050  C CD1 . ILE B 1 157 ? -42.264 5.823   -8.002  1.00 21.55 ? 156 ILE B CD1 1 
ATOM   4051  N N   . GLU B 1 158 ? -38.235 5.401   -9.680  1.00 21.42 ? 157 GLU B N   1 
ATOM   4052  C CA  . GLU B 1 158 ? -37.914 5.030   -11.036 1.00 22.27 ? 157 GLU B CA  1 
ATOM   4053  C C   . GLU B 1 158 ? -38.575 3.683   -11.271 1.00 21.76 ? 157 GLU B C   1 
ATOM   4054  O O   . GLU B 1 158 ? -38.430 2.793   -10.458 1.00 22.60 ? 157 GLU B O   1 
ATOM   4055  C CB  . GLU B 1 158 ? -36.384 4.939   -11.164 1.00 22.72 ? 157 GLU B CB  1 
ATOM   4056  C CG  . GLU B 1 158 ? -35.869 4.387   -12.467 1.00 23.07 ? 157 GLU B CG  1 
ATOM   4057  C CD  . GLU B 1 158 ? -34.336 4.474   -12.591 1.00 24.54 ? 157 GLU B CD  1 
ATOM   4058  O OE1 . GLU B 1 158 ? -33.803 3.777   -13.491 1.00 24.76 ? 157 GLU B OE1 1 
ATOM   4059  O OE2 . GLU B 1 158 ? -33.667 5.220   -11.805 1.00 26.41 ? 157 GLU B OE2 1 
ATOM   4060  N N   . THR B 1 159 ? -39.316 3.533   -12.363 1.00 21.80 ? 158 THR B N   1 
ATOM   4061  C CA  . THR B 1 159 ? -40.035 2.284   -12.617 1.00 21.07 ? 158 THR B CA  1 
ATOM   4062  C C   . THR B 1 159 ? -40.370 2.082   -14.088 1.00 21.90 ? 158 THR B C   1 
ATOM   4063  O O   . THR B 1 159 ? -40.786 3.031   -14.787 1.00 21.21 ? 158 THR B O   1 
ATOM   4064  C CB  . THR B 1 159 ? -41.346 2.180   -11.772 1.00 21.23 ? 158 THR B CB  1 
ATOM   4065  O OG1 . THR B 1 159 ? -42.063 0.984   -12.112 1.00 20.60 ? 158 THR B OG1 1 
ATOM   4066  C CG2 . THR B 1 159 ? -42.258 3.414   -11.991 1.00 19.81 ? 158 THR B CG2 1 
ATOM   4067  N N   . PRO B 1 160 ? -40.177 0.844   -14.577 1.00 22.73 ? 159 PRO B N   1 
ATOM   4068  C CA  . PRO B 1 160 ? -39.518 -0.286  -13.910 1.00 23.20 ? 159 PRO B CA  1 
ATOM   4069  C C   . PRO B 1 160 ? -38.074 -0.005  -13.556 1.00 23.66 ? 159 PRO B C   1 
ATOM   4070  O O   . PRO B 1 160 ? -37.469 0.885   -14.137 1.00 24.52 ? 159 PRO B O   1 
ATOM   4071  C CB  . PRO B 1 160 ? -39.585 -1.389  -14.962 1.00 23.06 ? 159 PRO B CB  1 
ATOM   4072  C CG  . PRO B 1 160 ? -40.749 -1.015  -15.806 1.00 22.83 ? 159 PRO B CG  1 
ATOM   4073  C CD  . PRO B 1 160 ? -40.692 0.457   -15.895 1.00 22.71 ? 159 PRO B CD  1 
ATOM   4074  N N   . THR B 1 161 ? -37.523 -0.723  -12.585 1.00 25.14 ? 160 THR B N   1 
ATOM   4075  C CA  . THR B 1 161 ? -36.092 -0.573  -12.280 1.00 26.25 ? 160 THR B CA  1 
ATOM   4076  C C   . THR B 1 161 ? -35.236 -1.303  -13.324 1.00 27.59 ? 160 THR B C   1 
ATOM   4077  O O   . THR B 1 161 ? -35.713 -2.199  -14.009 1.00 27.32 ? 160 THR B O   1 
ATOM   4078  C CB  . THR B 1 161 ? -35.758 -1.068  -10.856 1.00 26.67 ? 160 THR B CB  1 
ATOM   4079  O OG1 . THR B 1 161 ? -35.912 -2.492  -10.784 1.00 25.54 ? 160 THR B OG1 1 
ATOM   4080  C CG2 . THR B 1 161 ? -36.698 -0.415  -9.852  1.00 25.61 ? 160 THR B CG2 1 
ATOM   4081  N N   . ASN B 1 162 ? -33.979 -0.906  -13.471 1.00 29.13 ? 161 ASN B N   1 
ATOM   4082  C CA  . ASN B 1 162 ? -33.047 -1.687  -14.293 1.00 30.65 ? 161 ASN B CA  1 
ATOM   4083  C C   . ASN B 1 162 ? -31.897 -2.221  -13.422 1.00 30.72 ? 161 ASN B C   1 
ATOM   4084  O O   . ASN B 1 162 ? -31.469 -1.556  -12.486 1.00 31.10 ? 161 ASN B O   1 
ATOM   4085  C CB  . ASN B 1 162 ? -32.559 -0.872  -15.507 1.00 31.68 ? 161 ASN B CB  1 
ATOM   4086  C CG  . ASN B 1 162 ? -33.583 -0.870  -16.667 1.00 33.96 ? 161 ASN B CG  1 
ATOM   4087  O OD1 . ASN B 1 162 ? -33.521 -1.707  -17.573 1.00 37.04 ? 161 ASN B OD1 1 
ATOM   4088  N ND2 . ASN B 1 162 ? -34.553 0.040   -16.603 1.00 36.69 ? 161 ASN B ND2 1 
ATOM   4089  N N   . PRO B 1 163 ? -31.427 -3.450  -13.685 1.00 31.07 ? 162 PRO B N   1 
ATOM   4090  C CA  . PRO B 1 163 ? -31.865 -4.417  -14.691 1.00 30.86 ? 162 PRO B CA  1 
ATOM   4091  C C   . PRO B 1 163 ? -33.024 -5.295  -14.290 1.00 30.52 ? 162 PRO B C   1 
ATOM   4092  O O   . PRO B 1 163 ? -33.537 -6.013  -15.142 1.00 30.43 ? 162 PRO B O   1 
ATOM   4093  C CB  . PRO B 1 163 ? -30.630 -5.306  -14.861 1.00 31.14 ? 162 PRO B CB  1 
ATOM   4094  C CG  . PRO B 1 163 ? -30.008 -5.312  -13.501 1.00 31.03 ? 162 PRO B CG  1 
ATOM   4095  C CD  . PRO B 1 163 ? -30.278 -3.961  -12.906 1.00 30.89 ? 162 PRO B CD  1 
ATOM   4096  N N   . THR B 1 164 ? -33.421 -5.273  -13.020 1.00 29.96 ? 163 THR B N   1 
ATOM   4097  C CA  . THR B 1 164 ? -34.381 -6.244  -12.503 1.00 29.88 ? 163 THR B CA  1 
ATOM   4098  C C   . THR B 1 164 ? -35.851 -5.953  -12.805 1.00 29.58 ? 163 THR B C   1 
ATOM   4099  O O   . THR B 1 164 ? -36.707 -6.793  -12.523 1.00 29.39 ? 163 THR B O   1 
ATOM   4100  C CB  . THR B 1 164 ? -34.234 -6.414  -10.982 1.00 29.98 ? 163 THR B CB  1 
ATOM   4101  O OG1 . THR B 1 164 ? -34.368 -5.133  -10.343 1.00 31.24 ? 163 THR B OG1 1 
ATOM   4102  C CG2 . THR B 1 164 ? -32.872 -7.023  -10.655 1.00 29.93 ? 163 THR B CG2 1 
ATOM   4103  N N   . GLN B 1 165 ? -36.167 -4.786  -13.358 1.00 28.97 ? 164 GLN B N   1 
ATOM   4104  C CA  . GLN B 1 165 ? -37.549 -4.504  -13.748 1.00 29.13 ? 164 GLN B CA  1 
ATOM   4105  C C   . GLN B 1 165 ? -38.545 -4.647  -12.588 1.00 28.43 ? 164 GLN B C   1 
ATOM   4106  O O   . GLN B 1 165 ? -39.651 -5.140  -12.779 1.00 27.84 ? 164 GLN B O   1 
ATOM   4107  C CB  . GLN B 1 165 ? -37.989 -5.420  -14.897 1.00 29.16 ? 164 GLN B CB  1 
ATOM   4108  C CG  . GLN B 1 165 ? -36.971 -5.586  -16.016 1.00 31.36 ? 164 GLN B CG  1 
ATOM   4109  C CD  . GLN B 1 165 ? -36.773 -4.336  -16.819 1.00 33.04 ? 164 GLN B CD  1 
ATOM   4110  O OE1 . GLN B 1 165 ? -35.645 -3.858  -16.971 1.00 37.72 ? 164 GLN B OE1 1 
ATOM   4111  N NE2 . GLN B 1 165 ? -37.861 -3.789  -17.342 1.00 32.39 ? 164 GLN B NE2 1 
ATOM   4112  N N   . LYS B 1 166 ? -38.159 -4.247  -11.379 1.00 28.65 ? 165 LYS B N   1 
ATOM   4113  C CA  . LYS B 1 166 ? -39.167 -4.113  -10.311 1.00 29.41 ? 165 LYS B CA  1 
ATOM   4114  C C   . LYS B 1 166 ? -40.105 -2.972  -10.699 1.00 28.12 ? 165 LYS B C   1 
ATOM   4115  O O   . LYS B 1 166 ? -39.650 -1.959  -11.231 1.00 27.79 ? 165 LYS B O   1 
ATOM   4116  C CB  . LYS B 1 166 ? -38.530 -3.826  -8.952  1.00 29.54 ? 165 LYS B CB  1 
ATOM   4117  C CG  . LYS B 1 166 ? -38.418 -5.056  -8.033  1.00 32.31 ? 165 LYS B CG  1 
ATOM   4118  C CD  . LYS B 1 166 ? -37.282 -4.905  -6.985  1.00 32.37 ? 165 LYS B CD  1 
ATOM   4119  C CE  . LYS B 1 166 ? -37.558 -3.810  -5.952  1.00 34.88 ? 165 LYS B CE  1 
ATOM   4120  N NZ  . LYS B 1 166 ? -36.300 -3.363  -5.243  1.00 34.79 ? 165 LYS B NZ  1 
ATOM   4121  N N   . VAL B 1 167 ? -41.396 -3.146  -10.444 1.00 27.55 ? 166 VAL B N   1 
ATOM   4122  C CA  . VAL B 1 167 ? -42.396 -2.128  -10.761 1.00 27.20 ? 166 VAL B CA  1 
ATOM   4123  C C   . VAL B 1 167 ? -42.944 -1.467  -9.486  1.00 27.58 ? 166 VAL B C   1 
ATOM   4124  O O   . VAL B 1 167 ? -43.459 -2.153  -8.616  1.00 27.83 ? 166 VAL B O   1 
ATOM   4125  C CB  . VAL B 1 167 ? -43.558 -2.731  -11.578 1.00 27.33 ? 166 VAL B CB  1 
ATOM   4126  C CG1 . VAL B 1 167 ? -44.649 -1.708  -11.774 1.00 26.83 ? 166 VAL B CG1 1 
ATOM   4127  C CG2 . VAL B 1 167 ? -43.046 -3.226  -12.935 1.00 24.89 ? 166 VAL B CG2 1 
ATOM   4128  N N   . ILE B 1 168 ? -42.827 -0.138  -9.392  1.00 27.13 ? 167 ILE B N   1 
ATOM   4129  C CA  . ILE B 1 168 ? -43.299 0.611   -8.225  1.00 26.74 ? 167 ILE B CA  1 
ATOM   4130  C C   . ILE B 1 168 ? -44.677 1.180   -8.525  1.00 26.51 ? 167 ILE B C   1 
ATOM   4131  O O   . ILE B 1 168 ? -44.908 1.749   -9.604  1.00 25.75 ? 167 ILE B O   1 
ATOM   4132  C CB  . ILE B 1 168 ? -42.334 1.755   -7.843  1.00 27.17 ? 167 ILE B CB  1 
ATOM   4133  C CG1 . ILE B 1 168 ? -41.006 1.208   -7.319  1.00 27.88 ? 167 ILE B CG1 1 
ATOM   4134  C CG2 . ILE B 1 168 ? -42.954 2.667   -6.758  1.00 26.91 ? 167 ILE B CG2 1 
ATOM   4135  C CD1 . ILE B 1 168 ? -40.367 0.239   -8.194  1.00 29.32 ? 167 ILE B CD1 1 
ATOM   4136  N N   . ASP B 1 169 ? -45.597 1.014   -7.574  1.00 25.95 ? 168 ASP B N   1 
ATOM   4137  C CA  . ASP B 1 169 ? -46.923 1.611   -7.657  1.00 26.03 ? 168 ASP B CA  1 
ATOM   4138  C C   . ASP B 1 169 ? -46.825 3.134   -7.453  1.00 25.49 ? 168 ASP B C   1 
ATOM   4139  O O   . ASP B 1 169 ? -46.700 3.622   -6.319  1.00 25.82 ? 168 ASP B O   1 
ATOM   4140  C CB  . ASP B 1 169 ? -47.832 0.986   -6.599  1.00 26.27 ? 168 ASP B CB  1 
ATOM   4141  C CG  . ASP B 1 169 ? -49.245 1.512   -6.654  1.00 27.74 ? 168 ASP B CG  1 
ATOM   4142  O OD1 . ASP B 1 169 ? -49.493 2.582   -7.268  1.00 29.72 ? 168 ASP B OD1 1 
ATOM   4143  O OD2 . ASP B 1 169 ? -50.122 0.830   -6.092  1.00 31.22 ? 168 ASP B OD2 1 
ATOM   4144  N N   . ILE B 1 170 ? -46.879 3.876   -8.556  1.00 25.07 ? 169 ILE B N   1 
ATOM   4145  C CA  . ILE B 1 170 ? -46.643 5.325   -8.544  1.00 24.88 ? 169 ILE B CA  1 
ATOM   4146  C C   . ILE B 1 170 ? -47.703 6.070   -7.738  1.00 25.24 ? 169 ILE B C   1 
ATOM   4147  O O   . ILE B 1 170 ? -47.379 6.952   -6.938  1.00 25.03 ? 169 ILE B O   1 
ATOM   4148  C CB  . ILE B 1 170 ? -46.601 5.915   -9.995  1.00 24.85 ? 169 ILE B CB  1 
ATOM   4149  C CG1 . ILE B 1 170 ? -45.393 5.344   -10.773 1.00 24.56 ? 169 ILE B CG1 1 
ATOM   4150  C CG2 . ILE B 1 170 ? -46.552 7.451   -9.959  1.00 23.54 ? 169 ILE B CG2 1 
ATOM   4151  C CD1 . ILE B 1 170 ? -45.382 5.671   -12.245 1.00 24.04 ? 169 ILE B CD1 1 
ATOM   4152  N N   . GLU B 1 171 ? -48.961 5.732   -7.966  1.00 25.65 ? 170 GLU B N   1 
ATOM   4153  C CA  . GLU B 1 171 ? -50.059 6.397   -7.267  1.00 26.85 ? 170 GLU B CA  1 
ATOM   4154  C C   . GLU B 1 171 ? -50.041 6.089   -5.759  1.00 26.53 ? 170 GLU B C   1 
ATOM   4155  O O   . GLU B 1 171 ? -50.236 6.988   -4.914  1.00 25.85 ? 170 GLU B O   1 
ATOM   4156  C CB  . GLU B 1 171 ? -51.391 5.997   -7.899  1.00 26.94 ? 170 GLU B CB  1 
ATOM   4157  C CG  . GLU B 1 171 ? -52.594 6.509   -7.127  1.00 28.80 ? 170 GLU B CG  1 
ATOM   4158  C CD  . GLU B 1 171 ? -53.897 6.243   -7.832  1.00 29.68 ? 170 GLU B CD  1 
ATOM   4159  O OE1 . GLU B 1 171 ? -53.859 5.801   -9.002  1.00 32.59 ? 170 GLU B OE1 1 
ATOM   4160  O OE2 . GLU B 1 171 ? -54.963 6.467   -7.204  1.00 34.79 ? 170 GLU B OE2 1 
ATOM   4161  N N   . GLY B 1 172 ? -49.790 4.825   -5.429  1.00 26.25 ? 171 GLY B N   1 
ATOM   4162  C CA  . GLY B 1 172 ? -49.549 4.418   -4.043  1.00 26.25 ? 171 GLY B CA  1 
ATOM   4163  C C   . GLY B 1 172 ? -48.534 5.313   -3.365  1.00 26.39 ? 171 GLY B C   1 
ATOM   4164  O O   . GLY B 1 172 ? -48.811 5.887   -2.299  1.00 26.44 ? 171 GLY B O   1 
ATOM   4165  N N   . CYS B 1 173 ? -47.360 5.452   -3.975  1.00 25.85 ? 172 CYS B N   1 
ATOM   4166  C CA  . CYS B 1 173 ? -46.323 6.321   -3.421  1.00 26.80 ? 172 CYS B CA  1 
ATOM   4167  C C   . CYS B 1 173 ? -46.781 7.775   -3.309  1.00 26.03 ? 172 CYS B C   1 
ATOM   4168  O O   . CYS B 1 173 ? -46.508 8.435   -2.315  1.00 25.91 ? 172 CYS B O   1 
ATOM   4169  C CB  . CYS B 1 173 ? -45.028 6.265   -4.249  1.00 26.97 ? 172 CYS B CB  1 
ATOM   4170  S SG  . CYS B 1 173 ? -44.163 4.705   -4.105  1.00 31.11 ? 172 CYS B SG  1 
ATOM   4171  N N   . ALA B 1 174 ? -47.460 8.259   -4.342  1.00 26.22 ? 173 ALA B N   1 
ATOM   4172  C CA  . ALA B 1 174 ? -47.925 9.639   -4.401  1.00 26.43 ? 173 ALA B CA  1 
ATOM   4173  C C   . ALA B 1 174 ? -48.870 9.950   -3.225  1.00 26.84 ? 173 ALA B C   1 
ATOM   4174  O O   . ALA B 1 174 ? -48.699 10.943  -2.549  1.00 26.55 ? 173 ALA B O   1 
ATOM   4175  C CB  . ALA B 1 174 ? -48.622 9.917   -5.748  1.00 26.21 ? 173 ALA B CB  1 
ATOM   4176  N N   . HIS B 1 175 ? -49.861 9.103   -2.984  1.00 27.73 ? 174 HIS B N   1 
ATOM   4177  C CA  . HIS B 1 175 ? -50.786 9.346   -1.867  1.00 28.73 ? 174 HIS B CA  1 
ATOM   4178  C C   . HIS B 1 175 ? -50.056 9.378   -0.520  1.00 28.90 ? 174 HIS B C   1 
ATOM   4179  O O   . HIS B 1 175 ? -50.342 10.239  0.316   1.00 29.04 ? 174 HIS B O   1 
ATOM   4180  C CB  . HIS B 1 175 ? -51.894 8.294   -1.826  1.00 28.97 ? 174 HIS B CB  1 
ATOM   4181  C CG  . HIS B 1 175 ? -52.890 8.417   -2.933  1.00 30.01 ? 174 HIS B CG  1 
ATOM   4182  N ND1 . HIS B 1 175 ? -53.703 9.519   -3.083  1.00 31.91 ? 174 HIS B ND1 1 
ATOM   4183  C CD2 . HIS B 1 175 ? -53.223 7.567   -3.934  1.00 32.50 ? 174 HIS B CD2 1 
ATOM   4184  C CE1 . HIS B 1 175 ? -54.487 9.350   -4.132  1.00 32.72 ? 174 HIS B CE1 1 
ATOM   4185  N NE2 . HIS B 1 175 ? -54.211 8.176   -4.672  1.00 33.14 ? 174 HIS B NE2 1 
ATOM   4186  N N   . ILE B 1 176 ? -49.137 8.435   -0.311  1.00 29.40 ? 175 ILE B N   1 
ATOM   4187  C CA  . ILE B 1 176 ? -48.381 8.341   0.945   1.00 29.61 ? 175 ILE B CA  1 
ATOM   4188  C C   . ILE B 1 176 ? -47.549 9.596   1.159   1.00 29.77 ? 175 ILE B C   1 
ATOM   4189  O O   . ILE B 1 176 ? -47.534 10.168  2.247   1.00 30.16 ? 175 ILE B O   1 
ATOM   4190  C CB  . ILE B 1 176 ? -47.404 7.130   0.972   1.00 29.98 ? 175 ILE B CB  1 
ATOM   4191  C CG1 . ILE B 1 176 ? -48.087 5.854   1.468   1.00 31.00 ? 175 ILE B CG1 1 
ATOM   4192  C CG2 . ILE B 1 176 ? -46.231 7.398   1.907   1.00 30.42 ? 175 ILE B CG2 1 
ATOM   4193  C CD1 . ILE B 1 176 ? -48.912 5.137   0.439   1.00 31.67 ? 175 ILE B CD1 1 
ATOM   4194  N N   . VAL B 1 177 ? -46.847 10.007  0.108   1.00 29.06 ? 176 VAL B N   1 
ATOM   4195  C CA  . VAL B 1 177 ? -45.934 11.137  0.177   1.00 28.97 ? 176 VAL B CA  1 
ATOM   4196  C C   . VAL B 1 177 ? -46.682 12.435  0.432   1.00 28.31 ? 176 VAL B C   1 
ATOM   4197  O O   . VAL B 1 177 ? -46.273 13.234  1.257   1.00 28.07 ? 176 VAL B O   1 
ATOM   4198  C CB  . VAL B 1 177 ? -45.092 11.252  -1.141  1.00 29.05 ? 176 VAL B CB  1 
ATOM   4199  C CG1 . VAL B 1 177 ? -44.409 12.602  -1.229  1.00 29.64 ? 176 VAL B CG1 1 
ATOM   4200  C CG2 . VAL B 1 177 ? -44.075 10.115  -1.210  1.00 28.50 ? 176 VAL B CG2 1 
ATOM   4201  N N   . HIS B 1 178 ? -47.782 12.621  -0.291  1.00 28.53 ? 177 HIS B N   1 
ATOM   4202  C CA  . HIS B 1 178 ? -48.510 13.886  -0.318  1.00 28.74 ? 177 HIS B CA  1 
ATOM   4203  C C   . HIS B 1 178 ? -49.335 14.129  0.947   1.00 29.04 ? 177 HIS B C   1 
ATOM   4204  O O   . HIS B 1 178 ? -49.482 15.267  1.399   1.00 28.88 ? 177 HIS B O   1 
ATOM   4205  C CB  . HIS B 1 178 ? -49.389 13.934  -1.571  1.00 28.63 ? 177 HIS B CB  1 
ATOM   4206  C CG  . HIS B 1 178 ? -48.598 14.075  -2.832  1.00 28.39 ? 177 HIS B CG  1 
ATOM   4207  N ND1 . HIS B 1 178 ? -49.014 13.556  -4.037  1.00 28.41 ? 177 HIS B ND1 1 
ATOM   4208  C CD2 . HIS B 1 178 ? -47.401 14.662  -3.064  1.00 27.33 ? 177 HIS B CD2 1 
ATOM   4209  C CE1 . HIS B 1 178 ? -48.113 13.835  -4.960  1.00 28.76 ? 177 HIS B CE1 1 
ATOM   4210  N NE2 . HIS B 1 178 ? -47.121 14.494  -4.395  1.00 28.11 ? 177 HIS B NE2 1 
ATOM   4211  N N   . LYS B 1 179 ? -49.855 13.046  1.505   1.00 29.40 ? 178 LYS B N   1 
ATOM   4212  C CA  . LYS B 1 179 ? -50.488 13.031  2.826   1.00 30.37 ? 178 LYS B CA  1 
ATOM   4213  C C   . LYS B 1 179 ? -49.587 13.566  3.954   1.00 30.03 ? 178 LYS B C   1 
ATOM   4214  O O   . LYS B 1 179 ? -50.070 14.098  4.965   1.00 29.71 ? 178 LYS B O   1 
ATOM   4215  C CB  . LYS B 1 179 ? -50.842 11.579  3.122   1.00 30.54 ? 178 LYS B CB  1 
ATOM   4216  C CG  . LYS B 1 179 ? -51.607 11.327  4.353   1.00 31.99 ? 178 LYS B CG  1 
ATOM   4217  C CD  . LYS B 1 179 ? -52.026 9.877   4.400   1.00 31.88 ? 178 LYS B CD  1 
ATOM   4218  C CE  . LYS B 1 179 ? -50.873 8.955   4.620   1.00 33.27 ? 178 LYS B CE  1 
ATOM   4219  N NZ  . LYS B 1 179 ? -51.415 7.607   4.921   1.00 35.28 ? 178 LYS B NZ  1 
ATOM   4220  N N   . HIS B 1 180 ? -48.282 13.401  3.780   1.00 29.70 ? 179 HIS B N   1 
ATOM   4221  C CA  . HIS B 1 180 ? -47.303 13.837  4.772   1.00 30.08 ? 179 HIS B CA  1 
ATOM   4222  C C   . HIS B 1 180 ? -46.842 15.267  4.618   1.00 30.13 ? 179 HIS B C   1 
ATOM   4223  O O   . HIS B 1 180 ? -46.164 15.785  5.490   1.00 30.43 ? 179 HIS B O   1 
ATOM   4224  C CB  . HIS B 1 180 ? -46.106 12.886  4.785   1.00 29.87 ? 179 HIS B CB  1 
ATOM   4225  C CG  . HIS B 1 180 ? -46.417 11.568  5.416   1.00 30.36 ? 179 HIS B CG  1 
ATOM   4226  N ND1 . HIS B 1 180 ? -45.935 11.202  6.657   1.00 30.58 ? 179 HIS B ND1 1 
ATOM   4227  C CD2 . HIS B 1 180 ? -47.205 10.549  5.002   1.00 30.71 ? 179 HIS B CD2 1 
ATOM   4228  C CE1 . HIS B 1 180 ? -46.388 9.998   6.960   1.00 30.44 ? 179 HIS B CE1 1 
ATOM   4229  N NE2 . HIS B 1 180 ? -47.155 9.577   5.969   1.00 30.88 ? 179 HIS B NE2 1 
ATOM   4230  N N   . GLY B 1 181 ? -47.216 15.918  3.525   1.00 30.48 ? 180 GLY B N   1 
ATOM   4231  C CA  . GLY B 1 181 ? -47.045 17.359  3.422   1.00 30.75 ? 180 GLY B CA  1 
ATOM   4232  C C   . GLY B 1 181 ? -46.327 17.778  2.158   1.00 31.03 ? 180 GLY B C   1 
ATOM   4233  O O   . GLY B 1 181 ? -46.518 17.165  1.102   1.00 30.79 ? 180 GLY B O   1 
ATOM   4234  N N   . ASP B 1 182 ? -45.502 18.822  2.302   1.00 30.86 ? 181 ASP B N   1 
ATOM   4235  C CA  . ASP B 1 182 ? -44.811 19.520  1.216   1.00 30.99 ? 181 ASP B CA  1 
ATOM   4236  C C   . ASP B 1 182 ? -43.648 18.683  0.649   1.00 29.55 ? 181 ASP B C   1 
ATOM   4237  O O   . ASP B 1 182 ? -42.471 19.048  0.778   1.00 29.64 ? 181 ASP B O   1 
ATOM   4238  C CB  . ASP B 1 182 ? -44.301 20.876  1.775   1.00 31.71 ? 181 ASP B CB  1 
ATOM   4239  C CG  . ASP B 1 182 ? -43.638 21.753  0.724   1.00 34.88 ? 181 ASP B CG  1 
ATOM   4240  O OD1 . ASP B 1 182 ? -44.016 21.653  -0.468  1.00 39.03 ? 181 ASP B OD1 1 
ATOM   4241  O OD2 . ASP B 1 182 ? -42.730 22.550  1.096   1.00 39.76 ? 181 ASP B OD2 1 
ATOM   4242  N N   . ILE B 1 183 ? -43.996 17.550  0.041   1.00 27.64 ? 182 ILE B N   1 
ATOM   4243  C CA  . ILE B 1 183 ? -43.017 16.586  -0.440  1.00 26.76 ? 182 ILE B CA  1 
ATOM   4244  C C   . ILE B 1 183 ? -43.180 16.337  -1.940  1.00 25.59 ? 182 ILE B C   1 
ATOM   4245  O O   . ILE B 1 183 ? -44.289 16.057  -2.440  1.00 25.30 ? 182 ILE B O   1 
ATOM   4246  C CB  . ILE B 1 183 ? -43.102 15.237  0.308   1.00 26.45 ? 182 ILE B CB  1 
ATOM   4247  C CG1 . ILE B 1 183 ? -43.017 15.458  1.829   1.00 26.82 ? 182 ILE B CG1 1 
ATOM   4248  C CG2 . ILE B 1 183 ? -41.987 14.301  -0.179  1.00 25.13 ? 182 ILE B CG2 1 
ATOM   4249  C CD1 . ILE B 1 183 ? -42.821 14.156  2.650   1.00 26.73 ? 182 ILE B CD1 1 
ATOM   4250  N N   . ILE B 1 184 ? -42.047 16.455  -2.643  1.00 24.41 ? 183 ILE B N   1 
ATOM   4251  C CA  . ILE B 1 184 ? -41.996 16.338  -4.096  1.00 22.78 ? 183 ILE B CA  1 
ATOM   4252  C C   . ILE B 1 184 ? -41.715 14.899  -4.447  1.00 21.75 ? 183 ILE B C   1 
ATOM   4253  O O   . ILE B 1 184 ? -40.671 14.366  -4.059  1.00 21.55 ? 183 ILE B O   1 
ATOM   4254  C CB  . ILE B 1 184 ? -40.856 17.226  -4.675  1.00 22.99 ? 183 ILE B CB  1 
ATOM   4255  C CG1 . ILE B 1 184 ? -41.210 18.712  -4.503  1.00 22.91 ? 183 ILE B CG1 1 
ATOM   4256  C CG2 . ILE B 1 184 ? -40.587 16.889  -6.129  1.00 22.05 ? 183 ILE B CG2 1 
ATOM   4257  C CD1 . ILE B 1 184 ? -40.015 19.649  -4.547  1.00 22.27 ? 183 ILE B CD1 1 
ATOM   4258  N N   . LEU B 1 185 ? -42.639 14.270  -5.174  1.00 20.34 ? 184 LEU B N   1 
ATOM   4259  C CA  . LEU B 1 185 ? -42.411 12.937  -5.718  1.00 19.47 ? 184 LEU B CA  1 
ATOM   4260  C C   . LEU B 1 185 ? -41.934 13.031  -7.182  1.00 19.08 ? 184 LEU B C   1 
ATOM   4261  O O   . LEU B 1 185 ? -42.690 13.480  -8.044  1.00 18.88 ? 184 LEU B O   1 
ATOM   4262  C CB  . LEU B 1 185 ? -43.681 12.072  -5.633  1.00 19.37 ? 184 LEU B CB  1 
ATOM   4263  C CG  . LEU B 1 185 ? -43.592 10.630  -6.183  1.00 19.67 ? 184 LEU B CG  1 
ATOM   4264  C CD1 . LEU B 1 185 ? -42.592 9.742   -5.405  1.00 18.89 ? 184 LEU B CD1 1 
ATOM   4265  C CD2 . LEU B 1 185 ? -44.963 9.963   -6.224  1.00 18.46 ? 184 LEU B CD2 1 
ATOM   4266  N N   . VAL B 1 186 ? -40.695 12.583  -7.439  1.00 18.39 ? 185 VAL B N   1 
ATOM   4267  C CA  . VAL B 1 186 ? -40.147 12.447  -8.798  1.00 18.04 ? 185 VAL B CA  1 
ATOM   4268  C C   . VAL B 1 186 ? -40.211 11.004  -9.279  1.00 17.92 ? 185 VAL B C   1 
ATOM   4269  O O   . VAL B 1 186 ? -39.815 10.078  -8.553  1.00 18.39 ? 185 VAL B O   1 
ATOM   4270  C CB  . VAL B 1 186 ? -38.640 12.912  -8.887  1.00 18.02 ? 185 VAL B CB  1 
ATOM   4271  C CG1 . VAL B 1 186 ? -38.108 12.785  -10.336 1.00 17.72 ? 185 VAL B CG1 1 
ATOM   4272  C CG2 . VAL B 1 186 ? -38.446 14.350  -8.359  1.00 16.93 ? 185 VAL B CG2 1 
ATOM   4273  N N   . VAL B 1 187 ? -40.705 10.817  -10.509 1.00 17.89 ? 186 VAL B N   1 
ATOM   4274  C CA  . VAL B 1 187 ? -40.595 9.536   -11.228 1.00 17.04 ? 186 VAL B CA  1 
ATOM   4275  C C   . VAL B 1 187 ? -39.672 9.685   -12.446 1.00 17.22 ? 186 VAL B C   1 
ATOM   4276  O O   . VAL B 1 187 ? -39.955 10.477  -13.395 1.00 16.72 ? 186 VAL B O   1 
ATOM   4277  C CB  . VAL B 1 187 ? -41.956 8.996   -11.686 1.00 16.97 ? 186 VAL B CB  1 
ATOM   4278  C CG1 . VAL B 1 187 ? -41.798 7.661   -12.445 1.00 15.59 ? 186 VAL B CG1 1 
ATOM   4279  C CG2 . VAL B 1 187 ? -42.859 8.819   -10.488 1.00 16.30 ? 186 VAL B CG2 1 
ATOM   4280  N N   . ASP B 1 188 ? -38.555 8.957   -12.411 1.00 16.41 ? 187 ASP B N   1 
ATOM   4281  C CA  . ASP B 1 188 ? -37.724 8.783   -13.604 1.00 16.72 ? 187 ASP B CA  1 
ATOM   4282  C C   . ASP B 1 188 ? -38.403 7.803   -14.567 1.00 16.04 ? 187 ASP B C   1 
ATOM   4283  O O   . ASP B 1 188 ? -38.434 6.596   -14.317 1.00 16.91 ? 187 ASP B O   1 
ATOM   4284  C CB  . ASP B 1 188 ? -36.337 8.290   -13.214 1.00 16.47 ? 187 ASP B CB  1 
ATOM   4285  C CG  . ASP B 1 188 ? -35.387 8.218   -14.402 1.00 16.68 ? 187 ASP B CG  1 
ATOM   4286  O OD1 . ASP B 1 188 ? -35.852 8.154   -15.566 1.00 17.57 ? 187 ASP B OD1 1 
ATOM   4287  O OD2 . ASP B 1 188 ? -34.165 8.219   -14.152 1.00 17.37 ? 187 ASP B OD2 1 
ATOM   4288  N N   . ASN B 1 189 ? -38.966 8.355   -15.644 1.00 15.49 ? 188 ASN B N   1 
ATOM   4289  C CA  . ASN B 1 189 ? -39.712 7.644   -16.661 1.00 14.86 ? 188 ASN B CA  1 
ATOM   4290  C C   . ASN B 1 189 ? -38.862 7.325   -17.919 1.00 14.95 ? 188 ASN B C   1 
ATOM   4291  O O   . ASN B 1 189 ? -39.402 6.951   -18.971 1.00 13.44 ? 188 ASN B O   1 
ATOM   4292  C CB  . ASN B 1 189 ? -40.896 8.546   -17.062 1.00 15.11 ? 188 ASN B CB  1 
ATOM   4293  C CG  . ASN B 1 189 ? -42.081 7.781   -17.589 1.00 15.81 ? 188 ASN B CG  1 
ATOM   4294  O OD1 . ASN B 1 189 ? -42.363 6.668   -17.153 1.00 15.34 ? 188 ASN B OD1 1 
ATOM   4295  N ND2 . ASN B 1 189 ? -42.821 8.403   -18.503 1.00 13.53 ? 188 ASN B ND2 1 
ATOM   4296  N N   . THR B 1 190 ? -37.545 7.495   -17.812 1.00 15.37 ? 189 THR B N   1 
ATOM   4297  C CA  . THR B 1 190 ? -36.615 7.282   -18.924 1.00 15.43 ? 189 THR B CA  1 
ATOM   4298  C C   . THR B 1 190 ? -36.918 6.046   -19.760 1.00 16.57 ? 189 THR B C   1 
ATOM   4299  O O   . THR B 1 190 ? -36.962 6.108   -20.996 1.00 16.26 ? 189 THR B O   1 
ATOM   4300  C CB  . THR B 1 190 ? -35.189 7.155   -18.413 1.00 15.30 ? 189 THR B CB  1 
ATOM   4301  O OG1 . THR B 1 190 ? -34.784 8.425   -17.881 1.00 14.34 ? 189 THR B OG1 1 
ATOM   4302  C CG2 . THR B 1 190 ? -34.232 6.731   -19.542 1.00 14.95 ? 189 THR B CG2 1 
ATOM   4303  N N   . PHE B 1 191 ? -37.148 4.931   -19.083 1.00 18.05 ? 190 PHE B N   1 
ATOM   4304  C CA  . PHE B 1 191 ? -37.228 3.648   -19.768 1.00 19.17 ? 190 PHE B CA  1 
ATOM   4305  C C   . PHE B 1 191 ? -38.625 3.244   -20.155 1.00 18.66 ? 190 PHE B C   1 
ATOM   4306  O O   . PHE B 1 191 ? -38.805 2.186   -20.720 1.00 20.07 ? 190 PHE B O   1 
ATOM   4307  C CB  . PHE B 1 191 ? -36.521 2.573   -18.928 1.00 21.11 ? 190 PHE B CB  1 
ATOM   4308  C CG  . PHE B 1 191 ? -35.038 2.760   -18.884 1.00 22.24 ? 190 PHE B CG  1 
ATOM   4309  C CD1 . PHE B 1 191 ? -34.435 3.449   -17.839 1.00 25.17 ? 190 PHE B CD1 1 
ATOM   4310  C CD2 . PHE B 1 191 ? -34.252 2.313   -19.906 1.00 23.18 ? 190 PHE B CD2 1 
ATOM   4311  C CE1 . PHE B 1 191 ? -33.084 3.646   -17.820 1.00 24.22 ? 190 PHE B CE1 1 
ATOM   4312  C CE2 . PHE B 1 191 ? -32.899 2.519   -19.869 1.00 24.56 ? 190 PHE B CE2 1 
ATOM   4313  C CZ  . PHE B 1 191 ? -32.322 3.176   -18.835 1.00 24.68 ? 190 PHE B CZ  1 
ATOM   4314  N N   . MET B 1 192 ? -39.620 4.096   -19.919 1.00 18.13 ? 191 MET B N   1 
ATOM   4315  C CA  . MET B 1 192 ? -40.956 3.808   -20.411 1.00 17.70 ? 191 MET B CA  1 
ATOM   4316  C C   . MET B 1 192 ? -41.385 4.732   -21.529 1.00 16.69 ? 191 MET B C   1 
ATOM   4317  O O   . MET B 1 192 ? -42.064 4.303   -22.445 1.00 16.32 ? 191 MET B O   1 
ATOM   4318  C CB  . MET B 1 192 ? -41.965 3.860   -19.268 1.00 17.80 ? 191 MET B CB  1 
ATOM   4319  C CG  . MET B 1 192 ? -41.814 2.701   -18.301 1.00 19.26 ? 191 MET B CG  1 
ATOM   4320  S SD  . MET B 1 192 ? -42.340 1.133   -19.046 1.00 19.83 ? 191 MET B SD  1 
ATOM   4321  C CE  . MET B 1 192 ? -44.110 1.381   -18.925 1.00 19.05 ? 191 MET B CE  1 
ATOM   4322  N N   . SER B 1 193 ? -40.999 6.002   -21.436 1.00 15.85 ? 192 SER B N   1 
ATOM   4323  C CA  . SER B 1 193 ? -41.568 7.076   -22.261 1.00 15.03 ? 192 SER B CA  1 
ATOM   4324  C C   . SER B 1 193 ? -43.025 7.369   -21.857 1.00 14.75 ? 192 SER B C   1 
ATOM   4325  O O   . SER B 1 193 ? -43.695 6.510   -21.315 1.00 13.58 ? 192 SER B O   1 
ATOM   4326  C CB  . SER B 1 193 ? -41.459 6.760   -23.758 1.00 14.94 ? 192 SER B CB  1 
ATOM   4327  O OG  . SER B 1 193 ? -42.637 6.174   -24.282 1.00 14.01 ? 192 SER B OG  1 
ATOM   4328  N N   . PRO B 1 194 ? -43.517 8.586   -22.142 1.00 14.99 ? 193 PRO B N   1 
ATOM   4329  C CA  . PRO B 1 194 ? -44.905 8.906   -21.845 1.00 15.21 ? 193 PRO B CA  1 
ATOM   4330  C C   . PRO B 1 194 ? -45.882 8.245   -22.813 1.00 14.44 ? 193 PRO B C   1 
ATOM   4331  O O   . PRO B 1 194 ? -47.062 8.347   -22.629 1.00 15.24 ? 193 PRO B O   1 
ATOM   4332  C CB  . PRO B 1 194 ? -44.941 10.436  -21.967 1.00 15.26 ? 193 PRO B CB  1 
ATOM   4333  C CG  . PRO B 1 194 ? -43.897 10.732  -22.985 1.00 14.95 ? 193 PRO B CG  1 
ATOM   4334  C CD  . PRO B 1 194 ? -42.816 9.734   -22.758 1.00 15.61 ? 193 PRO B CD  1 
ATOM   4335  N N   . TYR B 1 195 ? -45.395 7.584   -23.854 1.00 15.48 ? 194 TYR B N   1 
ATOM   4336  C CA  . TYR B 1 195 ? -46.278 6.787   -24.701 1.00 14.67 ? 194 TYR B CA  1 
ATOM   4337  C C   . TYR B 1 195 ? -46.897 5.665   -23.862 1.00 15.13 ? 194 TYR B C   1 
ATOM   4338  O O   . TYR B 1 195 ? -48.064 5.279   -24.071 1.00 16.13 ? 194 TYR B O   1 
ATOM   4339  C CB  . TYR B 1 195 ? -45.521 6.189   -25.893 1.00 14.53 ? 194 TYR B CB  1 
ATOM   4340  C CG  . TYR B 1 195 ? -46.434 5.463   -26.852 1.00 13.54 ? 194 TYR B CG  1 
ATOM   4341  C CD1 . TYR B 1 195 ? -47.373 6.158   -27.603 1.00 11.81 ? 194 TYR B CD1 1 
ATOM   4342  C CD2 . TYR B 1 195 ? -46.374 4.075   -26.996 1.00 14.94 ? 194 TYR B CD2 1 
ATOM   4343  C CE1 . TYR B 1 195 ? -48.238 5.499   -28.468 1.00 12.45 ? 194 TYR B CE1 1 
ATOM   4344  C CE2 . TYR B 1 195 ? -47.211 3.403   -27.862 1.00 13.25 ? 194 TYR B CE2 1 
ATOM   4345  C CZ  . TYR B 1 195 ? -48.150 4.126   -28.606 1.00 15.48 ? 194 TYR B CZ  1 
ATOM   4346  O OH  . TYR B 1 195 ? -49.007 3.479   -29.463 1.00 12.27 ? 194 TYR B OH  1 
ATOM   4347  N N   . PHE B 1 196 ? -46.104 5.130   -22.942 1.00 15.14 ? 195 PHE B N   1 
ATOM   4348  C CA  . PHE B 1 196 ? -46.496 3.966   -22.137 1.00 14.99 ? 195 PHE B CA  1 
ATOM   4349  C C   . PHE B 1 196 ? -46.826 4.283   -20.673 1.00 15.09 ? 195 PHE B C   1 
ATOM   4350  O O   . PHE B 1 196 ? -47.585 3.564   -20.070 1.00 14.44 ? 195 PHE B O   1 
ATOM   4351  C CB  . PHE B 1 196 ? -45.406 2.883   -22.169 1.00 13.91 ? 195 PHE B CB  1 
ATOM   4352  C CG  . PHE B 1 196 ? -45.292 2.130   -23.487 1.00 14.10 ? 195 PHE B CG  1 
ATOM   4353  C CD1 . PHE B 1 196 ? -44.041 1.916   -24.055 1.00 12.71 ? 195 PHE B CD1 1 
ATOM   4354  C CD2 . PHE B 1 196 ? -46.412 1.598   -24.125 1.00 11.59 ? 195 PHE B CD2 1 
ATOM   4355  C CE1 . PHE B 1 196 ? -43.916 1.166   -25.237 1.00 12.06 ? 195 PHE B CE1 1 
ATOM   4356  C CE2 . PHE B 1 196 ? -46.295 0.873   -25.301 1.00 13.69 ? 195 PHE B CE2 1 
ATOM   4357  C CZ  . PHE B 1 196 ? -45.055 0.649   -25.849 1.00 11.47 ? 195 PHE B CZ  1 
ATOM   4358  N N   . GLN B 1 197 ? -46.264 5.346   -20.103 1.00 16.02 ? 196 GLN B N   1 
ATOM   4359  C CA  . GLN B 1 197 ? -46.465 5.630   -18.684 1.00 16.28 ? 196 GLN B CA  1 
ATOM   4360  C C   . GLN B 1 197 ? -46.507 7.137   -18.429 1.00 16.61 ? 196 GLN B C   1 
ATOM   4361  O O   . GLN B 1 197 ? -45.578 7.837   -18.800 1.00 16.37 ? 196 GLN B O   1 
ATOM   4362  C CB  . GLN B 1 197 ? -45.320 5.002   -17.870 1.00 16.33 ? 196 GLN B CB  1 
ATOM   4363  C CG  . GLN B 1 197 ? -45.490 5.069   -16.349 1.00 16.26 ? 196 GLN B CG  1 
ATOM   4364  C CD  . GLN B 1 197 ? -44.500 4.176   -15.615 1.00 16.46 ? 196 GLN B CD  1 
ATOM   4365  O OE1 . GLN B 1 197 ? -44.875 3.126   -15.127 1.00 18.60 ? 196 GLN B OE1 1 
ATOM   4366  N NE2 . GLN B 1 197 ? -43.222 4.589   -15.555 1.00 14.37 ? 196 GLN B NE2 1 
ATOM   4367  N N   . ARG B 1 198 ? -47.576 7.617   -17.786 1.00 16.94 ? 197 ARG B N   1 
ATOM   4368  C CA  . ARG B 1 198 ? -47.722 9.033   -17.455 1.00 17.58 ? 197 ARG B CA  1 
ATOM   4369  C C   . ARG B 1 198 ? -47.724 9.282   -15.945 1.00 18.03 ? 197 ARG B C   1 
ATOM   4370  O O   . ARG B 1 198 ? -48.792 9.404   -15.354 1.00 17.71 ? 197 ARG B O   1 
ATOM   4371  C CB  . ARG B 1 198 ? -48.999 9.599   -18.083 1.00 17.06 ? 197 ARG B CB  1 
ATOM   4372  C CG  . ARG B 1 198 ? -48.772 10.133  -19.456 1.00 17.73 ? 197 ARG B CG  1 
ATOM   4373  C CD  . ARG B 1 198 ? -50.023 10.615  -20.095 1.00 16.59 ? 197 ARG B CD  1 
ATOM   4374  N NE  . ARG B 1 198 ? -49.748 11.170  -21.405 1.00 16.28 ? 197 ARG B NE  1 
ATOM   4375  C CZ  . ARG B 1 198 ? -50.673 11.597  -22.247 1.00 16.69 ? 197 ARG B CZ  1 
ATOM   4376  N NH1 . ARG B 1 198 ? -51.945 11.529  -21.928 1.00 17.65 ? 197 ARG B NH1 1 
ATOM   4377  N NH2 . ARG B 1 198 ? -50.318 12.107  -23.418 1.00 18.99 ? 197 ARG B NH2 1 
ATOM   4378  N N   . PRO B 1 199 ? -46.519 9.354   -15.323 1.00 18.93 ? 198 PRO B N   1 
ATOM   4379  C CA  . PRO B 1 199 ? -46.410 9.569   -13.873 1.00 18.80 ? 198 PRO B CA  1 
ATOM   4380  C C   . PRO B 1 199 ? -47.203 10.748  -13.291 1.00 19.48 ? 198 PRO B C   1 
ATOM   4381  O O   . PRO B 1 199 ? -47.703 10.626  -12.164 1.00 19.30 ? 198 PRO B O   1 
ATOM   4382  C CB  . PRO B 1 199 ? -44.911 9.761   -13.659 1.00 18.90 ? 198 PRO B CB  1 
ATOM   4383  C CG  . PRO B 1 199 ? -44.297 8.890   -14.722 1.00 18.81 ? 198 PRO B CG  1 
ATOM   4384  C CD  . PRO B 1 199 ? -45.183 9.128   -15.924 1.00 18.79 ? 198 PRO B CD  1 
ATOM   4385  N N   . LEU B 1 200 ? -47.317 11.855  -14.029 1.00 19.02 ? 199 LEU B N   1 
ATOM   4386  C CA  . LEU B 1 200 ? -48.081 13.015  -13.544 1.00 19.43 ? 199 LEU B CA  1 
ATOM   4387  C C   . LEU B 1 200 ? -49.565 12.689  -13.466 1.00 19.93 ? 199 LEU B C   1 
ATOM   4388  O O   . LEU B 1 200 ? -50.279 13.222  -12.599 1.00 20.39 ? 199 LEU B O   1 
ATOM   4389  C CB  . LEU B 1 200 ? -47.866 14.243  -14.427 1.00 19.00 ? 199 LEU B CB  1 
ATOM   4390  C CG  . LEU B 1 200 ? -46.455 14.836  -14.557 1.00 18.67 ? 199 LEU B CG  1 
ATOM   4391  C CD1 . LEU B 1 200 ? -46.486 15.901  -15.605 1.00 17.90 ? 199 LEU B CD1 1 
ATOM   4392  C CD2 . LEU B 1 200 ? -45.919 15.402  -13.246 1.00 17.75 ? 199 LEU B CD2 1 
ATOM   4393  N N   . ALA B 1 201 ? -50.032 11.811  -14.359 1.00 19.93 ? 200 ALA B N   1 
ATOM   4394  C CA  . ALA B 1 201 ? -51.433 11.383  -14.343 1.00 20.25 ? 200 ALA B CA  1 
ATOM   4395  C C   . ALA B 1 201 ? -51.709 10.470  -13.172 1.00 20.92 ? 200 ALA B C   1 
ATOM   4396  O O   . ALA B 1 201 ? -52.861 10.312  -12.773 1.00 21.84 ? 200 ALA B O   1 
ATOM   4397  C CB  . ALA B 1 201 ? -51.817 10.686  -15.644 1.00 20.26 ? 200 ALA B CB  1 
ATOM   4398  N N   . LEU B 1 202 ? -50.665 9.852   -12.633 1.00 20.89 ? 201 LEU B N   1 
ATOM   4399  C CA  . LEU B 1 202 ? -50.807 8.913   -11.516 1.00 21.31 ? 201 LEU B CA  1 
ATOM   4400  C C   . LEU B 1 202 ? -50.473 9.533   -10.170 1.00 22.04 ? 201 LEU B C   1 
ATOM   4401  O O   . LEU B 1 202 ? -50.364 8.809   -9.167  1.00 22.97 ? 201 LEU B O   1 
ATOM   4402  C CB  . LEU B 1 202 ? -49.896 7.708   -11.741 1.00 21.01 ? 201 LEU B CB  1 
ATOM   4403  C CG  . LEU B 1 202 ? -50.145 6.907   -13.024 1.00 20.98 ? 201 LEU B CG  1 
ATOM   4404  C CD1 . LEU B 1 202 ? -48.910 6.096   -13.403 1.00 20.44 ? 201 LEU B CD1 1 
ATOM   4405  C CD2 . LEU B 1 202 ? -51.371 6.028   -12.895 1.00 18.04 ? 201 LEU B CD2 1 
ATOM   4406  N N   . GLY B 1 203 ? -50.269 10.850  -10.133 1.00 22.00 ? 202 GLY B N   1 
ATOM   4407  C CA  . GLY B 1 203 ? -50.015 11.551  -8.881  1.00 21.62 ? 202 GLY B CA  1 
ATOM   4408  C C   . GLY B 1 203 ? -48.598 12.041  -8.632  1.00 21.40 ? 202 GLY B C   1 
ATOM   4409  O O   . GLY B 1 203 ? -48.346 12.715  -7.633  1.00 21.85 ? 202 GLY B O   1 
ATOM   4410  N N   . ALA B 1 204 ? -47.650 11.711  -9.501  1.00 20.35 ? 203 ALA B N   1 
ATOM   4411  C CA  . ALA B 1 204 ? -46.306 12.265  -9.345  1.00 19.34 ? 203 ALA B CA  1 
ATOM   4412  C C   . ALA B 1 204 ? -46.336 13.789  -9.531  1.00 18.50 ? 203 ALA B C   1 
ATOM   4413  O O   . ALA B 1 204 ? -47.212 14.325  -10.183 1.00 18.12 ? 203 ALA B O   1 
ATOM   4414  C CB  . ALA B 1 204 ? -45.336 11.622  -10.339 1.00 19.00 ? 203 ALA B CB  1 
ATOM   4415  N N   . ASP B 1 205 ? -45.359 14.470  -8.959  1.00 18.48 ? 204 ASP B N   1 
ATOM   4416  C CA  . ASP B 1 205 ? -45.197 15.903  -9.136  1.00 18.69 ? 204 ASP B CA  1 
ATOM   4417  C C   . ASP B 1 205 ? -44.310 16.217  -10.349 1.00 18.99 ? 204 ASP B C   1 
ATOM   4418  O O   . ASP B 1 205 ? -44.471 17.261  -10.991 1.00 18.10 ? 204 ASP B O   1 
ATOM   4419  C CB  . ASP B 1 205 ? -44.586 16.494  -7.872  1.00 19.07 ? 204 ASP B CB  1 
ATOM   4420  C CG  . ASP B 1 205 ? -45.490 16.316  -6.658  1.00 20.36 ? 204 ASP B CG  1 
ATOM   4421  O OD1 . ASP B 1 205 ? -46.605 16.882  -6.682  1.00 20.31 ? 204 ASP B OD1 1 
ATOM   4422  O OD2 . ASP B 1 205 ? -45.101 15.586  -5.714  1.00 21.92 ? 204 ASP B OD2 1 
ATOM   4423  N N   . ILE B 1 206 ? -43.386 15.296  -10.646 1.00 19.19 ? 205 ILE B N   1 
ATOM   4424  C CA  . ILE B 1 206 ? -42.378 15.460  -11.689 1.00 19.12 ? 205 ILE B CA  1 
ATOM   4425  C C   . ILE B 1 206 ? -42.229 14.145  -12.446 1.00 19.38 ? 205 ILE B C   1 
ATOM   4426  O O   . ILE B 1 206 ? -42.066 13.098  -11.826 1.00 19.20 ? 205 ILE B O   1 
ATOM   4427  C CB  . ILE B 1 206 ? -40.996 15.871  -11.088 1.00 19.14 ? 205 ILE B CB  1 
ATOM   4428  C CG1 . ILE B 1 206 ? -41.087 17.259  -10.436 1.00 19.00 ? 205 ILE B CG1 1 
ATOM   4429  C CG2 . ILE B 1 206 ? -39.904 15.861  -12.170 1.00 18.89 ? 205 ILE B CG2 1 
ATOM   4430  C CD1 . ILE B 1 206 ? -39.757 17.861  -9.972  1.00 19.14 ? 205 ILE B CD1 1 
ATOM   4431  N N   . SER B 1 207 ? -42.328 14.209  -13.775 1.00 19.41 ? 206 SER B N   1 
ATOM   4432  C CA  . SER B 1 207 ? -41.978 13.079  -14.651 1.00 19.54 ? 206 SER B CA  1 
ATOM   4433  C C   . SER B 1 207 ? -40.688 13.494  -15.329 1.00 19.08 ? 206 SER B C   1 
ATOM   4434  O O   . SER B 1 207 ? -40.626 14.510  -16.015 1.00 18.70 ? 206 SER B O   1 
ATOM   4435  C CB  . SER B 1 207 ? -43.043 12.815  -15.693 1.00 19.62 ? 206 SER B CB  1 
ATOM   4436  O OG  . SER B 1 207 ? -42.701 11.672  -16.476 1.00 20.12 ? 206 SER B OG  1 
ATOM   4437  N N   . MET B 1 208 ? -39.641 12.708  -15.120 1.00 18.88 ? 207 MET B N   1 
ATOM   4438  C CA  . MET B 1 208 ? -38.316 13.115  -15.526 1.00 19.03 ? 207 MET B CA  1 
ATOM   4439  C C   . MET B 1 208 ? -37.708 12.070  -16.472 1.00 18.30 ? 207 MET B C   1 
ATOM   4440  O O   . MET B 1 208 ? -38.042 10.888  -16.382 1.00 18.18 ? 207 MET B O   1 
ATOM   4441  C CB  . MET B 1 208 ? -37.521 13.369  -14.241 1.00 19.26 ? 207 MET B CB  1 
ATOM   4442  C CG  . MET B 1 208 ? -36.069 13.411  -14.357 1.00 21.16 ? 207 MET B CG  1 
ATOM   4443  S SD  . MET B 1 208 ? -35.338 11.784  -14.557 1.00 19.82 ? 207 MET B SD  1 
ATOM   4444  C CE  . MET B 1 208 ? -33.679 12.409  -14.689 1.00 21.24 ? 207 MET B CE  1 
ATOM   4445  N N   . TYR B 1 209 ? -36.858 12.538  -17.397 1.00 18.28 ? 208 TYR B N   1 
ATOM   4446  C CA  . TYR B 1 209 ? -36.192 11.691  -18.422 1.00 18.91 ? 208 TYR B CA  1 
ATOM   4447  C C   . TYR B 1 209 ? -34.712 11.970  -18.561 1.00 19.69 ? 208 TYR B C   1 
ATOM   4448  O O   . TYR B 1 209 ? -34.242 13.107  -18.427 1.00 18.25 ? 208 TYR B O   1 
ATOM   4449  C CB  . TYR B 1 209 ? -36.788 11.895  -19.833 1.00 18.31 ? 208 TYR B CB  1 
ATOM   4450  C CG  . TYR B 1 209 ? -38.241 11.657  -19.845 1.00 18.00 ? 208 TYR B CG  1 
ATOM   4451  C CD1 . TYR B 1 209 ? -39.113 12.685  -19.532 1.00 17.78 ? 208 TYR B CD1 1 
ATOM   4452  C CD2 . TYR B 1 209 ? -38.760 10.387  -20.100 1.00 17.80 ? 208 TYR B CD2 1 
ATOM   4453  C CE1 . TYR B 1 209 ? -40.475 12.467  -19.481 1.00 18.61 ? 208 TYR B CE1 1 
ATOM   4454  C CE2 . TYR B 1 209 ? -40.124 10.165  -20.056 1.00 16.18 ? 208 TYR B CE2 1 
ATOM   4455  C CZ  . TYR B 1 209 ? -40.969 11.212  -19.726 1.00 16.34 ? 208 TYR B CZ  1 
ATOM   4456  O OH  . TYR B 1 209 ? -42.319 11.036  -19.662 1.00 17.36 ? 208 TYR B OH  1 
ATOM   4457  N N   . SER B 1 210 ? -33.997 10.885  -18.833 1.00 21.38 ? 209 SER B N   1 
ATOM   4458  C CA  . SER B 1 210 ? -32.857 10.903  -19.741 1.00 22.02 ? 209 SER B CA  1 
ATOM   4459  C C   . SER B 1 210 ? -33.449 10.661  -21.141 1.00 22.20 ? 209 SER B C   1 
ATOM   4460  O O   . SER B 1 210 ? -33.893 9.560   -21.469 1.00 21.63 ? 209 SER B O   1 
ATOM   4461  C CB  . SER B 1 210 ? -31.853 9.830   -19.367 1.00 22.01 ? 209 SER B CB  1 
ATOM   4462  O OG  . SER B 1 210 ? -30.849 9.773   -20.359 1.00 25.60 ? 209 SER B OG  1 
ATOM   4463  N N   . ALA B 1 211 ? -33.513 11.727  -21.937 1.00 22.46 ? 210 ALA B N   1 
ATOM   4464  C CA  . ALA B 1 211 ? -34.098 11.663  -23.280 1.00 23.08 ? 210 ALA B CA  1 
ATOM   4465  C C   . ALA B 1 211 ? -33.224 10.805  -24.165 1.00 23.49 ? 210 ALA B C   1 
ATOM   4466  O O   . ALA B 1 211 ? -33.663 10.281  -25.169 1.00 23.54 ? 210 ALA B O   1 
ATOM   4467  C CB  . ALA B 1 211 ? -34.262 13.050  -23.871 1.00 22.30 ? 210 ALA B CB  1 
ATOM   4468  N N   . THR B 1 212 ? -31.977 10.677  -23.737 1.00 24.05 ? 211 THR B N   1 
ATOM   4469  C CA  . THR B 1 212 ? -30.944 9.853   -24.360 1.00 24.76 ? 211 THR B CA  1 
ATOM   4470  C C   . THR B 1 212 ? -31.409 8.468   -24.779 1.00 24.65 ? 211 THR B C   1 
ATOM   4471  O O   . THR B 1 212 ? -30.931 7.943   -25.785 1.00 25.94 ? 211 THR B O   1 
ATOM   4472  C CB  . THR B 1 212 ? -29.771 9.741   -23.368 1.00 24.65 ? 211 THR B CB  1 
ATOM   4473  O OG1 . THR B 1 212 ? -29.432 11.065  -22.922 1.00 25.40 ? 211 THR B OG1 1 
ATOM   4474  C CG2 . THR B 1 212 ? -28.549 9.032   -23.964 1.00 25.71 ? 211 THR B CG2 1 
ATOM   4475  N N   . LYS B 1 213 ? -32.365 7.900   -24.038 1.00 23.54 ? 212 LYS B N   1 
ATOM   4476  C CA  . LYS B 1 213 ? -32.882 6.580   -24.318 1.00 22.80 ? 212 LYS B CA  1 
ATOM   4477  C C   . LYS B 1 213 ? -34.038 6.722   -25.310 1.00 21.72 ? 212 LYS B C   1 
ATOM   4478  O O   . LYS B 1 213 ? -33.824 7.261   -26.402 1.00 23.59 ? 212 LYS B O   1 
ATOM   4479  C CB  . LYS B 1 213 ? -33.294 5.889   -23.013 1.00 23.94 ? 212 LYS B CB  1 
ATOM   4480  C CG  . LYS B 1 213 ? -32.134 5.350   -22.142 1.00 26.26 ? 212 LYS B CG  1 
ATOM   4481  C CD  . LYS B 1 213 ? -30.918 6.237   -22.040 1.00 27.61 ? 212 LYS B CD  1 
ATOM   4482  C CE  . LYS B 1 213 ? -29.790 5.558   -21.231 1.00 28.68 ? 212 LYS B CE  1 
ATOM   4483  N NZ  . LYS B 1 213 ? -29.846 5.831   -19.716 1.00 30.00 ? 212 LYS B NZ  1 
ATOM   4484  N N   . TYR B 1 214 ? -35.251 6.309   -24.931 1.00 18.22 ? 213 TYR B N   1 
ATOM   4485  C CA  . TYR B 1 214 ? -36.374 6.185   -25.852 1.00 16.45 ? 213 TYR B CA  1 
ATOM   4486  C C   . TYR B 1 214 ? -36.936 7.497   -26.416 1.00 16.15 ? 213 TYR B C   1 
ATOM   4487  O O   . TYR B 1 214 ? -37.346 7.551   -27.581 1.00 15.36 ? 213 TYR B O   1 
ATOM   4488  C CB  . TYR B 1 214 ? -37.516 5.430   -25.172 1.00 15.32 ? 213 TYR B CB  1 
ATOM   4489  C CG  . TYR B 1 214 ? -37.307 3.934   -25.011 1.00 13.82 ? 213 TYR B CG  1 
ATOM   4490  C CD1 . TYR B 1 214 ? -37.417 3.323   -23.763 1.00 15.88 ? 213 TYR B CD1 1 
ATOM   4491  C CD2 . TYR B 1 214 ? -37.033 3.128   -26.113 1.00 12.78 ? 213 TYR B CD2 1 
ATOM   4492  C CE1 . TYR B 1 214 ? -37.259 1.926   -23.616 1.00 14.77 ? 213 TYR B CE1 1 
ATOM   4493  C CE2 . TYR B 1 214 ? -36.867 1.754   -25.978 1.00 13.93 ? 213 TYR B CE2 1 
ATOM   4494  C CZ  . TYR B 1 214 ? -36.982 1.161   -24.736 1.00 13.92 ? 213 TYR B CZ  1 
ATOM   4495  O OH  . TYR B 1 214 ? -36.819 -0.200  -24.627 1.00 13.28 ? 213 TYR B OH  1 
ATOM   4496  N N   . MET B 1 215 ? -36.976 8.544   -25.592 1.00 16.35 ? 214 MET B N   1 
ATOM   4497  C CA  . MET B 1 215 ? -37.585 9.805   -26.004 1.00 15.85 ? 214 MET B CA  1 
ATOM   4498  C C   . MET B 1 215 ? -37.018 10.221  -27.350 1.00 15.54 ? 214 MET B C   1 
ATOM   4499  O O   . MET B 1 215 ? -37.775 10.406  -28.308 1.00 15.05 ? 214 MET B O   1 
ATOM   4500  C CB  . MET B 1 215 ? -37.369 10.887  -24.954 1.00 16.48 ? 214 MET B CB  1 
ATOM   4501  C CG  . MET B 1 215 ? -38.081 10.591  -23.641 1.00 18.52 ? 214 MET B CG  1 
ATOM   4502  S SD  . MET B 1 215 ? -39.885 10.518  -23.830 1.00 24.41 ? 214 MET B SD  1 
ATOM   4503  C CE  . MET B 1 215 ? -40.202 12.214  -24.315 1.00 18.84 ? 214 MET B CE  1 
ATOM   4504  N N   . ASN B 1 216 ? -35.692 10.357  -27.417 1.00 15.48 ? 215 ASN B N   1 
ATOM   4505  C CA  . ASN B 1 216 ? -35.002 10.623  -28.694 1.00 15.18 ? 215 ASN B CA  1 
ATOM   4506  C C   . ASN B 1 216 ? -34.893 9.349   -29.492 1.00 14.64 ? 215 ASN B C   1 
ATOM   4507  O O   . ASN B 1 216 ? -35.284 9.309   -30.639 1.00 15.13 ? 215 ASN B O   1 
ATOM   4508  C CB  . ASN B 1 216 ? -33.617 11.212  -28.479 1.00 15.01 ? 215 ASN B CB  1 
ATOM   4509  C CG  . ASN B 1 216 ? -32.891 11.491  -29.792 1.00 15.06 ? 215 ASN B CG  1 
ATOM   4510  O OD1 . ASN B 1 216 ? -33.342 12.315  -30.582 1.00 16.74 ? 215 ASN B OD1 1 
ATOM   4511  N ND2 . ASN B 1 216 ? -31.760 10.817  -30.021 1.00 14.75 ? 215 ASN B ND2 1 
ATOM   4512  N N   . GLY B 1 217 ? -34.332 8.316   -28.876 1.00 14.25 ? 216 GLY B N   1 
ATOM   4513  C CA  . GLY B 1 217 ? -34.350 6.972   -29.445 1.00 14.82 ? 216 GLY B CA  1 
ATOM   4514  C C   . GLY B 1 217 ? -33.408 6.666   -30.594 1.00 14.68 ? 216 GLY B C   1 
ATOM   4515  O O   . GLY B 1 217 ? -33.489 5.580   -31.156 1.00 15.77 ? 216 GLY B O   1 
ATOM   4516  N N   . HIS B 1 218 ? -32.528 7.610   -30.950 1.00 14.16 ? 217 HIS B N   1 
ATOM   4517  C CA  . HIS B 1 218 ? -31.634 7.451   -32.093 1.00 14.59 ? 217 HIS B CA  1 
ATOM   4518  C C   . HIS B 1 218 ? -30.155 7.478   -31.680 1.00 14.92 ? 217 HIS B C   1 
ATOM   4519  O O   . HIS B 1 218 ? -29.273 7.721   -32.506 1.00 15.76 ? 217 HIS B O   1 
ATOM   4520  C CB  . HIS B 1 218 ? -31.952 8.512   -33.150 1.00 14.44 ? 217 HIS B CB  1 
ATOM   4521  C CG  . HIS B 1 218 ? -33.285 8.324   -33.813 1.00 15.33 ? 217 HIS B CG  1 
ATOM   4522  N ND1 . HIS B 1 218 ? -34.489 8.600   -33.184 1.00 16.00 ? 217 HIS B ND1 1 
ATOM   4523  C CD2 . HIS B 1 218 ? -33.603 7.879   -35.054 1.00 15.85 ? 217 HIS B CD2 1 
ATOM   4524  C CE1 . HIS B 1 218 ? -35.486 8.319   -34.007 1.00 16.74 ? 217 HIS B CE1 1 
ATOM   4525  N NE2 . HIS B 1 218 ? -34.977 7.884   -35.150 1.00 16.08 ? 217 HIS B NE2 1 
ATOM   4526  N N   . SER B 1 219 ? -29.903 7.270   -30.390 1.00 15.47 ? 218 SER B N   1 
ATOM   4527  C CA  . SER B 1 219 ? -28.553 7.103   -29.838 1.00 15.51 ? 218 SER B CA  1 
ATOM   4528  C C   . SER B 1 219 ? -27.583 8.196   -30.274 1.00 15.80 ? 218 SER B C   1 
ATOM   4529  O O   . SER B 1 219 ? -26.410 7.930   -30.496 1.00 15.67 ? 218 SER B O   1 
ATOM   4530  C CB  . SER B 1 219 ? -27.985 5.719   -30.208 1.00 15.58 ? 218 SER B CB  1 
ATOM   4531  O OG  . SER B 1 219 ? -28.855 4.645   -29.848 1.00 16.62 ? 218 SER B OG  1 
ATOM   4532  N N   . ASP B 1 220 ? -28.079 9.428   -30.414 1.00 16.37 ? 219 ASP B N   1 
ATOM   4533  C CA  . ASP B 1 220 ? -27.235 10.539  -30.868 1.00 16.05 ? 219 ASP B CA  1 
ATOM   4534  C C   . ASP B 1 220 ? -27.501 11.867  -30.110 1.00 16.16 ? 219 ASP B C   1 
ATOM   4535  O O   . ASP B 1 220 ? -27.072 12.928  -30.556 1.00 16.74 ? 219 ASP B O   1 
ATOM   4536  C CB  . ASP B 1 220 ? -27.348 10.707  -32.384 1.00 16.29 ? 219 ASP B CB  1 
ATOM   4537  C CG  . ASP B 1 220 ? -28.755 11.036  -32.840 1.00 17.13 ? 219 ASP B CG  1 
ATOM   4538  O OD1 . ASP B 1 220 ? -28.957 11.171  -34.067 1.00 16.67 ? 219 ASP B OD1 1 
ATOM   4539  O OD2 . ASP B 1 220 ? -29.647 11.135  -31.968 1.00 16.49 ? 219 ASP B OD2 1 
ATOM   4540  N N   . VAL B 1 221 ? -28.186 11.781  -28.963 1.00 15.68 ? 220 VAL B N   1 
ATOM   4541  C CA  . VAL B 1 221 ? -28.497 12.947  -28.128 1.00 14.92 ? 220 VAL B CA  1 
ATOM   4542  C C   . VAL B 1 221 ? -28.426 12.593  -26.664 1.00 15.09 ? 220 VAL B C   1 
ATOM   4543  O O   . VAL B 1 221 ? -29.073 11.656  -26.221 1.00 15.84 ? 220 VAL B O   1 
ATOM   4544  C CB  . VAL B 1 221 ? -29.923 13.537  -28.381 1.00 14.83 ? 220 VAL B CB  1 
ATOM   4545  C CG1 . VAL B 1 221 ? -30.193 14.690  -27.405 1.00 12.31 ? 220 VAL B CG1 1 
ATOM   4546  C CG2 . VAL B 1 221 ? -30.090 14.018  -29.823 1.00 12.31 ? 220 VAL B CG2 1 
ATOM   4547  N N   . VAL B 1 222 ? -27.654 13.381  -25.924 1.00 14.91 ? 221 VAL B N   1 
ATOM   4548  C CA  . VAL B 1 222 ? -27.617 13.324  -24.473 1.00 15.48 ? 221 VAL B CA  1 
ATOM   4549  C C   . VAL B 1 222 ? -28.446 14.521  -24.020 1.00 15.80 ? 221 VAL B C   1 
ATOM   4550  O O   . VAL B 1 222 ? -28.151 15.673  -24.364 1.00 14.79 ? 221 VAL B O   1 
ATOM   4551  C CB  . VAL B 1 222 ? -26.180 13.452  -23.949 1.00 15.79 ? 221 VAL B CB  1 
ATOM   4552  C CG1 . VAL B 1 222 ? -26.164 13.815  -22.463 1.00 15.03 ? 221 VAL B CG1 1 
ATOM   4553  C CG2 . VAL B 1 222 ? -25.389 12.171  -24.225 1.00 15.15 ? 221 VAL B CG2 1 
ATOM   4554  N N   . MET B 1 223 ? -29.520 14.242  -23.311 1.00 15.71 ? 222 MET B N   1 
ATOM   4555  C CA  . MET B 1 223 ? -30.459 15.284  -22.951 1.00 16.59 ? 222 MET B CA  1 
ATOM   4556  C C   . MET B 1 223 ? -31.298 14.838  -21.800 1.00 15.46 ? 222 MET B C   1 
ATOM   4557  O O   . MET B 1 223 ? -31.570 13.650  -21.676 1.00 15.07 ? 222 MET B O   1 
ATOM   4558  C CB  . MET B 1 223 ? -31.386 15.611  -24.125 1.00 16.72 ? 222 MET B CB  1 
ATOM   4559  C CG  . MET B 1 223 ? -32.471 16.587  -23.763 1.00 17.68 ? 222 MET B CG  1 
ATOM   4560  S SD  . MET B 1 223 ? -33.382 17.265  -25.154 1.00 20.81 ? 222 MET B SD  1 
ATOM   4561  C CE  . MET B 1 223 ? -32.125 18.121  -26.092 1.00 6.71  ? 222 MET B CE  1 
ATOM   4562  N N   . GLY B 1 224 ? -31.704 15.805  -20.970 1.00 14.37 ? 223 GLY B N   1 
ATOM   4563  C CA  . GLY B 1 224 ? -32.669 15.571  -19.910 1.00 14.40 ? 223 GLY B CA  1 
ATOM   4564  C C   . GLY B 1 224 ? -33.951 16.396  -20.076 1.00 13.53 ? 223 GLY B C   1 
ATOM   4565  O O   . GLY B 1 224 ? -33.965 17.476  -20.646 1.00 13.90 ? 223 GLY B O   1 
ATOM   4566  N N   . LEU B 1 225 ? -35.037 15.879  -19.554 1.00 13.03 ? 224 LEU B N   1 
ATOM   4567  C CA  . LEU B 1 225 ? -36.327 16.546  -19.653 1.00 12.47 ? 224 LEU B CA  1 
ATOM   4568  C C   . LEU B 1 225 ? -37.069 16.394  -18.332 1.00 13.02 ? 224 LEU B C   1 
ATOM   4569  O O   . LEU B 1 225 ? -36.937 15.374  -17.662 1.00 12.89 ? 224 LEU B O   1 
ATOM   4570  C CB  . LEU B 1 225 ? -37.137 15.939  -20.795 1.00 11.34 ? 224 LEU B CB  1 
ATOM   4571  C CG  . LEU B 1 225 ? -36.584 16.079  -22.207 1.00 9.43  ? 224 LEU B CG  1 
ATOM   4572  C CD1 . LEU B 1 225 ? -37.289 15.093  -23.161 1.00 6.10  ? 224 LEU B CD1 1 
ATOM   4573  C CD2 . LEU B 1 225 ? -36.733 17.522  -22.720 1.00 8.28  ? 224 LEU B CD2 1 
ATOM   4574  N N   . VAL B 1 226 ? -37.810 17.432  -17.951 1.00 13.72 ? 225 VAL B N   1 
ATOM   4575  C CA  . VAL B 1 226 ? -38.520 17.476  -16.652 1.00 13.78 ? 225 VAL B CA  1 
ATOM   4576  C C   . VAL B 1 226 ? -39.896 18.094  -16.906 1.00 13.93 ? 225 VAL B C   1 
ATOM   4577  O O   . VAL B 1 226 ? -39.979 19.268  -17.240 1.00 13.55 ? 225 VAL B O   1 
ATOM   4578  C CB  . VAL B 1 226 ? -37.773 18.360  -15.600 1.00 14.38 ? 225 VAL B CB  1 
ATOM   4579  C CG1 . VAL B 1 226 ? -38.609 18.494  -14.277 1.00 13.72 ? 225 VAL B CG1 1 
ATOM   4580  C CG2 . VAL B 1 226 ? -36.383 17.818  -15.307 1.00 15.00 ? 225 VAL B CG2 1 
ATOM   4581  N N   . SER B 1 227 ? -40.947 17.291  -16.749 1.00 14.54 ? 226 SER B N   1 
ATOM   4582  C CA  . SER B 1 227 ? -42.331 17.704  -16.956 1.00 15.02 ? 226 SER B CA  1 
ATOM   4583  C C   . SER B 1 227 ? -43.019 17.868  -15.605 1.00 15.78 ? 226 SER B C   1 
ATOM   4584  O O   . SER B 1 227 ? -42.802 17.073  -14.667 1.00 15.57 ? 226 SER B O   1 
ATOM   4585  C CB  . SER B 1 227 ? -43.070 16.686  -17.812 1.00 14.64 ? 226 SER B CB  1 
ATOM   4586  O OG  . SER B 1 227 ? -42.569 16.698  -19.146 1.00 16.21 ? 226 SER B OG  1 
ATOM   4587  N N   . VAL B 1 228 ? -43.793 18.938  -15.491 1.00 16.71 ? 227 VAL B N   1 
ATOM   4588  C CA  . VAL B 1 228 ? -44.346 19.373  -14.205 1.00 17.96 ? 227 VAL B CA  1 
ATOM   4589  C C   . VAL B 1 228 ? -45.700 20.051  -14.453 1.00 18.41 ? 227 VAL B C   1 
ATOM   4590  O O   . VAL B 1 228 ? -45.921 20.607  -15.516 1.00 18.24 ? 227 VAL B O   1 
ATOM   4591  C CB  . VAL B 1 228 ? -43.343 20.334  -13.477 1.00 17.90 ? 227 VAL B CB  1 
ATOM   4592  C CG1 . VAL B 1 228 ? -43.142 21.624  -14.267 1.00 17.54 ? 227 VAL B CG1 1 
ATOM   4593  C CG2 . VAL B 1 228 ? -43.779 20.649  -12.056 1.00 18.28 ? 227 VAL B CG2 1 
ATOM   4594  N N   . ASN B 1 229 ? -46.596 19.974  -13.470 1.00 19.34 ? 228 ASN B N   1 
ATOM   4595  C CA  . ASN B 1 229 ? -47.889 20.693  -13.496 1.00 19.60 ? 228 ASN B CA  1 
ATOM   4596  C C   . ASN B 1 229 ? -47.948 21.864  -12.529 1.00 20.52 ? 228 ASN B C   1 
ATOM   4597  O O   . ASN B 1 229 ? -48.482 22.907  -12.850 1.00 20.04 ? 228 ASN B O   1 
ATOM   4598  C CB  . ASN B 1 229 ? -49.037 19.732  -13.161 1.00 19.79 ? 228 ASN B CB  1 
ATOM   4599  C CG  . ASN B 1 229 ? -49.363 18.798  -14.307 1.00 19.28 ? 228 ASN B CG  1 
ATOM   4600  O OD1 . ASN B 1 229 ? -49.308 19.201  -15.476 1.00 21.32 ? 228 ASN B OD1 1 
ATOM   4601  N ND2 . ASN B 1 229 ? -49.742 17.552  -13.989 1.00 19.65 ? 228 ASN B ND2 1 
ATOM   4602  N N   . CYS B 1 230 ? -47.396 21.682  -11.343 1.00 22.50 ? 229 CYS B N   1 
ATOM   4603  C CA  . CYS B 1 230 ? -47.520 22.672  -10.290 1.00 22.80 ? 229 CYS B CA  1 
ATOM   4604  C C   . CYS B 1 230 ? -46.804 23.977  -10.617 1.00 22.81 ? 229 CYS B C   1 
ATOM   4605  O O   . CYS B 1 230 ? -45.638 24.011  -10.987 1.00 21.66 ? 229 CYS B O   1 
ATOM   4606  C CB  . CYS B 1 230 ? -47.000 22.102  -8.975  1.00 23.37 ? 229 CYS B CB  1 
ATOM   4607  S SG  . CYS B 1 230 ? -47.136 23.272  -7.601  1.00 27.10 ? 229 CYS B SG  1 
ATOM   4608  N N   . GLU B 1 231 ? -47.528 25.058  -10.420 1.00 23.32 ? 230 GLU B N   1 
ATOM   4609  C CA  . GLU B 1 231 ? -47.108 26.376  -10.849 1.00 24.24 ? 230 GLU B CA  1 
ATOM   4610  C C   . GLU B 1 231 ? -45.821 26.888  -10.181 1.00 23.87 ? 230 GLU B C   1 
ATOM   4611  O O   . GLU B 1 231 ? -44.907 27.380  -10.850 1.00 24.02 ? 230 GLU B O   1 
ATOM   4612  C CB  . GLU B 1 231 ? -48.274 27.330  -10.596 1.00 24.64 ? 230 GLU B CB  1 
ATOM   4613  C CG  . GLU B 1 231 ? -48.176 28.594  -11.332 1.00 27.77 ? 230 GLU B CG  1 
ATOM   4614  C CD  . GLU B 1 231 ? -48.253 28.420  -12.838 1.00 30.00 ? 230 GLU B CD  1 
ATOM   4615  O OE1 . GLU B 1 231 ? -47.778 29.348  -13.514 1.00 33.66 ? 230 GLU B OE1 1 
ATOM   4616  O OE2 . GLU B 1 231 ? -48.783 27.403  -13.343 1.00 31.56 ? 230 GLU B OE2 1 
ATOM   4617  N N   . SER B 1 232 ? -45.747 26.763  -8.867  1.00 23.92 ? 231 SER B N   1 
ATOM   4618  C CA  . SER B 1 232 ? -44.606 27.259  -8.096  1.00 23.96 ? 231 SER B CA  1 
ATOM   4619  C C   . SER B 1 232 ? -43.400 26.373  -8.290  1.00 23.14 ? 231 SER B C   1 
ATOM   4620  O O   . SER B 1 232 ? -42.282 26.846  -8.417  1.00 22.58 ? 231 SER B O   1 
ATOM   4621  C CB  . SER B 1 232 ? -44.948 27.249  -6.620  1.00 24.12 ? 231 SER B CB  1 
ATOM   4622  O OG  . SER B 1 232 ? -45.399 25.957  -6.317  1.00 26.47 ? 231 SER B OG  1 
ATOM   4623  N N   . LEU B 1 233 ? -43.632 25.073  -8.240  1.00 22.35 ? 232 LEU B N   1 
ATOM   4624  C CA  . LEU B 1 233 ? -42.609 24.104  -8.594  1.00 22.30 ? 232 LEU B CA  1 
ATOM   4625  C C   . LEU B 1 233 ? -41.963 24.443  -9.965  1.00 21.65 ? 232 LEU B C   1 
ATOM   4626  O O   . LEU B 1 233 ? -40.738 24.462  -10.116 1.00 21.14 ? 232 LEU B O   1 
ATOM   4627  C CB  . LEU B 1 233 ? -43.260 22.723  -8.625  1.00 22.47 ? 232 LEU B CB  1 
ATOM   4628  C CG  . LEU B 1 233 ? -42.364 21.505  -8.719  1.00 22.92 ? 232 LEU B CG  1 
ATOM   4629  C CD1 . LEU B 1 233 ? -41.132 21.634  -7.821  1.00 23.02 ? 232 LEU B CD1 1 
ATOM   4630  C CD2 . LEU B 1 233 ? -43.196 20.279  -8.369  1.00 22.88 ? 232 LEU B CD2 1 
ATOM   4631  N N   . HIS B 1 234 ? -42.809 24.724  -10.949 1.00 21.25 ? 233 HIS B N   1 
ATOM   4632  C CA  . HIS B 1 234 ? -42.357 25.060  -12.285 1.00 20.58 ? 233 HIS B CA  1 
ATOM   4633  C C   . HIS B 1 234 ? -41.497 26.313  -12.231 1.00 20.99 ? 233 HIS B C   1 
ATOM   4634  O O   . HIS B 1 234 ? -40.401 26.350  -12.791 1.00 19.82 ? 233 HIS B O   1 
ATOM   4635  C CB  . HIS B 1 234 ? -43.534 25.293  -13.235 1.00 20.23 ? 233 HIS B CB  1 
ATOM   4636  C CG  . HIS B 1 234 ? -43.119 25.869  -14.553 1.00 20.95 ? 233 HIS B CG  1 
ATOM   4637  N ND1 . HIS B 1 234 ? -43.551 27.097  -15.001 1.00 20.29 ? 233 HIS B ND1 1 
ATOM   4638  C CD2 . HIS B 1 234 ? -42.243 25.419  -15.486 1.00 20.27 ? 233 HIS B CD2 1 
ATOM   4639  C CE1 . HIS B 1 234 ? -42.999 27.357  -16.176 1.00 19.76 ? 233 HIS B CE1 1 
ATOM   4640  N NE2 . HIS B 1 234 ? -42.199 26.358  -16.489 1.00 20.01 ? 233 HIS B NE2 1 
ATOM   4641  N N   . ASN B 1 235 ? -42.010 27.338  -11.546 1.00 21.36 ? 234 ASN B N   1 
ATOM   4642  C CA  . ASN B 1 235 ? -41.317 28.609  -11.438 1.00 21.61 ? 234 ASN B CA  1 
ATOM   4643  C C   . ASN B 1 235 ? -39.967 28.427  -10.751 1.00 21.33 ? 234 ASN B C   1 
ATOM   4644  O O   . ASN B 1 235 ? -38.977 29.043  -11.136 1.00 21.67 ? 234 ASN B O   1 
ATOM   4645  C CB  . ASN B 1 235 ? -42.188 29.623  -10.698 1.00 21.69 ? 234 ASN B CB  1 
ATOM   4646  C CG  . ASN B 1 235 ? -43.409 30.046  -11.506 1.00 22.77 ? 234 ASN B CG  1 
ATOM   4647  O OD1 . ASN B 1 235 ? -43.389 30.015  -12.734 1.00 22.41 ? 234 ASN B OD1 1 
ATOM   4648  N ND2 . ASN B 1 235 ? -44.476 30.442  -10.817 1.00 21.11 ? 234 ASN B ND2 1 
ATOM   4649  N N   . ARG B 1 236 ? -39.929 27.555  -9.759  1.00 20.55 ? 235 ARG B N   1 
ATOM   4650  C CA  . ARG B 1 236 ? -38.680 27.246  -9.087  1.00 20.90 ? 235 ARG B CA  1 
ATOM   4651  C C   . ARG B 1 236 ? -37.694 26.516  -10.015 1.00 20.02 ? 235 ARG B C   1 
ATOM   4652  O O   . ARG B 1 236 ? -36.504 26.827  -10.022 1.00 20.12 ? 235 ARG B O   1 
ATOM   4653  C CB  . ARG B 1 236 ? -38.945 26.410  -7.846  1.00 20.77 ? 235 ARG B CB  1 
ATOM   4654  C CG  . ARG B 1 236 ? -39.610 27.187  -6.709  1.00 21.86 ? 235 ARG B CG  1 
ATOM   4655  C CD  . ARG B 1 236 ? -40.227 26.230  -5.693  1.00 21.72 ? 235 ARG B CD  1 
ATOM   4656  N NE  . ARG B 1 236 ? -39.207 25.421  -5.027  1.00 23.18 ? 235 ARG B NE  1 
ATOM   4657  C CZ  . ARG B 1 236 ? -39.473 24.423  -4.192  1.00 23.35 ? 235 ARG B CZ  1 
ATOM   4658  N NH1 . ARG B 1 236 ? -40.718 24.080  -3.921  1.00 23.38 ? 235 ARG B NH1 1 
ATOM   4659  N NH2 . ARG B 1 236 ? -38.477 23.759  -3.637  1.00 25.41 ? 235 ARG B NH2 1 
ATOM   4660  N N   . LEU B 1 237 ? -38.196 25.559  -10.794 1.00 18.58 ? 236 LEU B N   1 
ATOM   4661  C CA  . LEU B 1 237 ? -37.344 24.804  -11.732 1.00 17.62 ? 236 LEU B CA  1 
ATOM   4662  C C   . LEU B 1 237 ? -36.801 25.693  -12.845 1.00 17.75 ? 236 LEU B C   1 
ATOM   4663  O O   . LEU B 1 237 ? -35.663 25.516  -13.309 1.00 18.41 ? 236 LEU B O   1 
ATOM   4664  C CB  . LEU B 1 237 ? -38.147 23.647  -12.346 1.00 17.54 ? 236 LEU B CB  1 
ATOM   4665  C CG  . LEU B 1 237 ? -38.311 22.438  -11.438 1.00 17.16 ? 236 LEU B CG  1 
ATOM   4666  C CD1 . LEU B 1 237 ? -39.518 21.595  -11.871 1.00 16.32 ? 236 LEU B CD1 1 
ATOM   4667  C CD2 . LEU B 1 237 ? -36.998 21.632  -11.432 1.00 17.56 ? 236 LEU B CD2 1 
ATOM   4668  N N   . ARG B 1 238 ? -37.633 26.639  -13.275 1.00 16.61 ? 237 ARG B N   1 
ATOM   4669  C CA  . ARG B 1 238 ? -37.317 27.498  -14.395 1.00 17.31 ? 237 ARG B CA  1 
ATOM   4670  C C   . ARG B 1 238 ? -36.214 28.486  -14.004 1.00 17.49 ? 237 ARG B C   1 
ATOM   4671  O O   . ARG B 1 238 ? -35.252 28.705  -14.735 1.00 16.69 ? 237 ARG B O   1 
ATOM   4672  C CB  . ARG B 1 238 ? -38.587 28.217  -14.834 1.00 17.01 ? 237 ARG B CB  1 
ATOM   4673  C CG  . ARG B 1 238 ? -38.462 28.981  -16.129 1.00 18.15 ? 237 ARG B CG  1 
ATOM   4674  C CD  . ARG B 1 238 ? -38.179 28.064  -17.314 1.00 18.72 ? 237 ARG B CD  1 
ATOM   4675  N NE  . ARG B 1 238 ? -39.349 27.282  -17.679 1.00 17.80 ? 237 ARG B NE  1 
ATOM   4676  C CZ  . ARG B 1 238 ? -39.370 26.365  -18.648 1.00 20.07 ? 237 ARG B CZ  1 
ATOM   4677  N NH1 . ARG B 1 238 ? -38.279 26.104  -19.350 1.00 20.03 ? 237 ARG B NH1 1 
ATOM   4678  N NH2 . ARG B 1 238 ? -40.500 25.715  -18.922 1.00 19.50 ? 237 ARG B NH2 1 
ATOM   4679  N N   . PHE B 1 239 ? -36.366 29.070  -12.822 1.00 18.21 ? 238 PHE B N   1 
ATOM   4680  C CA  . PHE B 1 239 ? -35.320 29.860  -12.229 1.00 18.16 ? 238 PHE B CA  1 
ATOM   4681  C C   . PHE B 1 239 ? -33.979 29.134  -12.225 1.00 17.56 ? 238 PHE B C   1 
ATOM   4682  O O   . PHE B 1 239 ? -32.972 29.734  -12.575 1.00 18.49 ? 238 PHE B O   1 
ATOM   4683  C CB  . PHE B 1 239 ? -35.684 30.245  -10.800 1.00 19.04 ? 238 PHE B CB  1 
ATOM   4684  C CG  . PHE B 1 239 ? -34.608 31.031  -10.109 1.00 19.65 ? 238 PHE B CG  1 
ATOM   4685  C CD1 . PHE B 1 239 ? -34.507 32.407  -10.293 1.00 20.98 ? 238 PHE B CD1 1 
ATOM   4686  C CD2 . PHE B 1 239 ? -33.669 30.391  -9.310  1.00 22.08 ? 238 PHE B CD2 1 
ATOM   4687  C CE1 . PHE B 1 239 ? -33.508 33.132  -9.656  1.00 21.42 ? 238 PHE B CE1 1 
ATOM   4688  C CE2 . PHE B 1 239 ? -32.665 31.110  -8.690  1.00 20.37 ? 238 PHE B CE2 1 
ATOM   4689  C CZ  . PHE B 1 239 ? -32.591 32.478  -8.865  1.00 20.83 ? 238 PHE B CZ  1 
ATOM   4690  N N   . LEU B 1 240 ? -33.966 27.864  -11.807 1.00 16.90 ? 239 LEU B N   1 
ATOM   4691  C CA  . LEU B 1 240 ? -32.737 27.048  -11.763 1.00 16.59 ? 239 LEU B CA  1 
ATOM   4692  C C   . LEU B 1 240 ? -32.202 26.590  -13.150 1.00 15.43 ? 239 LEU B C   1 
ATOM   4693  O O   . LEU B 1 240 ? -30.998 26.405  -13.328 1.00 13.95 ? 239 LEU B O   1 
ATOM   4694  C CB  . LEU B 1 240 ? -32.955 25.820  -10.863 1.00 16.86 ? 239 LEU B CB  1 
ATOM   4695  C CG  . LEU B 1 240 ? -33.204 26.133  -9.377  1.00 18.58 ? 239 LEU B CG  1 
ATOM   4696  C CD1 . LEU B 1 240 ? -33.686 24.881  -8.601  1.00 18.12 ? 239 LEU B CD1 1 
ATOM   4697  C CD2 . LEU B 1 240 ? -31.943 26.718  -8.715  1.00 18.96 ? 239 LEU B CD2 1 
ATOM   4698  N N   . GLN B 1 241 ? -33.092 26.444  -14.133 1.00 14.74 ? 240 GLN B N   1 
ATOM   4699  C CA  . GLN B 1 241 ? -32.673 26.161  -15.497 1.00 14.55 ? 240 GLN B CA  1 
ATOM   4700  C C   . GLN B 1 241 ? -31.794 27.321  -15.980 1.00 15.10 ? 240 GLN B C   1 
ATOM   4701  O O   . GLN B 1 241 ? -30.695 27.097  -16.513 1.00 15.81 ? 240 GLN B O   1 
ATOM   4702  C CB  . GLN B 1 241 ? -33.897 25.948  -16.394 1.00 14.81 ? 240 GLN B CB  1 
ATOM   4703  C CG  . GLN B 1 241 ? -33.604 25.530  -17.849 1.00 14.42 ? 240 GLN B CG  1 
ATOM   4704  C CD  . GLN B 1 241 ? -34.819 25.641  -18.742 1.00 14.33 ? 240 GLN B CD  1 
ATOM   4705  O OE1 . GLN B 1 241 ? -35.528 26.643  -18.688 1.00 13.08 ? 240 GLN B OE1 1 
ATOM   4706  N NE2 . GLN B 1 241 ? -35.075 24.616  -19.566 1.00 13.50 ? 240 GLN B NE2 1 
ATOM   4707  N N   . ASN B 1 242 ? -32.255 28.553  -15.762 1.00 15.61 ? 241 ASN B N   1 
ATOM   4708  C CA  . ASN B 1 242 ? -31.480 29.732  -16.133 1.00 16.11 ? 241 ASN B CA  1 
ATOM   4709  C C   . ASN B 1 242 ? -30.231 29.897  -15.280 1.00 15.85 ? 241 ASN B C   1 
ATOM   4710  O O   . ASN B 1 242 ? -29.141 30.178  -15.796 1.00 15.85 ? 241 ASN B O   1 
ATOM   4711  C CB  . ASN B 1 242 ? -32.355 30.998  -16.042 1.00 16.82 ? 241 ASN B CB  1 
ATOM   4712  C CG  . ASN B 1 242 ? -31.712 32.225  -16.707 1.00 17.38 ? 241 ASN B CG  1 
ATOM   4713  O OD1 . ASN B 1 242 ? -31.106 32.133  -17.775 1.00 21.03 ? 241 ASN B OD1 1 
ATOM   4714  N ND2 . ASN B 1 242 ? -31.854 33.378  -16.073 1.00 18.38 ? 241 ASN B ND2 1 
ATOM   4715  N N   . SER B 1 243 ? -30.402 29.750  -13.968 1.00 15.85 ? 242 SER B N   1 
ATOM   4716  C CA  . SER B 1 243 ? -29.379 30.139  -13.008 1.00 16.33 ? 242 SER B CA  1 
ATOM   4717  C C   . SER B 1 243 ? -28.209 29.167  -12.923 1.00 16.27 ? 242 SER B C   1 
ATOM   4718  O O   . SER B 1 243 ? -27.082 29.575  -12.646 1.00 16.27 ? 242 SER B O   1 
ATOM   4719  C CB  . SER B 1 243 ? -30.015 30.330  -11.620 1.00 16.60 ? 242 SER B CB  1 
ATOM   4720  O OG  . SER B 1 243 ? -30.839 31.498  -11.674 1.00 20.64 ? 242 SER B OG  1 
ATOM   4721  N N   . LEU B 1 244 ? -28.485 27.879  -13.129 1.00 15.43 ? 243 LEU B N   1 
ATOM   4722  C CA  . LEU B 1 244 ? -27.445 26.859  -13.087 1.00 14.95 ? 243 LEU B CA  1 
ATOM   4723  C C   . LEU B 1 244 ? -26.874 26.616  -14.492 1.00 14.93 ? 243 LEU B C   1 
ATOM   4724  O O   . LEU B 1 244 ? -25.740 26.192  -14.647 1.00 14.88 ? 243 LEU B O   1 
ATOM   4725  C CB  . LEU B 1 244 ? -28.010 25.571  -12.513 1.00 14.34 ? 243 LEU B CB  1 
ATOM   4726  C CG  . LEU B 1 244 ? -28.544 25.645  -11.082 1.00 14.91 ? 243 LEU B CG  1 
ATOM   4727  C CD1 . LEU B 1 244 ? -29.005 24.246  -10.649 1.00 12.92 ? 243 LEU B CD1 1 
ATOM   4728  C CD2 . LEU B 1 244 ? -27.492 26.237  -10.109 1.00 13.15 ? 243 LEU B CD2 1 
ATOM   4729  N N   . GLY B 1 245 ? -27.701 26.867  -15.497 1.00 14.62 ? 244 GLY B N   1 
ATOM   4730  C CA  . GLY B 1 245 ? -27.284 26.904  -16.886 1.00 15.11 ? 244 GLY B CA  1 
ATOM   4731  C C   . GLY B 1 245 ? -26.904 25.577  -17.502 1.00 14.71 ? 244 GLY B C   1 
ATOM   4732  O O   . GLY B 1 245 ? -26.151 25.546  -18.474 1.00 14.76 ? 244 GLY B O   1 
ATOM   4733  N N   . ALA B 1 246 ? -27.401 24.472  -16.947 1.00 13.90 ? 245 ALA B N   1 
ATOM   4734  C CA  . ALA B 1 246 ? -27.115 23.162  -17.530 1.00 13.98 ? 245 ALA B CA  1 
ATOM   4735  C C   . ALA B 1 246 ? -28.101 22.892  -18.678 1.00 13.59 ? 245 ALA B C   1 
ATOM   4736  O O   . ALA B 1 246 ? -28.957 21.991  -18.607 1.00 14.44 ? 245 ALA B O   1 
ATOM   4737  C CB  . ALA B 1 246 ? -27.207 22.091  -16.464 1.00 13.40 ? 245 ALA B CB  1 
ATOM   4738  N N   . VAL B 1 247 ? -27.974 23.682  -19.738 1.00 13.11 ? 246 VAL B N   1 
ATOM   4739  C CA  . VAL B 1 247 ? -28.994 23.741  -20.799 1.00 12.55 ? 246 VAL B CA  1 
ATOM   4740  C C   . VAL B 1 247 ? -28.568 22.995  -22.060 1.00 12.16 ? 246 VAL B C   1 
ATOM   4741  O O   . VAL B 1 247 ? -27.358 22.898  -22.343 1.00 11.39 ? 246 VAL B O   1 
ATOM   4742  C CB  . VAL B 1 247 ? -29.341 25.225  -21.108 1.00 12.67 ? 246 VAL B CB  1 
ATOM   4743  C CG1 . VAL B 1 247 ? -30.020 25.853  -19.889 1.00 10.91 ? 246 VAL B CG1 1 
ATOM   4744  C CG2 . VAL B 1 247 ? -28.087 26.029  -21.533 1.00 12.05 ? 246 VAL B CG2 1 
ATOM   4745  N N   . PRO B 1 248 ? -29.552 22.455  -22.828 1.00 12.16 ? 247 PRO B N   1 
ATOM   4746  C CA  . PRO B 1 248 ? -29.217 21.703  -24.037 1.00 12.41 ? 247 PRO B CA  1 
ATOM   4747  C C   . PRO B 1 248 ? -28.935 22.612  -25.226 1.00 12.41 ? 247 PRO B C   1 
ATOM   4748  O O   . PRO B 1 248 ? -29.514 23.686  -25.339 1.00 14.32 ? 247 PRO B O   1 
ATOM   4749  C CB  . PRO B 1 248 ? -30.497 20.913  -24.326 1.00 11.46 ? 247 PRO B CB  1 
ATOM   4750  C CG  . PRO B 1 248 ? -31.582 21.828  -23.868 1.00 13.83 ? 247 PRO B CG  1 
ATOM   4751  C CD  . PRO B 1 248 ? -31.018 22.542  -22.634 1.00 12.11 ? 247 PRO B CD  1 
ATOM   4752  N N   . SER B 1 249 ? -28.056 22.187  -26.115 1.00 12.04 ? 248 SER B N   1 
ATOM   4753  C CA  . SER B 1 249 ? -27.889 22.854  -27.409 1.00 11.58 ? 248 SER B CA  1 
ATOM   4754  C C   . SER B 1 249 ? -29.235 22.952  -28.127 1.00 10.91 ? 248 SER B C   1 
ATOM   4755  O O   . SER B 1 249 ? -29.997 21.996  -28.109 1.00 9.00  ? 248 SER B O   1 
ATOM   4756  C CB  . SER B 1 249 ? -26.967 22.037  -28.303 1.00 12.05 ? 248 SER B CB  1 
ATOM   4757  O OG  . SER B 1 249 ? -26.908 22.623  -29.592 1.00 12.74 ? 248 SER B OG  1 
ATOM   4758  N N   . PRO B 1 250 ? -29.528 24.101  -28.773 1.00 10.93 ? 249 PRO B N   1 
ATOM   4759  C CA  . PRO B 1 250 ? -30.675 24.113  -29.671 1.00 11.27 ? 249 PRO B CA  1 
ATOM   4760  C C   . PRO B 1 250 ? -30.682 23.004  -30.741 1.00 11.16 ? 249 PRO B C   1 
ATOM   4761  O O   . PRO B 1 250 ? -31.760 22.574  -31.169 1.00 10.87 ? 249 PRO B O   1 
ATOM   4762  C CB  . PRO B 1 250 ? -30.570 25.471  -30.340 1.00 11.40 ? 249 PRO B CB  1 
ATOM   4763  C CG  . PRO B 1 250 ? -29.838 26.314  -29.382 1.00 12.17 ? 249 PRO B CG  1 
ATOM   4764  C CD  . PRO B 1 250 ? -28.860 25.413  -28.734 1.00 10.87 ? 249 PRO B CD  1 
ATOM   4765  N N   . ILE B 1 251 ? -29.505 22.556  -31.176 1.00 11.77 ? 250 ILE B N   1 
ATOM   4766  C CA  . ILE B 1 251 ? -29.412 21.531  -32.223 1.00 11.47 ? 250 ILE B CA  1 
ATOM   4767  C C   . ILE B 1 251 ? -29.881 20.196  -31.658 1.00 11.77 ? 250 ILE B C   1 
ATOM   4768  O O   . ILE B 1 251 ? -30.628 19.468  -32.312 1.00 11.42 ? 250 ILE B O   1 
ATOM   4769  C CB  . ILE B 1 251 ? -27.967 21.356  -32.799 1.00 11.77 ? 250 ILE B CB  1 
ATOM   4770  C CG1 . ILE B 1 251 ? -27.422 22.680  -33.280 1.00 11.56 ? 250 ILE B CG1 1 
ATOM   4771  C CG2 . ILE B 1 251 ? -27.979 20.302  -33.924 1.00 12.08 ? 250 ILE B CG2 1 
ATOM   4772  C CD1 . ILE B 1 251 ? -26.137 22.620  -33.950 1.00 12.65 ? 250 ILE B CD1 1 
ATOM   4773  N N   . ASP B 1 252 ? -29.455 19.887  -30.434 1.00 12.39 ? 251 ASP B N   1 
ATOM   4774  C CA  . ASP B 1 252 ? -29.905 18.688  -29.730 1.00 12.65 ? 251 ASP B CA  1 
ATOM   4775  C C   . ASP B 1 252 ? -31.411 18.738  -29.457 1.00 11.68 ? 251 ASP B C   1 
ATOM   4776  O O   . ASP B 1 252 ? -32.104 17.727  -29.587 1.00 10.75 ? 251 ASP B O   1 
ATOM   4777  C CB  . ASP B 1 252 ? -29.151 18.501  -28.395 1.00 13.25 ? 251 ASP B CB  1 
ATOM   4778  C CG  . ASP B 1 252 ? -27.697 18.040  -28.589 1.00 17.83 ? 251 ASP B CG  1 
ATOM   4779  O OD1 . ASP B 1 252 ? -26.937 18.046  -27.600 1.00 19.70 ? 251 ASP B OD1 1 
ATOM   4780  O OD2 . ASP B 1 252 ? -27.295 17.686  -29.719 1.00 22.04 ? 251 ASP B OD2 1 
ATOM   4781  N N   . CYS B 1 253 ? -31.930 19.916  -29.125 1.00 10.63 ? 252 CYS B N   1 
ATOM   4782  C CA  . CYS B 1 253 ? -33.377 20.060  -28.972 1.00 10.57 ? 252 CYS B CA  1 
ATOM   4783  C C   . CYS B 1 253 ? -34.110 19.706  -30.260 1.00 10.56 ? 252 CYS B C   1 
ATOM   4784  O O   . CYS B 1 253 ? -35.123 19.000  -30.243 1.00 10.14 ? 252 CYS B O   1 
ATOM   4785  C CB  . CYS B 1 253 ? -33.747 21.486  -28.549 1.00 10.91 ? 252 CYS B CB  1 
ATOM   4786  S SG  . CYS B 1 253 ? -33.167 21.922  -26.925 1.00 11.67 ? 252 CYS B SG  1 
ATOM   4787  N N   . TYR B 1 254 ? -33.608 20.232  -31.376 1.00 10.69 ? 253 TYR B N   1 
ATOM   4788  C CA  . TYR B 1 254 ? -34.161 19.911  -32.699 1.00 11.22 ? 253 TYR B CA  1 
ATOM   4789  C C   . TYR B 1 254 ? -34.152 18.409  -32.953 1.00 10.65 ? 253 TYR B C   1 
ATOM   4790  O O   . TYR B 1 254 ? -35.161 17.855  -33.361 1.00 10.57 ? 253 TYR B O   1 
ATOM   4791  C CB  . TYR B 1 254 ? -33.416 20.613  -33.832 1.00 11.59 ? 253 TYR B CB  1 
ATOM   4792  C CG  . TYR B 1 254 ? -33.972 20.215  -35.184 1.00 13.65 ? 253 TYR B CG  1 
ATOM   4793  C CD1 . TYR B 1 254 ? -35.133 20.792  -35.654 1.00 16.76 ? 253 TYR B CD1 1 
ATOM   4794  C CD2 . TYR B 1 254 ? -33.363 19.244  -35.969 1.00 13.60 ? 253 TYR B CD2 1 
ATOM   4795  C CE1 . TYR B 1 254 ? -35.653 20.449  -36.886 1.00 15.52 ? 253 TYR B CE1 1 
ATOM   4796  C CE2 . TYR B 1 254 ? -33.916 18.867  -37.205 1.00 13.90 ? 253 TYR B CE2 1 
ATOM   4797  C CZ  . TYR B 1 254 ? -35.051 19.485  -37.646 1.00 13.50 ? 253 TYR B CZ  1 
ATOM   4798  O OH  . TYR B 1 254 ? -35.667 19.169  -38.860 1.00 15.37 ? 253 TYR B OH  1 
ATOM   4799  N N   . LEU B 1 255 ? -33.014 17.763  -32.710 1.00 11.15 ? 254 LEU B N   1 
ATOM   4800  C CA  . LEU B 1 255 ? -32.872 16.319  -32.947 1.00 11.46 ? 254 LEU B CA  1 
ATOM   4801  C C   . LEU B 1 255 ? -33.774 15.487  -32.039 1.00 11.21 ? 254 LEU B C   1 
ATOM   4802  O O   . LEU B 1 255 ? -34.355 14.489  -32.471 1.00 10.50 ? 254 LEU B O   1 
ATOM   4803  C CB  . LEU B 1 255 ? -31.409 15.868  -32.776 1.00 11.73 ? 254 LEU B CB  1 
ATOM   4804  C CG  . LEU B 1 255 ? -30.438 16.370  -33.852 1.00 12.06 ? 254 LEU B CG  1 
ATOM   4805  C CD1 . LEU B 1 255 ? -28.984 15.982  -33.510 1.00 11.21 ? 254 LEU B CD1 1 
ATOM   4806  C CD2 . LEU B 1 255 ? -30.848 15.871  -35.255 1.00 11.51 ? 254 LEU B CD2 1 
ATOM   4807  N N   . CYS B 1 256 ? -33.884 15.899  -30.784 1.00 11.01 ? 255 CYS B N   1 
ATOM   4808  C CA  . CYS B 1 256 ? -34.813 15.226  -29.873 1.00 10.75 ? 255 CYS B CA  1 
ATOM   4809  C C   . CYS B 1 256 ? -36.268 15.415  -30.348 1.00 10.13 ? 255 CYS B C   1 
ATOM   4810  O O   . CYS B 1 256 ? -37.053 14.476  -30.401 1.00 9.47  ? 255 CYS B O   1 
ATOM   4811  C CB  . CYS B 1 256 ? -34.604 15.708  -28.445 1.00 10.92 ? 255 CYS B CB  1 
ATOM   4812  S SG  . CYS B 1 256 ? -35.534 14.747  -27.195 1.00 12.47 ? 255 CYS B SG  1 
ATOM   4813  N N   . ASN B 1 257 ? -36.616 16.625  -30.738 1.00 9.67  ? 256 ASN B N   1 
ATOM   4814  C CA  . ASN B 1 257 ? -37.970 16.880  -31.187 1.00 9.57  ? 256 ASN B CA  1 
ATOM   4815  C C   . ASN B 1 257 ? -38.253 16.047  -32.448 1.00 9.71  ? 256 ASN B C   1 
ATOM   4816  O O   . ASN B 1 257 ? -39.361 15.574  -32.636 1.00 9.50  ? 256 ASN B O   1 
ATOM   4817  C CB  . ASN B 1 257 ? -38.186 18.383  -31.394 1.00 9.41  ? 256 ASN B CB  1 
ATOM   4818  C CG  . ASN B 1 257 ? -39.636 18.834  -31.195 1.00 10.15 ? 256 ASN B CG  1 
ATOM   4819  O OD1 . ASN B 1 257 ? -39.869 19.999  -30.952 1.00 14.07 ? 256 ASN B OD1 1 
ATOM   4820  N ND2 . ASN B 1 257 ? -40.595 17.937  -31.343 1.00 10.58 ? 256 ASN B ND2 1 
ATOM   4821  N N   . ARG B 1 258 ? -37.242 15.847  -33.288 1.00 8.99  ? 257 ARG B N   1 
ATOM   4822  C CA  . ARG B 1 258 ? -37.407 15.092  -34.516 1.00 9.50  ? 257 ARG B CA  1 
ATOM   4823  C C   . ARG B 1 258 ? -37.616 13.621  -34.172 1.00 9.63  ? 257 ARG B C   1 
ATOM   4824  O O   . ARG B 1 258 ? -38.453 12.928  -34.784 1.00 10.31 ? 257 ARG B O   1 
ATOM   4825  C CB  . ARG B 1 258 ? -36.154 15.249  -35.381 1.00 9.65  ? 257 ARG B CB  1 
ATOM   4826  C CG  . ARG B 1 258 ? -36.152 14.549  -36.751 1.00 9.53  ? 257 ARG B CG  1 
ATOM   4827  C CD  . ARG B 1 258 ? -34.761 14.669  -37.348 1.00 9.34  ? 257 ARG B CD  1 
ATOM   4828  N NE  . ARG B 1 258 ? -34.682 14.686  -38.814 1.00 7.59  ? 257 ARG B NE  1 
ATOM   4829  C CZ  . ARG B 1 258 ? -34.237 13.692  -39.577 1.00 9.25  ? 257 ARG B CZ  1 
ATOM   4830  N NH1 . ARG B 1 258 ? -33.917 12.511  -39.085 1.00 12.45 ? 257 ARG B NH1 1 
ATOM   4831  N NH2 . ARG B 1 258 ? -34.129 13.876  -40.879 1.00 12.87 ? 257 ARG B NH2 1 
ATOM   4832  N N   . GLY B 1 259 ? -36.830 13.141  -33.210 1.00 9.74  ? 258 GLY B N   1 
ATOM   4833  C CA  . GLY B 1 259 ? -36.936 11.750  -32.775 1.00 10.07 ? 258 GLY B CA  1 
ATOM   4834  C C   . GLY B 1 259 ? -38.321 11.467  -32.209 1.00 10.14 ? 258 GLY B C   1 
ATOM   4835  O O   . GLY B 1 259 ? -38.868 10.412  -32.416 1.00 8.90  ? 258 GLY B O   1 
ATOM   4836  N N   . LEU B 1 260 ? -38.875 12.436  -31.489 1.00 10.89 ? 259 LEU B N   1 
ATOM   4837  C CA  . LEU B 1 260 ? -40.184 12.302  -30.846 1.00 11.94 ? 259 LEU B CA  1 
ATOM   4838  C C   . LEU B 1 260 ? -41.324 12.111  -31.844 1.00 11.25 ? 259 LEU B C   1 
ATOM   4839  O O   . LEU B 1 260 ? -42.363 11.542  -31.502 1.00 9.82  ? 259 LEU B O   1 
ATOM   4840  C CB  . LEU B 1 260 ? -40.527 13.566  -30.053 1.00 12.46 ? 259 LEU B CB  1 
ATOM   4841  C CG  . LEU B 1 260 ? -40.000 13.881  -28.661 1.00 15.88 ? 259 LEU B CG  1 
ATOM   4842  C CD1 . LEU B 1 260 ? -40.711 15.188  -28.243 1.00 14.10 ? 259 LEU B CD1 1 
ATOM   4843  C CD2 . LEU B 1 260 ? -40.278 12.743  -27.714 1.00 15.25 ? 259 LEU B CD2 1 
ATOM   4844  N N   . LYS B 1 261 ? -41.148 12.622  -33.060 1.00 11.01 ? 260 LYS B N   1 
ATOM   4845  C CA  . LYS B 1 261 ? -42.191 12.509  -34.082 1.00 10.83 ? 260 LYS B CA  1 
ATOM   4846  C C   . LYS B 1 261 ? -42.446 11.040  -34.507 1.00 10.77 ? 260 LYS B C   1 
ATOM   4847  O O   . LYS B 1 261 ? -43.440 10.758  -35.170 1.00 9.71  ? 260 LYS B O   1 
ATOM   4848  C CB  . LYS B 1 261 ? -41.875 13.354  -35.321 1.00 11.71 ? 260 LYS B CB  1 
ATOM   4849  C CG  . LYS B 1 261 ? -41.431 14.784  -35.034 1.00 14.54 ? 260 LYS B CG  1 
ATOM   4850  C CD  . LYS B 1 261 ? -42.501 15.822  -35.081 1.00 15.46 ? 260 LYS B CD  1 
ATOM   4851  C CE  . LYS B 1 261 ? -41.936 17.229  -34.707 1.00 14.68 ? 260 LYS B CE  1 
ATOM   4852  N NZ  . LYS B 1 261 ? -41.505 18.145  -35.795 1.00 13.37 ? 260 LYS B NZ  1 
ATOM   4853  N N   . THR B 1 262 ? -41.545 10.122  -34.124 1.00 9.90  ? 261 THR B N   1 
ATOM   4854  C CA  . THR B 1 262 ? -41.749 8.695   -34.389 1.00 9.68  ? 261 THR B CA  1 
ATOM   4855  C C   . THR B 1 262 ? -41.828 7.863   -33.115 1.00 9.04  ? 261 THR B C   1 
ATOM   4856  O O   . THR B 1 262 ? -41.827 6.651   -33.192 1.00 9.89  ? 261 THR B O   1 
ATOM   4857  C CB  . THR B 1 262 ? -40.617 8.093   -35.278 1.00 9.39  ? 261 THR B CB  1 
ATOM   4858  O OG1 . THR B 1 262 ? -39.351 8.307   -34.641 1.00 8.89  ? 261 THR B OG1 1 
ATOM   4859  C CG2 . THR B 1 262 ? -40.613 8.717   -36.697 1.00 8.88  ? 261 THR B CG2 1 
ATOM   4860  N N   . LEU B 1 263 ? -41.902 8.503   -31.957 1.00 9.83  ? 262 LEU B N   1 
ATOM   4861  C CA  . LEU B 1 263 ? -41.943 7.772   -30.670 1.00 10.36 ? 262 LEU B CA  1 
ATOM   4862  C C   . LEU B 1 263 ? -43.035 6.720   -30.652 1.00 10.42 ? 262 LEU B C   1 
ATOM   4863  O O   . LEU B 1 263 ? -42.811 5.617   -30.185 1.00 11.71 ? 262 LEU B O   1 
ATOM   4864  C CB  . LEU B 1 263 ? -42.197 8.735   -29.511 1.00 9.76  ? 262 LEU B CB  1 
ATOM   4865  C CG  . LEU B 1 263 ? -42.207 8.200   -28.089 1.00 9.52  ? 262 LEU B CG  1 
ATOM   4866  C CD1 . LEU B 1 263 ? -40.842 7.642   -27.700 1.00 8.42  ? 262 LEU B CD1 1 
ATOM   4867  C CD2 . LEU B 1 263 ? -42.571 9.351   -27.134 1.00 9.31  ? 262 LEU B CD2 1 
ATOM   4868  N N   . HIS B 1 264 ? -44.221 7.078   -31.128 1.00 10.91 ? 263 HIS B N   1 
ATOM   4869  C CA  . HIS B 1 264 ? -45.348 6.138   -31.146 1.00 11.99 ? 263 HIS B CA  1 
ATOM   4870  C C   . HIS B 1 264 ? -45.051 4.896   -31.981 1.00 10.72 ? 263 HIS B C   1 
ATOM   4871  O O   . HIS B 1 264 ? -45.261 3.781   -31.515 1.00 11.96 ? 263 HIS B O   1 
ATOM   4872  C CB  . HIS B 1 264 ? -46.695 6.804   -31.564 1.00 12.09 ? 263 HIS B CB  1 
ATOM   4873  C CG  . HIS B 1 264 ? -46.726 7.373   -32.953 1.00 14.09 ? 263 HIS B CG  1 
ATOM   4874  N ND1 . HIS B 1 264 ? -45.801 8.291   -33.411 1.00 17.26 ? 263 HIS B ND1 1 
ATOM   4875  C CD2 . HIS B 1 264 ? -47.621 7.211   -33.963 1.00 13.77 ? 263 HIS B CD2 1 
ATOM   4876  C CE1 . HIS B 1 264 ? -46.107 8.647   -34.650 1.00 16.39 ? 263 HIS B CE1 1 
ATOM   4877  N NE2 . HIS B 1 264 ? -47.216 8.017   -35.005 1.00 13.15 ? 263 HIS B NE2 1 
ATOM   4878  N N   . VAL B 1 265 ? -44.552 5.077   -33.195 1.00 10.63 ? 264 VAL B N   1 
ATOM   4879  C CA  . VAL B 1 265 ? -44.289 3.947   -34.088 1.00 9.88  ? 264 VAL B CA  1 
ATOM   4880  C C   . VAL B 1 265 ? -43.025 3.149   -33.672 1.00 10.20 ? 264 VAL B C   1 
ATOM   4881  O O   . VAL B 1 265 ? -42.963 1.941   -33.877 1.00 10.81 ? 264 VAL B O   1 
ATOM   4882  C CB  . VAL B 1 265 ? -44.293 4.314   -35.612 1.00 10.18 ? 264 VAL B CB  1 
ATOM   4883  C CG1 . VAL B 1 265 ? -45.684 4.799   -36.047 1.00 9.10  ? 264 VAL B CG1 1 
ATOM   4884  C CG2 . VAL B 1 265 ? -43.185 5.277   -36.008 1.00 8.13  ? 264 VAL B CG2 1 
ATOM   4885  N N   . ARG B 1 266 ? -42.062 3.824   -33.053 1.00 10.24 ? 265 ARG B N   1 
ATOM   4886  C CA  . ARG B 1 266 ? -40.897 3.155   -32.465 1.00 9.96  ? 265 ARG B CA  1 
ATOM   4887  C C   . ARG B 1 266 ? -41.277 2.301   -31.269 1.00 9.97  ? 265 ARG B C   1 
ATOM   4888  O O   . ARG B 1 266 ? -40.963 1.128   -31.235 1.00 9.48  ? 265 ARG B O   1 
ATOM   4889  C CB  . ARG B 1 266 ? -39.829 4.170   -32.068 1.00 9.50  ? 265 ARG B CB  1 
ATOM   4890  C CG  . ARG B 1 266 ? -39.135 4.742   -33.276 1.00 9.53  ? 265 ARG B CG  1 
ATOM   4891  C CD  . ARG B 1 266 ? -37.976 5.641   -32.939 1.00 9.63  ? 265 ARG B CD  1 
ATOM   4892  N NE  . ARG B 1 266 ? -38.351 6.888   -32.278 1.00 10.63 ? 265 ARG B NE  1 
ATOM   4893  C CZ  . ARG B 1 266 ? -38.240 7.137   -30.979 1.00 12.55 ? 265 ARG B CZ  1 
ATOM   4894  N NH1 . ARG B 1 266 ? -37.818 6.204   -30.125 1.00 14.22 ? 265 ARG B NH1 1 
ATOM   4895  N NH2 . ARG B 1 266 ? -38.547 8.338   -30.525 1.00 10.93 ? 265 ARG B NH2 1 
ATOM   4896  N N   . MET B 1 267 ? -41.989 2.893   -30.316 1.00 10.33 ? 266 MET B N   1 
ATOM   4897  C CA  . MET B 1 267 ? -42.314 2.215   -29.075 1.00 10.89 ? 266 MET B CA  1 
ATOM   4898  C C   . MET B 1 267 ? -43.212 1.031   -29.327 1.00 11.52 ? 266 MET B C   1 
ATOM   4899  O O   . MET B 1 267 ? -43.046 0.009   -28.678 1.00 12.22 ? 266 MET B O   1 
ATOM   4900  C CB  . MET B 1 267 ? -42.953 3.146   -28.038 1.00 10.47 ? 266 MET B CB  1 
ATOM   4901  C CG  . MET B 1 267 ? -42.068 4.247   -27.525 1.00 11.88 ? 266 MET B CG  1 
ATOM   4902  S SD  . MET B 1 267 ? -40.390 3.759   -27.079 1.00 12.69 ? 266 MET B SD  1 
ATOM   4903  C CE  . MET B 1 267 ? -40.667 2.764   -25.627 1.00 11.63 ? 266 MET B CE  1 
ATOM   4904  N N   . GLU B 1 268 ? -44.160 1.128   -30.246 1.00 12.35 ? 267 GLU B N   1 
ATOM   4905  C CA  . GLU B 1 268 ? -44.976 -0.048  -30.549 1.00 12.89 ? 267 GLU B CA  1 
ATOM   4906  C C   . GLU B 1 268 ? -44.116 -1.196  -31.076 1.00 13.45 ? 267 GLU B C   1 
ATOM   4907  O O   . GLU B 1 268 ? -44.392 -2.370  -30.787 1.00 12.93 ? 267 GLU B O   1 
ATOM   4908  C CB  . GLU B 1 268 ? -46.068 0.265   -31.564 1.00 13.60 ? 267 GLU B CB  1 
ATOM   4909  C CG  . GLU B 1 268 ? -47.149 1.163   -31.018 1.00 16.17 ? 267 GLU B CG  1 
ATOM   4910  C CD  . GLU B 1 268 ? -48.057 0.476   -29.996 1.00 19.73 ? 267 GLU B CD  1 
ATOM   4911  O OE1 . GLU B 1 268 ? -48.907 1.181   -29.434 1.00 21.44 ? 267 GLU B OE1 1 
ATOM   4912  O OE2 . GLU B 1 268 ? -47.919 -0.742  -29.734 1.00 19.81 ? 267 GLU B OE2 1 
ATOM   4913  N N   . LYS B 1 269 ? -43.087 -0.853  -31.860 1.00 13.50 ? 268 LYS B N   1 
ATOM   4914  C CA  . LYS B 1 269 ? -42.181 -1.859  -32.406 1.00 13.54 ? 268 LYS B CA  1 
ATOM   4915  C C   . LYS B 1 269 ? -41.252 -2.436  -31.313 1.00 12.72 ? 268 LYS B C   1 
ATOM   4916  O O   . LYS B 1 269 ? -41.035 -3.628  -31.298 1.00 12.46 ? 268 LYS B O   1 
ATOM   4917  C CB  . LYS B 1 269 ? -41.381 -1.316  -33.596 1.00 13.79 ? 268 LYS B CB  1 
ATOM   4918  C CG  . LYS B 1 269 ? -40.483 -2.347  -34.305 1.00 15.59 ? 268 LYS B CG  1 
ATOM   4919  C CD  . LYS B 1 269 ? -41.253 -3.557  -34.884 1.00 19.79 ? 268 LYS B CD  1 
ATOM   4920  C CE  . LYS B 1 269 ? -42.128 -3.162  -36.100 1.00 23.39 ? 268 LYS B CE  1 
ATOM   4921  N NZ  . LYS B 1 269 ? -43.055 -4.250  -36.668 1.00 22.63 ? 268 LYS B NZ  1 
ATOM   4922  N N   . HIS B 1 270 ? -40.728 -1.596  -30.410 1.00 12.52 ? 269 HIS B N   1 
ATOM   4923  C CA  . HIS B 1 270 ? -39.970 -2.056  -29.263 1.00 12.90 ? 269 HIS B CA  1 
ATOM   4924  C C   . HIS B 1 270 ? -40.810 -3.030  -28.432 1.00 13.91 ? 269 HIS B C   1 
ATOM   4925  O O   . HIS B 1 270 ? -40.306 -4.065  -28.004 1.00 14.24 ? 269 HIS B O   1 
ATOM   4926  C CB  . HIS B 1 270 ? -39.522 -0.888  -28.372 1.00 12.57 ? 269 HIS B CB  1 
ATOM   4927  C CG  . HIS B 1 270 ? -38.373 -0.097  -28.920 1.00 11.78 ? 269 HIS B CG  1 
ATOM   4928  N ND1 . HIS B 1 270 ? -37.120 -0.639  -29.129 1.00 11.82 ? 269 HIS B ND1 1 
ATOM   4929  C CD2 . HIS B 1 270 ? -38.279 1.214   -29.264 1.00 11.44 ? 269 HIS B CD2 1 
ATOM   4930  C CE1 . HIS B 1 270 ? -36.311 0.305   -29.589 1.00 12.64 ? 269 HIS B CE1 1 
ATOM   4931  N NE2 . HIS B 1 270 ? -36.992 1.436   -29.685 1.00 11.26 ? 269 HIS B NE2 1 
ATOM   4932  N N   . PHE B 1 271 ? -42.079 -2.688  -28.209 1.00 13.85 ? 270 PHE B N   1 
ATOM   4933  C CA  . PHE B 1 271 ? -43.009 -3.554  -27.471 1.00 14.82 ? 270 PHE B CA  1 
ATOM   4934  C C   . PHE B 1 271 ? -43.207 -4.886  -28.201 1.00 14.57 ? 270 PHE B C   1 
ATOM   4935  O O   . PHE B 1 271 ? -43.121 -5.941  -27.592 1.00 13.69 ? 270 PHE B O   1 
ATOM   4936  C CB  . PHE B 1 271 ? -44.347 -2.815  -27.298 1.00 15.18 ? 270 PHE B CB  1 
ATOM   4937  C CG  . PHE B 1 271 ? -45.349 -3.482  -26.389 1.00 15.20 ? 270 PHE B CG  1 
ATOM   4938  C CD1 . PHE B 1 271 ? -45.023 -4.559  -25.570 1.00 15.85 ? 270 PHE B CD1 1 
ATOM   4939  C CD2 . PHE B 1 271 ? -46.649 -2.978  -26.322 1.00 17.20 ? 270 PHE B CD2 1 
ATOM   4940  C CE1 . PHE B 1 271 ? -45.968 -5.121  -24.731 1.00 14.55 ? 270 PHE B CE1 1 
ATOM   4941  C CE2 . PHE B 1 271 ? -47.598 -3.550  -25.472 1.00 16.36 ? 270 PHE B CE2 1 
ATOM   4942  C CZ  . PHE B 1 271 ? -47.244 -4.621  -24.682 1.00 15.09 ? 270 PHE B CZ  1 
ATOM   4943  N N   . LYS B 1 272 ? -43.465 -4.827  -29.506 1.00 15.18 ? 271 LYS B N   1 
ATOM   4944  C CA  . LYS B 1 272 ? -43.720 -6.014  -30.295 1.00 15.59 ? 271 LYS B CA  1 
ATOM   4945  C C   . LYS B 1 272 ? -42.499 -6.962  -30.334 1.00 15.59 ? 271 LYS B C   1 
ATOM   4946  O O   . LYS B 1 272 ? -42.636 -8.144  -30.072 1.00 14.77 ? 271 LYS B O   1 
ATOM   4947  C CB  . LYS B 1 272 ? -44.143 -5.623  -31.707 1.00 16.17 ? 271 LYS B CB  1 
ATOM   4948  C CG  . LYS B 1 272 ? -44.744 -6.721  -32.501 1.00 18.03 ? 271 LYS B CG  1 
ATOM   4949  C CD  . LYS B 1 272 ? -45.033 -6.310  -33.975 1.00 18.39 ? 271 LYS B CD  1 
ATOM   4950  C CE  . LYS B 1 272 ? -45.553 -7.498  -34.775 1.00 20.97 ? 271 LYS B CE  1 
ATOM   4951  N NZ  . LYS B 1 272 ? -46.626 -8.245  -34.028 1.00 23.41 ? 271 LYS B NZ  1 
ATOM   4952  N N   . ASN B 1 273 ? -41.322 -6.434  -30.668 1.00 15.03 ? 272 ASN B N   1 
ATOM   4953  C CA  . ASN B 1 273 ? -40.073 -7.222  -30.639 1.00 14.74 ? 272 ASN B CA  1 
ATOM   4954  C C   . ASN B 1 273 ? -39.712 -7.683  -29.235 1.00 14.23 ? 272 ASN B C   1 
ATOM   4955  O O   . ASN B 1 273 ? -39.191 -8.783  -29.051 1.00 14.34 ? 272 ASN B O   1 
ATOM   4956  C CB  . ASN B 1 273 ? -38.905 -6.411  -31.232 1.00 14.77 ? 272 ASN B CB  1 
ATOM   4957  C CG  . ASN B 1 273 ? -38.964 -6.327  -32.721 1.00 14.99 ? 272 ASN B CG  1 
ATOM   4958  O OD1 . ASN B 1 273 ? -39.776 -6.992  -33.334 1.00 18.84 ? 272 ASN B OD1 1 
ATOM   4959  N ND2 . ASN B 1 273 ? -38.107 -5.512  -33.319 1.00 14.23 ? 272 ASN B ND2 1 
ATOM   4960  N N   . GLY B 1 274 ? -39.973 -6.821  -28.261 1.00 13.96 ? 273 GLY B N   1 
ATOM   4961  C CA  . GLY B 1 274 ? -39.701 -7.090  -26.846 1.00 13.60 ? 273 GLY B CA  1 
ATOM   4962  C C   . GLY B 1 274 ? -40.520 -8.246  -26.307 1.00 14.35 ? 273 GLY B C   1 
ATOM   4963  O O   . GLY B 1 274 ? -39.977 -9.138  -25.633 1.00 14.96 ? 273 GLY B O   1 
ATOM   4964  N N   . MET B 1 275 ? -41.819 -8.248  -26.612 1.00 14.02 ? 274 MET B N   1 
ATOM   4965  C CA  . MET B 1 275 ? -42.685 -9.346  -26.220 1.00 15.78 ? 274 MET B CA  1 
ATOM   4966  C C   . MET B 1 275 ? -42.270 -10.661 -26.900 1.00 15.33 ? 274 MET B C   1 
ATOM   4967  O O   . MET B 1 275 ? -42.277 -11.729 -26.274 1.00 15.36 ? 274 MET B O   1 
ATOM   4968  C CB  . MET B 1 275 ? -44.142 -9.032  -26.547 1.00 16.75 ? 274 MET B CB  1 
ATOM   4969  C CG  . MET B 1 275 ? -45.117 -10.047 -26.005 1.00 20.14 ? 274 MET B CG  1 
ATOM   4970  S SD  . MET B 1 275 ? -45.307 -9.949  -24.231 1.00 24.12 ? 274 MET B SD  1 
ATOM   4971  C CE  . MET B 1 275 ? -46.559 -11.213 -23.939 1.00 24.75 ? 274 MET B CE  1 
ATOM   4972  N N   . ALA B 1 276 ? -41.928 -10.579 -28.178 1.00 14.32 ? 275 ALA B N   1 
ATOM   4973  C CA  . ALA B 1 276 ? -41.516 -11.754 -28.924 1.00 14.28 ? 275 ALA B CA  1 
ATOM   4974  C C   . ALA B 1 276 ? -40.236 -12.373 -28.354 1.00 14.06 ? 275 ALA B C   1 
ATOM   4975  O O   . ALA B 1 276 ? -40.098 -13.611 -28.262 1.00 14.28 ? 275 ALA B O   1 
ATOM   4976  C CB  . ALA B 1 276 ? -41.317 -11.412 -30.363 1.00 13.03 ? 275 ALA B CB  1 
ATOM   4977  N N   . VAL B 1 277 ? -39.297 -11.507 -27.993 1.00 13.51 ? 276 VAL B N   1 
ATOM   4978  C CA  . VAL B 1 277 ? -38.036 -11.930 -27.404 1.00 12.57 ? 276 VAL B CA  1 
ATOM   4979  C C   . VAL B 1 277 ? -38.299 -12.511 -26.016 1.00 13.82 ? 276 VAL B C   1 
ATOM   4980  O O   . VAL B 1 277 ? -37.792 -13.602 -25.674 1.00 13.38 ? 276 VAL B O   1 
ATOM   4981  C CB  . VAL B 1 277 ? -37.015 -10.764 -27.362 1.00 12.45 ? 276 VAL B CB  1 
ATOM   4982  C CG1 . VAL B 1 277 ? -35.858 -11.061 -26.390 1.00 9.93  ? 276 VAL B CG1 1 
ATOM   4983  C CG2 . VAL B 1 277 ? -36.480 -10.491 -28.776 1.00 10.66 ? 276 VAL B CG2 1 
ATOM   4984  N N   . ALA B 1 278 ? -39.104 -11.792 -25.228 1.00 13.86 ? 277 ALA B N   1 
ATOM   4985  C CA  . ALA B 1 278 ? -39.451 -12.241 -23.878 1.00 14.29 ? 277 ALA B CA  1 
ATOM   4986  C C   . ALA B 1 278 ? -40.092 -13.619 -23.917 1.00 14.67 ? 277 ALA B C   1 
ATOM   4987  O O   . ALA B 1 278 ? -39.714 -14.481 -23.133 1.00 15.18 ? 277 ALA B O   1 
ATOM   4988  C CB  . ALA B 1 278 ? -40.363 -11.256 -23.169 1.00 13.56 ? 277 ALA B CB  1 
ATOM   4989  N N   . GLN B 1 279 ? -41.070 -13.799 -24.797 1.00 15.39 ? 278 GLN B N   1 
ATOM   4990  C CA  . GLN B 1 279 ? -41.755 -15.088 -24.947 1.00 17.05 ? 278 GLN B CA  1 
ATOM   4991  C C   . GLN B 1 279 ? -40.820 -16.202 -25.434 1.00 16.49 ? 278 GLN B C   1 
ATOM   4992  O O   . GLN B 1 279 ? -40.912 -17.333 -24.969 1.00 17.61 ? 278 GLN B O   1 
ATOM   4993  C CB  . GLN B 1 279 ? -42.982 -14.961 -25.868 1.00 16.61 ? 278 GLN B CB  1 
ATOM   4994  C CG  . GLN B 1 279 ? -44.157 -14.309 -25.150 1.00 18.74 ? 278 GLN B CG  1 
ATOM   4995  C CD  . GLN B 1 279 ? -45.318 -13.904 -26.044 1.00 20.52 ? 278 GLN B CD  1 
ATOM   4996  O OE1 . GLN B 1 279 ? -45.142 -13.556 -27.219 1.00 26.75 ? 278 GLN B OE1 1 
ATOM   4997  N NE2 . GLN B 1 279 ? -46.526 -13.938 -25.477 1.00 25.37 ? 278 GLN B NE2 1 
ATOM   4998  N N   . PHE B 1 280 ? -39.952 -15.888 -26.385 1.00 16.29 ? 279 PHE B N   1 
ATOM   4999  C CA  . PHE B 1 280 ? -38.974 -16.859 -26.885 1.00 15.78 ? 279 PHE B CA  1 
ATOM   5000  C C   . PHE B 1 280 ? -38.111 -17.350 -25.740 1.00 15.56 ? 279 PHE B C   1 
ATOM   5001  O O   . PHE B 1 280 ? -37.987 -18.533 -25.532 1.00 15.99 ? 279 PHE B O   1 
ATOM   5002  C CB  . PHE B 1 280 ? -38.095 -16.272 -27.985 1.00 15.87 ? 279 PHE B CB  1 
ATOM   5003  C CG  . PHE B 1 280 ? -36.897 -17.120 -28.319 1.00 16.63 ? 279 PHE B CG  1 
ATOM   5004  C CD1 . PHE B 1 280 ? -37.014 -18.209 -29.178 1.00 19.17 ? 279 PHE B CD1 1 
ATOM   5005  C CD2 . PHE B 1 280 ? -35.646 -16.833 -27.768 1.00 17.13 ? 279 PHE B CD2 1 
ATOM   5006  C CE1 . PHE B 1 280 ? -35.896 -18.997 -29.483 1.00 18.94 ? 279 PHE B CE1 1 
ATOM   5007  C CE2 . PHE B 1 280 ? -34.523 -17.625 -28.060 1.00 16.44 ? 279 PHE B CE2 1 
ATOM   5008  C CZ  . PHE B 1 280 ? -34.652 -18.699 -28.907 1.00 17.42 ? 279 PHE B CZ  1 
ATOM   5009  N N   . LEU B 1 281 ? -37.545 -16.425 -24.975 1.00 15.58 ? 280 LEU B N   1 
ATOM   5010  C CA  . LEU B 1 281 ? -36.701 -16.786 -23.831 1.00 15.86 ? 280 LEU B CA  1 
ATOM   5011  C C   . LEU B 1 281 ? -37.462 -17.583 -22.762 1.00 16.82 ? 280 LEU B C   1 
ATOM   5012  O O   . LEU B 1 281 ? -36.911 -18.498 -22.157 1.00 16.92 ? 280 LEU B O   1 
ATOM   5013  C CB  . LEU B 1 281 ? -36.064 -15.537 -23.217 1.00 15.01 ? 280 LEU B CB  1 
ATOM   5014  C CG  . LEU B 1 281 ? -35.183 -14.722 -24.164 1.00 13.59 ? 280 LEU B CG  1 
ATOM   5015  C CD1 . LEU B 1 281 ? -34.842 -13.362 -23.551 1.00 11.11 ? 280 LEU B CD1 1 
ATOM   5016  C CD2 . LEU B 1 281 ? -33.947 -15.511 -24.490 1.00 12.40 ? 280 LEU B CD2 1 
ATOM   5017  N N   . GLU B 1 282 ? -38.722 -17.230 -22.524 1.00 17.52 ? 281 GLU B N   1 
ATOM   5018  C CA  . GLU B 1 282 ? -39.494 -17.888 -21.488 1.00 17.76 ? 281 GLU B CA  1 
ATOM   5019  C C   . GLU B 1 282 ? -39.847 -19.339 -21.863 1.00 17.62 ? 281 GLU B C   1 
ATOM   5020  O O   . GLU B 1 282 ? -40.028 -20.185 -20.986 1.00 17.52 ? 281 GLU B O   1 
ATOM   5021  C CB  . GLU B 1 282 ? -40.751 -17.096 -21.172 1.00 18.31 ? 281 GLU B CB  1 
ATOM   5022  C CG  . GLU B 1 282 ? -41.595 -17.719 -20.085 1.00 20.50 ? 281 GLU B CG  1 
ATOM   5023  C CD  . GLU B 1 282 ? -42.339 -16.699 -19.261 1.00 21.84 ? 281 GLU B CD  1 
ATOM   5024  O OE1 . GLU B 1 282 ? -41.743 -16.150 -18.298 1.00 23.52 ? 281 GLU B OE1 1 
ATOM   5025  O OE2 . GLU B 1 282 ? -43.526 -16.470 -19.572 1.00 22.61 ? 281 GLU B OE2 1 
ATOM   5026  N N   . SER B 1 283 ? -39.924 -19.631 -23.149 1.00 16.73 ? 282 SER B N   1 
ATOM   5027  C CA  . SER B 1 283 ? -40.158 -20.984 -23.581 1.00 16.62 ? 282 SER B CA  1 
ATOM   5028  C C   . SER B 1 283 ? -38.868 -21.807 -23.645 1.00 15.70 ? 282 SER B C   1 
ATOM   5029  O O   . SER B 1 283 ? -38.938 -23.009 -23.848 1.00 15.08 ? 282 SER B O   1 
ATOM   5030  C CB  . SER B 1 283 ? -40.792 -20.972 -24.967 1.00 16.90 ? 282 SER B CB  1 
ATOM   5031  O OG  . SER B 1 283 ? -39.784 -20.566 -25.889 1.00 19.36 ? 282 SER B OG  1 
ATOM   5032  N N   . ASN B 1 284 ? -37.705 -21.170 -23.494 1.00 15.07 ? 283 ASN B N   1 
ATOM   5033  C CA  . ASN B 1 284 ? -36.433 -21.820 -23.773 1.00 15.05 ? 283 ASN B CA  1 
ATOM   5034  C C   . ASN B 1 284 ? -35.877 -22.539 -22.536 1.00 14.64 ? 283 ASN B C   1 
ATOM   5035  O O   . ASN B 1 284 ? -35.637 -21.907 -21.526 1.00 13.45 ? 283 ASN B O   1 
ATOM   5036  C CB  . ASN B 1 284 ? -35.412 -20.808 -24.300 1.00 15.15 ? 283 ASN B CB  1 
ATOM   5037  C CG  . ASN B 1 284 ? -34.236 -21.476 -24.997 1.00 15.50 ? 283 ASN B CG  1 
ATOM   5038  O OD1 . ASN B 1 284 ? -33.410 -22.103 -24.354 1.00 15.78 ? 283 ASN B OD1 1 
ATOM   5039  N ND2 . ASN B 1 284 ? -34.157 -21.331 -26.313 1.00 15.98 ? 283 ASN B ND2 1 
ATOM   5040  N N   . PRO B 1 285 ? -35.664 -23.872 -22.629 1.00 14.91 ? 284 PRO B N   1 
ATOM   5041  C CA  . PRO B 1 285 ? -35.132 -24.639 -21.497 1.00 14.83 ? 284 PRO B CA  1 
ATOM   5042  C C   . PRO B 1 285 ? -33.740 -24.255 -21.007 1.00 14.72 ? 284 PRO B C   1 
ATOM   5043  O O   . PRO B 1 285 ? -33.362 -24.657 -19.930 1.00 15.02 ? 284 PRO B O   1 
ATOM   5044  C CB  . PRO B 1 285 ? -35.101 -26.087 -22.044 1.00 15.57 ? 284 PRO B CB  1 
ATOM   5045  C CG  . PRO B 1 285 ? -36.125 -26.138 -23.051 1.00 14.47 ? 284 PRO B CG  1 
ATOM   5046  C CD  . PRO B 1 285 ? -35.955 -24.776 -23.763 1.00 15.16 ? 284 PRO B CD  1 
ATOM   5047  N N   . TRP B 1 286 ? -32.985 -23.486 -21.783 1.00 15.76 ? 285 TRP B N   1 
ATOM   5048  C CA  . TRP B 1 286 ? -31.651 -23.061 -21.353 1.00 16.09 ? 285 TRP B CA  1 
ATOM   5049  C C   . TRP B 1 286 ? -31.660 -21.676 -20.690 1.00 16.12 ? 285 TRP B C   1 
ATOM   5050  O O   . TRP B 1 286 ? -30.619 -21.184 -20.266 1.00 16.36 ? 285 TRP B O   1 
ATOM   5051  C CB  . TRP B 1 286 ? -30.658 -23.191 -22.519 1.00 17.78 ? 285 TRP B CB  1 
ATOM   5052  C CG  . TRP B 1 286 ? -30.277 -24.652 -22.766 1.00 18.63 ? 285 TRP B CG  1 
ATOM   5053  C CD1 . TRP B 1 286 ? -30.431 -25.375 -23.931 1.00 19.95 ? 285 TRP B CD1 1 
ATOM   5054  C CD2 . TRP B 1 286 ? -29.731 -25.566 -21.803 1.00 18.62 ? 285 TRP B CD2 1 
ATOM   5055  N NE1 . TRP B 1 286 ? -29.990 -26.672 -23.743 1.00 20.27 ? 285 TRP B NE1 1 
ATOM   5056  C CE2 . TRP B 1 286 ? -29.561 -26.810 -22.448 1.00 20.49 ? 285 TRP B CE2 1 
ATOM   5057  C CE3 . TRP B 1 286 ? -29.353 -25.446 -20.463 1.00 20.93 ? 285 TRP B CE3 1 
ATOM   5058  C CZ2 . TRP B 1 286 ? -29.032 -27.921 -21.796 1.00 20.54 ? 285 TRP B CZ2 1 
ATOM   5059  C CZ3 . TRP B 1 286 ? -28.826 -26.556 -19.813 1.00 20.84 ? 285 TRP B CZ3 1 
ATOM   5060  C CH2 . TRP B 1 286 ? -28.673 -27.780 -20.483 1.00 19.66 ? 285 TRP B CH2 1 
ATOM   5061  N N   . VAL B 1 287 ? -32.855 -21.094 -20.571 1.00 15.79 ? 286 VAL B N   1 
ATOM   5062  C CA  . VAL B 1 287 ? -33.100 -19.873 -19.822 1.00 15.72 ? 286 VAL B CA  1 
ATOM   5063  C C   . VAL B 1 287 ? -33.745 -20.245 -18.488 1.00 17.33 ? 286 VAL B C   1 
ATOM   5064  O O   . VAL B 1 287 ? -34.801 -20.910 -18.447 1.00 17.05 ? 286 VAL B O   1 
ATOM   5065  C CB  . VAL B 1 287 ? -34.033 -18.913 -20.594 1.00 15.72 ? 286 VAL B CB  1 
ATOM   5066  C CG1 . VAL B 1 287 ? -34.404 -17.665 -19.716 1.00 12.49 ? 286 VAL B CG1 1 
ATOM   5067  C CG2 . VAL B 1 287 ? -33.395 -18.497 -21.919 1.00 13.95 ? 286 VAL B CG2 1 
ATOM   5068  N N   . GLU B 1 288 ? -33.089 -19.812 -17.412 1.00 18.43 ? 287 GLU B N   1 
ATOM   5069  C CA  . GLU B 1 288 ? -33.511 -20.117 -16.049 1.00 19.08 ? 287 GLU B CA  1 
ATOM   5070  C C   . GLU B 1 288 ? -34.747 -19.317 -15.699 1.00 18.96 ? 287 GLU B C   1 
ATOM   5071  O O   . GLU B 1 288 ? -35.687 -19.848 -15.121 1.00 18.50 ? 287 GLU B O   1 
ATOM   5072  C CB  . GLU B 1 288 ? -32.386 -19.784 -15.058 1.00 19.12 ? 287 GLU B CB  1 
ATOM   5073  C CG  . GLU B 1 288 ? -32.745 -19.985 -13.580 1.00 21.71 ? 287 GLU B CG  1 
ATOM   5074  C CD  . GLU B 1 288 ? -33.113 -21.431 -13.272 1.00 27.00 ? 287 GLU B CD  1 
ATOM   5075  O OE1 . GLU B 1 288 ? -32.363 -22.333 -13.731 1.00 29.13 ? 287 GLU B OE1 1 
ATOM   5076  O OE2 . GLU B 1 288 ? -34.157 -21.657 -12.596 1.00 32.86 ? 287 GLU B OE2 1 
ATOM   5077  N N   . LYS B 1 289 ? -34.737 -18.038 -16.058 1.00 18.99 ? 288 LYS B N   1 
ATOM   5078  C CA  . LYS B 1 289 ? -35.815 -17.109 -15.702 1.00 19.81 ? 288 LYS B CA  1 
ATOM   5079  C C   . LYS B 1 289 ? -35.769 -15.872 -16.597 1.00 19.08 ? 288 LYS B C   1 
ATOM   5080  O O   . LYS B 1 289 ? -34.685 -15.405 -16.940 1.00 19.49 ? 288 LYS B O   1 
ATOM   5081  C CB  . LYS B 1 289 ? -35.643 -16.674 -14.243 1.00 19.85 ? 288 LYS B CB  1 
ATOM   5082  C CG  . LYS B 1 289 ? -36.736 -15.768 -13.702 1.00 21.26 ? 288 LYS B CG  1 
ATOM   5083  C CD  . LYS B 1 289 ? -36.333 -15.231 -12.337 1.00 22.31 ? 288 LYS B CD  1 
ATOM   5084  C CE  . LYS B 1 289 ? -37.424 -14.363 -11.719 1.00 24.43 ? 288 LYS B CE  1 
ATOM   5085  N NZ  . LYS B 1 289 ? -37.045 -13.874 -10.335 1.00 26.47 ? 288 LYS B NZ  1 
ATOM   5086  N N   . VAL B 1 290 ? -36.950 -15.358 -16.962 1.00 19.13 ? 289 VAL B N   1 
ATOM   5087  C CA  . VAL B 1 290 ? -37.088 -14.110 -17.729 1.00 18.15 ? 289 VAL B CA  1 
ATOM   5088  C C   . VAL B 1 290 ? -37.861 -13.089 -16.902 1.00 17.70 ? 289 VAL B C   1 
ATOM   5089  O O   . VAL B 1 290 ? -38.856 -13.424 -16.300 1.00 16.95 ? 289 VAL B O   1 
ATOM   5090  C CB  . VAL B 1 290 ? -37.848 -14.292 -19.064 1.00 18.45 ? 289 VAL B CB  1 
ATOM   5091  C CG1 . VAL B 1 290 ? -37.885 -12.964 -19.838 1.00 18.93 ? 289 VAL B CG1 1 
ATOM   5092  C CG2 . VAL B 1 290 ? -37.207 -15.374 -19.923 1.00 17.37 ? 289 VAL B CG2 1 
ATOM   5093  N N   . ILE B 1 291 ? -37.395 -11.844 -16.901 1.00 17.05 ? 290 ILE B N   1 
ATOM   5094  C CA  . ILE B 1 291 ? -38.117 -10.750 -16.256 1.00 17.54 ? 290 ILE B CA  1 
ATOM   5095  C C   . ILE B 1 291 ? -38.570 -9.773  -17.347 1.00 17.54 ? 290 ILE B C   1 
ATOM   5096  O O   . ILE B 1 291 ? -37.742 -9.113  -17.979 1.00 17.60 ? 290 ILE B O   1 
ATOM   5097  C CB  . ILE B 1 291 ? -37.259 -9.985  -15.196 1.00 17.12 ? 290 ILE B CB  1 
ATOM   5098  C CG1 . ILE B 1 291 ? -36.566 -10.931 -14.210 1.00 18.20 ? 290 ILE B CG1 1 
ATOM   5099  C CG2 . ILE B 1 291 ? -38.149 -9.032  -14.409 1.00 18.71 ? 290 ILE B CG2 1 
ATOM   5100  C CD1 . ILE B 1 291 ? -35.627 -10.216 -13.198 1.00 17.44 ? 290 ILE B CD1 1 
ATOM   5101  N N   . TYR B 1 292 ? -39.877 -9.735  -17.592 1.00 17.93 ? 291 TYR B N   1 
ATOM   5102  C CA  . TYR B 1 292 ? -40.466 -8.800  -18.543 1.00 17.74 ? 291 TYR B CA  1 
ATOM   5103  C C   . TYR B 1 292 ? -41.862 -8.439  -18.089 1.00 18.14 ? 291 TYR B C   1 
ATOM   5104  O O   . TYR B 1 292 ? -42.704 -9.321  -17.976 1.00 18.48 ? 291 TYR B O   1 
ATOM   5105  C CB  . TYR B 1 292 ? -40.558 -9.396  -19.947 1.00 17.13 ? 291 TYR B CB  1 
ATOM   5106  C CG  . TYR B 1 292 ? -40.998 -8.390  -20.997 1.00 16.67 ? 291 TYR B CG  1 
ATOM   5107  C CD1 . TYR B 1 292 ? -40.239 -7.242  -21.249 1.00 15.78 ? 291 TYR B CD1 1 
ATOM   5108  C CD2 . TYR B 1 292 ? -42.132 -8.600  -21.755 1.00 15.13 ? 291 TYR B CD2 1 
ATOM   5109  C CE1 . TYR B 1 292 ? -40.619 -6.333  -22.226 1.00 16.74 ? 291 TYR B CE1 1 
ATOM   5110  C CE2 . TYR B 1 292 ? -42.534 -7.686  -22.725 1.00 16.97 ? 291 TYR B CE2 1 
ATOM   5111  C CZ  . TYR B 1 292 ? -41.771 -6.563  -22.954 1.00 15.78 ? 291 TYR B CZ  1 
ATOM   5112  O OH  . TYR B 1 292 ? -42.167 -5.682  -23.913 1.00 17.37 ? 291 TYR B OH  1 
ATOM   5113  N N   . PRO B 1 293 ? -42.119 -7.136  -17.855 1.00 18.57 ? 292 PRO B N   1 
ATOM   5114  C CA  . PRO B 1 293 ? -43.434 -6.702  -17.342 1.00 18.84 ? 292 PRO B CA  1 
ATOM   5115  C C   . PRO B 1 293 ? -44.648 -7.087  -18.187 1.00 19.17 ? 292 PRO B C   1 
ATOM   5116  O O   . PRO B 1 293 ? -45.774 -7.096  -17.670 1.00 19.85 ? 292 PRO B O   1 
ATOM   5117  C CB  . PRO B 1 293 ? -43.287 -5.172  -17.236 1.00 18.94 ? 292 PRO B CB  1 
ATOM   5118  C CG  . PRO B 1 293 ? -41.788 -4.944  -17.086 1.00 18.56 ? 292 PRO B CG  1 
ATOM   5119  C CD  . PRO B 1 293 ? -41.185 -5.998  -17.998 1.00 18.33 ? 292 PRO B CD  1 
ATOM   5120  N N   . GLY B 1 294 ? -44.424 -7.418  -19.452 1.00 19.16 ? 293 GLY B N   1 
ATOM   5121  C CA  . GLY B 1 294 ? -45.494 -7.872  -20.349 1.00 19.85 ? 293 GLY B CA  1 
ATOM   5122  C C   . GLY B 1 294 ? -45.826 -9.354  -20.299 1.00 20.37 ? 293 GLY B C   1 
ATOM   5123  O O   . GLY B 1 294 ? -46.787 -9.793  -20.920 1.00 20.72 ? 293 GLY B O   1 
ATOM   5124  N N   . LEU B 1 295 ? -45.010 -10.133 -19.594 1.00 21.76 ? 294 LEU B N   1 
ATOM   5125  C CA  . LEU B 1 295 ? -45.285 -11.552 -19.354 1.00 21.75 ? 294 LEU B CA  1 
ATOM   5126  C C   . LEU B 1 295 ? -46.201 -11.727 -18.132 1.00 22.64 ? 294 LEU B C   1 
ATOM   5127  O O   . LEU B 1 295 ? -45.976 -11.118 -17.067 1.00 21.59 ? 294 LEU B O   1 
ATOM   5128  C CB  . LEU B 1 295 ? -43.972 -12.329 -19.139 1.00 21.13 ? 294 LEU B CB  1 
ATOM   5129  C CG  . LEU B 1 295 ? -43.030 -12.571 -20.332 1.00 21.77 ? 294 LEU B CG  1 
ATOM   5130  C CD1 . LEU B 1 295 ? -41.715 -13.262 -19.891 1.00 18.31 ? 294 LEU B CD1 1 
ATOM   5131  C CD2 . LEU B 1 295 ? -43.685 -13.397 -21.447 1.00 20.34 ? 294 LEU B CD2 1 
ATOM   5132  N N   . PRO B 1 296 ? -47.243 -12.577 -18.258 1.00 24.19 ? 295 PRO B N   1 
ATOM   5133  C CA  . PRO B 1 296 ? -48.004 -12.894 -17.032 1.00 24.98 ? 295 PRO B CA  1 
ATOM   5134  C C   . PRO B 1 296 ? -47.109 -13.311 -15.865 1.00 25.63 ? 295 PRO B C   1 
ATOM   5135  O O   . PRO B 1 296 ? -47.463 -13.073 -14.714 1.00 26.41 ? 295 PRO B O   1 
ATOM   5136  C CB  . PRO B 1 296 ? -48.914 -14.050 -17.458 1.00 24.96 ? 295 PRO B CB  1 
ATOM   5137  C CG  . PRO B 1 296 ? -49.073 -13.902 -18.905 1.00 24.93 ? 295 PRO B CG  1 
ATOM   5138  C CD  . PRO B 1 296 ? -47.786 -13.268 -19.437 1.00 24.23 ? 295 PRO B CD  1 
ATOM   5139  N N   . SER B 1 297 ? -45.950 -13.903 -16.159 1.00 26.13 ? 296 SER B N   1 
ATOM   5140  C CA  . SER B 1 297 ? -45.009 -14.328 -15.119 1.00 26.02 ? 296 SER B CA  1 
ATOM   5141  C C   . SER B 1 297 ? -44.354 -13.194 -14.316 1.00 26.18 ? 296 SER B C   1 
ATOM   5142  O O   . SER B 1 297 ? -43.759 -13.452 -13.260 1.00 26.10 ? 296 SER B O   1 
ATOM   5143  C CB  . SER B 1 297 ? -43.896 -15.175 -15.750 1.00 26.28 ? 296 SER B CB  1 
ATOM   5144  O OG  . SER B 1 297 ? -43.120 -14.380 -16.639 1.00 26.67 ? 296 SER B OG  1 
ATOM   5145  N N   . HIS B 1 298 ? -44.415 -11.950 -14.794 1.00 25.66 ? 297 HIS B N   1 
ATOM   5146  C CA  . HIS B 1 298 ? -43.839 -10.865 -14.003 1.00 25.97 ? 297 HIS B CA  1 
ATOM   5147  C C   . HIS B 1 298 ? -44.652 -10.733 -12.709 1.00 26.32 ? 297 HIS B C   1 
ATOM   5148  O O   . HIS B 1 298 ? -45.889 -10.745 -12.758 1.00 25.64 ? 297 HIS B O   1 
ATOM   5149  C CB  . HIS B 1 298 ? -43.798 -9.541  -14.765 1.00 25.35 ? 297 HIS B CB  1 
ATOM   5150  C CG  . HIS B 1 298 ? -42.881 -8.535  -14.151 1.00 24.10 ? 297 HIS B CG  1 
ATOM   5151  N ND1 . HIS B 1 298 ? -43.216 -7.814  -13.023 1.00 23.56 ? 297 HIS B ND1 1 
ATOM   5152  C CD2 . HIS B 1 298 ? -41.628 -8.151  -14.486 1.00 22.70 ? 297 HIS B CD2 1 
ATOM   5153  C CE1 . HIS B 1 298 ? -42.211 -7.016  -12.703 1.00 24.12 ? 297 HIS B CE1 1 
ATOM   5154  N NE2 . HIS B 1 298 ? -41.232 -7.202  -13.572 1.00 22.87 ? 297 HIS B NE2 1 
ATOM   5155  N N   . PRO B 1 299 ? -43.960 -10.669 -11.553 1.00 27.23 ? 298 PRO B N   1 
ATOM   5156  C CA  . PRO B 1 299 ? -44.688 -10.600 -10.275 1.00 28.36 ? 298 PRO B CA  1 
ATOM   5157  C C   . PRO B 1 299 ? -45.570 -9.351  -10.079 1.00 28.99 ? 298 PRO B C   1 
ATOM   5158  O O   . PRO B 1 299 ? -46.525 -9.412  -9.305  1.00 29.69 ? 298 PRO B O   1 
ATOM   5159  C CB  . PRO B 1 299 ? -43.573 -10.685 -9.213  1.00 28.37 ? 298 PRO B CB  1 
ATOM   5160  C CG  . PRO B 1 299 ? -42.311 -10.366 -9.922  1.00 27.71 ? 298 PRO B CG  1 
ATOM   5161  C CD  . PRO B 1 299 ? -42.498 -10.698 -11.360 1.00 27.36 ? 298 PRO B CD  1 
ATOM   5162  N N   . GLN B 1 300 ? -45.265 -8.239  -10.754 1.00 29.14 ? 299 GLN B N   1 
ATOM   5163  C CA  . GLN B 1 300 ? -46.153 -7.067  -10.730 1.00 28.63 ? 299 GLN B CA  1 
ATOM   5164  C C   . GLN B 1 300 ? -46.949 -6.913  -12.020 1.00 28.83 ? 299 GLN B C   1 
ATOM   5165  O O   . GLN B 1 300 ? -47.329 -5.797  -12.357 1.00 29.01 ? 299 GLN B O   1 
ATOM   5166  C CB  . GLN B 1 300 ? -45.366 -5.776  -10.500 1.00 28.89 ? 299 GLN B CB  1 
ATOM   5167  C CG  . GLN B 1 300 ? -44.861 -5.555  -9.099  1.00 28.64 ? 299 GLN B CG  1 
ATOM   5168  C CD  . GLN B 1 300 ? -43.433 -5.989  -8.919  1.00 29.36 ? 299 GLN B CD  1 
ATOM   5169  O OE1 . GLN B 1 300 ? -42.520 -5.501  -9.588  1.00 28.90 ? 299 GLN B OE1 1 
ATOM   5170  N NE2 . GLN B 1 300 ? -43.223 -6.909  -7.991  1.00 32.12 ? 299 GLN B NE2 1 
ATOM   5171  N N   . HIS B 1 301 ? -47.243 -8.013  -12.715 1.00 28.26 ? 300 HIS B N   1 
ATOM   5172  C CA  . HIS B 1 301 ? -47.874 -7.932  -14.044 1.00 28.20 ? 300 HIS B CA  1 
ATOM   5173  C C   . HIS B 1 301 ? -49.206 -7.155  -14.020 1.00 28.18 ? 300 HIS B C   1 
ATOM   5174  O O   . HIS B 1 301 ? -49.508 -6.393  -14.944 1.00 27.99 ? 300 HIS B O   1 
ATOM   5175  C CB  . HIS B 1 301 ? -48.058 -9.336  -14.655 1.00 27.81 ? 300 HIS B CB  1 
ATOM   5176  C CG  . HIS B 1 301 ? -48.670 -9.327  -16.024 1.00 28.65 ? 300 HIS B CG  1 
ATOM   5177  N ND1 . HIS B 1 301 ? -48.034 -8.776  -17.124 1.00 27.40 ? 300 HIS B ND1 1 
ATOM   5178  C CD2 . HIS B 1 301 ? -49.868 -9.783  -16.469 1.00 26.99 ? 300 HIS B CD2 1 
ATOM   5179  C CE1 . HIS B 1 301 ? -48.821 -8.887  -18.182 1.00 27.14 ? 300 HIS B CE1 1 
ATOM   5180  N NE2 . HIS B 1 301 ? -49.932 -9.505  -17.814 1.00 26.59 ? 300 HIS B NE2 1 
ATOM   5181  N N   . GLU B 1 302 ? -49.989 -7.324  -12.955 1.00 28.03 ? 301 GLU B N   1 
ATOM   5182  C CA  . GLU B 1 302 ? -51.270 -6.620  -12.838 1.00 28.12 ? 301 GLU B CA  1 
ATOM   5183  C C   . GLU B 1 302 ? -51.112 -5.141  -12.452 1.00 27.00 ? 301 GLU B C   1 
ATOM   5184  O O   . GLU B 1 302 ? -51.893 -4.310  -12.910 1.00 26.94 ? 301 GLU B O   1 
ATOM   5185  C CB  . GLU B 1 302 ? -52.200 -7.346  -11.856 1.00 28.77 ? 301 GLU B CB  1 
ATOM   5186  C CG  . GLU B 1 302 ? -52.562 -8.780  -12.288 1.00 30.66 ? 301 GLU B CG  1 
ATOM   5187  C CD  . GLU B 1 302 ? -53.208 -8.857  -13.676 1.00 33.60 ? 301 GLU B CD  1 
ATOM   5188  O OE1 . GLU B 1 302 ? -52.935 -9.828  -14.414 1.00 35.62 ? 301 GLU B OE1 1 
ATOM   5189  O OE2 . GLU B 1 302 ? -53.966 -7.938  -14.046 1.00 36.74 ? 301 GLU B OE2 1 
ATOM   5190  N N   . LEU B 1 303 ? -50.119 -4.808  -11.626 1.00 26.31 ? 302 LEU B N   1 
ATOM   5191  C CA  . LEU B 1 303 ? -49.803 -3.400  -11.374 1.00 26.26 ? 302 LEU B CA  1 
ATOM   5192  C C   . LEU B 1 303 ? -49.484 -2.733  -12.712 1.00 26.50 ? 302 LEU B C   1 
ATOM   5193  O O   . LEU B 1 303 ? -49.962 -1.620  -12.975 1.00 25.72 ? 302 LEU B O   1 
ATOM   5194  C CB  . LEU B 1 303 ? -48.600 -3.220  -10.431 1.00 26.17 ? 302 LEU B CB  1 
ATOM   5195  C CG  . LEU B 1 303 ? -48.522 -1.967  -9.530  1.00 26.19 ? 302 LEU B CG  1 
ATOM   5196  C CD1 . LEU B 1 303 ? -47.078 -1.532  -9.290  1.00 24.32 ? 302 LEU B CD1 1 
ATOM   5197  C CD2 . LEU B 1 303 ? -49.342 -0.804  -10.023 1.00 26.13 ? 302 LEU B CD2 1 
ATOM   5198  N N   . VAL B 1 304 ? -48.675 -3.425  -13.538 1.00 26.34 ? 303 VAL B N   1 
ATOM   5199  C CA  . VAL B 1 304 ? -48.184 -2.900  -14.829 1.00 26.04 ? 303 VAL B CA  1 
ATOM   5200  C C   . VAL B 1 304 ? -49.343 -2.553  -15.761 1.00 26.33 ? 303 VAL B C   1 
ATOM   5201  O O   . VAL B 1 304 ? -49.376 -1.462  -16.354 1.00 25.58 ? 303 VAL B O   1 
ATOM   5202  C CB  . VAL B 1 304 ? -47.213 -3.889  -15.555 1.00 25.79 ? 303 VAL B CB  1 
ATOM   5203  C CG1 . VAL B 1 304 ? -46.838 -3.372  -16.929 1.00 25.87 ? 303 VAL B CG1 1 
ATOM   5204  C CG2 . VAL B 1 304 ? -45.943 -4.105  -14.739 1.00 24.67 ? 303 VAL B CG2 1 
ATOM   5205  N N   . LYS B 1 305 ? -50.298 -3.463  -15.870 1.00 26.24 ? 304 LYS B N   1 
ATOM   5206  C CA  . LYS B 1 305 ? -51.469 -3.221  -16.691 1.00 26.92 ? 304 LYS B CA  1 
ATOM   5207  C C   . LYS B 1 305 ? -52.377 -2.090  -16.162 1.00 26.57 ? 304 LYS B C   1 
ATOM   5208  O O   . LYS B 1 305 ? -53.080 -1.481  -16.947 1.00 26.43 ? 304 LYS B O   1 
ATOM   5209  C CB  . LYS B 1 305 ? -52.276 -4.504  -16.859 1.00 27.18 ? 304 LYS B CB  1 
ATOM   5210  C CG  . LYS B 1 305 ? -51.512 -5.620  -17.540 1.00 29.07 ? 304 LYS B CG  1 
ATOM   5211  C CD  . LYS B 1 305 ? -52.449 -6.566  -18.276 1.00 31.07 ? 304 LYS B CD  1 
ATOM   5212  C CE  . LYS B 1 305 ? -53.261 -7.385  -17.294 1.00 31.96 ? 304 LYS B CE  1 
ATOM   5213  N NZ  . LYS B 1 305 ? -54.294 -8.224  -17.999 1.00 33.53 ? 304 LYS B NZ  1 
ATOM   5214  N N   . ARG B 1 306 ? -52.360 -1.818  -14.852 1.00 26.70 ? 305 ARG B N   1 
ATOM   5215  C CA  . ARG B 1 306 ? -53.158 -0.717  -14.265 1.00 26.89 ? 305 ARG B CA  1 
ATOM   5216  C C   . ARG B 1 306 ? -52.485 0.647   -14.434 1.00 26.08 ? 305 ARG B C   1 
ATOM   5217  O O   . ARG B 1 306 ? -53.152 1.672   -14.513 1.00 26.55 ? 305 ARG B O   1 
ATOM   5218  C CB  . ARG B 1 306 ? -53.374 -0.931  -12.757 1.00 27.08 ? 305 ARG B CB  1 
ATOM   5219  C CG  . ARG B 1 306 ? -54.338 -2.056  -12.403 1.00 28.24 ? 305 ARG B CG  1 
ATOM   5220  C CD  . ARG B 1 306 ? -54.812 -1.938  -10.951 1.00 28.62 ? 305 ARG B CD  1 
ATOM   5221  N NE  . ARG B 1 306 ? -53.737 -1.970  -9.953  1.00 31.20 ? 305 ARG B NE  1 
ATOM   5222  C CZ  . ARG B 1 306 ? -53.140 -3.077  -9.501  1.00 31.80 ? 305 ARG B CZ  1 
ATOM   5223  N NH1 . ARG B 1 306 ? -53.472 -4.281  -9.980  1.00 33.99 ? 305 ARG B NH1 1 
ATOM   5224  N NH2 . ARG B 1 306 ? -52.180 -2.982  -8.583  1.00 30.56 ? 305 ARG B NH2 1 
ATOM   5225  N N   . GLN B 1 307 ? -51.159 0.618   -14.496 1.00 24.29 ? 306 GLN B N   1 
ATOM   5226  C CA  . GLN B 1 307 ? -50.296 1.769   -14.407 1.00 23.57 ? 306 GLN B CA  1 
ATOM   5227  C C   . GLN B 1 307 ? -49.738 2.182   -15.790 1.00 23.16 ? 306 GLN B C   1 
ATOM   5228  O O   . GLN B 1 307 ? -49.228 3.291   -15.936 1.00 23.47 ? 306 GLN B O   1 
ATOM   5229  C CB  . GLN B 1 307 ? -49.170 1.388   -13.437 1.00 23.15 ? 306 GLN B CB  1 
ATOM   5230  C CG  . GLN B 1 307 ? -47.991 2.295   -13.371 1.00 24.59 ? 306 GLN B CG  1 
ATOM   5231  C CD  . GLN B 1 307 ? -47.243 2.179   -12.062 1.00 23.84 ? 306 GLN B CD  1 
ATOM   5232  O OE1 . GLN B 1 307 ? -47.759 2.559   -11.029 1.00 22.35 ? 306 GLN B OE1 1 
ATOM   5233  N NE2 . GLN B 1 307 ? -46.010 1.682   -12.110 1.00 25.28 ? 306 GLN B NE2 1 
ATOM   5234  N N   . CYS B 1 308 ? -49.883 1.319   -16.807 1.00 22.50 ? 307 CYS B N   1 
ATOM   5235  C CA  . CYS B 1 308 ? -49.166 1.482   -18.095 1.00 22.19 ? 307 CYS B CA  1 
ATOM   5236  C C   . CYS B 1 308 ? -50.011 1.087   -19.301 1.00 20.30 ? 307 CYS B C   1 
ATOM   5237  O O   . CYS B 1 308 ? -50.940 0.279   -19.203 1.00 19.57 ? 307 CYS B O   1 
ATOM   5238  C CB  . CYS B 1 308 ? -47.860 0.644   -18.093 1.00 22.27 ? 307 CYS B CB  1 
ATOM   5239  S SG  . CYS B 1 308 ? -46.833 0.873   -16.644 1.00 25.67 ? 307 CYS B SG  1 
ATOM   5240  N N   . THR B 1 309 ? -49.696 1.676   -20.451 1.00 18.70 ? 308 THR B N   1 
ATOM   5241  C CA  . THR B 1 309 ? -50.394 1.332   -21.697 1.00 17.61 ? 308 THR B CA  1 
ATOM   5242  C C   . THR B 1 309 ? -49.716 0.194   -22.503 1.00 17.10 ? 308 THR B C   1 
ATOM   5243  O O   . THR B 1 309 ? -50.246 -0.242  -23.530 1.00 17.39 ? 308 THR B O   1 
ATOM   5244  C CB  . THR B 1 309 ? -50.593 2.570   -22.608 1.00 18.03 ? 308 THR B CB  1 
ATOM   5245  O OG1 . THR B 1 309 ? -49.332 3.000   -23.142 1.00 18.14 ? 308 THR B OG1 1 
ATOM   5246  C CG2 . THR B 1 309 ? -51.253 3.727   -21.849 1.00 16.18 ? 308 THR B CG2 1 
ATOM   5247  N N   . GLY B 1 310 ? -48.550 -0.260  -22.053 1.00 16.63 ? 309 GLY B N   1 
ATOM   5248  C CA  . GLY B 1 310 ? -47.747 -1.263  -22.798 1.00 17.01 ? 309 GLY B CA  1 
ATOM   5249  C C   . GLY B 1 310 ? -46.351 -1.357  -22.218 1.00 16.39 ? 309 GLY B C   1 
ATOM   5250  O O   . GLY B 1 310 ? -46.044 -0.714  -21.218 1.00 16.46 ? 309 GLY B O   1 
ATOM   5251  N N   . CYS B 1 311 ? -45.485 -2.136  -22.857 1.00 15.80 ? 310 CYS B N   1 
ATOM   5252  C CA  . CYS B 1 311 ? -44.121 -2.344  -22.350 1.00 15.79 ? 310 CYS B CA  1 
ATOM   5253  C C   . CYS B 1 311 ? -43.084 -2.106  -23.444 1.00 15.17 ? 310 CYS B C   1 
ATOM   5254  O O   . CYS B 1 311 ? -43.415 -1.969  -24.607 1.00 13.68 ? 310 CYS B O   1 
ATOM   5255  C CB  . CYS B 1 311 ? -43.957 -3.757  -21.787 1.00 15.75 ? 310 CYS B CB  1 
ATOM   5256  S SG  . CYS B 1 311 ? -45.244 -4.243  -20.634 1.00 19.78 ? 310 CYS B SG  1 
ATOM   5257  N N   . THR B 1 312 ? -41.821 -2.049  -23.046 1.00 14.95 ? 311 THR B N   1 
ATOM   5258  C CA  . THR B 1 312 ? -40.761 -1.642  -23.949 1.00 15.43 ? 311 THR B CA  1 
ATOM   5259  C C   . THR B 1 312 ? -39.947 -2.830  -24.521 1.00 14.94 ? 311 THR B C   1 
ATOM   5260  O O   . THR B 1 312 ? -40.410 -3.980  -24.547 1.00 14.58 ? 311 THR B O   1 
ATOM   5261  C CB  . THR B 1 312 ? -39.857 -0.605  -23.255 1.00 15.20 ? 311 THR B CB  1 
ATOM   5262  O OG1 . THR B 1 312 ? -39.018 -1.265  -22.307 1.00 16.71 ? 311 THR B OG1 1 
ATOM   5263  C CG2 . THR B 1 312 ? -40.713 0.497   -22.568 1.00 15.47 ? 311 THR B CG2 1 
ATOM   5264  N N   . GLY B 1 313 ? -38.765 -2.516  -25.036 1.00 15.16 ? 312 GLY B N   1 
ATOM   5265  C CA  . GLY B 1 313 ? -37.811 -3.493  -25.502 1.00 14.85 ? 312 GLY B CA  1 
ATOM   5266  C C   . GLY B 1 313 ? -36.881 -3.989  -24.419 1.00 15.52 ? 312 GLY B C   1 
ATOM   5267  O O   . GLY B 1 313 ? -36.032 -4.849  -24.700 1.00 15.36 ? 312 GLY B O   1 
ATOM   5268  N N   . MET B 1 314 ? -37.014 -3.459  -23.193 1.00 14.70 ? 313 MET B N   1 
ATOM   5269  C CA  . MET B 1 314 ? -36.160 -3.899  -22.084 1.00 15.12 ? 313 MET B CA  1 
ATOM   5270  C C   . MET B 1 314 ? -36.564 -5.263  -21.537 1.00 14.94 ? 313 MET B C   1 
ATOM   5271  O O   . MET B 1 314 ? -37.639 -5.427  -20.924 1.00 14.03 ? 313 MET B O   1 
ATOM   5272  C CB  . MET B 1 314 ? -36.115 -2.875  -20.939 1.00 15.20 ? 313 MET B CB  1 
ATOM   5273  C CG  . MET B 1 314 ? -35.682 -1.447  -21.337 1.00 16.13 ? 313 MET B CG  1 
ATOM   5274  S SD  . MET B 1 314 ? -34.126 -1.332  -22.270 1.00 18.49 ? 313 MET B SD  1 
ATOM   5275  C CE  . MET B 1 314 ? -32.999 -2.015  -21.055 1.00 16.70 ? 313 MET B CE  1 
ATOM   5276  N N   . VAL B 1 315 ? -35.680 -6.239  -21.779 1.00 15.31 ? 314 VAL B N   1 
ATOM   5277  C CA  . VAL B 1 315 ? -35.897 -7.616  -21.385 1.00 15.35 ? 314 VAL B CA  1 
ATOM   5278  C C   . VAL B 1 315 ? -34.649 -8.114  -20.649 1.00 15.38 ? 314 VAL B C   1 
ATOM   5279  O O   . VAL B 1 315 ? -33.536 -8.017  -21.171 1.00 14.45 ? 314 VAL B O   1 
ATOM   5280  C CB  . VAL B 1 315 ? -36.192 -8.526  -22.608 1.00 15.90 ? 314 VAL B CB  1 
ATOM   5281  C CG1 . VAL B 1 315 ? -36.497 -9.977  -22.151 1.00 15.10 ? 314 VAL B CG1 1 
ATOM   5282  C CG2 . VAL B 1 315 ? -37.324 -7.953  -23.469 1.00 14.24 ? 314 VAL B CG2 1 
ATOM   5283  N N   . THR B 1 316 ? -34.862 -8.614  -19.423 1.00 15.11 ? 315 THR B N   1 
ATOM   5284  C CA  . THR B 1 316 ? -33.795 -9.144  -18.576 1.00 15.76 ? 315 THR B CA  1 
ATOM   5285  C C   . THR B 1 316 ? -34.049 -10.639 -18.402 1.00 15.60 ? 315 THR B C   1 
ATOM   5286  O O   . THR B 1 316 ? -35.191 -11.054 -18.241 1.00 14.95 ? 315 THR B O   1 
ATOM   5287  C CB  . THR B 1 316 ? -33.738 -8.417  -17.194 1.00 15.77 ? 315 THR B CB  1 
ATOM   5288  O OG1 . THR B 1 316 ? -33.279 -7.075  -17.394 1.00 17.52 ? 315 THR B OG1 1 
ATOM   5289  C CG2 . THR B 1 316 ? -32.753 -9.086  -16.244 1.00 15.71 ? 315 THR B CG2 1 
ATOM   5290  N N   . PHE B 1 317 ? -32.995 -11.452 -18.479 1.00 15.60 ? 316 PHE B N   1 
ATOM   5291  C CA  . PHE B 1 317 ? -33.141 -12.886 -18.220 1.00 15.64 ? 316 PHE B CA  1 
ATOM   5292  C C   . PHE B 1 317 ? -31.897 -13.484 -17.586 1.00 16.21 ? 316 PHE B C   1 
ATOM   5293  O O   . PHE B 1 317 ? -30.834 -12.867 -17.582 1.00 16.52 ? 316 PHE B O   1 
ATOM   5294  C CB  . PHE B 1 317 ? -33.533 -13.661 -19.480 1.00 15.46 ? 316 PHE B CB  1 
ATOM   5295  C CG  . PHE B 1 317 ? -32.392 -13.936 -20.426 1.00 15.57 ? 316 PHE B CG  1 
ATOM   5296  C CD1 . PHE B 1 317 ? -31.762 -15.186 -20.431 1.00 17.12 ? 316 PHE B CD1 1 
ATOM   5297  C CD2 . PHE B 1 317 ? -31.976 -12.983 -21.335 1.00 16.53 ? 316 PHE B CD2 1 
ATOM   5298  C CE1 . PHE B 1 317 ? -30.729 -15.469 -21.318 1.00 16.31 ? 316 PHE B CE1 1 
ATOM   5299  C CE2 . PHE B 1 317 ? -30.945 -13.260 -22.241 1.00 15.82 ? 316 PHE B CE2 1 
ATOM   5300  C CZ  . PHE B 1 317 ? -30.322 -14.496 -22.222 1.00 17.00 ? 316 PHE B CZ  1 
ATOM   5301  N N   . TYR B 1 318 ? -32.069 -14.670 -17.009 1.00 17.65 ? 317 TYR B N   1 
ATOM   5302  C CA  . TYR B 1 318 ? -30.970 -15.429 -16.414 1.00 18.09 ? 317 TYR B CA  1 
ATOM   5303  C C   . TYR B 1 318 ? -30.767 -16.674 -17.243 1.00 18.22 ? 317 TYR B C   1 
ATOM   5304  O O   . TYR B 1 318 ? -31.697 -17.473 -17.439 1.00 17.87 ? 317 TYR B O   1 
ATOM   5305  C CB  . TYR B 1 318 ? -31.282 -15.828 -14.977 1.00 19.91 ? 317 TYR B CB  1 
ATOM   5306  C CG  . TYR B 1 318 ? -31.486 -14.674 -14.027 1.00 20.21 ? 317 TYR B CG  1 
ATOM   5307  C CD1 . TYR B 1 318 ? -32.736 -14.079 -13.910 1.00 23.39 ? 317 TYR B CD1 1 
ATOM   5308  C CD2 . TYR B 1 318 ? -30.449 -14.188 -13.245 1.00 21.60 ? 317 TYR B CD2 1 
ATOM   5309  C CE1 . TYR B 1 318 ? -32.960 -13.020 -13.052 1.00 23.70 ? 317 TYR B CE1 1 
ATOM   5310  C CE2 . TYR B 1 318 ? -30.662 -13.119 -12.352 1.00 22.97 ? 317 TYR B CE2 1 
ATOM   5311  C CZ  . TYR B 1 318 ? -31.932 -12.546 -12.269 1.00 23.79 ? 317 TYR B CZ  1 
ATOM   5312  O OH  . TYR B 1 318 ? -32.204 -11.498 -11.420 1.00 23.07 ? 317 TYR B OH  1 
ATOM   5313  N N   . ILE B 1 319 ? -29.556 -16.832 -17.751 1.00 18.17 ? 318 ILE B N   1 
ATOM   5314  C CA  . ILE B 1 319 ? -29.202 -18.018 -18.505 1.00 18.71 ? 318 ILE B CA  1 
ATOM   5315  C C   . ILE B 1 319 ? -28.978 -19.156 -17.502 1.00 19.46 ? 318 ILE B C   1 
ATOM   5316  O O   . ILE B 1 319 ? -28.550 -18.896 -16.365 1.00 19.22 ? 318 ILE B O   1 
ATOM   5317  C CB  . ILE B 1 319 ? -27.943 -17.775 -19.366 1.00 18.78 ? 318 ILE B CB  1 
ATOM   5318  C CG1 . ILE B 1 319 ? -27.786 -18.885 -20.404 1.00 17.52 ? 318 ILE B CG1 1 
ATOM   5319  C CG2 . ILE B 1 319 ? -26.694 -17.654 -18.480 1.00 18.80 ? 318 ILE B CG2 1 
ATOM   5320  C CD1 . ILE B 1 319 ? -26.780 -18.551 -21.491 1.00 18.88 ? 318 ILE B CD1 1 
ATOM   5321  N N   . LYS B 1 320 ? -29.310 -20.391 -17.891 1.00 19.89 ? 319 LYS B N   1 
ATOM   5322  C CA  . LYS B 1 320 ? -28.995 -21.542 -17.045 1.00 21.00 ? 319 LYS B CA  1 
ATOM   5323  C C   . LYS B 1 320 ? -27.502 -21.819 -17.070 1.00 21.69 ? 319 LYS B C   1 
ATOM   5324  O O   . LYS B 1 320 ? -26.878 -21.792 -18.128 1.00 22.91 ? 319 LYS B O   1 
ATOM   5325  C CB  . LYS B 1 320 ? -29.755 -22.799 -17.480 1.00 20.87 ? 319 LYS B CB  1 
ATOM   5326  C CG  . LYS B 1 320 ? -31.192 -22.762 -17.084 1.00 21.47 ? 319 LYS B CG  1 
ATOM   5327  C CD  . LYS B 1 320 ? -31.841 -24.121 -17.110 1.00 21.19 ? 319 LYS B CD  1 
ATOM   5328  C CE  . LYS B 1 320 ? -33.251 -24.018 -16.611 1.00 21.62 ? 319 LYS B CE  1 
ATOM   5329  N NZ  . LYS B 1 320 ? -34.038 -25.188 -17.015 1.00 23.47 ? 319 LYS B NZ  1 
ATOM   5330  N N   . GLY B 1 321 ? -26.934 -22.085 -15.897 1.00 22.60 ? 320 GLY B N   1 
ATOM   5331  C CA  . GLY B 1 321 ? -25.539 -22.456 -15.779 1.00 22.29 ? 320 GLY B CA  1 
ATOM   5332  C C   . GLY B 1 321 ? -24.789 -21.454 -14.940 1.00 22.97 ? 320 GLY B C   1 
ATOM   5333  O O   . GLY B 1 321 ? -25.262 -21.020 -13.889 1.00 23.40 ? 320 GLY B O   1 
ATOM   5334  N N   . THR B 1 322 ? -23.631 -21.060 -15.429 1.00 22.97 ? 321 THR B N   1 
ATOM   5335  C CA  . THR B 1 322 ? -22.729 -20.232 -14.701 1.00 23.44 ? 321 THR B CA  1 
ATOM   5336  C C   . THR B 1 322 ? -22.411 -18.994 -15.512 1.00 23.08 ? 321 THR B C   1 
ATOM   5337  O O   . THR B 1 322 ? -22.925 -18.809 -16.617 1.00 22.04 ? 321 THR B O   1 
ATOM   5338  C CB  . THR B 1 322 ? -21.415 -20.996 -14.477 1.00 23.56 ? 321 THR B CB  1 
ATOM   5339  O OG1 . THR B 1 322 ? -20.874 -21.359 -15.753 1.00 25.04 ? 321 THR B OG1 1 
ATOM   5340  C CG2 . THR B 1 322 ? -21.667 -22.253 -13.649 1.00 24.93 ? 321 THR B CG2 1 
ATOM   5341  N N   . LEU B 1 323 ? -21.562 -18.150 -14.932 1.00 23.22 ? 322 LEU B N   1 
ATOM   5342  C CA  . LEU B 1 323 ? -21.029 -16.974 -15.590 1.00 23.13 ? 322 LEU B CA  1 
ATOM   5343  C C   . LEU B 1 323 ? -20.429 -17.341 -16.952 1.00 23.05 ? 322 LEU B C   1 
ATOM   5344  O O   . LEU B 1 323 ? -20.627 -16.618 -17.923 1.00 22.88 ? 322 LEU B O   1 
ATOM   5345  C CB  . LEU B 1 323 ? -19.968 -16.326 -14.683 1.00 23.98 ? 322 LEU B CB  1 
ATOM   5346  C CG  . LEU B 1 323 ? -19.269 -15.036 -15.105 1.00 24.35 ? 322 LEU B CG  1 
ATOM   5347  C CD1 . LEU B 1 323 ? -18.461 -15.329 -16.332 1.00 28.87 ? 322 LEU B CD1 1 
ATOM   5348  C CD2 . LEU B 1 323 ? -20.235 -13.861 -15.345 1.00 27.35 ? 322 LEU B CD2 1 
ATOM   5349  N N   . GLN B 1 324 ? -19.721 -18.472 -17.036 1.00 22.72 ? 323 GLN B N   1 
ATOM   5350  C CA  . GLN B 1 324 ? -19.127 -18.924 -18.311 1.00 22.54 ? 323 GLN B CA  1 
ATOM   5351  C C   . GLN B 1 324 ? -20.201 -19.046 -19.393 1.00 21.58 ? 323 GLN B C   1 
ATOM   5352  O O   . GLN B 1 324 ? -19.991 -18.635 -20.513 1.00 20.56 ? 323 GLN B O   1 
ATOM   5353  C CB  . GLN B 1 324 ? -18.384 -20.275 -18.160 1.00 22.60 ? 323 GLN B CB  1 
ATOM   5354  C CG  . GLN B 1 324 ? -17.816 -20.852 -19.492 1.00 22.84 ? 323 GLN B CG  1 
ATOM   5355  C CD  . GLN B 1 324 ? -17.525 -22.368 -19.446 1.00 24.04 ? 323 GLN B CD  1 
ATOM   5356  O OE1 . GLN B 1 324 ? -17.805 -23.039 -18.447 1.00 29.26 ? 323 GLN B OE1 1 
ATOM   5357  N NE2 . GLN B 1 324 ? -16.965 -22.902 -20.530 1.00 23.49 ? 323 GLN B NE2 1 
ATOM   5358  N N   . HIS B 1 325 ? -21.350 -19.608 -19.047 1.00 21.21 ? 324 HIS B N   1 
ATOM   5359  C CA  . HIS B 1 325 ? -22.423 -19.769 -20.030 1.00 21.47 ? 324 HIS B CA  1 
ATOM   5360  C C   . HIS B 1 325 ? -22.931 -18.408 -20.517 1.00 20.32 ? 324 HIS B C   1 
ATOM   5361  O O   . HIS B 1 325 ? -23.131 -18.221 -21.710 1.00 19.52 ? 324 HIS B O   1 
ATOM   5362  C CB  . HIS B 1 325 ? -23.554 -20.626 -19.474 1.00 21.56 ? 324 HIS B CB  1 
ATOM   5363  C CG  . HIS B 1 325 ? -23.140 -22.036 -19.185 1.00 23.07 ? 324 HIS B CG  1 
ATOM   5364  N ND1 . HIS B 1 325 ? -22.906 -22.496 -17.908 1.00 24.77 ? 324 HIS B ND1 1 
ATOM   5365  C CD2 . HIS B 1 325 ? -22.876 -23.074 -20.010 1.00 23.95 ? 324 HIS B CD2 1 
ATOM   5366  C CE1 . HIS B 1 325 ? -22.542 -23.764 -17.958 1.00 25.17 ? 324 HIS B CE1 1 
ATOM   5367  N NE2 . HIS B 1 325 ? -22.518 -24.141 -19.221 1.00 24.65 ? 324 HIS B NE2 1 
ATOM   5368  N N   . ALA B 1 326 ? -23.089 -17.467 -19.586 1.00 20.08 ? 325 ALA B N   1 
ATOM   5369  C CA  . ALA B 1 326 ? -23.462 -16.082 -19.913 1.00 19.92 ? 325 ALA B CA  1 
ATOM   5370  C C   . ALA B 1 326 ? -22.445 -15.459 -20.873 1.00 19.76 ? 325 ALA B C   1 
ATOM   5371  O O   . ALA B 1 326 ? -22.797 -14.850 -21.876 1.00 19.20 ? 325 ALA B O   1 
ATOM   5372  C CB  . ALA B 1 326 ? -23.592 -15.251 -18.636 1.00 20.35 ? 325 ALA B CB  1 
ATOM   5373  N N   . GLU B 1 327 ? -21.166 -15.657 -20.590 1.00 20.37 ? 326 GLU B N   1 
ATOM   5374  C CA  . GLU B 1 327 ? -20.117 -15.097 -21.425 1.00 21.20 ? 326 GLU B CA  1 
ATOM   5375  C C   . GLU B 1 327 ? -20.086 -15.682 -22.810 1.00 18.89 ? 326 GLU B C   1 
ATOM   5376  O O   . GLU B 1 327 ? -19.908 -14.950 -23.781 1.00 18.77 ? 326 GLU B O   1 
ATOM   5377  C CB  . GLU B 1 327 ? -18.763 -15.247 -20.734 1.00 21.52 ? 326 GLU B CB  1 
ATOM   5378  C CG  . GLU B 1 327 ? -18.686 -14.361 -19.493 1.00 24.86 ? 326 GLU B CG  1 
ATOM   5379  C CD  . GLU B 1 327 ? -17.361 -14.479 -18.762 1.00 26.82 ? 326 GLU B CD  1 
ATOM   5380  O OE1 . GLU B 1 327 ? -16.724 -15.569 -18.854 1.00 34.67 ? 326 GLU B OE1 1 
ATOM   5381  O OE2 . GLU B 1 327 ? -16.969 -13.480 -18.097 1.00 34.13 ? 326 GLU B OE2 1 
ATOM   5382  N N   . ILE B 1 328 ? -20.269 -16.997 -22.913 1.00 18.08 ? 327 ILE B N   1 
ATOM   5383  C CA  . ILE B 1 328 ? -20.263 -17.658 -24.200 1.00 17.46 ? 327 ILE B CA  1 
ATOM   5384  C C   . ILE B 1 328 ? -21.468 -17.146 -25.003 1.00 17.12 ? 327 ILE B C   1 
ATOM   5385  O O   . ILE B 1 328 ? -21.329 -16.799 -26.171 1.00 16.47 ? 327 ILE B O   1 
ATOM   5386  C CB  . ILE B 1 328 ? -20.311 -19.227 -24.080 1.00 17.85 ? 327 ILE B CB  1 
ATOM   5387  C CG1 . ILE B 1 328 ? -19.039 -19.787 -23.416 1.00 17.62 ? 327 ILE B CG1 1 
ATOM   5388  C CG2 . ILE B 1 328 ? -20.499 -19.856 -25.439 1.00 16.96 ? 327 ILE B CG2 1 
ATOM   5389  C CD1 . ILE B 1 328 ? -19.109 -21.316 -23.138 1.00 17.61 ? 327 ILE B CD1 1 
ATOM   5390  N N   . PHE B 1 329 ? -22.636 -17.080 -24.348 1.00 16.67 ? 328 PHE B N   1 
ATOM   5391  C CA  . PHE B 1 329 ? -23.826 -16.457 -24.935 1.00 16.14 ? 328 PHE B CA  1 
ATOM   5392  C C   . PHE B 1 329 ? -23.496 -15.080 -25.527 1.00 16.00 ? 328 PHE B C   1 
ATOM   5393  O O   . PHE B 1 329 ? -23.634 -14.878 -26.734 1.00 16.38 ? 328 PHE B O   1 
ATOM   5394  C CB  . PHE B 1 329 ? -24.975 -16.356 -23.914 1.00 15.81 ? 328 PHE B CB  1 
ATOM   5395  C CG  . PHE B 1 329 ? -26.124 -15.521 -24.403 1.00 14.36 ? 328 PHE B CG  1 
ATOM   5396  C CD1 . PHE B 1 329 ? -27.001 -16.028 -25.330 1.00 14.62 ? 328 PHE B CD1 1 
ATOM   5397  C CD2 . PHE B 1 329 ? -26.273 -14.217 -24.003 1.00 13.74 ? 328 PHE B CD2 1 
ATOM   5398  C CE1 . PHE B 1 329 ? -28.051 -15.242 -25.827 1.00 15.21 ? 328 PHE B CE1 1 
ATOM   5399  C CE2 . PHE B 1 329 ? -27.319 -13.438 -24.485 1.00 14.06 ? 328 PHE B CE2 1 
ATOM   5400  C CZ  . PHE B 1 329 ? -28.197 -13.960 -25.404 1.00 13.88 ? 328 PHE B CZ  1 
ATOM   5401  N N   . LEU B 1 330 ? -23.014 -14.155 -24.695 1.00 16.68 ? 329 LEU B N   1 
ATOM   5402  C CA  . LEU B 1 330 ? -22.743 -12.774 -25.140 1.00 17.21 ? 329 LEU B CA  1 
ATOM   5403  C C   . LEU B 1 330 ? -21.738 -12.700 -26.281 1.00 17.56 ? 329 LEU B C   1 
ATOM   5404  O O   . LEU B 1 330 ? -21.942 -11.988 -27.280 1.00 17.98 ? 329 LEU B O   1 
ATOM   5405  C CB  . LEU B 1 330 ? -22.249 -11.922 -23.971 1.00 17.71 ? 329 LEU B CB  1 
ATOM   5406  C CG  . LEU B 1 330 ? -23.278 -11.604 -22.896 1.00 18.31 ? 329 LEU B CG  1 
ATOM   5407  C CD1 . LEU B 1 330 ? -22.575 -11.038 -21.684 1.00 19.69 ? 329 LEU B CD1 1 
ATOM   5408  C CD2 . LEU B 1 330 ? -24.342 -10.637 -23.405 1.00 18.27 ? 329 LEU B CD2 1 
ATOM   5409  N N   . LYS B 1 331 ? -20.650 -13.454 -26.139 1.00 17.98 ? 330 LYS B N   1 
ATOM   5410  C CA  . LYS B 1 331 ? -19.619 -13.516 -27.159 1.00 17.83 ? 330 LYS B CA  1 
ATOM   5411  C C   . LYS B 1 331 ? -20.139 -14.017 -28.498 1.00 17.17 ? 330 LYS B C   1 
ATOM   5412  O O   . LYS B 1 331 ? -19.604 -13.653 -29.516 1.00 17.38 ? 330 LYS B O   1 
ATOM   5413  C CB  . LYS B 1 331 ? -18.451 -14.384 -26.702 1.00 17.80 ? 330 LYS B CB  1 
ATOM   5414  C CG  . LYS B 1 331 ? -17.267 -14.397 -27.694 1.00 19.43 ? 330 LYS B CG  1 
ATOM   5415  C CD  . LYS B 1 331 ? -16.236 -15.500 -27.415 1.00 19.55 ? 330 LYS B CD  1 
ATOM   5416  C CE  . LYS B 1 331 ? -15.012 -15.382 -28.321 1.00 20.72 ? 330 LYS B CE  1 
ATOM   5417  N NZ  . LYS B 1 331 ? -13.897 -16.323 -27.908 1.00 21.06 ? 330 LYS B NZ  1 
ATOM   5418  N N   . ASN B 1 332 ? -21.171 -14.855 -28.508 1.00 17.06 ? 331 ASN B N   1 
ATOM   5419  C CA  . ASN B 1 332 ? -21.649 -15.455 -29.760 1.00 16.77 ? 331 ASN B CA  1 
ATOM   5420  C C   . ASN B 1 332 ? -22.733 -14.664 -30.481 1.00 17.17 ? 331 ASN B C   1 
ATOM   5421  O O   . ASN B 1 332 ? -23.058 -14.981 -31.623 1.00 16.66 ? 331 ASN B O   1 
ATOM   5422  C CB  . ASN B 1 332 ? -22.103 -16.902 -29.542 1.00 16.39 ? 331 ASN B CB  1 
ATOM   5423  C CG  . ASN B 1 332 ? -20.928 -17.872 -29.533 1.00 15.27 ? 331 ASN B CG  1 
ATOM   5424  O OD1 . ASN B 1 332 ? -20.576 -18.429 -30.558 1.00 13.80 ? 331 ASN B OD1 1 
ATOM   5425  N ND2 . ASN B 1 332 ? -20.299 -18.023 -28.401 1.00 12.38 ? 331 ASN B ND2 1 
ATOM   5426  N N   . LEU B 1 333 ? -23.270 -13.638 -29.833 1.00 17.34 ? 332 LEU B N   1 
ATOM   5427  C CA  . LEU B 1 333 ? -24.273 -12.787 -30.476 1.00 17.67 ? 332 LEU B CA  1 
ATOM   5428  C C   . LEU B 1 333 ? -23.662 -12.124 -31.708 1.00 18.22 ? 332 LEU B C   1 
ATOM   5429  O O   . LEU B 1 333 ? -22.534 -11.634 -31.652 1.00 17.46 ? 332 LEU B O   1 
ATOM   5430  C CB  . LEU B 1 333 ? -24.787 -11.728 -29.509 1.00 17.96 ? 332 LEU B CB  1 
ATOM   5431  C CG  . LEU B 1 333 ? -25.618 -12.228 -28.309 1.00 16.89 ? 332 LEU B CG  1 
ATOM   5432  C CD1 . LEU B 1 333 ? -25.711 -11.155 -27.242 1.00 16.35 ? 332 LEU B CD1 1 
ATOM   5433  C CD2 . LEU B 1 333 ? -27.026 -12.711 -28.737 1.00 16.29 ? 332 LEU B CD2 1 
ATOM   5434  N N   . LYS B 1 334 ? -24.408 -12.143 -32.814 1.00 18.39 ? 333 LYS B N   1 
ATOM   5435  C CA  . LYS B 1 334 ? -23.963 -11.596 -34.087 1.00 19.75 ? 333 LYS B CA  1 
ATOM   5436  C C   . LYS B 1 334 ? -24.778 -10.381 -34.555 1.00 19.11 ? 333 LYS B C   1 
ATOM   5437  O O   . LYS B 1 334 ? -24.335 -9.662  -35.447 1.00 19.54 ? 333 LYS B O   1 
ATOM   5438  C CB  . LYS B 1 334 ? -24.030 -12.666 -35.174 1.00 19.79 ? 333 LYS B CB  1 
ATOM   5439  C CG  . LYS B 1 334 ? -23.090 -13.842 -34.987 1.00 21.72 ? 333 LYS B CG  1 
ATOM   5440  C CD  . LYS B 1 334 ? -23.443 -14.933 -35.989 1.00 23.56 ? 333 LYS B CD  1 
ATOM   5441  C CE  . LYS B 1 334 ? -22.349 -15.967 -36.100 1.00 28.61 ? 333 LYS B CE  1 
ATOM   5442  N NZ  . LYS B 1 334 ? -21.961 -16.496 -34.747 1.00 31.92 ? 333 LYS B NZ  1 
ATOM   5443  N N   . LEU B 1 335 ? -25.951 -10.152 -33.975 1.00 18.08 ? 334 LEU B N   1 
ATOM   5444  C CA  . LEU B 1 335 ? -26.792 -9.026  -34.372 1.00 18.02 ? 334 LEU B CA  1 
ATOM   5445  C C   . LEU B 1 335 ? -26.943 -8.067  -33.208 1.00 17.63 ? 334 LEU B C   1 
ATOM   5446  O O   . LEU B 1 335 ? -26.699 -6.869  -33.353 1.00 18.85 ? 334 LEU B O   1 
ATOM   5447  C CB  . LEU B 1 335 ? -28.143 -9.516  -34.878 1.00 17.54 ? 334 LEU B CB  1 
ATOM   5448  C CG  . LEU B 1 335 ? -29.196 -8.470  -35.269 1.00 17.91 ? 334 LEU B CG  1 
ATOM   5449  C CD1 . LEU B 1 335 ? -28.590 -7.322  -36.074 1.00 15.34 ? 334 LEU B CD1 1 
ATOM   5450  C CD2 . LEU B 1 335 ? -30.344 -9.168  -36.045 1.00 18.02 ? 334 LEU B CD2 1 
ATOM   5451  N N   . PHE B 1 336 ? -27.315 -8.594  -32.050 1.00 17.17 ? 335 PHE B N   1 
ATOM   5452  C CA  . PHE B 1 336 ? -27.237 -7.827  -30.810 1.00 16.78 ? 335 PHE B CA  1 
ATOM   5453  C C   . PHE B 1 336 ? -25.795 -7.360  -30.644 1.00 17.78 ? 335 PHE B C   1 
ATOM   5454  O O   . PHE B 1 336 ? -24.857 -8.116  -30.939 1.00 18.08 ? 335 PHE B O   1 
ATOM   5455  C CB  . PHE B 1 336 ? -27.628 -8.672  -29.598 1.00 15.66 ? 335 PHE B CB  1 
ATOM   5456  C CG  . PHE B 1 336 ? -29.103 -8.830  -29.414 1.00 14.34 ? 335 PHE B CG  1 
ATOM   5457  C CD1 . PHE B 1 336 ? -29.824 -9.703  -30.208 1.00 13.44 ? 335 PHE B CD1 1 
ATOM   5458  C CD2 . PHE B 1 336 ? -29.764 -8.134  -28.415 1.00 13.78 ? 335 PHE B CD2 1 
ATOM   5459  C CE1 . PHE B 1 336 ? -31.192 -9.858  -30.021 1.00 14.51 ? 335 PHE B CE1 1 
ATOM   5460  C CE2 . PHE B 1 336 ? -31.122 -8.265  -28.234 1.00 14.59 ? 335 PHE B CE2 1 
ATOM   5461  C CZ  . PHE B 1 336 ? -31.841 -9.134  -29.041 1.00 14.15 ? 335 PHE B CZ  1 
ATOM   5462  N N   . THR B 1 337 ? -25.631 -6.123  -30.187 1.00 18.27 ? 336 THR B N   1 
ATOM   5463  C CA  . THR B 1 337 ? -24.324 -5.503  -30.029 1.00 19.58 ? 336 THR B CA  1 
ATOM   5464  C C   . THR B 1 337 ? -24.027 -5.372  -28.545 1.00 20.73 ? 336 THR B C   1 
ATOM   5465  O O   . THR B 1 337 ? -24.900 -5.018  -27.756 1.00 20.54 ? 336 THR B O   1 
ATOM   5466  C CB  . THR B 1 337 ? -24.275 -4.113  -30.733 1.00 19.10 ? 336 THR B CB  1 
ATOM   5467  O OG1 . THR B 1 337 ? -24.470 -4.291  -32.140 1.00 19.05 ? 336 THR B OG1 1 
ATOM   5468  C CG2 . THR B 1 337 ? -22.935 -3.416  -30.524 1.00 19.47 ? 336 THR B CG2 1 
ATOM   5469  N N   . LEU B 1 338 ? -22.782 -5.646  -28.172 1.00 23.36 ? 337 LEU B N   1 
ATOM   5470  C CA  . LEU B 1 338 ? -22.351 -5.501  -26.795 1.00 25.45 ? 337 LEU B CA  1 
ATOM   5471  C C   . LEU B 1 338 ? -21.941 -4.056  -26.543 1.00 28.08 ? 337 LEU B C   1 
ATOM   5472  O O   . LEU B 1 338 ? -21.096 -3.497  -27.241 1.00 28.03 ? 337 LEU B O   1 
ATOM   5473  C CB  . LEU B 1 338 ? -21.203 -6.472  -26.476 1.00 25.84 ? 337 LEU B CB  1 
ATOM   5474  C CG  . LEU B 1 338 ? -21.396 -7.933  -26.915 1.00 26.47 ? 337 LEU B CG  1 
ATOM   5475  C CD1 . LEU B 1 338 ? -20.278 -8.848  -26.343 1.00 24.77 ? 337 LEU B CD1 1 
ATOM   5476  C CD2 . LEU B 1 338 ? -22.794 -8.456  -26.554 1.00 25.83 ? 337 LEU B CD2 1 
ATOM   5477  N N   . ALA B 1 339 ? -22.558 -3.449  -25.535 1.00 31.08 ? 338 ALA B N   1 
ATOM   5478  C CA  . ALA B 1 339 ? -22.343 -2.041  -25.231 1.00 34.15 ? 338 ALA B CA  1 
ATOM   5479  C C   . ALA B 1 339 ? -22.826 -1.786  -23.803 1.00 35.65 ? 338 ALA B C   1 
ATOM   5480  O O   . ALA B 1 339 ? -23.364 -2.696  -23.169 1.00 35.32 ? 338 ALA B O   1 
ATOM   5481  C CB  . ALA B 1 339 ? -23.099 -1.182  -26.228 1.00 33.34 ? 338 ALA B CB  1 
ATOM   5482  N N   . GLU B 1 340 ? -22.635 -0.569  -23.278 1.00 37.87 ? 339 GLU B N   1 
ATOM   5483  C CA  . GLU B 1 340 ? -23.158 -0.260  -21.925 1.00 38.97 ? 339 GLU B CA  1 
ATOM   5484  C C   . GLU B 1 340 ? -24.387 0.652   -21.900 1.00 39.75 ? 339 GLU B C   1 
ATOM   5485  O O   . GLU B 1 340 ? -24.954 0.862   -20.818 1.00 40.70 ? 339 GLU B O   1 
ATOM   5486  C CB  . GLU B 1 340 ? -22.058 0.204   -20.932 1.00 39.31 ? 339 GLU B CB  1 
ATOM   5487  C CG  . GLU B 1 340 ? -20.884 0.990   -21.508 1.00 40.40 ? 339 GLU B CG  1 
ATOM   5488  C CD  . GLU B 1 340 ? -19.831 1.319   -20.448 1.00 41.78 ? 339 GLU B CD  1 
ATOM   5489  O OE1 . GLU B 1 340 ? -20.033 2.292   -19.673 1.00 45.70 ? 339 GLU B OE1 1 
ATOM   5490  O OE2 . GLU B 1 340 ? -18.795 0.601   -20.386 1.00 45.50 ? 339 GLU B OE2 1 
ATOM   5491  N N   . SER B 1 341 ? -24.844 1.126   -23.068 1.00 40.36 ? 340 SER B N   1 
ATOM   5492  C CA  . SER B 1 341 ? -26.002 2.051   -23.153 1.00 40.30 ? 340 SER B CA  1 
ATOM   5493  C C   . SER B 1 341 ? -27.368 1.378   -23.463 1.00 40.35 ? 340 SER B C   1 
ATOM   5494  O O   . SER B 1 341 ? -27.557 0.189   -23.201 1.00 40.51 ? 340 SER B O   1 
ATOM   5495  C CB  . SER B 1 341 ? -25.718 3.132   -24.188 1.00 40.82 ? 340 SER B CB  1 
ATOM   5496  O OG  . SER B 1 341 ? -26.048 2.642   -25.476 1.00 42.14 ? 340 SER B OG  1 
ATOM   5497  N N   . LEU B 1 342 ? -28.328 2.139   -24.012 1.00 40.27 ? 341 LEU B N   1 
ATOM   5498  C CA  . LEU B 1 342 ? -29.723 1.684   -24.032 1.00 39.66 ? 341 LEU B CA  1 
ATOM   5499  C C   . LEU B 1 342 ? -30.755 2.556   -24.777 1.00 38.21 ? 341 LEU B C   1 
ATOM   5500  O O   . LEU B 1 342 ? -30.560 3.771   -24.982 1.00 38.95 ? 341 LEU B O   1 
ATOM   5501  C CB  . LEU B 1 342 ? -30.176 1.582   -22.582 1.00 39.97 ? 341 LEU B CB  1 
ATOM   5502  C CG  . LEU B 1 342 ? -31.423 0.765   -22.329 1.00 42.48 ? 341 LEU B CG  1 
ATOM   5503  C CD1 . LEU B 1 342 ? -31.377 0.295   -20.853 1.00 44.45 ? 341 LEU B CD1 1 
ATOM   5504  C CD2 . LEU B 1 342 ? -32.702 1.577   -22.679 1.00 43.18 ? 341 LEU B CD2 1 
ATOM   5505  N N   . GLY B 1 343 ? -31.865 1.919   -25.158 1.00 36.10 ? 342 GLY B N   1 
ATOM   5506  C CA  . GLY B 1 343 ? -33.111 2.618   -25.529 1.00 34.18 ? 342 GLY B CA  1 
ATOM   5507  C C   . GLY B 1 343 ? -33.152 3.219   -26.927 1.00 32.19 ? 342 GLY B C   1 
ATOM   5508  O O   . GLY B 1 343 ? -34.052 4.053   -27.231 1.00 33.04 ? 342 GLY B O   1 
ATOM   5509  N N   . GLY B 1 344 ? -32.184 2.808   -27.759 1.00 28.37 ? 343 GLY B N   1 
ATOM   5510  C CA  . GLY B 1 344 ? -32.075 3.248   -29.141 1.00 25.67 ? 343 GLY B CA  1 
ATOM   5511  C C   . GLY B 1 344 ? -32.660 2.222   -30.095 1.00 23.34 ? 343 GLY B C   1 
ATOM   5512  O O   . GLY B 1 344 ? -33.201 1.188   -29.672 1.00 21.80 ? 343 GLY B O   1 
ATOM   5513  N N   . PHE B 1 345 ? -32.544 2.515   -31.387 1.00 21.80 ? 344 PHE B N   1 
ATOM   5514  C CA  . PHE B 1 345 ? -33.126 1.680   -32.426 1.00 20.82 ? 344 PHE B CA  1 
ATOM   5515  C C   . PHE B 1 345 ? -32.412 0.328   -32.634 1.00 19.52 ? 344 PHE B C   1 
ATOM   5516  O O   . PHE B 1 345 ? -32.973 -0.565  -33.245 1.00 18.47 ? 344 PHE B O   1 
ATOM   5517  C CB  . PHE B 1 345 ? -33.236 2.438   -33.772 1.00 21.71 ? 344 PHE B CB  1 
ATOM   5518  C CG  . PHE B 1 345 ? -32.028 3.236   -34.130 1.00 22.10 ? 344 PHE B CG  1 
ATOM   5519  C CD1 . PHE B 1 345 ? -32.143 4.579   -34.436 1.00 22.70 ? 344 PHE B CD1 1 
ATOM   5520  C CD2 . PHE B 1 345 ? -30.765 2.652   -34.163 1.00 23.75 ? 344 PHE B CD2 1 
ATOM   5521  C CE1 . PHE B 1 345 ? -31.036 5.331   -34.781 1.00 23.40 ? 344 PHE B CE1 1 
ATOM   5522  C CE2 . PHE B 1 345 ? -29.640 3.407   -34.493 1.00 24.62 ? 344 PHE B CE2 1 
ATOM   5523  C CZ  . PHE B 1 345 ? -29.781 4.752   -34.805 1.00 23.68 ? 344 PHE B CZ  1 
ATOM   5524  N N   . GLU B 1 346 ? -31.181 0.172   -32.154 1.00 18.22 ? 345 GLU B N   1 
ATOM   5525  C CA  . GLU B 1 346 ? -30.486 -1.076  -32.415 1.00 18.38 ? 345 GLU B CA  1 
ATOM   5526  C C   . GLU B 1 346 ? -30.457 -1.933  -31.160 1.00 16.94 ? 345 GLU B C   1 
ATOM   5527  O O   . GLU B 1 346 ? -30.503 -1.436  -30.040 1.00 15.68 ? 345 GLU B O   1 
ATOM   5528  C CB  . GLU B 1 346 ? -29.107 -0.849  -33.050 1.00 18.62 ? 345 GLU B CB  1 
ATOM   5529  C CG  . GLU B 1 346 ? -27.899 -0.823  -32.144 1.00 20.31 ? 345 GLU B CG  1 
ATOM   5530  C CD  . GLU B 1 346 ? -26.584 -0.857  -32.926 1.00 20.98 ? 345 GLU B CD  1 
ATOM   5531  O OE1 . GLU B 1 346 ? -25.538 -1.095  -32.303 1.00 27.37 ? 345 GLU B OE1 1 
ATOM   5532  O OE2 . GLU B 1 346 ? -26.592 -0.669  -34.154 1.00 25.50 ? 345 GLU B OE2 1 
ATOM   5533  N N   . SER B 1 347 ? -30.419 -3.237  -31.381 1.00 16.84 ? 346 SER B N   1 
ATOM   5534  C CA  . SER B 1 347 ? -30.477 -4.224  -30.308 1.00 16.61 ? 346 SER B CA  1 
ATOM   5535  C C   . SER B 1 347 ? -29.132 -4.355  -29.620 1.00 17.72 ? 346 SER B C   1 
ATOM   5536  O O   . SER B 1 347 ? -28.095 -4.516  -30.277 1.00 16.78 ? 346 SER B O   1 
ATOM   5537  C CB  . SER B 1 347 ? -30.954 -5.564  -30.850 1.00 16.39 ? 346 SER B CB  1 
ATOM   5538  O OG  . SER B 1 347 ? -32.361 -5.496  -31.107 1.00 14.06 ? 346 SER B OG  1 
ATOM   5539  N N   . LEU B 1 348 ? -29.171 -4.273  -28.292 1.00 18.65 ? 347 LEU B N   1 
ATOM   5540  C CA  . LEU B 1 348 ? -27.973 -4.305  -27.459 1.00 20.23 ? 347 LEU B CA  1 
ATOM   5541  C C   . LEU B 1 348 ? -28.107 -5.332  -26.342 1.00 21.10 ? 347 LEU B C   1 
ATOM   5542  O O   . LEU B 1 348 ? -29.219 -5.657  -25.903 1.00 21.09 ? 347 LEU B O   1 
ATOM   5543  C CB  . LEU B 1 348 ? -27.727 -2.939  -26.829 1.00 20.21 ? 347 LEU B CB  1 
ATOM   5544  C CG  . LEU B 1 348 ? -27.661 -1.730  -27.771 1.00 21.64 ? 347 LEU B CG  1 
ATOM   5545  C CD1 . LEU B 1 348 ? -27.894 -0.460  -26.953 1.00 22.65 ? 347 LEU B CD1 1 
ATOM   5546  C CD2 . LEU B 1 348 ? -26.345 -1.686  -28.515 1.00 19.56 ? 347 LEU B CD2 1 
ATOM   5547  N N   . ALA B 1 349 ? -26.962 -5.814  -25.872 1.00 22.50 ? 348 ALA B N   1 
ATOM   5548  C CA  . ALA B 1 349 ? -26.898 -6.775  -24.770 1.00 23.69 ? 348 ALA B CA  1 
ATOM   5549  C C   . ALA B 1 349 ? -25.778 -6.392  -23.802 1.00 25.38 ? 348 ALA B C   1 
ATOM   5550  O O   . ALA B 1 349 ? -24.732 -5.888  -24.195 1.00 24.51 ? 348 ALA B O   1 
ATOM   5551  C CB  . ALA B 1 349 ? -26.681 -8.161  -25.298 1.00 23.23 ? 348 ALA B CB  1 
ATOM   5552  N N   . GLU B 1 350 ? -26.022 -6.623  -22.527 1.00 28.11 ? 349 GLU B N   1 
ATOM   5553  C CA  . GLU B 1 350 ? -25.068 -6.285  -21.487 1.00 31.63 ? 349 GLU B CA  1 
ATOM   5554  C C   . GLU B 1 350 ? -25.102 -7.376  -20.403 1.00 32.80 ? 349 GLU B C   1 
ATOM   5555  O O   . GLU B 1 350 ? -26.153 -7.961  -20.131 1.00 32.05 ? 349 GLU B O   1 
ATOM   5556  C CB  . GLU B 1 350 ? -25.436 -4.928  -20.875 1.00 31.52 ? 349 GLU B CB  1 
ATOM   5557  C CG  . GLU B 1 350 ? -24.356 -4.330  -19.976 1.00 34.37 ? 349 GLU B CG  1 
ATOM   5558  C CD  . GLU B 1 350 ? -24.873 -3.240  -19.046 1.00 34.71 ? 349 GLU B CD  1 
ATOM   5559  O OE1 . GLU B 1 350 ? -24.161 -2.941  -18.067 1.00 40.77 ? 349 GLU B OE1 1 
ATOM   5560  O OE2 . GLU B 1 350 ? -25.975 -2.692  -19.274 1.00 39.68 ? 349 GLU B OE2 1 
ATOM   5561  N N   . LEU B 1 351 ? -23.949 -7.630  -19.785 1.00 35.12 ? 350 LEU B N   1 
ATOM   5562  C CA  . LEU B 1 351 ? -23.892 -8.422  -18.560 1.00 36.63 ? 350 LEU B CA  1 
ATOM   5563  C C   . LEU B 1 351 ? -23.445 -7.487  -17.435 1.00 37.57 ? 350 LEU B C   1 
ATOM   5564  O O   . LEU B 1 351 ? -22.242 -7.327  -17.209 1.00 38.67 ? 350 LEU B O   1 
ATOM   5565  C CB  . LEU B 1 351 ? -22.925 -9.600  -18.726 1.00 36.63 ? 350 LEU B CB  1 
ATOM   5566  C CG  . LEU B 1 351 ? -22.971 -10.759 -17.719 1.00 36.13 ? 350 LEU B CG  1 
ATOM   5567  C CD1 . LEU B 1 351 ? -24.301 -11.479 -17.732 1.00 36.14 ? 350 LEU B CD1 1 
ATOM   5568  C CD2 . LEU B 1 351 ? -21.851 -11.726 -18.021 1.00 37.09 ? 350 LEU B CD2 1 
ATOM   5569  N N   . PRO B 1 352 ? -24.406 -6.861  -16.728 1.00 38.38 ? 351 PRO B N   1 
ATOM   5570  C CA  . PRO B 1 352 ? -24.079 -5.906  -15.661 1.00 38.70 ? 351 PRO B CA  1 
ATOM   5571  C C   . PRO B 1 352 ? -23.746 -6.586  -14.320 1.00 39.10 ? 351 PRO B C   1 
ATOM   5572  O O   . PRO B 1 352 ? -22.603 -7.021  -14.098 1.00 39.87 ? 351 PRO B O   1 
ATOM   5573  C CB  . PRO B 1 352 ? -25.360 -5.082  -15.537 1.00 38.98 ? 351 PRO B CB  1 
ATOM   5574  C CG  . PRO B 1 352 ? -26.445 -6.039  -15.891 1.00 38.96 ? 351 PRO B CG  1 
ATOM   5575  C CD  . PRO B 1 352 ? -25.863 -7.023  -16.885 1.00 38.51 ? 351 PRO B CD  1 
ATOM   5576  N N   . SER B 1 371 ? -26.496 -11.062 -10.310 1.00 38.29 ? 370 SER B N   1 
ATOM   5577  C CA  . SER B 1 371 ? -25.903 -12.399 -10.380 1.00 37.94 ? 370 SER B CA  1 
ATOM   5578  C C   . SER B 1 371 ? -25.034 -12.587 -11.621 1.00 37.24 ? 370 SER B C   1 
ATOM   5579  O O   . SER B 1 371 ? -25.040 -11.764 -12.541 1.00 37.44 ? 370 SER B O   1 
ATOM   5580  C CB  . SER B 1 371 ? -26.987 -13.493 -10.343 1.00 38.25 ? 370 SER B CB  1 
ATOM   5581  O OG  . SER B 1 371 ? -27.366 -13.918 -11.655 1.00 38.88 ? 370 SER B OG  1 
ATOM   5582  N N   . ASP B 1 372 ? -24.298 -13.695 -11.622 1.00 36.21 ? 371 ASP B N   1 
ATOM   5583  C CA  . ASP B 1 372 ? -23.427 -14.087 -12.733 1.00 35.43 ? 371 ASP B CA  1 
ATOM   5584  C C   . ASP B 1 372 ? -24.151 -14.426 -14.030 1.00 33.76 ? 371 ASP B C   1 
ATOM   5585  O O   . ASP B 1 372 ? -23.572 -14.322 -15.123 1.00 33.53 ? 371 ASP B O   1 
ATOM   5586  C CB  . ASP B 1 372 ? -22.623 -15.325 -12.330 1.00 36.03 ? 371 ASP B CB  1 
ATOM   5587  C CG  . ASP B 1 372 ? -21.473 -15.000 -11.400 1.00 37.79 ? 371 ASP B CG  1 
ATOM   5588  O OD1 . ASP B 1 372 ? -21.057 -15.916 -10.658 1.00 41.38 ? 371 ASP B OD1 1 
ATOM   5589  O OD2 . ASP B 1 372 ? -20.990 -13.840 -11.414 1.00 39.55 ? 371 ASP B OD2 1 
ATOM   5590  N N   . THR B 1 373 ? -25.396 -14.867 -13.916 1.00 31.79 ? 372 THR B N   1 
ATOM   5591  C CA  . THR B 1 373 ? -26.107 -15.341 -15.088 1.00 30.33 ? 372 THR B CA  1 
ATOM   5592  C C   . THR B 1 373 ? -27.120 -14.308 -15.654 1.00 29.80 ? 372 THR B C   1 
ATOM   5593  O O   . THR B 1 373 ? -27.842 -14.630 -16.604 1.00 28.84 ? 372 THR B O   1 
ATOM   5594  C CB  . THR B 1 373 ? -26.775 -16.706 -14.792 1.00 30.26 ? 372 THR B CB  1 
ATOM   5595  O OG1 . THR B 1 373 ? -27.598 -16.609 -13.626 1.00 28.78 ? 372 THR B OG1 1 
ATOM   5596  C CG2 . THR B 1 373 ? -25.713 -17.782 -14.572 1.00 30.05 ? 372 THR B CG2 1 
ATOM   5597  N N   . LEU B 1 374 ? -27.137 -13.081 -15.102 1.00 28.82 ? 373 LEU B N   1 
ATOM   5598  C CA  . LEU B 1 374 ? -28.159 -12.070 -15.444 1.00 27.97 ? 373 LEU B CA  1 
ATOM   5599  C C   . LEU B 1 374 ? -27.752 -11.229 -16.639 1.00 26.67 ? 373 LEU B C   1 
ATOM   5600  O O   . LEU B 1 374 ? -26.802 -10.443 -16.566 1.00 26.42 ? 373 LEU B O   1 
ATOM   5601  C CB  . LEU B 1 374 ? -28.477 -11.132 -14.261 1.00 28.28 ? 373 LEU B CB  1 
ATOM   5602  C CG  . LEU B 1 374 ? -29.404 -9.927  -14.572 1.00 28.97 ? 373 LEU B CG  1 
ATOM   5603  C CD1 . LEU B 1 374 ? -30.472 -9.666  -13.520 1.00 31.34 ? 373 LEU B CD1 1 
ATOM   5604  C CD2 . LEU B 1 374 ? -28.576 -8.651  -14.793 1.00 32.22 ? 373 LEU B CD2 1 
ATOM   5605  N N   . ILE B 1 375 ? -28.512 -11.364 -17.724 1.00 24.65 ? 374 ILE B N   1 
ATOM   5606  C CA  . ILE B 1 375 ? -28.236 -10.642 -18.959 1.00 22.63 ? 374 ILE B CA  1 
ATOM   5607  C C   . ILE B 1 375 ? -29.320 -9.596  -19.173 1.00 21.77 ? 374 ILE B C   1 
ATOM   5608  O O   . ILE B 1 375 ? -30.509 -9.861  -18.954 1.00 19.24 ? 374 ILE B O   1 
ATOM   5609  C CB  . ILE B 1 375 ? -28.123 -11.593 -20.148 1.00 22.58 ? 374 ILE B CB  1 
ATOM   5610  C CG1 . ILE B 1 375 ? -26.925 -12.542 -19.951 1.00 22.35 ? 374 ILE B CG1 1 
ATOM   5611  C CG2 . ILE B 1 375 ? -27.912 -10.806 -21.447 1.00 22.25 ? 374 ILE B CG2 1 
ATOM   5612  C CD1 . ILE B 1 375 ? -27.247 -13.950 -20.267 1.00 23.06 ? 374 ILE B CD1 1 
ATOM   5613  N N   . ARG B 1 376 ? -28.886 -8.388  -19.543 1.00 21.06 ? 375 ARG B N   1 
ATOM   5614  C CA  . ARG B 1 376 ? -29.817 -7.341  -19.901 1.00 21.68 ? 375 ARG B CA  1 
ATOM   5615  C C   . ARG B 1 376 ? -29.828 -7.095  -21.416 1.00 19.62 ? 375 ARG B C   1 
ATOM   5616  O O   . ARG B 1 376 ? -28.789 -6.892  -22.042 1.00 18.72 ? 375 ARG B O   1 
ATOM   5617  C CB  . ARG B 1 376 ? -29.581 -6.043  -19.109 1.00 21.95 ? 375 ARG B CB  1 
ATOM   5618  C CG  . ARG B 1 376 ? -30.646 -4.979  -19.518 1.00 25.55 ? 375 ARG B CG  1 
ATOM   5619  C CD  . ARG B 1 376 ? -31.086 -3.947  -18.435 1.00 27.29 ? 375 ARG B CD  1 
ATOM   5620  N NE  . ARG B 1 376 ? -30.029 -3.032  -17.999 1.00 32.32 ? 375 ARG B NE  1 
ATOM   5621  C CZ  . ARG B 1 376 ? -29.350 -2.200  -18.790 1.00 34.99 ? 375 ARG B CZ  1 
ATOM   5622  N NH1 . ARG B 1 376 ? -29.541 -2.172  -20.120 1.00 37.80 ? 375 ARG B NH1 1 
ATOM   5623  N NH2 . ARG B 1 376 ? -28.430 -1.410  -18.251 1.00 34.06 ? 375 ARG B NH2 1 
ATOM   5624  N N   . LEU B 1 377 ? -31.024 -7.140  -21.991 1.00 18.68 ? 376 LEU B N   1 
ATOM   5625  C CA  . LEU B 1 377 ? -31.241 -6.867  -23.412 1.00 18.24 ? 376 LEU B CA  1 
ATOM   5626  C C   . LEU B 1 377 ? -32.018 -5.567  -23.568 1.00 17.08 ? 376 LEU B C   1 
ATOM   5627  O O   . LEU B 1 377 ? -32.947 -5.288  -22.789 1.00 17.31 ? 376 LEU B O   1 
ATOM   5628  C CB  . LEU B 1 377 ? -32.033 -8.003  -24.077 1.00 18.06 ? 376 LEU B CB  1 
ATOM   5629  C CG  . LEU B 1 377 ? -31.483 -9.428  -23.935 1.00 18.75 ? 376 LEU B CG  1 
ATOM   5630  C CD1 . LEU B 1 377 ? -32.344 -10.405 -24.726 1.00 17.26 ? 376 LEU B CD1 1 
ATOM   5631  C CD2 . LEU B 1 377 ? -29.994 -9.486  -24.390 1.00 20.21 ? 376 LEU B CD2 1 
ATOM   5632  N N   . SER B 1 378 ? -31.601 -4.753  -24.533 1.00 16.58 ? 377 SER B N   1 
ATOM   5633  C CA  . SER B 1 378 ? -32.409 -3.645  -25.026 1.00 15.09 ? 377 SER B CA  1 
ATOM   5634  C C   . SER B 1 378 ? -32.754 -4.034  -26.441 1.00 14.47 ? 377 SER B C   1 
ATOM   5635  O O   . SER B 1 378 ? -31.937 -3.892  -27.335 1.00 14.42 ? 377 SER B O   1 
ATOM   5636  C CB  . SER B 1 378 ? -31.650 -2.316  -24.952 1.00 15.60 ? 377 SER B CB  1 
ATOM   5637  O OG  . SER B 1 378 ? -32.376 -1.246  -25.576 1.00 15.70 ? 377 SER B OG  1 
ATOM   5638  N N   . VAL B 1 379 ? -33.959 -4.566  -26.632 1.00 13.79 ? 378 VAL B N   1 
ATOM   5639  C CA  . VAL B 1 379 ? -34.405 -5.018  -27.952 1.00 13.12 ? 378 VAL B CA  1 
ATOM   5640  C C   . VAL B 1 379 ? -34.798 -3.833  -28.831 1.00 13.00 ? 378 VAL B C   1 
ATOM   5641  O O   . VAL B 1 379 ? -35.651 -3.013  -28.454 1.00 13.81 ? 378 VAL B O   1 
ATOM   5642  C CB  . VAL B 1 379 ? -35.577 -6.023  -27.863 1.00 12.40 ? 378 VAL B CB  1 
ATOM   5643  C CG1 . VAL B 1 379 ? -35.937 -6.492  -29.236 1.00 12.37 ? 378 VAL B CG1 1 
ATOM   5644  C CG2 . VAL B 1 379 ? -35.215 -7.228  -26.940 1.00 11.97 ? 378 VAL B CG2 1 
ATOM   5645  N N   . GLY B 1 380 ? -34.165 -3.744  -29.987 1.00 12.67 ? 379 GLY B N   1 
ATOM   5646  C CA  . GLY B 1 380 ? -34.359 -2.630  -30.913 1.00 13.02 ? 379 GLY B CA  1 
ATOM   5647  C C   . GLY B 1 380 ? -35.441 -2.894  -31.958 1.00 12.55 ? 379 GLY B C   1 
ATOM   5648  O O   . GLY B 1 380 ? -36.368 -3.694  -31.743 1.00 12.21 ? 379 GLY B O   1 
ATOM   5649  N N   . LEU B 1 381 ? -35.279 -2.248  -33.103 1.00 13.10 ? 380 LEU B N   1 
ATOM   5650  C CA  . LEU B 1 381 ? -36.314 -2.164  -34.146 1.00 13.54 ? 380 LEU B CA  1 
ATOM   5651  C C   . LEU B 1 381 ? -36.026 -3.024  -35.375 1.00 13.56 ? 380 LEU B C   1 
ATOM   5652  O O   . LEU B 1 381 ? -36.725 -2.906  -36.381 1.00 14.42 ? 380 LEU B O   1 
ATOM   5653  C CB  . LEU B 1 381 ? -36.496 -0.687  -34.589 1.00 13.10 ? 380 LEU B CB  1 
ATOM   5654  C CG  . LEU B 1 381 ? -36.816 0.343   -33.502 1.00 13.49 ? 380 LEU B CG  1 
ATOM   5655  C CD1 . LEU B 1 381 ? -36.927 1.739   -34.074 1.00 14.97 ? 380 LEU B CD1 1 
ATOM   5656  C CD2 . LEU B 1 381 ? -38.068 -0.022  -32.811 1.00 14.31 ? 380 LEU B CD2 1 
ATOM   5657  N N   . GLU B 1 382 ? -35.000 -3.881  -35.291 1.00 13.78 ? 381 GLU B N   1 
ATOM   5658  C CA  . GLU B 1 382 ? -34.645 -4.808  -36.356 1.00 12.88 ? 381 GLU B CA  1 
ATOM   5659  C C   . GLU B 1 382 ? -35.761 -5.812  -36.593 1.00 12.77 ? 381 GLU B C   1 
ATOM   5660  O O   . GLU B 1 382 ? -36.738 -5.867  -35.836 1.00 12.38 ? 381 GLU B O   1 
ATOM   5661  C CB  . GLU B 1 382 ? -33.364 -5.597  -35.979 1.00 12.86 ? 381 GLU B CB  1 
ATOM   5662  C CG  . GLU B 1 382 ? -32.096 -4.767  -35.811 1.00 13.61 ? 381 GLU B CG  1 
ATOM   5663  C CD  . GLU B 1 382 ? -31.809 -4.367  -34.393 1.00 13.13 ? 381 GLU B CD  1 
ATOM   5664  O OE1 . GLU B 1 382 ? -30.641 -4.046  -34.109 1.00 12.99 ? 381 GLU B OE1 1 
ATOM   5665  O OE2 . GLU B 1 382 ? -32.738 -4.363  -33.562 1.00 12.32 ? 381 GLU B OE2 1 
ATOM   5666  N N   . ASP B 1 383 ? -35.597 -6.628  -37.626 1.00 13.67 ? 382 ASP B N   1 
ATOM   5667  C CA  . ASP B 1 383 ? -36.571 -7.680  -37.931 1.00 14.99 ? 382 ASP B CA  1 
ATOM   5668  C C   . ASP B 1 383 ? -36.659 -8.714  -36.834 1.00 15.04 ? 382 ASP B C   1 
ATOM   5669  O O   . ASP B 1 383 ? -35.652 -9.270  -36.419 1.00 14.85 ? 382 ASP B O   1 
ATOM   5670  C CB  . ASP B 1 383 ? -36.249 -8.346  -39.263 1.00 15.27 ? 382 ASP B CB  1 
ATOM   5671  C CG  . ASP B 1 383 ? -36.491 -7.411  -40.433 1.00 17.55 ? 382 ASP B CG  1 
ATOM   5672  O OD1 . ASP B 1 383 ? -37.671 -7.235  -40.823 1.00 18.67 ? 382 ASP B OD1 1 
ATOM   5673  O OD2 . ASP B 1 383 ? -35.507 -6.834  -40.929 1.00 16.08 ? 382 ASP B OD2 1 
ATOM   5674  N N   . GLU B 1 384 ? -37.883 -8.990  -36.400 1.00 15.60 ? 383 GLU B N   1 
ATOM   5675  C CA  . GLU B 1 384 ? -38.129 -9.899  -35.295 1.00 16.15 ? 383 GLU B CA  1 
ATOM   5676  C C   . GLU B 1 384 ? -37.429 -11.237 -35.474 1.00 16.44 ? 383 GLU B C   1 
ATOM   5677  O O   . GLU B 1 384 ? -36.820 -11.727 -34.554 1.00 15.48 ? 383 GLU B O   1 
ATOM   5678  C CB  . GLU B 1 384 ? -39.628 -10.120 -35.102 1.00 16.54 ? 383 GLU B CB  1 
ATOM   5679  C CG  . GLU B 1 384 ? -39.975 -11.037 -33.977 1.00 16.61 ? 383 GLU B CG  1 
ATOM   5680  C CD  . GLU B 1 384 ? -41.470 -11.377 -33.924 1.00 18.32 ? 383 GLU B CD  1 
ATOM   5681  O OE1 . GLU B 1 384 ? -41.813 -12.571 -34.010 1.00 22.43 ? 383 GLU B OE1 1 
ATOM   5682  O OE2 . GLU B 1 384 ? -42.292 -10.445 -33.796 1.00 21.25 ? 383 GLU B OE2 1 
ATOM   5683  N N   . GLU B 1 385 ? -37.512 -11.817 -36.657 1.00 16.29 ? 384 GLU B N   1 
ATOM   5684  C CA  . GLU B 1 385 ? -36.947 -13.143 -36.849 1.00 17.55 ? 384 GLU B CA  1 
ATOM   5685  C C   . GLU B 1 385 ? -35.415 -13.129 -36.768 1.00 16.37 ? 384 GLU B C   1 
ATOM   5686  O O   . GLU B 1 385 ? -34.800 -14.071 -36.251 1.00 15.54 ? 384 GLU B O   1 
ATOM   5687  C CB  . GLU B 1 385 ? -37.458 -13.773 -38.147 1.00 18.32 ? 384 GLU B CB  1 
ATOM   5688  C CG  . GLU B 1 385 ? -37.441 -15.328 -38.115 1.00 24.75 ? 384 GLU B CG  1 
ATOM   5689  C CD  . GLU B 1 385 ? -38.677 -15.983 -37.435 1.00 31.44 ? 384 GLU B CD  1 
ATOM   5690  O OE1 . GLU B 1 385 ? -38.705 -16.138 -36.183 1.00 33.94 ? 384 GLU B OE1 1 
ATOM   5691  O OE2 . GLU B 1 385 ? -39.612 -16.392 -38.184 1.00 39.36 ? 384 GLU B OE2 1 
ATOM   5692  N N   . ASP B 1 386 ? -34.793 -12.055 -37.249 1.00 16.04 ? 385 ASP B N   1 
ATOM   5693  C CA  . ASP B 1 386 ? -33.328 -11.917 -37.142 1.00 15.37 ? 385 ASP B CA  1 
ATOM   5694  C C   . ASP B 1 386 ? -32.924 -11.886 -35.673 1.00 15.11 ? 385 ASP B C   1 
ATOM   5695  O O   . ASP B 1 386 ? -31.932 -12.494 -35.278 1.00 15.52 ? 385 ASP B O   1 
ATOM   5696  C CB  . ASP B 1 386 ? -32.831 -10.669 -37.879 1.00 15.09 ? 385 ASP B CB  1 
ATOM   5697  C CG  . ASP B 1 386 ? -33.056 -10.745 -39.365 1.00 15.44 ? 385 ASP B CG  1 
ATOM   5698  O OD1 . ASP B 1 386 ? -33.422 -11.818 -39.823 1.00 18.86 ? 385 ASP B OD1 1 
ATOM   5699  O OD2 . ASP B 1 386 ? -32.845 -9.756  -40.097 1.00 16.96 ? 385 ASP B OD2 1 
ATOM   5700  N N   . LEU B 1 387 ? -33.706 -11.178 -34.867 1.00 14.97 ? 386 LEU B N   1 
ATOM   5701  C CA  . LEU B 1 387 ? -33.419 -11.038 -33.448 1.00 14.11 ? 386 LEU B CA  1 
ATOM   5702  C C   . LEU B 1 387 ? -33.605 -12.379 -32.706 1.00 14.68 ? 386 LEU B C   1 
ATOM   5703  O O   . LEU B 1 387 ? -32.732 -12.788 -31.916 1.00 12.25 ? 386 LEU B O   1 
ATOM   5704  C CB  . LEU B 1 387 ? -34.281 -9.914  -32.854 1.00 14.07 ? 386 LEU B CB  1 
ATOM   5705  C CG  . LEU B 1 387 ? -33.909 -8.510  -33.345 1.00 12.72 ? 386 LEU B CG  1 
ATOM   5706  C CD1 . LEU B 1 387 ? -34.882 -7.469  -32.793 1.00 9.37  ? 386 LEU B CD1 1 
ATOM   5707  C CD2 . LEU B 1 387 ? -32.475 -8.160  -32.987 1.00 11.24 ? 386 LEU B CD2 1 
ATOM   5708  N N   . LEU B 1 388 ? -34.693 -13.106 -33.004 1.00 14.58 ? 387 LEU B N   1 
ATOM   5709  C CA  . LEU B 1 388 ? -34.905 -14.397 -32.345 1.00 15.38 ? 387 LEU B CA  1 
ATOM   5710  C C   . LEU B 1 388 ? -33.788 -15.375 -32.734 1.00 15.50 ? 387 LEU B C   1 
ATOM   5711  O O   . LEU B 1 388 ? -33.297 -16.091 -31.878 1.00 14.49 ? 387 LEU B O   1 
ATOM   5712  C CB  . LEU B 1 388 ? -36.284 -14.988 -32.679 1.00 15.16 ? 387 LEU B CB  1 
ATOM   5713  C CG  . LEU B 1 388 ? -37.467 -14.132 -32.214 1.00 15.66 ? 387 LEU B CG  1 
ATOM   5714  C CD1 . LEU B 1 388 ? -38.841 -14.791 -32.550 1.00 15.59 ? 387 LEU B CD1 1 
ATOM   5715  C CD2 . LEU B 1 388 ? -37.331 -13.801 -30.727 1.00 15.06 ? 387 LEU B CD2 1 
ATOM   5716  N N   . GLU B 1 389 ? -33.406 -15.382 -34.017 1.00 16.43 ? 388 GLU B N   1 
ATOM   5717  C CA  . GLU B 1 389 ? -32.371 -16.283 -34.544 1.00 16.55 ? 388 GLU B CA  1 
ATOM   5718  C C   . GLU B 1 389 ? -31.064 -16.036 -33.829 1.00 15.87 ? 388 GLU B C   1 
ATOM   5719  O O   . GLU B 1 389 ? -30.335 -16.968 -33.521 1.00 16.78 ? 388 GLU B O   1 
ATOM   5720  C CB  . GLU B 1 389 ? -32.132 -16.016 -36.033 1.00 17.37 ? 388 GLU B CB  1 
ATOM   5721  C CG  . GLU B 1 389 ? -31.581 -17.181 -36.898 1.00 20.62 ? 388 GLU B CG  1 
ATOM   5722  C CD  . GLU B 1 389 ? -30.465 -18.042 -36.279 1.00 28.61 ? 388 GLU B CD  1 
ATOM   5723  O OE1 . GLU B 1 389 ? -30.755 -19.214 -35.892 1.00 31.70 ? 388 GLU B OE1 1 
ATOM   5724  O OE2 . GLU B 1 389 ? -29.297 -17.569 -36.218 1.00 34.49 ? 388 GLU B OE2 1 
ATOM   5725  N N   . ASP B 1 390 ? -30.759 -14.770 -33.583 1.00 15.65 ? 389 ASP B N   1 
ATOM   5726  C CA  . ASP B 1 390 ? -29.489 -14.409 -32.968 1.00 15.30 ? 389 ASP B CA  1 
ATOM   5727  C C   . ASP B 1 390 ? -29.413 -14.938 -31.546 1.00 15.08 ? 389 ASP B C   1 
ATOM   5728  O O   . ASP B 1 390 ? -28.390 -15.517 -31.134 1.00 14.04 ? 389 ASP B O   1 
ATOM   5729  C CB  . ASP B 1 390 ? -29.265 -12.896 -33.005 1.00 15.75 ? 389 ASP B CB  1 
ATOM   5730  C CG  . ASP B 1 390 ? -27.833 -12.524 -32.730 1.00 15.72 ? 389 ASP B CG  1 
ATOM   5731  O OD1 . ASP B 1 390 ? -26.913 -13.248 -33.175 1.00 16.85 ? 389 ASP B OD1 1 
ATOM   5732  O OD2 . ASP B 1 390 ? -27.618 -11.493 -32.089 1.00 14.17 ? 389 ASP B OD2 1 
ATOM   5733  N N   . LEU B 1 391 ? -30.510 -14.798 -30.814 1.00 14.14 ? 390 LEU B N   1 
ATOM   5734  C CA  . LEU B 1 391 ? -30.578 -15.287 -29.446 1.00 14.77 ? 390 LEU B CA  1 
ATOM   5735  C C   . LEU B 1 391 ? -30.471 -16.802 -29.384 1.00 14.92 ? 390 LEU B C   1 
ATOM   5736  O O   . LEU B 1 391 ? -29.758 -17.348 -28.551 1.00 13.61 ? 390 LEU B O   1 
ATOM   5737  C CB  . LEU B 1 391 ? -31.880 -14.844 -28.771 1.00 14.59 ? 390 LEU B CB  1 
ATOM   5738  C CG  . LEU B 1 391 ? -32.042 -13.332 -28.605 1.00 15.49 ? 390 LEU B CG  1 
ATOM   5739  C CD1 . LEU B 1 391 ? -33.499 -12.928 -28.236 1.00 14.73 ? 390 LEU B CD1 1 
ATOM   5740  C CD2 . LEU B 1 391 ? -31.091 -12.803 -27.568 1.00 15.10 ? 390 LEU B CD2 1 
ATOM   5741  N N   . ASP B 1 392 ? -31.187 -17.460 -30.290 1.00 14.99 ? 391 ASP B N   1 
ATOM   5742  C CA  . ASP B 1 392 ? -31.244 -18.912 -30.347 1.00 16.05 ? 391 ASP B CA  1 
ATOM   5743  C C   . ASP B 1 392 ? -29.866 -19.525 -30.610 1.00 16.68 ? 391 ASP B C   1 
ATOM   5744  O O   . ASP B 1 392 ? -29.404 -20.433 -29.901 1.00 15.92 ? 391 ASP B O   1 
ATOM   5745  C CB  . ASP B 1 392 ? -32.202 -19.304 -31.463 1.00 15.91 ? 391 ASP B CB  1 
ATOM   5746  C CG  . ASP B 1 392 ? -32.569 -20.761 -31.423 1.00 16.87 ? 391 ASP B CG  1 
ATOM   5747  O OD1 . ASP B 1 392 ? -32.819 -21.255 -30.321 1.00 18.48 ? 391 ASP B OD1 1 
ATOM   5748  O OD2 . ASP B 1 392 ? -32.594 -21.398 -32.495 1.00 17.76 ? 391 ASP B OD2 1 
ATOM   5749  N N   . GLN B 1 393 ? -29.250 -18.989 -31.656 1.00 17.03 ? 392 GLN B N   1 
ATOM   5750  C CA  . GLN B 1 393 ? -27.894 -19.258 -32.120 1.00 18.08 ? 392 GLN B CA  1 
ATOM   5751  C C   . GLN B 1 393 ? -26.871 -19.115 -30.978 1.00 17.56 ? 392 GLN B C   1 
ATOM   5752  O O   . GLN B 1 393 ? -26.036 -20.000 -30.727 1.00 17.92 ? 392 GLN B O   1 
ATOM   5753  C CB  . GLN B 1 393 ? -27.697 -18.218 -33.243 1.00 19.07 ? 392 GLN B CB  1 
ATOM   5754  C CG  . GLN B 1 393 ? -26.416 -18.038 -33.898 1.00 20.47 ? 392 GLN B CG  1 
ATOM   5755  C CD  . GLN B 1 393 ? -25.453 -17.228 -33.127 1.00 18.59 ? 392 GLN B CD  1 
ATOM   5756  O OE1 . GLN B 1 393 ? -24.375 -17.697 -32.895 1.00 22.27 ? 392 GLN B OE1 1 
ATOM   5757  N NE2 . GLN B 1 393 ? -25.836 -16.023 -32.684 1.00 16.65 ? 392 GLN B NE2 1 
ATOM   5758  N N   . ALA B 1 394 ? -26.958 -18.019 -30.247 1.00 17.01 ? 393 ALA B N   1 
ATOM   5759  C CA  . ALA B 1 394 ? -26.031 -17.759 -29.127 1.00 16.43 ? 393 ALA B CA  1 
ATOM   5760  C C   . ALA B 1 394 ? -26.237 -18.669 -27.912 1.00 16.05 ? 393 ALA B C   1 
ATOM   5761  O O   . ALA B 1 394 ? -25.257 -19.107 -27.287 1.00 15.21 ? 393 ALA B O   1 
ATOM   5762  C CB  . ALA B 1 394 ? -26.100 -16.291 -28.732 1.00 16.87 ? 393 ALA B CB  1 
ATOM   5763  N N   . LEU B 1 395 ? -27.499 -18.918 -27.546 1.00 15.80 ? 394 LEU B N   1 
ATOM   5764  C CA  . LEU B 1 395 ? -27.847 -19.889 -26.490 1.00 15.67 ? 394 LEU B CA  1 
ATOM   5765  C C   . LEU B 1 395 ? -27.356 -21.312 -26.798 1.00 16.21 ? 394 LEU B C   1 
ATOM   5766  O O   . LEU B 1 395 ? -26.898 -22.020 -25.893 1.00 16.27 ? 394 LEU B O   1 
ATOM   5767  C CB  . LEU B 1 395 ? -29.370 -19.925 -26.249 1.00 15.67 ? 394 LEU B CB  1 
ATOM   5768  C CG  . LEU B 1 395 ? -30.016 -18.727 -25.528 1.00 15.06 ? 394 LEU B CG  1 
ATOM   5769  C CD1 . LEU B 1 395 ? -31.576 -18.763 -25.735 1.00 13.40 ? 394 LEU B CD1 1 
ATOM   5770  C CD2 . LEU B 1 395 ? -29.619 -18.677 -24.023 1.00 13.73 ? 394 LEU B CD2 1 
ATOM   5771  N N   . LYS B 1 396 ? -27.474 -21.722 -28.060 1.00 16.83 ? 395 LYS B N   1 
ATOM   5772  C CA  . LYS B 1 396 ? -26.983 -23.025 -28.528 1.00 18.40 ? 395 LYS B CA  1 
ATOM   5773  C C   . LYS B 1 396 ? -25.432 -23.144 -28.444 1.00 18.13 ? 395 LYS B C   1 
ATOM   5774  O O   . LYS B 1 396 ? -24.891 -24.238 -28.232 1.00 17.23 ? 395 LYS B O   1 
ATOM   5775  C CB  . LYS B 1 396 ? -27.440 -23.290 -29.971 1.00 18.41 ? 395 LYS B CB  1 
ATOM   5776  C CG  . LYS B 1 396 ? -28.908 -23.675 -30.143 1.00 20.68 ? 395 LYS B CG  1 
ATOM   5777  C CD  . LYS B 1 396 ? -29.354 -23.356 -31.598 1.00 21.30 ? 395 LYS B CD  1 
ATOM   5778  C CE  . LYS B 1 396 ? -30.594 -24.126 -32.047 1.00 24.08 ? 395 LYS B CE  1 
ATOM   5779  N NZ  . LYS B 1 396 ? -31.438 -24.511 -30.901 1.00 25.82 ? 395 LYS B NZ  1 
ATOM   5780  N N   . ALA B 1 397 ? -24.740 -22.017 -28.607 1.00 17.69 ? 396 ALA B N   1 
ATOM   5781  C CA  . ALA B 1 397 ? -23.286 -21.977 -28.479 1.00 17.60 ? 396 ALA B CA  1 
ATOM   5782  C C   . ALA B 1 397 ? -22.876 -22.167 -27.017 1.00 17.61 ? 396 ALA B C   1 
ATOM   5783  O O   . ALA B 1 397 ? -21.851 -22.802 -26.739 1.00 18.63 ? 396 ALA B O   1 
ATOM   5784  C CB  . ALA B 1 397 ? -22.726 -20.667 -29.040 1.00 16.90 ? 396 ALA B CB  1 
ATOM   5785  N N   . ALA B 1 398 ? -23.667 -21.616 -26.095 1.00 16.95 ? 397 ALA B N   1 
ATOM   5786  C CA  . ALA B 1 398 ? -23.438 -21.762 -24.659 1.00 18.01 ? 397 ALA B CA  1 
ATOM   5787  C C   . ALA B 1 398 ? -23.822 -23.157 -24.154 1.00 18.52 ? 397 ALA B C   1 
ATOM   5788  O O   . ALA B 1 398 ? -23.201 -23.664 -23.226 1.00 18.78 ? 397 ALA B O   1 
ATOM   5789  C CB  . ALA B 1 398 ? -24.223 -20.679 -23.843 1.00 16.90 ? 397 ALA B CB  1 
ATOM   5790  N N   . HIS B 1 399 ? -24.861 -23.740 -24.743 1.00 19.36 ? 398 HIS B N   1 
ATOM   5791  C CA  . HIS B 1 399 ? -25.406 -25.026 -24.307 1.00 20.55 ? 398 HIS B CA  1 
ATOM   5792  C C   . HIS B 1 399 ? -25.598 -25.883 -25.530 1.00 22.49 ? 398 HIS B C   1 
ATOM   5793  O O   . HIS B 1 399 ? -26.712 -26.030 -26.027 1.00 21.23 ? 398 HIS B O   1 
ATOM   5794  C CB  . HIS B 1 399 ? -26.730 -24.850 -23.592 1.00 19.53 ? 398 HIS B CB  1 
ATOM   5795  C CG  . HIS B 1 399 ? -26.603 -24.211 -22.259 1.00 18.94 ? 398 HIS B CG  1 
ATOM   5796  N ND1 . HIS B 1 399 ? -26.189 -24.899 -21.138 1.00 18.27 ? 398 HIS B ND1 1 
ATOM   5797  C CD2 . HIS B 1 399 ? -26.837 -22.940 -21.860 1.00 17.77 ? 398 HIS B CD2 1 
ATOM   5798  C CE1 . HIS B 1 399 ? -26.177 -24.076 -20.105 1.00 19.48 ? 398 HIS B CE1 1 
ATOM   5799  N NE2 . HIS B 1 399 ? -26.578 -22.883 -20.516 1.00 18.11 ? 398 HIS B NE2 1 
ATOM   5800  N N   . PRO B 1 400 ? -24.498 -26.454 -26.025 1.00 25.09 ? 399 PRO B N   1 
ATOM   5801  C CA  . PRO B 1 400 ? -24.583 -27.227 -27.242 1.00 27.06 ? 399 PRO B CA  1 
ATOM   5802  C C   . PRO B 1 400 ? -25.370 -28.513 -26.995 1.00 29.21 ? 399 PRO B C   1 
ATOM   5803  O O   . PRO B 1 400 ? -25.604 -28.883 -25.838 1.00 29.74 ? 399 PRO B O   1 
ATOM   5804  C CB  . PRO B 1 400 ? -23.117 -27.491 -27.599 1.00 26.93 ? 399 PRO B CB  1 
ATOM   5805  C CG  . PRO B 1 400 ? -22.387 -27.399 -26.330 1.00 26.14 ? 399 PRO B CG  1 
ATOM   5806  C CD  . PRO B 1 400 ? -23.135 -26.433 -25.460 1.00 25.54 ? 399 PRO B CD  1 
ATOM   5807  N N   . PRO B 1 401 ? -25.799 -29.179 -28.068 1.00 31.54 ? 400 PRO B N   1 
ATOM   5808  C CA  . PRO B 1 401 ? -26.679 -30.341 -27.920 1.00 32.85 ? 400 PRO B CA  1 
ATOM   5809  C C   . PRO B 1 401 ? -25.912 -31.668 -27.738 1.00 33.85 ? 400 PRO B C   1 
ATOM   5810  O O   . PRO B 1 401 ? -25.833 -32.205 -26.615 1.00 34.93 ? 400 PRO B O   1 
ATOM   5811  C CB  . PRO B 1 401 ? -27.461 -30.331 -29.241 1.00 33.26 ? 400 PRO B CB  1 
ATOM   5812  C CG  . PRO B 1 401 ? -26.477 -29.751 -30.262 1.00 32.56 ? 400 PRO B CG  1 
ATOM   5813  C CD  . PRO B 1 401 ? -25.486 -28.893 -29.485 1.00 31.87 ? 400 PRO B CD  1 
ATOM   5814  N N   . GLY C 1 11  ? -52.694 -10.056 -49.568 1.00 23.78 ? 10  GLY C N   1 
ATOM   5815  C CA  . GLY C 1 11  ? -52.154 -10.727 -50.803 1.00 23.31 ? 10  GLY C CA  1 
ATOM   5816  C C   . GLY C 1 11  ? -51.182 -9.873  -51.629 1.00 22.50 ? 10  GLY C C   1 
ATOM   5817  O O   . GLY C 1 11  ? -51.076 -10.014 -52.849 1.00 22.17 ? 10  GLY C O   1 
ATOM   5818  N N   . PHE C 1 12  ? -50.471 -8.981  -50.950 1.00 22.09 ? 11  PHE C N   1 
ATOM   5819  C CA  . PHE C 1 12  ? -49.330 -8.310  -51.538 1.00 20.66 ? 11  PHE C CA  1 
ATOM   5820  C C   . PHE C 1 12  ? -48.102 -9.224  -51.517 1.00 20.88 ? 11  PHE C C   1 
ATOM   5821  O O   . PHE C 1 12  ? -48.087 -10.264 -50.885 1.00 20.95 ? 11  PHE C O   1 
ATOM   5822  C CB  . PHE C 1 12  ? -49.028 -7.026  -50.761 1.00 20.72 ? 11  PHE C CB  1 
ATOM   5823  C CG  . PHE C 1 12  ? -50.039 -5.926  -50.979 1.00 18.38 ? 11  PHE C CG  1 
ATOM   5824  C CD1 . PHE C 1 12  ? -51.249 -5.936  -50.318 1.00 20.77 ? 11  PHE C CD1 1 
ATOM   5825  C CD2 . PHE C 1 12  ? -49.769 -4.894  -51.839 1.00 17.43 ? 11  PHE C CD2 1 
ATOM   5826  C CE1 . PHE C 1 12  ? -52.188 -4.903  -50.522 1.00 19.63 ? 11  PHE C CE1 1 
ATOM   5827  C CE2 . PHE C 1 12  ? -50.675 -3.879  -52.055 1.00 18.34 ? 11  PHE C CE2 1 
ATOM   5828  C CZ  . PHE C 1 12  ? -51.895 -3.883  -51.391 1.00 19.79 ? 11  PHE C CZ  1 
ATOM   5829  N N   . LEU C 1 13  ? -47.065 -8.803  -52.223 1.00 20.92 ? 12  LEU C N   1 
ATOM   5830  C CA  . LEU C 1 13  ? -45.757 -9.425  -52.155 1.00 20.65 ? 12  LEU C CA  1 
ATOM   5831  C C   . LEU C 1 13  ? -45.327 -9.503  -50.680 1.00 20.19 ? 12  LEU C C   1 
ATOM   5832  O O   . LEU C 1 13  ? -45.494 -8.533  -49.933 1.00 19.94 ? 12  LEU C O   1 
ATOM   5833  C CB  . LEU C 1 13  ? -44.788 -8.560  -52.969 1.00 20.90 ? 12  LEU C CB  1 
ATOM   5834  C CG  . LEU C 1 13  ? -43.794 -9.127  -53.962 1.00 22.76 ? 12  LEU C CG  1 
ATOM   5835  C CD1 . LEU C 1 13  ? -44.423 -10.270 -54.822 1.00 23.69 ? 12  LEU C CD1 1 
ATOM   5836  C CD2 . LEU C 1 13  ? -43.278 -7.990  -54.826 1.00 20.54 ? 12  LEU C CD2 1 
ATOM   5837  N N   . PRO C 1 14  ? -44.793 -10.661 -50.229 1.00 19.49 ? 13  PRO C N   1 
ATOM   5838  C CA  . PRO C 1 14  ? -44.312 -10.674 -48.850 1.00 19.32 ? 13  PRO C CA  1 
ATOM   5839  C C   . PRO C 1 14  ? -43.233 -9.621  -48.632 1.00 18.45 ? 13  PRO C C   1 
ATOM   5840  O O   . PRO C 1 14  ? -42.470 -9.322  -49.553 1.00 17.95 ? 13  PRO C O   1 
ATOM   5841  C CB  . PRO C 1 14  ? -43.695 -12.072 -48.696 1.00 19.25 ? 13  PRO C CB  1 
ATOM   5842  C CG  . PRO C 1 14  ? -44.358 -12.874 -49.729 1.00 19.92 ? 13  PRO C CG  1 
ATOM   5843  C CD  . PRO C 1 14  ? -44.586 -11.959 -50.883 1.00 19.58 ? 13  PRO C CD  1 
ATOM   5844  N N   . HIS C 1 15  ? -43.171 -9.100  -47.415 1.00 17.49 ? 14  HIS C N   1 
ATOM   5845  C CA  . HIS C 1 15  ? -42.186 -8.115  -47.051 1.00 17.36 ? 14  HIS C CA  1 
ATOM   5846  C C   . HIS C 1 15  ? -40.757 -8.590  -47.252 1.00 17.34 ? 14  HIS C C   1 
ATOM   5847  O O   . HIS C 1 15  ? -40.432 -9.768  -47.046 1.00 16.99 ? 14  HIS C O   1 
ATOM   5848  C CB  . HIS C 1 15  ? -42.426 -7.650  -45.626 1.00 17.29 ? 14  HIS C CB  1 
ATOM   5849  C CG  . HIS C 1 15  ? -43.534 -6.657  -45.531 1.00 16.57 ? 14  HIS C CG  1 
ATOM   5850  N ND1 . HIS C 1 15  ? -43.471 -5.431  -46.153 1.00 15.49 ? 14  HIS C ND1 1 
ATOM   5851  C CD2 . HIS C 1 15  ? -44.758 -6.730  -44.961 1.00 15.29 ? 14  HIS C CD2 1 
ATOM   5852  C CE1 . HIS C 1 15  ? -44.586 -4.767  -45.912 1.00 16.03 ? 14  HIS C CE1 1 
ATOM   5853  N NE2 . HIS C 1 15  ? -45.394 -5.545  -45.219 1.00 14.79 ? 14  HIS C NE2 1 
ATOM   5854  N N   . PHE C 1 16  ? -39.921 -7.663  -47.703 1.00 16.69 ? 15  PHE C N   1 
ATOM   5855  C CA  . PHE C 1 16  ? -38.537 -7.967  -48.009 1.00 16.13 ? 15  PHE C CA  1 
ATOM   5856  C C   . PHE C 1 16  ? -37.783 -8.339  -46.735 1.00 16.49 ? 15  PHE C C   1 
ATOM   5857  O O   . PHE C 1 16  ? -37.776 -7.593  -45.729 1.00 16.78 ? 15  PHE C O   1 
ATOM   5858  C CB  . PHE C 1 16  ? -37.864 -6.788  -48.709 1.00 15.10 ? 15  PHE C CB  1 
ATOM   5859  C CG  . PHE C 1 16  ? -38.580 -6.333  -49.948 1.00 14.79 ? 15  PHE C CG  1 
ATOM   5860  C CD1 . PHE C 1 16  ? -38.953 -5.006  -50.109 1.00 12.94 ? 15  PHE C CD1 1 
ATOM   5861  C CD2 . PHE C 1 16  ? -38.881 -7.232  -50.967 1.00 15.14 ? 15  PHE C CD2 1 
ATOM   5862  C CE1 . PHE C 1 16  ? -39.594 -4.583  -51.259 1.00 14.12 ? 15  PHE C CE1 1 
ATOM   5863  C CE2 . PHE C 1 16  ? -39.525 -6.804  -52.115 1.00 14.17 ? 15  PHE C CE2 1 
ATOM   5864  C CZ  . PHE C 1 16  ? -39.885 -5.481  -52.250 1.00 12.84 ? 15  PHE C CZ  1 
ATOM   5865  N N   . GLN C 1 17  ? -37.143 -9.501  -46.777 1.00 16.35 ? 16  GLN C N   1 
ATOM   5866  C CA  . GLN C 1 17  ? -36.410 -10.022 -45.622 1.00 17.15 ? 16  GLN C CA  1 
ATOM   5867  C C   . GLN C 1 17  ? -35.251 -9.159  -45.203 1.00 15.75 ? 16  GLN C C   1 
ATOM   5868  O O   . GLN C 1 17  ? -34.521 -8.650  -46.050 1.00 14.74 ? 16  GLN C O   1 
ATOM   5869  C CB  . GLN C 1 17  ? -35.862 -11.416 -45.929 1.00 18.15 ? 16  GLN C CB  1 
ATOM   5870  C CG  . GLN C 1 17  ? -36.819 -12.545 -45.631 1.00 22.72 ? 16  GLN C CG  1 
ATOM   5871  C CD  . GLN C 1 17  ? -36.060 -13.809 -45.279 1.00 28.67 ? 16  GLN C CD  1 
ATOM   5872  O OE1 . GLN C 1 17  ? -36.206 -14.342 -44.175 1.00 33.34 ? 16  GLN C OE1 1 
ATOM   5873  N NE2 . GLN C 1 17  ? -35.197 -14.265 -46.194 1.00 30.79 ? 16  GLN C NE2 1 
ATOM   5874  N N   . HIS C 1 18  ? -35.098 -8.992  -43.886 1.00 15.39 ? 17  HIS C N   1 
ATOM   5875  C CA  . HIS C 1 18  ? -33.974 -8.254  -43.285 1.00 14.94 ? 17  HIS C CA  1 
ATOM   5876  C C   . HIS C 1 18  ? -33.978 -6.758  -43.555 1.00 13.90 ? 17  HIS C C   1 
ATOM   5877  O O   . HIS C 1 18  ? -33.007 -6.070  -43.232 1.00 13.07 ? 17  HIS C O   1 
ATOM   5878  C CB  . HIS C 1 18  ? -32.610 -8.818  -43.727 1.00 15.44 ? 17  HIS C CB  1 
ATOM   5879  C CG  . HIS C 1 18  ? -32.534 -10.310 -43.692 1.00 16.83 ? 17  HIS C CG  1 
ATOM   5880  N ND1 . HIS C 1 18  ? -32.685 -11.032 -42.532 1.00 17.76 ? 17  HIS C ND1 1 
ATOM   5881  C CD2 . HIS C 1 18  ? -32.311 -11.216 -44.674 1.00 19.93 ? 17  HIS C CD2 1 
ATOM   5882  C CE1 . HIS C 1 18  ? -32.567 -12.320 -42.799 1.00 20.15 ? 17  HIS C CE1 1 
ATOM   5883  N NE2 . HIS C 1 18  ? -32.333 -12.458 -44.091 1.00 19.13 ? 17  HIS C NE2 1 
ATOM   5884  N N   . PHE C 1 19  ? -35.065 -6.243  -44.116 1.00 13.51 ? 18  PHE C N   1 
ATOM   5885  C CA  . PHE C 1 19  ? -35.136 -4.828  -44.460 1.00 12.75 ? 18  PHE C CA  1 
ATOM   5886  C C   . PHE C 1 19  ? -34.832 -3.912  -43.248 1.00 12.72 ? 18  PHE C C   1 
ATOM   5887  O O   . PHE C 1 19  ? -33.957 -3.027  -43.321 1.00 13.67 ? 18  PHE C O   1 
ATOM   5888  C CB  . PHE C 1 19  ? -36.506 -4.499  -45.100 1.00 13.16 ? 18  PHE C CB  1 
ATOM   5889  C CG  . PHE C 1 19  ? -36.590 -3.084  -45.628 1.00 13.16 ? 18  PHE C CG  1 
ATOM   5890  C CD1 . PHE C 1 19  ? -36.427 -2.812  -46.974 1.00 13.73 ? 18  PHE C CD1 1 
ATOM   5891  C CD2 . PHE C 1 19  ? -36.755 -2.020  -44.760 1.00 14.08 ? 18  PHE C CD2 1 
ATOM   5892  C CE1 . PHE C 1 19  ? -36.477 -1.512  -47.448 1.00 12.48 ? 18  PHE C CE1 1 
ATOM   5893  C CE2 . PHE C 1 19  ? -36.808 -0.706  -45.245 1.00 12.60 ? 18  PHE C CE2 1 
ATOM   5894  C CZ  . PHE C 1 19  ? -36.652 -0.468  -46.584 1.00 12.68 ? 18  PHE C CZ  1 
ATOM   5895  N N   . ALA C 1 20  ? -35.523 -4.152  -42.133 1.00 11.96 ? 19  ALA C N   1 
ATOM   5896  C CA  . ALA C 1 20  ? -35.356 -3.364  -40.919 1.00 12.00 ? 19  ALA C CA  1 
ATOM   5897  C C   . ALA C 1 20  ? -33.951 -3.554  -40.336 1.00 11.90 ? 19  ALA C C   1 
ATOM   5898  O O   . ALA C 1 20  ? -33.307 -2.589  -39.963 1.00 11.92 ? 19  ALA C O   1 
ATOM   5899  C CB  . ALA C 1 20  ? -36.413 -3.731  -39.899 1.00 10.98 ? 19  ALA C CB  1 
ATOM   5900  N N   . THR C 1 21  ? -33.466 -4.795  -40.301 1.00 11.80 ? 20  THR C N   1 
ATOM   5901  C CA  . THR C 1 21  ? -32.096 -5.074  -39.815 1.00 12.06 ? 20  THR C CA  1 
ATOM   5902  C C   . THR C 1 21  ? -31.069 -4.304  -40.615 1.00 12.92 ? 20  THR C C   1 
ATOM   5903  O O   . THR C 1 21  ? -30.230 -3.614  -40.066 1.00 14.00 ? 20  THR C O   1 
ATOM   5904  C CB  . THR C 1 21  ? -31.823 -6.577  -39.866 1.00 12.26 ? 20  THR C CB  1 
ATOM   5905  O OG1 . THR C 1 21  ? -32.843 -7.258  -39.108 1.00 11.07 ? 20  THR C OG1 1 
ATOM   5906  C CG2 . THR C 1 21  ? -30.430 -6.912  -39.313 1.00 12.35 ? 20  THR C CG2 1 
ATOM   5907  N N   . GLN C 1 22  ? -31.169 -4.390  -41.926 1.00 13.64 ? 21  GLN C N   1 
ATOM   5908  C CA  . GLN C 1 22  ? -30.269 -3.669  -42.822 1.00 14.83 ? 21  GLN C CA  1 
ATOM   5909  C C   . GLN C 1 22  ? -30.414 -2.140  -42.760 1.00 14.18 ? 21  GLN C C   1 
ATOM   5910  O O   . GLN C 1 22  ? -29.401 -1.423  -42.843 1.00 13.93 ? 21  GLN C O   1 
ATOM   5911  C CB  . GLN C 1 22  ? -30.453 -4.186  -44.251 1.00 14.54 ? 21  GLN C CB  1 
ATOM   5912  C CG  . GLN C 1 22  ? -29.821 -5.569  -44.397 1.00 16.70 ? 21  GLN C CG  1 
ATOM   5913  C CD  . GLN C 1 22  ? -30.225 -6.322  -45.648 1.00 18.05 ? 21  GLN C CD  1 
ATOM   5914  O OE1 . GLN C 1 22  ? -30.745 -5.754  -46.602 1.00 19.19 ? 21  GLN C OE1 1 
ATOM   5915  N NE2 . GLN C 1 22  ? -29.991 -7.636  -45.633 1.00 23.54 ? 21  GLN C NE2 1 
ATOM   5916  N N   . ALA C 1 23  ? -31.634 -1.638  -42.564 1.00 13.39 ? 22  ALA C N   1 
ATOM   5917  C CA  . ALA C 1 23  ? -31.828 -0.189  -42.431 1.00 12.85 ? 22  ALA C CA  1 
ATOM   5918  C C   . ALA C 1 23  ? -31.067 0.340   -41.226 1.00 13.15 ? 22  ALA C C   1 
ATOM   5919  O O   . ALA C 1 23  ? -30.449 1.419   -41.266 1.00 12.05 ? 22  ALA C O   1 
ATOM   5920  C CB  . ALA C 1 23  ? -33.325 0.180   -42.337 1.00 12.76 ? 22  ALA C CB  1 
ATOM   5921  N N   . ILE C 1 24  ? -31.107 -0.442  -40.152 1.00 13.11 ? 23  ILE C N   1 
ATOM   5922  C CA  . ILE C 1 24  ? -30.442 -0.072  -38.930 1.00 13.36 ? 23  ILE C CA  1 
ATOM   5923  C C   . ILE C 1 24  ? -28.924 -0.311  -38.959 1.00 13.65 ? 23  ILE C C   1 
ATOM   5924  O O   . ILE C 1 24  ? -28.170 0.464   -38.368 1.00 14.57 ? 23  ILE C O   1 
ATOM   5925  C CB  . ILE C 1 24  ? -31.097 -0.799  -37.741 1.00 13.82 ? 23  ILE C CB  1 
ATOM   5926  C CG1 . ILE C 1 24  ? -32.526 -0.243  -37.539 1.00 14.86 ? 23  ILE C CG1 1 
ATOM   5927  C CG2 . ILE C 1 24  ? -30.276 -0.615  -36.454 1.00 13.39 ? 23  ILE C CG2 1 
ATOM   5928  C CD1 . ILE C 1 24  ? -33.437 -1.140  -36.788 1.00 15.10 ? 23  ILE C CD1 1 
ATOM   5929  N N   . HIS C 1 25  ? -28.466 -1.351  -39.642 1.00 13.28 ? 24  HIS C N   1 
ATOM   5930  C CA  . HIS C 1 25  ? -27.062 -1.749  -39.542 1.00 13.36 ? 24  HIS C CA  1 
ATOM   5931  C C   . HIS C 1 25  ? -26.156 -1.481  -40.751 1.00 13.41 ? 24  HIS C C   1 
ATOM   5932  O O   . HIS C 1 25  ? -24.982 -1.202  -40.537 1.00 13.25 ? 24  HIS C O   1 
ATOM   5933  C CB  . HIS C 1 25  ? -26.971 -3.199  -39.079 1.00 12.66 ? 24  HIS C CB  1 
ATOM   5934  C CG  . HIS C 1 25  ? -27.471 -3.391  -37.680 1.00 12.20 ? 24  HIS C CG  1 
ATOM   5935  N ND1 . HIS C 1 25  ? -26.662 -3.222  -36.580 1.00 13.11 ? 24  HIS C ND1 1 
ATOM   5936  C CD2 . HIS C 1 25  ? -28.697 -3.697  -37.196 1.00 11.96 ? 24  HIS C CD2 1 
ATOM   5937  C CE1 . HIS C 1 25  ? -27.363 -3.433  -35.479 1.00 13.73 ? 24  HIS C CE1 1 
ATOM   5938  N NE2 . HIS C 1 25  ? -28.598 -3.748  -35.823 1.00 10.90 ? 24  HIS C NE2 1 
ATOM   5939  N N   . VAL C 1 26  ? -26.666 -1.513  -41.983 1.00 14.45 ? 25  VAL C N   1 
ATOM   5940  C CA  . VAL C 1 26  ? -25.775 -1.389  -43.170 1.00 14.35 ? 25  VAL C CA  1 
ATOM   5941  C C   . VAL C 1 26  ? -25.121 0.014   -43.246 1.00 15.37 ? 25  VAL C C   1 
ATOM   5942  O O   . VAL C 1 26  ? -25.784 1.046   -43.049 1.00 14.76 ? 25  VAL C O   1 
ATOM   5943  C CB  . VAL C 1 26  ? -26.463 -1.759  -44.512 1.00 14.78 ? 25  VAL C CB  1 
ATOM   5944  C CG1 . VAL C 1 26  ? -25.509 -1.545  -45.696 1.00 14.99 ? 25  VAL C CG1 1 
ATOM   5945  C CG2 . VAL C 1 26  ? -26.927 -3.221  -44.522 1.00 12.84 ? 25  VAL C CG2 1 
ATOM   5946  N N   . GLY C 1 27  ? -23.805 0.031   -43.501 1.00 15.10 ? 26  GLY C N   1 
ATOM   5947  C CA  . GLY C 1 27  ? -23.019 1.257   -43.511 1.00 15.89 ? 26  GLY C CA  1 
ATOM   5948  C C   . GLY C 1 27  ? -22.664 1.779   -42.124 1.00 16.08 ? 26  GLY C C   1 
ATOM   5949  O O   . GLY C 1 27  ? -21.921 2.743   -42.020 1.00 16.60 ? 26  GLY C O   1 
ATOM   5950  N N   . GLN C 1 28  ? -23.138 1.118   -41.065 1.00 16.67 ? 27  GLN C N   1 
ATOM   5951  C CA  . GLN C 1 28  ? -23.046 1.655   -39.685 1.00 17.66 ? 27  GLN C CA  1 
ATOM   5952  C C   . GLN C 1 28  ? -22.102 0.847   -38.776 1.00 18.07 ? 27  GLN C C   1 
ATOM   5953  O O   . GLN C 1 28  ? -22.058 1.083   -37.580 1.00 17.40 ? 27  GLN C O   1 
ATOM   5954  C CB  . GLN C 1 28  ? -24.439 1.742   -39.016 1.00 16.62 ? 27  GLN C CB  1 
ATOM   5955  C CG  . GLN C 1 28  ? -25.599 2.148   -39.915 1.00 16.89 ? 27  GLN C CG  1 
ATOM   5956  C CD  . GLN C 1 28  ? -25.524 3.575   -40.434 1.00 16.57 ? 27  GLN C CD  1 
ATOM   5957  O OE1 . GLN C 1 28  ? -25.651 4.530   -39.662 1.00 19.23 ? 27  GLN C OE1 1 
ATOM   5958  N NE2 . GLN C 1 28  ? -25.369 3.730   -41.754 1.00 15.10 ? 27  GLN C NE2 1 
ATOM   5959  N N   . ASP C 1 29  ? -21.327 -0.073  -39.348 1.00 19.51 ? 28  ASP C N   1 
ATOM   5960  C CA  . ASP C 1 29  ? -20.382 -0.870  -38.557 1.00 20.80 ? 28  ASP C CA  1 
ATOM   5961  C C   . ASP C 1 29  ? -19.474 0.037   -37.709 1.00 21.07 ? 28  ASP C C   1 
ATOM   5962  O O   . ASP C 1 29  ? -18.743 0.865   -38.268 1.00 20.65 ? 28  ASP C O   1 
ATOM   5963  C CB  . ASP C 1 29  ? -19.507 -1.717  -39.474 1.00 21.31 ? 28  ASP C CB  1 
ATOM   5964  C CG  . ASP C 1 29  ? -18.722 -2.780  -38.717 1.00 25.19 ? 28  ASP C CG  1 
ATOM   5965  O OD1 . ASP C 1 29  ? -18.471 -2.616  -37.486 1.00 27.74 ? 28  ASP C OD1 1 
ATOM   5966  O OD2 . ASP C 1 29  ? -18.376 -3.802  -39.365 1.00 29.92 ? 28  ASP C OD2 1 
ATOM   5967  N N   . PRO C 1 30  ? -19.503 -0.122  -36.371 1.00 21.39 ? 29  PRO C N   1 
ATOM   5968  C CA  . PRO C 1 30  ? -18.591 0.658   -35.500 1.00 22.16 ? 29  PRO C CA  1 
ATOM   5969  C C   . PRO C 1 30  ? -17.091 0.454   -35.777 1.00 23.13 ? 29  PRO C C   1 
ATOM   5970  O O   . PRO C 1 30  ? -16.270 1.311   -35.427 1.00 22.71 ? 29  PRO C O   1 
ATOM   5971  C CB  . PRO C 1 30  ? -18.950 0.195   -34.083 1.00 22.08 ? 29  PRO C CB  1 
ATOM   5972  C CG  . PRO C 1 30  ? -20.207 -0.518  -34.193 1.00 21.34 ? 29  PRO C CG  1 
ATOM   5973  C CD  . PRO C 1 30  ? -20.390 -0.995  -35.590 1.00 21.77 ? 29  PRO C CD  1 
ATOM   5974  N N   . GLU C 1 31  ? -16.758 -0.652  -36.438 1.00 24.19 ? 30  GLU C N   1 
ATOM   5975  C CA  . GLU C 1 31  ? -15.380 -0.977  -36.786 1.00 25.40 ? 30  GLU C CA  1 
ATOM   5976  C C   . GLU C 1 31  ? -14.772 0.004   -37.762 1.00 24.90 ? 30  GLU C C   1 
ATOM   5977  O O   . GLU C 1 31  ? -13.568 -0.002  -37.959 1.00 25.28 ? 30  GLU C O   1 
ATOM   5978  C CB  . GLU C 1 31  ? -15.274 -2.404  -37.364 1.00 26.12 ? 30  GLU C CB  1 
ATOM   5979  C CG  . GLU C 1 31  ? -14.812 -3.466  -36.367 1.00 30.87 ? 30  GLU C CG  1 
ATOM   5980  C CD  . GLU C 1 31  ? -15.674 -3.553  -35.138 1.00 36.42 ? 30  GLU C CD  1 
ATOM   5981  O OE1 . GLU C 1 31  ? -15.115 -3.490  -34.004 1.00 38.75 ? 30  GLU C OE1 1 
ATOM   5982  O OE2 . GLU C 1 31  ? -16.918 -3.675  -35.311 1.00 41.62 ? 30  GLU C OE2 1 
ATOM   5983  N N   . GLN C 1 32  ? -15.588 0.847   -38.376 1.00 25.11 ? 31  GLN C N   1 
ATOM   5984  C CA  . GLN C 1 32  ? -15.074 1.838   -39.321 1.00 25.23 ? 31  GLN C CA  1 
ATOM   5985  C C   . GLN C 1 32  ? -14.347 2.989   -38.651 1.00 24.54 ? 31  GLN C C   1 
ATOM   5986  O O   . GLN C 1 32  ? -13.587 3.700   -39.306 1.00 25.31 ? 31  GLN C O   1 
ATOM   5987  C CB  . GLN C 1 32  ? -16.229 2.438   -40.122 1.00 25.35 ? 31  GLN C CB  1 
ATOM   5988  C CG  . GLN C 1 32  ? -16.916 1.465   -41.006 1.00 25.73 ? 31  GLN C CG  1 
ATOM   5989  C CD  . GLN C 1 32  ? -18.143 2.073   -41.585 1.00 25.98 ? 31  GLN C CD  1 
ATOM   5990  O OE1 . GLN C 1 32  ? -18.150 2.492   -42.742 1.00 26.00 ? 31  GLN C OE1 1 
ATOM   5991  N NE2 . GLN C 1 32  ? -19.197 2.149   -40.780 1.00 23.04 ? 31  GLN C NE2 1 
ATOM   5992  N N   . TRP C 1 33  ? -14.616 3.193   -37.371 1.00 24.19 ? 32  TRP C N   1 
ATOM   5993  C CA  . TRP C 1 33  ? -14.192 4.400   -36.678 1.00 24.39 ? 32  TRP C CA  1 
ATOM   5994  C C   . TRP C 1 33  ? -13.254 4.012   -35.558 1.00 24.50 ? 32  TRP C C   1 
ATOM   5995  O O   . TRP C 1 33  ? -13.469 2.986   -34.913 1.00 24.00 ? 32  TRP C O   1 
ATOM   5996  C CB  . TRP C 1 33  ? -15.402 5.113   -36.067 1.00 23.67 ? 32  TRP C CB  1 
ATOM   5997  C CG  . TRP C 1 33  ? -16.607 5.023   -36.917 1.00 22.94 ? 32  TRP C CG  1 
ATOM   5998  C CD1 . TRP C 1 33  ? -17.819 4.450   -36.587 1.00 22.05 ? 32  TRP C CD1 1 
ATOM   5999  C CD2 . TRP C 1 33  ? -16.732 5.485   -38.267 1.00 23.42 ? 32  TRP C CD2 1 
ATOM   6000  N NE1 . TRP C 1 33  ? -18.675 4.540   -37.645 1.00 21.93 ? 32  TRP C NE1 1 
ATOM   6001  C CE2 . TRP C 1 33  ? -18.043 5.162   -38.694 1.00 23.01 ? 32  TRP C CE2 1 
ATOM   6002  C CE3 . TRP C 1 33  ? -15.864 6.139   -39.162 1.00 22.43 ? 32  TRP C CE3 1 
ATOM   6003  C CZ2 . TRP C 1 33  ? -18.511 5.478   -39.969 1.00 22.74 ? 32  TRP C CZ2 1 
ATOM   6004  C CZ3 . TRP C 1 33  ? -16.333 6.451   -40.439 1.00 22.59 ? 32  TRP C CZ3 1 
ATOM   6005  C CH2 . TRP C 1 33  ? -17.644 6.125   -40.826 1.00 22.79 ? 32  TRP C CH2 1 
ATOM   6006  N N   . THR C 1 34  ? -12.253 4.857   -35.314 1.00 24.58 ? 33  THR C N   1 
ATOM   6007  C CA  . THR C 1 34  ? -11.355 4.697   -34.174 1.00 25.35 ? 33  THR C CA  1 
ATOM   6008  C C   . THR C 1 34  ? -12.166 4.645   -32.881 1.00 25.75 ? 33  THR C C   1 
ATOM   6009  O O   . THR C 1 34  ? -11.823 3.911   -31.954 1.00 26.25 ? 33  THR C O   1 
ATOM   6010  C CB  . THR C 1 34  ? -10.314 5.861   -34.080 1.00 25.61 ? 33  THR C CB  1 
ATOM   6011  O OG1 . THR C 1 34  ? -9.727  6.117   -35.367 1.00 26.35 ? 33  THR C OG1 1 
ATOM   6012  C CG2 . THR C 1 34  ? -9.199  5.521   -33.084 1.00 26.20 ? 33  THR C CG2 1 
ATOM   6013  N N   . SER C 1 35  ? -13.257 5.412   -32.836 1.00 25.40 ? 34  SER C N   1 
ATOM   6014  C CA  . SER C 1 35  ? -14.108 5.505   -31.644 1.00 25.21 ? 34  SER C CA  1 
ATOM   6015  C C   . SER C 1 35  ? -15.005 4.289   -31.387 1.00 25.14 ? 34  SER C C   1 
ATOM   6016  O O   . SER C 1 35  ? -15.545 4.143   -30.294 1.00 23.88 ? 34  SER C O   1 
ATOM   6017  C CB  . SER C 1 35  ? -15.015 6.732   -31.778 1.00 25.45 ? 34  SER C CB  1 
ATOM   6018  O OG  . SER C 1 35  ? -15.969 6.507   -32.792 1.00 24.46 ? 34  SER C OG  1 
ATOM   6019  N N   . ARG C 1 36  ? -15.208 3.447   -32.403 1.00 25.33 ? 35  ARG C N   1 
ATOM   6020  C CA  . ARG C 1 36  ? -16.221 2.389   -32.330 1.00 25.70 ? 35  ARG C CA  1 
ATOM   6021  C C   . ARG C 1 36  ? -17.634 2.929   -32.042 1.00 24.13 ? 35  ARG C C   1 
ATOM   6022  O O   . ARG C 1 36  ? -18.454 2.243   -31.440 1.00 23.84 ? 35  ARG C O   1 
ATOM   6023  C CB  . ARG C 1 36  ? -15.867 1.351   -31.264 1.00 26.71 ? 35  ARG C CB  1 
ATOM   6024  C CG  . ARG C 1 36  ? -14.433 0.861   -31.300 1.00 30.99 ? 35  ARG C CG  1 
ATOM   6025  C CD  . ARG C 1 36  ? -14.121 0.085   -32.550 1.00 36.67 ? 35  ARG C CD  1 
ATOM   6026  N NE  . ARG C 1 36  ? -13.107 0.760   -33.359 1.00 40.62 ? 35  ARG C NE  1 
ATOM   6027  C CZ  . ARG C 1 36  ? -12.395 0.179   -34.330 1.00 41.83 ? 35  ARG C CZ  1 
ATOM   6028  N NH1 . ARG C 1 36  ? -12.564 -1.107  -34.635 1.00 44.53 ? 35  ARG C NH1 1 
ATOM   6029  N NH2 . ARG C 1 36  ? -11.498 0.891   -35.001 1.00 41.18 ? 35  ARG C NH2 1 
ATOM   6030  N N   . ALA C 1 37  ? -17.902 4.154   -32.477 1.00 22.74 ? 36  ALA C N   1 
ATOM   6031  C CA  . ALA C 1 37  ? -19.245 4.736   -32.425 1.00 22.38 ? 36  ALA C CA  1 
ATOM   6032  C C   . ALA C 1 37  ? -20.268 3.842   -33.126 1.00 22.04 ? 36  ALA C C   1 
ATOM   6033  O O   . ALA C 1 37  ? -20.039 3.388   -34.250 1.00 22.46 ? 36  ALA C O   1 
ATOM   6034  C CB  . ALA C 1 37  ? -19.233 6.096   -33.087 1.00 21.60 ? 36  ALA C CB  1 
ATOM   6035  N N   . VAL C 1 38  ? -21.402 3.623   -32.470 1.00 21.50 ? 37  VAL C N   1 
ATOM   6036  C CA  . VAL C 1 38  ? -22.499 2.827   -33.010 1.00 21.20 ? 37  VAL C CA  1 
ATOM   6037  C C   . VAL C 1 38  ? -23.235 3.621   -34.097 1.00 20.58 ? 37  VAL C C   1 
ATOM   6038  O O   . VAL C 1 38  ? -23.772 3.038   -35.038 1.00 20.59 ? 37  VAL C O   1 
ATOM   6039  C CB  . VAL C 1 38  ? -23.451 2.391   -31.862 1.00 21.76 ? 37  VAL C CB  1 
ATOM   6040  C CG1 . VAL C 1 38  ? -24.847 2.114   -32.369 1.00 22.04 ? 37  VAL C CG1 1 
ATOM   6041  C CG2 . VAL C 1 38  ? -22.843 1.172   -31.077 1.00 21.76 ? 37  VAL C CG2 1 
ATOM   6042  N N   . VAL C 1 39  ? -23.239 4.949   -33.974 1.00 19.80 ? 38  VAL C N   1 
ATOM   6043  C CA  . VAL C 1 39  ? -23.773 5.840   -35.018 1.00 19.33 ? 38  VAL C CA  1 
ATOM   6044  C C   . VAL C 1 39  ? -22.587 6.520   -35.704 1.00 19.21 ? 38  VAL C C   1 
ATOM   6045  O O   . VAL C 1 39  ? -21.712 7.059   -35.006 1.00 18.56 ? 38  VAL C O   1 
ATOM   6046  C CB  . VAL C 1 39  ? -24.690 6.955   -34.411 1.00 19.55 ? 38  VAL C CB  1 
ATOM   6047  C CG1 . VAL C 1 39  ? -25.249 7.864   -35.498 1.00 19.06 ? 38  VAL C CG1 1 
ATOM   6048  C CG2 . VAL C 1 39  ? -25.801 6.343   -33.587 1.00 18.31 ? 38  VAL C CG2 1 
ATOM   6049  N N   . PRO C 1 40  ? -22.520 6.472   -37.058 1.00 19.02 ? 39  PRO C N   1 
ATOM   6050  C CA  . PRO C 1 40  ? -21.413 7.151   -37.754 1.00 19.11 ? 39  PRO C CA  1 
ATOM   6051  C C   . PRO C 1 40  ? -21.295 8.661   -37.461 1.00 19.07 ? 39  PRO C C   1 
ATOM   6052  O O   . PRO C 1 40  ? -22.300 9.383   -37.505 1.00 19.24 ? 39  PRO C O   1 
ATOM   6053  C CB  . PRO C 1 40  ? -21.742 6.913   -39.230 1.00 18.88 ? 39  PRO C CB  1 
ATOM   6054  C CG  . PRO C 1 40  ? -22.528 5.657   -39.216 1.00 18.89 ? 39  PRO C CG  1 
ATOM   6055  C CD  . PRO C 1 40  ? -23.384 5.764   -38.016 1.00 19.07 ? 39  PRO C CD  1 
ATOM   6056  N N   . PRO C 1 41  ? -20.060 9.140   -37.204 1.00 19.31 ? 40  PRO C N   1 
ATOM   6057  C CA  . PRO C 1 41  ? -19.846 10.590  -37.081 1.00 18.79 ? 40  PRO C CA  1 
ATOM   6058  C C   . PRO C 1 41  ? -20.209 11.367  -38.354 1.00 18.51 ? 40  PRO C C   1 
ATOM   6059  O O   . PRO C 1 41  ? -20.267 10.810  -39.465 1.00 18.74 ? 40  PRO C O   1 
ATOM   6060  C CB  . PRO C 1 41  ? -18.339 10.727  -36.788 1.00 19.22 ? 40  PRO C CB  1 
ATOM   6061  C CG  . PRO C 1 41  ? -17.852 9.362   -36.428 1.00 19.87 ? 40  PRO C CG  1 
ATOM   6062  C CD  . PRO C 1 41  ? -18.813 8.361   -37.036 1.00 18.84 ? 40  PRO C CD  1 
ATOM   6063  N N   . ILE C 1 42  ? -20.473 12.651  -38.175 1.00 17.22 ? 41  ILE C N   1 
ATOM   6064  C CA  . ILE C 1 42  ? -20.723 13.549  -39.282 1.00 16.88 ? 41  ILE C CA  1 
ATOM   6065  C C   . ILE C 1 42  ? -19.371 14.184  -39.618 1.00 16.54 ? 41  ILE C C   1 
ATOM   6066  O O   . ILE C 1 42  ? -18.860 15.028  -38.865 1.00 17.74 ? 41  ILE C O   1 
ATOM   6067  C CB  . ILE C 1 42  ? -21.736 14.654  -38.912 1.00 16.94 ? 41  ILE C CB  1 
ATOM   6068  C CG1 . ILE C 1 42  ? -22.952 14.076  -38.146 1.00 16.87 ? 41  ILE C CG1 1 
ATOM   6069  C CG2 . ILE C 1 42  ? -22.150 15.430  -40.153 1.00 16.12 ? 41  ILE C CG2 1 
ATOM   6070  C CD1 . ILE C 1 42  ? -23.788 15.120  -37.493 1.00 15.68 ? 41  ILE C CD1 1 
ATOM   6071  N N   . SER C 1 43  ? -18.777 13.742  -40.713 1.00 15.48 ? 42  SER C N   1 
ATOM   6072  C CA  . SER C 1 43  ? -17.503 14.274  -41.166 1.00 15.02 ? 42  SER C CA  1 
ATOM   6073  C C   . SER C 1 43  ? -17.744 15.375  -42.186 1.00 14.88 ? 42  SER C C   1 
ATOM   6074  O O   . SER C 1 43  ? -18.095 15.123  -43.357 1.00 15.26 ? 42  SER C O   1 
ATOM   6075  C CB  . SER C 1 43  ? -16.611 13.162  -41.734 1.00 15.09 ? 42  SER C CB  1 
ATOM   6076  O OG  . SER C 1 43  ? -15.322 13.652  -42.019 1.00 15.02 ? 42  SER C OG  1 
ATOM   6077  N N   . LEU C 1 44  ? -17.548 16.609  -41.738 1.00 14.90 ? 43  LEU C N   1 
ATOM   6078  C CA  . LEU C 1 44  ? -17.728 17.764  -42.613 1.00 15.52 ? 43  LEU C CA  1 
ATOM   6079  C C   . LEU C 1 44  ? -16.472 18.120  -43.358 1.00 15.12 ? 43  LEU C C   1 
ATOM   6080  O O   . LEU C 1 44  ? -16.520 18.908  -44.300 1.00 15.79 ? 43  LEU C O   1 
ATOM   6081  C CB  . LEU C 1 44  ? -18.181 18.984  -41.814 1.00 16.03 ? 43  LEU C CB  1 
ATOM   6082  C CG  . LEU C 1 44  ? -19.470 18.877  -41.010 1.00 15.74 ? 43  LEU C CG  1 
ATOM   6083  C CD1 . LEU C 1 44  ? -19.889 20.277  -40.553 1.00 16.51 ? 43  LEU C CD1 1 
ATOM   6084  C CD2 . LEU C 1 44  ? -20.570 18.265  -41.815 1.00 12.79 ? 43  LEU C CD2 1 
ATOM   6085  N N   . SER C 1 45  ? -15.327 17.589  -42.938 1.00 14.86 ? 44  SER C N   1 
ATOM   6086  C CA  . SER C 1 45  ? -14.060 17.937  -43.587 1.00 14.42 ? 44  SER C CA  1 
ATOM   6087  C C   . SER C 1 45  ? -14.156 17.880  -45.128 1.00 14.34 ? 44  SER C C   1 
ATOM   6088  O O   . SER C 1 45  ? -14.565 16.862  -45.700 1.00 14.60 ? 44  SER C O   1 
ATOM   6089  C CB  . SER C 1 45  ? -12.924 17.018  -43.130 1.00 15.18 ? 44  SER C CB  1 
ATOM   6090  O OG  . SER C 1 45  ? -11.660 17.502  -43.583 1.00 13.99 ? 44  SER C OG  1 
ATOM   6091  N N   . THR C 1 46  ? -13.760 18.973  -45.779 1.00 13.61 ? 45  THR C N   1 
ATOM   6092  C CA  . THR C 1 46  ? -13.664 19.021  -47.232 1.00 13.15 ? 45  THR C CA  1 
ATOM   6093  C C   . THR C 1 46  ? -12.469 18.233  -47.757 1.00 13.15 ? 45  THR C C   1 
ATOM   6094  O O   . THR C 1 46  ? -12.488 17.776  -48.906 1.00 13.11 ? 45  THR C O   1 
ATOM   6095  C CB  . THR C 1 46  ? -13.574 20.457  -47.785 1.00 13.24 ? 45  THR C CB  1 
ATOM   6096  O OG1 . THR C 1 46  ? -12.383 21.104  -47.312 1.00 11.88 ? 45  THR C OG1 1 
ATOM   6097  C CG2 . THR C 1 46  ? -14.825 21.260  -47.413 1.00 13.54 ? 45  THR C CG2 1 
ATOM   6098  N N   . THR C 1 47  ? -11.450 18.048  -46.930 1.00 13.42 ? 46  THR C N   1 
ATOM   6099  C CA  . THR C 1 47  ? -10.208 17.447  -47.411 1.00 14.25 ? 46  THR C CA  1 
ATOM   6100  C C   . THR C 1 47  ? -9.615  16.521  -46.378 1.00 14.56 ? 46  THR C C   1 
ATOM   6101  O O   . THR C 1 47  ? -10.094 16.419  -45.230 1.00 15.02 ? 46  THR C O   1 
ATOM   6102  C CB  . THR C 1 47  ? -9.178  18.512  -47.961 1.00 14.20 ? 46  THR C CB  1 
ATOM   6103  O OG1 . THR C 1 47  ? -8.140  17.853  -48.723 1.00 14.25 ? 46  THR C OG1 1 
ATOM   6104  C CG2 . THR C 1 47  ? -8.566  19.353  -46.856 1.00 15.02 ? 46  THR C CG2 1 
ATOM   6105  N N   . PHE C 1 48  ? -8.607  15.784  -46.827 1.00 14.86 ? 47  PHE C N   1 
ATOM   6106  C CA  . PHE C 1 48  ? -8.069  14.659  -46.090 1.00 15.24 ? 47  PHE C CA  1 
ATOM   6107  C C   . PHE C 1 48  ? -6.568  14.593  -46.384 1.00 15.85 ? 47  PHE C C   1 
ATOM   6108  O O   . PHE C 1 48  ? -6.118  14.857  -47.519 1.00 14.04 ? 47  PHE C O   1 
ATOM   6109  C CB  . PHE C 1 48  ? -8.740  13.352  -46.526 1.00 15.64 ? 47  PHE C CB  1 
ATOM   6110  C CG  . PHE C 1 48  ? -10.247 13.404  -46.498 1.00 15.70 ? 47  PHE C CG  1 
ATOM   6111  C CD1 . PHE C 1 48  ? -10.950 13.916  -47.569 1.00 15.95 ? 47  PHE C CD1 1 
ATOM   6112  C CD2 . PHE C 1 48  ? -10.952 12.964  -45.383 1.00 15.29 ? 47  PHE C CD2 1 
ATOM   6113  C CE1 . PHE C 1 48  ? -12.354 13.977  -47.548 1.00 16.44 ? 47  PHE C CE1 1 
ATOM   6114  C CE2 . PHE C 1 48  ? -12.345 13.022  -45.345 1.00 15.05 ? 47  PHE C CE2 1 
ATOM   6115  C CZ  . PHE C 1 48  ? -13.048 13.531  -46.429 1.00 15.48 ? 47  PHE C CZ  1 
ATOM   6116  N N   . LYS C 1 49  ? -5.823  14.240  -45.343 1.00 16.20 ? 48  LYS C N   1 
ATOM   6117  C CA  . LYS C 1 49  ? -4.375  14.148  -45.408 1.00 17.38 ? 48  LYS C CA  1 
ATOM   6118  C C   . LYS C 1 49  ? -3.948  12.926  -46.218 1.00 17.55 ? 48  LYS C C   1 
ATOM   6119  O O   . LYS C 1 49  ? -4.491  11.832  -46.055 1.00 17.04 ? 48  LYS C O   1 
ATOM   6120  C CB  . LYS C 1 49  ? -3.824  14.095  -43.977 1.00 17.10 ? 48  LYS C CB  1 
ATOM   6121  C CG  . LYS C 1 49  ? -2.319  13.934  -43.867 1.00 18.60 ? 48  LYS C CG  1 
ATOM   6122  C CD  . LYS C 1 49  ? -1.866  14.169  -42.443 1.00 19.38 ? 48  LYS C CD  1 
ATOM   6123  C CE  . LYS C 1 49  ? -0.468  13.654  -42.199 1.00 22.38 ? 48  LYS C CE  1 
ATOM   6124  N NZ  . LYS C 1 49  ? -0.053  14.154  -40.861 1.00 27.13 ? 48  LYS C NZ  1 
ATOM   6125  N N   . GLN C 1 50  ? -2.958  13.118  -47.078 1.00 18.71 ? 49  GLN C N   1 
ATOM   6126  C CA  . GLN C 1 50  ? -2.442  12.055  -47.921 1.00 20.42 ? 49  GLN C CA  1 
ATOM   6127  C C   . GLN C 1 50  ? -1.031  11.700  -47.462 1.00 21.19 ? 49  GLN C C   1 
ATOM   6128  O O   . GLN C 1 50  ? -0.273  12.567  -47.034 1.00 21.32 ? 49  GLN C O   1 
ATOM   6129  C CB  . GLN C 1 50  ? -2.428  12.500  -49.381 1.00 19.96 ? 49  GLN C CB  1 
ATOM   6130  C CG  . GLN C 1 50  ? -3.815  12.744  -49.958 1.00 21.43 ? 49  GLN C CG  1 
ATOM   6131  C CD  . GLN C 1 50  ? -3.819  12.908  -51.462 1.00 22.30 ? 49  GLN C CD  1 
ATOM   6132  O OE1 . GLN C 1 50  ? -2.935  12.390  -52.165 1.00 24.14 ? 49  GLN C OE1 1 
ATOM   6133  N NE2 . GLN C 1 50  ? -4.812  13.642  -51.975 1.00 22.49 ? 49  GLN C NE2 1 
ATOM   6134  N N   . GLY C 1 51  ? -0.691  10.419  -47.537 1.00 22.40 ? 50  GLY C N   1 
ATOM   6135  C CA  . GLY C 1 51  ? 0.634   9.934   -47.143 1.00 22.74 ? 50  GLY C CA  1 
ATOM   6136  C C   . GLY C 1 51  ? 1.696   10.254  -48.180 1.00 23.53 ? 50  GLY C C   1 
ATOM   6137  O O   . GLY C 1 51  ? 2.855   10.358  -47.862 1.00 23.08 ? 50  GLY C O   1 
ATOM   6138  N N   . ALA C 1 52  ? 1.294   10.374  -49.434 1.00 24.68 ? 51  ALA C N   1 
ATOM   6139  C CA  . ALA C 1 52  ? 2.195   10.800  -50.499 1.00 25.88 ? 51  ALA C CA  1 
ATOM   6140  C C   . ALA C 1 52  ? 1.298   11.296  -51.615 1.00 26.92 ? 51  ALA C C   1 
ATOM   6141  O O   . ALA C 1 52  ? 0.103   10.981  -51.606 1.00 27.41 ? 51  ALA C O   1 
ATOM   6142  C CB  . ALA C 1 52  ? 3.067   9.621   -50.964 1.00 25.61 ? 51  ALA C CB  1 
ATOM   6143  N N   . PRO C 1 53  ? 1.841   12.074  -52.572 1.00 28.55 ? 52  PRO C N   1 
ATOM   6144  C CA  . PRO C 1 53  ? 0.974   12.655  -53.608 1.00 29.71 ? 52  PRO C CA  1 
ATOM   6145  C C   . PRO C 1 53  ? 0.188   11.615  -54.429 1.00 31.84 ? 52  PRO C C   1 
ATOM   6146  O O   . PRO C 1 53  ? 0.772   10.656  -54.950 1.00 31.88 ? 52  PRO C O   1 
ATOM   6147  C CB  . PRO C 1 53  ? 1.956   13.425  -54.499 1.00 29.53 ? 52  PRO C CB  1 
ATOM   6148  C CG  . PRO C 1 53  ? 3.149   13.669  -53.648 1.00 28.97 ? 52  PRO C CG  1 
ATOM   6149  C CD  . PRO C 1 53  ? 3.247   12.481  -52.753 1.00 28.39 ? 52  PRO C CD  1 
ATOM   6150  N N   . GLY C 1 54  ? -1.126  11.799  -54.518 1.00 34.00 ? 53  GLY C N   1 
ATOM   6151  C CA  . GLY C 1 54  ? -1.990  10.883  -55.260 1.00 36.39 ? 53  GLY C CA  1 
ATOM   6152  C C   . GLY C 1 54  ? -2.446  9.672   -54.454 1.00 38.10 ? 53  GLY C C   1 
ATOM   6153  O O   . GLY C 1 54  ? -3.592  9.245   -54.583 1.00 38.82 ? 53  GLY C O   1 
ATOM   6154  N N   . GLN C 1 55  ? -1.539  9.093   -53.659 1.00 40.04 ? 54  GLN C N   1 
ATOM   6155  C CA  . GLN C 1 55  ? -1.889  8.094   -52.648 1.00 41.19 ? 54  GLN C CA  1 
ATOM   6156  C C   . GLN C 1 55  ? -2.655  6.900   -53.251 1.00 41.77 ? 54  GLN C C   1 
ATOM   6157  O O   . GLN C 1 55  ? -3.865  6.967   -53.537 1.00 42.79 ? 54  GLN C O   1 
ATOM   6158  C CB  . GLN C 1 55  ? -2.707  8.777   -51.549 1.00 41.37 ? 54  GLN C CB  1 
ATOM   6159  C CG  . GLN C 1 55  ? -2.878  7.998   -50.258 1.00 41.78 ? 54  GLN C CG  1 
ATOM   6160  C CD  . GLN C 1 55  ? -4.217  8.294   -49.572 1.00 42.75 ? 54  GLN C CD  1 
ATOM   6161  O OE1 . GLN C 1 55  ? -5.000  9.158   -50.019 1.00 45.28 ? 54  GLN C OE1 1 
ATOM   6162  N NE2 . GLN C 1 55  ? -4.497  7.562   -48.492 1.00 43.69 ? 54  GLN C NE2 1 
ATOM   6163  N N   . GLY C 1 58  ? -7.907  5.776   -49.690 1.00 29.34 ? 57  GLY C N   1 
ATOM   6164  C CA  . GLY C 1 58  ? -8.515  6.679   -48.689 1.00 28.60 ? 57  GLY C CA  1 
ATOM   6165  C C   . GLY C 1 58  ? -9.238  7.851   -49.321 1.00 28.15 ? 57  GLY C C   1 
ATOM   6166  O O   . GLY C 1 58  ? -9.228  8.015   -50.556 1.00 29.31 ? 57  GLY C O   1 
ATOM   6167  N N   . PHE C 1 59  ? -9.862  8.687   -48.495 1.00 26.91 ? 58  PHE C N   1 
ATOM   6168  C CA  . PHE C 1 59  ? -10.560 9.867   -49.011 1.00 25.35 ? 58  PHE C CA  1 
ATOM   6169  C C   . PHE C 1 59  ? -9.581  10.950  -49.481 1.00 24.46 ? 58  PHE C C   1 
ATOM   6170  O O   . PHE C 1 59  ? -8.474  11.073  -48.948 1.00 23.65 ? 58  PHE C O   1 
ATOM   6171  C CB  . PHE C 1 59  ? -11.518 10.418  -47.952 1.00 25.10 ? 58  PHE C CB  1 
ATOM   6172  C CG  . PHE C 1 59  ? -12.598 9.458   -47.582 1.00 24.27 ? 58  PHE C CG  1 
ATOM   6173  C CD1 . PHE C 1 59  ? -13.684 9.280   -48.419 1.00 23.47 ? 58  PHE C CD1 1 
ATOM   6174  C CD2 . PHE C 1 59  ? -12.506 8.692   -46.415 1.00 24.86 ? 58  PHE C CD2 1 
ATOM   6175  C CE1 . PHE C 1 59  ? -14.693 8.383   -48.092 1.00 23.43 ? 58  PHE C CE1 1 
ATOM   6176  C CE2 . PHE C 1 59  ? -13.515 7.787   -46.083 1.00 25.22 ? 58  PHE C CE2 1 
ATOM   6177  C CZ  . PHE C 1 59  ? -14.607 7.635   -46.927 1.00 24.16 ? 58  PHE C CZ  1 
ATOM   6178  N N   . GLU C 1 60  ? -9.988  11.718  -50.491 1.00 23.62 ? 59  GLU C N   1 
ATOM   6179  C CA  . GLU C 1 60  ? -9.155  12.825  -50.981 1.00 23.81 ? 59  GLU C CA  1 
ATOM   6180  C C   . GLU C 1 60  ? -9.856  14.168  -51.080 1.00 22.10 ? 59  GLU C C   1 
ATOM   6181  O O   . GLU C 1 60  ? -9.225  15.185  -50.837 1.00 21.38 ? 59  GLU C O   1 
ATOM   6182  C CB  . GLU C 1 60  ? -8.442  12.470  -52.300 1.00 24.23 ? 59  GLU C CB  1 
ATOM   6183  C CG  . GLU C 1 60  ? -9.297  12.135  -53.456 1.00 25.61 ? 59  GLU C CG  1 
ATOM   6184  C CD  . GLU C 1 60  ? -8.459  11.780  -54.667 1.00 26.64 ? 59  GLU C CD  1 
ATOM   6185  O OE1 . GLU C 1 60  ? -7.722  10.773  -54.607 1.00 30.48 ? 59  GLU C OE1 1 
ATOM   6186  O OE2 . GLU C 1 60  ? -8.533  12.523  -55.678 1.00 33.46 ? 59  GLU C OE2 1 
ATOM   6187  N N   . TYR C 1 61  ? -11.149 14.173  -51.422 1.00 20.75 ? 60  TYR C N   1 
ATOM   6188  C CA  . TYR C 1 61  ? -11.932 15.413  -51.452 1.00 19.13 ? 60  TYR C CA  1 
ATOM   6189  C C   . TYR C 1 61  ? -13.423 15.130  -51.268 1.00 18.07 ? 60  TYR C C   1 
ATOM   6190  O O   . TYR C 1 61  ? -13.983 14.290  -51.969 1.00 17.00 ? 60  TYR C O   1 
ATOM   6191  C CB  . TYR C 1 61  ? -11.733 16.092  -52.799 1.00 19.00 ? 60  TYR C CB  1 
ATOM   6192  C CG  . TYR C 1 61  ? -12.255 17.503  -52.885 1.00 18.37 ? 60  TYR C CG  1 
ATOM   6193  C CD1 . TYR C 1 61  ? -13.252 17.845  -53.811 1.00 18.47 ? 60  TYR C CD1 1 
ATOM   6194  C CD2 . TYR C 1 61  ? -11.710 18.526  -52.083 1.00 18.40 ? 60  TYR C CD2 1 
ATOM   6195  C CE1 . TYR C 1 61  ? -13.713 19.172  -53.918 1.00 17.56 ? 60  TYR C CE1 1 
ATOM   6196  C CE2 . TYR C 1 61  ? -12.172 19.855  -52.186 1.00 17.66 ? 60  TYR C CE2 1 
ATOM   6197  C CZ  . TYR C 1 61  ? -13.165 20.161  -53.106 1.00 17.64 ? 60  TYR C CZ  1 
ATOM   6198  O OH  . TYR C 1 61  ? -13.591 21.450  -53.258 1.00 18.21 ? 60  TYR C OH  1 
ATOM   6199  N N   . SER C 1 62  ? -14.060 15.869  -50.363 1.00 17.26 ? 61  SER C N   1 
ATOM   6200  C CA  . SER C 1 62  ? -15.403 15.540  -49.905 1.00 16.18 ? 61  SER C CA  1 
ATOM   6201  C C   . SER C 1 62  ? -16.410 15.301  -51.036 1.00 15.83 ? 61  SER C C   1 
ATOM   6202  O O   . SER C 1 62  ? -17.206 14.355  -50.964 1.00 14.49 ? 61  SER C O   1 
ATOM   6203  C CB  . SER C 1 62  ? -15.931 16.623  -48.956 1.00 16.29 ? 61  SER C CB  1 
ATOM   6204  O OG  . SER C 1 62  ? -17.299 16.414  -48.659 1.00 15.29 ? 61  SER C OG  1 
ATOM   6205  N N   . ARG C 1 63  ? -16.369 16.156  -52.063 1.00 15.92 ? 62  ARG C N   1 
ATOM   6206  C CA  . ARG C 1 63  ? -17.284 16.063  -53.205 1.00 15.52 ? 62  ARG C CA  1 
ATOM   6207  C C   . ARG C 1 63  ? -17.128 14.721  -53.891 1.00 15.72 ? 62  ARG C C   1 
ATOM   6208  O O   . ARG C 1 63  ? -18.103 14.143  -54.354 1.00 14.85 ? 62  ARG C O   1 
ATOM   6209  C CB  . ARG C 1 63  ? -17.042 17.193  -54.234 1.00 15.75 ? 62  ARG C CB  1 
ATOM   6210  C CG  . ARG C 1 63  ? -17.853 17.005  -55.519 1.00 15.92 ? 62  ARG C CG  1 
ATOM   6211  C CD  . ARG C 1 63  ? -17.903 18.186  -56.475 1.00 15.84 ? 62  ARG C CD  1 
ATOM   6212  N NE  . ARG C 1 63  ? -16.687 18.989  -56.519 1.00 18.43 ? 62  ARG C NE  1 
ATOM   6213  C CZ  . ARG C 1 63  ? -15.520 18.574  -57.012 1.00 18.61 ? 62  ARG C CZ  1 
ATOM   6214  N NH1 . ARG C 1 63  ? -14.489 19.399  -57.019 1.00 17.28 ? 62  ARG C NH1 1 
ATOM   6215  N NH2 . ARG C 1 63  ? -15.381 17.349  -57.507 1.00 18.01 ? 62  ARG C NH2 1 
ATOM   6216  N N   . SER C 1 64  ? -15.887 14.250  -53.993 1.00 15.76 ? 63  SER C N   1 
ATOM   6217  C CA  . SER C 1 64  ? -15.598 12.990  -54.671 1.00 15.73 ? 63  SER C CA  1 
ATOM   6218  C C   . SER C 1 64  ? -16.094 11.824  -53.829 1.00 15.62 ? 63  SER C C   1 
ATOM   6219  O O   . SER C 1 64  ? -16.597 10.842  -54.341 1.00 15.44 ? 63  SER C O   1 
ATOM   6220  C CB  . SER C 1 64  ? -14.088 12.870  -54.932 1.00 16.28 ? 63  SER C CB  1 
ATOM   6221  O OG  . SER C 1 64  ? -13.607 14.038  -55.615 1.00 16.41 ? 63  SER C OG  1 
ATOM   6222  N N   . GLY C 1 65  ? -15.974 11.956  -52.516 1.00 15.33 ? 64  GLY C N   1 
ATOM   6223  C CA  . GLY C 1 65  ? -16.421 10.918  -51.603 1.00 15.44 ? 64  GLY C CA  1 
ATOM   6224  C C   . GLY C 1 65  ? -16.100 11.310  -50.176 1.00 14.70 ? 64  GLY C C   1 
ATOM   6225  O O   . GLY C 1 65  ? -15.096 11.971  -49.913 1.00 15.16 ? 64  GLY C O   1 
ATOM   6226  N N   . ASN C 1 66  ? -16.952 10.912  -49.243 1.00 14.48 ? 65  ASN C N   1 
ATOM   6227  C CA  . ASN C 1 66  ? -16.706 11.249  -47.843 1.00 13.64 ? 65  ASN C CA  1 
ATOM   6228  C C   . ASN C 1 66  ? -17.398 10.235  -46.954 1.00 13.47 ? 65  ASN C C   1 
ATOM   6229  O O   . ASN C 1 66  ? -18.318 9.561   -47.417 1.00 12.99 ? 65  ASN C O   1 
ATOM   6230  C CB  . ASN C 1 66  ? -17.150 12.694  -47.548 1.00 13.71 ? 65  ASN C CB  1 
ATOM   6231  C CG  . ASN C 1 66  ? -18.636 12.912  -47.750 1.00 12.31 ? 65  ASN C CG  1 
ATOM   6232  O OD1 . ASN C 1 66  ? -19.447 12.516  -46.909 1.00 10.73 ? 65  ASN C OD1 1 
ATOM   6233  N ND2 . ASN C 1 66  ? -18.998 13.574  -48.853 1.00 9.79  ? 65  ASN C ND2 1 
ATOM   6234  N N   . PRO C 1 67  ? -16.932 10.095  -45.697 1.00 13.45 ? 66  PRO C N   1 
ATOM   6235  C CA  . PRO C 1 67  ? -17.376 8.987   -44.851 1.00 13.21 ? 66  PRO C CA  1 
ATOM   6236  C C   . PRO C 1 67  ? -18.880 8.929   -44.639 1.00 11.95 ? 66  PRO C C   1 
ATOM   6237  O O   . PRO C 1 67  ? -19.479 7.864   -44.747 1.00 12.16 ? 66  PRO C O   1 
ATOM   6238  C CB  . PRO C 1 67  ? -16.651 9.244   -43.515 1.00 13.20 ? 66  PRO C CB  1 
ATOM   6239  C CG  . PRO C 1 67  ? -15.522 10.085  -43.846 1.00 14.48 ? 66  PRO C CG  1 
ATOM   6240  C CD  . PRO C 1 67  ? -15.927 10.921  -45.019 1.00 13.64 ? 66  PRO C CD  1 
ATOM   6241  N N   . THR C 1 68  ? -19.479 10.066  -44.334 1.00 11.38 ? 67  THR C N   1 
ATOM   6242  C CA  . THR C 1 68  ? -20.901 10.102  -43.992 1.00 11.27 ? 67  THR C CA  1 
ATOM   6243  C C   . THR C 1 68  ? -21.818 9.819   -45.183 1.00 11.05 ? 67  THR C C   1 
ATOM   6244  O O   . THR C 1 68  ? -22.759 9.042   -45.060 1.00 11.70 ? 67  THR C O   1 
ATOM   6245  C CB  . THR C 1 68  ? -21.268 11.398  -43.250 1.00 11.09 ? 67  THR C CB  1 
ATOM   6246  O OG1 . THR C 1 68  ? -20.377 11.540  -42.124 1.00 10.04 ? 67  THR C OG1 1 
ATOM   6247  C CG2 . THR C 1 68  ? -22.724 11.324  -42.757 1.00 10.78 ? 67  THR C CG2 1 
ATOM   6248  N N   . ARG C 1 69  ? -21.523 10.404  -46.335 1.00 10.71 ? 68  ARG C N   1 
ATOM   6249  C CA  . ARG C 1 69  ? -22.256 10.072  -47.549 1.00 11.53 ? 68  ARG C CA  1 
ATOM   6250  C C   . ARG C 1 69  ? -22.081 8.612   -47.955 1.00 11.62 ? 68  ARG C C   1 
ATOM   6251  O O   . ARG C 1 69  ? -23.039 7.945   -48.342 1.00 11.33 ? 68  ARG C O   1 
ATOM   6252  C CB  . ARG C 1 69  ? -21.814 10.960  -48.699 1.00 11.05 ? 68  ARG C CB  1 
ATOM   6253  C CG  . ARG C 1 69  ? -22.625 10.775  -49.954 1.00 10.85 ? 68  ARG C CG  1 
ATOM   6254  C CD  . ARG C 1 69  ? -22.130 11.766  -50.957 1.00 12.50 ? 68  ARG C CD  1 
ATOM   6255  N NE  . ARG C 1 69  ? -21.074 11.242  -51.822 1.00 11.58 ? 68  ARG C NE  1 
ATOM   6256  C CZ  . ARG C 1 69  ? -20.245 11.989  -52.556 1.00 11.71 ? 68  ARG C CZ  1 
ATOM   6257  N NH1 . ARG C 1 69  ? -20.269 13.302  -52.495 1.00 11.77 ? 68  ARG C NH1 1 
ATOM   6258  N NH2 . ARG C 1 69  ? -19.377 11.416  -53.375 1.00 11.50 ? 68  ARG C NH2 1 
ATOM   6259  N N   . ASN C 1 70  ? -20.847 8.121   -47.882 1.00 11.89 ? 69  ASN C N   1 
ATOM   6260  C CA  . ASN C 1 70  ? -20.561 6.759   -48.319 1.00 11.94 ? 69  ASN C CA  1 
ATOM   6261  C C   . ASN C 1 70  ? -21.345 5.770   -47.467 1.00 11.37 ? 69  ASN C C   1 
ATOM   6262  O O   . ASN C 1 70  ? -21.872 4.777   -47.993 1.00 9.81  ? 69  ASN C O   1 
ATOM   6263  C CB  . ASN C 1 70  ? -19.054 6.475   -48.321 1.00 12.50 ? 69  ASN C CB  1 
ATOM   6264  C CG  . ASN C 1 70  ? -18.316 7.220   -49.452 1.00 13.99 ? 69  ASN C CG  1 
ATOM   6265  O OD1 . ASN C 1 70  ? -18.772 8.245   -49.967 1.00 16.64 ? 69  ASN C OD1 1 
ATOM   6266  N ND2 . ASN C 1 70  ? -17.189 6.668   -49.865 1.00 18.81 ? 69  ASN C ND2 1 
ATOM   6267  N N   . CYS C 1 71  ? -21.465 6.064   -46.169 1.00 11.26 ? 70  CYS C N   1 
ATOM   6268  C CA  . CYS C 1 71  ? -22.281 5.245   -45.268 1.00 11.78 ? 70  CYS C CA  1 
ATOM   6269  C C   . CYS C 1 71  ? -23.749 5.209   -45.649 1.00 10.98 ? 70  CYS C C   1 
ATOM   6270  O O   . CYS C 1 71  ? -24.356 4.156   -45.590 1.00 11.56 ? 70  CYS C O   1 
ATOM   6271  C CB  . CYS C 1 71  ? -22.178 5.708   -43.824 1.00 11.89 ? 70  CYS C CB  1 
ATOM   6272  S SG  . CYS C 1 71  ? -20.539 5.442   -43.049 1.00 17.09 ? 70  CYS C SG  1 
ATOM   6273  N N   . LEU C 1 72  ? -24.327 6.371   -45.955 1.00 10.88 ? 71  LEU C N   1 
ATOM   6274  C CA  . LEU C 1 72  ? -25.718 6.472   -46.387 1.00 10.50 ? 71  LEU C CA  1 
ATOM   6275  C C   . LEU C 1 72  ? -25.921 5.705   -47.675 1.00 10.89 ? 71  LEU C C   1 
ATOM   6276  O O   . LEU C 1 72  ? -26.922 4.993   -47.840 1.00 11.18 ? 71  LEU C O   1 
ATOM   6277  C CB  . LEU C 1 72  ? -26.134 7.960   -46.574 1.00 11.19 ? 71  LEU C CB  1 
ATOM   6278  C CG  . LEU C 1 72  ? -27.488 8.286   -47.266 1.00 9.86  ? 71  LEU C CG  1 
ATOM   6279  C CD1 . LEU C 1 72  ? -28.651 7.750   -46.465 1.00 9.16  ? 71  LEU C CD1 1 
ATOM   6280  C CD2 . LEU C 1 72  ? -27.647 9.808   -47.521 1.00 7.89  ? 71  LEU C CD2 1 
ATOM   6281  N N   . GLU C 1 73  ? -24.988 5.868   -48.609 1.00 11.76 ? 72  GLU C N   1 
ATOM   6282  C CA  . GLU C 1 73  ? -25.088 5.198   -49.919 1.00 11.84 ? 72  GLU C CA  1 
ATOM   6283  C C   . GLU C 1 73  ? -25.094 3.666   -49.791 1.00 11.92 ? 72  GLU C C   1 
ATOM   6284  O O   . GLU C 1 73  ? -25.809 2.988   -50.495 1.00 11.55 ? 72  GLU C O   1 
ATOM   6285  C CB  . GLU C 1 73  ? -23.978 5.677   -50.863 1.00 11.74 ? 72  GLU C CB  1 
ATOM   6286  C CG  . GLU C 1 73  ? -24.179 7.087   -51.348 1.00 12.27 ? 72  GLU C CG  1 
ATOM   6287  C CD  . GLU C 1 73  ? -23.008 7.645   -52.153 1.00 12.55 ? 72  GLU C CD  1 
ATOM   6288  O OE1 . GLU C 1 73  ? -21.960 6.975   -52.267 1.00 12.80 ? 72  GLU C OE1 1 
ATOM   6289  O OE2 . GLU C 1 73  ? -23.138 8.767   -52.695 1.00 10.37 ? 72  GLU C OE2 1 
ATOM   6290  N N   . LYS C 1 74  ? -24.278 3.135   -48.900 1.00 12.54 ? 73  LYS C N   1 
ATOM   6291  C CA  . LYS C 1 74  ? -24.260 1.699   -48.645 1.00 13.03 ? 73  LYS C CA  1 
ATOM   6292  C C   . LYS C 1 74  ? -25.608 1.221   -48.115 1.00 11.44 ? 73  LYS C C   1 
ATOM   6293  O O   . LYS C 1 74  ? -26.142 0.199   -48.557 1.00 10.61 ? 73  LYS C O   1 
ATOM   6294  C CB  . LYS C 1 74  ? -23.220 1.350   -47.587 1.00 13.94 ? 73  LYS C CB  1 
ATOM   6295  C CG  . LYS C 1 74  ? -21.848 1.123   -48.054 1.00 19.04 ? 73  LYS C CG  1 
ATOM   6296  C CD  . LYS C 1 74  ? -21.062 0.472   -46.921 1.00 23.46 ? 73  LYS C CD  1 
ATOM   6297  C CE  . LYS C 1 74  ? -19.635 0.082   -47.320 1.00 26.40 ? 73  LYS C CE  1 
ATOM   6298  N NZ  . LYS C 1 74  ? -18.811 -0.421  -46.136 1.00 27.21 ? 73  LYS C NZ  1 
ATOM   6299  N N   . ALA C 1 75  ? -26.131 1.948   -47.135 1.00 10.52 ? 74  ALA C N   1 
ATOM   6300  C CA  . ALA C 1 75  ? -27.433 1.620   -46.529 1.00 10.51 ? 74  ALA C CA  1 
ATOM   6301  C C   . ALA C 1 75  ? -28.561 1.644   -47.574 1.00 10.89 ? 74  ALA C C   1 
ATOM   6302  O O   . ALA C 1 75  ? -29.311 0.685   -47.708 1.00 10.73 ? 74  ALA C O   1 
ATOM   6303  C CB  . ALA C 1 75  ? -27.750 2.583   -45.376 1.00 10.18 ? 74  ALA C CB  1 
ATOM   6304  N N   . VAL C 1 76  ? -28.653 2.735   -48.333 1.00 10.52 ? 75  VAL C N   1 
ATOM   6305  C CA  . VAL C 1 76  ? -29.691 2.851   -49.357 1.00 10.51 ? 75  VAL C CA  1 
ATOM   6306  C C   . VAL C 1 76  ? -29.573 1.711   -50.379 1.00 10.78 ? 75  VAL C C   1 
ATOM   6307  O O   . VAL C 1 76  ? -30.564 1.056   -50.716 1.00 9.91  ? 75  VAL C O   1 
ATOM   6308  C CB  . VAL C 1 76  ? -29.649 4.209   -50.073 1.00 9.91  ? 75  VAL C CB  1 
ATOM   6309  C CG1 . VAL C 1 76  ? -30.677 4.231   -51.210 1.00 9.46  ? 75  VAL C CG1 1 
ATOM   6310  C CG2 . VAL C 1 76  ? -29.925 5.326   -49.093 1.00 7.52  ? 75  VAL C CG2 1 
ATOM   6311  N N   . ALA C 1 77  ? -28.362 1.466   -50.865 1.00 11.41 ? 76  ALA C N   1 
ATOM   6312  C CA  . ALA C 1 77  ? -28.152 0.343   -51.785 1.00 11.35 ? 76  ALA C CA  1 
ATOM   6313  C C   . ALA C 1 77  ? -28.737 -0.968  -51.189 1.00 11.66 ? 76  ALA C C   1 
ATOM   6314  O O   . ALA C 1 77  ? -29.538 -1.663  -51.834 1.00 12.31 ? 76  ALA C O   1 
ATOM   6315  C CB  . ALA C 1 77  ? -26.659 0.208   -52.131 1.00 11.33 ? 76  ALA C CB  1 
ATOM   6316  N N   . ALA C 1 78  ? -28.385 -1.284  -49.947 1.00 11.64 ? 77  ALA C N   1 
ATOM   6317  C CA  . ALA C 1 78  ? -28.927 -2.479  -49.274 1.00 11.11 ? 77  ALA C CA  1 
ATOM   6318  C C   . ALA C 1 78  ? -30.459 -2.497  -49.330 1.00 11.67 ? 77  ALA C C   1 
ATOM   6319  O O   . ALA C 1 78  ? -31.063 -3.515  -49.676 1.00 12.08 ? 77  ALA C O   1 
ATOM   6320  C CB  . ALA C 1 78  ? -28.452 -2.560  -47.820 1.00 10.59 ? 77  ALA C CB  1 
ATOM   6321  N N   . LEU C 1 79  ? -31.084 -1.366  -49.014 1.00 11.70 ? 78  LEU C N   1 
ATOM   6322  C CA  . LEU C 1 79  ? -32.547 -1.269  -49.005 1.00 11.94 ? 78  LEU C CA  1 
ATOM   6323  C C   . LEU C 1 79  ? -33.208 -1.481  -50.361 1.00 12.10 ? 78  LEU C C   1 
ATOM   6324  O O   . LEU C 1 79  ? -34.290 -2.098  -50.444 1.00 10.72 ? 78  LEU C O   1 
ATOM   6325  C CB  . LEU C 1 79  ? -32.983 0.059   -48.380 1.00 12.42 ? 78  LEU C CB  1 
ATOM   6326  C CG  . LEU C 1 79  ? -32.583 0.225   -46.911 1.00 10.84 ? 78  LEU C CG  1 
ATOM   6327  C CD1 . LEU C 1 79  ? -33.188 1.509   -46.374 1.00 12.67 ? 78  LEU C CD1 1 
ATOM   6328  C CD2 . LEU C 1 79  ? -32.984 -0.964  -46.041 1.00 9.41  ? 78  LEU C CD2 1 
ATOM   6329  N N   . ASP C 1 80  ? -32.545 -1.027  -51.416 1.00 12.47 ? 79  ASP C N   1 
ATOM   6330  C CA  . ASP C 1 80  ? -32.959 -1.317  -52.796 1.00 13.27 ? 79  ASP C CA  1 
ATOM   6331  C C   . ASP C 1 80  ? -32.647 -2.717  -53.337 1.00 14.21 ? 79  ASP C C   1 
ATOM   6332  O O   . ASP C 1 80  ? -33.093 -3.057  -54.447 1.00 14.45 ? 79  ASP C O   1 
ATOM   6333  C CB  . ASP C 1 80  ? -32.333 -0.291  -53.766 1.00 13.49 ? 79  ASP C CB  1 
ATOM   6334  C CG  . ASP C 1 80  ? -33.178 0.965   -53.913 1.00 14.41 ? 79  ASP C CG  1 
ATOM   6335  O OD1 . ASP C 1 80  ? -34.381 0.811   -54.230 1.00 16.86 ? 79  ASP C OD1 1 
ATOM   6336  O OD2 . ASP C 1 80  ? -32.639 2.082   -53.758 1.00 12.42 ? 79  ASP C OD2 1 
ATOM   6337  N N   . GLY C 1 81  ? -31.852 -3.496  -52.610 1.00 14.49 ? 80  GLY C N   1 
ATOM   6338  C CA  . GLY C 1 81  ? -31.306 -4.756  -53.130 1.00 14.72 ? 80  GLY C CA  1 
ATOM   6339  C C   . GLY C 1 81  ? -30.265 -4.491  -54.197 1.00 14.80 ? 80  GLY C C   1 
ATOM   6340  O O   . GLY C 1 81  ? -30.073 -5.305  -55.094 1.00 15.02 ? 80  GLY C O   1 
ATOM   6341  N N   . ALA C 1 82  ? -29.626 -3.322  -54.109 1.00 14.53 ? 81  ALA C N   1 
ATOM   6342  C CA  . ALA C 1 82  ? -28.678 -2.831  -55.099 1.00 14.49 ? 81  ALA C CA  1 
ATOM   6343  C C   . ALA C 1 82  ? -27.231 -3.053  -54.671 1.00 14.14 ? 81  ALA C C   1 
ATOM   6344  O O   . ALA C 1 82  ? -26.926 -3.076  -53.486 1.00 14.30 ? 81  ALA C O   1 
ATOM   6345  C CB  . ALA C 1 82  ? -28.913 -1.309  -55.382 1.00 13.84 ? 81  ALA C CB  1 
ATOM   6346  N N   . LYS C 1 83  ? -26.344 -3.183  -55.658 1.00 15.01 ? 82  LYS C N   1 
ATOM   6347  C CA  . LYS C 1 83  ? -24.900 -3.201  -55.415 1.00 15.94 ? 82  LYS C CA  1 
ATOM   6348  C C   . LYS C 1 83  ? -24.379 -1.820  -55.016 1.00 14.83 ? 82  LYS C C   1 
ATOM   6349  O O   . LYS C 1 83  ? -23.470 -1.731  -54.202 1.00 15.04 ? 82  LYS C O   1 
ATOM   6350  C CB  . LYS C 1 83  ? -24.124 -3.701  -56.649 1.00 15.77 ? 82  LYS C CB  1 
ATOM   6351  C CG  . LYS C 1 83  ? -24.498 -5.107  -57.068 1.00 19.11 ? 82  LYS C CG  1 
ATOM   6352  C CD  . LYS C 1 83  ? -23.312 -5.879  -57.687 1.00 20.95 ? 82  LYS C CD  1 
ATOM   6353  C CE  . LYS C 1 83  ? -22.930 -5.396  -59.062 1.00 25.16 ? 82  LYS C CE  1 
ATOM   6354  N NZ  . LYS C 1 83  ? -23.719 -6.029  -60.166 1.00 29.59 ? 82  LYS C NZ  1 
ATOM   6355  N N   . TYR C 1 84  ? -24.968 -0.758  -55.570 1.00 14.05 ? 83  TYR C N   1 
ATOM   6356  C CA  . TYR C 1 84  ? -24.397 0.594   -55.489 1.00 13.89 ? 83  TYR C CA  1 
ATOM   6357  C C   . TYR C 1 84  ? -25.480 1.657   -55.314 1.00 13.22 ? 83  TYR C C   1 
ATOM   6358  O O   . TYR C 1 84  ? -26.594 1.516   -55.829 1.00 13.12 ? 83  TYR C O   1 
ATOM   6359  C CB  . TYR C 1 84  ? -23.646 0.934   -56.788 1.00 14.95 ? 83  TYR C CB  1 
ATOM   6360  C CG  . TYR C 1 84  ? -22.524 -0.015  -57.157 1.00 15.87 ? 83  TYR C CG  1 
ATOM   6361  C CD1 . TYR C 1 84  ? -22.604 -0.829  -58.282 1.00 17.62 ? 83  TYR C CD1 1 
ATOM   6362  C CD2 . TYR C 1 84  ? -21.373 -0.074  -56.384 1.00 17.72 ? 83  TYR C CD2 1 
ATOM   6363  C CE1 . TYR C 1 84  ? -21.560 -1.694  -58.615 1.00 16.82 ? 83  TYR C CE1 1 
ATOM   6364  C CE2 . TYR C 1 84  ? -20.328 -0.921  -56.710 1.00 18.05 ? 83  TYR C CE2 1 
ATOM   6365  C CZ  . TYR C 1 84  ? -20.430 -1.724  -57.815 1.00 17.82 ? 83  TYR C CZ  1 
ATOM   6366  O OH  . TYR C 1 84  ? -19.373 -2.550  -58.088 1.00 19.72 ? 83  TYR C OH  1 
ATOM   6367  N N   . CYS C 1 85  ? -25.156 2.736   -54.616 1.00 12.69 ? 84  CYS C N   1 
ATOM   6368  C CA  . CYS C 1 85  ? -26.058 3.896   -54.604 1.00 12.66 ? 84  CYS C CA  1 
ATOM   6369  C C   . CYS C 1 85  ? -25.231 5.157   -54.600 1.00 12.04 ? 84  CYS C C   1 
ATOM   6370  O O   . CYS C 1 85  ? -24.130 5.170   -54.047 1.00 11.94 ? 84  CYS C O   1 
ATOM   6371  C CB  . CYS C 1 85  ? -26.981 3.842   -53.399 1.00 12.63 ? 84  CYS C CB  1 
ATOM   6372  S SG  . CYS C 1 85  ? -28.105 5.216   -53.181 1.00 13.28 ? 84  CYS C SG  1 
ATOM   6373  N N   . LEU C 1 86  ? -25.751 6.189   -55.257 1.00 11.61 ? 85  LEU C N   1 
ATOM   6374  C CA  . LEU C 1 86  ? -25.142 7.529   -55.271 1.00 10.91 ? 85  LEU C CA  1 
ATOM   6375  C C   . LEU C 1 86  ? -26.163 8.534   -54.724 1.00 10.34 ? 85  LEU C C   1 
ATOM   6376  O O   . LEU C 1 86  ? -27.330 8.537   -55.150 1.00 9.42  ? 85  LEU C O   1 
ATOM   6377  C CB  . LEU C 1 86  ? -24.759 7.919   -56.701 1.00 11.22 ? 85  LEU C CB  1 
ATOM   6378  C CG  . LEU C 1 86  ? -23.992 6.871   -57.521 1.00 10.29 ? 85  LEU C CG  1 
ATOM   6379  C CD1 . LEU C 1 86  ? -24.935 6.013   -58.340 1.00 10.90 ? 85  LEU C CD1 1 
ATOM   6380  C CD2 . LEU C 1 86  ? -22.965 7.585   -58.424 1.00 10.64 ? 85  LEU C CD2 1 
ATOM   6381  N N   . ALA C 1 87  ? -25.703 9.394   -53.829 1.00 9.38  ? 86  ALA C N   1 
ATOM   6382  C CA  . ALA C 1 87  ? -26.540 10.454  -53.218 1.00 9.63  ? 86  ALA C CA  1 
ATOM   6383  C C   . ALA C 1 87  ? -26.258 11.801  -53.889 1.00 9.02  ? 86  ALA C C   1 
ATOM   6384  O O   . ALA C 1 87  ? -25.105 12.083  -54.238 1.00 10.92 ? 86  ALA C O   1 
ATOM   6385  C CB  . ALA C 1 87  ? -26.247 10.556  -51.734 1.00 8.17  ? 86  ALA C CB  1 
ATOM   6386  N N   . PHE C 1 88  ? -27.312 12.613  -54.012 1.00 8.97  ? 87  PHE C N   1 
ATOM   6387  C CA  . PHE C 1 88  ? -27.324 13.888  -54.696 1.00 8.54  ? 87  PHE C CA  1 
ATOM   6388  C C   . PHE C 1 88  ? -28.016 14.960  -53.878 1.00 8.21  ? 87  PHE C C   1 
ATOM   6389  O O   . PHE C 1 88  ? -28.756 14.664  -52.924 1.00 8.23  ? 87  PHE C O   1 
ATOM   6390  C CB  . PHE C 1 88  ? -27.988 13.777  -56.080 1.00 8.65  ? 87  PHE C CB  1 
ATOM   6391  C CG  . PHE C 1 88  ? -27.247 12.855  -57.014 1.00 9.21  ? 87  PHE C CG  1 
ATOM   6392  C CD1 . PHE C 1 88  ? -27.642 11.549  -57.170 1.00 8.54  ? 87  PHE C CD1 1 
ATOM   6393  C CD2 . PHE C 1 88  ? -26.097 13.276  -57.642 1.00 8.69  ? 87  PHE C CD2 1 
ATOM   6394  C CE1 . PHE C 1 88  ? -26.922 10.679  -57.969 1.00 9.08  ? 87  PHE C CE1 1 
ATOM   6395  C CE2 . PHE C 1 88  ? -25.367 12.404  -58.451 1.00 8.97  ? 87  PHE C CE2 1 
ATOM   6396  C CZ  . PHE C 1 88  ? -25.770 11.123  -58.614 1.00 9.01  ? 87  PHE C CZ  1 
ATOM   6397  N N   . ALA C 1 89  ? -27.740 16.201  -54.272 1.00 7.75  ? 88  ALA C N   1 
ATOM   6398  C CA  . ALA C 1 89  ? -28.251 17.413  -53.603 1.00 7.77  ? 88  ALA C CA  1 
ATOM   6399  C C   . ALA C 1 89  ? -29.781 17.518  -53.587 1.00 7.33  ? 88  ALA C C   1 
ATOM   6400  O O   . ALA C 1 89  ? -30.324 18.198  -52.745 1.00 8.29  ? 88  ALA C O   1 
ATOM   6401  C CB  . ALA C 1 89  ? -27.649 18.657  -54.267 1.00 7.05  ? 88  ALA C CB  1 
ATOM   6402  N N   . SER C 1 90  ? -30.439 16.896  -54.566 1.00 7.93  ? 89  SER C N   1 
ATOM   6403  C CA  . SER C 1 90  ? -31.903 16.853  -54.705 1.00 7.40  ? 89  SER C CA  1 
ATOM   6404  C C   . SER C 1 90  ? -32.323 15.698  -55.633 1.00 7.42  ? 89  SER C C   1 
ATOM   6405  O O   . SER C 1 90  ? -31.499 15.119  -56.385 1.00 5.97  ? 89  SER C O   1 
ATOM   6406  C CB  . SER C 1 90  ? -32.460 18.179  -55.235 1.00 7.78  ? 89  SER C CB  1 
ATOM   6407  O OG  . SER C 1 90  ? -32.067 18.490  -56.581 1.00 7.29  ? 89  SER C OG  1 
ATOM   6408  N N   . GLY C 1 91  ? -33.605 15.360  -55.590 1.00 7.53  ? 90  GLY C N   1 
ATOM   6409  C CA  . GLY C 1 91  ? -34.165 14.427  -56.564 1.00 7.61  ? 90  GLY C CA  1 
ATOM   6410  C C   . GLY C 1 91  ? -33.977 14.966  -57.957 1.00 7.26  ? 90  GLY C C   1 
ATOM   6411  O O   . GLY C 1 91  ? -33.597 14.222  -58.852 1.00 8.73  ? 90  GLY C O   1 
ATOM   6412  N N   . LEU C 1 92  ? -34.227 16.260  -58.164 1.00 8.58  ? 91  LEU C N   1 
ATOM   6413  C CA  . LEU C 1 92  ? -33.989 16.874  -59.501 1.00 8.72  ? 91  LEU C CA  1 
ATOM   6414  C C   . LEU C 1 92  ? -32.520 16.773  -59.931 1.00 9.50  ? 91  LEU C C   1 
ATOM   6415  O O   . LEU C 1 92  ? -32.233 16.510  -61.095 1.00 9.28  ? 91  LEU C O   1 
ATOM   6416  C CB  . LEU C 1 92  ? -34.453 18.323  -59.577 1.00 8.17  ? 91  LEU C CB  1 
ATOM   6417  C CG  . LEU C 1 92  ? -35.957 18.590  -59.620 1.00 10.89 ? 91  LEU C CG  1 
ATOM   6418  C CD1 . LEU C 1 92  ? -36.255 20.070  -59.753 1.00 10.02 ? 91  LEU C CD1 1 
ATOM   6419  C CD2 . LEU C 1 92  ? -36.643 17.829  -60.754 1.00 12.59 ? 91  LEU C CD2 1 
ATOM   6420  N N   . ALA C 1 93  ? -31.588 16.951  -58.996 1.00 8.81  ? 92  ALA C N   1 
ATOM   6421  C CA  . ALA C 1 93  ? -30.167 16.867  -59.320 1.00 9.43  ? 92  ALA C CA  1 
ATOM   6422  C C   . ALA C 1 93  ? -29.754 15.455  -59.725 1.00 9.59  ? 92  ALA C C   1 
ATOM   6423  O O   . ALA C 1 93  ? -28.863 15.268  -60.546 1.00 9.43  ? 92  ALA C O   1 
ATOM   6424  C CB  . ALA C 1 93  ? -29.313 17.376  -58.150 1.00 8.71  ? 92  ALA C CB  1 
ATOM   6425  N N   . ALA C 1 94  ? -30.402 14.469  -59.121 1.00 9.97  ? 93  ALA C N   1 
ATOM   6426  C CA  . ALA C 1 94  ? -30.255 13.073  -59.493 1.00 10.15 ? 93  ALA C CA  1 
ATOM   6427  C C   . ALA C 1 94  ? -30.722 12.864  -60.915 1.00 10.55 ? 93  ALA C C   1 
ATOM   6428  O O   . ALA C 1 94  ? -30.078 12.162  -61.713 1.00 10.05 ? 93  ALA C O   1 
ATOM   6429  C CB  . ALA C 1 94  ? -31.082 12.202  -58.535 1.00 10.30 ? 93  ALA C CB  1 
ATOM   6430  N N   . THR C 1 95  ? -31.857 13.479  -61.240 1.00 11.00 ? 94  THR C N   1 
ATOM   6431  C CA  . THR C 1 95  ? -32.446 13.363  -62.577 1.00 11.12 ? 94  THR C CA  1 
ATOM   6432  C C   . THR C 1 95  ? -31.543 14.001  -63.645 1.00 11.11 ? 94  THR C C   1 
ATOM   6433  O O   . THR C 1 95  ? -31.342 13.443  -64.699 1.00 10.46 ? 94  THR C O   1 
ATOM   6434  C CB  . THR C 1 95  ? -33.834 14.062  -62.621 1.00 10.91 ? 94  THR C CB  1 
ATOM   6435  O OG1 . THR C 1 95  ? -34.700 13.484  -61.651 1.00 12.32 ? 94  THR C OG1 1 
ATOM   6436  C CG2 . THR C 1 95  ? -34.479 13.946  -64.013 1.00 10.69 ? 94  THR C CG2 1 
ATOM   6437  N N   . VAL C 1 96  ? -31.038 15.187  -63.359 1.00 10.97 ? 95  VAL C N   1 
ATOM   6438  C CA  . VAL C 1 96  ? -30.095 15.863  -64.248 1.00 11.62 ? 95  VAL C CA  1 
ATOM   6439  C C   . VAL C 1 96  ? -28.829 14.983  -64.453 1.00 12.18 ? 95  VAL C C   1 
ATOM   6440  O O   . VAL C 1 96  ? -28.324 14.824  -65.581 1.00 12.68 ? 95  VAL C O   1 
ATOM   6441  C CB  . VAL C 1 96  ? -29.716 17.255  -63.665 1.00 11.11 ? 95  VAL C CB  1 
ATOM   6442  C CG1 . VAL C 1 96  ? -28.649 17.946  -64.529 1.00 11.34 ? 95  VAL C CG1 1 
ATOM   6443  C CG2 . VAL C 1 96  ? -30.969 18.138  -63.514 1.00 10.89 ? 95  VAL C CG2 1 
ATOM   6444  N N   . THR C 1 97  ? -28.350 14.377  -63.372 1.00 12.66 ? 96  THR C N   1 
ATOM   6445  C CA  . THR C 1 97  ? -27.089 13.632  -63.429 1.00 12.66 ? 96  THR C CA  1 
ATOM   6446  C C   . THR C 1 97  ? -27.280 12.375  -64.274 1.00 13.10 ? 96  THR C C   1 
ATOM   6447  O O   . THR C 1 97  ? -26.446 12.042  -65.108 1.00 13.62 ? 96  THR C O   1 
ATOM   6448  C CB  . THR C 1 97  ? -26.549 13.300  -62.025 1.00 11.41 ? 96  THR C CB  1 
ATOM   6449  O OG1 . THR C 1 97  ? -26.445 14.499  -61.239 1.00 13.21 ? 96  THR C OG1 1 
ATOM   6450  C CG2 . THR C 1 97  ? -25.160 12.658  -62.108 1.00 10.18 ? 96  THR C CG2 1 
ATOM   6451  N N   . ILE C 1 98  ? -28.400 11.689  -64.058 1.00 12.55 ? 97  ILE C N   1 
ATOM   6452  C CA  . ILE C 1 98  ? -28.753 10.515  -64.860 1.00 12.40 ? 97  ILE C CA  1 
ATOM   6453  C C   . ILE C 1 98  ? -28.843 10.901  -66.350 1.00 12.44 ? 97  ILE C C   1 
ATOM   6454  O O   . ILE C 1 98  ? -28.329 10.197  -67.245 1.00 11.76 ? 97  ILE C O   1 
ATOM   6455  C CB  . ILE C 1 98  ? -30.109 9.911   -64.371 1.00 12.35 ? 97  ILE C CB  1 
ATOM   6456  C CG1 . ILE C 1 98  ? -29.927 9.190   -63.033 1.00 13.06 ? 97  ILE C CG1 1 
ATOM   6457  C CG2 . ILE C 1 98  ? -30.681 8.950   -65.417 1.00 12.71 ? 97  ILE C CG2 1 
ATOM   6458  C CD1 . ILE C 1 98  ? -31.219 8.878   -62.283 1.00 11.37 ? 97  ILE C CD1 1 
ATOM   6459  N N   . THR C 1 99  ? -29.493 12.024  -66.615 1.00 12.89 ? 98  THR C N   1 
ATOM   6460  C CA  . THR C 1 99  ? -29.658 12.524  -67.997 1.00 12.99 ? 98  THR C CA  1 
ATOM   6461  C C   . THR C 1 99  ? -28.318 12.808  -68.670 1.00 13.36 ? 98  THR C C   1 
ATOM   6462  O O   . THR C 1 99  ? -28.185 12.607  -69.888 1.00 13.05 ? 98  THR C O   1 
ATOM   6463  C CB  . THR C 1 99  ? -30.587 13.766  -68.020 1.00 13.45 ? 98  THR C CB  1 
ATOM   6464  O OG1 . THR C 1 99  ? -31.863 13.397  -67.477 1.00 10.03 ? 98  THR C OG1 1 
ATOM   6465  C CG2 . THR C 1 99  ? -30.780 14.318  -69.444 1.00 12.29 ? 98  THR C CG2 1 
ATOM   6466  N N   . HIS C 1 100 ? -27.317 13.222  -67.886 1.00 13.91 ? 99  HIS C N   1 
ATOM   6467  C CA  . HIS C 1 100 ? -25.947 13.393  -68.396 1.00 14.28 ? 99  HIS C CA  1 
ATOM   6468  C C   . HIS C 1 100 ? -25.224 12.092  -68.792 1.00 14.15 ? 99  HIS C C   1 
ATOM   6469  O O   . HIS C 1 100 ? -24.108 12.142  -69.301 1.00 14.25 ? 99  HIS C O   1 
ATOM   6470  C CB  . HIS C 1 100 ? -25.084 14.208  -67.418 1.00 14.94 ? 99  HIS C CB  1 
ATOM   6471  C CG  . HIS C 1 100 ? -25.302 15.681  -67.528 1.00 15.61 ? 99  HIS C CG  1 
ATOM   6472  N ND1 . HIS C 1 100 ? -26.433 16.299  -67.045 1.00 16.18 ? 99  HIS C ND1 1 
ATOM   6473  C CD2 . HIS C 1 100 ? -24.559 16.650  -68.107 1.00 16.18 ? 99  HIS C CD2 1 
ATOM   6474  C CE1 . HIS C 1 100 ? -26.372 17.591  -67.318 1.00 15.88 ? 99  HIS C CE1 1 
ATOM   6475  N NE2 . HIS C 1 100 ? -25.235 17.831  -67.947 1.00 16.89 ? 99  HIS C NE2 1 
ATOM   6476  N N   . LEU C 1 101 ? -25.827 10.939  -68.523 1.00 13.86 ? 100 LEU C N   1 
ATOM   6477  C CA  . LEU C 1 101 ? -25.370 9.682   -69.114 1.00 13.74 ? 100 LEU C CA  1 
ATOM   6478  C C   . LEU C 1 101 ? -25.498 9.670   -70.647 1.00 14.62 ? 100 LEU C C   1 
ATOM   6479  O O   . LEU C 1 101 ? -24.805 8.898   -71.320 1.00 15.51 ? 100 LEU C O   1 
ATOM   6480  C CB  . LEU C 1 101 ? -26.156 8.502   -68.555 1.00 13.31 ? 100 LEU C CB  1 
ATOM   6481  C CG  . LEU C 1 101 ? -25.971 8.167   -67.068 1.00 14.09 ? 100 LEU C CG  1 
ATOM   6482  C CD1 . LEU C 1 101 ? -26.985 7.133   -66.629 1.00 11.61 ? 100 LEU C CD1 1 
ATOM   6483  C CD2 . LEU C 1 101 ? -24.542 7.679   -66.798 1.00 13.24 ? 100 LEU C CD2 1 
ATOM   6484  N N   . LEU C 1 102 ? -26.359 10.523  -71.192 1.00 14.83 ? 101 LEU C N   1 
ATOM   6485  C CA  . LEU C 1 102 ? -26.658 10.520  -72.618 1.00 16.12 ? 101 LEU C CA  1 
ATOM   6486  C C   . LEU C 1 102 ? -25.711 11.420  -73.409 1.00 16.45 ? 101 LEU C C   1 
ATOM   6487  O O   . LEU C 1 102 ? -24.654 11.785  -72.914 1.00 16.55 ? 101 LEU C O   1 
ATOM   6488  C CB  . LEU C 1 102 ? -28.131 10.879  -72.842 1.00 16.33 ? 101 LEU C CB  1 
ATOM   6489  C CG  . LEU C 1 102 ? -29.117 10.057  -72.008 1.00 16.65 ? 101 LEU C CG  1 
ATOM   6490  C CD1 . LEU C 1 102 ? -30.572 10.438  -72.300 1.00 16.80 ? 101 LEU C CD1 1 
ATOM   6491  C CD2 . LEU C 1 102 ? -28.890 8.601   -72.194 1.00 18.71 ? 101 LEU C CD2 1 
ATOM   6492  N N   . LYS C 1 103 ? -26.075 11.754  -74.642 1.00 17.53 ? 102 LYS C N   1 
ATOM   6493  C CA  . LYS C 1 103 ? -25.310 12.707  -75.468 1.00 18.35 ? 102 LYS C CA  1 
ATOM   6494  C C   . LYS C 1 103 ? -26.230 13.294  -76.516 1.00 17.80 ? 102 LYS C C   1 
ATOM   6495  O O   . LYS C 1 103 ? -27.299 12.749  -76.778 1.00 17.72 ? 102 LYS C O   1 
ATOM   6496  C CB  . LYS C 1 103 ? -24.111 12.024  -76.134 1.00 18.19 ? 102 LYS C CB  1 
ATOM   6497  C CG  . LYS C 1 103 ? -24.422 10.683  -76.762 1.00 20.07 ? 102 LYS C CG  1 
ATOM   6498  C CD  . LYS C 1 103 ? -23.188 10.072  -77.416 1.00 21.54 ? 102 LYS C CD  1 
ATOM   6499  C CE  . LYS C 1 103 ? -23.555 8.827   -78.213 1.00 24.75 ? 102 LYS C CE  1 
ATOM   6500  N NZ  . LYS C 1 103 ? -24.372 9.126   -79.421 1.00 28.55 ? 102 LYS C NZ  1 
ATOM   6501  N N   . ALA C 1 104 ? -25.819 14.416  -77.088 1.00 18.16 ? 103 ALA C N   1 
ATOM   6502  C CA  . ALA C 1 104 ? -26.531 15.034  -78.189 1.00 18.71 ? 103 ALA C CA  1 
ATOM   6503  C C   . ALA C 1 104 ? -26.938 13.949  -79.203 1.00 19.31 ? 103 ALA C C   1 
ATOM   6504  O O   . ALA C 1 104 ? -26.154 13.058  -79.530 1.00 19.15 ? 103 ALA C O   1 
ATOM   6505  C CB  . ALA C 1 104 ? -25.669 16.103  -78.844 1.00 18.64 ? 103 ALA C CB  1 
ATOM   6506  N N   . GLY C 1 105 ? -28.188 14.005  -79.650 1.00 19.57 ? 104 GLY C N   1 
ATOM   6507  C CA  . GLY C 1 105 ? -28.714 13.015  -80.572 1.00 19.58 ? 104 GLY C CA  1 
ATOM   6508  C C   . GLY C 1 105 ? -29.574 11.931  -79.943 1.00 19.54 ? 104 GLY C C   1 
ATOM   6509  O O   . GLY C 1 105 ? -30.357 11.293  -80.647 1.00 20.02 ? 104 GLY C O   1 
ATOM   6510  N N   . ASP C 1 106 ? -29.438 11.696  -78.636 1.00 19.01 ? 105 ASP C N   1 
ATOM   6511  C CA  . ASP C 1 106 ? -30.198 10.630  -77.968 1.00 18.83 ? 105 ASP C CA  1 
ATOM   6512  C C   . ASP C 1 106 ? -31.641 11.063  -77.733 1.00 18.47 ? 105 ASP C C   1 
ATOM   6513  O O   . ASP C 1 106 ? -31.938 12.254  -77.695 1.00 18.16 ? 105 ASP C O   1 
ATOM   6514  C CB  . ASP C 1 106 ? -29.545 10.225  -76.623 1.00 18.75 ? 105 ASP C CB  1 
ATOM   6515  C CG  . ASP C 1 106 ? -28.217 9.465   -76.788 1.00 20.83 ? 105 ASP C CG  1 
ATOM   6516  O OD1 . ASP C 1 106 ? -27.854 9.053   -77.915 1.00 19.25 ? 105 ASP C OD1 1 
ATOM   6517  O OD2 . ASP C 1 106 ? -27.517 9.282   -75.762 1.00 22.19 ? 105 ASP C OD2 1 
ATOM   6518  N N   . GLN C 1 107 ? -32.541 10.083  -77.602 1.00 18.24 ? 106 GLN C N   1 
ATOM   6519  C CA  . GLN C 1 107 ? -33.930 10.329  -77.271 1.00 18.44 ? 106 GLN C CA  1 
ATOM   6520  C C   . GLN C 1 107 ? -34.259 9.807   -75.867 1.00 17.46 ? 106 GLN C C   1 
ATOM   6521  O O   . GLN C 1 107 ? -33.825 8.738   -75.452 1.00 16.82 ? 106 GLN C O   1 
ATOM   6522  C CB  . GLN C 1 107 ? -34.907 9.664   -78.270 1.00 18.77 ? 106 GLN C CB  1 
ATOM   6523  C CG  . GLN C 1 107 ? -36.380 9.866   -77.877 1.00 19.71 ? 106 GLN C CG  1 
ATOM   6524  C CD  . GLN C 1 107 ? -37.344 8.832   -78.436 1.00 21.85 ? 106 GLN C CD  1 
ATOM   6525  O OE1 . GLN C 1 107 ? -37.058 7.627   -78.458 1.00 25.73 ? 106 GLN C OE1 1 
ATOM   6526  N NE2 . GLN C 1 107 ? -38.533 9.302   -78.841 1.00 25.18 ? 106 GLN C NE2 1 
ATOM   6527  N N   . ILE C 1 108 ? -35.077 10.586  -75.175 1.00 17.29 ? 107 ILE C N   1 
ATOM   6528  C CA  . ILE C 1 108 ? -35.609 10.237  -73.876 1.00 16.69 ? 107 ILE C CA  1 
ATOM   6529  C C   . ILE C 1 108 ? -37.120 10.049  -73.988 1.00 15.75 ? 107 ILE C C   1 
ATOM   6530  O O   . ILE C 1 108 ? -37.828 10.922  -74.483 1.00 15.76 ? 107 ILE C O   1 
ATOM   6531  C CB  . ILE C 1 108 ? -35.321 11.369  -72.862 1.00 16.64 ? 107 ILE C CB  1 
ATOM   6532  C CG1 . ILE C 1 108 ? -33.800 11.532  -72.647 1.00 17.97 ? 107 ILE C CG1 1 
ATOM   6533  C CG2 . ILE C 1 108 ? -36.057 11.097  -71.566 1.00 15.82 ? 107 ILE C CG2 1 
ATOM   6534  C CD1 . ILE C 1 108 ? -33.381 12.810  -71.829 1.00 17.68 ? 107 ILE C CD1 1 
ATOM   6535  N N   . ILE C 1 109 ? -37.613 8.904   -73.541 1.00 15.13 ? 108 ILE C N   1 
ATOM   6536  C CA  . ILE C 1 109 ? -39.049 8.721   -73.339 1.00 14.72 ? 108 ILE C CA  1 
ATOM   6537  C C   . ILE C 1 109 ? -39.381 8.874   -71.853 1.00 13.81 ? 108 ILE C C   1 
ATOM   6538  O O   . ILE C 1 109 ? -38.801 8.193   -71.027 1.00 13.16 ? 108 ILE C O   1 
ATOM   6539  C CB  . ILE C 1 109 ? -39.543 7.359   -73.828 1.00 14.64 ? 108 ILE C CB  1 
ATOM   6540  C CG1 . ILE C 1 109 ? -39.308 7.218   -75.352 1.00 15.97 ? 108 ILE C CG1 1 
ATOM   6541  C CG2 . ILE C 1 109 ? -41.027 7.194   -73.480 1.00 13.50 ? 108 ILE C CG2 1 
ATOM   6542  C CD1 . ILE C 1 109 ? -39.615 5.812   -75.919 1.00 15.29 ? 108 ILE C CD1 1 
ATOM   6543  N N   . CYS C 1 110 ? -40.298 9.788   -71.538 1.00 13.17 ? 109 CYS C N   1 
ATOM   6544  C CA  . CYS C 1 110 ? -40.713 10.066  -70.164 1.00 12.61 ? 109 CYS C CA  1 
ATOM   6545  C C   . CYS C 1 110 ? -42.177 9.720   -70.004 1.00 12.72 ? 109 CYS C C   1 
ATOM   6546  O O   . CYS C 1 110 ? -42.988 10.070  -70.844 1.00 12.32 ? 109 CYS C O   1 
ATOM   6547  C CB  . CYS C 1 110 ? -40.520 11.544  -69.824 1.00 12.51 ? 109 CYS C CB  1 
ATOM   6548  S SG  . CYS C 1 110 ? -40.867 11.994  -68.074 1.00 13.12 ? 109 CYS C SG  1 
ATOM   6549  N N   . MET C 1 111 ? -42.507 9.062   -68.898 1.00 12.78 ? 110 MET C N   1 
ATOM   6550  C CA  . MET C 1 111 ? -43.889 8.806   -68.516 1.00 12.19 ? 110 MET C CA  1 
ATOM   6551  C C   . MET C 1 111 ? -44.664 10.097  -68.596 1.00 12.18 ? 110 MET C C   1 
ATOM   6552  O O   . MET C 1 111 ? -44.155 11.155  -68.218 1.00 10.78 ? 110 MET C O   1 
ATOM   6553  C CB  . MET C 1 111 ? -43.937 8.230   -67.111 1.00 12.42 ? 110 MET C CB  1 
ATOM   6554  C CG  . MET C 1 111 ? -45.326 7.934   -66.561 1.00 12.57 ? 110 MET C CG  1 
ATOM   6555  S SD  . MET C 1 111 ? -46.209 6.812   -67.634 1.00 15.66 ? 110 MET C SD  1 
ATOM   6556  C CE  . MET C 1 111 ? -47.845 6.769   -66.872 1.00 12.20 ? 110 MET C CE  1 
ATOM   6557  N N   . ASP C 1 112 ? -45.886 10.039  -69.119 1.00 12.27 ? 111 ASP C N   1 
ATOM   6558  C CA  . ASP C 1 112 ? -46.616 11.281  -69.369 1.00 12.94 ? 111 ASP C CA  1 
ATOM   6559  C C   . ASP C 1 112 ? -47.032 12.028  -68.092 1.00 12.37 ? 111 ASP C C   1 
ATOM   6560  O O   . ASP C 1 112 ? -47.044 13.241  -68.086 1.00 13.14 ? 111 ASP C O   1 
ATOM   6561  C CB  . ASP C 1 112 ? -47.789 11.079  -70.357 1.00 13.73 ? 111 ASP C CB  1 
ATOM   6562  C CG  . ASP C 1 112 ? -48.885 10.161  -69.838 1.00 15.26 ? 111 ASP C CG  1 
ATOM   6563  O OD1 . ASP C 1 112 ? -49.922 10.103  -70.525 1.00 16.11 ? 111 ASP C OD1 1 
ATOM   6564  O OD2 . ASP C 1 112 ? -48.734 9.479   -68.804 1.00 14.15 ? 111 ASP C OD2 1 
ATOM   6565  N N   . ASP C 1 113 ? -47.314 11.300  -67.006 1.00 12.03 ? 112 ASP C N   1 
ATOM   6566  C CA  . ASP C 1 113 ? -47.606 11.904  -65.718 1.00 10.77 ? 112 ASP C CA  1 
ATOM   6567  C C   . ASP C 1 113 ? -46.388 11.716  -64.795 1.00 10.16 ? 112 ASP C C   1 
ATOM   6568  O O   . ASP C 1 113 ? -46.081 10.616  -64.367 1.00 9.98  ? 112 ASP C O   1 
ATOM   6569  C CB  . ASP C 1 113 ? -48.859 11.282  -65.114 1.00 11.15 ? 112 ASP C CB  1 
ATOM   6570  C CG  . ASP C 1 113 ? -49.371 12.045  -63.899 1.00 10.00 ? 112 ASP C CG  1 
ATOM   6571  O OD1 . ASP C 1 113 ? -49.347 13.289  -63.951 1.00 9.12  ? 112 ASP C OD1 1 
ATOM   6572  O OD2 . ASP C 1 113 ? -49.806 11.390  -62.898 1.00 8.85  ? 112 ASP C OD2 1 
ATOM   6573  N N   . VAL C 1 114 ? -45.670 12.799  -64.556 1.00 10.39 ? 113 VAL C N   1 
ATOM   6574  C CA  . VAL C 1 114 ? -44.580 12.808  -63.604 1.00 10.04 ? 113 VAL C CA  1 
ATOM   6575  C C   . VAL C 1 114 ? -44.614 14.091  -62.777 1.00 9.96  ? 113 VAL C C   1 
ATOM   6576  O O   . VAL C 1 114 ? -45.341 15.051  -63.070 1.00 9.44  ? 113 VAL C O   1 
ATOM   6577  C CB  . VAL C 1 114 ? -43.201 12.681  -64.293 1.00 10.02 ? 113 VAL C CB  1 
ATOM   6578  C CG1 . VAL C 1 114 ? -43.061 11.343  -64.963 1.00 9.42  ? 113 VAL C CG1 1 
ATOM   6579  C CG2 . VAL C 1 114 ? -42.972 13.812  -65.272 1.00 9.24  ? 113 VAL C CG2 1 
ATOM   6580  N N   . TYR C 1 115 ? -43.821 14.072  -61.721 1.00 10.03 ? 114 TYR C N   1 
ATOM   6581  C CA  . TYR C 1 115 ? -43.555 15.234  -60.915 1.00 10.26 ? 114 TYR C CA  1 
ATOM   6582  C C   . TYR C 1 115 ? -43.348 16.435  -61.835 1.00 9.25  ? 114 TYR C C   1 
ATOM   6583  O O   . TYR C 1 115 ? -42.587 16.366  -62.795 1.00 8.93  ? 114 TYR C O   1 
ATOM   6584  C CB  . TYR C 1 115 ? -42.289 14.988  -60.075 1.00 10.55 ? 114 TYR C CB  1 
ATOM   6585  C CG  . TYR C 1 115 ? -41.872 16.218  -59.337 1.00 11.11 ? 114 TYR C CG  1 
ATOM   6586  C CD1 . TYR C 1 115 ? -42.781 16.867  -58.515 1.00 11.20 ? 114 TYR C CD1 1 
ATOM   6587  C CD2 . TYR C 1 115 ? -40.585 16.750  -59.472 1.00 11.99 ? 114 TYR C CD2 1 
ATOM   6588  C CE1 . TYR C 1 115 ? -42.454 17.989  -57.858 1.00 12.63 ? 114 TYR C CE1 1 
ATOM   6589  C CE2 . TYR C 1 115 ? -40.233 17.894  -58.797 1.00 12.55 ? 114 TYR C CE2 1 
ATOM   6590  C CZ  . TYR C 1 115 ? -41.190 18.512  -57.995 1.00 13.39 ? 114 TYR C CZ  1 
ATOM   6591  O OH  . TYR C 1 115 ? -40.918 19.646  -57.298 1.00 14.39 ? 114 TYR C OH  1 
ATOM   6592  N N   . GLY C 1 116 ? -44.050 17.518  -61.570 1.00 9.54  ? 115 GLY C N   1 
ATOM   6593  C CA  . GLY C 1 116 ? -43.961 18.695  -62.430 1.00 9.91  ? 115 GLY C CA  1 
ATOM   6594  C C   . GLY C 1 116 ? -42.537 19.104  -62.778 1.00 11.21 ? 115 GLY C C   1 
ATOM   6595  O O   . GLY C 1 116 ? -42.266 19.493  -63.917 1.00 12.76 ? 115 GLY C O   1 
ATOM   6596  N N   . GLY C 1 117 ? -41.640 19.063  -61.794 1.00 10.65 ? 116 GLY C N   1 
ATOM   6597  C CA  . GLY C 1 117 ? -40.220 19.384  -62.005 1.00 11.06 ? 116 GLY C CA  1 
ATOM   6598  C C   . GLY C 1 117 ? -39.485 18.472  -62.982 1.00 10.95 ? 116 GLY C C   1 
ATOM   6599  O O   . GLY C 1 117 ? -38.566 18.921  -63.687 1.00 10.84 ? 116 GLY C O   1 
ATOM   6600  N N   . THR C 1 118 ? -39.878 17.197  -63.027 1.00 10.71 ? 117 THR C N   1 
ATOM   6601  C CA  . THR C 1 118 ? -39.313 16.258  -63.998 1.00 11.37 ? 117 THR C CA  1 
ATOM   6602  C C   . THR C 1 118 ? -39.718 16.661  -65.433 1.00 11.77 ? 117 THR C C   1 
ATOM   6603  O O   . THR C 1 118 ? -38.875 16.740  -66.346 1.00 12.33 ? 117 THR C O   1 
ATOM   6604  C CB  . THR C 1 118 ? -39.756 14.836  -63.658 1.00 10.70 ? 117 THR C CB  1 
ATOM   6605  O OG1 . THR C 1 118 ? -39.243 14.501  -62.354 1.00 13.11 ? 117 THR C OG1 1 
ATOM   6606  C CG2 . THR C 1 118 ? -39.244 13.848  -64.653 1.00 10.89 ? 117 THR C CG2 1 
ATOM   6607  N N   . ASN C 1 119 ? -41.009 16.945  -65.584 1.00 11.10 ? 118 ASN C N   1 
ATOM   6608  C CA  . ASN C 1 119 ? -41.578 17.441  -66.808 1.00 11.55 ? 118 ASN C CA  1 
ATOM   6609  C C   . ASN C 1 119 ? -40.870 18.733  -67.255 1.00 11.66 ? 118 ASN C C   1 
ATOM   6610  O O   . ASN C 1 119 ? -40.363 18.820  -68.371 1.00 12.97 ? 118 ASN C O   1 
ATOM   6611  C CB  . ASN C 1 119 ? -43.084 17.653  -66.562 1.00 11.14 ? 118 ASN C CB  1 
ATOM   6612  C CG  . ASN C 1 119 ? -43.850 18.003  -67.838 1.00 12.42 ? 118 ASN C CG  1 
ATOM   6613  O OD1 . ASN C 1 119 ? -43.620 19.055  -68.454 1.00 12.31 ? 118 ASN C OD1 1 
ATOM   6614  N ND2 . ASN C 1 119 ? -44.798 17.150  -68.196 1.00 11.35 ? 118 ASN C ND2 1 
ATOM   6615  N N   . ARG C 1 120 ? -40.794 19.707  -66.353 1.00 12.23 ? 119 ARG C N   1 
ATOM   6616  C CA  . ARG C 1 120 ? -40.089 20.964  -66.592 1.00 11.83 ? 119 ARG C CA  1 
ATOM   6617  C C   . ARG C 1 120 ? -38.637 20.746  -67.083 1.00 12.57 ? 119 ARG C C   1 
ATOM   6618  O O   . ARG C 1 120 ? -38.229 21.311  -68.107 1.00 12.59 ? 119 ARG C O   1 
ATOM   6619  C CB  . ARG C 1 120 ? -40.111 21.838  -65.324 1.00 12.10 ? 119 ARG C CB  1 
ATOM   6620  C CG  . ARG C 1 120 ? -39.337 23.152  -65.456 1.00 11.80 ? 119 ARG C CG  1 
ATOM   6621  C CD  . ARG C 1 120 ? -39.429 23.996  -64.190 1.00 12.53 ? 119 ARG C CD  1 
ATOM   6622  N NE  . ARG C 1 120 ? -38.930 23.220  -63.048 1.00 12.01 ? 119 ARG C NE  1 
ATOM   6623  C CZ  . ARG C 1 120 ? -39.452 23.240  -61.826 1.00 13.19 ? 119 ARG C CZ  1 
ATOM   6624  N NH1 . ARG C 1 120 ? -40.476 24.040  -61.539 1.00 15.69 ? 119 ARG C NH1 1 
ATOM   6625  N NH2 . ARG C 1 120 ? -38.922 22.489  -60.876 1.00 12.42 ? 119 ARG C NH2 1 
ATOM   6626  N N   . TYR C 1 121 ? -37.872 19.921  -66.384 1.00 12.34 ? 120 TYR C N   1 
ATOM   6627  C CA  . TYR C 1 121 ? -36.478 19.701  -66.748 1.00 12.45 ? 120 TYR C CA  1 
ATOM   6628  C C   . TYR C 1 121 ? -36.338 19.119  -68.137 1.00 12.78 ? 120 TYR C C   1 
ATOM   6629  O O   . TYR C 1 121 ? -35.583 19.638  -68.980 1.00 12.93 ? 120 TYR C O   1 
ATOM   6630  C CB  . TYR C 1 121 ? -35.774 18.791  -65.727 1.00 12.19 ? 120 TYR C CB  1 
ATOM   6631  C CG  . TYR C 1 121 ? -34.425 18.331  -66.239 1.00 11.34 ? 120 TYR C CG  1 
ATOM   6632  C CD1 . TYR C 1 121 ? -33.395 19.254  -66.488 1.00 10.81 ? 120 TYR C CD1 1 
ATOM   6633  C CD2 . TYR C 1 121 ? -34.190 16.996  -66.516 1.00 11.48 ? 120 TYR C CD2 1 
ATOM   6634  C CE1 . TYR C 1 121 ? -32.183 18.842  -66.991 1.00 10.20 ? 120 TYR C CE1 1 
ATOM   6635  C CE2 . TYR C 1 121 ? -32.995 16.583  -67.030 1.00 13.37 ? 120 TYR C CE2 1 
ATOM   6636  C CZ  . TYR C 1 121 ? -31.990 17.507  -67.277 1.00 11.98 ? 120 TYR C CZ  1 
ATOM   6637  O OH  . TYR C 1 121 ? -30.792 17.050  -67.776 1.00 11.65 ? 120 TYR C OH  1 
ATOM   6638  N N   . PHE C 1 122 ? -37.065 18.038  -68.387 1.00 12.89 ? 121 PHE C N   1 
ATOM   6639  C CA  . PHE C 1 122 ? -36.997 17.371  -69.677 1.00 13.44 ? 121 PHE C CA  1 
ATOM   6640  C C   . PHE C 1 122 ? -37.513 18.274  -70.807 1.00 14.18 ? 121 PHE C C   1 
ATOM   6641  O O   . PHE C 1 122 ? -36.810 18.492  -71.812 1.00 14.36 ? 121 PHE C O   1 
ATOM   6642  C CB  . PHE C 1 122 ? -37.762 16.041  -69.653 1.00 13.46 ? 121 PHE C CB  1 
ATOM   6643  C CG  . PHE C 1 122 ? -37.047 14.922  -68.930 1.00 14.20 ? 121 PHE C CG  1 
ATOM   6644  C CD1 . PHE C 1 122 ? -35.676 14.698  -69.110 1.00 13.95 ? 121 PHE C CD1 1 
ATOM   6645  C CD2 . PHE C 1 122 ? -37.758 14.044  -68.138 1.00 13.41 ? 121 PHE C CD2 1 
ATOM   6646  C CE1 . PHE C 1 122 ? -35.038 13.640  -68.461 1.00 13.97 ? 121 PHE C CE1 1 
ATOM   6647  C CE2 . PHE C 1 122 ? -37.129 12.982  -67.478 1.00 14.12 ? 121 PHE C CE2 1 
ATOM   6648  C CZ  . PHE C 1 122 ? -35.776 12.780  -67.638 1.00 13.72 ? 121 PHE C CZ  1 
ATOM   6649  N N   . ARG C 1 123 ? -38.710 18.826  -70.623 1.00 13.96 ? 122 ARG C N   1 
ATOM   6650  C CA  . ARG C 1 123 ? -39.351 19.643  -71.640 1.00 14.32 ? 122 ARG C CA  1 
ATOM   6651  C C   . ARG C 1 123 ? -38.620 20.938  -71.952 1.00 14.17 ? 122 ARG C C   1 
ATOM   6652  O O   . ARG C 1 123 ? -38.443 21.325  -73.122 1.00 13.05 ? 122 ARG C O   1 
ATOM   6653  C CB  . ARG C 1 123 ? -40.777 19.998  -71.195 1.00 15.03 ? 122 ARG C CB  1 
ATOM   6654  C CG  . ARG C 1 123 ? -41.668 20.556  -72.311 1.00 14.58 ? 122 ARG C CG  1 
ATOM   6655  C CD  . ARG C 1 123 ? -43.056 20.848  -71.798 1.00 15.72 ? 122 ARG C CD  1 
ATOM   6656  N NE  . ARG C 1 123 ? -43.101 22.070  -70.992 1.00 16.25 ? 122 ARG C NE  1 
ATOM   6657  C CZ  . ARG C 1 123 ? -43.058 23.297  -71.503 1.00 17.09 ? 122 ARG C CZ  1 
ATOM   6658  N NH1 . ARG C 1 123 ? -42.977 23.499  -72.824 1.00 19.28 ? 122 ARG C NH1 1 
ATOM   6659  N NH2 . ARG C 1 123 ? -43.099 24.335  -70.689 1.00 17.61 ? 122 ARG C NH2 1 
ATOM   6660  N N   . GLN C 1 124 ? -38.198 21.635  -70.916 1.00 14.41 ? 123 GLN C N   1 
ATOM   6661  C CA  . GLN C 1 124 ? -37.670 22.977  -71.113 1.00 14.81 ? 123 GLN C CA  1 
ATOM   6662  C C   . GLN C 1 124 ? -36.140 23.072  -71.113 1.00 14.26 ? 123 GLN C C   1 
ATOM   6663  O O   . GLN C 1 124 ? -35.585 24.047  -71.602 1.00 14.05 ? 123 GLN C O   1 
ATOM   6664  C CB  . GLN C 1 124 ? -38.248 23.905  -70.072 1.00 14.67 ? 123 GLN C CB  1 
ATOM   6665  C CG  . GLN C 1 124 ? -39.775 24.002  -70.098 1.00 15.88 ? 123 GLN C CG  1 
ATOM   6666  C CD  . GLN C 1 124 ? -40.319 24.876  -68.967 1.00 16.69 ? 123 GLN C CD  1 
ATOM   6667  O OE1 . GLN C 1 124 ? -41.145 24.437  -68.150 1.00 21.79 ? 123 GLN C OE1 1 
ATOM   6668  N NE2 . GLN C 1 124 ? -39.875 26.115  -68.930 1.00 17.90 ? 123 GLN C NE2 1 
ATOM   6669  N N   . VAL C 1 125 ? -35.455 22.084  -70.557 1.00 14.55 ? 124 VAL C N   1 
ATOM   6670  C CA  . VAL C 1 125 ? -34.017 22.222  -70.354 1.00 14.18 ? 124 VAL C CA  1 
ATOM   6671  C C   . VAL C 1 125 ? -33.231 21.188  -71.168 1.00 14.67 ? 124 VAL C C   1 
ATOM   6672  O O   . VAL C 1 125 ? -32.449 21.577  -72.039 1.00 15.43 ? 124 VAL C O   1 
ATOM   6673  C CB  . VAL C 1 125 ? -33.618 22.197  -68.863 1.00 13.97 ? 124 VAL C CB  1 
ATOM   6674  C CG1 . VAL C 1 125 ? -32.099 22.423  -68.717 1.00 13.94 ? 124 VAL C CG1 1 
ATOM   6675  C CG2 . VAL C 1 125 ? -34.401 23.249  -68.076 1.00 12.81 ? 124 VAL C CG2 1 
ATOM   6676  N N   . ALA C 1 126 ? -33.440 19.910  -70.878 1.00 14.55 ? 125 ALA C N   1 
ATOM   6677  C CA  . ALA C 1 126 ? -32.741 18.816  -71.539 1.00 14.92 ? 125 ALA C CA  1 
ATOM   6678  C C   . ALA C 1 126 ? -32.947 18.845  -73.061 1.00 15.60 ? 125 ALA C C   1 
ATOM   6679  O O   . ALA C 1 126 ? -32.027 18.528  -73.828 1.00 16.14 ? 125 ALA C O   1 
ATOM   6680  C CB  . ALA C 1 126 ? -33.174 17.457  -70.954 1.00 14.11 ? 125 ALA C CB  1 
ATOM   6681  N N   . SER C 1 127 ? -34.147 19.236  -73.479 1.00 15.76 ? 126 SER C N   1 
ATOM   6682  C CA  . SER C 1 127 ? -34.497 19.342  -74.905 1.00 17.32 ? 126 SER C CA  1 
ATOM   6683  C C   . SER C 1 127 ? -33.637 20.329  -75.701 1.00 17.43 ? 126 SER C C   1 
ATOM   6684  O O   . SER C 1 127 ? -33.613 20.271  -76.935 1.00 18.58 ? 126 SER C O   1 
ATOM   6685  C CB  . SER C 1 127 ? -35.947 19.795  -75.035 1.00 16.63 ? 126 SER C CB  1 
ATOM   6686  O OG  . SER C 1 127 ? -36.059 21.112  -74.531 1.00 18.20 ? 126 SER C OG  1 
ATOM   6687  N N   . GLU C 1 128 ? -32.989 21.252  -75.002 1.00 17.36 ? 127 GLU C N   1 
ATOM   6688  C CA  . GLU C 1 128 ? -32.195 22.286  -75.614 1.00 18.18 ? 127 GLU C CA  1 
ATOM   6689  C C   . GLU C 1 128 ? -30.746 21.896  -75.856 1.00 17.91 ? 127 GLU C C   1 
ATOM   6690  O O   . GLU C 1 128 ? -30.001 22.660  -76.483 1.00 18.00 ? 127 GLU C O   1 
ATOM   6691  C CB  . GLU C 1 128 ? -32.248 23.549  -74.750 1.00 18.65 ? 127 GLU C CB  1 
ATOM   6692  C CG  . GLU C 1 128 ? -33.628 24.123  -74.659 1.00 19.92 ? 127 GLU C CG  1 
ATOM   6693  C CD  . GLU C 1 128 ? -34.032 24.965  -75.885 1.00 24.39 ? 127 GLU C CD  1 
ATOM   6694  O OE1 . GLU C 1 128 ? -35.095 25.611  -75.800 1.00 25.96 ? 127 GLU C OE1 1 
ATOM   6695  O OE2 . GLU C 1 128 ? -33.318 24.971  -76.919 1.00 25.64 ? 127 GLU C OE2 1 
ATOM   6696  N N   . PHE C 1 129 ? -30.366 20.723  -75.371 1.00 17.47 ? 128 PHE C N   1 
ATOM   6697  C CA  . PHE C 1 129 ? -29.012 20.198  -75.486 1.00 17.65 ? 128 PHE C CA  1 
ATOM   6698  C C   . PHE C 1 129 ? -28.926 18.918  -76.337 1.00 17.80 ? 128 PHE C C   1 
ATOM   6699  O O   . PHE C 1 129 ? -28.152 17.997  -76.063 1.00 17.94 ? 128 PHE C O   1 
ATOM   6700  C CB  . PHE C 1 129 ? -28.464 19.994  -74.081 1.00 17.45 ? 128 PHE C CB  1 
ATOM   6701  C CG  . PHE C 1 129 ? -28.280 21.270  -73.363 1.00 16.37 ? 128 PHE C CG  1 
ATOM   6702  C CD1 . PHE C 1 129 ? -29.223 21.710  -72.461 1.00 15.33 ? 128 PHE C CD1 1 
ATOM   6703  C CD2 . PHE C 1 129 ? -27.192 22.082  -73.660 1.00 16.38 ? 128 PHE C CD2 1 
ATOM   6704  C CE1 . PHE C 1 129 ? -29.061 22.911  -71.819 1.00 17.06 ? 128 PHE C CE1 1 
ATOM   6705  C CE2 . PHE C 1 129 ? -27.017 23.286  -73.026 1.00 17.50 ? 128 PHE C CE2 1 
ATOM   6706  C CZ  . PHE C 1 129 ? -27.951 23.713  -72.109 1.00 17.57 ? 128 PHE C CZ  1 
ATOM   6707  N N   . GLY C 1 130 ? -29.744 18.880  -77.379 1.00 18.24 ? 129 GLY C N   1 
ATOM   6708  C CA  . GLY C 1 130 ? -29.663 17.845  -78.375 1.00 18.53 ? 129 GLY C CA  1 
ATOM   6709  C C   . GLY C 1 130 ? -30.345 16.557  -77.996 1.00 18.99 ? 129 GLY C C   1 
ATOM   6710  O O   . GLY C 1 130 ? -30.149 15.546  -78.671 1.00 19.20 ? 129 GLY C O   1 
ATOM   6711  N N   . LEU C 1 131 ? -31.133 16.583  -76.924 1.00 18.92 ? 130 LEU C N   1 
ATOM   6712  C CA  . LEU C 1 131 ? -31.904 15.425  -76.534 1.00 19.18 ? 130 LEU C CA  1 
ATOM   6713  C C   . LEU C 1 131 ? -33.337 15.608  -76.990 1.00 19.42 ? 130 LEU C C   1 
ATOM   6714  O O   . LEU C 1 131 ? -33.913 16.673  -76.803 1.00 19.10 ? 130 LEU C O   1 
ATOM   6715  C CB  . LEU C 1 131 ? -31.844 15.236  -75.017 1.00 19.03 ? 130 LEU C CB  1 
ATOM   6716  C CG  . LEU C 1 131 ? -30.417 14.983  -74.532 1.00 18.38 ? 130 LEU C CG  1 
ATOM   6717  C CD1 . LEU C 1 131 ? -30.283 15.227  -73.007 1.00 16.02 ? 130 LEU C CD1 1 
ATOM   6718  C CD2 . LEU C 1 131 ? -29.955 13.592  -74.968 1.00 17.70 ? 130 LEU C CD2 1 
ATOM   6719  N N   . LYS C 1 132 ? -33.892 14.583  -77.619 1.00 19.97 ? 131 LYS C N   1 
ATOM   6720  C CA  . LYS C 1 132 ? -35.312 14.582  -77.968 1.00 21.46 ? 131 LYS C CA  1 
ATOM   6721  C C   . LYS C 1 132 ? -36.146 13.985  -76.837 1.00 20.31 ? 131 LYS C C   1 
ATOM   6722  O O   . LYS C 1 132 ? -35.822 12.927  -76.323 1.00 20.83 ? 131 LYS C O   1 
ATOM   6723  C CB  . LYS C 1 132 ? -35.559 13.798  -79.261 1.00 22.20 ? 131 LYS C CB  1 
ATOM   6724  C CG  . LYS C 1 132 ? -36.943 14.042  -79.861 1.00 26.50 ? 131 LYS C CG  1 
ATOM   6725  C CD  . LYS C 1 132 ? -37.866 12.833  -79.725 1.00 31.05 ? 131 LYS C CD  1 
ATOM   6726  C CE  . LYS C 1 132 ? -37.559 11.776  -80.806 1.00 33.88 ? 131 LYS C CE  1 
ATOM   6727  N NZ  . LYS C 1 132 ? -38.651 11.602  -81.833 1.00 35.42 ? 131 LYS C NZ  1 
ATOM   6728  N N   . ILE C 1 133 ? -37.230 14.667  -76.472 1.00 19.73 ? 132 ILE C N   1 
ATOM   6729  C CA  . ILE C 1 133 ? -38.102 14.246  -75.373 1.00 19.46 ? 132 ILE C CA  1 
ATOM   6730  C C   . ILE C 1 133 ? -39.462 13.869  -75.929 1.00 18.91 ? 132 ILE C C   1 
ATOM   6731  O O   . ILE C 1 133 ? -40.078 14.652  -76.659 1.00 18.85 ? 132 ILE C O   1 
ATOM   6732  C CB  . ILE C 1 133 ? -38.280 15.369  -74.316 1.00 19.49 ? 132 ILE C CB  1 
ATOM   6733  C CG1 . ILE C 1 133 ? -36.926 16.011  -73.993 1.00 20.83 ? 132 ILE C CG1 1 
ATOM   6734  C CG2 . ILE C 1 133 ? -38.965 14.840  -73.057 1.00 19.00 ? 132 ILE C CG2 1 
ATOM   6735  C CD1 . ILE C 1 133 ? -35.847 15.040  -73.539 1.00 20.92 ? 132 ILE C CD1 1 
ATOM   6736  N N   . SER C 1 134 ? -39.905 12.662  -75.588 1.00 18.81 ? 133 SER C N   1 
ATOM   6737  C CA  . SER C 1 134 ? -41.244 12.176  -75.881 1.00 18.70 ? 133 SER C CA  1 
ATOM   6738  C C   . SER C 1 134 ? -41.936 11.837  -74.582 1.00 17.53 ? 133 SER C C   1 
ATOM   6739  O O   . SER C 1 134 ? -41.428 11.029  -73.804 1.00 17.15 ? 133 SER C O   1 
ATOM   6740  C CB  . SER C 1 134 ? -41.187 10.908  -76.748 1.00 18.82 ? 133 SER C CB  1 
ATOM   6741  O OG  . SER C 1 134 ? -40.319 11.088  -77.852 1.00 22.61 ? 133 SER C OG  1 
ATOM   6742  N N   . PHE C 1 135 ? -43.114 12.411  -74.364 1.00 16.87 ? 134 PHE C N   1 
ATOM   6743  C CA  . PHE C 1 135 ? -43.953 12.029  -73.231 1.00 16.86 ? 134 PHE C CA  1 
ATOM   6744  C C   . PHE C 1 135 ? -44.987 10.998  -73.684 1.00 17.29 ? 134 PHE C C   1 
ATOM   6745  O O   . PHE C 1 135 ? -45.796 11.269  -74.584 1.00 17.73 ? 134 PHE C O   1 
ATOM   6746  C CB  . PHE C 1 135 ? -44.636 13.246  -72.627 1.00 16.63 ? 134 PHE C CB  1 
ATOM   6747  C CG  . PHE C 1 135 ? -43.701 14.180  -71.946 1.00 15.96 ? 134 PHE C CG  1 
ATOM   6748  C CD1 . PHE C 1 135 ? -43.356 14.000  -70.604 1.00 16.31 ? 134 PHE C CD1 1 
ATOM   6749  C CD2 . PHE C 1 135 ? -43.169 15.257  -72.631 1.00 15.89 ? 134 PHE C CD2 1 
ATOM   6750  C CE1 . PHE C 1 135 ? -42.477 14.904  -69.968 1.00 15.07 ? 134 PHE C CE1 1 
ATOM   6751  C CE2 . PHE C 1 135 ? -42.295 16.162  -71.999 1.00 15.46 ? 134 PHE C CE2 1 
ATOM   6752  C CZ  . PHE C 1 135 ? -41.950 15.982  -70.679 1.00 15.15 ? 134 PHE C CZ  1 
ATOM   6753  N N   . VAL C 1 136 ? -44.952 9.833   -73.047 1.00 17.36 ? 135 VAL C N   1 
ATOM   6754  C CA  . VAL C 1 136 ? -45.709 8.662   -73.465 1.00 17.33 ? 135 VAL C CA  1 
ATOM   6755  C C   . VAL C 1 136 ? -46.378 8.029   -72.248 1.00 17.90 ? 135 VAL C C   1 
ATOM   6756  O O   . VAL C 1 136 ? -45.760 7.945   -71.179 1.00 17.09 ? 135 VAL C O   1 
ATOM   6757  C CB  . VAL C 1 136 ? -44.769 7.600   -74.116 1.00 16.89 ? 135 VAL C CB  1 
ATOM   6758  C CG1 . VAL C 1 136 ? -45.553 6.306   -74.477 1.00 16.96 ? 135 VAL C CG1 1 
ATOM   6759  C CG2 . VAL C 1 136 ? -44.086 8.158   -75.324 1.00 16.25 ? 135 VAL C CG2 1 
ATOM   6760  N N   . ASP C 1 137 ? -47.633 7.592   -72.411 1.00 18.78 ? 136 ASP C N   1 
ATOM   6761  C CA  . ASP C 1 137 ? -48.331 6.875   -71.356 1.00 20.19 ? 136 ASP C CA  1 
ATOM   6762  C C   . ASP C 1 137 ? -47.813 5.446   -71.291 1.00 21.31 ? 136 ASP C C   1 
ATOM   6763  O O   . ASP C 1 137 ? -48.350 4.530   -71.929 1.00 21.69 ? 136 ASP C O   1 
ATOM   6764  C CB  . ASP C 1 137 ? -49.842 6.879   -71.559 1.00 19.84 ? 136 ASP C CB  1 
ATOM   6765  C CG  . ASP C 1 137 ? -50.576 6.179   -70.433 1.00 21.72 ? 136 ASP C CG  1 
ATOM   6766  O OD1 . ASP C 1 137 ? -49.931 5.773   -69.439 1.00 19.85 ? 136 ASP C OD1 1 
ATOM   6767  O OD2 . ASP C 1 137 ? -51.802 6.004   -70.539 1.00 24.57 ? 136 ASP C OD2 1 
ATOM   6768  N N   . CYS C 1 138 ? -46.760 5.253   -70.507 1.00 22.58 ? 137 CYS C N   1 
ATOM   6769  C CA  . CYS C 1 138 ? -46.127 3.944   -70.399 1.00 23.07 ? 137 CYS C CA  1 
ATOM   6770  C C   . CYS C 1 138 ? -46.958 2.956   -69.579 1.00 24.32 ? 137 CYS C C   1 
ATOM   6771  O O   . CYS C 1 138 ? -46.597 1.786   -69.473 1.00 25.89 ? 137 CYS C O   1 
ATOM   6772  C CB  . CYS C 1 138 ? -44.728 4.069   -69.802 1.00 23.21 ? 137 CYS C CB  1 
ATOM   6773  S SG  . CYS C 1 138 ? -43.586 5.066   -70.758 1.00 19.19 ? 137 CYS C SG  1 
ATOM   6774  N N   . SER C 1 139 ? -48.057 3.403   -68.991 1.00 26.21 ? 138 SER C N   1 
ATOM   6775  C CA  . SER C 1 139 ? -48.973 2.476   -68.324 1.00 27.03 ? 138 SER C CA  1 
ATOM   6776  C C   . SER C 1 139 ? -49.739 1.615   -69.331 1.00 28.65 ? 138 SER C C   1 
ATOM   6777  O O   . SER C 1 139 ? -50.403 0.666   -68.944 1.00 29.19 ? 138 SER C O   1 
ATOM   6778  C CB  . SER C 1 139 ? -49.941 3.209   -67.406 1.00 27.16 ? 138 SER C CB  1 
ATOM   6779  O OG  . SER C 1 139 ? -51.048 3.746   -68.103 1.00 26.01 ? 138 SER C OG  1 
ATOM   6780  N N   . LYS C 1 140 ? -49.634 1.962   -70.611 1.00 29.96 ? 139 LYS C N   1 
ATOM   6781  C CA  . LYS C 1 140 ? -50.206 1.204   -71.713 1.00 31.36 ? 139 LYS C CA  1 
ATOM   6782  C C   . LYS C 1 140 ? -49.028 0.690   -72.524 1.00 31.97 ? 139 LYS C C   1 
ATOM   6783  O O   . LYS C 1 140 ? -48.486 1.405   -73.363 1.00 32.25 ? 139 LYS C O   1 
ATOM   6784  C CB  . LYS C 1 140 ? -51.080 2.127   -72.560 1.00 31.31 ? 139 LYS C CB  1 
ATOM   6785  C CG  . LYS C 1 140 ? -52.335 2.580   -71.859 1.00 31.83 ? 139 LYS C CG  1 
ATOM   6786  C CD  . LYS C 1 140 ? -52.973 3.754   -72.563 1.00 32.71 ? 139 LYS C CD  1 
ATOM   6787  C CE  . LYS C 1 140 ? -54.423 3.990   -72.128 1.00 33.72 ? 139 LYS C CE  1 
ATOM   6788  N NZ  . LYS C 1 140 ? -54.788 3.408   -70.786 1.00 36.41 ? 139 LYS C NZ  1 
ATOM   6789  N N   . ILE C 1 141 ? -48.626 -0.557  -72.261 1.00 33.27 ? 140 ILE C N   1 
ATOM   6790  C CA  . ILE C 1 141 ? -47.348 -1.082  -72.767 1.00 33.74 ? 140 ILE C CA  1 
ATOM   6791  C C   . ILE C 1 141 ? -47.163 -0.979  -74.293 1.00 33.40 ? 140 ILE C C   1 
ATOM   6792  O O   . ILE C 1 141 ? -46.016 -0.846  -74.772 1.00 33.52 ? 140 ILE C O   1 
ATOM   6793  C CB  . ILE C 1 141 ? -47.064 -2.540  -72.288 1.00 33.98 ? 140 ILE C CB  1 
ATOM   6794  C CG1 . ILE C 1 141 ? -48.048 -3.544  -72.890 1.00 34.42 ? 140 ILE C CG1 1 
ATOM   6795  C CG2 . ILE C 1 141 ? -47.066 -2.614  -70.753 1.00 34.96 ? 140 ILE C CG2 1 
ATOM   6796  C CD1 . ILE C 1 141 ? -47.448 -4.962  -73.043 1.00 34.54 ? 140 ILE C CD1 1 
ATOM   6797  N N   . LYS C 1 142 ? -48.260 -1.005  -75.056 1.00 32.49 ? 141 LYS C N   1 
ATOM   6798  C CA  . LYS C 1 142 ? -48.120 -0.898  -76.507 1.00 32.14 ? 141 LYS C CA  1 
ATOM   6799  C C   . LYS C 1 142 ? -47.735 0.495   -76.978 1.00 31.36 ? 141 LYS C C   1 
ATOM   6800  O O   . LYS C 1 142 ? -47.114 0.621   -78.027 1.00 31.67 ? 141 LYS C O   1 
ATOM   6801  C CB  . LYS C 1 142 ? -49.373 -1.388  -77.240 1.00 32.66 ? 141 LYS C CB  1 
ATOM   6802  C CG  . LYS C 1 142 ? -49.957 -2.680  -76.645 1.00 33.88 ? 141 LYS C CG  1 
ATOM   6803  C CD  . LYS C 1 142 ? -50.649 -3.588  -77.681 1.00 34.32 ? 141 LYS C CD  1 
ATOM   6804  C CE  . LYS C 1 142 ? -51.603 -2.831  -78.611 1.00 36.01 ? 141 LYS C CE  1 
ATOM   6805  N NZ  . LYS C 1 142 ? -52.424 -1.833  -77.881 1.00 36.98 ? 141 LYS C NZ  1 
ATOM   6806  N N   . LEU C 1 143 ? -48.099 1.541   -76.227 1.00 30.22 ? 142 LEU C N   1 
ATOM   6807  C CA  . LEU C 1 143 ? -47.710 2.920   -76.600 1.00 29.17 ? 142 LEU C CA  1 
ATOM   6808  C C   . LEU C 1 143 ? -46.204 3.132   -76.453 1.00 27.71 ? 142 LEU C C   1 
ATOM   6809  O O   . LEU C 1 143 ? -45.589 3.870   -77.226 1.00 26.74 ? 142 LEU C O   1 
ATOM   6810  C CB  . LEU C 1 143 ? -48.452 3.953   -75.747 1.00 28.93 ? 142 LEU C CB  1 
ATOM   6811  C CG  . LEU C 1 143 ? -49.971 4.069   -75.973 1.00 28.55 ? 142 LEU C CG  1 
ATOM   6812  C CD1 . LEU C 1 143 ? -50.518 5.212   -75.171 1.00 26.95 ? 142 LEU C CD1 1 
ATOM   6813  C CD2 . LEU C 1 143 ? -50.296 4.254   -77.448 1.00 26.92 ? 142 LEU C CD2 1 
ATOM   6814  N N   . LEU C 1 144 ? -45.622 2.489   -75.439 1.00 27.07 ? 143 LEU C N   1 
ATOM   6815  C CA  . LEU C 1 144 ? -44.185 2.564   -75.197 1.00 26.69 ? 143 LEU C CA  1 
ATOM   6816  C C   . LEU C 1 144 ? -43.460 1.877   -76.343 1.00 27.38 ? 143 LEU C C   1 
ATOM   6817  O O   . LEU C 1 144 ? -42.554 2.447   -76.941 1.00 26.98 ? 143 LEU C O   1 
ATOM   6818  C CB  . LEU C 1 144 ? -43.819 1.895   -73.866 1.00 26.71 ? 143 LEU C CB  1 
ATOM   6819  C CG  . LEU C 1 144 ? -42.319 1.735   -73.554 1.00 25.50 ? 143 LEU C CG  1 
ATOM   6820  C CD1 . LEU C 1 144 ? -41.573 3.080   -73.643 1.00 21.58 ? 143 LEU C CD1 1 
ATOM   6821  C CD2 . LEU C 1 144 ? -42.106 1.089   -72.203 1.00 25.63 ? 143 LEU C CD2 1 
ATOM   6822  N N   . GLU C 1 145 ? -43.889 0.656   -76.653 1.00 28.47 ? 144 GLU C N   1 
ATOM   6823  C CA  . GLU C 1 145 ? -43.279 -0.121  -77.713 1.00 29.19 ? 144 GLU C CA  1 
ATOM   6824  C C   . GLU C 1 145 ? -43.263 0.686   -79.004 1.00 28.95 ? 144 GLU C C   1 
ATOM   6825  O O   . GLU C 1 145 ? -42.217 0.797   -79.654 1.00 29.43 ? 144 GLU C O   1 
ATOM   6826  C CB  . GLU C 1 145 ? -43.982 -1.472  -77.898 1.00 29.85 ? 144 GLU C CB  1 
ATOM   6827  C CG  . GLU C 1 145 ? -43.133 -2.455  -78.711 1.00 32.94 ? 144 GLU C CG  1 
ATOM   6828  C CD  . GLU C 1 145 ? -43.291 -3.898  -78.255 1.00 38.36 ? 144 GLU C CD  1 
ATOM   6829  O OE1 . GLU C 1 145 ? -42.247 -4.608  -78.119 1.00 42.35 ? 144 GLU C OE1 1 
ATOM   6830  O OE2 . GLU C 1 145 ? -44.453 -4.318  -78.020 1.00 41.00 ? 144 GLU C OE2 1 
ATOM   6831  N N   . ALA C 1 146 ? -44.395 1.303   -79.337 1.00 28.40 ? 145 ALA C N   1 
ATOM   6832  C CA  . ALA C 1 146 ? -44.510 2.125   -80.546 1.00 27.92 ? 145 ALA C CA  1 
ATOM   6833  C C   . ALA C 1 146 ? -43.627 3.364   -80.504 1.00 27.78 ? 145 ALA C C   1 
ATOM   6834  O O   . ALA C 1 146 ? -43.194 3.853   -81.545 1.00 27.92 ? 145 ALA C O   1 
ATOM   6835  C CB  . ALA C 1 146 ? -45.967 2.536   -80.752 1.00 28.25 ? 145 ALA C CB  1 
ATOM   6836  N N   . ALA C 1 147 ? -43.386 3.880   -79.297 1.00 27.54 ? 146 ALA C N   1 
ATOM   6837  C CA  . ALA C 1 147 ? -42.585 5.089   -79.076 1.00 27.26 ? 146 ALA C CA  1 
ATOM   6838  C C   . ALA C 1 147 ? -41.070 4.870   -79.178 1.00 26.93 ? 146 ALA C C   1 
ATOM   6839  O O   . ALA C 1 147 ? -40.325 5.816   -79.464 1.00 27.84 ? 146 ALA C O   1 
ATOM   6840  C CB  . ALA C 1 147 ? -42.920 5.694   -77.718 1.00 26.91 ? 146 ALA C CB  1 
ATOM   6841  N N   . ILE C 1 148 ? -40.608 3.646   -78.938 1.00 26.37 ? 147 ILE C N   1 
ATOM   6842  C CA  . ILE C 1 148 ? -39.173 3.375   -78.959 1.00 26.12 ? 147 ILE C CA  1 
ATOM   6843  C C   . ILE C 1 148 ? -38.620 3.514   -80.372 1.00 26.45 ? 147 ILE C C   1 
ATOM   6844  O O   . ILE C 1 148 ? -39.215 3.024   -81.326 1.00 26.72 ? 147 ILE C O   1 
ATOM   6845  C CB  . ILE C 1 148 ? -38.827 1.998   -78.376 1.00 25.94 ? 147 ILE C CB  1 
ATOM   6846  C CG1 . ILE C 1 148 ? -39.169 1.959   -76.884 1.00 24.81 ? 147 ILE C CG1 1 
ATOM   6847  C CG2 . ILE C 1 148 ? -37.319 1.708   -78.550 1.00 25.87 ? 147 ILE C CG2 1 
ATOM   6848  C CD1 . ILE C 1 148 ? -39.302 0.605   -76.313 1.00 23.73 ? 147 ILE C CD1 1 
ATOM   6849  N N   . THR C 1 149 ? -37.514 4.245   -80.490 1.00 26.39 ? 148 THR C N   1 
ATOM   6850  C CA  . THR C 1 149 ? -36.801 4.420   -81.752 1.00 26.07 ? 148 THR C CA  1 
ATOM   6851  C C   . THR C 1 149 ? -35.355 3.985   -81.558 1.00 25.99 ? 148 THR C C   1 
ATOM   6852  O O   . THR C 1 149 ? -34.915 3.707   -80.431 1.00 25.74 ? 148 THR C O   1 
ATOM   6853  C CB  . THR C 1 149 ? -36.835 5.892   -82.269 1.00 25.95 ? 148 THR C CB  1 
ATOM   6854  O OG1 . THR C 1 149 ? -35.778 6.666   -81.671 1.00 27.33 ? 148 THR C OG1 1 
ATOM   6855  C CG2 . THR C 1 149 ? -38.177 6.544   -82.008 1.00 25.09 ? 148 THR C CG2 1 
ATOM   6856  N N   . PRO C 1 150 ? -34.606 3.875   -82.658 1.00 25.92 ? 149 PRO C N   1 
ATOM   6857  C CA  . PRO C 1 150 ? -33.185 3.544   -82.505 1.00 25.66 ? 149 PRO C CA  1 
ATOM   6858  C C   . PRO C 1 150 ? -32.387 4.572   -81.699 1.00 24.53 ? 149 PRO C C   1 
ATOM   6859  O O   . PRO C 1 150 ? -31.336 4.245   -81.183 1.00 25.17 ? 149 PRO C O   1 
ATOM   6860  C CB  . PRO C 1 150 ? -32.691 3.476   -83.953 1.00 25.22 ? 149 PRO C CB  1 
ATOM   6861  C CG  . PRO C 1 150 ? -33.917 3.126   -84.720 1.00 26.31 ? 149 PRO C CG  1 
ATOM   6862  C CD  . PRO C 1 150 ? -34.989 3.940   -84.078 1.00 26.17 ? 149 PRO C CD  1 
ATOM   6863  N N   . GLU C 1 151 ? -32.895 5.788   -81.596 1.00 24.32 ? 150 GLU C N   1 
ATOM   6864  C CA  . GLU C 1 151 ? -32.236 6.841   -80.822 1.00 24.15 ? 150 GLU C CA  1 
ATOM   6865  C C   . GLU C 1 151 ? -32.608 6.835   -79.333 1.00 22.81 ? 150 GLU C C   1 
ATOM   6866  O O   . GLU C 1 151 ? -32.006 7.584   -78.557 1.00 22.31 ? 150 GLU C O   1 
ATOM   6867  C CB  . GLU C 1 151 ? -32.558 8.215   -81.412 1.00 25.07 ? 150 GLU C CB  1 
ATOM   6868  C CG  . GLU C 1 151 ? -31.935 8.468   -82.781 1.00 29.43 ? 150 GLU C CG  1 
ATOM   6869  C CD  . GLU C 1 151 ? -32.725 7.843   -83.929 1.00 34.69 ? 150 GLU C CD  1 
ATOM   6870  O OE1 . GLU C 1 151 ? -32.087 7.275   -84.860 1.00 36.78 ? 150 GLU C OE1 1 
ATOM   6871  O OE2 . GLU C 1 151 ? -33.979 7.905   -83.885 1.00 36.99 ? 150 GLU C OE2 1 
ATOM   6872  N N   . THR C 1 152 ? -33.594 6.028   -78.942 1.00 21.50 ? 151 THR C N   1 
ATOM   6873  C CA  . THR C 1 152 ? -34.006 5.937   -77.516 1.00 21.03 ? 151 THR C CA  1 
ATOM   6874  C C   . THR C 1 152 ? -32.890 5.351   -76.641 1.00 20.19 ? 151 THR C C   1 
ATOM   6875  O O   . THR C 1 152 ? -32.395 4.262   -76.898 1.00 19.90 ? 151 THR C O   1 
ATOM   6876  C CB  . THR C 1 152 ? -35.265 5.089   -77.326 1.00 20.74 ? 151 THR C CB  1 
ATOM   6877  O OG1 . THR C 1 152 ? -36.298 5.555   -78.201 1.00 19.12 ? 151 THR C OG1 1 
ATOM   6878  C CG2 . THR C 1 152 ? -35.762 5.143   -75.839 1.00 20.17 ? 151 THR C CG2 1 
ATOM   6879  N N   . LYS C 1 153 ? -32.473 6.100   -75.630 1.00 19.65 ? 152 LYS C N   1 
ATOM   6880  C CA  . LYS C 1 153 ? -31.420 5.646   -74.719 1.00 18.60 ? 152 LYS C CA  1 
ATOM   6881  C C   . LYS C 1 153 ? -31.831 5.681   -73.249 1.00 17.75 ? 152 LYS C C   1 
ATOM   6882  O O   . LYS C 1 153 ? -31.157 5.081   -72.405 1.00 16.61 ? 152 LYS C O   1 
ATOM   6883  C CB  . LYS C 1 153 ? -30.162 6.472   -74.917 1.00 19.70 ? 152 LYS C CB  1 
ATOM   6884  C CG  . LYS C 1 153 ? -29.590 6.428   -76.315 1.00 21.41 ? 152 LYS C CG  1 
ATOM   6885  C CD  . LYS C 1 153 ? -29.131 5.034   -76.701 1.00 24.40 ? 152 LYS C CD  1 
ATOM   6886  C CE  . LYS C 1 153 ? -28.536 5.040   -78.110 1.00 26.40 ? 152 LYS C CE  1 
ATOM   6887  N NZ  . LYS C 1 153 ? -27.740 3.814   -78.335 1.00 30.17 ? 152 LYS C NZ  1 
ATOM   6888  N N   . LEU C 1 154 ? -32.938 6.368   -72.951 1.00 16.54 ? 153 LEU C N   1 
ATOM   6889  C CA  . LEU C 1 154 ? -33.423 6.501   -71.578 1.00 15.20 ? 153 LEU C CA  1 
ATOM   6890  C C   . LEU C 1 154 ? -34.944 6.421   -71.576 1.00 14.65 ? 153 LEU C C   1 
ATOM   6891  O O   . LEU C 1 154 ? -35.593 7.116   -72.339 1.00 14.33 ? 153 LEU C O   1 
ATOM   6892  C CB  . LEU C 1 154 ? -32.970 7.834   -70.956 1.00 15.29 ? 153 LEU C CB  1 
ATOM   6893  C CG  . LEU C 1 154 ? -33.511 8.149   -69.514 1.00 15.14 ? 153 LEU C CG  1 
ATOM   6894  C CD1 . LEU C 1 154 ? -33.045 7.079   -68.566 1.00 14.69 ? 153 LEU C CD1 1 
ATOM   6895  C CD2 . LEU C 1 154 ? -33.099 9.573   -69.001 1.00 14.27 ? 153 LEU C CD2 1 
ATOM   6896  N N   . VAL C 1 155 ? -35.493 5.572   -70.715 1.00 14.21 ? 154 VAL C N   1 
ATOM   6897  C CA  . VAL C 1 155 ? -36.916 5.569   -70.421 1.00 13.73 ? 154 VAL C CA  1 
ATOM   6898  C C   . VAL C 1 155 ? -37.122 5.913   -68.936 1.00 13.45 ? 154 VAL C C   1 
ATOM   6899  O O   . VAL C 1 155 ? -36.660 5.209   -68.078 1.00 12.53 ? 154 VAL C O   1 
ATOM   6900  C CB  . VAL C 1 155 ? -37.553 4.217   -70.759 1.00 14.35 ? 154 VAL C CB  1 
ATOM   6901  C CG1 . VAL C 1 155 ? -38.994 4.164   -70.276 1.00 13.06 ? 154 VAL C CG1 1 
ATOM   6902  C CG2 . VAL C 1 155 ? -37.472 3.976   -72.295 1.00 12.45 ? 154 VAL C CG2 1 
ATOM   6903  N N   . TRP C 1 156 ? -37.810 7.022   -68.672 1.00 13.72 ? 155 TRP C N   1 
ATOM   6904  C CA  . TRP C 1 156 ? -37.981 7.541   -67.308 1.00 13.11 ? 155 TRP C CA  1 
ATOM   6905  C C   . TRP C 1 156 ? -39.420 7.326   -66.866 1.00 13.49 ? 155 TRP C C   1 
ATOM   6906  O O   . TRP C 1 156 ? -40.319 7.965   -67.397 1.00 13.65 ? 155 TRP C O   1 
ATOM   6907  C CB  . TRP C 1 156 ? -37.658 9.044   -67.288 1.00 13.21 ? 155 TRP C CB  1 
ATOM   6908  C CG  . TRP C 1 156 ? -37.675 9.571   -65.936 1.00 12.75 ? 155 TRP C CG  1 
ATOM   6909  C CD1 . TRP C 1 156 ? -38.772 9.903   -65.200 1.00 11.61 ? 155 TRP C CD1 1 
ATOM   6910  C CD2 . TRP C 1 156 ? -36.538 9.772   -65.093 1.00 12.76 ? 155 TRP C CD2 1 
ATOM   6911  N NE1 . TRP C 1 156 ? -38.387 10.306  -63.941 1.00 12.60 ? 155 TRP C NE1 1 
ATOM   6912  C CE2 . TRP C 1 156 ? -37.017 10.229  -63.849 1.00 13.31 ? 155 TRP C CE2 1 
ATOM   6913  C CE3 . TRP C 1 156 ? -35.165 9.605   -65.263 1.00 11.40 ? 155 TRP C CE3 1 
ATOM   6914  C CZ2 . TRP C 1 156 ? -36.161 10.527  -62.789 1.00 12.54 ? 155 TRP C CZ2 1 
ATOM   6915  C CZ3 . TRP C 1 156 ? -34.329 9.915   -64.213 1.00 12.59 ? 155 TRP C CZ3 1 
ATOM   6916  C CH2 . TRP C 1 156 ? -34.821 10.367  -63.002 1.00 12.47 ? 155 TRP C CH2 1 
ATOM   6917  N N   . ILE C 1 157 ? -39.656 6.451   -65.897 1.00 13.86 ? 156 ILE C N   1 
ATOM   6918  C CA  . ILE C 1 157 ? -41.020 6.274   -65.379 1.00 14.46 ? 156 ILE C CA  1 
ATOM   6919  C C   . ILE C 1 157 ? -41.137 6.501   -63.865 1.00 14.03 ? 156 ILE C C   1 
ATOM   6920  O O   . ILE C 1 157 ? -40.159 6.341   -63.122 1.00 13.43 ? 156 ILE C O   1 
ATOM   6921  C CB  . ILE C 1 157 ? -41.606 4.883   -65.699 1.00 15.01 ? 156 ILE C CB  1 
ATOM   6922  C CG1 . ILE C 1 157 ? -40.987 3.809   -64.821 1.00 15.80 ? 156 ILE C CG1 1 
ATOM   6923  C CG2 . ILE C 1 157 ? -41.427 4.526   -67.182 1.00 12.69 ? 156 ILE C CG2 1 
ATOM   6924  C CD1 . ILE C 1 157 ? -41.641 2.425   -64.995 1.00 16.71 ? 156 ILE C CD1 1 
ATOM   6925  N N   . GLU C 1 158 ? -42.343 6.887   -63.455 1.00 12.43 ? 157 GLU C N   1 
ATOM   6926  C CA  . GLU C 1 158 ? -42.753 6.871   -62.073 1.00 12.52 ? 157 GLU C CA  1 
ATOM   6927  C C   . GLU C 1 158 ? -43.828 5.825   -61.961 1.00 11.92 ? 157 GLU C C   1 
ATOM   6928  O O   . GLU C 1 158 ? -44.559 5.604   -62.921 1.00 12.83 ? 157 GLU C O   1 
ATOM   6929  C CB  . GLU C 1 158 ? -43.349 8.213   -61.645 1.00 11.66 ? 157 GLU C CB  1 
ATOM   6930  C CG  . GLU C 1 158 ? -42.345 9.339   -61.434 1.00 12.22 ? 157 GLU C CG  1 
ATOM   6931  C CD  . GLU C 1 158 ? -43.023 10.657  -61.135 1.00 10.86 ? 157 GLU C CD  1 
ATOM   6932  O OE1 . GLU C 1 158 ? -44.214 10.613  -60.738 1.00 10.04 ? 157 GLU C OE1 1 
ATOM   6933  O OE2 . GLU C 1 158 ? -42.385 11.739  -61.292 1.00 9.98  ? 157 GLU C OE2 1 
ATOM   6934  N N   . THR C 1 159 ? -43.905 5.156   -60.818 1.00 11.74 ? 158 THR C N   1 
ATOM   6935  C CA  . THR C 1 159 ? -45.095 4.369   -60.480 1.00 11.29 ? 158 THR C CA  1 
ATOM   6936  C C   . THR C 1 159 ? -45.224 4.156   -58.978 1.00 11.60 ? 158 THR C C   1 
ATOM   6937  O O   . THR C 1 159 ? -44.307 3.659   -58.344 1.00 12.04 ? 158 THR C O   1 
ATOM   6938  C CB  . THR C 1 159 ? -45.171 3.028   -61.244 1.00 10.95 ? 158 THR C CB  1 
ATOM   6939  O OG1 . THR C 1 159 ? -46.326 2.289   -60.810 1.00 10.77 ? 158 THR C OG1 1 
ATOM   6940  C CG2 . THR C 1 159 ? -43.897 2.179   -61.037 1.00 10.22 ? 158 THR C CG2 1 
ATOM   6941  N N   . PRO C 1 160 ? -46.359 4.568   -58.383 1.00 12.19 ? 159 PRO C N   1 
ATOM   6942  C CA  . PRO C 1 160 ? -47.452 5.324   -59.011 1.00 12.01 ? 159 PRO C CA  1 
ATOM   6943  C C   . PRO C 1 160 ? -46.990 6.712   -59.434 1.00 11.30 ? 159 PRO C C   1 
ATOM   6944  O O   . PRO C 1 160 ? -46.069 7.263   -58.806 1.00 12.41 ? 159 PRO C O   1 
ATOM   6945  C CB  . PRO C 1 160 ? -48.497 5.420   -57.907 1.00 11.54 ? 159 PRO C CB  1 
ATOM   6946  C CG  . PRO C 1 160 ? -48.108 4.370   -56.881 1.00 12.79 ? 159 PRO C CG  1 
ATOM   6947  C CD  . PRO C 1 160 ? -46.642 4.260   -56.973 1.00 11.38 ? 159 PRO C CD  1 
ATOM   6948  N N   . THR C 1 161 ? -47.622 7.264   -60.473 1.00 10.46 ? 160 THR C N   1 
ATOM   6949  C CA  . THR C 1 161 ? -47.285 8.608   -60.957 1.00 9.71  ? 160 THR C CA  1 
ATOM   6950  C C   . THR C 1 161 ? -47.739 9.744   -60.048 1.00 9.98  ? 160 THR C C   1 
ATOM   6951  O O   . THR C 1 161 ? -48.746 9.665   -59.339 1.00 9.04  ? 160 THR C O   1 
ATOM   6952  C CB  . THR C 1 161 ? -47.834 8.887   -62.393 1.00 10.97 ? 160 THR C CB  1 
ATOM   6953  O OG1 . THR C 1 161 ? -49.269 8.918   -62.381 1.00 10.04 ? 160 THR C OG1 1 
ATOM   6954  C CG2 . THR C 1 161 ? -47.319 7.829   -63.361 1.00 8.16  ? 160 THR C CG2 1 
ATOM   6955  N N   . ASN C 1 162 ? -46.976 10.820  -60.099 1.00 10.00 ? 161 ASN C N   1 
ATOM   6956  C CA  . ASN C 1 162 ? -47.258 11.988  -59.304 1.00 10.49 ? 161 ASN C CA  1 
ATOM   6957  C C   . ASN C 1 162 ? -47.893 13.025  -60.203 1.00 10.24 ? 161 ASN C C   1 
ATOM   6958  O O   . ASN C 1 162 ? -47.207 13.560  -61.063 1.00 10.83 ? 161 ASN C O   1 
ATOM   6959  C CB  . ASN C 1 162 ? -45.944 12.522  -58.713 1.00 10.62 ? 161 ASN C CB  1 
ATOM   6960  C CG  . ASN C 1 162 ? -46.154 13.700  -57.760 1.00 12.07 ? 161 ASN C CG  1 
ATOM   6961  O OD1 . ASN C 1 162 ? -47.288 14.112  -57.508 1.00 10.12 ? 161 ASN C OD1 1 
ATOM   6962  N ND2 . ASN C 1 162 ? -45.061 14.214  -57.203 1.00 10.94 ? 161 ASN C ND2 1 
ATOM   6963  N N   . PRO C 1 163 ? -49.157 13.411  -59.958 1.00 10.34 ? 162 PRO C N   1 
ATOM   6964  C CA  . PRO C 1 163 ? -50.085 13.089  -58.886 1.00 10.28 ? 162 PRO C CA  1 
ATOM   6965  C C   . PRO C 1 163 ? -51.239 12.124  -59.188 1.00 10.84 ? 162 PRO C C   1 
ATOM   6966  O O   . PRO C 1 163 ? -51.988 11.844  -58.275 1.00 10.66 ? 162 PRO C O   1 
ATOM   6967  C CB  . PRO C 1 163 ? -50.727 14.445  -58.629 1.00 10.50 ? 162 PRO C CB  1 
ATOM   6968  C CG  . PRO C 1 163 ? -50.931 14.981  -60.016 1.00 9.10  ? 162 PRO C CG  1 
ATOM   6969  C CD  . PRO C 1 163 ? -49.731 14.475  -60.824 1.00 9.39  ? 162 PRO C CD  1 
ATOM   6970  N N   . THR C 1 164 ? -51.417 11.660  -60.430 1.00 11.34 ? 163 THR C N   1 
ATOM   6971  C CA  . THR C 1 164 ? -52.650 10.905  -60.800 1.00 11.31 ? 163 THR C CA  1 
ATOM   6972  C C   . THR C 1 164 ? -52.585 9.410   -60.524 1.00 11.58 ? 163 THR C C   1 
ATOM   6973  O O   . THR C 1 164 ? -53.586 8.693   -60.679 1.00 10.90 ? 163 THR C O   1 
ATOM   6974  C CB  . THR C 1 164 ? -53.112 11.150  -62.274 1.00 10.99 ? 163 THR C CB  1 
ATOM   6975  O OG1 . THR C 1 164 ? -52.246 10.450  -63.199 1.00 12.74 ? 163 THR C OG1 1 
ATOM   6976  C CG2 . THR C 1 164 ? -53.180 12.662  -62.602 1.00 9.61  ? 163 THR C CG2 1 
ATOM   6977  N N   . GLN C 1 165 ? -51.416 8.945   -60.092 1.00 11.55 ? 164 GLN C N   1 
ATOM   6978  C CA  . GLN C 1 165 ? -51.231 7.593   -59.607 1.00 11.68 ? 164 GLN C CA  1 
ATOM   6979  C C   . GLN C 1 165 ? -51.632 6.488   -60.586 1.00 12.69 ? 164 GLN C C   1 
ATOM   6980  O O   . GLN C 1 165 ? -52.226 5.473   -60.204 1.00 12.25 ? 164 GLN C O   1 
ATOM   6981  C CB  . GLN C 1 165 ? -51.878 7.437   -58.238 1.00 11.81 ? 164 GLN C CB  1 
ATOM   6982  C CG  . GLN C 1 165 ? -51.250 8.390   -57.220 1.00 12.51 ? 164 GLN C CG  1 
ATOM   6983  C CD  . GLN C 1 165 ? -51.404 7.941   -55.783 1.00 10.68 ? 164 GLN C CD  1 
ATOM   6984  O OE1 . GLN C 1 165 ? -50.900 6.870   -55.391 1.00 11.92 ? 164 GLN C OE1 1 
ATOM   6985  N NE2 . GLN C 1 165 ? -52.050 8.776   -54.976 1.00 6.92  ? 164 GLN C NE2 1 
ATOM   6986  N N   . LYS C 1 166 ? -51.250 6.700   -61.850 1.00 12.79 ? 165 LYS C N   1 
ATOM   6987  C CA  . LYS C 1 166 ? -51.202 5.624   -62.821 1.00 13.66 ? 165 LYS C CA  1 
ATOM   6988  C C   . LYS C 1 166 ? -50.073 4.682   -62.410 1.00 13.66 ? 165 LYS C C   1 
ATOM   6989  O O   . LYS C 1 166 ? -49.050 5.109   -61.865 1.00 12.65 ? 165 LYS C O   1 
ATOM   6990  C CB  . LYS C 1 166 ? -50.971 6.174   -64.212 1.00 14.54 ? 165 LYS C CB  1 
ATOM   6991  C CG  . LYS C 1 166 ? -52.215 6.816   -64.800 1.00 17.97 ? 165 LYS C CG  1 
ATOM   6992  C CD  . LYS C 1 166 ? -51.861 7.963   -65.752 1.00 21.10 ? 165 LYS C CD  1 
ATOM   6993  C CE  . LYS C 1 166 ? -51.267 7.538   -67.085 1.00 22.92 ? 165 LYS C CE  1 
ATOM   6994  N NZ  . LYS C 1 166 ? -50.903 8.740   -67.893 1.00 22.54 ? 165 LYS C NZ  1 
ATOM   6995  N N   . VAL C 1 167 ? -50.298 3.398   -62.639 1.00 13.46 ? 166 VAL C N   1 
ATOM   6996  C CA  . VAL C 1 167 ? -49.365 2.348   -62.240 1.00 13.67 ? 166 VAL C CA  1 
ATOM   6997  C C   . VAL C 1 167 ? -48.861 1.644   -63.498 1.00 14.18 ? 166 VAL C C   1 
ATOM   6998  O O   . VAL C 1 167 ? -49.638 1.329   -64.419 1.00 13.81 ? 166 VAL C O   1 
ATOM   6999  C CB  . VAL C 1 167 ? -50.028 1.358   -61.246 1.00 13.54 ? 166 VAL C CB  1 
ATOM   7000  C CG1 . VAL C 1 167 ? -49.166 0.115   -61.027 1.00 12.36 ? 166 VAL C CG1 1 
ATOM   7001  C CG2 . VAL C 1 167 ? -50.295 2.068   -59.895 1.00 13.11 ? 166 VAL C CG2 1 
ATOM   7002  N N   . ILE C 1 168 ? -47.553 1.406   -63.516 1.00 15.06 ? 167 ILE C N   1 
ATOM   7003  C CA  . ILE C 1 168 ? -46.849 0.783   -64.618 1.00 15.61 ? 167 ILE C CA  1 
ATOM   7004  C C   . ILE C 1 168 ? -46.312 -0.577  -64.145 1.00 16.18 ? 167 ILE C C   1 
ATOM   7005  O O   . ILE C 1 168 ? -45.756 -0.695  -63.047 1.00 16.77 ? 167 ILE C O   1 
ATOM   7006  C CB  . ILE C 1 168 ? -45.659 1.659   -65.076 1.00 16.36 ? 167 ILE C CB  1 
ATOM   7007  C CG1 . ILE C 1 168 ? -46.132 2.965   -65.721 1.00 18.47 ? 167 ILE C CG1 1 
ATOM   7008  C CG2 . ILE C 1 168 ? -44.739 0.882   -66.024 1.00 14.83 ? 167 ILE C CG2 1 
ATOM   7009  C CD1 . ILE C 1 168 ? -46.696 3.993   -64.716 1.00 21.44 ? 167 ILE C CD1 1 
ATOM   7010  N N   . ASP C 1 169 ? -46.493 -1.603  -64.976 1.00 16.40 ? 168 ASP C N   1 
ATOM   7011  C CA  . ASP C 1 169 ? -45.900 -2.927  -64.754 1.00 17.13 ? 168 ASP C CA  1 
ATOM   7012  C C   . ASP C 1 169 ? -44.406 -2.829  -65.051 1.00 16.67 ? 168 ASP C C   1 
ATOM   7013  O O   . ASP C 1 169 ? -44.002 -2.812  -66.198 1.00 17.03 ? 168 ASP C O   1 
ATOM   7014  C CB  . ASP C 1 169 ? -46.572 -3.950  -65.683 1.00 17.29 ? 168 ASP C CB  1 
ATOM   7015  C CG  . ASP C 1 169 ? -46.134 -5.373  -65.425 1.00 19.47 ? 168 ASP C CG  1 
ATOM   7016  O OD1 . ASP C 1 169 ? -45.004 -5.622  -64.956 1.00 19.80 ? 168 ASP C OD1 1 
ATOM   7017  O OD2 . ASP C 1 169 ? -46.947 -6.277  -65.713 1.00 22.43 ? 168 ASP C OD2 1 
ATOM   7018  N N   . ILE C 1 170 ? -43.593 -2.716  -64.007 1.00 16.26 ? 169 ILE C N   1 
ATOM   7019  C CA  . ILE C 1 170 ? -42.154 -2.433  -64.179 1.00 16.04 ? 169 ILE C CA  1 
ATOM   7020  C C   . ILE C 1 170 ? -41.483 -3.576  -64.950 1.00 16.57 ? 169 ILE C C   1 
ATOM   7021  O O   . ILE C 1 170 ? -40.781 -3.339  -65.915 1.00 16.42 ? 169 ILE C O   1 
ATOM   7022  C CB  . ILE C 1 170 ? -41.459 -2.180  -62.816 1.00 15.32 ? 169 ILE C CB  1 
ATOM   7023  C CG1 . ILE C 1 170 ? -41.987 -0.882  -62.165 1.00 14.51 ? 169 ILE C CG1 1 
ATOM   7024  C CG2 . ILE C 1 170 ? -39.920 -2.098  -62.979 1.00 15.55 ? 169 ILE C CG2 1 
ATOM   7025  C CD1 . ILE C 1 170 ? -41.676 -0.762  -60.655 1.00 12.71 ? 169 ILE C CD1 1 
ATOM   7026  N N   . GLU C 1 171 ? -41.732 -4.816  -64.545 1.00 18.04 ? 170 GLU C N   1 
ATOM   7027  C CA  . GLU C 1 171 ? -41.148 -5.978  -65.262 1.00 18.84 ? 170 GLU C CA  1 
ATOM   7028  C C   . GLU C 1 171 ? -41.533 -6.048  -66.747 1.00 18.88 ? 170 GLU C C   1 
ATOM   7029  O O   . GLU C 1 171 ? -40.672 -6.256  -67.613 1.00 18.12 ? 170 GLU C O   1 
ATOM   7030  C CB  . GLU C 1 171 ? -41.548 -7.258  -64.555 1.00 20.12 ? 170 GLU C CB  1 
ATOM   7031  C CG  . GLU C 1 171 ? -40.673 -8.432  -64.874 1.00 23.93 ? 170 GLU C CG  1 
ATOM   7032  C CD  . GLU C 1 171 ? -40.816 -9.517  -63.833 1.00 30.38 ? 170 GLU C CD  1 
ATOM   7033  O OE1 . GLU C 1 171 ? -41.957 -9.763  -63.386 1.00 33.43 ? 170 GLU C OE1 1 
ATOM   7034  O OE2 . GLU C 1 171 ? -39.785 -10.109 -63.436 1.00 36.37 ? 170 GLU C OE2 1 
ATOM   7035  N N   . GLY C 1 172 ? -42.815 -5.836  -67.049 1.00 18.50 ? 171 GLY C N   1 
ATOM   7036  C CA  . GLY C 1 172 ? -43.279 -5.790  -68.425 1.00 18.50 ? 171 GLY C CA  1 
ATOM   7037  C C   . GLY C 1 172 ? -42.631 -4.665  -69.199 1.00 18.76 ? 171 GLY C C   1 
ATOM   7038  O O   . GLY C 1 172 ? -42.260 -4.802  -70.361 1.00 18.07 ? 171 GLY C O   1 
ATOM   7039  N N   . CYS C 1 173 ? -42.500 -3.528  -68.548 1.00 19.99 ? 172 CYS C N   1 
ATOM   7040  C CA  . CYS C 1 173 ? -41.909 -2.356  -69.172 1.00 20.03 ? 172 CYS C CA  1 
ATOM   7041  C C   . CYS C 1 173 ? -40.403 -2.571  -69.441 1.00 19.56 ? 172 CYS C C   1 
ATOM   7042  O O   . CYS C 1 173 ? -39.873 -2.201  -70.495 1.00 19.52 ? 172 CYS C O   1 
ATOM   7043  C CB  . CYS C 1 173 ? -42.163 -1.173  -68.241 1.00 20.49 ? 172 CYS C CB  1 
ATOM   7044  S SG  . CYS C 1 173 ? -41.528 0.333   -68.782 1.00 24.90 ? 172 CYS C SG  1 
ATOM   7045  N N   . ALA C 1 174 ? -39.733 -3.181  -68.474 1.00 19.06 ? 173 ALA C N   1 
ATOM   7046  C CA  . ALA C 1 174 ? -38.319 -3.535  -68.574 1.00 19.63 ? 173 ALA C CA  1 
ATOM   7047  C C   . ALA C 1 174 ? -38.090 -4.503  -69.740 1.00 20.02 ? 173 ALA C C   1 
ATOM   7048  O O   . ALA C 1 174 ? -37.207 -4.306  -70.582 1.00 19.06 ? 173 ALA C O   1 
ATOM   7049  C CB  . ALA C 1 174 ? -37.860 -4.188  -67.264 1.00 18.62 ? 173 ALA C CB  1 
ATOM   7050  N N   . HIS C 1 175 ? -38.900 -5.554  -69.775 1.00 21.15 ? 174 HIS C N   1 
ATOM   7051  C CA  . HIS C 1 175 ? -38.802 -6.510  -70.856 1.00 22.79 ? 174 HIS C CA  1 
ATOM   7052  C C   . HIS C 1 175 ? -38.909 -5.806  -72.220 1.00 22.95 ? 174 HIS C C   1 
ATOM   7053  O O   . HIS C 1 175 ? -38.043 -5.993  -73.073 1.00 23.40 ? 174 HIS C O   1 
ATOM   7054  C CB  . HIS C 1 175 ? -39.810 -7.645  -70.702 1.00 23.67 ? 174 HIS C CB  1 
ATOM   7055  C CG  . HIS C 1 175 ? -39.706 -8.657  -71.791 1.00 27.50 ? 174 HIS C CG  1 
ATOM   7056  N ND1 . HIS C 1 175 ? -38.961 -9.808  -71.668 1.00 31.79 ? 174 HIS C ND1 1 
ATOM   7057  C CD2 . HIS C 1 175 ? -40.187 -8.650  -73.059 1.00 31.58 ? 174 HIS C CD2 1 
ATOM   7058  C CE1 . HIS C 1 175 ? -39.023 -10.492 -72.798 1.00 31.79 ? 174 HIS C CE1 1 
ATOM   7059  N NE2 . HIS C 1 175 ? -39.757 -9.809  -73.661 1.00 32.69 ? 174 HIS C NE2 1 
ATOM   7060  N N   . ILE C 1 176 ? -39.934 -4.980  -72.415 1.00 23.09 ? 175 ILE C N   1 
ATOM   7061  C CA  . ILE C 1 176 ? -40.075 -4.191  -73.628 1.00 23.54 ? 175 ILE C CA  1 
ATOM   7062  C C   . ILE C 1 176 ? -38.836 -3.325  -73.941 1.00 23.47 ? 175 ILE C C   1 
ATOM   7063  O O   . ILE C 1 176 ? -38.333 -3.343  -75.059 1.00 23.15 ? 175 ILE C O   1 
ATOM   7064  C CB  . ILE C 1 176 ? -41.314 -3.251  -73.556 1.00 24.07 ? 175 ILE C CB  1 
ATOM   7065  C CG1 . ILE C 1 176 ? -42.622 -4.048  -73.624 1.00 24.24 ? 175 ILE C CG1 1 
ATOM   7066  C CG2 . ILE C 1 176 ? -41.313 -2.255  -74.691 1.00 24.59 ? 175 ILE C CG2 1 
ATOM   7067  C CD1 . ILE C 1 176 ? -43.834 -3.198  -73.341 1.00 24.42 ? 175 ILE C CD1 1 
ATOM   7068  N N   . VAL C 1 177 ? -38.365 -2.552  -72.963 1.00 23.52 ? 176 VAL C N   1 
ATOM   7069  C CA  . VAL C 1 177 ? -37.291 -1.575  -73.202 1.00 23.26 ? 176 VAL C CA  1 
ATOM   7070  C C   . VAL C 1 177 ? -35.962 -2.284  -73.518 1.00 23.56 ? 176 VAL C C   1 
ATOM   7071  O O   . VAL C 1 177 ? -35.190 -1.835  -74.355 1.00 23.03 ? 176 VAL C O   1 
ATOM   7072  C CB  . VAL C 1 177 ? -37.115 -0.612  -71.990 1.00 23.28 ? 176 VAL C CB  1 
ATOM   7073  C CG1 . VAL C 1 177 ? -35.917 0.288   -72.181 1.00 23.67 ? 176 VAL C CG1 1 
ATOM   7074  C CG2 . VAL C 1 177 ? -38.362 0.230   -71.793 1.00 22.34 ? 176 VAL C CG2 1 
ATOM   7075  N N   . HIS C 1 178 ? -35.718 -3.402  -72.853 1.00 23.74 ? 177 HIS C N   1 
ATOM   7076  C CA  . HIS C 1 178 ? -34.449 -4.100  -72.999 1.00 24.47 ? 177 HIS C CA  1 
ATOM   7077  C C   . HIS C 1 178 ? -34.409 -5.068  -74.190 1.00 26.08 ? 177 HIS C C   1 
ATOM   7078  O O   . HIS C 1 178 ? -33.338 -5.543  -74.545 1.00 25.33 ? 177 HIS C O   1 
ATOM   7079  C CB  . HIS C 1 178 ? -34.127 -4.858  -71.717 1.00 23.86 ? 177 HIS C CB  1 
ATOM   7080  C CG  . HIS C 1 178 ? -33.869 -3.967  -70.543 1.00 22.67 ? 177 HIS C CG  1 
ATOM   7081  N ND1 . HIS C 1 178 ? -34.293 -4.282  -69.272 1.00 19.63 ? 177 HIS C ND1 1 
ATOM   7082  C CD2 . HIS C 1 178 ? -33.220 -2.781  -70.446 1.00 19.33 ? 177 HIS C CD2 1 
ATOM   7083  C CE1 . HIS C 1 178 ? -33.903 -3.332  -68.438 1.00 20.45 ? 177 HIS C CE1 1 
ATOM   7084  N NE2 . HIS C 1 178 ? -33.261 -2.405  -69.123 1.00 18.65 ? 177 HIS C NE2 1 
ATOM   7085  N N   . LYS C 1 179 ? -35.563 -5.341  -74.797 1.00 28.12 ? 178 LYS C N   1 
ATOM   7086  C CA  . LYS C 1 179 ? -35.640 -6.209  -75.971 1.00 30.54 ? 178 LYS C CA  1 
ATOM   7087  C C   . LYS C 1 179 ? -34.787 -5.688  -77.108 1.00 31.68 ? 178 LYS C C   1 
ATOM   7088  O O   . LYS C 1 179 ? -34.070 -6.441  -77.748 1.00 32.94 ? 178 LYS C O   1 
ATOM   7089  C CB  . LYS C 1 179 ? -37.075 -6.360  -76.465 1.00 30.70 ? 178 LYS C CB  1 
ATOM   7090  C CG  . LYS C 1 179 ? -37.278 -7.658  -77.243 1.00 32.19 ? 178 LYS C CG  1 
ATOM   7091  C CD  . LYS C 1 179 ? -38.672 -7.779  -77.806 1.00 32.43 ? 178 LYS C CD  1 
ATOM   7092  C CE  . LYS C 1 179 ? -38.875 -9.136  -78.474 1.00 34.54 ? 178 LYS C CE  1 
ATOM   7093  N NZ  . LYS C 1 179 ? -39.051 -10.240 -77.468 1.00 36.68 ? 178 LYS C NZ  1 
ATOM   7094  N N   . HIS C 1 180 ? -34.846 -4.397  -77.370 1.00 33.18 ? 179 HIS C N   1 
ATOM   7095  C CA  . HIS C 1 180 ? -33.971 -3.865  -78.384 1.00 34.48 ? 179 HIS C CA  1 
ATOM   7096  C C   . HIS C 1 180 ? -32.990 -2.858  -77.831 1.00 34.16 ? 179 HIS C C   1 
ATOM   7097  O O   . HIS C 1 180 ? -33.177 -1.661  -77.881 1.00 35.48 ? 179 HIS C O   1 
ATOM   7098  C CB  . HIS C 1 180 ? -34.766 -3.401  -79.611 1.00 35.39 ? 179 HIS C CB  1 
ATOM   7099  C CG  . HIS C 1 180 ? -35.456 -4.538  -80.308 1.00 36.95 ? 179 HIS C CG  1 
ATOM   7100  N ND1 . HIS C 1 180 ? -36.796 -4.822  -80.131 1.00 38.97 ? 179 HIS C ND1 1 
ATOM   7101  C CD2 . HIS C 1 180 ? -34.968 -5.520  -81.102 1.00 39.09 ? 179 HIS C CD2 1 
ATOM   7102  C CE1 . HIS C 1 180 ? -37.111 -5.906  -80.815 1.00 38.53 ? 179 HIS C CE1 1 
ATOM   7103  N NE2 . HIS C 1 180 ? -36.018 -6.355  -81.404 1.00 40.14 ? 179 HIS C NE2 1 
ATOM   7104  N N   . GLY C 1 181 ? -31.938 -3.399  -77.259 1.00 34.00 ? 180 GLY C N   1 
ATOM   7105  C CA  . GLY C 1 181 ? -30.677 -2.704  -77.202 1.00 33.38 ? 180 GLY C CA  1 
ATOM   7106  C C   . GLY C 1 181 ? -30.377 -2.003  -75.910 1.00 32.40 ? 180 GLY C C   1 
ATOM   7107  O O   . GLY C 1 181 ? -30.949 -2.304  -74.843 1.00 34.14 ? 180 GLY C O   1 
ATOM   7108  N N   . ASP C 1 182 ? -29.504 -1.020  -76.049 1.00 30.38 ? 181 ASP C N   1 
ATOM   7109  C CA  . ASP C 1 182 ? -28.882 -0.317  -74.957 1.00 28.90 ? 181 ASP C CA  1 
ATOM   7110  C C   . ASP C 1 182 ? -29.781 0.832   -74.458 1.00 26.34 ? 181 ASP C C   1 
ATOM   7111  O O   . ASP C 1 182 ? -29.501 2.006   -74.703 1.00 25.75 ? 181 ASP C O   1 
ATOM   7112  C CB  . ASP C 1 182 ? -27.544 0.214   -75.506 1.00 29.83 ? 181 ASP C CB  1 
ATOM   7113  C CG  . ASP C 1 182 ? -26.671 0.827   -74.454 1.00 31.50 ? 181 ASP C CG  1 
ATOM   7114  O OD1 . ASP C 1 182 ? -26.653 0.285   -73.326 1.00 32.17 ? 181 ASP C OD1 1 
ATOM   7115  O OD2 . ASP C 1 182 ? -25.991 1.842   -74.781 1.00 34.68 ? 181 ASP C OD2 1 
ATOM   7116  N N   . ILE C 1 183 ? -30.882 0.485   -73.790 1.00 23.52 ? 182 ILE C N   1 
ATOM   7117  C CA  . ILE C 1 183 ? -31.791 1.495   -73.235 1.00 21.96 ? 182 ILE C CA  1 
ATOM   7118  C C   . ILE C 1 183 ? -31.856 1.366   -71.711 1.00 20.38 ? 182 ILE C C   1 
ATOM   7119  O O   . ILE C 1 183 ? -32.073 0.276   -71.165 1.00 19.84 ? 182 ILE C O   1 
ATOM   7120  C CB  . ILE C 1 183 ? -33.223 1.400   -73.829 1.00 22.19 ? 182 ILE C CB  1 
ATOM   7121  C CG1 . ILE C 1 183 ? -33.202 1.359   -75.364 1.00 22.15 ? 182 ILE C CG1 1 
ATOM   7122  C CG2 . ILE C 1 183 ? -34.105 2.580   -73.367 1.00 21.61 ? 182 ILE C CG2 1 
ATOM   7123  C CD1 . ILE C 1 183 ? -34.598 1.384   -76.001 1.00 22.20 ? 182 ILE C CD1 1 
ATOM   7124  N N   . ILE C 1 184 ? -31.651 2.495   -71.038 1.00 18.44 ? 183 ILE C N   1 
ATOM   7125  C CA  . ILE C 1 184 ? -31.693 2.572   -69.580 1.00 17.50 ? 183 ILE C CA  1 
ATOM   7126  C C   . ILE C 1 184 ? -33.143 2.786   -69.130 1.00 16.70 ? 183 ILE C C   1 
ATOM   7127  O O   . ILE C 1 184 ? -33.809 3.706   -69.596 1.00 16.09 ? 183 ILE C O   1 
ATOM   7128  C CB  . ILE C 1 184 ? -30.836 3.761   -69.061 1.00 16.90 ? 183 ILE C CB  1 
ATOM   7129  C CG1 . ILE C 1 184 ? -29.353 3.540   -69.362 1.00 17.71 ? 183 ILE C CG1 1 
ATOM   7130  C CG2 . ILE C 1 184 ? -30.993 3.949   -67.558 1.00 17.16 ? 183 ILE C CG2 1 
ATOM   7131  C CD1 . ILE C 1 184 ? -28.539 4.860   -69.423 1.00 17.79 ? 183 ILE C CD1 1 
ATOM   7132  N N   . LEU C 1 185 ? -33.632 1.918   -68.251 1.00 16.14 ? 184 LEU C N   1 
ATOM   7133  C CA  . LEU C 1 185 ? -34.926 2.147   -67.611 1.00 15.65 ? 184 LEU C CA  1 
ATOM   7134  C C   . LEU C 1 185 ? -34.754 2.656   -66.185 1.00 14.07 ? 184 LEU C C   1 
ATOM   7135  O O   . LEU C 1 185 ? -34.264 1.945   -65.336 1.00 14.46 ? 184 LEU C O   1 
ATOM   7136  C CB  . LEU C 1 185 ? -35.759 0.868   -67.570 1.00 15.30 ? 184 LEU C CB  1 
ATOM   7137  C CG  . LEU C 1 185 ? -37.092 0.997   -66.816 1.00 15.79 ? 184 LEU C CG  1 
ATOM   7138  C CD1 . LEU C 1 185 ? -37.966 2.045   -67.435 1.00 15.47 ? 184 LEU C CD1 1 
ATOM   7139  C CD2 . LEU C 1 185 ? -37.797 -0.362  -66.756 1.00 15.92 ? 184 LEU C CD2 1 
ATOM   7140  N N   . VAL C 1 186 ? -35.186 3.883   -65.937 1.00 13.73 ? 185 VAL C N   1 
ATOM   7141  C CA  . VAL C 1 186 ? -35.226 4.439   -64.587 1.00 12.02 ? 185 VAL C CA  1 
ATOM   7142  C C   . VAL C 1 186 ? -36.641 4.322   -64.026 1.00 11.80 ? 185 VAL C C   1 
ATOM   7143  O O   . VAL C 1 186 ? -37.617 4.704   -64.691 1.00 10.97 ? 185 VAL C O   1 
ATOM   7144  C CB  . VAL C 1 186 ? -34.815 5.942   -64.584 1.00 11.88 ? 185 VAL C CB  1 
ATOM   7145  C CG1 . VAL C 1 186 ? -34.956 6.563   -63.190 1.00 8.75  ? 185 VAL C CG1 1 
ATOM   7146  C CG2 . VAL C 1 186 ? -33.388 6.138   -65.145 1.00 8.79  ? 185 VAL C CG2 1 
ATOM   7147  N N   . VAL C 1 187 ? -36.736 3.844   -62.791 1.00 12.37 ? 186 VAL C N   1 
ATOM   7148  C CA  . VAL C 1 187 ? -37.957 3.993   -61.993 1.00 11.83 ? 186 VAL C CA  1 
ATOM   7149  C C   . VAL C 1 187 ? -37.691 4.951   -60.833 1.00 11.64 ? 186 VAL C C   1 
ATOM   7150  O O   . VAL C 1 187 ? -36.892 4.661   -59.932 1.00 11.82 ? 186 VAL C O   1 
ATOM   7151  C CB  . VAL C 1 187 ? -38.511 2.667   -61.441 1.00 11.95 ? 186 VAL C CB  1 
ATOM   7152  C CG1 . VAL C 1 187 ? -39.861 2.924   -60.764 1.00 10.80 ? 186 VAL C CG1 1 
ATOM   7153  C CG2 . VAL C 1 187 ? -38.646 1.613   -62.536 1.00 10.31 ? 186 VAL C CG2 1 
ATOM   7154  N N   . ASP C 1 188 ? -38.370 6.087   -60.893 1.00 10.94 ? 187 ASP C N   1 
ATOM   7155  C CA  . ASP C 1 188 ? -38.455 7.028   -59.801 1.00 10.14 ? 187 ASP C CA  1 
ATOM   7156  C C   . ASP C 1 188 ? -39.466 6.437   -58.834 1.00 10.06 ? 187 ASP C C   1 
ATOM   7157  O O   . ASP C 1 188 ? -40.691 6.409   -59.089 1.00 10.62 ? 187 ASP C O   1 
ATOM   7158  C CB  . ASP C 1 188 ? -38.827 8.418   -60.350 1.00 10.05 ? 187 ASP C CB  1 
ATOM   7159  C CG  . ASP C 1 188 ? -39.091 9.447   -59.278 1.00 8.95  ? 187 ASP C CG  1 
ATOM   7160  O OD1 . ASP C 1 188 ? -39.235 9.099   -58.087 1.00 8.36  ? 187 ASP C OD1 1 
ATOM   7161  O OD2 . ASP C 1 188 ? -39.163 10.643  -59.646 1.00 8.86  ? 187 ASP C OD2 1 
ATOM   7162  N N   . ASN C 1 189 ? -38.909 5.931   -57.735 1.00 9.31  ? 188 ASN C N   1 
ATOM   7163  C CA  . ASN C 1 189 ? -39.593 5.134   -56.727 1.00 9.57  ? 188 ASN C CA  1 
ATOM   7164  C C   . ASN C 1 189 ? -39.849 5.973   -55.477 1.00 9.09  ? 188 ASN C C   1 
ATOM   7165  O O   . ASN C 1 189 ? -39.997 5.446   -54.377 1.00 10.49 ? 188 ASN C O   1 
ATOM   7166  C CB  . ASN C 1 189 ? -38.720 3.909   -56.403 1.00 8.39  ? 188 ASN C CB  1 
ATOM   7167  C CG  . ASN C 1 189 ? -39.479 2.813   -55.691 1.00 10.58 ? 188 ASN C CG  1 
ATOM   7168  O OD1 . ASN C 1 189 ? -40.617 2.512   -56.036 1.00 12.29 ? 188 ASN C OD1 1 
ATOM   7169  N ND2 . ASN C 1 189 ? -38.830 2.179   -54.702 1.00 9.47  ? 188 ASN C ND2 1 
ATOM   7170  N N   . THR C 1 190 ? -39.880 7.287   -55.653 1.00 10.54 ? 189 THR C N   1 
ATOM   7171  C CA  . THR C 1 190 ? -40.124 8.251   -54.551 1.00 9.95  ? 189 THR C CA  1 
ATOM   7172  C C   . THR C 1 190 ? -41.355 7.934   -53.689 1.00 11.55 ? 189 THR C C   1 
ATOM   7173  O O   . THR C 1 190 ? -41.273 7.944   -52.454 1.00 11.45 ? 189 THR C O   1 
ATOM   7174  C CB  . THR C 1 190 ? -40.241 9.661   -55.132 1.00 10.06 ? 189 THR C CB  1 
ATOM   7175  O OG1 . THR C 1 190 ? -39.011 9.997   -55.749 1.00 7.42  ? 189 THR C OG1 1 
ATOM   7176  C CG2 . THR C 1 190 ? -40.632 10.702  -54.090 1.00 7.33  ? 189 THR C CG2 1 
ATOM   7177  N N   . PHE C 1 191 ? -42.476 7.646   -54.345 1.00 13.00 ? 190 PHE C N   1 
ATOM   7178  C CA  . PHE C 1 191 ? -43.768 7.439   -53.676 1.00 13.33 ? 190 PHE C CA  1 
ATOM   7179  C C   . PHE C 1 191 ? -43.836 6.155   -52.864 1.00 13.71 ? 190 PHE C C   1 
ATOM   7180  O O   . PHE C 1 191 ? -44.374 6.165   -51.749 1.00 15.06 ? 190 PHE C O   1 
ATOM   7181  C CB  . PHE C 1 191 ? -44.914 7.397   -54.712 1.00 13.55 ? 190 PHE C CB  1 
ATOM   7182  C CG  . PHE C 1 191 ? -45.614 8.723   -54.969 1.00 12.99 ? 190 PHE C CG  1 
ATOM   7183  C CD1 . PHE C 1 191 ? -44.944 9.951   -54.886 1.00 13.22 ? 190 PHE C CD1 1 
ATOM   7184  C CD2 . PHE C 1 191 ? -46.954 8.731   -55.337 1.00 14.43 ? 190 PHE C CD2 1 
ATOM   7185  C CE1 . PHE C 1 191 ? -45.597 11.134  -55.184 1.00 13.35 ? 190 PHE C CE1 1 
ATOM   7186  C CE2 . PHE C 1 191 ? -47.628 9.939   -55.632 1.00 13.20 ? 190 PHE C CE2 1 
ATOM   7187  C CZ  . PHE C 1 191 ? -46.951 11.131  -55.539 1.00 13.37 ? 190 PHE C CZ  1 
ATOM   7188  N N   . MET C 1 192 ? -43.300 5.054   -53.412 1.00 13.64 ? 191 MET C N   1 
ATOM   7189  C CA  . MET C 1 192 ? -43.362 3.764   -52.740 1.00 12.88 ? 191 MET C CA  1 
ATOM   7190  C C   . MET C 1 192 ? -42.296 3.539   -51.665 1.00 12.94 ? 191 MET C C   1 
ATOM   7191  O O   . MET C 1 192 ? -42.598 2.937   -50.621 1.00 12.72 ? 191 MET C O   1 
ATOM   7192  C CB  . MET C 1 192 ? -43.308 2.622   -53.758 1.00 12.64 ? 191 MET C CB  1 
ATOM   7193  C CG  . MET C 1 192 ? -44.472 2.566   -54.742 1.00 12.91 ? 191 MET C CG  1 
ATOM   7194  S SD  . MET C 1 192 ? -46.102 2.724   -53.992 1.00 12.38 ? 191 MET C SD  1 
ATOM   7195  C CE  . MET C 1 192 ? -46.124 1.248   -52.967 1.00 9.30  ? 191 MET C CE  1 
ATOM   7196  N N   . SER C 1 193 ? -41.066 4.012   -51.904 1.00 12.05 ? 192 SER C N   1 
ATOM   7197  C CA  . SER C 1 193 ? -39.904 3.627   -51.089 1.00 11.94 ? 192 SER C CA  1 
ATOM   7198  C C   . SER C 1 193 ? -39.526 2.159   -51.339 1.00 11.66 ? 192 SER C C   1 
ATOM   7199  O O   . SER C 1 193 ? -40.365 1.370   -51.733 1.00 11.48 ? 192 SER C O   1 
ATOM   7200  C CB  . SER C 1 193 ? -40.144 3.863   -49.576 1.00 11.80 ? 192 SER C CB  1 
ATOM   7201  O OG  . SER C 1 193 ? -40.734 2.743   -48.929 1.00 9.55  ? 192 SER C OG  1 
ATOM   7202  N N   . PRO C 1 194 ? -38.262 1.780   -51.065 1.00 11.69 ? 193 PRO C N   1 
ATOM   7203  C CA  . PRO C 1 194 ? -37.849 0.398   -51.267 1.00 11.32 ? 193 PRO C CA  1 
ATOM   7204  C C   . PRO C 1 194 ? -38.460 -0.567  -50.252 1.00 10.91 ? 193 PRO C C   1 
ATOM   7205  O O   . PRO C 1 194 ? -38.404 -1.776  -50.438 1.00 10.81 ? 193 PRO C O   1 
ATOM   7206  C CB  . PRO C 1 194 ? -36.329 0.472   -51.118 1.00 11.56 ? 193 PRO C CB  1 
ATOM   7207  C CG  . PRO C 1 194 ? -36.103 1.576   -50.211 1.00 11.78 ? 193 PRO C CG  1 
ATOM   7208  C CD  . PRO C 1 194 ? -37.155 2.593   -50.531 1.00 11.97 ? 193 PRO C CD  1 
ATOM   7209  N N   . TYR C 1 195 ? -39.070 -0.039  -49.191 1.00 11.61 ? 194 TYR C N   1 
ATOM   7210  C CA  . TYR C 1 195 ? -39.858 -0.872  -48.291 1.00 11.15 ? 194 TYR C CA  1 
ATOM   7211  C C   . TYR C 1 195 ? -41.046 -1.579  -48.987 1.00 11.20 ? 194 TYR C C   1 
ATOM   7212  O O   . TYR C 1 195 ? -41.365 -2.741  -48.679 1.00 10.65 ? 194 TYR C O   1 
ATOM   7213  C CB  . TYR C 1 195 ? -40.370 -0.043  -47.132 1.00 11.56 ? 194 TYR C CB  1 
ATOM   7214  C CG  . TYR C 1 195 ? -41.029 -0.885  -46.069 1.00 11.57 ? 194 TYR C CG  1 
ATOM   7215  C CD1 . TYR C 1 195 ? -40.284 -1.763  -45.304 1.00 12.49 ? 194 TYR C CD1 1 
ATOM   7216  C CD2 . TYR C 1 195 ? -42.396 -0.846  -45.870 1.00 10.57 ? 194 TYR C CD2 1 
ATOM   7217  C CE1 . TYR C 1 195 ? -40.879 -2.566  -44.364 1.00 11.25 ? 194 TYR C CE1 1 
ATOM   7218  C CE2 . TYR C 1 195 ? -42.999 -1.637  -44.924 1.00 11.60 ? 194 TYR C CE2 1 
ATOM   7219  C CZ  . TYR C 1 195 ? -42.234 -2.489  -44.172 1.00 11.90 ? 194 TYR C CZ  1 
ATOM   7220  O OH  . TYR C 1 195 ? -42.828 -3.272  -43.214 1.00 12.98 ? 194 TYR C OH  1 
ATOM   7221  N N   . PHE C 1 196 ? -41.687 -0.876  -49.919 1.00 11.27 ? 195 PHE C N   1 
ATOM   7222  C CA  . PHE C 1 196 ? -42.890 -1.371  -50.608 1.00 10.92 ? 195 PHE C CA  1 
ATOM   7223  C C   . PHE C 1 196 ? -42.657 -1.804  -52.037 1.00 11.14 ? 195 PHE C C   1 
ATOM   7224  O O   . PHE C 1 196 ? -43.432 -2.600  -52.569 1.00 9.73  ? 195 PHE C O   1 
ATOM   7225  C CB  . PHE C 1 196 ? -44.005 -0.307  -50.595 1.00 11.11 ? 195 PHE C CB  1 
ATOM   7226  C CG  . PHE C 1 196 ? -44.666 -0.125  -49.249 1.00 12.02 ? 195 PHE C CG  1 
ATOM   7227  C CD1 . PHE C 1 196 ? -44.901 1.146   -48.734 1.00 10.47 ? 195 PHE C CD1 1 
ATOM   7228  C CD2 . PHE C 1 196 ? -45.072 -1.227  -48.510 1.00 10.16 ? 195 PHE C CD2 1 
ATOM   7229  C CE1 . PHE C 1 196 ? -45.517 1.309   -47.505 1.00 11.50 ? 195 PHE C CE1 1 
ATOM   7230  C CE2 . PHE C 1 196 ? -45.665 -1.075  -47.272 1.00 12.84 ? 195 PHE C CE2 1 
ATOM   7231  C CZ  . PHE C 1 196 ? -45.890 0.203   -46.769 1.00 12.81 ? 195 PHE C CZ  1 
ATOM   7232  N N   . GLN C 1 197 ? -41.626 -1.276  -52.686 1.00 11.77 ? 196 GLN C N   1 
ATOM   7233  C CA  . GLN C 1 197 ? -41.370 -1.614  -54.074 1.00 11.45 ? 196 GLN C CA  1 
ATOM   7234  C C   . GLN C 1 197 ? -39.866 -1.590  -54.379 1.00 11.96 ? 196 GLN C C   1 
ATOM   7235  O O   . GLN C 1 197 ? -39.178 -0.625  -54.040 1.00 11.06 ? 196 GLN C O   1 
ATOM   7236  C CB  . GLN C 1 197 ? -42.140 -0.622  -54.977 1.00 12.13 ? 196 GLN C CB  1 
ATOM   7237  C CG  . GLN C 1 197 ? -42.094 -0.857  -56.489 1.00 12.25 ? 196 GLN C CG  1 
ATOM   7238  C CD  . GLN C 1 197 ? -43.057 0.054   -57.303 1.00 11.56 ? 196 GLN C CD  1 
ATOM   7239  O OE1 . GLN C 1 197 ? -44.123 -0.402  -57.749 1.00 10.93 ? 196 GLN C OE1 1 
ATOM   7240  N NE2 . GLN C 1 197 ? -42.697 1.336   -57.469 1.00 7.00  ? 196 GLN C NE2 1 
ATOM   7241  N N   . ARG C 1 198 ? -39.387 -2.626  -55.079 1.00 11.75 ? 197 ARG C N   1 
ATOM   7242  C CA  . ARG C 1 198 ? -37.971 -2.753  -55.489 1.00 12.27 ? 197 ARG C CA  1 
ATOM   7243  C C   . ARG C 1 198 ? -37.813 -2.851  -57.002 1.00 12.49 ? 197 ARG C C   1 
ATOM   7244  O O   . ARG C 1 198 ? -37.702 -3.962  -57.560 1.00 12.24 ? 197 ARG C O   1 
ATOM   7245  C CB  . ARG C 1 198 ? -37.324 -3.975  -54.849 1.00 12.46 ? 197 ARG C CB  1 
ATOM   7246  C CG  . ARG C 1 198 ? -36.759 -3.679  -53.507 1.00 14.76 ? 197 ARG C CG  1 
ATOM   7247  C CD  . ARG C 1 198 ? -36.106 -4.866  -52.881 1.00 15.91 ? 197 ARG C CD  1 
ATOM   7248  N NE  . ARG C 1 198 ? -35.551 -4.464  -51.598 1.00 17.02 ? 197 ARG C NE  1 
ATOM   7249  C CZ  . ARG C 1 198 ? -35.047 -5.297  -50.709 1.00 17.61 ? 197 ARG C CZ  1 
ATOM   7250  N NH1 . ARG C 1 198 ? -35.040 -6.593  -50.958 1.00 18.20 ? 197 ARG C NH1 1 
ATOM   7251  N NH2 . ARG C 1 198 ? -34.559 -4.839  -49.564 1.00 16.51 ? 197 ARG C NH2 1 
ATOM   7252  N N   . PRO C 1 199 ? -37.780 -1.696  -57.684 1.00 12.77 ? 198 PRO C N   1 
ATOM   7253  C CA  . PRO C 1 199 ? -37.671 -1.673  -59.141 1.00 12.90 ? 198 PRO C CA  1 
ATOM   7254  C C   . PRO C 1 199 ? -36.498 -2.488  -59.737 1.00 13.38 ? 198 PRO C C   1 
ATOM   7255  O O   . PRO C 1 199 ? -36.617 -2.998  -60.861 1.00 11.92 ? 198 PRO C O   1 
ATOM   7256  C CB  . PRO C 1 199 ? -37.525 -0.182  -59.444 1.00 12.74 ? 198 PRO C CB  1 
ATOM   7257  C CG  . PRO C 1 199 ? -38.189 0.486   -58.282 1.00 12.00 ? 198 PRO C CG  1 
ATOM   7258  C CD  . PRO C 1 199 ? -37.874 -0.337  -57.132 1.00 12.94 ? 198 PRO C CD  1 
ATOM   7259  N N   . LEU C 1 200 ? -35.393 -2.597  -59.001 1.00 13.93 ? 199 LEU C N   1 
ATOM   7260  C CA  . LEU C 1 200 ? -34.227 -3.300  -59.502 1.00 14.62 ? 199 LEU C CA  1 
ATOM   7261  C C   . LEU C 1 200 ? -34.515 -4.804  -59.522 1.00 15.79 ? 199 LEU C C   1 
ATOM   7262  O O   . LEU C 1 200 ? -34.079 -5.501  -60.445 1.00 16.93 ? 199 LEU C O   1 
ATOM   7263  C CB  . LEU C 1 200 ? -32.978 -2.966  -58.686 1.00 14.94 ? 199 LEU C CB  1 
ATOM   7264  C CG  . LEU C 1 200 ? -32.418 -1.546  -58.752 1.00 13.85 ? 199 LEU C CG  1 
ATOM   7265  C CD1 . LEU C 1 200 ? -31.309 -1.376  -57.694 1.00 14.81 ? 199 LEU C CD1 1 
ATOM   7266  C CD2 . LEU C 1 200 ? -31.939 -1.198  -60.126 1.00 13.14 ? 199 LEU C CD2 1 
ATOM   7267  N N   . ALA C 1 201 ? -35.292 -5.292  -58.557 1.00 16.15 ? 200 ALA C N   1 
ATOM   7268  C CA  . ALA C 1 201 ? -35.704 -6.705  -58.535 1.00 16.58 ? 200 ALA C CA  1 
ATOM   7269  C C   . ALA C 1 201 ? -36.689 -7.058  -59.648 1.00 17.21 ? 200 ALA C C   1 
ATOM   7270  O O   . ALA C 1 201 ? -36.896 -8.251  -59.951 1.00 18.51 ? 200 ALA C O   1 
ATOM   7271  C CB  . ALA C 1 201 ? -36.293 -7.053  -57.198 1.00 16.38 ? 200 ALA C CB  1 
ATOM   7272  N N   . LEU C 1 202 ? -37.302 -6.032  -60.239 1.00 16.87 ? 201 LEU C N   1 
ATOM   7273  C CA  . LEU C 1 202 ? -38.315 -6.172  -61.287 1.00 16.63 ? 201 LEU C CA  1 
ATOM   7274  C C   . LEU C 1 202 ? -37.773 -5.824  -62.649 1.00 16.40 ? 201 LEU C C   1 
ATOM   7275  O O   . LEU C 1 202 ? -38.542 -5.783  -63.599 1.00 16.84 ? 201 LEU C O   1 
ATOM   7276  C CB  . LEU C 1 202 ? -39.535 -5.263  -60.989 1.00 16.30 ? 201 LEU C CB  1 
ATOM   7277  C CG  . LEU C 1 202 ? -40.223 -5.463  -59.633 1.00 16.95 ? 201 LEU C CG  1 
ATOM   7278  C CD1 . LEU C 1 202 ? -41.103 -4.260  -59.239 1.00 14.94 ? 201 LEU C CD1 1 
ATOM   7279  C CD2 . LEU C 1 202 ? -41.037 -6.757  -59.643 1.00 16.34 ? 201 LEU C CD2 1 
ATOM   7280  N N   . GLY C 1 203 ? -36.460 -5.564  -62.749 1.00 15.99 ? 202 GLY C N   1 
ATOM   7281  C CA  . GLY C 1 203 ? -35.776 -5.384  -64.031 1.00 16.03 ? 202 GLY C CA  1 
ATOM   7282  C C   . GLY C 1 203 ? -35.432 -3.966  -64.439 1.00 15.90 ? 202 GLY C C   1 
ATOM   7283  O O   . GLY C 1 203 ? -34.940 -3.747  -65.546 1.00 16.26 ? 202 GLY C O   1 
ATOM   7284  N N   . ALA C 1 204 ? -35.701 -2.979  -63.575 1.00 15.38 ? 203 ALA C N   1 
ATOM   7285  C CA  . ALA C 1 204 ? -35.229 -1.616  -63.850 1.00 14.54 ? 203 ALA C CA  1 
ATOM   7286  C C   . ALA C 1 204 ? -33.714 -1.598  -63.760 1.00 14.11 ? 203 ALA C C   1 
ATOM   7287  O O   . ALA C 1 204 ? -33.113 -2.398  -63.053 1.00 14.19 ? 203 ALA C O   1 
ATOM   7288  C CB  . ALA C 1 204 ? -35.831 -0.604  -62.887 1.00 14.13 ? 203 ALA C CB  1 
ATOM   7289  N N   . ASP C 1 205 ? -33.095 -0.668  -64.468 1.00 14.84 ? 204 ASP C N   1 
ATOM   7290  C CA  . ASP C 1 205 ? -31.633 -0.491  -64.403 1.00 15.28 ? 204 ASP C CA  1 
ATOM   7291  C C   . ASP C 1 205 ? -31.225 0.432   -63.245 1.00 15.01 ? 204 ASP C C   1 
ATOM   7292  O O   . ASP C 1 205 ? -30.152 0.270   -62.640 1.00 14.42 ? 204 ASP C O   1 
ATOM   7293  C CB  . ASP C 1 205 ? -31.139 0.096   -65.717 1.00 15.15 ? 204 ASP C CB  1 
ATOM   7294  C CG  . ASP C 1 205 ? -31.425 -0.807  -66.893 1.00 17.23 ? 204 ASP C CG  1 
ATOM   7295  O OD1 . ASP C 1 205 ? -31.028 -1.983  -66.797 1.00 21.34 ? 204 ASP C OD1 1 
ATOM   7296  O OD2 . ASP C 1 205 ? -32.059 -0.363  -67.874 1.00 17.00 ? 204 ASP C OD2 1 
ATOM   7297  N N   . ILE C 1 206 ? -32.099 1.408   -62.982 1.00 14.95 ? 205 ILE C N   1 
ATOM   7298  C CA  . ILE C 1 206 ? -31.926 2.400   -61.921 1.00 13.85 ? 205 ILE C CA  1 
ATOM   7299  C C   . ILE C 1 206 ? -33.219 2.541   -61.115 1.00 14.12 ? 205 ILE C C   1 
ATOM   7300  O O   . ILE C 1 206 ? -34.330 2.637   -61.675 1.00 14.39 ? 205 ILE C O   1 
ATOM   7301  C CB  . ILE C 1 206 ? -31.567 3.781   -62.489 1.00 13.75 ? 205 ILE C CB  1 
ATOM   7302  C CG1 . ILE C 1 206 ? -30.181 3.758   -63.174 1.00 14.00 ? 205 ILE C CG1 1 
ATOM   7303  C CG2 . ILE C 1 206 ? -31.643 4.860   -61.396 1.00 13.79 ? 205 ILE C CG2 1 
ATOM   7304  C CD1 . ILE C 1 206 ? -29.856 5.018   -64.008 1.00 12.43 ? 205 ILE C CD1 1 
ATOM   7305  N N   . SER C 1 207 ? -33.050 2.574   -59.797 1.00 13.84 ? 206 SER C N   1 
ATOM   7306  C CA  . SER C 1 207 ? -34.102 2.959   -58.874 1.00 13.58 ? 206 SER C CA  1 
ATOM   7307  C C   . SER C 1 207 ? -33.716 4.322   -58.274 1.00 12.56 ? 206 SER C C   1 
ATOM   7308  O O   . SER C 1 207 ? -32.707 4.422   -57.579 1.00 13.00 ? 206 SER C O   1 
ATOM   7309  C CB  . SER C 1 207 ? -34.267 1.886   -57.797 1.00 13.63 ? 206 SER C CB  1 
ATOM   7310  O OG  . SER C 1 207 ? -35.285 2.247   -56.876 1.00 15.38 ? 206 SER C OG  1 
ATOM   7311  N N   . MET C 1 208 ? -34.497 5.356   -58.585 1.00 10.81 ? 207 MET C N   1 
ATOM   7312  C CA  . MET C 1 208 ? -34.230 6.722   -58.162 1.00 11.29 ? 207 MET C CA  1 
ATOM   7313  C C   . MET C 1 208 ? -35.210 7.228   -57.090 1.00 10.69 ? 207 MET C C   1 
ATOM   7314  O O   . MET C 1 208 ? -36.370 6.839   -57.069 1.00 10.93 ? 207 MET C O   1 
ATOM   7315  C CB  . MET C 1 208 ? -34.244 7.621   -59.400 1.00 10.82 ? 207 MET C CB  1 
ATOM   7316  C CG  . MET C 1 208 ? -34.087 9.097   -59.129 1.00 12.68 ? 207 MET C CG  1 
ATOM   7317  S SD  . MET C 1 208 ? -35.703 9.804   -58.995 1.00 12.26 ? 207 MET C SD  1 
ATOM   7318  C CE  . MET C 1 208 ? -35.289 11.528  -58.725 1.00 10.91 ? 207 MET C CE  1 
ATOM   7319  N N   . TYR C 1 209 ? -34.735 8.110   -56.207 1.00 11.25 ? 208 TYR C N   1 
ATOM   7320  C CA  . TYR C 1 209 ? -35.589 8.757   -55.203 1.00 10.82 ? 208 TYR C CA  1 
ATOM   7321  C C   . TYR C 1 209 ? -35.352 10.250  -55.102 1.00 10.88 ? 208 TYR C C   1 
ATOM   7322  O O   . TYR C 1 209 ? -34.196 10.724  -55.164 1.00 10.39 ? 208 TYR C O   1 
ATOM   7323  C CB  . TYR C 1 209 ? -35.334 8.184   -53.804 1.00 11.50 ? 208 TYR C CB  1 
ATOM   7324  C CG  . TYR C 1 209 ? -35.538 6.729   -53.747 1.00 9.80  ? 208 TYR C CG  1 
ATOM   7325  C CD1 . TYR C 1 209 ? -34.499 5.857   -54.047 1.00 10.08 ? 208 TYR C CD1 1 
ATOM   7326  C CD2 . TYR C 1 209 ? -36.782 6.207   -53.454 1.00 10.57 ? 208 TYR C CD2 1 
ATOM   7327  C CE1 . TYR C 1 209 ? -34.693 4.482   -54.013 1.00 11.16 ? 208 TYR C CE1 1 
ATOM   7328  C CE2 . TYR C 1 209 ? -36.991 4.847   -53.416 1.00 10.59 ? 208 TYR C CE2 1 
ATOM   7329  C CZ  . TYR C 1 209 ? -35.952 3.981   -53.697 1.00 10.81 ? 208 TYR C CZ  1 
ATOM   7330  O OH  . TYR C 1 209 ? -36.180 2.613   -53.680 1.00 9.85  ? 208 TYR C OH  1 
ATOM   7331  N N   . SER C 1 210 ? -36.448 10.981  -54.960 1.00 9.86  ? 209 SER C N   1 
ATOM   7332  C CA  . SER C 1 210 ? -36.397 12.213  -54.192 1.00 10.04 ? 209 SER C CA  1 
ATOM   7333  C C   . SER C 1 210 ? -36.442 11.767  -52.742 1.00 9.05  ? 209 SER C C   1 
ATOM   7334  O O   . SER C 1 210 ? -37.498 11.358  -52.248 1.00 8.85  ? 209 SER C O   1 
ATOM   7335  C CB  . SER C 1 210 ? -37.583 13.111  -54.473 1.00 9.84  ? 209 SER C CB  1 
ATOM   7336  O OG  . SER C 1 210 ? -37.462 14.267  -53.705 1.00 10.62 ? 209 SER C OG  1 
ATOM   7337  N N   . ALA C 1 211 ? -35.291 11.808  -52.077 1.00 8.86  ? 210 ALA C N   1 
ATOM   7338  C CA  . ALA C 1 211 ? -35.177 11.386  -50.673 1.00 8.87  ? 210 ALA C CA  1 
ATOM   7339  C C   . ALA C 1 211 ? -35.794 12.462  -49.768 1.00 8.48  ? 210 ALA C C   1 
ATOM   7340  O O   . ALA C 1 211 ? -36.082 12.218  -48.580 1.00 9.14  ? 210 ALA C O   1 
ATOM   7341  C CB  . ALA C 1 211 ? -33.687 11.147  -50.298 1.00 8.29  ? 210 ALA C CB  1 
ATOM   7342  N N   . THR C 1 212 ? -36.006 13.638  -50.351 1.00 8.09  ? 211 THR C N   1 
ATOM   7343  C CA  . THR C 1 212 ? -36.783 14.733  -49.746 1.00 7.30  ? 211 THR C CA  1 
ATOM   7344  C C   . THR C 1 212 ? -38.149 14.316  -49.202 1.00 8.02  ? 211 THR C C   1 
ATOM   7345  O O   . THR C 1 212 ? -38.703 14.949  -48.284 1.00 9.28  ? 211 THR C O   1 
ATOM   7346  C CB  . THR C 1 212 ? -37.003 15.834  -50.790 1.00 7.19  ? 211 THR C CB  1 
ATOM   7347  O OG1 . THR C 1 212 ? -35.740 16.138  -51.403 1.00 4.95  ? 211 THR C OG1 1 
ATOM   7348  C CG2 . THR C 1 212 ? -37.580 17.085  -50.155 1.00 6.10  ? 211 THR C CG2 1 
ATOM   7349  N N   . LYS C 1 213 ? -38.696 13.249  -49.758 1.00 8.65  ? 212 LYS C N   1 
ATOM   7350  C CA  . LYS C 1 213 ? -40.013 12.807  -49.399 1.00 9.02  ? 212 LYS C CA  1 
ATOM   7351  C C   . LYS C 1 213 ? -39.898 11.703  -48.354 1.00 9.40  ? 212 LYS C C   1 
ATOM   7352  O O   . LYS C 1 213 ? -39.455 11.965  -47.251 1.00 10.35 ? 212 LYS C O   1 
ATOM   7353  C CB  . LYS C 1 213 ? -40.813 12.414  -50.656 1.00 9.31  ? 212 LYS C CB  1 
ATOM   7354  C CG  . LYS C 1 213 ? -40.644 13.372  -51.893 1.00 8.86  ? 212 LYS C CG  1 
ATOM   7355  C CD  . LYS C 1 213 ? -40.901 14.813  -51.579 1.00 11.89 ? 212 LYS C CD  1 
ATOM   7356  C CE  . LYS C 1 213 ? -40.660 15.789  -52.740 1.00 11.01 ? 212 LYS C CE  1 
ATOM   7357  N NZ  . LYS C 1 213 ? -41.003 15.315  -54.111 1.00 15.62 ? 212 LYS C NZ  1 
ATOM   7358  N N   . TYR C 1 214 ? -40.301 10.487  -48.689 1.00 9.55  ? 213 TYR C N   1 
ATOM   7359  C CA  . TYR C 1 214 ? -40.390 9.423   -47.720 1.00 9.03  ? 213 TYR C CA  1 
ATOM   7360  C C   . TYR C 1 214 ? -39.046 8.908   -47.213 1.00 8.87  ? 213 TYR C C   1 
ATOM   7361  O O   . TYR C 1 214 ? -38.949 8.515   -46.046 1.00 8.49  ? 213 TYR C O   1 
ATOM   7362  C CB  . TYR C 1 214 ? -41.149 8.237   -48.318 1.00 9.81  ? 213 TYR C CB  1 
ATOM   7363  C CG  . TYR C 1 214 ? -42.656 8.345   -48.361 1.00 9.65  ? 213 TYR C CG  1 
ATOM   7364  C CD1 . TYR C 1 214 ? -43.331 8.380   -49.583 1.00 11.75 ? 213 TYR C CD1 1 
ATOM   7365  C CD2 . TYR C 1 214 ? -43.419 8.358   -47.188 1.00 11.00 ? 213 TYR C CD2 1 
ATOM   7366  C CE1 . TYR C 1 214 ? -44.710 8.468   -49.642 1.00 9.87  ? 213 TYR C CE1 1 
ATOM   7367  C CE2 . TYR C 1 214 ? -44.812 8.414   -47.243 1.00 9.95  ? 213 TYR C CE2 1 
ATOM   7368  C CZ  . TYR C 1 214 ? -45.446 8.473   -48.476 1.00 10.34 ? 213 TYR C CZ  1 
ATOM   7369  O OH  . TYR C 1 214 ? -46.817 8.538   -48.563 1.00 10.77 ? 213 TYR C OH  1 
ATOM   7370  N N   . MET C 1 215 ? -38.022 8.872   -48.062 1.00 8.05  ? 214 MET C N   1 
ATOM   7371  C CA  . MET C 1 215 ? -36.775 8.207   -47.652 1.00 8.99  ? 214 MET C CA  1 
ATOM   7372  C C   . MET C 1 215 ? -36.249 8.818   -46.342 1.00 8.81  ? 214 MET C C   1 
ATOM   7373  O O   . MET C 1 215 ? -36.091 8.114   -45.303 1.00 8.52  ? 214 MET C O   1 
ATOM   7374  C CB  . MET C 1 215 ? -35.736 8.218   -48.784 1.00 8.66  ? 214 MET C CB  1 
ATOM   7375  C CG  . MET C 1 215 ? -36.210 7.429   -49.983 1.00 11.34 ? 214 MET C CG  1 
ATOM   7376  S SD  . MET C 1 215 ? -36.274 5.661   -49.567 1.00 14.86 ? 214 MET C SD  1 
ATOM   7377  C CE  . MET C 1 215 ? -34.534 5.278   -49.796 1.00 9.43  ? 214 MET C CE  1 
ATOM   7378  N N   . ASN C 1 216 ? -36.060 10.129  -46.358 1.00 9.05  ? 215 ASN C N   1 
ATOM   7379  C CA  . ASN C 1 216 ? -35.757 10.865  -45.123 1.00 8.83  ? 215 ASN C CA  1 
ATOM   7380  C C   . ASN C 1 216 ? -36.958 10.927  -44.158 1.00 8.53  ? 215 ASN C C   1 
ATOM   7381  O O   . ASN C 1 216 ? -36.839 10.677  -42.946 1.00 9.49  ? 215 ASN C O   1 
ATOM   7382  C CB  . ASN C 1 216 ? -35.287 12.275  -45.458 1.00 8.48  ? 215 ASN C CB  1 
ATOM   7383  C CG  . ASN C 1 216 ? -34.880 13.065  -44.215 1.00 8.69  ? 215 ASN C CG  1 
ATOM   7384  O OD1 . ASN C 1 216 ? -33.984 12.647  -43.463 1.00 6.99  ? 215 ASN C OD1 1 
ATOM   7385  N ND2 . ASN C 1 216 ? -35.585 14.172  -43.953 1.00 8.43  ? 215 ASN C ND2 1 
ATOM   7386  N N   . GLY C 1 217 ? -38.101 11.325  -44.701 1.00 9.30  ? 216 GLY C N   1 
ATOM   7387  C CA  . GLY C 1 217 ? -39.379 11.291  -44.000 1.00 8.95  ? 216 GLY C CA  1 
ATOM   7388  C C   . GLY C 1 217 ? -39.624 12.288  -42.889 1.00 8.63  ? 216 GLY C C   1 
ATOM   7389  O O   . GLY C 1 217 ? -40.673 12.236  -42.229 1.00 8.73  ? 216 GLY C O   1 
ATOM   7390  N N   . HIS C 1 218 ? -38.697 13.220  -42.699 1.00 7.86  ? 217 HIS C N   1 
ATOM   7391  C CA  . HIS C 1 218 ? -38.759 14.167  -41.588 1.00 8.03  ? 217 HIS C CA  1 
ATOM   7392  C C   . HIS C 1 218 ? -38.788 15.637  -42.023 1.00 8.29  ? 217 HIS C C   1 
ATOM   7393  O O   . HIS C 1 218 ? -38.599 16.557  -41.186 1.00 8.04  ? 217 HIS C O   1 
ATOM   7394  C CB  . HIS C 1 218 ? -37.606 13.888  -40.629 1.00 8.69  ? 217 HIS C CB  1 
ATOM   7395  C CG  . HIS C 1 218 ? -37.789 12.622  -39.838 1.00 9.70  ? 217 HIS C CG  1 
ATOM   7396  N ND1 . HIS C 1 218 ? -37.561 11.371  -40.371 1.00 7.85  ? 217 HIS C ND1 1 
ATOM   7397  C CD2 . HIS C 1 218 ? -38.178 12.421  -38.556 1.00 10.53 ? 217 HIS C CD2 1 
ATOM   7398  C CE1 . HIS C 1 218 ? -37.819 10.454  -39.454 1.00 9.83  ? 217 HIS C CE1 1 
ATOM   7399  N NE2 . HIS C 1 218 ? -38.214 11.063  -38.347 1.00 11.30 ? 217 HIS C NE2 1 
ATOM   7400  N N   . SER C 1 219 ? -39.019 15.849  -43.318 1.00 8.35  ? 218 SER C N   1 
ATOM   7401  C CA  . SER C 1 219 ? -39.408 17.155  -43.879 1.00 9.09  ? 218 SER C CA  1 
ATOM   7402  C C   . SER C 1 219 ? -38.321 18.201  -43.649 1.00 9.51  ? 218 SER C C   1 
ATOM   7403  O O   . SER C 1 219 ? -38.613 19.403  -43.514 1.00 9.27  ? 218 SER C O   1 
ATOM   7404  C CB  . SER C 1 219 ? -40.743 17.615  -43.266 1.00 9.92  ? 218 SER C CB  1 
ATOM   7405  O OG  . SER C 1 219 ? -41.783 16.650  -43.464 1.00 10.58 ? 218 SER C OG  1 
ATOM   7406  N N   . ASP C 1 220 ? -37.062 17.738  -43.591 1.00 9.76  ? 219 ASP C N   1 
ATOM   7407  C CA  . ASP C 1 220 ? -35.965 18.618  -43.242 1.00 9.53  ? 219 ASP C CA  1 
ATOM   7408  C C   . ASP C 1 220 ? -34.654 18.382  -44.002 1.00 9.43  ? 219 ASP C C   1 
ATOM   7409  O O   . ASP C 1 220 ? -33.590 18.846  -43.570 1.00 10.30 ? 219 ASP C O   1 
ATOM   7410  C CB  . ASP C 1 220 ? -35.738 18.525  -41.729 1.00 9.37  ? 219 ASP C CB  1 
ATOM   7411  C CG  . ASP C 1 220 ? -35.250 17.162  -41.283 1.00 8.51  ? 219 ASP C CG  1 
ATOM   7412  O OD1 . ASP C 1 220 ? -34.882 17.057  -40.092 1.00 11.60 ? 219 ASP C OD1 1 
ATOM   7413  O OD2 . ASP C 1 220 ? -35.234 16.190  -42.074 1.00 5.60  ? 219 ASP C OD2 1 
ATOM   7414  N N   . VAL C 1 221 ? -34.735 17.638  -45.100 1.00 9.73  ? 220 VAL C N   1 
ATOM   7415  C CA  . VAL C 1 221 ? -33.611 17.346  -45.981 1.00 9.00  ? 220 VAL C CA  1 
ATOM   7416  C C   . VAL C 1 221 ? -34.130 17.295  -47.411 1.00 8.79  ? 220 VAL C C   1 
ATOM   7417  O O   . VAL C 1 221 ? -35.117 16.589  -47.687 1.00 9.22  ? 220 VAL C O   1 
ATOM   7418  C CB  . VAL C 1 221 ? -32.957 15.956  -45.675 1.00 9.57  ? 220 VAL C CB  1 
ATOM   7419  C CG1 . VAL C 1 221 ? -31.923 15.575  -46.771 1.00 7.61  ? 220 VAL C CG1 1 
ATOM   7420  C CG2 . VAL C 1 221 ? -32.338 15.909  -44.268 1.00 7.99  ? 220 VAL C CG2 1 
ATOM   7421  N N   . VAL C 1 222 ? -33.470 18.052  -48.296 1.00 8.23  ? 221 VAL C N   1 
ATOM   7422  C CA  . VAL C 1 222 ? -33.618 17.935  -49.751 1.00 8.49  ? 221 VAL C CA  1 
ATOM   7423  C C   . VAL C 1 222 ? -32.435 17.104  -50.258 1.00 9.13  ? 221 VAL C C   1 
ATOM   7424  O O   . VAL C 1 222 ? -31.290 17.446  -50.030 1.00 8.52  ? 221 VAL C O   1 
ATOM   7425  C CB  . VAL C 1 222 ? -33.675 19.311  -50.453 1.00 8.11  ? 221 VAL C CB  1 
ATOM   7426  C CG1 . VAL C 1 222 ? -33.786 19.181  -51.996 1.00 7.72  ? 221 VAL C CG1 1 
ATOM   7427  C CG2 . VAL C 1 222 ? -34.854 20.127  -49.916 1.00 6.38  ? 221 VAL C CG2 1 
ATOM   7428  N N   . MET C 1 223 ? -32.735 16.019  -50.958 1.00 9.00  ? 222 MET C N   1 
ATOM   7429  C CA  . MET C 1 223 ? -31.738 15.065  -51.367 1.00 9.15  ? 222 MET C CA  1 
ATOM   7430  C C   . MET C 1 223 ? -32.319 14.140  -52.430 1.00 8.81  ? 222 MET C C   1 
ATOM   7431  O O   . MET C 1 223 ? -33.535 13.856  -52.441 1.00 8.00  ? 222 MET C O   1 
ATOM   7432  C CB  . MET C 1 223 ? -31.334 14.227  -50.163 1.00 9.17  ? 222 MET C CB  1 
ATOM   7433  C CG  . MET C 1 223 ? -30.300 13.151  -50.462 1.00 10.95 ? 222 MET C CG  1 
ATOM   7434  S SD  . MET C 1 223 ? -29.750 12.312  -48.974 1.00 14.64 ? 222 MET C SD  1 
ATOM   7435  C CE  . MET C 1 223 ? -28.888 13.663  -48.166 1.00 9.80  ? 222 MET C CE  1 
ATOM   7436  N N   . GLY C 1 224 ? -31.428 13.640  -53.298 1.00 8.64  ? 223 GLY C N   1 
ATOM   7437  C CA  . GLY C 1 224 ? -31.760 12.605  -54.253 1.00 8.24  ? 223 GLY C CA  1 
ATOM   7438  C C   . GLY C 1 224 ? -30.874 11.392  -54.084 1.00 8.56  ? 223 GLY C C   1 
ATOM   7439  O O   . GLY C 1 224 ? -29.756 11.479  -53.531 1.00 9.33  ? 223 GLY C O   1 
ATOM   7440  N N   . LEU C 1 225 ? -31.363 10.269  -54.573 1.00 7.50  ? 224 LEU C N   1 
ATOM   7441  C CA  . LEU C 1 225 ? -30.682 9.006   -54.429 1.00 8.78  ? 224 LEU C CA  1 
ATOM   7442  C C   . LEU C 1 225 ? -30.932 8.139   -55.682 1.00 9.27  ? 224 LEU C C   1 
ATOM   7443  O O   . LEU C 1 225 ? -32.040 8.101   -56.187 1.00 10.64 ? 224 LEU C O   1 
ATOM   7444  C CB  . LEU C 1 225 ? -31.171 8.248   -53.195 1.00 7.69  ? 224 LEU C CB  1 
ATOM   7445  C CG  . LEU C 1 225 ? -30.999 8.819   -51.777 1.00 9.16  ? 224 LEU C CG  1 
ATOM   7446  C CD1 . LEU C 1 225 ? -31.913 8.064   -50.795 1.00 7.80  ? 224 LEU C CD1 1 
ATOM   7447  C CD2 . LEU C 1 225 ? -29.534 8.830   -51.316 1.00 7.99  ? 224 LEU C CD2 1 
ATOM   7448  N N   . VAL C 1 226 ? -29.892 7.410   -56.098 1.00 9.48  ? 225 VAL C N   1 
ATOM   7449  C CA  . VAL C 1 226 ? -29.867 6.616   -57.297 1.00 9.31  ? 225 VAL C CA  1 
ATOM   7450  C C   . VAL C 1 226 ? -29.145 5.284   -57.022 1.00 10.36 ? 225 VAL C C   1 
ATOM   7451  O O   . VAL C 1 226 ? -27.942 5.274   -56.700 1.00 9.52  ? 225 VAL C O   1 
ATOM   7452  C CB  . VAL C 1 226 ? -29.135 7.374   -58.418 1.00 9.59  ? 225 VAL C CB  1 
ATOM   7453  C CG1 . VAL C 1 226 ? -28.974 6.473   -59.704 1.00 10.51 ? 225 VAL C CG1 1 
ATOM   7454  C CG2 . VAL C 1 226 ? -29.840 8.658   -58.758 1.00 5.98  ? 225 VAL C CG2 1 
ATOM   7455  N N   . SER C 1 227 ? -29.886 4.180   -57.143 1.00 10.64 ? 226 SER C N   1 
ATOM   7456  C CA  . SER C 1 227 ? -29.358 2.854   -56.890 1.00 11.80 ? 226 SER C CA  1 
ATOM   7457  C C   . SER C 1 227 ? -29.268 2.103   -58.213 1.00 12.43 ? 226 SER C C   1 
ATOM   7458  O O   . SER C 1 227 ? -30.143 2.242   -59.099 1.00 12.09 ? 226 SER C O   1 
ATOM   7459  C CB  . SER C 1 227 ? -30.246 2.096   -55.918 1.00 11.90 ? 226 SER C CB  1 
ATOM   7460  O OG  . SER C 1 227 ? -30.149 2.641   -54.622 1.00 12.69 ? 226 SER C OG  1 
ATOM   7461  N N   . VAL C 1 228 ? -28.194 1.338   -58.341 1.00 12.59 ? 227 VAL C N   1 
ATOM   7462  C CA  . VAL C 1 228 ? -27.822 0.717   -59.574 1.00 13.47 ? 227 VAL C CA  1 
ATOM   7463  C C   . VAL C 1 228 ? -27.077 -0.610  -59.281 1.00 14.10 ? 227 VAL C C   1 
ATOM   7464  O O   . VAL C 1 228 ? -26.408 -0.758  -58.252 1.00 13.80 ? 227 VAL C O   1 
ATOM   7465  C CB  . VAL C 1 228 ? -26.965 1.742   -60.409 1.00 14.06 ? 227 VAL C CB  1 
ATOM   7466  C CG1 . VAL C 1 228 ? -25.602 1.951   -59.748 1.00 13.74 ? 227 VAL C CG1 1 
ATOM   7467  C CG2 . VAL C 1 228 ? -26.834 1.344   -61.857 1.00 12.30 ? 227 VAL C CG2 1 
ATOM   7468  N N   . ASN C 1 229 ? -27.219 -1.579  -60.188 1.00 14.61 ? 228 ASN C N   1 
ATOM   7469  C CA  . ASN C 1 229 ? -26.462 -2.847  -60.112 1.00 15.22 ? 228 ASN C CA  1 
ATOM   7470  C C   . ASN C 1 229 ? -25.371 -2.951  -61.192 1.00 16.03 ? 228 ASN C C   1 
ATOM   7471  O O   . ASN C 1 229 ? -24.261 -3.425  -60.916 1.00 15.47 ? 228 ASN C O   1 
ATOM   7472  C CB  . ASN C 1 229 ? -27.403 -4.050  -60.226 1.00 15.67 ? 228 ASN C CB  1 
ATOM   7473  C CG  . ASN C 1 229 ? -28.239 -4.276  -58.971 1.00 15.88 ? 228 ASN C CG  1 
ATOM   7474  O OD1 . ASN C 1 229 ? -27.764 -4.101  -57.840 1.00 15.27 ? 228 ASN C OD1 1 
ATOM   7475  N ND2 . ASN C 1 229 ? -29.495 -4.695  -59.172 1.00 14.24 ? 228 ASN C ND2 1 
ATOM   7476  N N   . CYS C 1 230 ? -25.678 -2.518  -62.410 1.00 17.62 ? 229 CYS C N   1 
ATOM   7477  C CA  . CYS C 1 230 ? -24.733 -2.631  -63.526 1.00 18.72 ? 229 CYS C CA  1 
ATOM   7478  C C   . CYS C 1 230 ? -23.431 -1.856  -63.291 1.00 18.41 ? 229 CYS C C   1 
ATOM   7479  O O   . CYS C 1 230 ? -23.453 -0.665  -63.040 1.00 18.63 ? 229 CYS C O   1 
ATOM   7480  C CB  . CYS C 1 230 ? -25.386 -2.170  -64.837 1.00 18.68 ? 229 CYS C CB  1 
ATOM   7481  S SG  . CYS C 1 230 ? -24.316 -2.267  -66.321 1.00 21.68 ? 229 CYS C SG  1 
ATOM   7482  N N   . GLU C 1 231 ? -22.301 -2.557  -63.373 1.00 18.92 ? 230 GLU C N   1 
ATOM   7483  C CA  . GLU C 1 231 ? -20.963 -1.951  -63.224 1.00 18.99 ? 230 GLU C CA  1 
ATOM   7484  C C   . GLU C 1 231 ? -20.706 -0.764  -64.114 1.00 18.25 ? 230 GLU C C   1 
ATOM   7485  O O   . GLU C 1 231 ? -20.236 0.298   -63.683 1.00 17.42 ? 230 GLU C O   1 
ATOM   7486  C CB  . GLU C 1 231 ? -19.904 -2.985  -63.590 1.00 19.91 ? 230 GLU C CB  1 
ATOM   7487  C CG  . GLU C 1 231 ? -19.749 -4.039  -62.554 1.00 21.47 ? 230 GLU C CG  1 
ATOM   7488  C CD  . GLU C 1 231 ? -19.364 -3.444  -61.243 1.00 22.20 ? 230 GLU C CD  1 
ATOM   7489  O OE1 . GLU C 1 231 ? -18.512 -2.531  -61.246 1.00 23.35 ? 230 GLU C OE1 1 
ATOM   7490  O OE2 . GLU C 1 231 ? -19.902 -3.897  -60.221 1.00 26.43 ? 230 GLU C OE2 1 
ATOM   7491  N N   . SER C 1 232 ? -20.973 -0.958  -65.391 1.00 18.12 ? 231 SER C N   1 
ATOM   7492  C CA  . SER C 1 232 ? -20.704 0.093   -66.370 1.00 17.87 ? 231 SER C CA  1 
ATOM   7493  C C   . SER C 1 232 ? -21.538 1.340   -66.058 1.00 16.69 ? 231 SER C C   1 
ATOM   7494  O O   . SER C 1 232 ? -21.037 2.455   -66.024 1.00 15.43 ? 231 SER C O   1 
ATOM   7495  C CB  . SER C 1 232 ? -21.021 -0.402  -67.776 1.00 18.26 ? 231 SER C CB  1 
ATOM   7496  O OG  . SER C 1 232 ? -20.775 0.655   -68.692 1.00 21.71 ? 231 SER C OG  1 
ATOM   7497  N N   . LEU C 1 233 ? -22.808 1.118   -65.788 1.00 16.55 ? 232 LEU C N   1 
ATOM   7498  C CA  . LEU C 1 233 ? -23.719 2.208   -65.440 1.00 16.62 ? 232 LEU C CA  1 
ATOM   7499  C C   . LEU C 1 233 ? -23.302 2.896   -64.126 1.00 15.81 ? 232 LEU C C   1 
ATOM   7500  O O   . LEU C 1 233 ? -23.362 4.120   -63.992 1.00 16.64 ? 232 LEU C O   1 
ATOM   7501  C CB  . LEU C 1 233 ? -25.140 1.653   -65.364 1.00 16.86 ? 232 LEU C CB  1 
ATOM   7502  C CG  . LEU C 1 233 ? -26.330 2.603   -65.451 1.00 19.12 ? 232 LEU C CG  1 
ATOM   7503  C CD1 . LEU C 1 233 ? -26.199 3.587   -66.622 1.00 19.85 ? 232 LEU C CD1 1 
ATOM   7504  C CD2 . LEU C 1 233 ? -27.633 1.767   -65.597 1.00 17.55 ? 232 LEU C CD2 1 
ATOM   7505  N N   . HIS C 1 234 ? -22.864 2.119   -63.156 1.00 15.36 ? 233 HIS C N   1 
ATOM   7506  C CA  . HIS C 1 234 ? -22.396 2.688   -61.903 1.00 15.16 ? 233 HIS C CA  1 
ATOM   7507  C C   . HIS C 1 234 ? -21.206 3.603   -62.127 1.00 15.44 ? 233 HIS C C   1 
ATOM   7508  O O   . HIS C 1 234 ? -21.203 4.752   -61.698 1.00 15.64 ? 233 HIS C O   1 
ATOM   7509  C CB  . HIS C 1 234 ? -22.031 1.607   -60.921 1.00 14.95 ? 233 HIS C CB  1 
ATOM   7510  C CG  . HIS C 1 234 ? -21.399 2.138   -59.681 1.00 15.50 ? 233 HIS C CG  1 
ATOM   7511  N ND1 . HIS C 1 234 ? -20.179 1.703   -59.221 1.00 14.52 ? 233 HIS C ND1 1 
ATOM   7512  C CD2 . HIS C 1 234 ? -21.796 3.113   -58.828 1.00 15.46 ? 233 HIS C CD2 1 
ATOM   7513  C CE1 . HIS C 1 234 ? -19.860 2.366   -58.124 1.00 16.29 ? 233 HIS C CE1 1 
ATOM   7514  N NE2 . HIS C 1 234 ? -20.833 3.215   -57.855 1.00 14.18 ? 233 HIS C NE2 1 
ATOM   7515  N N   . ASN C 1 235 ? -20.204 3.092   -62.823 1.00 16.19 ? 234 ASN C N   1 
ATOM   7516  C CA  . ASN C 1 235 ? -19.021 3.876   -63.169 1.00 16.79 ? 234 ASN C CA  1 
ATOM   7517  C C   . ASN C 1 235 ? -19.331 5.191   -63.904 1.00 16.09 ? 234 ASN C C   1 
ATOM   7518  O O   . ASN C 1 235 ? -18.774 6.237   -63.577 1.00 15.55 ? 234 ASN C O   1 
ATOM   7519  C CB  . ASN C 1 235 ? -18.063 3.009   -63.986 1.00 16.93 ? 234 ASN C CB  1 
ATOM   7520  C CG  . ASN C 1 235 ? -17.550 1.803   -63.209 1.00 19.21 ? 234 ASN C CG  1 
ATOM   7521  O OD1 . ASN C 1 235 ? -17.608 1.761   -61.981 1.00 19.98 ? 234 ASN C OD1 1 
ATOM   7522  N ND2 . ASN C 1 235 ? -17.059 0.796   -63.940 1.00 22.37 ? 234 ASN C ND2 1 
ATOM   7523  N N   . ARG C 1 236 ? -20.244 5.144   -64.871 1.00 15.46 ? 235 ARG C N   1 
ATOM   7524  C CA  . ARG C 1 236 ? -20.649 6.347   -65.577 1.00 14.84 ? 235 ARG C CA  1 
ATOM   7525  C C   . ARG C 1 236 ? -21.351 7.321   -64.621 1.00 14.35 ? 235 ARG C C   1 
ATOM   7526  O O   . ARG C 1 236 ? -21.116 8.521   -64.677 1.00 13.04 ? 235 ARG C O   1 
ATOM   7527  C CB  . ARG C 1 236 ? -21.564 6.017   -66.768 1.00 15.12 ? 235 ARG C CB  1 
ATOM   7528  C CG  . ARG C 1 236 ? -20.878 5.228   -67.893 1.00 16.09 ? 235 ARG C CG  1 
ATOM   7529  C CD  . ARG C 1 236 ? -21.885 4.590   -68.849 1.00 16.25 ? 235 ARG C CD  1 
ATOM   7530  N NE  . ARG C 1 236 ? -22.727 5.557   -69.555 1.00 17.47 ? 235 ARG C NE  1 
ATOM   7531  C CZ  . ARG C 1 236 ? -23.841 5.247   -70.214 1.00 16.53 ? 235 ARG C CZ  1 
ATOM   7532  N NH1 . ARG C 1 236 ? -24.273 4.003   -70.258 1.00 18.79 ? 235 ARG C NH1 1 
ATOM   7533  N NH2 . ARG C 1 236 ? -24.526 6.190   -70.837 1.00 18.26 ? 235 ARG C NH2 1 
ATOM   7534  N N   . LEU C 1 237 ? -22.207 6.796   -63.745 1.00 13.33 ? 236 LEU C N   1 
ATOM   7535  C CA  . LEU C 1 237 ? -22.887 7.639   -62.775 1.00 12.63 ? 236 LEU C CA  1 
ATOM   7536  C C   . LEU C 1 237 ? -21.924 8.236   -61.770 1.00 12.74 ? 236 LEU C C   1 
ATOM   7537  O O   . LEU C 1 237 ? -22.001 9.437   -61.465 1.00 11.98 ? 236 LEU C O   1 
ATOM   7538  C CB  . LEU C 1 237 ? -23.973 6.849   -62.055 1.00 12.82 ? 236 LEU C CB  1 
ATOM   7539  C CG  . LEU C 1 237 ? -25.269 6.684   -62.856 1.00 11.23 ? 236 LEU C CG  1 
ATOM   7540  C CD1 . LEU C 1 237 ? -26.052 5.496   -62.277 1.00 11.89 ? 236 LEU C CD1 1 
ATOM   7541  C CD2 . LEU C 1 237 ? -26.080 8.002   -62.852 1.00 10.89 ? 236 LEU C CD2 1 
ATOM   7542  N N   . ARG C 1 238 ? -21.015 7.404   -61.264 1.00 13.06 ? 237 ARG C N   1 
ATOM   7543  C CA  . ARG C 1 238 ? -20.013 7.847   -60.274 1.00 13.90 ? 237 ARG C CA  1 
ATOM   7544  C C   . ARG C 1 238 ? -19.163 8.981   -60.800 1.00 13.16 ? 237 ARG C C   1 
ATOM   7545  O O   . ARG C 1 238 ? -18.884 9.943   -60.079 1.00 13.68 ? 237 ARG C O   1 
ATOM   7546  C CB  . ARG C 1 238 ? -19.079 6.710   -59.902 1.00 14.82 ? 237 ARG C CB  1 
ATOM   7547  C CG  . ARG C 1 238 ? -18.604 6.779   -58.509 1.00 16.03 ? 237 ARG C CG  1 
ATOM   7548  C CD  . ARG C 1 238 ? -19.622 5.979   -57.687 1.00 19.36 ? 237 ARG C CD  1 
ATOM   7549  N NE  . ARG C 1 238 ? -20.057 6.743   -56.581 1.00 19.20 ? 237 ARG C NE  1 
ATOM   7550  C CZ  . ARG C 1 238 ? -20.880 6.325   -55.625 1.00 18.34 ? 237 ARG C CZ  1 
ATOM   7551  N NH1 . ARG C 1 238 ? -21.411 5.086   -55.561 1.00 15.93 ? 237 ARG C NH1 1 
ATOM   7552  N NH2 . ARG C 1 238 ? -21.139 7.197   -54.696 1.00 17.49 ? 237 ARG C NH2 1 
ATOM   7553  N N   . PHE C 1 239 ? -18.755 8.860   -62.063 1.00 12.59 ? 238 PHE C N   1 
ATOM   7554  C CA  . PHE C 1 239 ? -17.999 9.910   -62.744 1.00 11.78 ? 238 PHE C CA  1 
ATOM   7555  C C   . PHE C 1 239 ? -18.770 11.244  -62.716 1.00 11.53 ? 238 PHE C C   1 
ATOM   7556  O O   . PHE C 1 239 ? -18.218 12.302  -62.406 1.00 10.19 ? 238 PHE C O   1 
ATOM   7557  C CB  . PHE C 1 239 ? -17.701 9.495   -64.183 1.00 12.21 ? 238 PHE C CB  1 
ATOM   7558  C CG  . PHE C 1 239 ? -16.926 10.517  -64.953 1.00 12.21 ? 238 PHE C CG  1 
ATOM   7559  C CD1 . PHE C 1 239 ? -15.543 10.592  -64.824 1.00 12.83 ? 238 PHE C CD1 1 
ATOM   7560  C CD2 . PHE C 1 239 ? -17.578 11.441  -65.777 1.00 11.22 ? 238 PHE C CD2 1 
ATOM   7561  C CE1 . PHE C 1 239 ? -14.814 11.548  -65.540 1.00 12.40 ? 238 PHE C CE1 1 
ATOM   7562  C CE2 . PHE C 1 239 ? -16.868 12.396  -66.464 1.00 10.72 ? 238 PHE C CE2 1 
ATOM   7563  C CZ  . PHE C 1 239 ? -15.487 12.444  -66.367 1.00 11.27 ? 238 PHE C CZ  1 
ATOM   7564  N N   . LEU C 1 240 ? -20.066 11.174  -63.012 1.00 11.35 ? 239 LEU C N   1 
ATOM   7565  C CA  . LEU C 1 240 ? -20.899 12.368  -63.085 1.00 11.62 ? 239 LEU C CA  1 
ATOM   7566  C C   . LEU C 1 240 ? -21.258 12.917  -61.711 1.00 11.73 ? 239 LEU C C   1 
ATOM   7567  O O   . LEU C 1 240 ? -21.452 14.108  -61.569 1.00 11.96 ? 239 LEU C O   1 
ATOM   7568  C CB  . LEU C 1 240 ? -22.165 12.084  -63.906 1.00 12.19 ? 239 LEU C CB  1 
ATOM   7569  C CG  . LEU C 1 240 ? -21.903 11.858  -65.405 1.00 13.30 ? 239 LEU C CG  1 
ATOM   7570  C CD1 . LEU C 1 240 ? -23.106 11.172  -66.096 1.00 15.80 ? 239 LEU C CD1 1 
ATOM   7571  C CD2 . LEU C 1 240 ? -21.526 13.180  -66.114 1.00 14.29 ? 239 LEU C CD2 1 
ATOM   7572  N N   . GLN C 1 241 ? -21.346 12.060  -60.699 1.00 12.06 ? 240 GLN C N   1 
ATOM   7573  C CA  . GLN C 1 241 ? -21.532 12.548  -59.331 1.00 12.52 ? 240 GLN C CA  1 
ATOM   7574  C C   . GLN C 1 241 ? -20.346 13.479  -58.974 1.00 13.24 ? 240 GLN C C   1 
ATOM   7575  O O   . GLN C 1 241 ? -20.542 14.591  -58.462 1.00 12.27 ? 240 GLN C O   1 
ATOM   7576  C CB  . GLN C 1 241 ? -21.676 11.382  -58.343 1.00 12.30 ? 240 GLN C CB  1 
ATOM   7577  C CG  . GLN C 1 241 ? -21.920 11.832  -56.901 1.00 11.49 ? 240 GLN C CG  1 
ATOM   7578  C CD  . GLN C 1 241 ? -21.723 10.734  -55.884 1.00 12.99 ? 240 GLN C CD  1 
ATOM   7579  O OE1 . GLN C 1 241 ? -20.733 10.007  -55.922 1.00 13.38 ? 240 GLN C OE1 1 
ATOM   7580  N NE2 . GLN C 1 241 ? -22.667 10.609  -54.954 1.00 8.06  ? 240 GLN C NE2 1 
ATOM   7581  N N   . ASN C 1 242 ? -19.120 13.041  -59.292 1.00 12.75 ? 241 ASN C N   1 
ATOM   7582  C CA  . ASN C 1 242 ? -17.945 13.840  -58.988 1.00 13.61 ? 241 ASN C CA  1 
ATOM   7583  C C   . ASN C 1 242 ? -17.818 15.051  -59.911 1.00 13.21 ? 241 ASN C C   1 
ATOM   7584  O O   . ASN C 1 242 ? -17.485 16.153  -59.468 1.00 14.34 ? 241 ASN C O   1 
ATOM   7585  C CB  . ASN C 1 242 ? -16.675 12.980  -59.047 1.00 13.54 ? 241 ASN C CB  1 
ATOM   7586  C CG  . ASN C 1 242 ? -15.405 13.785  -58.704 1.00 16.23 ? 241 ASN C CG  1 
ATOM   7587  O OD1 . ASN C 1 242 ? -14.465 13.847  -59.500 1.00 19.75 ? 241 ASN C OD1 1 
ATOM   7588  N ND2 . ASN C 1 242 ? -15.398 14.415  -57.552 1.00 13.30 ? 241 ASN C ND2 1 
ATOM   7589  N N   . SER C 1 243 ? -18.127 14.857  -61.183 1.00 13.04 ? 242 SER C N   1 
ATOM   7590  C CA  . SER C 1 243 ? -17.809 15.834  -62.228 1.00 13.37 ? 242 SER C CA  1 
ATOM   7591  C C   . SER C 1 243 ? -18.823 16.949  -62.358 1.00 11.91 ? 242 SER C C   1 
ATOM   7592  O O   . SER C 1 243 ? -18.478 18.031  -62.812 1.00 9.70  ? 242 SER C O   1 
ATOM   7593  C CB  . SER C 1 243 ? -17.669 15.131  -63.580 1.00 13.68 ? 242 SER C CB  1 
ATOM   7594  O OG  . SER C 1 243 ? -16.533 14.294  -63.525 1.00 18.37 ? 242 SER C OG  1 
ATOM   7595  N N   . LEU C 1 244 ? -20.076 16.664  -61.999 1.00 10.86 ? 243 LEU C N   1 
ATOM   7596  C CA  . LEU C 1 244 ? -21.113 17.697  -61.984 1.00 10.68 ? 243 LEU C CA  1 
ATOM   7597  C C   . LEU C 1 244 ? -21.290 18.306  -60.601 1.00 10.63 ? 243 LEU C C   1 
ATOM   7598  O O   . LEU C 1 244 ? -21.794 19.405  -60.485 1.00 10.74 ? 243 LEU C O   1 
ATOM   7599  C CB  . LEU C 1 244 ? -22.459 17.158  -62.468 1.00 10.41 ? 243 LEU C CB  1 
ATOM   7600  C CG  . LEU C 1 244 ? -22.519 16.483  -63.843 1.00 10.98 ? 243 LEU C CG  1 
ATOM   7601  C CD1 . LEU C 1 244 ? -23.962 16.112  -64.169 1.00 9.18  ? 243 LEU C CD1 1 
ATOM   7602  C CD2 . LEU C 1 244 ? -21.880 17.339  -64.941 1.00 8.54  ? 243 LEU C CD2 1 
ATOM   7603  N N   . GLY C 1 245 ? -20.912 17.565  -59.567 1.00 10.33 ? 244 GLY C N   1 
ATOM   7604  C CA  . GLY C 1 245 ? -20.839 18.085  -58.220 1.00 11.12 ? 244 GLY C CA  1 
ATOM   7605  C C   . GLY C 1 245 ? -22.136 18.484  -57.514 1.00 10.58 ? 244 GLY C C   1 
ATOM   7606  O O   . GLY C 1 245 ? -22.115 19.321  -56.603 1.00 10.01 ? 244 GLY C O   1 
ATOM   7607  N N   . ALA C 1 246 ? -23.248 17.881  -57.926 1.00 10.83 ? 245 ALA C N   1 
ATOM   7608  C CA  . ALA C 1 246 ? -24.567 18.122  -57.299 1.00 10.92 ? 245 ALA C CA  1 
ATOM   7609  C C   . ALA C 1 246 ? -24.734 17.141  -56.130 1.00 10.97 ? 245 ALA C C   1 
ATOM   7610  O O   . ALA C 1 246 ? -25.616 16.257  -56.137 1.00 11.58 ? 245 ALA C O   1 
ATOM   7611  C CB  . ALA C 1 246 ? -25.676 17.963  -58.323 1.00 9.77  ? 245 ALA C CB  1 
ATOM   7612  N N   . VAL C 1 247 ? -23.877 17.338  -55.131 1.00 10.70 ? 246 VAL C N   1 
ATOM   7613  C CA  . VAL C 1 247 ? -23.674 16.424  -54.041 1.00 11.08 ? 246 VAL C CA  1 
ATOM   7614  C C   . VAL C 1 247 ? -24.336 16.969  -52.772 1.00 11.45 ? 246 VAL C C   1 
ATOM   7615  O O   . VAL C 1 247 ? -24.510 18.197  -52.623 1.00 11.26 ? 246 VAL C O   1 
ATOM   7616  C CB  . VAL C 1 247 ? -22.150 16.171  -53.816 1.00 11.25 ? 246 VAL C CB  1 
ATOM   7617  C CG1 . VAL C 1 247 ? -21.548 15.555  -55.058 1.00 12.27 ? 246 VAL C CG1 1 
ATOM   7618  C CG2 . VAL C 1 247 ? -21.411 17.461  -53.458 1.00 10.34 ? 246 VAL C CG2 1 
ATOM   7619  N N   . PRO C 1 248 ? -24.747 16.067  -51.873 1.00 11.65 ? 247 PRO C N   1 
ATOM   7620  C CA  . PRO C 1 248 ? -25.428 16.489  -50.651 1.00 12.23 ? 247 PRO C CA  1 
ATOM   7621  C C   . PRO C 1 248 ? -24.442 16.810  -49.538 1.00 12.30 ? 247 PRO C C   1 
ATOM   7622  O O   . PRO C 1 248 ? -23.344 16.243  -49.502 1.00 13.15 ? 247 PRO C O   1 
ATOM   7623  C CB  . PRO C 1 248 ? -26.258 15.244  -50.290 1.00 11.70 ? 247 PRO C CB  1 
ATOM   7624  C CG  . PRO C 1 248 ? -25.374 14.110  -50.742 1.00 12.94 ? 247 PRO C CG  1 
ATOM   7625  C CD  . PRO C 1 248 ? -24.629 14.592  -51.949 1.00 13.06 ? 247 PRO C CD  1 
ATOM   7626  N N   . SER C 1 249 ? -24.833 17.699  -48.622 1.00 13.19 ? 248 SER C N   1 
ATOM   7627  C CA  . SER C 1 249 ? -24.078 17.924  -47.392 1.00 13.66 ? 248 SER C CA  1 
ATOM   7628  C C   . SER C 1 249 ? -23.892 16.630  -46.581 1.00 12.97 ? 248 SER C C   1 
ATOM   7629  O O   . SER C 1 249 ? -24.829 15.857  -46.418 1.00 12.30 ? 248 SER C O   1 
ATOM   7630  C CB  . SER C 1 249 ? -24.843 18.934  -46.528 1.00 14.21 ? 248 SER C CB  1 
ATOM   7631  O OG  . SER C 1 249 ? -24.195 19.125  -45.298 1.00 17.74 ? 248 SER C OG  1 
ATOM   7632  N N   . PRO C 1 250 ? -22.691 16.390  -46.039 1.00 13.06 ? 249 PRO C N   1 
ATOM   7633  C CA  . PRO C 1 250 ? -22.583 15.243  -45.129 1.00 12.93 ? 249 PRO C CA  1 
ATOM   7634  C C   . PRO C 1 250 ? -23.539 15.277  -43.941 1.00 13.09 ? 249 PRO C C   1 
ATOM   7635  O O   . PRO C 1 250 ? -23.960 14.227  -43.456 1.00 12.99 ? 249 PRO C O   1 
ATOM   7636  C CB  . PRO C 1 250 ? -21.112 15.291  -44.677 1.00 12.81 ? 249 PRO C CB  1 
ATOM   7637  C CG  . PRO C 1 250 ? -20.421 15.937  -45.788 1.00 12.80 ? 249 PRO C CG  1 
ATOM   7638  C CD  . PRO C 1 250 ? -21.375 17.003  -46.268 1.00 12.97 ? 249 PRO C CD  1 
ATOM   7639  N N   . ILE C 1 251 ? -23.902 16.465  -43.476 1.00 13.47 ? 250 ILE C N   1 
ATOM   7640  C CA  . ILE C 1 251 ? -24.820 16.551  -42.349 1.00 13.71 ? 250 ILE C CA  1 
ATOM   7641  C C   . ILE C 1 251 ? -26.242 16.137  -42.778 1.00 12.47 ? 250 ILE C C   1 
ATOM   7642  O O   . ILE C 1 251 ? -26.925 15.398  -42.053 1.00 11.75 ? 250 ILE C O   1 
ATOM   7643  C CB  . ILE C 1 251 ? -24.705 17.932  -41.621 1.00 14.06 ? 250 ILE C CB  1 
ATOM   7644  C CG1 . ILE C 1 251 ? -25.473 17.904  -40.310 1.00 16.29 ? 250 ILE C CG1 1 
ATOM   7645  C CG2 . ILE C 1 251 ? -25.204 19.059  -42.459 1.00 15.85 ? 250 ILE C CG2 1 
ATOM   7646  C CD1 . ILE C 1 251 ? -24.723 18.584  -39.204 1.00 18.93 ? 250 ILE C CD1 1 
ATOM   7647  N N   . ASP C 1 252 ? -26.659 16.536  -43.978 1.00 11.55 ? 251 ASP C N   1 
ATOM   7648  C CA  . ASP C 1 252 ? -27.917 16.051  -44.561 1.00 11.75 ? 251 ASP C CA  1 
ATOM   7649  C C   . ASP C 1 252 ? -27.876 14.554  -44.770 1.00 10.96 ? 251 ASP C C   1 
ATOM   7650  O O   . ASP C 1 252 ? -28.881 13.885  -44.564 1.00 11.08 ? 251 ASP C O   1 
ATOM   7651  C CB  . ASP C 1 252 ? -28.238 16.701  -45.935 1.00 11.99 ? 251 ASP C CB  1 
ATOM   7652  C CG  . ASP C 1 252 ? -28.759 18.120  -45.821 1.00 14.41 ? 251 ASP C CG  1 
ATOM   7653  O OD1 . ASP C 1 252 ? -29.269 18.628  -46.842 1.00 20.06 ? 251 ASP C OD1 1 
ATOM   7654  O OD2 . ASP C 1 252 ? -28.654 18.748  -44.734 1.00 16.62 ? 251 ASP C OD2 1 
ATOM   7655  N N   . CYS C 1 253 ? -26.735 14.029  -45.232 1.00 10.42 ? 252 CYS C N   1 
ATOM   7656  C CA  . CYS C 1 253 ? -26.551 12.573  -45.307 1.00 10.07 ? 252 CYS C CA  1 
ATOM   7657  C C   . CYS C 1 253 ? -26.806 11.872  -43.963 1.00 10.13 ? 252 CYS C C   1 
ATOM   7658  O O   . CYS C 1 253 ? -27.458 10.838  -43.931 1.00 10.11 ? 252 CYS C O   1 
ATOM   7659  C CB  . CYS C 1 253 ? -25.156 12.214  -45.822 1.00 10.28 ? 252 CYS C CB  1 
ATOM   7660  S SG  . CYS C 1 253 ? -24.899 12.688  -47.557 1.00 11.55 ? 252 CYS C SG  1 
ATOM   7661  N N   . TYR C 1 254 ? -26.275 12.437  -42.874 1.00 9.85  ? 253 TYR C N   1 
ATOM   7662  C CA  A TYR C 1 254 ? -26.502 11.898  -41.516 0.50 9.90  ? 253 TYR C CA  1 
ATOM   7663  C CA  B TYR C 1 254 ? -26.502 11.892  -41.546 0.50 9.67  ? 253 TYR C CA  1 
ATOM   7664  C C   . TYR C 1 254 ? -27.987 11.952  -41.137 1.00 9.46  ? 253 TYR C C   1 
ATOM   7665  O O   . TYR C 1 254 ? -28.542 10.989  -40.584 1.00 9.08  ? 253 TYR C O   1 
ATOM   7666  C CB  A TYR C 1 254 ? -25.650 12.619  -40.447 0.50 10.75 ? 253 TYR C CB  1 
ATOM   7667  C CB  B TYR C 1 254 ? -25.646 12.618  -40.517 0.50 10.16 ? 253 TYR C CB  1 
ATOM   7668  C CG  A TYR C 1 254 ? -26.351 12.775  -39.088 0.50 10.70 ? 253 TYR C CG  1 
ATOM   7669  C CG  B TYR C 1 254 ? -25.964 12.152  -39.126 0.50 9.92  ? 253 TYR C CG  1 
ATOM   7670  C CD1 A TYR C 1 254 ? -26.484 11.696  -38.214 0.50 11.98 ? 253 TYR C CD1 1 
ATOM   7671  C CD1 B TYR C 1 254 ? -25.316 11.056  -38.590 0.50 10.87 ? 253 TYR C CD1 1 
ATOM   7672  C CD2 A TYR C 1 254 ? -26.927 13.998  -38.715 0.50 10.46 ? 253 TYR C CD2 1 
ATOM   7673  C CD2 B TYR C 1 254 ? -26.956 12.773  -38.372 0.50 10.81 ? 253 TYR C CD2 1 
ATOM   7674  C CE1 A TYR C 1 254 ? -27.164 11.837  -36.981 0.50 12.28 ? 253 TYR C CE1 1 
ATOM   7675  C CE1 B TYR C 1 254 ? -25.604 10.609  -37.329 0.50 10.28 ? 253 TYR C CE1 1 
ATOM   7676  C CE2 A TYR C 1 254 ? -27.589 14.155  -37.497 0.50 11.49 ? 253 TYR C CE2 1 
ATOM   7677  C CE2 B TYR C 1 254 ? -27.283 12.308  -37.104 0.50 11.87 ? 253 TYR C CE2 1 
ATOM   7678  C CZ  A TYR C 1 254 ? -27.711 13.074  -36.634 0.50 12.60 ? 253 TYR C CZ  1 
ATOM   7679  C CZ  B TYR C 1 254 ? -26.584 11.233  -36.586 0.50 10.79 ? 253 TYR C CZ  1 
ATOM   7680  O OH  A TYR C 1 254 ? -28.365 13.231  -35.423 0.50 13.08 ? 253 TYR C OH  1 
ATOM   7681  O OH  B TYR C 1 254 ? -26.878 10.757  -35.341 0.50 11.51 ? 253 TYR C OH  1 
ATOM   7682  N N   . LEU C 1 255 ? -28.627 13.073  -41.401 1.00 8.73  ? 254 LEU C N   1 
ATOM   7683  C CA  . LEU C 1 255 ? -30.063 13.224  -41.111 1.00 8.88  ? 254 LEU C CA  1 
ATOM   7684  C C   . LEU C 1 255 ? -30.914 12.228  -41.911 1.00 8.80  ? 254 LEU C C   1 
ATOM   7685  O O   . LEU C 1 255 ? -31.872 11.661  -41.383 1.00 7.79  ? 254 LEU C O   1 
ATOM   7686  C CB  . LEU C 1 255 ? -30.513 14.674  -41.390 1.00 8.85  ? 254 LEU C CB  1 
ATOM   7687  C CG  . LEU C 1 255 ? -30.118 15.736  -40.376 1.00 10.02 ? 254 LEU C CG  1 
ATOM   7688  C CD1 . LEU C 1 255 ? -30.314 17.185  -40.926 1.00 9.60  ? 254 LEU C CD1 1 
ATOM   7689  C CD2 . LEU C 1 255 ? -30.899 15.577  -39.046 1.00 10.58 ? 254 LEU C CD2 1 
ATOM   7690  N N   . CYS C 1 256 ? -30.588 12.021  -43.190 1.00 9.68  ? 255 CYS C N   1 
ATOM   7691  C CA  . CYS C 1 256 ? -31.325 11.062  -44.015 1.00 9.24  ? 255 CYS C CA  1 
ATOM   7692  C C   . CYS C 1 256 ? -31.079 9.613   -43.566 1.00 9.17  ? 255 CYS C C   1 
ATOM   7693  O O   . CYS C 1 256 ? -31.991 8.777   -43.574 1.00 8.82  ? 255 CYS C O   1 
ATOM   7694  C CB  . CYS C 1 256 ? -30.971 11.231  -45.499 1.00 8.64  ? 255 CYS C CB  1 
ATOM   7695  S SG  . CYS C 1 256 ? -31.958 10.197  -46.622 1.00 11.51 ? 255 CYS C SG  1 
ATOM   7696  N N   . ASN C 1 257 ? -29.841 9.306   -43.208 1.00 8.89  ? 256 ASN C N   1 
ATOM   7697  C CA  . ASN C 1 257 ? -29.514 7.982   -42.717 1.00 9.51  ? 256 ASN C CA  1 
ATOM   7698  C C   . ASN C 1 257 ? -30.241 7.731   -41.401 1.00 8.80  ? 256 ASN C C   1 
ATOM   7699  O O   . ASN C 1 257 ? -30.699 6.641   -41.131 1.00 8.56  ? 256 ASN C O   1 
ATOM   7700  C CB  . ASN C 1 257 ? -28.005 7.844   -42.531 1.00 9.12  ? 256 ASN C CB  1 
ATOM   7701  C CG  . ASN C 1 257 ? -27.498 6.403   -42.669 1.00 11.44 ? 256 ASN C CG  1 
ATOM   7702  O OD1 . ASN C 1 257 ? -26.322 6.191   -43.005 1.00 13.30 ? 256 ASN C OD1 1 
ATOM   7703  N ND2 . ASN C 1 257 ? -28.348 5.416   -42.370 1.00 12.54 ? 256 ASN C ND2 1 
ATOM   7704  N N   . ARG C 1 258 ? -30.338 8.752   -40.573 1.00 9.61  ? 257 ARG C N   1 
ATOM   7705  C CA  . ARG C 1 258 ? -31.091 8.634   -39.333 1.00 9.56  ? 257 ARG C CA  1 
ATOM   7706  C C   . ARG C 1 258 ? -32.571 8.404   -39.628 1.00 9.14  ? 257 ARG C C   1 
ATOM   7707  O O   . ARG C 1 258 ? -33.186 7.545   -39.016 1.00 8.11  ? 257 ARG C O   1 
ATOM   7708  C CB  . ARG C 1 258 ? -30.863 9.876   -38.477 1.00 9.40  ? 257 ARG C CB  1 
ATOM   7709  C CG  . ARG C 1 258 ? -31.695 9.990   -37.240 1.00 10.65 ? 257 ARG C CG  1 
ATOM   7710  C CD  . ARG C 1 258 ? -31.624 11.432  -36.744 1.00 11.39 ? 257 ARG C CD  1 
ATOM   7711  N NE  . ARG C 1 258 ? -31.501 11.583  -35.295 1.00 12.72 ? 257 ARG C NE  1 
ATOM   7712  C CZ  . ARG C 1 258 ? -32.451 12.053  -34.484 1.00 12.46 ? 257 ARG C CZ  1 
ATOM   7713  N NH1 . ARG C 1 258 ? -33.653 12.331  -34.931 1.00 11.74 ? 257 ARG C NH1 1 
ATOM   7714  N NH2 . ARG C 1 258 ? -32.189 12.217  -33.190 1.00 12.53 ? 257 ARG C NH2 1 
ATOM   7715  N N   . GLY C 1 259 ? -33.136 9.168   -40.568 1.00 8.30  ? 258 GLY C N   1 
ATOM   7716  C CA  . GLY C 1 259 ? -34.497 8.972   -40.959 1.00 9.01  ? 258 GLY C CA  1 
ATOM   7717  C C   . GLY C 1 259 ? -34.755 7.566   -41.496 1.00 9.33  ? 258 GLY C C   1 
ATOM   7718  O O   . GLY C 1 259 ? -35.758 6.958   -41.183 1.00 8.75  ? 258 GLY C O   1 
ATOM   7719  N N   . LEU C 1 260 ? -33.823 7.020   -42.265 1.00 10.64 ? 259 LEU C N   1 
ATOM   7720  C CA  . LEU C 1 260 ? -33.962 5.649   -42.786 1.00 10.92 ? 259 LEU C CA  1 
ATOM   7721  C C   . LEU C 1 260 ? -34.201 4.583   -41.721 1.00 11.14 ? 259 LEU C C   1 
ATOM   7722  O O   . LEU C 1 260 ? -34.831 3.560   -41.998 1.00 11.30 ? 259 LEU C O   1 
ATOM   7723  C CB  . LEU C 1 260 ? -32.740 5.240   -43.612 1.00 11.40 ? 259 LEU C CB  1 
ATOM   7724  C CG  . LEU C 1 260 ? -32.600 5.869   -45.001 1.00 12.16 ? 259 LEU C CG  1 
ATOM   7725  C CD1 . LEU C 1 260 ? -31.271 5.465   -45.598 1.00 12.63 ? 259 LEU C CD1 1 
ATOM   7726  C CD2 . LEU C 1 260 ? -33.743 5.480   -45.909 1.00 12.02 ? 259 LEU C CD2 1 
ATOM   7727  N N   . LYS C 1 261 ? -33.683 4.799   -40.519 1.00 11.91 ? 260 LYS C N   1 
ATOM   7728  C CA  . LYS C 1 261 ? -33.764 3.797   -39.456 1.00 12.27 ? 260 LYS C CA  1 
ATOM   7729  C C   . LYS C 1 261 ? -35.179 3.620   -38.878 1.00 11.75 ? 260 LYS C C   1 
ATOM   7730  O O   . LYS C 1 261 ? -35.417 2.659   -38.159 1.00 11.26 ? 260 LYS C O   1 
ATOM   7731  C CB  . LYS C 1 261 ? -32.745 4.079   -38.357 1.00 13.04 ? 260 LYS C CB  1 
ATOM   7732  C CG  . LYS C 1 261 ? -31.346 4.326   -38.944 1.00 16.38 ? 260 LYS C CG  1 
ATOM   7733  C CD  . LYS C 1 261 ? -30.206 3.907   -38.076 1.00 15.41 ? 260 LYS C CD  1 
ATOM   7734  C CE  . LYS C 1 261 ? -28.894 4.047   -38.828 1.00 15.45 ? 260 LYS C CE  1 
ATOM   7735  N NZ  . LYS C 1 261 ? -27.831 4.648   -37.978 1.00 14.42 ? 260 LYS C NZ  1 
ATOM   7736  N N   . THR C 1 262 ? -36.098 4.534   -39.200 1.00 10.86 ? 261 THR C N   1 
ATOM   7737  C CA  . THR C 1 262 ? -37.525 4.347   -38.917 1.00 10.20 ? 261 THR C CA  1 
ATOM   7738  C C   . THR C 1 262 ? -38.351 4.166   -40.202 1.00 10.13 ? 261 THR C C   1 
ATOM   7739  O O   . THR C 1 262 ? -39.570 4.225   -40.163 1.00 10.31 ? 261 THR C O   1 
ATOM   7740  C CB  . THR C 1 262 ? -38.088 5.540   -38.141 1.00 10.12 ? 261 THR C CB  1 
ATOM   7741  O OG1 . THR C 1 262 ? -37.774 6.765   -38.829 1.00 10.32 ? 261 THR C OG1 1 
ATOM   7742  C CG2 . THR C 1 262 ? -37.489 5.594   -36.723 1.00 9.57  ? 261 THR C CG2 1 
ATOM   7743  N N   . LEU C 1 263 ? -37.716 3.956   -41.345 1.00 9.79  ? 262 LEU C N   1 
ATOM   7744  C CA  . LEU C 1 263 ? -38.491 3.877   -42.596 1.00 9.64  ? 262 LEU C CA  1 
ATOM   7745  C C   . LEU C 1 263 ? -39.550 2.757   -42.542 1.00 9.69  ? 262 LEU C C   1 
ATOM   7746  O O   . LEU C 1 263 ? -40.702 2.960   -42.923 1.00 9.93  ? 262 LEU C O   1 
ATOM   7747  C CB  . LEU C 1 263 ? -37.580 3.733   -43.805 1.00 9.30  ? 262 LEU C CB  1 
ATOM   7748  C CG  . LEU C 1 263 ? -38.232 3.610   -45.182 1.00 9.61  ? 262 LEU C CG  1 
ATOM   7749  C CD1 . LEU C 1 263 ? -38.924 4.945   -45.660 1.00 5.96  ? 262 LEU C CD1 1 
ATOM   7750  C CD2 . LEU C 1 263 ? -37.172 3.166   -46.186 1.00 9.24  ? 262 LEU C CD2 1 
ATOM   7751  N N   . HIS C 1 264 ? -39.169 1.591   -42.057 1.00 9.73  ? 263 HIS C N   1 
ATOM   7752  C CA  . HIS C 1 264 ? -40.112 0.470   -41.980 1.00 10.53 ? 263 HIS C CA  1 
ATOM   7753  C C   . HIS C 1 264 ? -41.336 0.819   -41.132 1.00 9.30  ? 263 HIS C C   1 
ATOM   7754  O O   . HIS C 1 264 ? -42.477 0.642   -41.558 1.00 9.92  ? 263 HIS C O   1 
ATOM   7755  C CB  . HIS C 1 264 ? -39.423 -0.847  -41.497 1.00 11.10 ? 263 HIS C CB  1 
ATOM   7756  C CG  . HIS C 1 264 ? -38.765 -0.763  -40.158 1.00 12.53 ? 263 HIS C CG  1 
ATOM   7757  N ND1 . HIS C 1 264 ? -37.878 0.235   -39.811 1.00 16.45 ? 263 HIS C ND1 1 
ATOM   7758  C CD2 . HIS C 1 264 ? -38.824 -1.601  -39.088 1.00 14.36 ? 263 HIS C CD2 1 
ATOM   7759  C CE1 . HIS C 1 264 ? -37.445 0.025   -38.577 1.00 15.03 ? 263 HIS C CE1 1 
ATOM   7760  N NE2 . HIS C 1 264 ? -37.994 -1.088  -38.123 1.00 14.42 ? 263 HIS C NE2 1 
ATOM   7761  N N   . VAL C 1 265 ? -41.115 1.355   -39.953 1.00 9.66  ? 264 VAL C N   1 
ATOM   7762  C CA  . VAL C 1 265 ? -42.234 1.637   -39.041 1.00 9.33  ? 264 VAL C CA  1 
ATOM   7763  C C   . VAL C 1 265 ? -43.070 2.858   -39.484 1.00 9.81  ? 264 VAL C C   1 
ATOM   7764  O O   . VAL C 1 265 ? -44.286 2.907   -39.266 1.00 8.37  ? 264 VAL C O   1 
ATOM   7765  C CB  . VAL C 1 265 ? -41.787 1.747   -37.591 1.00 10.32 ? 264 VAL C CB  1 
ATOM   7766  C CG1 . VAL C 1 265 ? -41.276 0.382   -37.093 1.00 9.77  ? 264 VAL C CG1 1 
ATOM   7767  C CG2 . VAL C 1 265 ? -40.739 2.840   -37.353 1.00 10.65 ? 264 VAL C CG2 1 
ATOM   7768  N N   . ARG C 1 266 ? -42.422 3.834   -40.110 1.00 8.95  ? 265 ARG C N   1 
ATOM   7769  C CA  . ARG C 1 266 ? -43.149 4.940   -40.729 1.00 8.86  ? 265 ARG C CA  1 
ATOM   7770  C C   . ARG C 1 266 ? -44.025 4.466   -41.904 1.00 9.25  ? 265 ARG C C   1 
ATOM   7771  O O   . ARG C 1 266 ? -45.208 4.803   -41.986 1.00 8.59  ? 265 ARG C O   1 
ATOM   7772  C CB  . ARG C 1 266 ? -42.151 6.002   -41.201 1.00 8.64  ? 265 ARG C CB  1 
ATOM   7773  C CG  . ARG C 1 266 ? -41.444 6.679   -40.070 1.00 8.36  ? 265 ARG C CG  1 
ATOM   7774  C CD  . ARG C 1 266 ? -40.700 7.917   -40.556 1.00 8.45  ? 265 ARG C CD  1 
ATOM   7775  N NE  . ARG C 1 266 ? -39.461 7.581   -41.240 1.00 8.56  ? 265 ARG C NE  1 
ATOM   7776  C CZ  . ARG C 1 266 ? -39.273 7.586   -42.555 1.00 9.58  ? 265 ARG C CZ  1 
ATOM   7777  N NH1 . ARG C 1 266 ? -40.236 7.918   -43.386 1.00 9.35  ? 265 ARG C NH1 1 
ATOM   7778  N NH2 . ARG C 1 266 ? -38.075 7.280   -43.042 1.00 9.86  ? 265 ARG C NH2 1 
ATOM   7779  N N   . MET C 1 267 ? -43.433 3.669   -42.795 1.00 9.15  ? 266 MET C N   1 
ATOM   7780  C CA  . MET C 1 267 ? -44.134 3.217   -43.990 1.00 9.64  ? 266 MET C CA  1 
ATOM   7781  C C   . MET C 1 267 ? -45.336 2.353   -43.671 1.00 10.24 ? 266 MET C C   1 
ATOM   7782  O O   . MET C 1 267 ? -46.408 2.571   -44.255 1.00 11.05 ? 266 MET C O   1 
ATOM   7783  C CB  . MET C 1 267 ? -43.205 2.540   -44.991 1.00 9.94  ? 266 MET C CB  1 
ATOM   7784  C CG  . MET C 1 267 ? -42.134 3.456   -45.653 1.00 9.84  ? 266 MET C CG  1 
ATOM   7785  S SD  . MET C 1 267 ? -42.665 5.127   -46.177 1.00 11.30 ? 266 MET C SD  1 
ATOM   7786  C CE  . MET C 1 267 ? -43.833 4.750   -47.484 1.00 7.01  ? 266 MET C CE  1 
ATOM   7787  N N   . GLU C 1 268 ? -45.210 1.432   -42.710 1.00 10.90 ? 267 GLU C N   1 
ATOM   7788  C CA  . GLU C 1 268 ? -46.381 0.648   -42.282 1.00 11.13 ? 267 GLU C CA  1 
ATOM   7789  C C   . GLU C 1 268 ? -47.536 1.539   -41.795 1.00 11.37 ? 267 GLU C C   1 
ATOM   7790  O O   . GLU C 1 268 ? -48.704 1.288   -42.095 1.00 10.07 ? 267 GLU C O   1 
ATOM   7791  C CB  . GLU C 1 268 ? -45.979 -0.335  -41.183 1.00 11.86 ? 267 GLU C CB  1 
ATOM   7792  C CG  . GLU C 1 268 ? -45.126 -1.493  -41.723 1.00 14.70 ? 267 GLU C CG  1 
ATOM   7793  C CD  . GLU C 1 268 ? -45.907 -2.447  -42.663 1.00 17.63 ? 267 GLU C CD  1 
ATOM   7794  O OE1 . GLU C 1 268 ? -45.285 -3.396  -43.167 1.00 18.80 ? 267 GLU C OE1 1 
ATOM   7795  O OE2 . GLU C 1 268 ? -47.124 -2.241  -42.927 1.00 20.68 ? 267 GLU C OE2 1 
ATOM   7796  N N   . LYS C 1 269 ? -47.192 2.589   -41.047 1.00 11.51 ? 268 LYS C N   1 
ATOM   7797  C CA  . LYS C 1 269 ? -48.195 3.498   -40.520 1.00 11.56 ? 268 LYS C CA  1 
ATOM   7798  C C   . LYS C 1 269 ? -48.781 4.402   -41.628 1.00 11.31 ? 268 LYS C C   1 
ATOM   7799  O O   . LYS C 1 269 ? -49.996 4.648   -41.645 1.00 10.82 ? 268 LYS C O   1 
ATOM   7800  C CB  . LYS C 1 269 ? -47.637 4.326   -39.359 1.00 12.61 ? 268 LYS C CB  1 
ATOM   7801  C CG  . LYS C 1 269 ? -48.652 5.267   -38.735 1.00 14.61 ? 268 LYS C CG  1 
ATOM   7802  C CD  . LYS C 1 269 ? -49.726 4.494   -38.019 1.00 19.58 ? 268 LYS C CD  1 
ATOM   7803  C CE  . LYS C 1 269 ? -50.984 5.283   -37.875 1.00 24.49 ? 268 LYS C CE  1 
ATOM   7804  N NZ  . LYS C 1 269 ? -51.584 5.237   -36.486 1.00 27.61 ? 268 LYS C NZ  1 
ATOM   7805  N N   . HIS C 1 270 ? -47.947 4.860   -42.563 1.00 10.45 ? 269 HIS C N   1 
ATOM   7806  C CA  . HIS C 1 270 ? -48.463 5.545   -43.761 1.00 10.30 ? 269 HIS C CA  1 
ATOM   7807  C C   . HIS C 1 270 ? -49.498 4.704   -44.521 1.00 10.65 ? 269 HIS C C   1 
ATOM   7808  O O   . HIS C 1 270 ? -50.489 5.222   -45.051 1.00 11.32 ? 269 HIS C O   1 
ATOM   7809  C CB  . HIS C 1 270 ? -47.323 5.941   -44.721 1.00 9.89  ? 269 HIS C CB  1 
ATOM   7810  C CG  . HIS C 1 270 ? -46.523 7.126   -44.274 1.00 7.85  ? 269 HIS C CG  1 
ATOM   7811  N ND1 . HIS C 1 270 ? -47.086 8.350   -44.005 1.00 4.90  ? 269 HIS C ND1 1 
ATOM   7812  C CD2 . HIS C 1 270 ? -45.190 7.279   -44.097 1.00 9.55  ? 269 HIS C CD2 1 
ATOM   7813  C CE1 . HIS C 1 270 ? -46.136 9.194   -43.643 1.00 8.86  ? 269 HIS C CE1 1 
ATOM   7814  N NE2 . HIS C 1 270 ? -44.975 8.572   -43.697 1.00 8.09  ? 269 HIS C NE2 1 
ATOM   7815  N N   . PHE C 1 271 ? -49.235 3.410   -44.615 1.00 11.37 ? 270 PHE C N   1 
ATOM   7816  C CA  . PHE C 1 271 ? -50.106 2.477   -45.331 1.00 11.76 ? 270 PHE C CA  1 
ATOM   7817  C C   . PHE C 1 271 ? -51.442 2.358   -44.608 1.00 11.92 ? 270 PHE C C   1 
ATOM   7818  O O   . PHE C 1 271 ? -52.503 2.436   -45.235 1.00 12.22 ? 270 PHE C O   1 
ATOM   7819  C CB  . PHE C 1 271 ? -49.417 1.112   -45.393 1.00 12.09 ? 270 PHE C CB  1 
ATOM   7820  C CG  . PHE C 1 271 ? -50.159 0.049   -46.185 1.00 11.94 ? 270 PHE C CG  1 
ATOM   7821  C CD1 . PHE C 1 271 ? -51.269 0.343   -46.982 1.00 12.62 ? 270 PHE C CD1 1 
ATOM   7822  C CD2 . PHE C 1 271 ? -49.683 -1.265  -46.165 1.00 10.84 ? 270 PHE C CD2 1 
ATOM   7823  C CE1 . PHE C 1 271 ? -51.926 -0.660  -47.703 1.00 12.53 ? 270 PHE C CE1 1 
ATOM   7824  C CE2 . PHE C 1 271 ? -50.333 -2.275  -46.894 1.00 12.06 ? 270 PHE C CE2 1 
ATOM   7825  C CZ  . PHE C 1 271 ? -51.433 -1.973  -47.671 1.00 11.01 ? 270 PHE C CZ  1 
ATOM   7826  N N   . LYS C 1 272 ? -51.381 2.153   -43.297 1.00 12.04 ? 271 LYS C N   1 
ATOM   7827  C CA  . LYS C 1 272 ? -52.595 2.041   -42.457 1.00 13.03 ? 271 LYS C CA  1 
ATOM   7828  C C   . LYS C 1 272 ? -53.462 3.303   -42.567 1.00 12.12 ? 271 LYS C C   1 
ATOM   7829  O O   . LYS C 1 272 ? -54.682 3.224   -42.766 1.00 10.68 ? 271 LYS C O   1 
ATOM   7830  C CB  . LYS C 1 272 ? -52.258 1.871   -40.968 1.00 13.10 ? 271 LYS C CB  1 
ATOM   7831  C CG  . LYS C 1 272 ? -52.187 0.485   -40.379 1.00 18.46 ? 271 LYS C CG  1 
ATOM   7832  C CD  . LYS C 1 272 ? -50.738 0.117   -39.846 1.00 23.43 ? 271 LYS C CD  1 
ATOM   7833  C CE  . LYS C 1 272 ? -50.301 0.844   -38.520 1.00 24.97 ? 271 LYS C CE  1 
ATOM   7834  N NZ  . LYS C 1 272 ? -48.781 0.979   -38.257 1.00 22.56 ? 271 LYS C NZ  1 
ATOM   7835  N N   . ASN C 1 273 ? -52.821 4.454   -42.325 1.00 11.88 ? 272 ASN C N   1 
ATOM   7836  C CA  . ASN C 1 273 ? -53.523 5.749   -42.337 1.00 11.44 ? 272 ASN C CA  1 
ATOM   7837  C C   . ASN C 1 273 ? -54.032 6.055   -43.746 1.00 10.45 ? 272 ASN C C   1 
ATOM   7838  O O   . ASN C 1 273 ? -55.162 6.484   -43.913 1.00 11.19 ? 272 ASN C O   1 
ATOM   7839  C CB  . ASN C 1 273 ? -52.643 6.909   -41.818 1.00 10.56 ? 272 ASN C CB  1 
ATOM   7840  C CG  . ASN C 1 273 ? -52.629 7.051   -40.281 1.00 12.13 ? 272 ASN C CG  1 
ATOM   7841  O OD1 . ASN C 1 273 ? -53.317 6.342   -39.538 1.00 13.80 ? 272 ASN C OD1 1 
ATOM   7842  N ND2 . ASN C 1 273 ? -51.817 7.979   -39.806 1.00 8.96  ? 272 ASN C ND2 1 
ATOM   7843  N N   . GLY C 1 274 ? -53.188 5.840   -44.755 1.00 10.97 ? 273 GLY C N   1 
ATOM   7844  C CA  . GLY C 1 274 ? -53.518 6.079   -46.151 1.00 10.62 ? 273 GLY C CA  1 
ATOM   7845  C C   . GLY C 1 274 ? -54.716 5.281   -46.600 1.00 11.61 ? 273 GLY C C   1 
ATOM   7846  O O   . GLY C 1 274 ? -55.612 5.817   -47.235 1.00 12.01 ? 273 GLY C O   1 
ATOM   7847  N N   . MET C 1 275 ? -54.746 4.005   -46.231 1.00 12.39 ? 274 MET C N   1 
ATOM   7848  C CA  . MET C 1 275 ? -55.840 3.116   -46.606 1.00 12.90 ? 274 MET C CA  1 
ATOM   7849  C C   . MET C 1 275 ? -57.143 3.563   -45.954 1.00 12.83 ? 274 MET C C   1 
ATOM   7850  O O   . MET C 1 275 ? -58.162 3.668   -46.624 1.00 12.66 ? 274 MET C O   1 
ATOM   7851  C CB  . MET C 1 275 ? -55.496 1.684   -46.224 1.00 14.11 ? 274 MET C CB  1 
ATOM   7852  C CG  . MET C 1 275 ? -56.524 0.689   -46.654 1.00 15.27 ? 274 MET C CG  1 
ATOM   7853  S SD  . MET C 1 275 ? -56.586 0.404   -48.432 1.00 20.07 ? 274 MET C SD  1 
ATOM   7854  C CE  . MET C 1 275 ? -57.618 -1.075  -48.366 1.00 21.84 ? 274 MET C CE  1 
ATOM   7855  N N   . ALA C 1 276 ? -57.084 3.883   -44.665 1.00 12.95 ? 275 ALA C N   1 
ATOM   7856  C CA  . ALA C 1 276 ? -58.235 4.428   -43.938 1.00 12.74 ? 275 ALA C CA  1 
ATOM   7857  C C   . ALA C 1 276 ? -58.780 5.690   -44.591 1.00 12.18 ? 275 ALA C C   1 
ATOM   7858  O O   . ALA C 1 276 ? -60.001 5.843   -44.743 1.00 11.66 ? 275 ALA C O   1 
ATOM   7859  C CB  . ALA C 1 276 ? -57.885 4.694   -42.462 1.00 12.24 ? 275 ALA C CB  1 
ATOM   7860  N N   . VAL C 1 277 ? -57.879 6.608   -44.945 1.00 11.24 ? 276 VAL C N   1 
ATOM   7861  C CA  . VAL C 1 277 ? -58.262 7.845   -45.657 1.00 9.98  ? 276 VAL C CA  1 
ATOM   7862  C C   . VAL C 1 277 ? -58.904 7.538   -46.999 1.00 10.10 ? 276 VAL C C   1 
ATOM   7863  O O   . VAL C 1 277 ? -59.975 8.052   -47.304 1.00 8.82  ? 276 VAL C O   1 
ATOM   7864  C CB  . VAL C 1 277 ? -57.040 8.835   -45.816 1.00 9.06  ? 276 VAL C CB  1 
ATOM   7865  C CG1 . VAL C 1 277 ? -57.279 9.888   -46.876 1.00 7.30  ? 276 VAL C CG1 1 
ATOM   7866  C CG2 . VAL C 1 277 ? -56.725 9.465   -44.478 1.00 8.92  ? 276 VAL C CG2 1 
ATOM   7867  N N   . ALA C 1 278 ? -58.243 6.709   -47.801 1.00 11.23 ? 277 ALA C N   1 
ATOM   7868  C CA  . ALA C 1 278 ? -58.741 6.390   -49.136 1.00 11.67 ? 277 ALA C CA  1 
ATOM   7869  C C   . ALA C 1 278 ? -60.181 5.814   -49.063 1.00 12.18 ? 277 ALA C C   1 
ATOM   7870  O O   . ALA C 1 278 ? -61.068 6.249   -49.801 1.00 11.31 ? 277 ALA C O   1 
ATOM   7871  C CB  . ALA C 1 278 ? -57.802 5.407   -49.837 1.00 10.09 ? 277 ALA C CB  1 
ATOM   7872  N N   . GLN C 1 279 ? -60.386 4.856   -48.160 1.00 12.15 ? 278 GLN C N   1 
ATOM   7873  C CA  . GLN C 1 279 ? -61.704 4.232   -47.936 1.00 13.98 ? 278 GLN C CA  1 
ATOM   7874  C C   . GLN C 1 279 ? -62.747 5.233   -47.449 1.00 13.28 ? 278 GLN C C   1 
ATOM   7875  O O   . GLN C 1 279 ? -63.859 5.224   -47.927 1.00 12.58 ? 278 GLN C O   1 
ATOM   7876  C CB  . GLN C 1 279 ? -61.589 3.069   -46.940 1.00 14.20 ? 278 GLN C CB  1 
ATOM   7877  C CG  . GLN C 1 279 ? -60.701 1.937   -47.469 1.00 17.13 ? 278 GLN C CG  1 
ATOM   7878  C CD  . GLN C 1 279 ? -60.632 0.714   -46.568 1.00 19.52 ? 278 GLN C CD  1 
ATOM   7879  O OE1 . GLN C 1 279 ? -60.346 0.809   -45.363 1.00 25.71 ? 278 GLN C OE1 1 
ATOM   7880  N NE2 . GLN C 1 279 ? -60.857 -0.455  -47.162 1.00 27.06 ? 278 GLN C NE2 1 
ATOM   7881  N N   . PHE C 1 280 ? -62.367 6.108   -46.508 1.00 13.33 ? 279 PHE C N   1 
ATOM   7882  C CA  . PHE C 1 280 ? -63.238 7.193   -46.067 1.00 12.36 ? 279 PHE C CA  1 
ATOM   7883  C C   . PHE C 1 280 ? -63.695 8.091   -47.231 1.00 13.36 ? 279 PHE C C   1 
ATOM   7884  O O   . PHE C 1 280 ? -64.894 8.397   -47.387 1.00 13.58 ? 279 PHE C O   1 
ATOM   7885  C CB  . PHE C 1 280 ? -62.565 8.037   -44.996 1.00 12.21 ? 279 PHE C CB  1 
ATOM   7886  C CG  . PHE C 1 280 ? -63.350 9.240   -44.641 1.00 11.86 ? 279 PHE C CG  1 
ATOM   7887  C CD1 . PHE C 1 280 ? -64.435 9.142   -43.787 1.00 13.25 ? 279 PHE C CD1 1 
ATOM   7888  C CD2 . PHE C 1 280 ? -63.084 10.455  -45.237 1.00 10.85 ? 279 PHE C CD2 1 
ATOM   7889  C CE1 . PHE C 1 280 ? -65.211 10.259  -43.494 1.00 12.82 ? 279 PHE C CE1 1 
ATOM   7890  C CE2 . PHE C 1 280 ? -63.857 11.575  -44.933 1.00 13.18 ? 279 PHE C CE2 1 
ATOM   7891  C CZ  . PHE C 1 280 ? -64.911 11.469  -44.065 1.00 12.12 ? 279 PHE C CZ  1 
ATOM   7892  N N   . LEU C 1 281 ? -62.734 8.511   -48.051 1.00 12.95 ? 280 LEU C N   1 
ATOM   7893  C CA  . LEU C 1 281 ? -63.029 9.415   -49.132 1.00 12.76 ? 280 LEU C CA  1 
ATOM   7894  C C   . LEU C 1 281 ? -63.920 8.736   -50.165 1.00 12.53 ? 280 LEU C C   1 
ATOM   7895  O O   . LEU C 1 281 ? -64.831 9.363   -50.693 1.00 12.15 ? 280 LEU C O   1 
ATOM   7896  C CB  . LEU C 1 281 ? -61.737 9.909   -49.796 1.00 13.03 ? 280 LEU C CB  1 
ATOM   7897  C CG  . LEU C 1 281 ? -60.888 10.834  -48.914 1.00 12.39 ? 280 LEU C CG  1 
ATOM   7898  C CD1 . LEU C 1 281 ? -59.480 11.055  -49.533 1.00 10.17 ? 280 LEU C CD1 1 
ATOM   7899  C CD2 . LEU C 1 281 ? -61.628 12.137  -48.678 1.00 10.39 ? 280 LEU C CD2 1 
ATOM   7900  N N   . GLU C 1 282 ? -63.657 7.471   -50.477 1.00 12.86 ? 281 GLU C N   1 
ATOM   7901  C CA  . GLU C 1 282 ? -64.405 6.823   -51.552 1.00 13.59 ? 281 GLU C CA  1 
ATOM   7902  C C   . GLU C 1 282 ? -65.872 6.612   -51.189 1.00 13.90 ? 281 GLU C C   1 
ATOM   7903  O O   . GLU C 1 282 ? -66.695 6.558   -52.081 1.00 15.03 ? 281 GLU C O   1 
ATOM   7904  C CB  . GLU C 1 282 ? -63.815 5.494   -51.971 1.00 13.05 ? 281 GLU C CB  1 
ATOM   7905  C CG  . GLU C 1 282 ? -64.243 5.097   -53.391 1.00 15.31 ? 281 GLU C CG  1 
ATOM   7906  C CD  . GLU C 1 282 ? -63.434 3.952   -53.955 1.00 14.94 ? 281 GLU C CD  1 
ATOM   7907  O OE1 . GLU C 1 282 ? -62.757 4.137   -54.985 1.00 18.83 ? 281 GLU C OE1 1 
ATOM   7908  O OE2 . GLU C 1 282 ? -63.474 2.862   -53.361 1.00 15.55 ? 281 GLU C OE2 1 
ATOM   7909  N N   . SER C 1 283 ? -66.203 6.479   -49.912 1.00 13.86 ? 282 SER C N   1 
ATOM   7910  C CA  . SER C 1 283 ? -67.592 6.261   -49.541 1.00 15.49 ? 282 SER C CA  1 
ATOM   7911  C C   . SER C 1 283 ? -68.254 7.575   -49.112 1.00 15.02 ? 282 SER C C   1 
ATOM   7912  O O   . SER C 1 283 ? -69.368 7.576   -48.563 1.00 15.39 ? 282 SER C O   1 
ATOM   7913  C CB  . SER C 1 283 ? -67.722 5.163   -48.479 1.00 15.55 ? 282 SER C CB  1 
ATOM   7914  O OG  . SER C 1 283 ? -67.378 5.653   -47.201 1.00 19.17 ? 282 SER C OG  1 
ATOM   7915  N N   . ASN C 1 284 ? -67.569 8.687   -49.377 1.00 15.19 ? 283 ASN C N   1 
ATOM   7916  C CA  . ASN C 1 284 ? -68.051 10.019  -48.969 1.00 14.81 ? 283 ASN C CA  1 
ATOM   7917  C C   . ASN C 1 284 ? -68.747 10.631  -50.174 1.00 14.78 ? 283 ASN C C   1 
ATOM   7918  O O   . ASN C 1 284 ? -68.178 10.683  -51.236 1.00 14.09 ? 283 ASN C O   1 
ATOM   7919  C CB  . ASN C 1 284 ? -66.894 10.909  -48.476 1.00 14.97 ? 283 ASN C CB  1 
ATOM   7920  C CG  . ASN C 1 284 ? -67.352 12.310  -48.050 1.00 15.16 ? 283 ASN C CG  1 
ATOM   7921  O OD1 . ASN C 1 284 ? -67.707 13.139  -48.886 1.00 13.82 ? 283 ASN C OD1 1 
ATOM   7922  N ND2 . ASN C 1 284 ? -67.313 12.583  -46.737 1.00 16.43 ? 283 ASN C ND2 1 
ATOM   7923  N N   . PRO C 1 285 ? -70.004 11.077  -50.013 1.00 15.43 ? 284 PRO C N   1 
ATOM   7924  C CA  . PRO C 1 285 ? -70.814 11.529  -51.160 1.00 14.94 ? 284 PRO C CA  1 
ATOM   7925  C C   . PRO C 1 285 ? -70.366 12.850  -51.813 1.00 14.57 ? 284 PRO C C   1 
ATOM   7926  O O   . PRO C 1 285 ? -70.812 13.168  -52.907 1.00 14.87 ? 284 PRO C O   1 
ATOM   7927  C CB  . PRO C 1 285 ? -72.214 11.661  -50.559 1.00 14.78 ? 284 PRO C CB  1 
ATOM   7928  C CG  . PRO C 1 285 ? -72.006 11.854  -49.153 1.00 15.48 ? 284 PRO C CG  1 
ATOM   7929  C CD  . PRO C 1 285 ? -70.751 11.164  -48.755 1.00 14.78 ? 284 PRO C CD  1 
ATOM   7930  N N   . TRP C 1 286 ? -69.473 13.587  -51.162 1.00 14.23 ? 285 TRP C N   1 
ATOM   7931  C CA  . TRP C 1 286 ? -68.928 14.814  -51.723 1.00 14.23 ? 285 TRP C CA  1 
ATOM   7932  C C   . TRP C 1 286 ? -67.645 14.597  -52.522 1.00 12.99 ? 285 TRP C C   1 
ATOM   7933  O O   . TRP C 1 286 ? -67.070 15.557  -53.006 1.00 13.04 ? 285 TRP C O   1 
ATOM   7934  C CB  . TRP C 1 286 ? -68.709 15.837  -50.614 1.00 15.06 ? 285 TRP C CB  1 
ATOM   7935  C CG  . TRP C 1 286 ? -69.990 16.324  -50.053 1.00 16.05 ? 285 TRP C CG  1 
ATOM   7936  C CD1 . TRP C 1 286 ? -71.035 16.877  -50.754 1.00 17.11 ? 285 TRP C CD1 1 
ATOM   7937  C CD2 . TRP C 1 286 ? -70.383 16.310  -48.694 1.00 16.01 ? 285 TRP C CD2 1 
ATOM   7938  N NE1 . TRP C 1 286 ? -72.044 17.196  -49.905 1.00 18.30 ? 285 TRP C NE1 1 
ATOM   7939  C CE2 . TRP C 1 286 ? -71.671 16.868  -48.629 1.00 17.59 ? 285 TRP C CE2 1 
ATOM   7940  C CE3 . TRP C 1 286 ? -69.767 15.894  -47.519 1.00 17.17 ? 285 TRP C CE3 1 
ATOM   7941  C CZ2 . TRP C 1 286 ? -72.351 17.031  -47.436 1.00 19.06 ? 285 TRP C CZ2 1 
ATOM   7942  C CZ3 . TRP C 1 286 ? -70.437 16.048  -46.335 1.00 17.31 ? 285 TRP C CZ3 1 
ATOM   7943  C CH2 . TRP C 1 286 ? -71.721 16.620  -46.296 1.00 18.39 ? 285 TRP C CH2 1 
ATOM   7944  N N   . VAL C 1 287 ? -67.246 13.336  -52.685 1.00 11.42 ? 286 VAL C N   1 
ATOM   7945  C CA  . VAL C 1 287 ? -66.034 12.975  -53.377 1.00 10.69 ? 286 VAL C CA  1 
ATOM   7946  C C   . VAL C 1 287 ? -66.434 12.300  -54.704 1.00 11.10 ? 286 VAL C C   1 
ATOM   7947  O O   . VAL C 1 287 ? -67.225 11.368  -54.713 1.00 10.36 ? 286 VAL C O   1 
ATOM   7948  C CB  . VAL C 1 287 ? -65.136 12.081  -52.476 1.00 10.35 ? 286 VAL C CB  1 
ATOM   7949  C CG1 . VAL C 1 287 ? -63.979 11.483  -53.269 1.00 9.42  ? 286 VAL C CG1 1 
ATOM   7950  C CG2 . VAL C 1 287 ? -64.608 12.910  -51.279 1.00 7.90  ? 286 VAL C CG2 1 
ATOM   7951  N N   . GLU C 1 288 ? -65.917 12.811  -55.816 1.00 11.61 ? 287 GLU C N   1 
ATOM   7952  C CA  . GLU C 1 288 ? -66.244 12.269  -57.144 1.00 12.14 ? 287 GLU C CA  1 
ATOM   7953  C C   . GLU C 1 288 ? -65.558 10.944  -57.416 1.00 11.99 ? 287 GLU C C   1 
ATOM   7954  O O   . GLU C 1 288 ? -66.159 10.012  -57.924 1.00 11.74 ? 287 GLU C O   1 
ATOM   7955  C CB  . GLU C 1 288 ? -65.854 13.289  -58.217 1.00 12.31 ? 287 GLU C CB  1 
ATOM   7956  C CG  . GLU C 1 288 ? -66.136 12.854  -59.662 1.00 13.34 ? 287 GLU C CG  1 
ATOM   7957  C CD  . GLU C 1 288 ? -67.607 12.517  -59.925 1.00 17.68 ? 287 GLU C CD  1 
ATOM   7958  O OE1 . GLU C 1 288 ? -68.492 13.106  -59.277 1.00 17.08 ? 287 GLU C OE1 1 
ATOM   7959  O OE2 . GLU C 1 288 ? -67.866 11.670  -60.806 1.00 23.17 ? 287 GLU C OE2 1 
ATOM   7960  N N   . LYS C 1 289 ? -64.271 10.867  -57.100 1.00 13.07 ? 288 LYS C N   1 
ATOM   7961  C CA  . LYS C 1 289 ? -63.433 9.702   -57.450 1.00 13.00 ? 288 LYS C CA  1 
ATOM   7962  C C   . LYS C 1 289 ? -62.221 9.738   -56.527 1.00 12.51 ? 288 LYS C C   1 
ATOM   7963  O O   . LYS C 1 289 ? -61.712 10.823  -56.225 1.00 11.03 ? 288 LYS C O   1 
ATOM   7964  C CB  . LYS C 1 289 ? -62.994 9.769   -58.929 1.00 13.74 ? 288 LYS C CB  1 
ATOM   7965  C CG  . LYS C 1 289 ? -62.365 8.505   -59.462 1.00 14.55 ? 288 LYS C CG  1 
ATOM   7966  C CD  . LYS C 1 289 ? -61.697 8.717   -60.811 1.00 16.20 ? 288 LYS C CD  1 
ATOM   7967  C CE  . LYS C 1 289 ? -61.403 7.397   -61.511 1.00 17.55 ? 288 LYS C CE  1 
ATOM   7968  N NZ  . LYS C 1 289 ? -61.032 7.587   -62.965 1.00 22.33 ? 288 LYS C NZ  1 
ATOM   7969  N N   . VAL C 1 290 ? -61.787 8.562   -56.082 1.00 11.64 ? 289 VAL C N   1 
ATOM   7970  C CA  . VAL C 1 290 ? -60.564 8.395   -55.297 1.00 11.44 ? 289 VAL C CA  1 
ATOM   7971  C C   . VAL C 1 290 ? -59.598 7.563   -56.141 1.00 11.68 ? 289 VAL C C   1 
ATOM   7972  O O   . VAL C 1 290 ? -60.016 6.608   -56.815 1.00 11.92 ? 289 VAL C O   1 
ATOM   7973  C CB  . VAL C 1 290 ? -60.848 7.701   -53.936 1.00 10.78 ? 289 VAL C CB  1 
ATOM   7974  C CG1 . VAL C 1 290 ? -59.532 7.380   -53.181 1.00 10.82 ? 289 VAL C CG1 1 
ATOM   7975  C CG2 . VAL C 1 290 ? -61.741 8.557   -53.080 1.00 9.75  ? 289 VAL C CG2 1 
ATOM   7976  N N   . ILE C 1 291 ? -58.326 7.942   -56.143 1.00 11.54 ? 290 ILE C N   1 
ATOM   7977  C CA  . ILE C 1 291 ? -57.284 7.138   -56.759 1.00 11.93 ? 290 ILE C CA  1 
ATOM   7978  C C   . ILE C 1 291 ? -56.297 6.690   -55.682 1.00 12.05 ? 290 ILE C C   1 
ATOM   7979  O O   . ILE C 1 291 ? -55.498 7.466   -55.201 1.00 12.04 ? 290 ILE C O   1 
ATOM   7980  C CB  . ILE C 1 291 ? -56.539 7.877   -57.882 1.00 12.18 ? 290 ILE C CB  1 
ATOM   7981  C CG1 . ILE C 1 291 ? -57.525 8.440   -58.899 1.00 13.83 ? 290 ILE C CG1 1 
ATOM   7982  C CG2 . ILE C 1 291 ? -55.591 6.931   -58.630 1.00 10.71 ? 290 ILE C CG2 1 
ATOM   7983  C CD1 . ILE C 1 291 ? -56.878 9.378   -59.872 1.00 13.36 ? 290 ILE C CD1 1 
ATOM   7984  N N   . TYR C 1 292 ? -56.386 5.427   -55.287 1.00 12.22 ? 291 TYR C N   1 
ATOM   7985  C CA  . TYR C 1 292 ? -55.441 4.860   -54.342 1.00 12.07 ? 291 TYR C CA  1 
ATOM   7986  C C   . TYR C 1 292 ? -55.145 3.409   -54.725 1.00 13.06 ? 291 TYR C C   1 
ATOM   7987  O O   . TYR C 1 292 ? -56.058 2.586   -54.752 1.00 12.95 ? 291 TYR C O   1 
ATOM   7988  C CB  . TYR C 1 292 ? -56.003 4.928   -52.948 1.00 11.59 ? 291 TYR C CB  1 
ATOM   7989  C CG  . TYR C 1 292 ? -55.027 4.486   -51.885 1.00 10.52 ? 291 TYR C CG  1 
ATOM   7990  C CD1 . TYR C 1 292 ? -53.815 5.168   -51.691 1.00 8.14  ? 291 TYR C CD1 1 
ATOM   7991  C CD2 . TYR C 1 292 ? -55.293 3.380   -51.085 1.00 8.45  ? 291 TYR C CD2 1 
ATOM   7992  C CE1 . TYR C 1 292 ? -52.920 4.775   -50.690 1.00 8.41  ? 291 TYR C CE1 1 
ATOM   7993  C CE2 . TYR C 1 292 ? -54.383 2.970   -50.111 1.00 8.65  ? 291 TYR C CE2 1 
ATOM   7994  C CZ  . TYR C 1 292 ? -53.212 3.671   -49.905 1.00 8.15  ? 291 TYR C CZ  1 
ATOM   7995  O OH  . TYR C 1 292 ? -52.338 3.242   -48.919 1.00 9.29  ? 291 TYR C OH  1 
ATOM   7996  N N   . PRO C 1 293 ? -53.869 3.098   -55.028 1.00 12.94 ? 292 PRO C N   1 
ATOM   7997  C CA  . PRO C 1 293 ? -53.516 1.725   -55.401 1.00 13.49 ? 292 PRO C CA  1 
ATOM   7998  C C   . PRO C 1 293 ? -53.998 0.626   -54.435 1.00 13.24 ? 292 PRO C C   1 
ATOM   7999  O O   . PRO C 1 293 ? -54.167 -0.493  -54.858 1.00 13.82 ? 292 PRO C O   1 
ATOM   8000  C CB  . PRO C 1 293 ? -51.983 1.762   -55.463 1.00 13.68 ? 292 PRO C CB  1 
ATOM   8001  C CG  . PRO C 1 293 ? -51.663 3.161   -55.802 1.00 13.28 ? 292 PRO C CG  1 
ATOM   8002  C CD  . PRO C 1 293 ? -52.698 3.991   -55.063 1.00 13.52 ? 292 PRO C CD  1 
ATOM   8003  N N   . GLY C 1 294 ? -54.189 0.957   -53.160 1.00 13.25 ? 293 GLY C N   1 
ATOM   8004  C CA  . GLY C 1 294 ? -54.663 0.009   -52.133 1.00 13.30 ? 293 GLY C CA  1 
ATOM   8005  C C   . GLY C 1 294 ? -56.146 -0.332  -52.193 1.00 13.44 ? 293 GLY C C   1 
ATOM   8006  O O   . GLY C 1 294 ? -56.576 -1.262  -51.537 1.00 13.85 ? 293 GLY C O   1 
ATOM   8007  N N   . LEU C 1 295 ? -56.922 0.453   -52.948 1.00 13.30 ? 294 LEU C N   1 
ATOM   8008  C CA  . LEU C 1 295 ? -58.360 0.259   -53.103 1.00 13.27 ? 294 LEU C CA  1 
ATOM   8009  C C   . LEU C 1 295 ? -58.615 -0.621  -54.336 1.00 13.57 ? 294 LEU C C   1 
ATOM   8010  O O   . LEU C 1 295 ? -57.974 -0.425  -55.363 1.00 13.37 ? 294 LEU C O   1 
ATOM   8011  C CB  . LEU C 1 295 ? -59.065 1.609   -53.310 1.00 12.84 ? 294 LEU C CB  1 
ATOM   8012  C CG  . LEU C 1 295 ? -59.258 2.592   -52.141 1.00 10.85 ? 294 LEU C CG  1 
ATOM   8013  C CD1 . LEU C 1 295 ? -59.921 3.914   -52.653 1.00 11.51 ? 294 LEU C CD1 1 
ATOM   8014  C CD2 . LEU C 1 295 ? -60.054 1.960   -50.998 1.00 11.29 ? 294 LEU C CD2 1 
ATOM   8015  N N   . PRO C 1 296 ? -59.560 -1.577  -54.246 1.00 14.25 ? 295 PRO C N   1 
ATOM   8016  C CA  . PRO C 1 296 ? -60.032 -2.415  -55.368 1.00 14.69 ? 295 PRO C CA  1 
ATOM   8017  C C   . PRO C 1 296 ? -60.482 -1.654  -56.614 1.00 14.68 ? 295 PRO C C   1 
ATOM   8018  O O   . PRO C 1 296 ? -60.380 -2.161  -57.731 1.00 15.35 ? 295 PRO C O   1 
ATOM   8019  C CB  . PRO C 1 296 ? -61.249 -3.119  -54.778 1.00 14.80 ? 295 PRO C CB  1 
ATOM   8020  C CG  . PRO C 1 296 ? -61.014 -3.178  -53.377 1.00 15.44 ? 295 PRO C CG  1 
ATOM   8021  C CD  . PRO C 1 296 ? -60.232 -1.959  -52.995 1.00 14.85 ? 295 PRO C CD  1 
ATOM   8022  N N   . SER C 1 297 ? -60.971 -0.441  -56.422 1.00 15.06 ? 296 SER C N   1 
ATOM   8023  C CA  . SER C 1 297 ? -61.332 0.430   -57.524 1.00 14.54 ? 296 SER C CA  1 
ATOM   8024  C C   . SER C 1 297 ? -60.141 0.901   -58.343 1.00 15.07 ? 296 SER C C   1 
ATOM   8025  O O   . SER C 1 297 ? -60.335 1.347   -59.465 1.00 14.33 ? 296 SER C O   1 
ATOM   8026  C CB  . SER C 1 297 ? -62.043 1.660   -56.990 1.00 15.38 ? 296 SER C CB  1 
ATOM   8027  O OG  . SER C 1 297 ? -61.173 2.427   -56.183 1.00 13.78 ? 296 SER C OG  1 
ATOM   8028  N N   . HIS C 1 298 ? -58.917 0.841   -57.805 1.00 14.38 ? 297 HIS C N   1 
ATOM   8029  C CA  . HIS C 1 298 ? -57.796 1.279   -58.615 1.00 14.69 ? 297 HIS C CA  1 
ATOM   8030  C C   . HIS C 1 298 ? -57.668 0.325   -59.812 1.00 15.39 ? 297 HIS C C   1 
ATOM   8031  O O   . HIS C 1 298 ? -57.684 -0.891  -59.641 1.00 14.34 ? 297 HIS C O   1 
ATOM   8032  C CB  . HIS C 1 298 ? -56.486 1.356   -57.834 1.00 14.24 ? 297 HIS C CB  1 
ATOM   8033  C CG  . HIS C 1 298 ? -55.428 2.167   -58.523 1.00 13.03 ? 297 HIS C CG  1 
ATOM   8034  N ND1 . HIS C 1 298 ? -54.777 1.730   -59.655 1.00 12.69 ? 297 HIS C ND1 1 
ATOM   8035  C CD2 . HIS C 1 298 ? -54.921 3.390   -58.248 1.00 13.22 ? 297 HIS C CD2 1 
ATOM   8036  C CE1 . HIS C 1 298 ? -53.901 2.643   -60.036 1.00 15.04 ? 297 HIS C CE1 1 
ATOM   8037  N NE2 . HIS C 1 298 ? -53.967 3.658   -59.196 1.00 13.50 ? 297 HIS C NE2 1 
ATOM   8038  N N   . PRO C 1 299 ? -57.560 0.884   -61.028 1.00 16.75 ? 298 PRO C N   1 
ATOM   8039  C CA  . PRO C 1 299 ? -57.459 0.093   -62.240 1.00 16.84 ? 298 PRO C CA  1 
ATOM   8040  C C   . PRO C 1 299 ? -56.310 -0.906  -62.259 1.00 17.47 ? 298 PRO C C   1 
ATOM   8041  O O   . PRO C 1 299 ? -56.373 -1.891  -62.996 1.00 17.40 ? 298 PRO C O   1 
ATOM   8042  C CB  . PRO C 1 299 ? -57.233 1.144   -63.322 1.00 17.03 ? 298 PRO C CB  1 
ATOM   8043  C CG  . PRO C 1 299 ? -57.662 2.390   -62.758 1.00 17.36 ? 298 PRO C CG  1 
ATOM   8044  C CD  . PRO C 1 299 ? -57.565 2.333   -61.316 1.00 16.65 ? 298 PRO C CD  1 
ATOM   8045  N N   . GLN C 1 300 ? -55.263 -0.658  -61.474 1.00 17.54 ? 299 GLN C N   1 
ATOM   8046  C CA  . GLN C 1 300 ? -54.110 -1.530  -61.449 1.00 17.38 ? 299 GLN C CA  1 
ATOM   8047  C C   . GLN C 1 300 ? -53.938 -2.145  -60.084 1.00 17.38 ? 299 GLN C C   1 
ATOM   8048  O O   . GLN C 1 300 ? -52.840 -2.511  -59.710 1.00 17.85 ? 299 GLN C O   1 
ATOM   8049  C CB  . GLN C 1 300 ? -52.858 -0.752  -61.843 1.00 17.75 ? 299 GLN C CB  1 
ATOM   8050  C CG  . GLN C 1 300 ? -52.745 -0.420  -63.316 1.00 19.42 ? 299 GLN C CG  1 
ATOM   8051  C CD  . GLN C 1 300 ? -53.272 0.974   -63.736 1.00 21.15 ? 299 GLN C CD  1 
ATOM   8052  O OE1 . GLN C 1 300 ? -52.958 2.019   -63.122 1.00 21.75 ? 299 GLN C OE1 1 
ATOM   8053  N NE2 . GLN C 1 300 ? -54.018 0.993   -64.838 1.00 19.56 ? 299 GLN C NE2 1 
ATOM   8054  N N   . HIS C 1 301 ? -55.025 -2.261  -59.325 1.00 17.43 ? 300 HIS C N   1 
ATOM   8055  C CA  . HIS C 1 301 ? -54.948 -2.784  -57.975 1.00 17.31 ? 300 HIS C CA  1 
ATOM   8056  C C   . HIS C 1 301 ? -54.329 -4.196  -57.921 1.00 18.02 ? 300 HIS C C   1 
ATOM   8057  O O   . HIS C 1 301 ? -53.533 -4.516  -57.023 1.00 16.92 ? 300 HIS C O   1 
ATOM   8058  C CB  . HIS C 1 301 ? -56.333 -2.776  -57.327 1.00 17.92 ? 300 HIS C CB  1 
ATOM   8059  C CG  . HIS C 1 301 ? -56.346 -3.355  -55.957 1.00 16.75 ? 300 HIS C CG  1 
ATOM   8060  N ND1 . HIS C 1 301 ? -55.643 -2.792  -54.910 1.00 18.39 ? 300 HIS C ND1 1 
ATOM   8061  C CD2 . HIS C 1 301 ? -56.944 -4.461  -55.465 1.00 16.47 ? 300 HIS C CD2 1 
ATOM   8062  C CE1 . HIS C 1 301 ? -55.819 -3.527  -53.827 1.00 16.08 ? 300 HIS C CE1 1 
ATOM   8063  N NE2 . HIS C 1 301 ? -56.613 -4.539  -54.134 1.00 17.64 ? 300 HIS C NE2 1 
ATOM   8064  N N   . GLU C 1 302 ? -54.667 -5.034  -58.890 1.00 17.87 ? 301 GLU C N   1 
ATOM   8065  C CA  . GLU C 1 302 ? -54.125 -6.390  -58.876 1.00 18.85 ? 301 GLU C CA  1 
ATOM   8066  C C   . GLU C 1 302 ? -52.648 -6.379  -59.228 1.00 18.50 ? 301 GLU C C   1 
ATOM   8067  O O   . GLU C 1 302 ? -51.886 -7.111  -58.620 1.00 18.83 ? 301 GLU C O   1 
ATOM   8068  C CB  . GLU C 1 302 ? -54.923 -7.345  -59.786 1.00 19.40 ? 301 GLU C CB  1 
ATOM   8069  C CG  . GLU C 1 302 ? -56.290 -7.742  -59.234 1.00 21.26 ? 301 GLU C CG  1 
ATOM   8070  C CD  . GLU C 1 302 ? -56.263 -8.232  -57.795 1.00 23.61 ? 301 GLU C CD  1 
ATOM   8071  O OE1 . GLU C 1 302 ? -55.319 -8.936  -57.368 1.00 28.40 ? 301 GLU C OE1 1 
ATOM   8072  O OE2 . GLU C 1 302 ? -57.205 -7.902  -57.064 1.00 26.62 ? 301 GLU C OE2 1 
ATOM   8073  N N   . LEU C 1 303 ? -52.248 -5.523  -60.174 1.00 18.02 ? 302 LEU C N   1 
ATOM   8074  C CA  . LEU C 1 303 ? -50.839 -5.362  -60.514 1.00 17.68 ? 302 LEU C CA  1 
ATOM   8075  C C   . LEU C 1 303 ? -50.040 -4.895  -59.299 1.00 17.40 ? 302 LEU C C   1 
ATOM   8076  O O   . LEU C 1 303 ? -48.970 -5.413  -59.024 1.00 16.20 ? 302 LEU C O   1 
ATOM   8077  C CB  . LEU C 1 303 ? -50.661 -4.381  -61.683 1.00 17.77 ? 302 LEU C CB  1 
ATOM   8078  C CG  . LEU C 1 303 ? -49.239 -3.939  -62.063 1.00 17.94 ? 302 LEU C CG  1 
ATOM   8079  C CD1 . LEU C 1 303 ? -48.329 -5.185  -62.315 1.00 18.67 ? 302 LEU C CD1 1 
ATOM   8080  C CD2 . LEU C 1 303 ? -49.288 -3.009  -63.276 1.00 15.72 ? 302 LEU C CD2 1 
ATOM   8081  N N   . VAL C 1 304 ? -50.584 -3.924  -58.571 1.00 17.02 ? 303 VAL C N   1 
ATOM   8082  C CA  . VAL C 1 304 ? -49.946 -3.371  -57.379 1.00 16.76 ? 303 VAL C CA  1 
ATOM   8083  C C   . VAL C 1 304 ? -49.621 -4.456  -56.352 1.00 17.07 ? 303 VAL C C   1 
ATOM   8084  O O   . VAL C 1 304 ? -48.519 -4.487  -55.818 1.00 15.73 ? 303 VAL C O   1 
ATOM   8085  C CB  . VAL C 1 304 ? -50.824 -2.246  -56.778 1.00 16.58 ? 303 VAL C CB  1 
ATOM   8086  C CG1 . VAL C 1 304 ? -50.447 -1.961  -55.338 1.00 17.87 ? 303 VAL C CG1 1 
ATOM   8087  C CG2 . VAL C 1 304 ? -50.765 -0.990  -57.678 1.00 16.80 ? 303 VAL C CG2 1 
ATOM   8088  N N   . LYS C 1 305 ? -50.555 -5.372  -56.119 1.00 17.30 ? 304 LYS C N   1 
ATOM   8089  C CA  . LYS C 1 305 ? -50.327 -6.470  -55.186 1.00 18.89 ? 304 LYS C CA  1 
ATOM   8090  C C   . LYS C 1 305 ? -49.239 -7.441  -55.644 1.00 18.97 ? 304 LYS C C   1 
ATOM   8091  O O   . LYS C 1 305 ? -48.575 -8.064  -54.824 1.00 19.47 ? 304 LYS C O   1 
ATOM   8092  C CB  . LYS C 1 305 ? -51.628 -7.232  -54.909 1.00 18.92 ? 304 LYS C CB  1 
ATOM   8093  C CG  . LYS C 1 305 ? -52.700 -6.346  -54.342 1.00 21.60 ? 304 LYS C CG  1 
ATOM   8094  C CD  . LYS C 1 305 ? -53.602 -7.050  -53.335 1.00 25.70 ? 304 LYS C CD  1 
ATOM   8095  C CE  . LYS C 1 305 ? -54.690 -7.849  -54.003 1.00 27.89 ? 304 LYS C CE  1 
ATOM   8096  N NZ  . LYS C 1 305 ? -55.427 -8.635  -52.955 1.00 29.83 ? 304 LYS C NZ  1 
ATOM   8097  N N   . ARG C 1 306 ? -49.072 -7.540  -56.951 1.00 19.26 ? 305 ARG C N   1 
ATOM   8098  C CA  . ARG C 1 306 ? -48.077 -8.390  -57.548 1.00 19.80 ? 305 ARG C CA  1 
ATOM   8099  C C   . ARG C 1 306 ? -46.684 -7.764  -57.478 1.00 19.36 ? 305 ARG C C   1 
ATOM   8100  O O   . ARG C 1 306 ? -45.705 -8.503  -57.359 1.00 18.45 ? 305 ARG C O   1 
ATOM   8101  C CB  . ARG C 1 306 ? -48.414 -8.676  -59.014 1.00 19.91 ? 305 ARG C CB  1 
ATOM   8102  C CG  . ARG C 1 306 ? -49.613 -9.573  -59.227 1.00 21.34 ? 305 ARG C CG  1 
ATOM   8103  C CD  . ARG C 1 306 ? -49.585 -10.235 -60.613 1.00 21.67 ? 305 ARG C CD  1 
ATOM   8104  N NE  . ARG C 1 306 ? -49.588 -9.269  -61.711 1.00 23.61 ? 305 ARG C NE  1 
ATOM   8105  C CZ  . ARG C 1 306 ? -50.678 -8.713  -62.238 1.00 24.92 ? 305 ARG C CZ  1 
ATOM   8106  N NH1 . ARG C 1 306 ? -51.892 -8.992  -61.775 1.00 27.72 ? 305 ARG C NH1 1 
ATOM   8107  N NH2 . ARG C 1 306 ? -50.559 -7.850  -63.228 1.00 25.83 ? 305 ARG C NH2 1 
ATOM   8108  N N   . GLN C 1 307 ? -46.578 -6.431  -57.601 1.00 17.90 ? 306 GLN C N   1 
ATOM   8109  C CA  . GLN C 1 307 ? -45.237 -5.818  -57.624 1.00 17.38 ? 306 GLN C CA  1 
ATOM   8110  C C   . GLN C 1 307 ? -44.858 -5.009  -56.377 1.00 16.52 ? 306 GLN C C   1 
ATOM   8111  O O   . GLN C 1 307 ? -43.790 -4.438  -56.351 1.00 15.81 ? 306 GLN C O   1 
ATOM   8112  C CB  . GLN C 1 307 ? -44.983 -5.016  -58.920 1.00 17.32 ? 306 GLN C CB  1 
ATOM   8113  C CG  . GLN C 1 307 ? -45.714 -3.733  -59.068 1.00 17.28 ? 306 GLN C CG  1 
ATOM   8114  C CD  . GLN C 1 307 ? -45.351 -2.982  -60.358 1.00 18.03 ? 306 GLN C CD  1 
ATOM   8115  O OE1 . GLN C 1 307 ? -44.787 -3.548  -61.315 1.00 15.61 ? 306 GLN C OE1 1 
ATOM   8116  N NE2 . GLN C 1 307 ? -45.684 -1.700  -60.390 1.00 19.01 ? 306 GLN C NE2 1 
ATOM   8117  N N   . CYS C 1 308 ? -45.712 -4.998  -55.351 1.00 16.09 ? 307 CYS C N   1 
ATOM   8118  C CA  . CYS C 1 308 ? -45.458 -4.224  -54.131 1.00 16.26 ? 307 CYS C CA  1 
ATOM   8119  C C   . CYS C 1 308 ? -45.791 -5.022  -52.905 1.00 15.69 ? 307 CYS C C   1 
ATOM   8120  O O   . CYS C 1 308 ? -46.617 -5.935  -52.976 1.00 15.92 ? 307 CYS C O   1 
ATOM   8121  C CB  . CYS C 1 308 ? -46.302 -2.957  -54.123 1.00 16.22 ? 307 CYS C CB  1 
ATOM   8122  S SG  . CYS C 1 308 ? -46.203 -2.006  -55.630 1.00 16.15 ? 307 CYS C SG  1 
ATOM   8123  N N   . THR C 1 309 ? -45.179 -4.658  -51.775 1.00 15.39 ? 308 THR C N   1 
ATOM   8124  C CA  . THR C 1 309 ? -45.424 -5.335  -50.493 1.00 14.83 ? 308 THR C CA  1 
ATOM   8125  C C   . THR C 1 309 ? -46.480 -4.593  -49.672 1.00 14.69 ? 308 THR C C   1 
ATOM   8126  O O   . THR C 1 309 ? -46.868 -5.026  -48.597 1.00 13.58 ? 308 THR C O   1 
ATOM   8127  C CB  . THR C 1 309 ? -44.125 -5.479  -49.646 1.00 14.96 ? 308 THR C CB  1 
ATOM   8128  O OG1 . THR C 1 309 ? -43.664 -4.188  -49.237 1.00 15.34 ? 308 THR C OG1 1 
ATOM   8129  C CG2 . THR C 1 309 ? -43.023 -6.173  -50.441 1.00 14.13 ? 308 THR C CG2 1 
ATOM   8130  N N   . GLY C 1 310 ? -46.949 -3.472  -50.197 1.00 14.42 ? 309 GLY C N   1 
ATOM   8131  C CA  . GLY C 1 310 ? -47.958 -2.672  -49.519 1.00 14.30 ? 309 GLY C CA  1 
ATOM   8132  C C   . GLY C 1 310 ? -48.173 -1.388  -50.266 1.00 14.03 ? 309 GLY C C   1 
ATOM   8133  O O   . GLY C 1 310 ? -47.664 -1.227  -51.378 1.00 13.81 ? 309 GLY C O   1 
ATOM   8134  N N   . CYS C 1 311 ? -48.889 -0.455  -49.643 1.00 13.76 ? 310 CYS C N   1 
ATOM   8135  C CA  . CYS C 1 311 ? -49.146 0.866   -50.243 1.00 14.46 ? 310 CYS C CA  1 
ATOM   8136  C C   . CYS C 1 311 ? -48.730 2.015   -49.307 1.00 14.55 ? 310 CYS C C   1 
ATOM   8137  O O   . CYS C 1 311 ? -48.521 1.844   -48.099 1.00 14.27 ? 310 CYS C O   1 
ATOM   8138  C CB  . CYS C 1 311 ? -50.629 1.023   -50.611 1.00 14.40 ? 310 CYS C CB  1 
ATOM   8139  S SG  . CYS C 1 311 ? -51.264 -0.266  -51.686 1.00 16.12 ? 310 CYS C SG  1 
ATOM   8140  N N   . THR C 1 312 ? -48.653 3.196   -49.891 1.00 14.52 ? 311 THR C N   1 
ATOM   8141  C CA  . THR C 1 312 ? -48.045 4.346   -49.244 1.00 14.79 ? 311 THR C CA  1 
ATOM   8142  C C   . THR C 1 312 ? -49.114 5.314   -48.703 1.00 13.65 ? 311 THR C C   1 
ATOM   8143  O O   . THR C 1 312 ? -50.315 4.988   -48.657 1.00 13.25 ? 311 THR C O   1 
ATOM   8144  C CB  . THR C 1 312 ? -47.063 4.989   -50.256 1.00 14.59 ? 311 THR C CB  1 
ATOM   8145  O OG1 . THR C 1 312 ? -46.072 5.751   -49.575 1.00 21.48 ? 311 THR C OG1 1 
ATOM   8146  C CG2 . THR C 1 312 ? -47.808 5.860   -51.278 1.00 15.61 ? 311 THR C CG2 1 
ATOM   8147  N N   . GLY C 1 313 ? -48.679 6.483   -48.242 1.00 12.79 ? 312 GLY C N   1 
ATOM   8148  C CA  . GLY C 1 313 ? -49.593 7.467   -47.690 1.00 12.14 ? 312 GLY C CA  1 
ATOM   8149  C C   . GLY C 1 313 ? -50.222 8.410   -48.700 1.00 11.31 ? 312 GLY C C   1 
ATOM   8150  O O   . GLY C 1 313 ? -50.988 9.311   -48.330 1.00 11.41 ? 312 GLY C O   1 
ATOM   8151  N N   . MET C 1 314 ? -49.846 8.279   -49.964 1.00 11.03 ? 313 MET C N   1 
ATOM   8152  C CA  . MET C 1 314 ? -50.315 9.205   -50.986 1.00 10.60 ? 313 MET C CA  1 
ATOM   8153  C C   . MET C 1 314 ? -51.709 8.827   -51.482 1.00 10.86 ? 313 MET C C   1 
ATOM   8154  O O   . MET C 1 314 ? -51.925 7.696   -51.923 1.00 11.58 ? 313 MET C O   1 
ATOM   8155  C CB  . MET C 1 314 ? -49.350 9.229   -52.160 1.00 10.59 ? 313 MET C CB  1 
ATOM   8156  C CG  . MET C 1 314 ? -47.927 9.579   -51.792 1.00 10.66 ? 313 MET C CG  1 
ATOM   8157  S SD  . MET C 1 314 ? -47.837 11.110  -50.843 1.00 8.95  ? 313 MET C SD  1 
ATOM   8158  C CE  . MET C 1 314 ? -48.472 12.338  -52.002 1.00 6.39  ? 313 MET C CE  1 
ATOM   8159  N N   . VAL C 1 315 ? -52.641 9.779   -51.408 1.00 10.79 ? 314 VAL C N   1 
ATOM   8160  C CA  . VAL C 1 315 ? -54.055 9.545   -51.765 1.00 10.03 ? 314 VAL C CA  1 
ATOM   8161  C C   . VAL C 1 315 ? -54.510 10.733  -52.616 1.00 10.54 ? 314 VAL C C   1 
ATOM   8162  O O   . VAL C 1 315 ? -54.416 11.893  -52.203 1.00 10.25 ? 314 VAL C O   1 
ATOM   8163  C CB  . VAL C 1 315 ? -55.006 9.402   -50.533 1.00 9.95  ? 314 VAL C CB  1 
ATOM   8164  C CG1 . VAL C 1 315 ? -56.494 9.094   -51.014 1.00 9.25  ? 314 VAL C CG1 1 
ATOM   8165  C CG2 . VAL C 1 315 ? -54.503 8.335   -49.523 1.00 7.51  ? 314 VAL C CG2 1 
ATOM   8166  N N   . THR C 1 316 ? -54.975 10.427  -53.822 1.00 10.59 ? 315 THR C N   1 
ATOM   8167  C CA  . THR C 1 316 ? -55.418 11.436  -54.758 1.00 11.12 ? 315 THR C CA  1 
ATOM   8168  C C   . THR C 1 316 ? -56.920 11.277  -54.881 1.00 11.29 ? 315 THR C C   1 
ATOM   8169  O O   . THR C 1 316 ? -57.459 10.153  -54.855 1.00 10.68 ? 315 THR C O   1 
ATOM   8170  C CB  . THR C 1 316 ? -54.759 11.241  -56.151 1.00 10.76 ? 315 THR C CB  1 
ATOM   8171  O OG1 . THR C 1 316 ? -53.332 11.308  -56.032 1.00 11.56 ? 315 THR C OG1 1 
ATOM   8172  C CG2 . THR C 1 316 ? -55.248 12.267  -57.178 1.00 10.77 ? 315 THR C CG2 1 
ATOM   8173  N N   . PHE C 1 317 ? -57.607 12.401  -55.017 1.00 11.68 ? 316 PHE C N   1 
ATOM   8174  C CA  . PHE C 1 317 ? -59.038 12.339  -55.241 1.00 11.61 ? 316 PHE C CA  1 
ATOM   8175  C C   . PHE C 1 317 ? -59.517 13.581  -55.960 1.00 12.17 ? 316 PHE C C   1 
ATOM   8176  O O   . PHE C 1 317 ? -58.820 14.597  -56.034 1.00 12.03 ? 316 PHE C O   1 
ATOM   8177  C CB  . PHE C 1 317 ? -59.812 12.070  -53.922 1.00 11.24 ? 316 PHE C CB  1 
ATOM   8178  C CG  . PHE C 1 317 ? -59.951 13.280  -53.008 1.00 10.36 ? 316 PHE C CG  1 
ATOM   8179  C CD1 . PHE C 1 317 ? -61.113 14.068  -53.030 1.00 9.41  ? 316 PHE C CD1 1 
ATOM   8180  C CD2 . PHE C 1 317 ? -58.923 13.625  -52.133 1.00 9.65  ? 316 PHE C CD2 1 
ATOM   8181  C CE1 . PHE C 1 317 ? -61.225 15.187  -52.231 1.00 10.10 ? 316 PHE C CE1 1 
ATOM   8182  C CE2 . PHE C 1 317 ? -59.040 14.709  -51.314 1.00 10.50 ? 316 PHE C CE2 1 
ATOM   8183  C CZ  . PHE C 1 317 ? -60.204 15.506  -51.360 1.00 11.17 ? 316 PHE C CZ  1 
ATOM   8184  N N   . TYR C 1 318 ? -60.717 13.468  -56.510 1.00 12.26 ? 317 TYR C N   1 
ATOM   8185  C CA  . TYR C 1 318 ? -61.382 14.570  -57.144 1.00 11.95 ? 317 TYR C CA  1 
ATOM   8186  C C   . TYR C 1 318 ? -62.583 14.920  -56.305 1.00 12.04 ? 317 TYR C C   1 
ATOM   8187  O O   . TYR C 1 318 ? -63.421 14.061  -56.025 1.00 9.82  ? 317 TYR C O   1 
ATOM   8188  C CB  . TYR C 1 318 ? -61.864 14.167  -58.526 1.00 12.82 ? 317 TYR C CB  1 
ATOM   8189  C CG  . TYR C 1 318 ? -60.809 13.909  -59.562 1.00 11.66 ? 317 TYR C CG  1 
ATOM   8190  C CD1 . TYR C 1 318 ? -60.222 12.669  -59.676 1.00 13.99 ? 317 TYR C CD1 1 
ATOM   8191  C CD2 . TYR C 1 318 ? -60.428 14.904  -60.456 1.00 13.31 ? 317 TYR C CD2 1 
ATOM   8192  C CE1 . TYR C 1 318 ? -59.274 12.408  -60.658 1.00 14.36 ? 317 TYR C CE1 1 
ATOM   8193  C CE2 . TYR C 1 318 ? -59.487 14.656  -61.468 1.00 13.14 ? 317 TYR C CE2 1 
ATOM   8194  C CZ  . TYR C 1 318 ? -58.913 13.407  -61.550 1.00 13.74 ? 317 TYR C CZ  1 
ATOM   8195  O OH  . TYR C 1 318 ? -57.986 13.153  -62.516 1.00 12.34 ? 317 TYR C OH  1 
ATOM   8196  N N   . ILE C 1 319 ? -62.660 16.183  -55.886 1.00 11.82 ? 318 ILE C N   1 
ATOM   8197  C CA  . ILE C 1 319 ? -63.809 16.674  -55.132 1.00 11.04 ? 318 ILE C CA  1 
ATOM   8198  C C   . ILE C 1 319 ? -64.908 16.943  -56.139 1.00 11.19 ? 318 ILE C C   1 
ATOM   8199  O O   . ILE C 1 319 ? -64.626 17.309  -57.270 1.00 11.60 ? 318 ILE C O   1 
ATOM   8200  C CB  . ILE C 1 319 ? -63.454 17.972  -54.357 1.00 11.27 ? 318 ILE C CB  1 
ATOM   8201  C CG1 . ILE C 1 319 ? -64.512 18.313  -53.296 1.00 10.95 ? 318 ILE C CG1 1 
ATOM   8202  C CG2 . ILE C 1 319 ? -63.206 19.142  -55.330 1.00 7.42  ? 318 ILE C CG2 1 
ATOM   8203  C CD1 . ILE C 1 319 ? -64.030 19.359  -52.279 1.00 11.76 ? 318 ILE C CD1 1 
ATOM   8204  N N   . LYS C 1 320 ? -66.160 16.734  -55.733 1.00 11.82 ? 319 LYS C N   1 
ATOM   8205  C CA  . LYS C 1 320 ? -67.290 17.166  -56.529 1.00 11.49 ? 319 LYS C CA  1 
ATOM   8206  C C   . LYS C 1 320 ? -67.315 18.690  -56.565 1.00 12.16 ? 319 LYS C C   1 
ATOM   8207  O O   . LYS C 1 320 ? -66.688 19.358  -55.738 1.00 12.92 ? 319 LYS C O   1 
ATOM   8208  C CB  . LYS C 1 320 ? -68.610 16.587  -55.981 1.00 11.23 ? 319 LYS C CB  1 
ATOM   8209  C CG  . LYS C 1 320 ? -68.746 15.109  -56.256 1.00 9.78  ? 319 LYS C CG  1 
ATOM   8210  C CD  . LYS C 1 320 ? -70.048 14.533  -55.766 1.00 11.06 ? 319 LYS C CD  1 
ATOM   8211  C CE  . LYS C 1 320 ? -70.126 13.075  -56.114 1.00 12.40 ? 319 LYS C CE  1 
ATOM   8212  N NZ  . LYS C 1 320 ? -71.284 12.397  -55.427 1.00 11.15 ? 319 LYS C NZ  1 
ATOM   8213  N N   . GLY C 1 321 ? -68.014 19.223  -57.555 1.00 12.04 ? 320 GLY C N   1 
ATOM   8214  C CA  . GLY C 1 321 ? -68.136 20.640  -57.746 1.00 12.16 ? 320 GLY C CA  1 
ATOM   8215  C C   . GLY C 1 321 ? -67.007 21.196  -58.595 1.00 11.98 ? 320 GLY C C   1 
ATOM   8216  O O   . GLY C 1 321 ? -66.585 20.584  -59.577 1.00 11.24 ? 320 GLY C O   1 
ATOM   8217  N N   . THR C 1 322 ? -66.491 22.341  -58.182 1.00 11.47 ? 321 THR C N   1 
ATOM   8218  C CA  . THR C 1 322 ? -65.556 23.116  -58.981 1.00 11.61 ? 321 THR C CA  1 
ATOM   8219  C C   . THR C 1 322 ? -64.374 23.503  -58.121 1.00 11.33 ? 321 THR C C   1 
ATOM   8220  O O   . THR C 1 322 ? -64.324 23.165  -56.950 1.00 10.92 ? 321 THR C O   1 
ATOM   8221  C CB  . THR C 1 322 ? -66.188 24.446  -59.471 1.00 11.81 ? 321 THR C CB  1 
ATOM   8222  O OG1 . THR C 1 322 ? -66.388 25.308  -58.343 1.00 11.97 ? 321 THR C OG1 1 
ATOM   8223  C CG2 . THR C 1 322 ? -67.540 24.211  -60.219 1.00 11.44 ? 321 THR C CG2 1 
ATOM   8224  N N   . LEU C 1 323 ? -63.445 24.238  -58.718 1.00 12.04 ? 322 LEU C N   1 
ATOM   8225  C CA  . LEU C 1 323 ? -62.323 24.833  -57.987 1.00 11.94 ? 322 LEU C CA  1 
ATOM   8226  C C   . LEU C 1 323 ? -62.733 25.550  -56.719 1.00 12.12 ? 322 LEU C C   1 
ATOM   8227  O O   . LEU C 1 323 ? -62.004 25.500  -55.724 1.00 12.17 ? 322 LEU C O   1 
ATOM   8228  C CB  . LEU C 1 323 ? -61.553 25.802  -58.879 1.00 11.88 ? 322 LEU C CB  1 
ATOM   8229  C CG  . LEU C 1 323 ? -60.373 26.505  -58.208 1.00 11.89 ? 322 LEU C CG  1 
ATOM   8230  C CD1 . LEU C 1 323 ? -59.355 25.513  -57.689 1.00 9.33  ? 322 LEU C CD1 1 
ATOM   8231  C CD2 . LEU C 1 323 ? -59.733 27.535  -59.169 1.00 12.95 ? 322 LEU C CD2 1 
ATOM   8232  N N   . GLN C 1 324 ? -63.900 26.201  -56.724 1.00 12.12 ? 323 GLN C N   1 
ATOM   8233  C CA  . GLN C 1 324 ? -64.384 26.879  -55.529 1.00 11.63 ? 323 GLN C CA  1 
ATOM   8234  C C   . GLN C 1 324 ? -64.605 25.919  -54.375 1.00 11.03 ? 323 GLN C C   1 
ATOM   8235  O O   . GLN C 1 324 ? -64.264 26.234  -53.246 1.00 10.67 ? 323 GLN C O   1 
ATOM   8236  C CB  . GLN C 1 324 ? -65.633 27.724  -55.808 1.00 11.77 ? 323 GLN C CB  1 
ATOM   8237  C CG  . GLN C 1 324 ? -65.389 28.860  -56.830 1.00 12.75 ? 323 GLN C CG  1 
ATOM   8238  C CD  . GLN C 1 324 ? -66.556 29.831  -56.925 1.00 14.35 ? 323 GLN C CD  1 
ATOM   8239  O OE1 . GLN C 1 324 ? -67.696 29.447  -57.251 1.00 13.91 ? 323 GLN C OE1 1 
ATOM   8240  N NE2 . GLN C 1 324 ? -66.284 31.104  -56.631 1.00 19.69 ? 323 GLN C NE2 1 
ATOM   8241  N N   . HIS C 1 325 ? -65.115 24.724  -54.646 1.00 10.99 ? 324 HIS C N   1 
ATOM   8242  C CA  . HIS C 1 325 ? -65.320 23.715  -53.589 1.00 10.60 ? 324 HIS C CA  1 
ATOM   8243  C C   . HIS C 1 325 ? -63.965 23.106  -53.088 1.00 10.65 ? 324 HIS C C   1 
ATOM   8244  O O   . HIS C 1 325 ? -63.765 22.929  -51.895 1.00 11.26 ? 324 HIS C O   1 
ATOM   8245  C CB  . HIS C 1 325 ? -66.313 22.635  -54.081 1.00 10.20 ? 324 HIS C CB  1 
ATOM   8246  C CG  . HIS C 1 325 ? -67.615 23.188  -54.591 1.00 9.36  ? 324 HIS C CG  1 
ATOM   8247  N ND1 . HIS C 1 325 ? -67.845 23.442  -55.927 1.00 11.29 ? 324 HIS C ND1 1 
ATOM   8248  C CD2 . HIS C 1 325 ? -68.735 23.584  -53.942 1.00 10.57 ? 324 HIS C CD2 1 
ATOM   8249  C CE1 . HIS C 1 325 ? -69.060 23.933  -56.083 1.00 10.82 ? 324 HIS C CE1 1 
ATOM   8250  N NE2 . HIS C 1 325 ? -69.627 24.017  -54.893 1.00 9.29  ? 324 HIS C NE2 1 
ATOM   8251  N N   . ALA C 1 326 ? -63.036 22.858  -54.006 1.00 11.48 ? 325 ALA C N   1 
ATOM   8252  C CA  . ALA C 1 326 ? -61.668 22.437  -53.665 1.00 11.29 ? 325 ALA C CA  1 
ATOM   8253  C C   . ALA C 1 326 ? -61.014 23.440  -52.727 1.00 12.48 ? 325 ALA C C   1 
ATOM   8254  O O   . ALA C 1 326 ? -60.398 23.063  -51.724 1.00 12.03 ? 325 ALA C O   1 
ATOM   8255  C CB  . ALA C 1 326 ? -60.840 22.268  -54.923 1.00 10.65 ? 325 ALA C CB  1 
ATOM   8256  N N   . GLU C 1 327 ? -61.178 24.719  -53.042 1.00 12.65 ? 326 GLU C N   1 
ATOM   8257  C CA  . GLU C 1 327 ? -60.613 25.786  -52.219 1.00 13.63 ? 326 GLU C CA  1 
ATOM   8258  C C   . GLU C 1 327 ? -61.260 25.890  -50.853 1.00 12.14 ? 326 GLU C C   1 
ATOM   8259  O O   . GLU C 1 327 ? -60.555 26.078  -49.846 1.00 11.65 ? 326 GLU C O   1 
ATOM   8260  C CB  . GLU C 1 327 ? -60.657 27.113  -52.966 1.00 13.61 ? 326 GLU C CB  1 
ATOM   8261  C CG  . GLU C 1 327 ? -59.619 27.115  -54.056 1.00 16.11 ? 326 GLU C CG  1 
ATOM   8262  C CD  . GLU C 1 327 ? -59.691 28.324  -54.965 1.00 17.29 ? 326 GLU C CD  1 
ATOM   8263  O OE1 . GLU C 1 327 ? -60.782 28.896  -55.143 1.00 21.77 ? 326 GLU C OE1 1 
ATOM   8264  O OE2 . GLU C 1 327 ? -58.647 28.681  -55.527 1.00 22.39 ? 326 GLU C OE2 1 
ATOM   8265  N N   . ILE C 1 328 ? -62.579 25.732  -50.787 1.00 11.28 ? 327 ILE C N   1 
ATOM   8266  C CA  . ILE C 1 328 ? -63.236 25.717  -49.483 1.00 11.16 ? 327 ILE C CA  1 
ATOM   8267  C C   . ILE C 1 328 ? -62.766 24.530  -48.622 1.00 11.01 ? 327 ILE C C   1 
ATOM   8268  O O   . ILE C 1 328 ? -62.518 24.664  -47.421 1.00 10.85 ? 327 ILE C O   1 
ATOM   8269  C CB  . ILE C 1 328 ? -64.766 25.744  -49.598 1.00 11.01 ? 327 ILE C CB  1 
ATOM   8270  C CG1 . ILE C 1 328 ? -65.224 27.094  -50.184 1.00 11.08 ? 327 ILE C CG1 1 
ATOM   8271  C CG2 . ILE C 1 328 ? -65.398 25.583  -48.236 1.00 10.59 ? 327 ILE C CG2 1 
ATOM   8272  C CD1 . ILE C 1 328 ? -66.634 27.100  -50.768 1.00 11.91 ? 327 ILE C CD1 1 
ATOM   8273  N N   . PHE C 1 329 ? -62.678 23.366  -49.244 1.00 11.65 ? 328 PHE C N   1 
ATOM   8274  C CA  . PHE C 1 329 ? -62.181 22.166  -48.578 1.00 12.09 ? 328 PHE C CA  1 
ATOM   8275  C C   . PHE C 1 329 ? -60.791 22.449  -48.002 1.00 12.84 ? 328 PHE C C   1 
ATOM   8276  O O   . PHE C 1 329 ? -60.560 22.249  -46.813 1.00 13.52 ? 328 PHE C O   1 
ATOM   8277  C CB  . PHE C 1 329 ? -62.135 20.992  -49.569 1.00 11.97 ? 328 PHE C CB  1 
ATOM   8278  C CG  . PHE C 1 329 ? -61.304 19.848  -49.096 1.00 11.67 ? 328 PHE C CG  1 
ATOM   8279  C CD1 . PHE C 1 329 ? -61.808 18.963  -48.174 1.00 10.54 ? 328 PHE C CD1 1 
ATOM   8280  C CD2 . PHE C 1 329 ? -59.980 19.706  -49.529 1.00 11.46 ? 328 PHE C CD2 1 
ATOM   8281  C CE1 . PHE C 1 329 ? -61.035 17.914  -47.710 1.00 12.15 ? 328 PHE C CE1 1 
ATOM   8282  C CE2 . PHE C 1 329 ? -59.197 18.670  -49.069 1.00 11.89 ? 328 PHE C CE2 1 
ATOM   8283  C CZ  . PHE C 1 329 ? -59.722 17.766  -48.151 1.00 11.54 ? 328 PHE C CZ  1 
ATOM   8284  N N   . LEU C 1 330 ? -59.888 22.954  -48.845 1.00 13.37 ? 329 LEU C N   1 
ATOM   8285  C CA  . LEU C 1 330 ? -58.478 23.163  -48.426 1.00 14.06 ? 329 LEU C CA  1 
ATOM   8286  C C   . LEU C 1 330 ? -58.359 24.163  -47.290 1.00 14.39 ? 329 LEU C C   1 
ATOM   8287  O O   . LEU C 1 330 ? -57.592 23.966  -46.340 1.00 14.46 ? 329 LEU C O   1 
ATOM   8288  C CB  . LEU C 1 330 ? -57.616 23.609  -49.620 1.00 13.53 ? 329 LEU C CB  1 
ATOM   8289  C CG  . LEU C 1 330 ? -57.379 22.495  -50.621 1.00 13.01 ? 329 LEU C CG  1 
ATOM   8290  C CD1 . LEU C 1 330 ? -56.712 23.029  -51.873 1.00 13.37 ? 329 LEU C CD1 1 
ATOM   8291  C CD2 . LEU C 1 330 ? -56.568 21.317  -50.015 1.00 8.59  ? 329 LEU C CD2 1 
ATOM   8292  N N   . LYS C 1 331 ? -59.165 25.210  -47.379 1.00 14.68 ? 330 LYS C N   1 
ATOM   8293  C CA  . LYS C 1 331 ? -59.140 26.311  -46.429 1.00 15.88 ? 330 LYS C CA  1 
ATOM   8294  C C   . LYS C 1 331 ? -59.708 25.936  -45.070 1.00 14.74 ? 330 LYS C C   1 
ATOM   8295  O O   . LYS C 1 331 ? -59.373 26.561  -44.052 1.00 14.57 ? 330 LYS C O   1 
ATOM   8296  C CB  . LYS C 1 331 ? -59.840 27.531  -47.070 1.00 16.19 ? 330 LYS C CB  1 
ATOM   8297  C CG  . LYS C 1 331 ? -60.756 28.368  -46.231 1.00 19.56 ? 330 LYS C CG  1 
ATOM   8298  C CD  . LYS C 1 331 ? -61.361 29.513  -47.093 1.00 19.74 ? 330 LYS C CD  1 
ATOM   8299  C CE  . LYS C 1 331 ? -62.569 29.060  -47.976 1.00 23.57 ? 330 LYS C CE  1 
ATOM   8300  N NZ  . LYS C 1 331 ? -62.510 29.436  -49.502 1.00 24.87 ? 330 LYS C NZ  1 
ATOM   8301  N N   . ASN C 1 332 ? -60.562 24.922  -45.045 1.00 14.09 ? 331 ASN C N   1 
ATOM   8302  C CA  . ASN C 1 332 ? -61.182 24.451  -43.816 1.00 13.88 ? 331 ASN C CA  1 
ATOM   8303  C C   . ASN C 1 332 ? -60.414 23.357  -43.087 1.00 13.02 ? 331 ASN C C   1 
ATOM   8304  O O   . ASN C 1 332 ? -60.774 23.003  -41.978 1.00 14.02 ? 331 ASN C O   1 
ATOM   8305  C CB  . ASN C 1 332 ? -62.645 24.030  -44.070 1.00 13.46 ? 331 ASN C CB  1 
ATOM   8306  C CG  . ASN C 1 332 ? -63.591 25.236  -44.071 1.00 13.97 ? 331 ASN C CG  1 
ATOM   8307  O OD1 . ASN C 1 332 ? -64.139 25.572  -43.046 1.00 14.38 ? 331 ASN C OD1 1 
ATOM   8308  N ND2 . ASN C 1 332 ? -63.725 25.908  -45.200 1.00 12.22 ? 331 ASN C ND2 1 
ATOM   8309  N N   . LEU C 1 333 ? -59.344 22.835  -43.683 1.00 13.43 ? 332 LEU C N   1 
ATOM   8310  C CA  . LEU C 1 333 ? -58.538 21.826  -43.021 1.00 13.47 ? 332 LEU C CA  1 
ATOM   8311  C C   . LEU C 1 333 ? -57.826 22.446  -41.856 1.00 13.71 ? 332 LEU C C   1 
ATOM   8312  O O   . LEU C 1 333 ? -57.314 23.560  -41.967 1.00 13.08 ? 332 LEU C O   1 
ATOM   8313  C CB  . LEU C 1 333 ? -57.478 21.223  -43.942 1.00 13.22 ? 332 LEU C CB  1 
ATOM   8314  C CG  . LEU C 1 333 ? -58.035 20.423  -45.110 1.00 12.27 ? 332 LEU C CG  1 
ATOM   8315  C CD1 . LEU C 1 333 ? -56.959 20.258  -46.136 1.00 12.36 ? 332 LEU C CD1 1 
ATOM   8316  C CD2 . LEU C 1 333 ? -58.650 19.095  -44.646 1.00 11.13 ? 332 LEU C CD2 1 
ATOM   8317  N N   . LYS C 1 334 ? -57.781 21.699  -40.762 1.00 14.35 ? 333 LYS C N   1 
ATOM   8318  C CA  . LYS C 1 334 ? -57.234 22.179  -39.494 1.00 15.69 ? 333 LYS C CA  1 
ATOM   8319  C C   . LYS C 1 334 ? -56.077 21.344  -38.947 1.00 15.52 ? 333 LYS C C   1 
ATOM   8320  O O   . LYS C 1 334 ? -55.425 21.749  -37.999 1.00 16.28 ? 333 LYS C O   1 
ATOM   8321  C CB  . LYS C 1 334 ? -58.356 22.222  -38.457 1.00 16.45 ? 333 LYS C CB  1 
ATOM   8322  C CG  . LYS C 1 334 ? -59.189 23.499  -38.538 1.00 18.50 ? 333 LYS C CG  1 
ATOM   8323  C CD  . LYS C 1 334 ? -60.640 23.245  -38.469 1.00 23.89 ? 333 LYS C CD  1 
ATOM   8324  C CE  . LYS C 1 334 ? -61.077 22.637  -37.160 1.00 26.33 ? 333 LYS C CE  1 
ATOM   8325  N NZ  . LYS C 1 334 ? -62.550 22.801  -36.993 1.00 27.98 ? 333 LYS C NZ  1 
ATOM   8326  N N   . LEU C 1 335 ? -55.832 20.189  -39.544 1.00 14.89 ? 334 LEU C N   1 
ATOM   8327  C CA  . LEU C 1 335 ? -54.784 19.292  -39.102 1.00 14.20 ? 334 LEU C CA  1 
ATOM   8328  C C   . LEU C 1 335 ? -53.853 19.038  -40.279 1.00 13.48 ? 334 LEU C C   1 
ATOM   8329  O O   . LEU C 1 335 ? -52.647 19.261  -40.166 1.00 13.31 ? 334 LEU C O   1 
ATOM   8330  C CB  . LEU C 1 335 ? -55.384 17.992  -38.547 1.00 14.05 ? 334 LEU C CB  1 
ATOM   8331  C CG  . LEU C 1 335 ? -54.368 16.904  -38.138 1.00 14.68 ? 334 LEU C CG  1 
ATOM   8332  C CD1 . LEU C 1 335 ? -53.237 17.548  -37.312 1.00 14.33 ? 334 LEU C CD1 1 
ATOM   8333  C CD2 . LEU C 1 335 ? -55.035 15.753  -37.354 1.00 13.22 ? 334 LEU C CD2 1 
ATOM   8334  N N   . PHE C 1 336 ? -54.426 18.584  -41.397 1.00 12.71 ? 335 PHE C N   1 
ATOM   8335  C CA  . PHE C 1 336 ? -53.754 18.601  -42.686 1.00 12.45 ? 335 PHE C CA  1 
ATOM   8336  C C   . PHE C 1 336 ? -53.284 20.031  -42.959 1.00 12.40 ? 335 PHE C C   1 
ATOM   8337  O O   . PHE C 1 336 ? -54.026 21.008  -42.728 1.00 12.31 ? 335 PHE C O   1 
ATOM   8338  C CB  . PHE C 1 336 ? -54.695 18.191  -43.826 1.00 12.10 ? 335 PHE C CB  1 
ATOM   8339  C CG  . PHE C 1 336 ? -54.872 16.710  -43.993 1.00 11.48 ? 335 PHE C CG  1 
ATOM   8340  C CD1 . PHE C 1 336 ? -55.833 16.013  -43.242 1.00 10.76 ? 335 PHE C CD1 1 
ATOM   8341  C CD2 . PHE C 1 336 ? -54.144 16.016  -44.940 1.00 11.13 ? 335 PHE C CD2 1 
ATOM   8342  C CE1 . PHE C 1 336 ? -56.006 14.656  -43.415 1.00 11.26 ? 335 PHE C CE1 1 
ATOM   8343  C CE2 . PHE C 1 336 ? -54.319 14.641  -45.121 1.00 10.06 ? 335 PHE C CE2 1 
ATOM   8344  C CZ  . PHE C 1 336 ? -55.249 13.965  -44.349 1.00 11.43 ? 335 PHE C CZ  1 
ATOM   8345  N N   . THR C 1 337 ? -52.059 20.150  -43.450 1.00 12.53 ? 336 THR C N   1 
ATOM   8346  C CA  . THR C 1 337 ? -51.491 21.447  -43.815 1.00 11.29 ? 336 THR C CA  1 
ATOM   8347  C C   . THR C 1 337 ? -51.464 21.657  -45.335 1.00 11.64 ? 336 THR C C   1 
ATOM   8348  O O   . THR C 1 337 ? -51.026 20.785  -46.089 1.00 11.27 ? 336 THR C O   1 
ATOM   8349  C CB  . THR C 1 337 ? -50.090 21.578  -43.235 1.00 11.55 ? 336 THR C CB  1 
ATOM   8350  O OG1 . THR C 1 337 ? -50.138 21.253  -41.834 1.00 9.45  ? 336 THR C OG1 1 
ATOM   8351  C CG2 . THR C 1 337 ? -49.529 22.982  -43.456 1.00 9.40  ? 336 THR C CG2 1 
ATOM   8352  N N   . LEU C 1 338 ? -51.940 22.822  -45.773 1.00 11.16 ? 337 LEU C N   1 
ATOM   8353  C CA  . LEU C 1 338 ? -51.788 23.249  -47.163 1.00 11.27 ? 337 LEU C CA  1 
ATOM   8354  C C   . LEU C 1 338 ? -50.327 23.612  -47.457 1.00 10.98 ? 337 LEU C C   1 
ATOM   8355  O O   . LEU C 1 338 ? -49.855 24.655  -47.013 1.00 10.66 ? 337 LEU C O   1 
ATOM   8356  C CB  . LEU C 1 338 ? -52.694 24.442  -47.478 1.00 10.74 ? 337 LEU C CB  1 
ATOM   8357  C CG  . LEU C 1 338 ? -52.667 24.937  -48.924 1.00 11.64 ? 337 LEU C CG  1 
ATOM   8358  C CD1 . LEU C 1 338 ? -53.115 23.827  -49.930 1.00 11.38 ? 337 LEU C CD1 1 
ATOM   8359  C CD2 . LEU C 1 338 ? -53.521 26.208  -49.096 1.00 11.57 ? 337 LEU C CD2 1 
ATOM   8360  N N   . ALA C 1 339 ? -49.659 22.760  -48.238 1.00 10.65 ? 338 ALA C N   1 
ATOM   8361  C CA  . ALA C 1 339 ? -48.224 22.839  -48.472 1.00 10.43 ? 338 ALA C CA  1 
ATOM   8362  C C   . ALA C 1 339 ? -47.841 21.893  -49.619 1.00 9.83  ? 338 ALA C C   1 
ATOM   8363  O O   . ALA C 1 339 ? -48.522 20.894  -49.879 1.00 10.61 ? 338 ALA C O   1 
ATOM   8364  C CB  . ALA C 1 339 ? -47.441 22.491  -47.189 1.00 8.76  ? 338 ALA C CB  1 
ATOM   8365  N N   . GLU C 1 340 ? -46.750 22.226  -50.308 1.00 10.59 ? 339 GLU C N   1 
ATOM   8366  C CA  . GLU C 1 340 ? -46.130 21.354  -51.279 1.00 10.02 ? 339 GLU C CA  1 
ATOM   8367  C C   . GLU C 1 340 ? -45.299 20.297  -50.542 1.00 9.70  ? 339 GLU C C   1 
ATOM   8368  O O   . GLU C 1 340 ? -45.203 20.314  -49.305 1.00 8.73  ? 339 GLU C O   1 
ATOM   8369  C CB  . GLU C 1 340 ? -45.260 22.180  -52.259 1.00 10.98 ? 339 GLU C CB  1 
ATOM   8370  C CG  . GLU C 1 340 ? -46.073 23.198  -53.087 1.00 11.59 ? 339 GLU C CG  1 
ATOM   8371  C CD  . GLU C 1 340 ? -45.381 23.638  -54.373 1.00 12.00 ? 339 GLU C CD  1 
ATOM   8372  O OE1 . GLU C 1 340 ? -44.193 23.296  -54.586 1.00 15.33 ? 339 GLU C OE1 1 
ATOM   8373  O OE2 . GLU C 1 340 ? -46.027 24.354  -55.162 1.00 17.28 ? 339 GLU C OE2 1 
ATOM   8374  N N   . SER C 1 341 ? -44.762 19.357  -51.315 1.00 8.71  ? 340 SER C N   1 
ATOM   8375  C CA  . SER C 1 341 ? -44.012 18.207  -50.837 1.00 8.98  ? 340 SER C CA  1 
ATOM   8376  C C   . SER C 1 341 ? -44.892 17.082  -50.290 1.00 8.66  ? 340 SER C C   1 
ATOM   8377  O O   . SER C 1 341 ? -46.121 17.146  -50.343 1.00 9.64  ? 340 SER C O   1 
ATOM   8378  C CB  . SER C 1 341 ? -42.952 18.593  -49.781 1.00 9.38  ? 340 SER C CB  1 
ATOM   8379  O OG  . SER C 1 341 ? -41.915 17.617  -49.808 1.00 10.89 ? 340 SER C OG  1 
ATOM   8380  N N   . LEU C 1 342 ? -44.244 16.056  -49.745 1.00 8.76  ? 341 LEU C N   1 
ATOM   8381  C CA  . LEU C 1 342 ? -44.916 14.823  -49.344 1.00 8.50  ? 341 LEU C CA  1 
ATOM   8382  C C   . LEU C 1 342 ? -43.951 13.902  -48.636 1.00 9.20  ? 341 LEU C C   1 
ATOM   8383  O O   . LEU C 1 342 ? -42.725 14.117  -48.651 1.00 7.91  ? 341 LEU C O   1 
ATOM   8384  C CB  . LEU C 1 342 ? -45.502 14.069  -50.564 1.00 8.69  ? 341 LEU C CB  1 
ATOM   8385  C CG  . LEU C 1 342 ? -44.524 13.553  -51.643 1.00 9.01  ? 341 LEU C CG  1 
ATOM   8386  C CD1 . LEU C 1 342 ? -44.466 12.001  -51.743 1.00 7.49  ? 341 LEU C CD1 1 
ATOM   8387  C CD2 . LEU C 1 342 ? -44.876 14.216  -52.978 1.00 9.04  ? 341 LEU C CD2 1 
ATOM   8388  N N   . GLY C 1 343 ? -44.522 12.884  -47.990 1.00 9.18  ? 342 GLY C N   1 
ATOM   8389  C CA  . GLY C 1 343 ? -43.735 11.807  -47.419 1.00 10.25 ? 342 GLY C CA  1 
ATOM   8390  C C   . GLY C 1 343 ? -43.190 11.982  -46.035 1.00 10.27 ? 342 GLY C C   1 
ATOM   8391  O O   . GLY C 1 343 ? -42.455 11.127  -45.567 1.00 10.90 ? 342 GLY C O   1 
ATOM   8392  N N   . GLY C 1 344 ? -43.568 13.069  -45.373 1.00 11.33 ? 343 GLY C N   1 
ATOM   8393  C CA  . GLY C 1 344 ? -43.182 13.341  -44.000 1.00 11.32 ? 343 GLY C CA  1 
ATOM   8394  C C   . GLY C 1 344 ? -44.156 12.835  -42.952 1.00 11.53 ? 343 GLY C C   1 
ATOM   8395  O O   . GLY C 1 344 ? -45.240 12.317  -43.278 1.00 11.25 ? 343 GLY C O   1 
ATOM   8396  N N   . PHE C 1 345 ? -43.775 13.043  -41.694 1.00 11.21 ? 344 PHE C N   1 
ATOM   8397  C CA  . PHE C 1 345 ? -44.565 12.612  -40.529 1.00 11.70 ? 344 PHE C CA  1 
ATOM   8398  C C   . PHE C 1 345 ? -45.913 13.355  -40.480 1.00 12.04 ? 344 PHE C C   1 
ATOM   8399  O O   . PHE C 1 345 ? -46.888 12.822  -39.968 1.00 12.11 ? 344 PHE C O   1 
ATOM   8400  C CB  . PHE C 1 345 ? -43.777 12.764  -39.203 1.00 12.31 ? 344 PHE C CB  1 
ATOM   8401  C CG  . PHE C 1 345 ? -42.917 13.992  -39.128 1.00 11.81 ? 344 PHE C CG  1 
ATOM   8402  C CD1 . PHE C 1 345 ? -41.545 13.893  -38.975 1.00 14.01 ? 344 PHE C CD1 1 
ATOM   8403  C CD2 . PHE C 1 345 ? -43.473 15.258  -39.223 1.00 13.56 ? 344 PHE C CD2 1 
ATOM   8404  C CE1 . PHE C 1 345 ? -40.745 15.035  -38.900 1.00 12.31 ? 344 PHE C CE1 1 
ATOM   8405  C CE2 . PHE C 1 345 ? -42.667 16.396  -39.166 1.00 12.21 ? 344 PHE C CE2 1 
ATOM   8406  C CZ  . PHE C 1 345 ? -41.315 16.275  -39.019 1.00 13.47 ? 344 PHE C CZ  1 
ATOM   8407  N N   . GLU C 1 346 ? -45.983 14.538  -41.111 1.00 11.87 ? 345 GLU C N   1 
ATOM   8408  C CA  . GLU C 1 346 ? -47.187 15.361  -41.040 1.00 11.68 ? 345 GLU C CA  1 
ATOM   8409  C C   . GLU C 1 346 ? -48.035 15.233  -42.307 1.00 10.87 ? 345 GLU C C   1 
ATOM   8410  O O   . GLU C 1 346 ? -47.525 15.040  -43.405 1.00 10.51 ? 345 GLU C O   1 
ATOM   8411  C CB  . GLU C 1 346 ? -46.848 16.826  -40.747 1.00 11.45 ? 345 GLU C CB  1 
ATOM   8412  C CG  . GLU C 1 346 ? -46.180 17.592  -41.870 1.00 13.93 ? 345 GLU C CG  1 
ATOM   8413  C CD  . GLU C 1 346 ? -44.672 17.258  -42.017 1.00 16.87 ? 345 GLU C CD  1 
ATOM   8414  O OE1 . GLU C 1 346 ? -44.326 16.221  -42.629 1.00 16.41 ? 345 GLU C OE1 1 
ATOM   8415  O OE2 . GLU C 1 346 ? -43.845 18.045  -41.496 1.00 21.13 ? 345 GLU C OE2 1 
ATOM   8416  N N   . SER C 1 347 ? -49.347 15.360  -42.138 1.00 11.11 ? 346 SER C N   1 
ATOM   8417  C CA  . SER C 1 347 ? -50.267 15.272  -43.266 1.00 10.27 ? 346 SER C CA  1 
ATOM   8418  C C   . SER C 1 347 ? -50.367 16.600  -44.034 1.00 10.21 ? 346 SER C C   1 
ATOM   8419  O O   . SER C 1 347 ? -50.539 17.681  -43.444 1.00 10.03 ? 346 SER C O   1 
ATOM   8420  C CB  . SER C 1 347 ? -51.651 14.827  -42.788 1.00 10.39 ? 346 SER C CB  1 
ATOM   8421  O OG  . SER C 1 347 ? -51.600 13.548  -42.207 1.00 9.79  ? 346 SER C OG  1 
ATOM   8422  N N   . LEU C 1 348 ? -50.282 16.492  -45.355 1.00 8.66  ? 347 LEU C N   1 
ATOM   8423  C CA  . LEU C 1 348 ? -50.274 17.638  -46.240 1.00 8.50  ? 347 LEU C CA  1 
ATOM   8424  C C   . LEU C 1 348 ? -51.369 17.468  -47.255 1.00 8.27  ? 347 LEU C C   1 
ATOM   8425  O O   . LEU C 1 348 ? -51.692 16.342  -47.644 1.00 7.94  ? 347 LEU C O   1 
ATOM   8426  C CB  . LEU C 1 348 ? -48.942 17.744  -46.984 1.00 8.63  ? 347 LEU C CB  1 
ATOM   8427  C CG  . LEU C 1 348 ? -47.664 17.917  -46.162 1.00 7.05  ? 347 LEU C CG  1 
ATOM   8428  C CD1 . LEU C 1 348 ? -46.518 18.075  -47.151 1.00 7.44  ? 347 LEU C CD1 1 
ATOM   8429  C CD2 . LEU C 1 348 ? -47.793 19.116  -45.169 1.00 7.53  ? 347 LEU C CD2 1 
ATOM   8430  N N   . ALA C 1 349 ? -51.935 18.587  -47.682 1.00 7.42  ? 348 ALA C N   1 
ATOM   8431  C CA  . ALA C 1 349 ? -52.869 18.581  -48.802 1.00 7.99  ? 348 ALA C CA  1 
ATOM   8432  C C   . ALA C 1 349 ? -52.477 19.648  -49.805 1.00 8.08  ? 348 ALA C C   1 
ATOM   8433  O O   . ALA C 1 349 ? -51.969 20.712  -49.447 1.00 8.43  ? 348 ALA C O   1 
ATOM   8434  C CB  . ALA C 1 349 ? -54.280 18.813  -48.312 1.00 7.42  ? 348 ALA C CB  1 
ATOM   8435  N N   . GLU C 1 350 ? -52.738 19.383  -51.069 1.00 9.44  ? 349 GLU C N   1 
ATOM   8436  C CA  . GLU C 1 350 ? -52.477 20.389  -52.101 1.00 9.79  ? 349 GLU C CA  1 
ATOM   8437  C C   . GLU C 1 350 ? -53.348 20.206  -53.331 1.00 10.01 ? 349 GLU C C   1 
ATOM   8438  O O   . GLU C 1 350 ? -54.014 19.189  -53.492 1.00 10.43 ? 349 GLU C O   1 
ATOM   8439  C CB  . GLU C 1 350 ? -51.009 20.387  -52.525 1.00 9.77  ? 349 GLU C CB  1 
ATOM   8440  C CG  . GLU C 1 350 ? -50.584 19.157  -53.301 1.00 10.08 ? 349 GLU C CG  1 
ATOM   8441  C CD  . GLU C 1 350 ? -49.849 19.440  -54.573 1.00 10.85 ? 349 GLU C CD  1 
ATOM   8442  O OE1 . GLU C 1 350 ? -49.420 18.473  -55.203 1.00 11.93 ? 349 GLU C OE1 1 
ATOM   8443  O OE2 . GLU C 1 350 ? -49.671 20.611  -54.961 1.00 15.67 ? 349 GLU C OE2 1 
ATOM   8444  N N   . LEU C 1 351 ? -53.292 21.210  -54.198 1.00 10.98 ? 350 LEU C N   1 
ATOM   8445  C CA  . LEU C 1 351 ? -54.008 21.221  -55.465 1.00 11.31 ? 350 LEU C CA  1 
ATOM   8446  C C   . LEU C 1 351 ? -52.952 21.296  -56.556 1.00 10.92 ? 350 LEU C C   1 
ATOM   8447  O O   . LEU C 1 351 ? -52.480 22.390  -56.868 1.00 10.83 ? 350 LEU C O   1 
ATOM   8448  C CB  . LEU C 1 351 ? -54.944 22.442  -55.451 1.00 11.59 ? 350 LEU C CB  1 
ATOM   8449  C CG  . LEU C 1 351 ? -56.081 22.697  -56.449 1.00 13.40 ? 350 LEU C CG  1 
ATOM   8450  C CD1 . LEU C 1 351 ? -57.121 21.621  -56.381 1.00 16.75 ? 350 LEU C CD1 1 
ATOM   8451  C CD2 . LEU C 1 351 ? -56.707 24.060  -56.134 1.00 16.62 ? 350 LEU C CD2 1 
ATOM   8452  N N   . PRO C 1 352 ? -52.498 20.125  -57.070 1.00 10.95 ? 351 PRO C N   1 
ATOM   8453  C CA  . PRO C 1 352 ? -51.399 20.066  -58.022 1.00 11.63 ? 351 PRO C CA  1 
ATOM   8454  C C   . PRO C 1 352 ? -51.442 21.041  -59.199 1.00 12.07 ? 351 PRO C C   1 
ATOM   8455  O O   . PRO C 1 352 ? -50.394 21.558  -59.594 1.00 12.49 ? 351 PRO C O   1 
ATOM   8456  C CB  . PRO C 1 352 ? -51.437 18.614  -58.515 1.00 11.47 ? 351 PRO C CB  1 
ATOM   8457  C CG  . PRO C 1 352 ? -51.912 17.837  -57.328 1.00 11.14 ? 351 PRO C CG  1 
ATOM   8458  C CD  . PRO C 1 352 ? -52.915 18.756  -56.664 1.00 12.07 ? 351 PRO C CD  1 
ATOM   8459  N N   . ALA C 1 353 ? -52.621 21.299  -59.756 1.00 11.73 ? 352 ALA C N   1 
ATOM   8460  C CA  . ALA C 1 353 ? -52.736 22.163  -60.937 1.00 12.37 ? 352 ALA C CA  1 
ATOM   8461  C C   . ALA C 1 353 ? -52.203 23.568  -60.711 1.00 13.17 ? 352 ALA C C   1 
ATOM   8462  O O   . ALA C 1 353 ? -51.668 24.197  -61.624 1.00 13.25 ? 352 ALA C O   1 
ATOM   8463  C CB  . ALA C 1 353 ? -54.183 22.254  -61.373 1.00 11.84 ? 352 ALA C CB  1 
ATOM   8464  N N   . ILE C 1 354 ? -52.410 24.046  -59.491 1.00 13.85 ? 353 ILE C N   1 
ATOM   8465  C CA  . ILE C 1 354 ? -52.044 25.385  -59.055 1.00 15.47 ? 353 ILE C CA  1 
ATOM   8466  C C   . ILE C 1 354 ? -50.748 25.390  -58.280 1.00 14.27 ? 353 ILE C C   1 
ATOM   8467  O O   . ILE C 1 354 ? -50.107 26.398  -58.190 1.00 15.16 ? 353 ILE C O   1 
ATOM   8468  C CB  . ILE C 1 354 ? -53.142 25.929  -58.125 1.00 15.31 ? 353 ILE C CB  1 
ATOM   8469  C CG1 . ILE C 1 354 ? -54.420 26.154  -58.903 1.00 17.42 ? 353 ILE C CG1 1 
ATOM   8470  C CG2 . ILE C 1 354 ? -52.773 27.273  -57.523 1.00 18.07 ? 353 ILE C CG2 1 
ATOM   8471  C CD1 . ILE C 1 354 ? -55.490 26.708  -57.978 1.00 18.33 ? 353 ILE C CD1 1 
ATOM   8472  N N   . MET C 1 355 ? -50.363 24.254  -57.712 1.00 13.46 ? 354 MET C N   1 
ATOM   8473  C CA  . MET C 1 355 ? -49.199 24.201  -56.840 1.00 12.15 ? 354 MET C CA  1 
ATOM   8474  C C   . MET C 1 355 ? -48.049 23.388  -57.470 1.00 11.55 ? 354 MET C C   1 
ATOM   8475  O O   . MET C 1 355 ? -47.323 23.895  -58.343 1.00 10.60 ? 354 MET C O   1 
ATOM   8476  C CB  . MET C 1 355 ? -49.662 23.685  -55.457 1.00 11.91 ? 354 MET C CB  1 
ATOM   8477  C CG  . MET C 1 355 ? -50.619 24.673  -54.787 1.00 12.22 ? 354 MET C CG  1 
ATOM   8478  S SD  . MET C 1 355 ? -51.438 24.110  -53.304 1.00 11.99 ? 354 MET C SD  1 
ATOM   8479  C CE  . MET C 1 355 ? -50.075 23.925  -52.153 1.00 9.33  ? 354 MET C CE  1 
ATOM   8480  N N   . THR C 1 356 ? -47.868 22.138  -57.062 1.00 11.14 ? 355 THR C N   1 
ATOM   8481  C CA  . THR C 1 356 ? -46.675 21.388  -57.477 1.00 11.28 ? 355 THR C CA  1 
ATOM   8482  C C   . THR C 1 356 ? -46.595 21.124  -58.971 1.00 11.03 ? 355 THR C C   1 
ATOM   8483  O O   . THR C 1 356 ? -45.528 20.805  -59.482 1.00 11.32 ? 355 THR C O   1 
ATOM   8484  C CB  . THR C 1 356 ? -46.577 20.046  -56.778 1.00 11.44 ? 355 THR C CB  1 
ATOM   8485  O OG1 . THR C 1 356 ? -47.771 19.297  -57.035 1.00 11.05 ? 355 THR C OG1 1 
ATOM   8486  C CG2 . THR C 1 356 ? -46.399 20.240  -55.269 1.00 12.12 ? 355 THR C CG2 1 
ATOM   8487  N N   . HIS C 1 357 ? -47.726 21.214  -59.675 1.00 10.99 ? 356 HIS C N   1 
ATOM   8488  C CA  . HIS C 1 357 ? -47.754 20.883  -61.104 1.00 10.48 ? 356 HIS C CA  1 
ATOM   8489  C C   . HIS C 1 357 ? -48.153 22.076  -61.963 1.00 11.11 ? 356 HIS C C   1 
ATOM   8490  O O   . HIS C 1 357 ? -48.500 21.904  -63.129 1.00 11.10 ? 356 HIS C O   1 
ATOM   8491  C CB  . HIS C 1 357 ? -48.646 19.646  -61.349 1.00 10.94 ? 356 HIS C CB  1 
ATOM   8492  C CG  . HIS C 1 357 ? -48.024 18.363  -60.889 1.00 9.68  ? 356 HIS C CG  1 
ATOM   8493  N ND1 . HIS C 1 357 ? -47.841 18.052  -59.556 1.00 6.68  ? 356 HIS C ND1 1 
ATOM   8494  C CD2 . HIS C 1 357 ? -47.505 17.332  -61.592 1.00 8.15  ? 356 HIS C CD2 1 
ATOM   8495  C CE1 . HIS C 1 357 ? -47.243 16.879  -59.466 1.00 7.73  ? 356 HIS C CE1 1 
ATOM   8496  N NE2 . HIS C 1 357 ? -47.029 16.424  -60.687 1.00 6.91  ? 356 HIS C NE2 1 
ATOM   8497  N N   . ALA C 1 358 ? -47.990 23.291  -61.421 1.00 10.48 ? 357 ALA C N   1 
ATOM   8498  C CA  . ALA C 1 358 ? -48.198 24.520  -62.196 1.00 11.57 ? 357 ALA C CA  1 
ATOM   8499  C C   . ALA C 1 358 ? -47.152 24.609  -63.299 1.00 11.24 ? 357 ALA C C   1 
ATOM   8500  O O   . ALA C 1 358 ? -47.368 25.291  -64.275 1.00 11.69 ? 357 ALA C O   1 
ATOM   8501  C CB  . ALA C 1 358 ? -48.130 25.779  -61.304 1.00 10.52 ? 357 ALA C CB  1 
ATOM   8502  N N   . SER C 1 359 ? -46.027 23.910  -63.124 1.00 12.43 ? 358 SER C N   1 
ATOM   8503  C CA  . SER C 1 359 ? -44.937 23.828  -64.135 1.00 13.34 ? 358 SER C CA  1 
ATOM   8504  C C   . SER C 1 359 ? -45.257 22.949  -65.357 1.00 13.27 ? 358 SER C C   1 
ATOM   8505  O O   . SER C 1 359 ? -44.516 22.974  -66.356 1.00 13.71 ? 358 SER C O   1 
ATOM   8506  C CB  . SER C 1 359 ? -43.700 23.237  -63.472 1.00 13.11 ? 358 SER C CB  1 
ATOM   8507  O OG  . SER C 1 359 ? -44.106 22.053  -62.755 1.00 16.20 ? 358 SER C OG  1 
ATOM   8508  N N   . VAL C 1 360 ? -46.314 22.141  -65.253 1.00 13.40 ? 359 VAL C N   1 
ATOM   8509  C CA  . VAL C 1 360 ? -46.867 21.355  -66.368 1.00 12.96 ? 359 VAL C CA  1 
ATOM   8510  C C   . VAL C 1 360 ? -47.834 22.249  -67.173 1.00 13.91 ? 359 VAL C C   1 
ATOM   8511  O O   . VAL C 1 360 ? -48.686 22.950  -66.626 1.00 13.34 ? 359 VAL C O   1 
ATOM   8512  C CB  . VAL C 1 360 ? -47.563 20.059  -65.870 1.00 13.42 ? 359 VAL C CB  1 
ATOM   8513  C CG1 . VAL C 1 360 ? -48.137 19.210  -67.057 1.00 11.46 ? 359 VAL C CG1 1 
ATOM   8514  C CG2 . VAL C 1 360 ? -46.598 19.233  -65.018 1.00 11.79 ? 359 VAL C CG2 1 
ATOM   8515  N N   . LEU C 1 361 ? -47.621 22.302  -68.480 1.00 15.22 ? 360 LEU C N   1 
ATOM   8516  C CA  . LEU C 1 361 ? -48.462 23.096  -69.364 1.00 15.50 ? 360 LEU C CA  1 
ATOM   8517  C C   . LEU C 1 361 ? -49.918 22.743  -69.150 1.00 15.83 ? 360 LEU C C   1 
ATOM   8518  O O   . LEU C 1 361 ? -50.245 21.578  -68.938 1.00 14.74 ? 360 LEU C O   1 
ATOM   8519  C CB  . LEU C 1 361 ? -48.097 22.826  -70.818 1.00 15.65 ? 360 LEU C CB  1 
ATOM   8520  C CG  . LEU C 1 361 ? -46.810 23.436  -71.357 1.00 17.03 ? 360 LEU C CG  1 
ATOM   8521  C CD1 . LEU C 1 361 ? -46.592 22.917  -72.760 1.00 15.36 ? 360 LEU C CD1 1 
ATOM   8522  C CD2 . LEU C 1 361 ? -46.829 24.974  -71.323 1.00 16.63 ? 360 LEU C CD2 1 
ATOM   8523  N N   . LYS C 1 362 ? -50.782 23.754  -69.194 1.00 16.36 ? 361 LYS C N   1 
ATOM   8524  C CA  . LYS C 1 362 ? -52.202 23.544  -68.920 1.00 16.65 ? 361 LYS C CA  1 
ATOM   8525  C C   . LYS C 1 362 ? -52.832 22.515  -69.842 1.00 16.04 ? 361 LYS C C   1 
ATOM   8526  O O   . LYS C 1 362 ? -53.629 21.725  -69.385 1.00 15.77 ? 361 LYS C O   1 
ATOM   8527  C CB  . LYS C 1 362 ? -53.011 24.853  -68.980 1.00 16.91 ? 361 LYS C CB  1 
ATOM   8528  C CG  . LYS C 1 362 ? -54.525 24.589  -68.881 1.00 18.36 ? 361 LYS C CG  1 
ATOM   8529  C CD  . LYS C 1 362 ? -55.286 25.575  -68.033 1.00 22.54 ? 361 LYS C CD  1 
ATOM   8530  C CE  . LYS C 1 362 ? -56.799 25.202  -67.941 1.00 22.64 ? 361 LYS C CE  1 
ATOM   8531  N NZ  . LYS C 1 362 ? -57.073 23.903  -67.190 1.00 24.91 ? 361 LYS C NZ  1 
ATOM   8532  N N   . ASN C 1 363 ? -52.497 22.529  -71.130 1.00 15.97 ? 362 ASN C N   1 
ATOM   8533  C CA  . ASN C 1 363 ? -53.054 21.521  -72.041 1.00 16.13 ? 362 ASN C CA  1 
ATOM   8534  C C   . ASN C 1 363 ? -52.598 20.126  -71.649 1.00 15.69 ? 362 ASN C C   1 
ATOM   8535  O O   . ASN C 1 363 ? -53.371 19.184  -71.740 1.00 15.78 ? 362 ASN C O   1 
ATOM   8536  C CB  . ASN C 1 363 ? -52.663 21.779  -73.500 1.00 16.55 ? 362 ASN C CB  1 
ATOM   8537  C CG  . ASN C 1 363 ? -53.380 22.978  -74.111 1.00 17.71 ? 362 ASN C CG  1 
ATOM   8538  O OD1 . ASN C 1 363 ? -54.290 23.562  -73.514 1.00 19.03 ? 362 ASN C OD1 1 
ATOM   8539  N ND2 . ASN C 1 363 ? -52.958 23.354  -75.315 1.00 20.56 ? 362 ASN C ND2 1 
ATOM   8540  N N   . ASP C 1 364 ? -51.339 20.001  -71.206 1.00 14.95 ? 363 ASP C N   1 
ATOM   8541  C CA  . ASP C 1 364 ? -50.812 18.715  -70.723 1.00 14.95 ? 363 ASP C CA  1 
ATOM   8542  C C   . ASP C 1 364 ? -51.532 18.255  -69.456 1.00 13.73 ? 363 ASP C C   1 
ATOM   8543  O O   . ASP C 1 364 ? -51.884 17.091  -69.331 1.00 14.28 ? 363 ASP C O   1 
ATOM   8544  C CB  . ASP C 1 364 ? -49.306 18.794  -70.475 1.00 14.74 ? 363 ASP C CB  1 
ATOM   8545  C CG  . ASP C 1 364 ? -48.507 19.036  -71.758 1.00 17.78 ? 363 ASP C CG  1 
ATOM   8546  O OD1 . ASP C 1 364 ? -49.111 19.067  -72.844 1.00 21.70 ? 363 ASP C OD1 1 
ATOM   8547  O OD2 . ASP C 1 364 ? -47.273 19.239  -71.679 1.00 19.76 ? 363 ASP C OD2 1 
ATOM   8548  N N   . ARG C 1 365 ? -51.740 19.174  -68.515 1.00 12.87 ? 364 ARG C N   1 
ATOM   8549  C CA  . ARG C 1 365 ? -52.542 18.909  -67.317 1.00 12.23 ? 364 ARG C CA  1 
ATOM   8550  C C   . ARG C 1 365 ? -53.948 18.426  -67.654 1.00 12.69 ? 364 ARG C C   1 
ATOM   8551  O O   . ARG C 1 365 ? -54.450 17.467  -67.044 1.00 10.45 ? 364 ARG C O   1 
ATOM   8552  C CB  . ARG C 1 365 ? -52.700 20.179  -66.495 1.00 12.47 ? 364 ARG C CB  1 
ATOM   8553  C CG  . ARG C 1 365 ? -51.427 20.697  -65.900 1.00 11.72 ? 364 ARG C CG  1 
ATOM   8554  C CD  . ARG C 1 365 ? -51.651 21.538  -64.641 1.00 12.51 ? 364 ARG C CD  1 
ATOM   8555  N NE  . ARG C 1 365 ? -52.478 22.737  -64.819 1.00 12.91 ? 364 ARG C NE  1 
ATOM   8556  C CZ  . ARG C 1 365 ? -52.032 23.961  -65.118 1.00 14.32 ? 364 ARG C CZ  1 
ATOM   8557  N NH1 . ARG C 1 365 ? -50.748 24.197  -65.368 1.00 15.04 ? 364 ARG C NH1 1 
ATOM   8558  N NH2 . ARG C 1 365 ? -52.891 24.967  -65.189 1.00 14.41 ? 364 ARG C NH2 1 
ATOM   8559  N N   . ASP C 1 366 ? -54.603 19.126  -68.591 1.00 13.09 ? 365 ASP C N   1 
ATOM   8560  C CA  . ASP C 1 366 ? -55.970 18.761  -68.982 1.00 14.41 ? 365 ASP C CA  1 
ATOM   8561  C C   . ASP C 1 366 ? -55.992 17.372  -69.598 1.00 14.66 ? 365 ASP C C   1 
ATOM   8562  O O   . ASP C 1 366 ? -56.890 16.598  -69.296 1.00 16.15 ? 365 ASP C O   1 
ATOM   8563  C CB  . ASP C 1 366 ? -56.593 19.780  -69.962 1.00 14.50 ? 365 ASP C CB  1 
ATOM   8564  C CG  . ASP C 1 366 ? -56.894 21.126  -69.306 1.00 16.87 ? 365 ASP C CG  1 
ATOM   8565  O OD1 . ASP C 1 366 ? -57.059 21.183  -68.075 1.00 18.88 ? 365 ASP C OD1 1 
ATOM   8566  O OD2 . ASP C 1 366 ? -56.950 22.145  -70.030 1.00 20.27 ? 365 ASP C OD2 1 
ATOM   8567  N N   . VAL C 1 367 ? -55.014 17.071  -70.458 1.00 14.52 ? 366 VAL C N   1 
ATOM   8568  C CA  . VAL C 1 367 ? -54.868 15.749  -71.077 1.00 14.50 ? 366 VAL C CA  1 
ATOM   8569  C C   . VAL C 1 367 ? -54.655 14.652  -70.009 1.00 14.15 ? 366 VAL C C   1 
ATOM   8570  O O   . VAL C 1 367 ? -55.264 13.591  -70.059 1.00 13.61 ? 366 VAL C O   1 
ATOM   8571  C CB  . VAL C 1 367 ? -53.698 15.792  -72.132 1.00 14.93 ? 366 VAL C CB  1 
ATOM   8572  C CG1 . VAL C 1 367 ? -53.113 14.410  -72.439 1.00 16.13 ? 366 VAL C CG1 1 
ATOM   8573  C CG2 . VAL C 1 367 ? -54.164 16.483  -73.410 1.00 15.08 ? 366 VAL C CG2 1 
ATOM   8574  N N   . LEU C 1 368 ? -53.827 14.955  -69.007 1.00 13.98 ? 367 LEU C N   1 
ATOM   8575  C CA  . LEU C 1 368 ? -53.494 14.021  -67.928 1.00 12.77 ? 367 LEU C CA  1 
ATOM   8576  C C   . LEU C 1 368 ? -54.580 13.862  -66.863 1.00 12.86 ? 367 LEU C C   1 
ATOM   8577  O O   . LEU C 1 368 ? -54.504 12.937  -66.058 1.00 11.45 ? 367 LEU C O   1 
ATOM   8578  C CB  . LEU C 1 368 ? -52.201 14.461  -67.220 1.00 11.89 ? 367 LEU C CB  1 
ATOM   8579  C CG  . LEU C 1 368 ? -50.926 14.477  -68.055 1.00 12.25 ? 367 LEU C CG  1 
ATOM   8580  C CD1 . LEU C 1 368 ? -49.792 15.142  -67.254 1.00 9.98  ? 367 LEU C CD1 1 
ATOM   8581  C CD2 . LEU C 1 368 ? -50.532 13.052  -68.550 1.00 10.19 ? 367 LEU C CD2 1 
ATOM   8582  N N   . GLY C 1 369 ? -55.566 14.760  -66.842 1.00 12.27 ? 368 GLY C N   1 
ATOM   8583  C CA  . GLY C 1 369 ? -56.583 14.753  -65.803 1.00 12.06 ? 368 GLY C CA  1 
ATOM   8584  C C   . GLY C 1 369 ? -56.221 15.510  -64.532 1.00 11.99 ? 368 GLY C C   1 
ATOM   8585  O O   . GLY C 1 369 ? -56.846 15.313  -63.501 1.00 10.76 ? 368 GLY C O   1 
ATOM   8586  N N   . ILE C 1 370 ? -55.203 16.375  -64.605 1.00 11.56 ? 369 ILE C N   1 
ATOM   8587  C CA  . ILE C 1 370 ? -54.813 17.191  -63.469 1.00 10.50 ? 369 ILE C CA  1 
ATOM   8588  C C   . ILE C 1 370 ? -55.693 18.439  -63.530 1.00 11.03 ? 369 ILE C C   1 
ATOM   8589  O O   . ILE C 1 370 ? -55.274 19.534  -63.912 1.00 11.00 ? 369 ILE C O   1 
ATOM   8590  C CB  . ILE C 1 370 ? -53.306 17.536  -63.480 1.00 10.45 ? 369 ILE C CB  1 
ATOM   8591  C CG1 . ILE C 1 370 ? -52.458 16.285  -63.692 1.00 9.88  ? 369 ILE C CG1 1 
ATOM   8592  C CG2 . ILE C 1 370 ? -52.867 18.215  -62.173 1.00 9.76  ? 369 ILE C CG2 1 
ATOM   8593  C CD1 . ILE C 1 370 ? -51.014 16.562  -63.627 1.00 8.83  ? 369 ILE C CD1 1 
ATOM   8594  N N   . SER C 1 371 ? -56.944 18.247  -63.164 1.00 10.74 ? 370 SER C N   1 
ATOM   8595  C CA  . SER C 1 371 ? -57.924 19.289  -63.253 1.00 10.78 ? 370 SER C CA  1 
ATOM   8596  C C   . SER C 1 371 ? -57.868 20.166  -61.998 1.00 11.88 ? 370 SER C C   1 
ATOM   8597  O O   . SER C 1 371 ? -57.160 19.842  -61.036 1.00 11.29 ? 370 SER C O   1 
ATOM   8598  C CB  . SER C 1 371 ? -59.309 18.645  -63.394 1.00 11.20 ? 370 SER C CB  1 
ATOM   8599  O OG  . SER C 1 371 ? -59.647 17.917  -62.210 1.00 8.28  ? 370 SER C OG  1 
ATOM   8600  N N   . ASP C 1 372 ? -58.669 21.230  -61.990 1.00 11.46 ? 371 ASP C N   1 
ATOM   8601  C CA  . ASP C 1 372 ? -58.783 22.100  -60.818 1.00 12.85 ? 371 ASP C CA  1 
ATOM   8602  C C   . ASP C 1 372 ? -59.564 21.487  -59.641 1.00 11.57 ? 371 ASP C C   1 
ATOM   8603  O O   . ASP C 1 372 ? -59.691 22.098  -58.554 1.00 12.10 ? 371 ASP C O   1 
ATOM   8604  C CB  . ASP C 1 372 ? -59.427 23.438  -61.232 1.00 14.00 ? 371 ASP C CB  1 
ATOM   8605  C CG  . ASP C 1 372 ? -58.503 24.293  -62.107 1.00 18.15 ? 371 ASP C CG  1 
ATOM   8606  O OD1 . ASP C 1 372 ? -57.291 23.954  -62.288 1.00 25.94 ? 371 ASP C OD1 1 
ATOM   8607  O OD2 . ASP C 1 372 ? -58.990 25.324  -62.605 1.00 24.64 ? 371 ASP C OD2 1 
ATOM   8608  N N   . THR C 1 373 ? -60.100 20.297  -59.841 1.00 11.18 ? 372 THR C N   1 
ATOM   8609  C CA  . THR C 1 373 ? -60.749 19.575  -58.752 1.00 10.65 ? 372 THR C CA  1 
ATOM   8610  C C   . THR C 1 373 ? -59.915 18.402  -58.233 1.00 9.97  ? 372 THR C C   1 
ATOM   8611  O O   . THR C 1 373 ? -60.309 17.751  -57.270 1.00 9.09  ? 372 THR C O   1 
ATOM   8612  C CB  . THR C 1 373 ? -62.183 19.108  -59.130 1.00 10.57 ? 372 THR C CB  1 
ATOM   8613  O OG1 . THR C 1 373 ? -62.170 18.412  -60.385 1.00 12.68 ? 372 THR C OG1 1 
ATOM   8614  C CG2 . THR C 1 373 ? -63.143 20.330  -59.164 1.00 10.42 ? 372 THR C CG2 1 
ATOM   8615  N N   . LEU C 1 374 ? -58.760 18.152  -58.833 1.00 9.65  ? 373 LEU C N   1 
ATOM   8616  C CA  . LEU C 1 374 ? -57.856 17.108  -58.326 1.00 10.16 ? 373 LEU C CA  1 
ATOM   8617  C C   . LEU C 1 374 ? -57.052 17.596  -57.114 1.00 10.25 ? 373 LEU C C   1 
ATOM   8618  O O   . LEU C 1 374 ? -56.318 18.581  -57.186 1.00 10.65 ? 373 LEU C O   1 
ATOM   8619  C CB  . LEU C 1 374 ? -56.887 16.600  -59.408 1.00 9.82  ? 373 LEU C CB  1 
ATOM   8620  C CG  . LEU C 1 374 ? -55.989 15.431  -58.961 1.00 10.76 ? 373 LEU C CG  1 
ATOM   8621  C CD1 . LEU C 1 374 ? -55.590 14.501  -60.126 1.00 10.71 ? 373 LEU C CD1 1 
ATOM   8622  C CD2 . LEU C 1 374 ? -54.717 15.935  -58.190 1.00 8.18  ? 373 LEU C CD2 1 
ATOM   8623  N N   . ILE C 1 375 ? -57.204 16.877  -56.008 1.00 10.31 ? 374 ILE C N   1 
ATOM   8624  C CA  . ILE C 1 375 ? -56.516 17.186  -54.744 1.00 9.74  ? 374 ILE C CA  1 
ATOM   8625  C C   . ILE C 1 375 ? -55.607 15.988  -54.485 1.00 10.22 ? 374 ILE C C   1 
ATOM   8626  O O   . ILE C 1 375 ? -56.014 14.829  -54.659 1.00 9.21  ? 374 ILE C O   1 
ATOM   8627  C CB  . ILE C 1 375 ? -57.547 17.363  -53.596 1.00 10.19 ? 374 ILE C CB  1 
ATOM   8628  C CG1 . ILE C 1 375 ? -58.386 18.639  -53.839 1.00 9.41  ? 374 ILE C CG1 1 
ATOM   8629  C CG2 . ILE C 1 375 ? -56.886 17.465  -52.198 1.00 10.03 ? 374 ILE C CG2 1 
ATOM   8630  C CD1 . ILE C 1 375 ? -59.685 18.604  -53.182 1.00 9.17  ? 374 ILE C CD1 1 
ATOM   8631  N N   . ARG C 1 376 ? -54.393 16.276  -54.044 1.00 10.30 ? 375 ARG C N   1 
ATOM   8632  C CA  . ARG C 1 376 ? -53.511 15.245  -53.552 1.00 9.74  ? 375 ARG C CA  1 
ATOM   8633  C C   . ARG C 1 376 ? -53.217 15.403  -52.050 1.00 9.74  ? 375 ARG C C   1 
ATOM   8634  O O   . ARG C 1 376 ? -52.864 16.489  -51.582 1.00 9.39  ? 375 ARG C O   1 
ATOM   8635  C CB  . ARG C 1 376 ? -52.238 15.292  -54.371 1.00 9.47  ? 375 ARG C CB  1 
ATOM   8636  C CG  . ARG C 1 376 ? -51.373 14.097  -54.184 1.00 10.07 ? 375 ARG C CG  1 
ATOM   8637  C CD  . ARG C 1 376 ? -49.994 14.415  -54.650 1.00 8.85  ? 375 ARG C CD  1 
ATOM   8638  N NE  . ARG C 1 376 ? -49.314 15.254  -53.694 1.00 8.24  ? 375 ARG C NE  1 
ATOM   8639  C CZ  . ARG C 1 376 ? -48.165 15.875  -53.920 1.00 10.05 ? 375 ARG C CZ  1 
ATOM   8640  N NH1 . ARG C 1 376 ? -47.566 15.757  -55.085 1.00 10.37 ? 375 ARG C NH1 1 
ATOM   8641  N NH2 . ARG C 1 376 ? -47.598 16.610  -52.960 1.00 9.89  ? 375 ARG C NH2 1 
ATOM   8642  N N   . LEU C 1 377 ? -53.379 14.300  -51.305 1.00 9.42  ? 376 LEU C N   1 
ATOM   8643  C CA  . LEU C 1 377 ? -53.063 14.236  -49.904 1.00 9.67  ? 376 LEU C CA  1 
ATOM   8644  C C   . LEU C 1 377 ? -51.805 13.427  -49.739 1.00 9.62  ? 376 LEU C C   1 
ATOM   8645  O O   . LEU C 1 377 ? -51.629 12.407  -50.426 1.00 9.45  ? 376 LEU C O   1 
ATOM   8646  C CB  . LEU C 1 377 ? -54.168 13.501  -49.119 1.00 9.12  ? 376 LEU C CB  1 
ATOM   8647  C CG  . LEU C 1 377 ? -55.581 14.090  -49.247 1.00 10.08 ? 376 LEU C CG  1 
ATOM   8648  C CD1 . LEU C 1 377 ? -56.580 13.282  -48.404 1.00 7.04  ? 376 LEU C CD1 1 
ATOM   8649  C CD2 . LEU C 1 377 ? -55.599 15.562  -48.854 1.00 8.21  ? 376 LEU C CD2 1 
ATOM   8650  N N   . SER C 1 378 ? -50.944 13.885  -48.829 1.00 9.20  ? 377 SER C N   1 
ATOM   8651  C CA  . SER C 1 378 ? -49.871 13.068  -48.283 1.00 8.80  ? 377 SER C CA  1 
ATOM   8652  C C   . SER C 1 378 ? -50.281 12.761  -46.859 1.00 8.60  ? 377 SER C C   1 
ATOM   8653  O O   . SER C 1 378 ? -50.218 13.648  -46.002 1.00 9.40  ? 377 SER C O   1 
ATOM   8654  C CB  . SER C 1 378 ? -48.535 13.824  -48.297 1.00 9.02  ? 377 SER C CB  1 
ATOM   8655  O OG  . SER C 1 378 ? -47.532 13.042  -47.672 1.00 8.15  ? 377 SER C OG  1 
ATOM   8656  N N   . VAL C 1 379 ? -50.763 11.545  -46.607 1.00 7.56  ? 378 VAL C N   1 
ATOM   8657  C CA  . VAL C 1 379 ? -51.237 11.179  -45.276 1.00 7.65  ? 378 VAL C CA  1 
ATOM   8658  C C   . VAL C 1 379 ? -50.063 10.796  -44.368 1.00 8.16  ? 378 VAL C C   1 
ATOM   8659  O O   . VAL C 1 379 ? -49.247 9.947   -44.714 1.00 9.28  ? 378 VAL C O   1 
ATOM   8660  C CB  . VAL C 1 379 ? -52.287 10.041  -45.301 1.00 7.56  ? 378 VAL C CB  1 
ATOM   8661  C CG1 . VAL C 1 379 ? -52.761 9.729   -43.881 1.00 5.56  ? 378 VAL C CG1 1 
ATOM   8662  C CG2 . VAL C 1 379 ? -53.457 10.420  -46.244 1.00 6.46  ? 378 VAL C CG2 1 
ATOM   8663  N N   . GLY C 1 380 ? -50.004 11.456  -43.211 1.00 7.58  ? 379 GLY C N   1 
ATOM   8664  C CA  . GLY C 1 380 ? -48.866 11.394  -42.328 1.00 7.45  ? 379 GLY C CA  1 
ATOM   8665  C C   . GLY C 1 380 ? -49.109 10.368  -41.224 1.00 8.38  ? 379 GLY C C   1 
ATOM   8666  O O   . GLY C 1 380 ? -49.921 9.435   -41.368 1.00 7.78  ? 379 GLY C O   1 
ATOM   8667  N N   . LEU C 1 381 ? -48.416 10.553  -40.105 1.00 9.16  ? 380 LEU C N   1 
ATOM   8668  C CA  . LEU C 1 381 ? -48.404 9.562   -39.053 1.00 9.75  ? 380 LEU C CA  1 
ATOM   8669  C C   . LEU C 1 381 ? -49.219 9.976   -37.829 1.00 10.28 ? 380 LEU C C   1 
ATOM   8670  O O   . LEU C 1 381 ? -49.117 9.334   -36.786 1.00 10.57 ? 380 LEU C O   1 
ATOM   8671  C CB  . LEU C 1 381 ? -46.956 9.277   -38.650 1.00 10.47 ? 380 LEU C CB  1 
ATOM   8672  C CG  . LEU C 1 381 ? -46.017 8.859   -39.781 1.00 9.58  ? 380 LEU C CG  1 
ATOM   8673  C CD1 . LEU C 1 381 ? -44.615 8.645   -39.191 1.00 11.15 ? 380 LEU C CD1 1 
ATOM   8674  C CD2 . LEU C 1 381 ? -46.547 7.598   -40.502 1.00 9.64  ? 380 LEU C CD2 1 
ATOM   8675  N N   . GLU C 1 382 ? -50.056 11.014  -37.953 1.00 10.63 ? 381 GLU C N   1 
ATOM   8676  C CA  . GLU C 1 382 ? -50.976 11.372  -36.859 1.00 10.50 ? 381 GLU C CA  1 
ATOM   8677  C C   . GLU C 1 382 ? -52.033 10.295  -36.591 1.00 11.43 ? 381 GLU C C   1 
ATOM   8678  O O   . GLU C 1 382 ? -52.134 9.270   -37.303 1.00 10.76 ? 381 GLU C O   1 
ATOM   8679  C CB  . GLU C 1 382 ? -51.676 12.727  -37.131 1.00 11.06 ? 381 GLU C CB  1 
ATOM   8680  C CG  . GLU C 1 382 ? -50.726 13.857  -37.415 1.00 8.57  ? 381 GLU C CG  1 
ATOM   8681  C CD  . GLU C 1 382 ? -50.482 14.056  -38.909 1.00 7.38  ? 381 GLU C CD  1 
ATOM   8682  O OE1 . GLU C 1 382 ? -50.136 15.185  -39.296 1.00 9.14  ? 381 GLU C OE1 1 
ATOM   8683  O OE2 . GLU C 1 382 ? -50.636 13.100  -39.693 1.00 7.37  ? 381 GLU C OE2 1 
ATOM   8684  N N   . ASP C 1 383 ? -52.811 10.510  -35.536 1.00 11.44 ? 382 ASP C N   1 
ATOM   8685  C CA  . ASP C 1 383 ? -53.845 9.540   -35.171 1.00 12.48 ? 382 ASP C CA  1 
ATOM   8686  C C   . ASP C 1 383 ? -54.911 9.468   -36.231 1.00 12.72 ? 382 ASP C C   1 
ATOM   8687  O O   . ASP C 1 383 ? -55.438 10.485  -36.684 1.00 11.97 ? 382 ASP C O   1 
ATOM   8688  C CB  . ASP C 1 383 ? -54.455 9.856   -33.812 1.00 11.47 ? 382 ASP C CB  1 
ATOM   8689  C CG  . ASP C 1 383 ? -53.494 9.584   -32.708 1.00 13.01 ? 382 ASP C CG  1 
ATOM   8690  O OD1 . ASP C 1 383 ? -53.279 8.395   -32.429 1.00 16.81 ? 382 ASP C OD1 1 
ATOM   8691  O OD2 . ASP C 1 383 ? -52.894 10.533  -32.183 1.00 13.39 ? 382 ASP C OD2 1 
ATOM   8692  N N   . GLU C 1 384 ? -55.229 8.249   -36.619 1.00 13.26 ? 383 GLU C N   1 
ATOM   8693  C CA  . GLU C 1 384 ? -56.127 8.049   -37.723 1.00 14.49 ? 383 GLU C CA  1 
ATOM   8694  C C   . GLU C 1 384 ? -57.441 8.814   -37.565 1.00 14.85 ? 383 GLU C C   1 
ATOM   8695  O O   . GLU C 1 384 ? -57.901 9.431   -38.498 1.00 15.42 ? 383 GLU C O   1 
ATOM   8696  C CB  . GLU C 1 384 ? -56.399 6.564   -37.906 1.00 14.60 ? 383 GLU C CB  1 
ATOM   8697  C CG  . GLU C 1 384 ? -57.394 6.241   -39.018 1.00 15.20 ? 383 GLU C CG  1 
ATOM   8698  C CD  . GLU C 1 384 ? -57.851 4.792   -38.981 1.00 16.30 ? 383 GLU C CD  1 
ATOM   8699  O OE1 . GLU C 1 384 ? -59.068 4.567   -38.860 1.00 16.53 ? 383 GLU C OE1 1 
ATOM   8700  O OE2 . GLU C 1 384 ? -56.993 3.889   -39.066 1.00 19.27 ? 383 GLU C OE2 1 
ATOM   8701  N N   . GLU C 1 385 ? -58.061 8.754   -36.397 1.00 15.82 ? 384 GLU C N   1 
ATOM   8702  C CA  . GLU C 1 385 ? -59.379 9.343   -36.252 1.00 16.25 ? 384 GLU C CA  1 
ATOM   8703  C C   . GLU C 1 385 ? -59.308 10.861  -36.366 1.00 15.01 ? 384 GLU C C   1 
ATOM   8704  O O   . GLU C 1 385 ? -60.255 11.501  -36.842 1.00 14.90 ? 384 GLU C O   1 
ATOM   8705  C CB  . GLU C 1 385 ? -60.037 8.924   -34.933 1.00 16.68 ? 384 GLU C CB  1 
ATOM   8706  C CG  . GLU C 1 385 ? -61.605 9.065   -34.918 1.00 19.83 ? 384 GLU C CG  1 
ATOM   8707  C CD  . GLU C 1 385 ? -62.325 8.886   -36.303 1.00 26.27 ? 384 GLU C CD  1 
ATOM   8708  O OE1 . GLU C 1 385 ? -62.505 7.721   -36.788 1.00 27.66 ? 384 GLU C OE1 1 
ATOM   8709  O OE2 . GLU C 1 385 ? -62.756 9.932   -36.877 1.00 29.37 ? 384 GLU C OE2 1 
ATOM   8710  N N   . ASP C 1 386 ? -58.185 11.446  -35.954 1.00 14.06 ? 385 ASP C N   1 
ATOM   8711  C CA  . ASP C 1 386 ? -58.036 12.888  -36.074 1.00 13.70 ? 385 ASP C CA  1 
ATOM   8712  C C   . ASP C 1 386 ? -57.959 13.295  -37.541 1.00 12.64 ? 385 ASP C C   1 
ATOM   8713  O O   . ASP C 1 386 ? -58.474 14.340  -37.916 1.00 12.41 ? 385 ASP C O   1 
ATOM   8714  C CB  . ASP C 1 386 ? -56.786 13.402  -35.370 1.00 13.32 ? 385 ASP C CB  1 
ATOM   8715  C CG  . ASP C 1 386 ? -56.833 13.223  -33.875 1.00 14.97 ? 385 ASP C CG  1 
ATOM   8716  O OD1 . ASP C 1 386 ? -57.927 13.226  -33.282 1.00 17.40 ? 385 ASP C OD1 1 
ATOM   8717  O OD2 . ASP C 1 386 ? -55.759 13.075  -33.292 1.00 12.85 ? 385 ASP C OD2 1 
ATOM   8718  N N   . LEU C 1 387 ? -57.263 12.505  -38.346 1.00 12.41 ? 386 LEU C N   1 
ATOM   8719  C CA  . LEU C 1 387 ? -57.151 12.781  -39.782 1.00 12.72 ? 386 LEU C CA  1 
ATOM   8720  C C   . LEU C 1 387 ? -58.516 12.629  -40.488 1.00 13.23 ? 386 LEU C C   1 
ATOM   8721  O O   . LEU C 1 387 ? -58.849 13.413  -41.374 1.00 13.13 ? 386 LEU C O   1 
ATOM   8722  C CB  . LEU C 1 387 ? -56.099 11.867  -40.450 1.00 12.92 ? 386 LEU C CB  1 
ATOM   8723  C CG  . LEU C 1 387 ? -54.660 12.115  -39.995 1.00 12.46 ? 386 LEU C CG  1 
ATOM   8724  C CD1 . LEU C 1 387 ? -53.654 11.064  -40.468 1.00 14.52 ? 386 LEU C CD1 1 
ATOM   8725  C CD2 . LEU C 1 387 ? -54.216 13.504  -40.444 1.00 13.20 ? 386 LEU C CD2 1 
ATOM   8726  N N   . LEU C 1 388 ? -59.299 11.628  -40.093 1.00 13.59 ? 387 LEU C N   1 
ATOM   8727  C CA  . LEU C 1 388 ? -60.588 11.367  -40.761 1.00 14.07 ? 387 LEU C CA  1 
ATOM   8728  C C   . LEU C 1 388 ? -61.595 12.432  -40.367 1.00 14.84 ? 387 LEU C C   1 
ATOM   8729  O O   . LEU C 1 388 ? -62.387 12.864  -41.200 1.00 14.96 ? 387 LEU C O   1 
ATOM   8730  C CB  . LEU C 1 388 ? -61.128 9.986   -40.433 1.00 13.75 ? 387 LEU C CB  1 
ATOM   8731  C CG  . LEU C 1 388 ? -60.350 8.799   -40.982 1.00 15.11 ? 387 LEU C CG  1 
ATOM   8732  C CD1 . LEU C 1 388 ? -61.067 7.501   -40.593 1.00 14.12 ? 387 LEU C CD1 1 
ATOM   8733  C CD2 . LEU C 1 388 ? -60.171 8.901   -42.491 1.00 14.36 ? 387 LEU C CD2 1 
ATOM   8734  N N   . GLU C 1 389 ? -61.542 12.850  -39.106 1.00 16.26 ? 388 GLU C N   1 
ATOM   8735  C CA  . GLU C 1 389 ? -62.351 13.955  -38.608 1.00 17.93 ? 388 GLU C CA  1 
ATOM   8736  C C   . GLU C 1 389 ? -62.073 15.241  -39.388 1.00 15.29 ? 388 GLU C C   1 
ATOM   8737  O O   . GLU C 1 389 ? -62.995 15.958  -39.764 1.00 15.12 ? 388 GLU C O   1 
ATOM   8738  C CB  . GLU C 1 389 ? -62.086 14.193  -37.117 1.00 18.11 ? 388 GLU C CB  1 
ATOM   8739  C CG  . GLU C 1 389 ? -62.966 13.348  -36.160 1.00 23.76 ? 388 GLU C CG  1 
ATOM   8740  C CD  . GLU C 1 389 ? -62.348 13.055  -34.755 1.00 24.94 ? 388 GLU C CD  1 
ATOM   8741  O OE1 . GLU C 1 389 ? -61.263 13.602  -34.386 1.00 36.17 ? 388 GLU C OE1 1 
ATOM   8742  O OE2 . GLU C 1 389 ? -62.975 12.247  -34.010 1.00 33.44 ? 388 GLU C OE2 1 
ATOM   8743  N N   . ASP C 1 390 ? -60.794 15.548  -39.593 1.00 14.38 ? 389 ASP C N   1 
ATOM   8744  C CA  . ASP C 1 390 ? -60.398 16.742  -40.320 1.00 13.28 ? 389 ASP C CA  1 
ATOM   8745  C C   . ASP C 1 390 ? -60.944 16.771  -41.755 1.00 13.05 ? 389 ASP C C   1 
ATOM   8746  O O   . ASP C 1 390 ? -61.473 17.778  -42.231 1.00 13.28 ? 389 ASP C O   1 
ATOM   8747  C CB  . ASP C 1 390 ? -58.863 16.893  -40.363 1.00 13.07 ? 389 ASP C CB  1 
ATOM   8748  C CG  . ASP C 1 390 ? -58.433 18.295  -40.738 1.00 12.40 ? 389 ASP C CG  1 
ATOM   8749  O OD1 . ASP C 1 390 ? -59.154 19.253  -40.352 1.00 13.73 ? 389 ASP C OD1 1 
ATOM   8750  O OD2 . ASP C 1 390 ? -57.385 18.464  -41.420 1.00 8.41  ? 389 ASP C OD2 1 
ATOM   8751  N N   . LEU C 1 391 ? -60.787 15.664  -42.449 1.00 12.21 ? 390 LEU C N   1 
ATOM   8752  C CA  . LEU C 1 391 ? -61.311 15.536  -43.787 1.00 11.70 ? 390 LEU C CA  1 
ATOM   8753  C C   . LEU C 1 391 ? -62.835 15.610  -43.798 1.00 11.89 ? 390 LEU C C   1 
ATOM   8754  O O   . LEU C 1 391 ? -63.416 16.266  -44.627 1.00 11.17 ? 390 LEU C O   1 
ATOM   8755  C CB  . LEU C 1 391 ? -60.876 14.219  -44.384 1.00 10.47 ? 390 LEU C CB  1 
ATOM   8756  C CG  . LEU C 1 391 ? -59.381 14.087  -44.635 1.00 9.75  ? 390 LEU C CG  1 
ATOM   8757  C CD1 . LEU C 1 391 ? -59.087 12.638  -45.028 1.00 9.35  ? 390 LEU C CD1 1 
ATOM   8758  C CD2 . LEU C 1 391 ? -58.879 15.129  -45.691 1.00 6.55  ? 390 LEU C CD2 1 
ATOM   8759  N N   . ASP C 1 392 ? -63.465 14.937  -42.854 1.00 13.61 ? 391 ASP C N   1 
ATOM   8760  C CA  . ASP C 1 392 ? -64.930 14.921  -42.793 1.00 14.47 ? 391 ASP C CA  1 
ATOM   8761  C C   . ASP C 1 392 ? -65.517 16.331  -42.647 1.00 13.50 ? 391 ASP C C   1 
ATOM   8762  O O   . ASP C 1 392 ? -66.399 16.734  -43.427 1.00 14.32 ? 391 ASP C O   1 
ATOM   8763  C CB  . ASP C 1 392 ? -65.393 14.005  -41.673 1.00 15.04 ? 391 ASP C CB  1 
ATOM   8764  C CG  . ASP C 1 392 ? -66.897 13.800  -41.678 1.00 18.63 ? 391 ASP C CG  1 
ATOM   8765  O OD1 . ASP C 1 392 ? -67.483 13.472  -42.740 1.00 21.24 ? 391 ASP C OD1 1 
ATOM   8766  O OD2 . ASP C 1 392 ? -67.483 14.002  -40.612 1.00 22.97 ? 391 ASP C OD2 1 
ATOM   8767  N N   . GLN C 1 393 ? -65.021 17.084  -41.676 1.00 13.45 ? 392 GLN C N   1 
ATOM   8768  C CA  . GLN C 1 393 ? -65.503 18.446  -41.440 1.00 13.26 ? 392 GLN C CA  1 
ATOM   8769  C C   . GLN C 1 393 ? -65.173 19.416  -42.602 1.00 13.47 ? 392 GLN C C   1 
ATOM   8770  O O   . GLN C 1 393 ? -65.957 20.306  -42.916 1.00 13.22 ? 392 GLN C O   1 
ATOM   8771  C CB  . GLN C 1 393 ? -65.016 18.980  -40.075 1.00 13.95 ? 392 GLN C CB  1 
ATOM   8772  C CG  . GLN C 1 393 ? -63.469 19.224  -39.895 1.00 13.96 ? 392 GLN C CG  1 
ATOM   8773  C CD  . GLN C 1 393 ? -62.983 20.516  -40.502 1.00 14.93 ? 392 GLN C CD  1 
ATOM   8774  O OE1 . GLN C 1 393 ? -63.717 21.503  -40.534 1.00 14.10 ? 392 GLN C OE1 1 
ATOM   8775  N NE2 . GLN C 1 393 ? -61.735 20.526  -40.999 1.00 13.11 ? 392 GLN C NE2 1 
ATOM   8776  N N   . ALA C 1 394 ? -64.032 19.227  -43.263 1.00 13.18 ? 393 ALA C N   1 
ATOM   8777  C CA  . ALA C 1 394 ? -63.660 20.090  -44.377 1.00 13.26 ? 393 ALA C CA  1 
ATOM   8778  C C   . ALA C 1 394 ? -64.551 19.840  -45.597 1.00 13.53 ? 393 ALA C C   1 
ATOM   8779  O O   . ALA C 1 394 ? -64.945 20.773  -46.300 1.00 14.03 ? 393 ALA C O   1 
ATOM   8780  C CB  . ALA C 1 394 ? -62.156 19.912  -44.712 1.00 13.61 ? 393 ALA C CB  1 
ATOM   8781  N N   . LEU C 1 395 ? -64.872 18.583  -45.864 1.00 13.30 ? 394 LEU C N   1 
ATOM   8782  C CA  . LEU C 1 395 ? -65.745 18.243  -46.975 1.00 13.27 ? 394 LEU C CA  1 
ATOM   8783  C C   . LEU C 1 395 ? -67.159 18.778  -46.696 1.00 14.10 ? 394 LEU C C   1 
ATOM   8784  O O   . LEU C 1 395 ? -67.834 19.246  -47.596 1.00 12.92 ? 394 LEU C O   1 
ATOM   8785  C CB  . LEU C 1 395 ? -65.769 16.726  -47.227 1.00 12.46 ? 394 LEU C CB  1 
ATOM   8786  C CG  . LEU C 1 395 ? -64.524 16.188  -47.942 1.00 12.71 ? 394 LEU C CG  1 
ATOM   8787  C CD1 . LEU C 1 395 ? -64.370 14.641  -47.875 1.00 9.12  ? 394 LEU C CD1 1 
ATOM   8788  C CD2 . LEU C 1 395 ? -64.424 16.691  -49.383 1.00 10.12 ? 394 LEU C CD2 1 
ATOM   8789  N N   . LYS C 1 396 ? -67.574 18.723  -45.435 1.00 15.64 ? 395 LYS C N   1 
ATOM   8790  C CA  . LYS C 1 396 ? -68.860 19.253  -45.035 1.00 16.72 ? 395 LYS C CA  1 
ATOM   8791  C C   . LYS C 1 396 ? -68.933 20.745  -45.258 1.00 16.56 ? 395 LYS C C   1 
ATOM   8792  O O   . LYS C 1 396 ? -69.954 21.257  -45.735 1.00 16.16 ? 395 LYS C O   1 
ATOM   8793  C CB  . LYS C 1 396 ? -69.135 18.955  -43.572 1.00 17.44 ? 395 LYS C CB  1 
ATOM   8794  C CG  . LYS C 1 396 ? -69.564 17.553  -43.292 1.00 19.37 ? 395 LYS C CG  1 
ATOM   8795  C CD  . LYS C 1 396 ? -69.657 17.321  -41.798 1.00 19.74 ? 395 LYS C CD  1 
ATOM   8796  C CE  . LYS C 1 396 ? -70.545 16.142  -41.470 1.00 23.55 ? 395 LYS C CE  1 
ATOM   8797  N NZ  . LYS C 1 396 ? -69.796 14.879  -41.312 1.00 24.36 ? 395 LYS C NZ  1 
ATOM   8798  N N   . ALA C 1 397 ? -67.849 21.447  -44.922 1.00 15.59 ? 396 ALA C N   1 
ATOM   8799  C CA  . ALA C 1 397 ? -67.778 22.881  -45.154 1.00 15.19 ? 396 ALA C CA  1 
ATOM   8800  C C   . ALA C 1 397 ? -67.870 23.196  -46.642 1.00 14.90 ? 396 ALA C C   1 
ATOM   8801  O O   . ALA C 1 397 ? -68.516 24.168  -47.009 1.00 14.84 ? 396 ALA C O   1 
ATOM   8802  C CB  . ALA C 1 397 ? -66.518 23.502  -44.526 1.00 14.87 ? 396 ALA C CB  1 
ATOM   8803  N N   . ALA C 1 398 ? -67.302 22.354  -47.504 1.00 13.95 ? 397 ALA C N   1 
ATOM   8804  C CA  . ALA C 1 398 ? -67.396 22.590  -48.963 1.00 14.03 ? 397 ALA C CA  1 
ATOM   8805  C C   . ALA C 1 398 ? -68.771 22.204  -49.529 1.00 13.92 ? 397 ALA C C   1 
ATOM   8806  O O   . ALA C 1 398 ? -69.289 22.879  -50.431 1.00 13.27 ? 397 ALA C O   1 
ATOM   8807  C CB  . ALA C 1 398 ? -66.282 21.835  -49.711 1.00 13.10 ? 397 ALA C CB  1 
ATOM   8808  N N   . HIS C 1 399 ? -69.330 21.109  -48.998 1.00 14.48 ? 398 HIS C N   1 
ATOM   8809  C CA  . HIS C 1 399 ? -70.582 20.488  -49.465 1.00 14.85 ? 398 HIS C CA  1 
ATOM   8810  C C   . HIS C 1 399 ? -70.946 20.777  -50.908 1.00 15.35 ? 398 HIS C C   1 
ATOM   8811  O O   . HIS C 1 399 ? -72.000 21.383  -51.201 1.00 15.67 ? 398 HIS C O   1 
ATOM   8812  C CB  . HIS C 1 399 ? -71.762 20.821  -48.535 1.00 15.61 ? 398 HIS C CB  1 
ATOM   8813  C CG  . HIS C 1 399 ? -71.982 22.284  -48.319 1.00 17.10 ? 398 HIS C CG  1 
ATOM   8814  N ND1 . HIS C 1 399 ? -71.396 22.975  -47.282 1.00 19.88 ? 398 HIS C ND1 1 
ATOM   8815  C CD2 . HIS C 1 399 ? -72.736 23.184  -48.994 1.00 17.40 ? 398 HIS C CD2 1 
ATOM   8816  C CE1 . HIS C 1 399 ? -71.765 24.242  -47.338 1.00 18.37 ? 398 HIS C CE1 1 
ATOM   8817  N NE2 . HIS C 1 399 ? -72.573 24.395  -48.369 1.00 19.23 ? 398 HIS C NE2 1 
ATOM   8818  N N   . PRO C 1 400 ? -70.108 20.302  -51.840 1.00 15.19 ? 399 PRO C N   1 
ATOM   8819  C CA  . PRO C 1 400 ? -70.439 20.537  -53.241 1.00 15.53 ? 399 PRO C CA  1 
ATOM   8820  C C   . PRO C 1 400 ? -71.709 19.790  -53.663 1.00 16.59 ? 399 PRO C C   1 
ATOM   8821  O O   . PRO C 1 400 ? -72.158 18.894  -52.959 1.00 15.35 ? 399 PRO C O   1 
ATOM   8822  C CB  . PRO C 1 400 ? -69.243 19.955  -53.984 1.00 15.02 ? 399 PRO C CB  1 
ATOM   8823  C CG  . PRO C 1 400 ? -68.704 18.913  -53.053 1.00 15.57 ? 399 PRO C CG  1 
ATOM   8824  C CD  . PRO C 1 400 ? -68.870 19.522  -51.693 1.00 15.55 ? 399 PRO C CD  1 
ATOM   8825  N N   . PRO C 1 401 ? -72.249 20.124  -54.840 1.00 17.78 ? 400 PRO C N   1 
ATOM   8826  C CA  . PRO C 1 401 ? -73.391 19.377  -55.397 1.00 19.53 ? 400 PRO C CA  1 
ATOM   8827  C C   . PRO C 1 401 ? -73.075 17.883  -55.454 1.00 21.18 ? 400 PRO C C   1 
ATOM   8828  O O   . PRO C 1 401 ? -72.033 17.510  -55.979 1.00 21.44 ? 400 PRO C O   1 
ATOM   8829  C CB  . PRO C 1 401 ? -73.533 19.949  -56.804 1.00 19.34 ? 400 PRO C CB  1 
ATOM   8830  C CG  . PRO C 1 401 ? -72.829 21.281  -56.745 1.00 18.73 ? 400 PRO C CG  1 
ATOM   8831  C CD  . PRO C 1 401 ? -71.764 21.175  -55.744 1.00 17.53 ? 400 PRO C CD  1 
ATOM   8832  N N   . SER C 1 402 ? -73.960 17.048  -54.907 1.00 23.51 ? 401 SER C N   1 
ATOM   8833  C CA  . SER C 1 402 ? -73.621 15.649  -54.530 1.00 25.58 ? 401 SER C CA  1 
ATOM   8834  C C   . SER C 1 402 ? -73.818 14.596  -55.627 1.00 26.03 ? 401 SER C C   1 
ATOM   8835  O O   . SER C 1 402 ? -74.244 14.916  -56.752 1.00 28.52 ? 401 SER C O   1 
ATOM   8836  C CB  . SER C 1 402 ? -74.452 15.230  -53.319 1.00 26.14 ? 401 SER C CB  1 
ATOM   8837  O OG  . SER C 1 402 ? -75.793 14.998  -53.739 1.00 29.14 ? 401 SER C OG  1 
ATOM   8838  N N   . GLY D 1 11  ? -0.261  50.679  -53.190 1.00 21.91 ? 10  GLY D N   1 
ATOM   8839  C CA  . GLY D 1 11  ? -0.365  50.833  -54.685 1.00 21.31 ? 10  GLY D CA  1 
ATOM   8840  C C   . GLY D 1 11  ? -1.493  49.989  -55.264 1.00 20.46 ? 10  GLY D C   1 
ATOM   8841  O O   . GLY D 1 11  ? -1.850  50.126  -56.432 1.00 20.45 ? 10  GLY D O   1 
ATOM   8842  N N   . PHE D 1 12  ? -2.072  49.136  -54.428 1.00 20.16 ? 11  PHE D N   1 
ATOM   8843  C CA  . PHE D 1 12  ? -3.261  48.369  -54.803 1.00 19.44 ? 11  PHE D CA  1 
ATOM   8844  C C   . PHE D 1 12  ? -4.504  49.247  -54.807 1.00 19.74 ? 11  PHE D C   1 
ATOM   8845  O O   . PHE D 1 12  ? -4.501  50.320  -54.218 1.00 20.45 ? 11  PHE D O   1 
ATOM   8846  C CB  . PHE D 1 12  ? -3.479  47.221  -53.826 1.00 18.74 ? 11  PHE D CB  1 
ATOM   8847  C CG  . PHE D 1 12  ? -2.480  46.102  -53.957 1.00 17.74 ? 11  PHE D CG  1 
ATOM   8848  C CD1 . PHE D 1 12  ? -1.235  46.198  -53.360 1.00 16.81 ? 11  PHE D CD1 1 
ATOM   8849  C CD2 . PHE D 1 12  ? -2.798  44.944  -54.664 1.00 16.44 ? 11  PHE D CD2 1 
ATOM   8850  C CE1 . PHE D 1 12  ? -0.309  45.160  -53.460 1.00 17.75 ? 11  PHE D CE1 1 
ATOM   8851  C CE2 . PHE D 1 12  ? -1.883  43.909  -54.774 1.00 16.09 ? 11  PHE D CE2 1 
ATOM   8852  C CZ  . PHE D 1 12  ? -0.641  44.005  -54.177 1.00 16.47 ? 11  PHE D CZ  1 
ATOM   8853  N N   . LEU D 1 13  ? -5.566  48.792  -55.469 1.00 19.91 ? 12  LEU D N   1 
ATOM   8854  C CA  . LEU D 1 13  ? -6.877  49.453  -55.361 1.00 20.06 ? 12  LEU D CA  1 
ATOM   8855  C C   . LEU D 1 13  ? -7.254  49.620  -53.899 1.00 19.34 ? 12  LEU D C   1 
ATOM   8856  O O   . LEU D 1 13  ? -7.024  48.717  -53.114 1.00 19.78 ? 12  LEU D O   1 
ATOM   8857  C CB  . LEU D 1 13  ? -7.970  48.617  -56.011 1.00 19.91 ? 12  LEU D CB  1 
ATOM   8858  C CG  . LEU D 1 13  ? -8.017  48.502  -57.515 1.00 21.65 ? 12  LEU D CG  1 
ATOM   8859  C CD1 . LEU D 1 13  ? -9.271  47.670  -57.870 1.00 19.89 ? 12  LEU D CD1 1 
ATOM   8860  C CD2 . LEU D 1 13  ? -8.043  49.868  -58.160 1.00 20.11 ? 12  LEU D CD2 1 
ATOM   8861  N N   . PRO D 1 14  ? -7.827  50.777  -53.519 1.00 18.96 ? 13  PRO D N   1 
ATOM   8862  C CA  . PRO D 1 14  ? -8.227  50.928  -52.122 1.00 18.15 ? 13  PRO D CA  1 
ATOM   8863  C C   . PRO D 1 14  ? -9.232  49.835  -51.775 1.00 17.28 ? 13  PRO D C   1 
ATOM   8864  O O   . PRO D 1 14  ? -9.969  49.389  -52.640 1.00 17.14 ? 13  PRO D O   1 
ATOM   8865  C CB  . PRO D 1 14  ? -8.933  52.296  -52.102 1.00 18.05 ? 13  PRO D CB  1 
ATOM   8866  C CG  . PRO D 1 14  ? -8.324  53.038  -53.248 1.00 19.58 ? 13  PRO D CG  1 
ATOM   8867  C CD  . PRO D 1 14  ? -8.163  51.976  -54.312 1.00 19.47 ? 13  PRO D CD  1 
ATOM   8868  N N   . HIS D 1 15  ? -9.263  49.426  -50.522 1.00 16.90 ? 14  HIS D N   1 
ATOM   8869  C CA  . HIS D 1 15  ? -10.231 48.434  -50.088 1.00 16.54 ? 14  HIS D CA  1 
ATOM   8870  C C   . HIS D 1 15  ? -11.660 48.922  -50.266 1.00 16.89 ? 14  HIS D C   1 
ATOM   8871  O O   . HIS D 1 15  ? -11.936 50.133  -50.167 1.00 16.22 ? 14  HIS D O   1 
ATOM   8872  C CB  . HIS D 1 15  ? -9.956  48.071  -48.645 1.00 16.80 ? 14  HIS D CB  1 
ATOM   8873  C CG  . HIS D 1 15  ? -8.794  47.143  -48.492 1.00 17.01 ? 14  HIS D CG  1 
ATOM   8874  N ND1 . HIS D 1 15  ? -8.877  45.809  -48.810 1.00 17.01 ? 14  HIS D ND1 1 
ATOM   8875  C CD2 . HIS D 1 15  ? -7.521  47.354  -48.086 1.00 18.51 ? 14  HIS D CD2 1 
ATOM   8876  C CE1 . HIS D 1 15  ? -7.708  45.230  -48.588 1.00 18.48 ? 14  HIS D CE1 1 
ATOM   8877  N NE2 . HIS D 1 15  ? -6.869  46.145  -48.144 1.00 17.50 ? 14  HIS D NE2 1 
ATOM   8878  N N   . PHE D 1 16  ? -12.565 47.965  -50.474 1.00 16.32 ? 15  PHE D N   1 
ATOM   8879  C CA  . PHE D 1 16  ? -13.960 48.258  -50.742 1.00 16.38 ? 15  PHE D CA  1 
ATOM   8880  C C   . PHE D 1 16  ? -14.618 48.764  -49.489 1.00 16.64 ? 15  PHE D C   1 
ATOM   8881  O O   . PHE D 1 16  ? -14.510 48.157  -48.425 1.00 16.76 ? 15  PHE D O   1 
ATOM   8882  C CB  . PHE D 1 16  ? -14.655 47.009  -51.244 1.00 16.66 ? 15  PHE D CB  1 
ATOM   8883  C CG  . PHE D 1 16  ? -13.990 46.427  -52.449 1.00 16.59 ? 15  PHE D CG  1 
ATOM   8884  C CD1 . PHE D 1 16  ? -13.546 45.122  -52.457 1.00 15.50 ? 15  PHE D CD1 1 
ATOM   8885  C CD2 . PHE D 1 16  ? -13.736 47.224  -53.555 1.00 17.70 ? 15  PHE D CD2 1 
ATOM   8886  C CE1 . PHE D 1 16  ? -12.897 44.606  -53.552 1.00 16.05 ? 15  PHE D CE1 1 
ATOM   8887  C CE2 . PHE D 1 16  ? -13.099 46.707  -54.668 1.00 16.24 ? 15  PHE D CE2 1 
ATOM   8888  C CZ  . PHE D 1 16  ? -12.674 45.396  -54.657 1.00 17.23 ? 15  PHE D CZ  1 
ATOM   8889  N N   . GLN D 1 17  ? -15.293 49.892  -49.612 1.00 16.11 ? 16  GLN D N   1 
ATOM   8890  C CA  . GLN D 1 17  ? -15.872 50.532  -48.456 1.00 16.84 ? 16  GLN D CA  1 
ATOM   8891  C C   . GLN D 1 17  ? -17.035 49.674  -47.919 1.00 15.25 ? 16  GLN D C   1 
ATOM   8892  O O   . GLN D 1 17  ? -17.786 49.080  -48.691 1.00 14.07 ? 16  GLN D O   1 
ATOM   8893  C CB  . GLN D 1 17  ? -16.335 51.933  -48.864 1.00 17.06 ? 16  GLN D CB  1 
ATOM   8894  C CG  . GLN D 1 17  ? -16.249 52.975  -47.770 1.00 21.04 ? 16  GLN D CG  1 
ATOM   8895  C CD  . GLN D 1 17  ? -16.930 54.312  -48.172 1.00 21.05 ? 16  GLN D CD  1 
ATOM   8896  O OE1 . GLN D 1 17  ? -17.064 55.220  -47.348 1.00 28.02 ? 16  GLN D OE1 1 
ATOM   8897  N NE2 . GLN D 1 17  ? -17.344 54.426  -49.439 1.00 25.48 ? 16  GLN D NE2 1 
ATOM   8898  N N   . HIS D 1 18  ? -17.134 49.571  -46.596 1.00 14.44 ? 17  HIS D N   1 
ATOM   8899  C CA  . HIS D 1 18  ? -18.257 48.925  -45.886 1.00 14.61 ? 17  HIS D CA  1 
ATOM   8900  C C   . HIS D 1 18  ? -18.282 47.397  -45.994 1.00 13.46 ? 17  HIS D C   1 
ATOM   8901  O O   . HIS D 1 18  ? -19.280 46.759  -45.606 1.00 13.10 ? 17  HIS D O   1 
ATOM   8902  C CB  . HIS D 1 18  ? -19.613 49.483  -46.351 1.00 14.95 ? 17  HIS D CB  1 
ATOM   8903  C CG  . HIS D 1 18  ? -19.698 50.973  -46.292 1.00 15.94 ? 17  HIS D CG  1 
ATOM   8904  N ND1 . HIS D 1 18  ? -19.529 51.684  -45.123 1.00 15.72 ? 17  HIS D ND1 1 
ATOM   8905  C CD2 . HIS D 1 18  ? -19.947 51.888  -47.261 1.00 16.82 ? 17  HIS D CD2 1 
ATOM   8906  C CE1 . HIS D 1 18  ? -19.645 52.976  -45.379 1.00 18.06 ? 17  HIS D CE1 1 
ATOM   8907  N NE2 . HIS D 1 18  ? -19.898 53.126  -46.667 1.00 17.61 ? 17  HIS D NE2 1 
ATOM   8908  N N   . PHE D 1 19  ? -17.200 46.814  -46.508 1.00 12.56 ? 18  PHE D N   1 
ATOM   8909  C CA  . PHE D 1 19  ? -17.148 45.375  -46.732 1.00 11.76 ? 18  PHE D CA  1 
ATOM   8910  C C   . PHE D 1 19  ? -17.358 44.554  -45.447 1.00 10.81 ? 18  PHE D C   1 
ATOM   8911  O O   . PHE D 1 19  ? -18.150 43.576  -45.450 1.00 10.52 ? 18  PHE D O   1 
ATOM   8912  C CB  . PHE D 1 19  ? -15.828 44.963  -47.412 1.00 12.17 ? 18  PHE D CB  1 
ATOM   8913  C CG  . PHE D 1 19  ? -15.813 43.527  -47.872 1.00 12.72 ? 18  PHE D CG  1 
ATOM   8914  C CD1 . PHE D 1 19  ? -16.006 43.203  -49.221 1.00 12.28 ? 18  PHE D CD1 1 
ATOM   8915  C CD2 . PHE D 1 19  ? -15.639 42.495  -46.965 1.00 13.19 ? 18  PHE D CD2 1 
ATOM   8916  C CE1 . PHE D 1 19  ? -16.013 41.896  -49.628 1.00 11.55 ? 18  PHE D CE1 1 
ATOM   8917  C CE2 . PHE D 1 19  ? -15.618 41.178  -47.392 1.00 12.52 ? 18  PHE D CE2 1 
ATOM   8918  C CZ  . PHE D 1 19  ? -15.805 40.880  -48.722 1.00 10.56 ? 18  PHE D CZ  1 
ATOM   8919  N N   . ALA D 1 20  ? -16.673 44.928  -44.362 1.00 10.81 ? 19  ALA D N   1 
ATOM   8920  C CA  . ALA D 1 20  ? -16.804 44.227  -43.068 1.00 10.70 ? 19  ALA D CA  1 
ATOM   8921  C C   . ALA D 1 20  ? -18.210 44.376  -42.487 1.00 11.03 ? 19  ALA D C   1 
ATOM   8922  O O   . ALA D 1 20  ? -18.827 43.390  -42.024 1.00 10.81 ? 19  ALA D O   1 
ATOM   8923  C CB  . ALA D 1 20  ? -15.750 44.740  -42.044 1.00 10.22 ? 19  ALA D CB  1 
ATOM   8924  N N   . THR D 1 21  ? -18.690 45.623  -42.451 1.00 10.79 ? 20  THR D N   1 
ATOM   8925  C CA  . THR D 1 21  ? -20.021 45.930  -41.936 1.00 9.97  ? 20  THR D CA  1 
ATOM   8926  C C   . THR D 1 21  ? -21.063 45.097  -42.673 1.00 10.20 ? 20  THR D C   1 
ATOM   8927  O O   . THR D 1 21  ? -21.931 44.462  -42.062 1.00 10.44 ? 20  THR D O   1 
ATOM   8928  C CB  . THR D 1 21  ? -20.322 47.442  -42.100 1.00 10.82 ? 20  THR D CB  1 
ATOM   8929  O OG1 . THR D 1 21  ? -19.350 48.225  -41.379 1.00 9.42  ? 20  THR D OG1 1 
ATOM   8930  C CG2 . THR D 1 21  ? -21.731 47.776  -41.611 1.00 10.71 ? 20  THR D CG2 1 
ATOM   8931  N N   . GLN D 1 22  ? -20.976 45.108  -44.002 1.00 9.89  ? 21  GLN D N   1 
ATOM   8932  C CA  . GLN D 1 22  ? -21.906 44.376  -44.850 1.00 10.66 ? 21  GLN D CA  1 
ATOM   8933  C C   . GLN D 1 22  ? -21.771 42.863  -44.747 1.00 9.83  ? 21  GLN D C   1 
ATOM   8934  O O   . GLN D 1 22  ? -22.781 42.137  -44.810 1.00 9.84  ? 21  GLN D O   1 
ATOM   8935  C CB  . GLN D 1 22  ? -21.742 44.811  -46.291 1.00 10.56 ? 21  GLN D CB  1 
ATOM   8936  C CG  . GLN D 1 22  ? -22.281 46.189  -46.525 1.00 12.12 ? 21  GLN D CG  1 
ATOM   8937  C CD  . GLN D 1 22  ? -22.055 46.666  -47.940 1.00 14.44 ? 21  GLN D CD  1 
ATOM   8938  O OE1 . GLN D 1 22  ? -21.381 46.023  -48.735 1.00 16.61 ? 21  GLN D OE1 1 
ATOM   8939  N NE2 . GLN D 1 22  ? -22.601 47.840  -48.247 1.00 23.13 ? 21  GLN D NE2 1 
ATOM   8940  N N   . ALA D 1 23  ? -20.537 42.380  -44.602 1.00 9.68  ? 22  ALA D N   1 
ATOM   8941  C CA  . ALA D 1 23  ? -20.313 40.951  -44.383 1.00 10.47 ? 22  ALA D CA  1 
ATOM   8942  C C   . ALA D 1 23  ? -21.007 40.490  -43.113 1.00 10.63 ? 22  ALA D C   1 
ATOM   8943  O O   . ALA D 1 23  ? -21.560 39.396  -43.068 1.00 11.53 ? 22  ALA D O   1 
ATOM   8944  C CB  . ALA D 1 23  ? -18.780 40.623  -44.342 1.00 10.37 ? 22  ALA D CB  1 
ATOM   8945  N N   . ILE D 1 24  ? -21.015 41.353  -42.095 1.00 10.47 ? 23  ILE D N   1 
ATOM   8946  C CA  . ILE D 1 24  ? -21.591 41.018  -40.813 1.00 9.90  ? 23  ILE D CA  1 
ATOM   8947  C C   . ILE D 1 24  ? -23.123 41.230  -40.732 1.00 10.25 ? 23  ILE D C   1 
ATOM   8948  O O   . ILE D 1 24  ? -23.789 40.525  -39.980 1.00 10.00 ? 23  ILE D O   1 
ATOM   8949  C CB  . ILE D 1 24  ? -20.815 41.742  -39.684 1.00 10.30 ? 23  ILE D CB  1 
ATOM   8950  C CG1 . ILE D 1 24  ? -19.399 41.117  -39.581 1.00 8.71  ? 23  ILE D CG1 1 
ATOM   8951  C CG2 . ILE D 1 24  ? -21.529 41.630  -38.348 1.00 7.41  ? 23  ILE D CG2 1 
ATOM   8952  C CD1 . ILE D 1 24  ? -18.396 42.001  -38.934 1.00 5.80  ? 23  ILE D CD1 1 
ATOM   8953  N N   . HIS D 1 25  ? -23.682 42.135  -41.538 1.00 10.50 ? 24  HIS D N   1 
ATOM   8954  C CA  . HIS D 1 25  ? -25.071 42.579  -41.363 1.00 10.85 ? 24  HIS D CA  1 
ATOM   8955  C C   . HIS D 1 25  ? -26.029 42.298  -42.516 1.00 11.26 ? 24  HIS D C   1 
ATOM   8956  O O   . HIS D 1 25  ? -27.206 42.096  -42.264 1.00 10.88 ? 24  HIS D O   1 
ATOM   8957  C CB  . HIS D 1 25  ? -25.090 44.069  -41.005 1.00 11.38 ? 24  HIS D CB  1 
ATOM   8958  C CG  . HIS D 1 25  ? -24.594 44.336  -39.621 1.00 10.87 ? 24  HIS D CG  1 
ATOM   8959  N ND1 . HIS D 1 25  ? -25.389 44.152  -38.515 1.00 10.85 ? 24  HIS D ND1 1 
ATOM   8960  C CD2 . HIS D 1 25  ? -23.370 44.683  -39.154 1.00 12.24 ? 24  HIS D CD2 1 
ATOM   8961  C CE1 . HIS D 1 25  ? -24.688 44.412  -37.425 1.00 12.35 ? 24  HIS D CE1 1 
ATOM   8962  N NE2 . HIS D 1 25  ? -23.461 44.737  -37.783 1.00 13.02 ? 24  HIS D NE2 1 
ATOM   8963  N N   . VAL D 1 26  ? -25.546 42.262  -43.760 1.00 10.64 ? 25  VAL D N   1 
ATOM   8964  C CA  . VAL D 1 26  ? -26.465 42.062  -44.890 1.00 10.09 ? 25  VAL D CA  1 
ATOM   8965  C C   . VAL D 1 26  ? -27.090 40.664  -44.831 1.00 10.85 ? 25  VAL D C   1 
ATOM   8966  O O   . VAL D 1 26  ? -26.402 39.665  -44.602 1.00 10.58 ? 25  VAL D O   1 
ATOM   8967  C CB  . VAL D 1 26  ? -25.790 42.327  -46.243 1.00 9.66  ? 25  VAL D CB  1 
ATOM   8968  C CG1 . VAL D 1 26  ? -26.735 41.913  -47.423 1.00 9.71  ? 25  VAL D CG1 1 
ATOM   8969  C CG2 . VAL D 1 26  ? -25.433 43.822  -46.333 1.00 8.52  ? 25  VAL D CG2 1 
ATOM   8970  N N   . GLY D 1 27  ? -28.408 40.615  -44.983 1.00 10.97 ? 26  GLY D N   1 
ATOM   8971  C CA  . GLY D 1 27  ? -29.171 39.373  -44.840 1.00 11.32 ? 26  GLY D CA  1 
ATOM   8972  C C   . GLY D 1 27  ? -29.437 38.913  -43.406 1.00 12.22 ? 26  GLY D C   1 
ATOM   8973  O O   . GLY D 1 27  ? -30.142 37.927  -43.198 1.00 13.51 ? 26  GLY D O   1 
ATOM   8974  N N   . GLN D 1 28  ? -28.912 39.636  -42.417 1.00 12.20 ? 27  GLN D N   1 
ATOM   8975  C CA  . GLN D 1 28  ? -28.864 39.165  -41.031 1.00 12.04 ? 27  GLN D CA  1 
ATOM   8976  C C   . GLN D 1 28  ? -29.745 40.008  -40.104 1.00 12.52 ? 27  GLN D C   1 
ATOM   8977  O O   . GLN D 1 28  ? -29.667 39.900  -38.877 1.00 11.89 ? 27  GLN D O   1 
ATOM   8978  C CB  . GLN D 1 28  ? -27.413 39.178  -40.532 1.00 12.20 ? 27  GLN D CB  1 
ATOM   8979  C CG  . GLN D 1 28  ? -26.377 38.697  -41.541 1.00 10.91 ? 27  GLN D CG  1 
ATOM   8980  C CD  . GLN D 1 28  ? -26.530 37.273  -41.943 1.00 11.23 ? 27  GLN D CD  1 
ATOM   8981  O OE1 . GLN D 1 28  ? -26.312 36.377  -41.126 1.00 13.61 ? 27  GLN D OE1 1 
ATOM   8982  N NE2 . GLN D 1 28  ? -26.887 37.032  -43.207 1.00 7.76  ? 27  GLN D NE2 1 
ATOM   8983  N N   . ASP D 1 29  ? -30.606 40.821  -40.704 1.00 13.08 ? 28  ASP D N   1 
ATOM   8984  C CA  . ASP D 1 29  ? -31.497 41.703  -39.975 1.00 14.75 ? 28  ASP D CA  1 
ATOM   8985  C C   . ASP D 1 29  ? -32.409 40.919  -39.052 1.00 14.60 ? 28  ASP D C   1 
ATOM   8986  O O   . ASP D 1 29  ? -33.191 40.095  -39.531 1.00 15.26 ? 28  ASP D O   1 
ATOM   8987  C CB  . ASP D 1 29  ? -32.374 42.502  -40.951 1.00 14.95 ? 28  ASP D CB  1 
ATOM   8988  C CG  . ASP D 1 29  ? -33.148 43.615  -40.267 1.00 17.45 ? 28  ASP D CG  1 
ATOM   8989  O OD1 . ASP D 1 29  ? -33.187 43.691  -39.024 1.00 14.06 ? 28  ASP D OD1 1 
ATOM   8990  O OD2 . ASP D 1 29  ? -33.728 44.436  -41.006 1.00 22.10 ? 28  ASP D OD2 1 
ATOM   8991  N N   . PRO D 1 30  ? -32.340 41.192  -37.740 1.00 14.70 ? 29  PRO D N   1 
ATOM   8992  C CA  . PRO D 1 30  ? -33.172 40.472  -36.759 1.00 15.16 ? 29  PRO D CA  1 
ATOM   8993  C C   . PRO D 1 30  ? -34.683 40.607  -36.954 1.00 15.41 ? 29  PRO D C   1 
ATOM   8994  O O   . PRO D 1 30  ? -35.445 39.767  -36.470 1.00 14.88 ? 29  PRO D O   1 
ATOM   8995  C CB  . PRO D 1 30  ? -32.797 41.136  -35.433 1.00 15.10 ? 29  PRO D CB  1 
ATOM   8996  C CG  . PRO D 1 30  ? -31.461 41.737  -35.649 1.00 14.96 ? 29  PRO D CG  1 
ATOM   8997  C CD  . PRO D 1 30  ? -31.461 42.178  -37.079 1.00 14.83 ? 29  PRO D CD  1 
ATOM   8998  N N   . GLU D 1 31  ? -35.107 41.662  -37.645 1.00 15.21 ? 30  GLU D N   1 
ATOM   8999  C CA  . GLU D 1 31  ? -36.531 41.909  -37.845 1.00 15.80 ? 30  GLU D CA  1 
ATOM   9000  C C   . GLU D 1 31  ? -37.174 40.922  -38.818 1.00 15.44 ? 30  GLU D C   1 
ATOM   9001  O O   . GLU D 1 31  ? -38.394 40.879  -38.927 1.00 15.88 ? 30  GLU D O   1 
ATOM   9002  C CB  . GLU D 1 31  ? -36.762 43.332  -38.333 1.00 16.37 ? 30  GLU D CB  1 
ATOM   9003  C CG  . GLU D 1 31  ? -36.176 44.393  -37.424 1.00 18.74 ? 30  GLU D CG  1 
ATOM   9004  C CD  . GLU D 1 31  ? -36.980 44.573  -36.168 1.00 23.51 ? 30  GLU D CD  1 
ATOM   9005  O OE1 . GLU D 1 31  ? -38.234 44.472  -36.240 1.00 27.74 ? 30  GLU D OE1 1 
ATOM   9006  O OE2 . GLU D 1 31  ? -36.366 44.820  -35.104 1.00 28.08 ? 30  GLU D OE2 1 
ATOM   9007  N N   . GLN D 1 32  ? -36.354 40.133  -39.503 1.00 14.79 ? 31  GLN D N   1 
ATOM   9008  C CA  . GLN D 1 32  ? -36.819 39.056  -40.370 1.00 14.33 ? 31  GLN D CA  1 
ATOM   9009  C C   . GLN D 1 32  ? -37.518 37.955  -39.597 1.00 13.22 ? 31  GLN D C   1 
ATOM   9010  O O   . GLN D 1 32  ? -38.338 37.240  -40.154 1.00 13.67 ? 31  GLN D O   1 
ATOM   9011  C CB  . GLN D 1 32  ? -35.622 38.384  -41.058 1.00 14.28 ? 31  GLN D CB  1 
ATOM   9012  C CG  . GLN D 1 32  ? -34.919 39.260  -42.026 1.00 15.02 ? 31  GLN D CG  1 
ATOM   9013  C CD  . GLN D 1 32  ? -33.703 38.587  -42.576 1.00 15.57 ? 31  GLN D CD  1 
ATOM   9014  O OE1 . GLN D 1 32  ? -33.747 38.027  -43.675 1.00 18.43 ? 31  GLN D OE1 1 
ATOM   9015  N NE2 . GLN D 1 32  ? -32.617 38.601  -41.817 1.00 13.05 ? 31  GLN D NE2 1 
ATOM   9016  N N   . TRP D 1 33  ? -37.145 37.800  -38.336 1.00 12.53 ? 32  TRP D N   1 
ATOM   9017  C CA  . TRP D 1 33  ? -37.550 36.673  -37.501 1.00 12.89 ? 32  TRP D CA  1 
ATOM   9018  C C   . TRP D 1 33  ? -38.452 37.152  -36.378 1.00 13.13 ? 32  TRP D C   1 
ATOM   9019  O O   . TRP D 1 33  ? -38.221 38.209  -35.793 1.00 11.94 ? 32  TRP D O   1 
ATOM   9020  C CB  . TRP D 1 33  ? -36.328 35.945  -36.908 1.00 12.52 ? 32  TRP D CB  1 
ATOM   9021  C CG  . TRP D 1 33  ? -35.170 35.930  -37.864 1.00 12.44 ? 32  TRP D CG  1 
ATOM   9022  C CD1 . TRP D 1 33  ? -33.961 36.543  -37.695 1.00 12.84 ? 32  TRP D CD1 1 
ATOM   9023  C CD2 . TRP D 1 33  ? -35.143 35.346  -39.162 1.00 12.43 ? 32  TRP D CD2 1 
ATOM   9024  N NE1 . TRP D 1 33  ? -33.183 36.363  -38.801 1.00 13.50 ? 32  TRP D NE1 1 
ATOM   9025  C CE2 . TRP D 1 33  ? -33.871 35.617  -39.715 1.00 11.66 ? 32  TRP D CE2 1 
ATOM   9026  C CE3 . TRP D 1 33  ? -36.056 34.569  -39.901 1.00 14.11 ? 32  TRP D CE3 1 
ATOM   9027  C CZ2 . TRP D 1 33  ? -33.496 35.188  -41.002 1.00 12.48 ? 32  TRP D CZ2 1 
ATOM   9028  C CZ3 . TRP D 1 33  ? -35.680 34.128  -41.175 1.00 13.20 ? 32  TRP D CZ3 1 
ATOM   9029  C CH2 . TRP D 1 33  ? -34.413 34.447  -41.713 1.00 13.63 ? 32  TRP D CH2 1 
ATOM   9030  N N   . THR D 1 34  ? -39.450 36.330  -36.062 1.00 13.48 ? 33  THR D N   1 
ATOM   9031  C CA  . THR D 1 34  ? -40.363 36.606  -34.977 1.00 14.18 ? 33  THR D CA  1 
ATOM   9032  C C   . THR D 1 34  ? -39.618 36.606  -33.612 1.00 13.53 ? 33  THR D C   1 
ATOM   9033  O O   . THR D 1 34  ? -39.968 37.357  -32.713 1.00 12.46 ? 33  THR D O   1 
ATOM   9034  C CB  . THR D 1 34  ? -41.572 35.620  -35.030 1.00 15.04 ? 33  THR D CB  1 
ATOM   9035  O OG1 . THR D 1 34  ? -41.092 34.285  -34.955 1.00 19.73 ? 33  THR D OG1 1 
ATOM   9036  C CG2 . THR D 1 34  ? -42.332 35.735  -36.342 1.00 14.27 ? 33  THR D CG2 1 
ATOM   9037  N N   . SER D 1 35  ? -38.539 35.833  -33.507 1.00 12.92 ? 34  SER D N   1 
ATOM   9038  C CA  . SER D 1 35  ? -37.669 35.827  -32.330 1.00 13.45 ? 34  SER D CA  1 
ATOM   9039  C C   . SER D 1 35  ? -36.752 37.052  -32.155 1.00 13.82 ? 34  SER D C   1 
ATOM   9040  O O   . SER D 1 35  ? -36.173 37.243  -31.081 1.00 14.17 ? 34  SER D O   1 
ATOM   9041  C CB  . SER D 1 35  ? -36.738 34.614  -32.409 1.00 13.55 ? 34  SER D CB  1 
ATOM   9042  O OG  . SER D 1 35  ? -35.769 34.798  -33.434 1.00 12.55 ? 34  SER D OG  1 
ATOM   9043  N N   . ARG D 1 36  ? -36.558 37.810  -33.237 1.00 14.59 ? 35  ARG D N   1 
ATOM   9044  C CA  . ARG D 1 36  ? -35.562 38.885  -33.306 1.00 14.85 ? 35  ARG D CA  1 
ATOM   9045  C C   . ARG D 1 36  ? -34.139 38.385  -33.055 1.00 13.44 ? 35  ARG D C   1 
ATOM   9046  O O   . ARG D 1 36  ? -33.307 39.141  -32.523 1.00 12.74 ? 35  ARG D O   1 
ATOM   9047  C CB  . ARG D 1 36  ? -35.856 40.014  -32.303 1.00 15.57 ? 35  ARG D CB  1 
ATOM   9048  C CG  . ARG D 1 36  ? -37.248 40.583  -32.242 1.00 20.03 ? 35  ARG D CG  1 
ATOM   9049  C CD  . ARG D 1 36  ? -37.577 41.494  -33.400 1.00 26.57 ? 35  ARG D CD  1 
ATOM   9050  N NE  . ARG D 1 36  ? -38.432 40.779  -34.329 1.00 31.75 ? 35  ARG D NE  1 
ATOM   9051  C CZ  . ARG D 1 36  ? -39.441 41.297  -35.018 1.00 32.29 ? 35  ARG D CZ  1 
ATOM   9052  N NH1 . ARG D 1 36  ? -39.765 42.583  -34.916 1.00 36.08 ? 35  ARG D NH1 1 
ATOM   9053  N NH2 . ARG D 1 36  ? -40.134 40.506  -35.830 1.00 31.48 ? 35  ARG D NH2 1 
ATOM   9054  N N   . ALA D 1 37  ? -33.876 37.123  -33.406 1.00 12.12 ? 36  ALA D N   1 
ATOM   9055  C CA  . ALA D 1 37  ? -32.529 36.555  -33.425 1.00 12.15 ? 36  ALA D CA  1 
ATOM   9056  C C   . ALA D 1 37  ? -31.530 37.443  -34.182 1.00 12.23 ? 36  ALA D C   1 
ATOM   9057  O O   . ALA D 1 37  ? -31.785 37.896  -35.305 1.00 11.59 ? 36  ALA D O   1 
ATOM   9058  C CB  . ALA D 1 37  ? -32.550 35.164  -34.041 1.00 11.71 ? 36  ALA D CB  1 
ATOM   9059  N N   . VAL D 1 38  ? -30.396 37.688  -33.538 1.00 12.63 ? 37  VAL D N   1 
ATOM   9060  C CA  . VAL D 1 38  ? -29.305 38.473  -34.116 1.00 13.12 ? 37  VAL D CA  1 
ATOM   9061  C C   . VAL D 1 38  ? -28.544 37.663  -35.177 1.00 12.48 ? 37  VAL D C   1 
ATOM   9062  O O   . VAL D 1 38  ? -27.941 38.236  -36.098 1.00 12.75 ? 37  VAL D O   1 
ATOM   9063  C CB  . VAL D 1 38  ? -28.386 38.971  -32.970 1.00 14.02 ? 37  VAL D CB  1 
ATOM   9064  C CG1 . VAL D 1 38  ? -26.949 39.057  -33.393 1.00 16.88 ? 37  VAL D CG1 1 
ATOM   9065  C CG2 . VAL D 1 38  ? -28.951 40.311  -32.354 1.00 13.24 ? 37  VAL D CG2 1 
ATOM   9066  N N   . VAL D 1 39  ? -28.614 36.346  -35.060 1.00 11.32 ? 38  VAL D N   1 
ATOM   9067  C CA  . VAL D 1 39  ? -28.099 35.408  -36.065 1.00 12.07 ? 38  VAL D CA  1 
ATOM   9068  C C   . VAL D 1 39  ? -29.275 34.670  -36.674 1.00 11.57 ? 38  VAL D C   1 
ATOM   9069  O O   . VAL D 1 39  ? -30.121 34.186  -35.942 1.00 11.86 ? 38  VAL D O   1 
ATOM   9070  C CB  . VAL D 1 39  ? -27.128 34.357  -35.468 1.00 12.26 ? 38  VAL D CB  1 
ATOM   9071  C CG1 . VAL D 1 39  ? -26.719 33.338  -36.573 1.00 12.56 ? 38  VAL D CG1 1 
ATOM   9072  C CG2 . VAL D 1 39  ? -25.912 35.057  -34.883 1.00 13.28 ? 38  VAL D CG2 1 
ATOM   9073  N N   . PRO D 1 40  ? -29.361 34.642  -38.017 1.00 12.28 ? 39  PRO D N   1 
ATOM   9074  C CA  . PRO D 1 40  ? -30.445 33.914  -38.676 1.00 12.67 ? 39  PRO D CA  1 
ATOM   9075  C C   . PRO D 1 40  ? -30.528 32.429  -38.258 1.00 12.88 ? 39  PRO D C   1 
ATOM   9076  O O   . PRO D 1 40  ? -29.498 31.746  -38.134 1.00 12.67 ? 39  PRO D O   1 
ATOM   9077  C CB  . PRO D 1 40  ? -30.107 34.067  -40.157 1.00 12.70 ? 39  PRO D CB  1 
ATOM   9078  C CG  . PRO D 1 40  ? -29.351 35.381  -40.233 1.00 11.64 ? 39  PRO D CG  1 
ATOM   9079  C CD  . PRO D 1 40  ? -28.509 35.341  -39.011 1.00 12.05 ? 39  PRO D CD  1 
ATOM   9080  N N   . PRO D 1 41  ? -31.753 31.943  -38.006 1.00 12.97 ? 40  PRO D N   1 
ATOM   9081  C CA  . PRO D 1 41  ? -31.957 30.524  -37.707 1.00 12.22 ? 40  PRO D CA  1 
ATOM   9082  C C   . PRO D 1 41  ? -31.625 29.662  -38.900 1.00 11.67 ? 40  PRO D C   1 
ATOM   9083  O O   . PRO D 1 41  ? -31.638 30.146  -40.072 1.00 11.46 ? 40  PRO D O   1 
ATOM   9084  C CB  . PRO D 1 41  ? -33.454 30.425  -37.420 1.00 12.13 ? 40  PRO D CB  1 
ATOM   9085  C CG  . PRO D 1 41  ? -33.970 31.762  -37.340 1.00 14.34 ? 40  PRO D CG  1 
ATOM   9086  C CD  . PRO D 1 41  ? -33.019 32.700  -38.001 1.00 13.44 ? 40  PRO D CD  1 
ATOM   9087  N N   . ILE D 1 42  ? -31.336 28.394  -38.629 1.00 11.25 ? 41  ILE D N   1 
ATOM   9088  C CA  . ILE D 1 42  ? -31.183 27.392  -39.684 1.00 11.96 ? 41  ILE D CA  1 
ATOM   9089  C C   . ILE D 1 42  ? -32.538 26.761  -39.960 1.00 11.30 ? 41  ILE D C   1 
ATOM   9090  O O   . ILE D 1 42  ? -33.008 25.973  -39.172 1.00 11.50 ? 41  ILE D O   1 
ATOM   9091  C CB  . ILE D 1 42  ? -30.151 26.279  -39.322 1.00 11.53 ? 41  ILE D CB  1 
ATOM   9092  C CG1 . ILE D 1 42  ? -28.886 26.896  -38.711 1.00 12.85 ? 41  ILE D CG1 1 
ATOM   9093  C CG2 . ILE D 1 42  ? -29.805 25.496  -40.565 1.00 11.98 ? 41  ILE D CG2 1 
ATOM   9094  C CD1 . ILE D 1 42  ? -27.805 25.902  -38.370 1.00 11.54 ? 41  ILE D CD1 1 
ATOM   9095  N N   . SER D 1 43  ? -33.188 27.138  -41.056 1.00 10.80 ? 42  SER D N   1 
ATOM   9096  C CA  . SER D 1 43  ? -34.474 26.552  -41.378 1.00 10.15 ? 42  SER D CA  1 
ATOM   9097  C C   . SER D 1 43  ? -34.250 25.341  -42.309 1.00 9.72  ? 42  SER D C   1 
ATOM   9098  O O   . SER D 1 43  ? -33.939 25.495  -43.495 1.00 10.74 ? 42  SER D O   1 
ATOM   9099  C CB  . SER D 1 43  ? -35.445 27.595  -41.984 1.00 10.61 ? 42  SER D CB  1 
ATOM   9100  O OG  . SER D 1 43  ? -36.720 27.025  -42.357 1.00 9.96  ? 42  SER D OG  1 
ATOM   9101  N N   . LEU D 1 44  ? -34.444 24.145  -41.758 1.00 9.22  ? 43  LEU D N   1 
ATOM   9102  C CA  . LEU D 1 44  ? -34.291 22.908  -42.513 1.00 9.94  ? 43  LEU D CA  1 
ATOM   9103  C C   . LEU D 1 44  ? -35.580 22.514  -43.227 1.00 9.83  ? 43  LEU D C   1 
ATOM   9104  O O   . LEU D 1 44  ? -35.562 21.689  -44.145 1.00 10.14 ? 43  LEU D O   1 
ATOM   9105  C CB  . LEU D 1 44  ? -33.869 21.751  -41.606 1.00 10.29 ? 43  LEU D CB  1 
ATOM   9106  C CG  . LEU D 1 44  ? -32.578 21.830  -40.785 1.00 10.77 ? 43  LEU D CG  1 
ATOM   9107  C CD1 . LEU D 1 44  ? -32.261 20.463  -40.256 1.00 9.57  ? 43  LEU D CD1 1 
ATOM   9108  C CD2 . LEU D 1 44  ? -31.440 22.335  -41.617 1.00 12.52 ? 43  LEU D CD2 1 
ATOM   9109  N N   . SER D 1 45  ? -36.702 23.079  -42.801 1.00 9.19  ? 44  SER D N   1 
ATOM   9110  C CA  . SER D 1 45  ? -37.992 22.690  -43.337 1.00 9.57  ? 44  SER D CA  1 
ATOM   9111  C C   . SER D 1 45  ? -37.982 22.635  -44.857 1.00 8.33  ? 44  SER D C   1 
ATOM   9112  O O   . SER D 1 45  ? -37.552 23.571  -45.514 1.00 9.37  ? 44  SER D O   1 
ATOM   9113  C CB  . SER D 1 45  ? -39.070 23.649  -42.891 1.00 9.60  ? 44  SER D CB  1 
ATOM   9114  O OG  . SER D 1 45  ? -40.332 23.112  -43.210 1.00 10.62 ? 44  SER D OG  1 
ATOM   9115  N N   . THR D 1 46  ? -38.495 21.551  -45.414 1.00 8.70  ? 45  THR D N   1 
ATOM   9116  C CA  . THR D 1 46  ? -38.552 21.402  -46.877 1.00 8.39  ? 45  THR D CA  1 
ATOM   9117  C C   . THR D 1 46  ? -39.737 22.168  -47.463 1.00 8.64  ? 45  THR D C   1 
ATOM   9118  O O   . THR D 1 46  ? -39.781 22.486  -48.680 1.00 8.17  ? 45  THR D O   1 
ATOM   9119  C CB  . THR D 1 46  ? -38.679 19.903  -47.267 1.00 8.75  ? 45  THR D CB  1 
ATOM   9120  O OG1 . THR D 1 46  ? -39.791 19.330  -46.575 1.00 6.47  ? 45  THR D OG1 1 
ATOM   9121  C CG2 . THR D 1 46  ? -37.407 19.138  -46.938 1.00 8.24  ? 45  THR D CG2 1 
ATOM   9122  N N   . THR D 1 47  ? -40.721 22.433  -46.607 1.00 8.40  ? 46  THR D N   1 
ATOM   9123  C CA  . THR D 1 47  ? -41.960 23.013  -47.058 1.00 9.01  ? 46  THR D CA  1 
ATOM   9124  C C   . THR D 1 47  ? -42.525 23.975  -46.037 1.00 9.33  ? 46  THR D C   1 
ATOM   9125  O O   . THR D 1 47  ? -42.046 24.057  -44.892 1.00 8.52  ? 46  THR D O   1 
ATOM   9126  C CB  . THR D 1 47  ? -42.995 21.903  -47.506 1.00 9.88  ? 46  THR D CB  1 
ATOM   9127  O OG1 . THR D 1 47  ? -44.075 22.509  -48.228 1.00 10.48 ? 46  THR D OG1 1 
ATOM   9128  C CG2 . THR D 1 47  ? -43.521 21.109  -46.330 1.00 7.91  ? 46  THR D CG2 1 
ATOM   9129  N N   . PHE D 1 48  ? -43.564 24.681  -46.474 1.00 10.11 ? 47  PHE D N   1 
ATOM   9130  C CA  . PHE D 1 48  ? -44.055 25.876  -45.814 1.00 10.37 ? 47  PHE D CA  1 
ATOM   9131  C C   . PHE D 1 48  ? -45.574 25.930  -46.013 1.00 11.06 ? 47  PHE D C   1 
ATOM   9132  O O   . PHE D 1 48  ? -46.083 25.662  -47.114 1.00 10.32 ? 47  PHE D O   1 
ATOM   9133  C CB  . PHE D 1 48  ? -43.375 27.139  -46.420 1.00 9.81  ? 47  PHE D CB  1 
ATOM   9134  C CG  . PHE D 1 48  ? -41.874 27.058  -46.454 1.00 9.24  ? 47  PHE D CG  1 
ATOM   9135  C CD1 . PHE D 1 48  ? -41.226 26.430  -47.510 1.00 9.43  ? 47  PHE D CD1 1 
ATOM   9136  C CD2 . PHE D 1 48  ? -41.105 27.546  -45.405 1.00 8.45  ? 47  PHE D CD2 1 
ATOM   9137  C CE1 . PHE D 1 48  ? -39.854 26.306  -47.538 1.00 9.30  ? 47  PHE D CE1 1 
ATOM   9138  C CE2 . PHE D 1 48  ? -39.724 27.434  -45.427 1.00 8.63  ? 47  PHE D CE2 1 
ATOM   9139  C CZ  . PHE D 1 48  ? -39.099 26.813  -46.490 1.00 10.34 ? 47  PHE D CZ  1 
ATOM   9140  N N   . LYS D 1 49  ? -46.292 26.279  -44.947 1.00 11.83 ? 48  LYS D N   1 
ATOM   9141  C CA  . LYS D 1 49  ? -47.746 26.428  -44.983 1.00 12.93 ? 48  LYS D CA  1 
ATOM   9142  C C   . LYS D 1 49  ? -48.164 27.631  -45.825 1.00 13.65 ? 48  LYS D C   1 
ATOM   9143  O O   . LYS D 1 49  ? -47.588 28.731  -45.697 1.00 13.59 ? 48  LYS D O   1 
ATOM   9144  C CB  . LYS D 1 49  ? -48.283 26.565  -43.555 1.00 12.99 ? 48  LYS D CB  1 
ATOM   9145  C CG  . LYS D 1 49  ? -49.766 26.907  -43.469 1.00 14.54 ? 48  LYS D CG  1 
ATOM   9146  C CD  . LYS D 1 49  ? -50.197 26.907  -42.011 1.00 14.20 ? 48  LYS D CD  1 
ATOM   9147  C CE  . LYS D 1 49  ? -51.607 27.432  -41.848 1.00 17.14 ? 48  LYS D CE  1 
ATOM   9148  N NZ  . LYS D 1 49  ? -51.989 27.444  -40.405 1.00 20.11 ? 48  LYS D NZ  1 
ATOM   9149  N N   . GLN D 1 50  ? -49.141 27.409  -46.712 1.00 14.15 ? 49  GLN D N   1 
ATOM   9150  C CA  . GLN D 1 50  ? -49.710 28.473  -47.549 1.00 14.98 ? 49  GLN D CA  1 
ATOM   9151  C C   . GLN D 1 50  ? -51.093 28.876  -47.066 1.00 15.61 ? 49  GLN D C   1 
ATOM   9152  O O   . GLN D 1 50  ? -51.828 28.066  -46.516 1.00 15.76 ? 49  GLN D O   1 
ATOM   9153  C CB  . GLN D 1 50  ? -49.763 28.014  -49.007 1.00 14.47 ? 49  GLN D CB  1 
ATOM   9154  C CG  . GLN D 1 50  ? -48.429 27.565  -49.526 1.00 15.15 ? 49  GLN D CG  1 
ATOM   9155  C CD  . GLN D 1 50  ? -48.426 27.288  -51.020 1.00 17.22 ? 49  GLN D CD  1 
ATOM   9156  O OE1 . GLN D 1 50  ? -49.246 27.849  -51.776 1.00 18.56 ? 49  GLN D OE1 1 
ATOM   9157  N NE2 . GLN D 1 50  ? -47.477 26.440  -51.473 1.00 16.01 ? 49  GLN D NE2 1 
ATOM   9158  N N   . GLY D 1 51  ? -51.434 30.152  -47.232 1.00 16.85 ? 50  GLY D N   1 
ATOM   9159  C CA  . GLY D 1 51  ? -52.765 30.631  -46.904 1.00 18.06 ? 50  GLY D CA  1 
ATOM   9160  C C   . GLY D 1 51  ? -53.803 30.130  -47.897 1.00 18.92 ? 50  GLY D C   1 
ATOM   9161  O O   . GLY D 1 51  ? -54.915 29.780  -47.528 1.00 19.36 ? 50  GLY D O   1 
ATOM   9162  N N   . ALA D 1 52  ? -53.412 30.066  -49.160 1.00 20.42 ? 51  ALA D N   1 
ATOM   9163  C CA  . ALA D 1 52  ? -54.310 29.676  -50.224 1.00 21.29 ? 51  ALA D CA  1 
ATOM   9164  C C   . ALA D 1 52  ? -53.462 29.118  -51.349 1.00 22.43 ? 51  ALA D C   1 
ATOM   9165  O O   . ALA D 1 52  ? -52.327 29.556  -51.510 1.00 20.81 ? 51  ALA D O   1 
ATOM   9166  C CB  . ALA D 1 52  ? -55.074 30.883  -50.710 1.00 21.49 ? 51  ALA D CB  1 
ATOM   9167  N N   . PRO D 1 53  ? -54.021 28.176  -52.150 1.00 23.92 ? 52  PRO D N   1 
ATOM   9168  C CA  . PRO D 1 53  ? -53.300 27.606  -53.289 1.00 25.98 ? 52  PRO D CA  1 
ATOM   9169  C C   . PRO D 1 53  ? -52.890 28.680  -54.293 1.00 28.92 ? 52  PRO D C   1 
ATOM   9170  O O   . PRO D 1 53  ? -53.623 29.652  -54.483 1.00 29.88 ? 52  PRO D O   1 
ATOM   9171  C CB  . PRO D 1 53  ? -54.330 26.682  -53.945 1.00 25.72 ? 52  PRO D CB  1 
ATOM   9172  C CG  . PRO D 1 53  ? -55.389 26.506  -52.979 1.00 24.49 ? 52  PRO D CG  1 
ATOM   9173  C CD  . PRO D 1 53  ? -55.382 27.632  -52.034 1.00 23.45 ? 52  PRO D CD  1 
ATOM   9174  N N   . GLY D 1 54  ? -51.727 28.523  -54.920 1.00 32.19 ? 53  GLY D N   1 
ATOM   9175  C CA  . GLY D 1 54  ? -51.327 29.434  -56.009 1.00 34.32 ? 53  GLY D CA  1 
ATOM   9176  C C   . GLY D 1 54  ? -51.039 30.810  -55.465 1.00 36.28 ? 53  GLY D C   1 
ATOM   9177  O O   . GLY D 1 54  ? -51.890 31.706  -55.519 1.00 36.80 ? 53  GLY D O   1 
ATOM   9178  N N   . GLN D 1 55  ? -49.821 30.978  -54.958 1.00 38.15 ? 54  GLN D N   1 
ATOM   9179  C CA  . GLN D 1 55  ? -49.573 32.024  -54.006 1.00 39.44 ? 54  GLN D CA  1 
ATOM   9180  C C   . GLN D 1 55  ? -48.324 32.830  -54.358 1.00 39.89 ? 54  GLN D C   1 
ATOM   9181  O O   . GLN D 1 55  ? -47.190 32.376  -54.168 1.00 40.97 ? 54  GLN D O   1 
ATOM   9182  C CB  . GLN D 1 55  ? -49.478 31.385  -52.617 1.00 39.88 ? 54  GLN D CB  1 
ATOM   9183  C CG  . GLN D 1 55  ? -50.198 32.157  -51.558 1.00 40.84 ? 54  GLN D CG  1 
ATOM   9184  C CD  . GLN D 1 55  ? -49.673 31.863  -50.183 1.00 42.32 ? 54  GLN D CD  1 
ATOM   9185  O OE1 . GLN D 1 55  ? -50.447 31.727  -49.233 1.00 43.01 ? 54  GLN D OE1 1 
ATOM   9186  N NE2 . GLN D 1 55  ? -48.345 31.772  -50.056 1.00 43.16 ? 54  GLN D NE2 1 
ATOM   9187  N N   . HIS D 1 56  ? -48.538 34.044  -54.862 1.00 40.21 ? 55  HIS D N   1 
ATOM   9188  C CA  . HIS D 1 56  ? -47.441 34.943  -55.224 1.00 39.89 ? 55  HIS D CA  1 
ATOM   9189  C C   . HIS D 1 56  ? -46.693 35.492  -53.990 1.00 39.67 ? 55  HIS D C   1 
ATOM   9190  O O   . HIS D 1 56  ? -46.292 36.671  -53.984 1.00 40.69 ? 55  HIS D O   1 
ATOM   9191  C CB  . HIS D 1 56  ? -47.996 36.116  -56.040 1.00 40.10 ? 55  HIS D CB  1 
ATOM   9192  N N   . SER D 1 57  ? -46.481 34.654  -52.966 1.00 38.16 ? 56  SER D N   1 
ATOM   9193  C CA  . SER D 1 57  ? -46.044 35.149  -51.656 1.00 37.13 ? 56  SER D CA  1 
ATOM   9194  C C   . SER D 1 57  ? -45.427 34.052  -50.775 1.00 35.21 ? 56  SER D C   1 
ATOM   9195  O O   . SER D 1 57  ? -45.946 32.936  -50.699 1.00 36.26 ? 56  SER D O   1 
ATOM   9196  C CB  . SER D 1 57  ? -47.233 35.732  -50.896 1.00 37.22 ? 56  SER D CB  1 
ATOM   9197  O OG  . SER D 1 57  ? -47.873 34.707  -50.141 1.00 39.23 ? 56  SER D OG  1 
ATOM   9198  N N   . GLY D 1 58  ? -44.348 34.404  -50.085 1.00 32.08 ? 57  GLY D N   1 
ATOM   9199  C CA  . GLY D 1 58  ? -43.697 33.511  -49.138 1.00 29.06 ? 57  GLY D CA  1 
ATOM   9200  C C   . GLY D 1 58  ? -43.009 32.307  -49.768 1.00 26.27 ? 57  GLY D C   1 
ATOM   9201  O O   . GLY D 1 58  ? -43.087 32.060  -50.983 1.00 25.10 ? 57  GLY D O   1 
ATOM   9202  N N   . PHE D 1 59  ? -42.350 31.546  -48.911 1.00 22.38 ? 58  PHE D N   1 
ATOM   9203  C CA  . PHE D 1 59  ? -41.622 30.369  -49.331 1.00 20.20 ? 58  PHE D CA  1 
ATOM   9204  C C   . PHE D 1 59  ? -42.605 29.258  -49.688 1.00 18.74 ? 58  PHE D C   1 
ATOM   9205  O O   . PHE D 1 59  ? -43.692 29.185  -49.117 1.00 18.26 ? 58  PHE D O   1 
ATOM   9206  C CB  . PHE D 1 59  ? -40.686 29.938  -48.212 1.00 19.33 ? 58  PHE D CB  1 
ATOM   9207  C CG  . PHE D 1 59  ? -39.610 30.931  -47.921 1.00 17.82 ? 58  PHE D CG  1 
ATOM   9208  C CD1 . PHE D 1 59  ? -38.511 31.029  -48.755 1.00 17.00 ? 58  PHE D CD1 1 
ATOM   9209  C CD2 . PHE D 1 59  ? -39.715 31.789  -46.855 1.00 17.76 ? 58  PHE D CD2 1 
ATOM   9210  C CE1 . PHE D 1 59  ? -37.496 31.956  -48.498 1.00 18.94 ? 58  PHE D CE1 1 
ATOM   9211  C CE2 . PHE D 1 59  ? -38.701 32.726  -46.582 1.00 17.12 ? 58  PHE D CE2 1 
ATOM   9212  C CZ  . PHE D 1 59  ? -37.596 32.805  -47.402 1.00 17.00 ? 58  PHE D CZ  1 
ATOM   9213  N N   . GLU D 1 60  ? -42.220 28.414  -50.639 1.00 17.39 ? 59  GLU D N   1 
ATOM   9214  C CA  . GLU D 1 60  ? -43.082 27.300  -51.095 1.00 16.79 ? 59  GLU D CA  1 
ATOM   9215  C C   . GLU D 1 60  ? -42.437 25.921  -50.948 1.00 14.20 ? 59  GLU D C   1 
ATOM   9216  O O   . GLU D 1 60  ? -43.089 24.945  -50.564 1.00 12.15 ? 59  GLU D O   1 
ATOM   9217  C CB  . GLU D 1 60  ? -43.455 27.512  -52.566 1.00 16.38 ? 59  GLU D CB  1 
ATOM   9218  C CG  . GLU D 1 60  ? -44.429 28.626  -52.748 1.00 19.92 ? 59  GLU D CG  1 
ATOM   9219  C CD  . GLU D 1 60  ? -44.728 28.911  -54.200 1.00 21.06 ? 59  GLU D CD  1 
ATOM   9220  O OE1 . GLU D 1 60  ? -44.222 28.171  -55.078 1.00 27.41 ? 59  GLU D OE1 1 
ATOM   9221  O OE2 . GLU D 1 60  ? -45.451 29.905  -54.438 1.00 28.43 ? 59  GLU D OE2 1 
ATOM   9222  N N   . TYR D 1 61  ? -41.157 25.858  -51.284 1.00 12.83 ? 60  TYR D N   1 
ATOM   9223  C CA  . TYR D 1 61  ? -40.438 24.602  -51.307 1.00 11.91 ? 60  TYR D CA  1 
ATOM   9224  C C   . TYR D 1 61  ? -38.958 24.912  -51.225 1.00 11.02 ? 60  TYR D C   1 
ATOM   9225  O O   . TYR D 1 61  ? -38.465 25.776  -51.928 1.00 9.54  ? 60  TYR D O   1 
ATOM   9226  C CB  . TYR D 1 61  ? -40.762 23.849  -52.586 1.00 11.66 ? 60  TYR D CB  1 
ATOM   9227  C CG  . TYR D 1 61  ? -40.194 22.453  -52.610 1.00 12.71 ? 60  TYR D CG  1 
ATOM   9228  C CD1 . TYR D 1 61  ? -40.729 21.446  -51.795 1.00 12.43 ? 60  TYR D CD1 1 
ATOM   9229  C CD2 . TYR D 1 61  ? -39.111 22.139  -53.427 1.00 11.53 ? 60  TYR D CD2 1 
ATOM   9230  C CE1 . TYR D 1 61  ? -40.227 20.163  -51.825 1.00 13.60 ? 60  TYR D CE1 1 
ATOM   9231  C CE2 . TYR D 1 61  ? -38.587 20.847  -53.444 1.00 11.57 ? 60  TYR D CE2 1 
ATOM   9232  C CZ  . TYR D 1 61  ? -39.160 19.868  -52.652 1.00 11.49 ? 60  TYR D CZ  1 
ATOM   9233  O OH  . TYR D 1 61  ? -38.671 18.588  -52.661 1.00 12.53 ? 60  TYR D OH  1 
ATOM   9234  N N   . SER D 1 62  ? -38.282 24.238  -50.309 1.00 10.97 ? 61  SER D N   1 
ATOM   9235  C CA  . SER D 1 62  ? -36.928 24.581  -49.930 1.00 11.16 ? 61  SER D CA  1 
ATOM   9236  C C   . SER D 1 62  ? -35.974 24.651  -51.122 1.00 11.16 ? 61  SER D C   1 
ATOM   9237  O O   . SER D 1 62  ? -35.135 25.546  -51.179 1.00 12.75 ? 61  SER D O   1 
ATOM   9238  C CB  . SER D 1 62  ? -36.404 23.575  -48.892 1.00 10.66 ? 61  SER D CB  1 
ATOM   9239  O OG  . SER D 1 62  ? -35.020 23.772  -48.585 1.00 9.86  ? 61  SER D OG  1 
ATOM   9240  N N   . ARG D 1 63  ? -36.082 23.723  -52.071 1.00 11.93 ? 62  ARG D N   1 
ATOM   9241  C CA  . ARG D 1 63  ? -35.162 23.738  -53.210 1.00 11.47 ? 62  ARG D CA  1 
ATOM   9242  C C   . ARG D 1 63  ? -35.293 25.064  -53.967 1.00 11.30 ? 62  ARG D C   1 
ATOM   9243  O O   . ARG D 1 63  ? -34.312 25.569  -54.501 1.00 10.20 ? 62  ARG D O   1 
ATOM   9244  C CB  . ARG D 1 63  ? -35.395 22.561  -54.169 1.00 12.26 ? 62  ARG D CB  1 
ATOM   9245  C CG  . ARG D 1 63  ? -34.648 22.720  -55.511 1.00 12.27 ? 62  ARG D CG  1 
ATOM   9246  C CD  . ARG D 1 63  ? -34.597 21.469  -56.366 1.00 12.19 ? 62  ARG D CD  1 
ATOM   9247  N NE  . ARG D 1 63  ? -35.802 20.669  -56.300 1.00 12.39 ? 62  ARG D NE  1 
ATOM   9248  C CZ  . ARG D 1 63  ? -36.986 21.064  -56.748 1.00 12.93 ? 62  ARG D CZ  1 
ATOM   9249  N NH1 . ARG D 1 63  ? -38.021 20.253  -56.655 1.00 12.34 ? 62  ARG D NH1 1 
ATOM   9250  N NH2 . ARG D 1 63  ? -37.150 22.278  -57.240 1.00 12.69 ? 62  ARG D NH2 1 
ATOM   9251  N N   . SER D 1 64  ? -36.503 25.628  -53.990 1.00 10.61 ? 63  SER D N   1 
ATOM   9252  C CA  . SER D 1 64  ? -36.793 26.811  -54.793 1.00 10.89 ? 63  SER D CA  1 
ATOM   9253  C C   . SER D 1 64  ? -36.288 28.046  -54.080 1.00 10.70 ? 63  SER D C   1 
ATOM   9254  O O   . SER D 1 64  ? -35.782 28.972  -54.701 1.00 10.81 ? 63  SER D O   1 
ATOM   9255  C CB  . SER D 1 64  ? -38.305 26.922  -55.069 1.00 10.44 ? 63  SER D CB  1 
ATOM   9256  O OG  . SER D 1 64  ? -38.795 25.687  -55.584 1.00 11.31 ? 63  SER D OG  1 
ATOM   9257  N N   . GLY D 1 65  ? -36.443 28.039  -52.767 1.00 10.79 ? 64  GLY D N   1 
ATOM   9258  C CA  . GLY D 1 65  ? -35.953 29.091  -51.931 1.00 11.08 ? 64  GLY D CA  1 
ATOM   9259  C C   . GLY D 1 65  ? -36.213 28.721  -50.492 1.00 11.11 ? 64  GLY D C   1 
ATOM   9260  O O   . GLY D 1 65  ? -37.182 28.014  -50.170 1.00 11.26 ? 64  GLY D O   1 
ATOM   9261  N N   . ASN D 1 66  ? -35.346 29.202  -49.617 1.00 10.72 ? 65  ASN D N   1 
ATOM   9262  C CA  . ASN D 1 66  ? -35.513 28.964  -48.189 1.00 10.53 ? 65  ASN D CA  1 
ATOM   9263  C C   . ASN D 1 66  ? -34.833 30.060  -47.402 1.00 10.39 ? 65  ASN D C   1 
ATOM   9264  O O   . ASN D 1 66  ? -33.948 30.734  -47.927 1.00 10.96 ? 65  ASN D O   1 
ATOM   9265  C CB  . ASN D 1 66  ? -35.012 27.567  -47.798 1.00 10.91 ? 65  ASN D CB  1 
ATOM   9266  C CG  . ASN D 1 66  ? -33.543 27.367  -48.067 1.00 11.04 ? 65  ASN D CG  1 
ATOM   9267  O OD1 . ASN D 1 66  ? -32.693 27.776  -47.280 1.00 8.08  ? 65  ASN D OD1 1 
ATOM   9268  N ND2 . ASN D 1 66  ? -33.235 26.713  -49.186 1.00 12.86 ? 65  ASN D ND2 1 
ATOM   9269  N N   . PRO D 1 67  ? -35.278 30.300  -46.169 1.00 9.49  ? 66  PRO D N   1 
ATOM   9270  C CA  . PRO D 1 67  ? -34.740 31.397  -45.366 1.00 9.83  ? 66  PRO D CA  1 
ATOM   9271  C C   . PRO D 1 67  ? -33.218 31.535  -45.258 1.00 9.76  ? 66  PRO D C   1 
ATOM   9272  O O   . PRO D 1 67  ? -32.661 32.580  -45.591 1.00 9.36  ? 66  PRO D O   1 
ATOM   9273  C CB  . PRO D 1 67  ? -35.366 31.139  -43.991 1.00 9.24  ? 66  PRO D CB  1 
ATOM   9274  C CG  . PRO D 1 67  ? -36.697 30.586  -44.348 1.00 9.75  ? 66  PRO D CG  1 
ATOM   9275  C CD  . PRO D 1 67  ? -36.387 29.631  -45.465 1.00 10.57 ? 66  PRO D CD  1 
ATOM   9276  N N   . THR D 1 68  ? -32.569 30.476  -44.807 1.00 10.64 ? 67  THR D N   1 
ATOM   9277  C CA  . THR D 1 68  ? -31.155 30.497  -44.538 1.00 10.15 ? 67  THR D CA  1 
ATOM   9278  C C   . THR D 1 68  ? -30.339 30.679  -45.812 1.00 10.06 ? 67  THR D C   1 
ATOM   9279  O O   . THR D 1 68  ? -29.372 31.431  -45.793 1.00 10.20 ? 67  THR D O   1 
ATOM   9280  C CB  . THR D 1 68  ? -30.738 29.235  -43.767 1.00 10.46 ? 67  THR D CB  1 
ATOM   9281  O OG1 . THR D 1 68  ? -31.645 29.070  -42.682 1.00 9.54  ? 67  THR D OG1 1 
ATOM   9282  C CG2 . THR D 1 68  ? -29.286 29.349  -43.232 1.00 10.44 ? 67  THR D CG2 1 
ATOM   9283  N N   . ARG D 1 69  ? -30.716 30.015  -46.909 1.00 10.01 ? 68  ARG D N   1 
ATOM   9284  C CA  . ARG D 1 69  ? -30.015 30.221  -48.188 1.00 10.00 ? 68  ARG D CA  1 
ATOM   9285  C C   . ARG D 1 69  ? -30.200 31.634  -48.720 1.00 10.42 ? 68  ARG D C   1 
ATOM   9286  O O   . ARG D 1 69  ? -29.262 32.267  -49.241 1.00 10.99 ? 68  ARG D O   1 
ATOM   9287  C CB  . ARG D 1 69  ? -30.512 29.241  -49.254 1.00 10.05 ? 68  ARG D CB  1 
ATOM   9288  C CG  . ARG D 1 69  ? -29.697 29.270  -50.523 1.00 8.91  ? 68  ARG D CG  1 
ATOM   9289  C CD  . ARG D 1 69  ? -30.157 28.211  -51.477 1.00 9.51  ? 68  ARG D CD  1 
ATOM   9290  N NE  . ARG D 1 69  ? -31.260 28.671  -52.308 1.00 9.41  ? 68  ARG D NE  1 
ATOM   9291  C CZ  . ARG D 1 69  ? -32.105 27.862  -52.966 1.00 9.27  ? 68  ARG D CZ  1 
ATOM   9292  N NH1 . ARG D 1 69  ? -32.009 26.554  -52.872 1.00 10.70 ? 68  ARG D NH1 1 
ATOM   9293  N NH2 . ARG D 1 69  ? -33.050 28.366  -53.742 1.00 11.72 ? 68  ARG D NH2 1 
ATOM   9294  N N   . ASN D 1 70  ? -31.425 32.138  -48.613 1.00 11.36 ? 69  ASN D N   1 
ATOM   9295  C CA  . ASN D 1 70  ? -31.719 33.456  -49.139 1.00 11.23 ? 69  ASN D CA  1 
ATOM   9296  C C   . ASN D 1 70  ? -30.893 34.550  -48.397 1.00 10.43 ? 69  ASN D C   1 
ATOM   9297  O O   . ASN D 1 70  ? -30.416 35.508  -49.013 1.00 9.19  ? 69  ASN D O   1 
ATOM   9298  C CB  . ASN D 1 70  ? -33.237 33.712  -49.133 1.00 12.10 ? 69  ASN D CB  1 
ATOM   9299  C CG  . ASN D 1 70  ? -33.999 32.917  -50.221 1.00 13.46 ? 69  ASN D CG  1 
ATOM   9300  O OD1 . ASN D 1 70  ? -33.555 31.874  -50.721 1.00 13.27 ? 69  ASN D OD1 1 
ATOM   9301  N ND2 . ASN D 1 70  ? -35.167 33.427  -50.584 1.00 17.90 ? 69  ASN D ND2 1 
ATOM   9302  N N   . CYS D 1 71  ? -30.663 34.363  -47.104 1.00 10.08 ? 70  CYS D N   1 
ATOM   9303  C CA  . CYS D 1 71  ? -29.860 35.290  -46.301 1.00 10.50 ? 70  CYS D CA  1 
ATOM   9304  C C   . CYS D 1 71  ? -28.403 35.311  -46.753 1.00 10.00 ? 70  CYS D C   1 
ATOM   9305  O O   . CYS D 1 71  ? -27.814 36.368  -46.889 1.00 9.60  ? 70  CYS D O   1 
ATOM   9306  C CB  . CYS D 1 71  ? -29.912 34.903  -44.818 1.00 10.15 ? 70  CYS D CB  1 
ATOM   9307  S SG  . CYS D 1 71  ? -31.537 35.204  -44.061 1.00 12.59 ? 70  CYS D SG  1 
ATOM   9308  N N   . LEU D 1 72  ? -27.837 34.112  -46.922 1.00 10.32 ? 71  LEU D N   1 
ATOM   9309  C CA  . LEU D 1 72  ? -26.490 33.931  -47.458 1.00 10.15 ? 71  LEU D CA  1 
ATOM   9310  C C   . LEU D 1 72  ? -26.377 34.606  -48.807 1.00 10.47 ? 71  LEU D C   1 
ATOM   9311  O O   . LEU D 1 72  ? -25.442 35.365  -49.065 1.00 10.92 ? 71  LEU D O   1 
ATOM   9312  C CB  . LEU D 1 72  ? -26.173 32.423  -47.602 1.00 10.38 ? 71  LEU D CB  1 
ATOM   9313  C CG  . LEU D 1 72  ? -24.848 32.116  -48.294 1.00 10.70 ? 71  LEU D CG  1 
ATOM   9314  C CD1 . LEU D 1 72  ? -23.674 32.761  -47.548 1.00 8.20  ? 71  LEU D CD1 1 
ATOM   9315  C CD2 . LEU D 1 72  ? -24.664 30.632  -48.473 1.00 9.94  ? 71  LEU D CD2 1 
ATOM   9316  N N   . GLU D 1 73  ? -27.348 34.356  -49.678 1.00 11.21 ? 72  GLU D N   1 
ATOM   9317  C CA  . GLU D 1 73  ? -27.261 34.896  -51.011 1.00 11.46 ? 72  GLU D CA  1 
ATOM   9318  C C   . GLU D 1 73  ? -27.268 36.434  -50.991 1.00 11.22 ? 72  GLU D C   1 
ATOM   9319  O O   . GLU D 1 73  ? -26.500 37.055  -51.717 1.00 10.36 ? 72  GLU D O   1 
ATOM   9320  C CB  . GLU D 1 73  ? -28.361 34.320  -51.883 1.00 11.82 ? 72  GLU D CB  1 
ATOM   9321  C CG  . GLU D 1 73  ? -28.206 32.824  -52.196 1.00 11.59 ? 72  GLU D CG  1 
ATOM   9322  C CD  . GLU D 1 73  ? -29.388 32.276  -52.995 1.00 11.73 ? 72  GLU D CD  1 
ATOM   9323  O OE1 . GLU D 1 73  ? -30.434 32.956  -53.052 1.00 8.51  ? 72  GLU D OE1 1 
ATOM   9324  O OE2 . GLU D 1 73  ? -29.283 31.157  -53.548 1.00 9.10  ? 72  GLU D OE2 1 
ATOM   9325  N N   . LYS D 1 74  ? -28.113 37.045  -50.163 1.00 11.92 ? 73  LYS D N   1 
ATOM   9326  C CA  . LYS D 1 74  ? -28.119 38.516  -50.049 1.00 13.02 ? 73  LYS D CA  1 
ATOM   9327  C C   . LYS D 1 74  ? -26.770 39.049  -49.604 1.00 11.63 ? 73  LYS D C   1 
ATOM   9328  O O   . LYS D 1 74  ? -26.277 40.031  -50.129 1.00 11.26 ? 73  LYS D O   1 
ATOM   9329  C CB  . LYS D 1 74  ? -29.155 38.990  -49.044 1.00 13.77 ? 73  LYS D CB  1 
ATOM   9330  C CG  . LYS D 1 74  ? -30.577 38.843  -49.486 1.00 17.47 ? 73  LYS D CG  1 
ATOM   9331  C CD  . LYS D 1 74  ? -31.484 39.891  -48.799 1.00 17.78 ? 73  LYS D CD  1 
ATOM   9332  C CE  . LYS D 1 74  ? -32.212 39.359  -47.608 1.00 22.81 ? 73  LYS D CE  1 
ATOM   9333  N NZ  . LYS D 1 74  ? -33.362 40.288  -47.268 1.00 24.43 ? 73  LYS D NZ  1 
ATOM   9334  N N   . ALA D 1 75  ? -26.195 38.374  -48.617 1.00 11.40 ? 74  ALA D N   1 
ATOM   9335  C CA  . ALA D 1 75  ? -24.900 38.728  -48.058 1.00 10.68 ? 74  ALA D CA  1 
ATOM   9336  C C   . ALA D 1 75  ? -23.797 38.669  -49.121 1.00 11.02 ? 74  ALA D C   1 
ATOM   9337  O O   . ALA D 1 75  ? -23.057 39.644  -49.304 1.00 10.46 ? 74  ALA D O   1 
ATOM   9338  C CB  . ALA D 1 75  ? -24.572 37.815  -46.823 1.00 10.44 ? 74  ALA D CB  1 
ATOM   9339  N N   . VAL D 1 76  ? -23.720 37.556  -49.853 1.00 10.96 ? 75  VAL D N   1 
ATOM   9340  C CA  . VAL D 1 76  ? -22.684 37.386  -50.873 1.00 10.94 ? 75  VAL D CA  1 
ATOM   9341  C C   . VAL D 1 76  ? -22.847 38.391  -52.025 1.00 11.30 ? 75  VAL D C   1 
ATOM   9342  O O   . VAL D 1 76  ? -21.860 38.951  -52.500 1.00 11.19 ? 75  VAL D O   1 
ATOM   9343  C CB  . VAL D 1 76  ? -22.623 35.950  -51.416 1.00 10.81 ? 75  VAL D CB  1 
ATOM   9344  C CG1 . VAL D 1 76  ? -21.519 35.849  -52.449 1.00 10.09 ? 75  VAL D CG1 1 
ATOM   9345  C CG2 . VAL D 1 76  ? -22.349 34.975  -50.278 1.00 11.34 ? 75  VAL D CG2 1 
ATOM   9346  N N   . ALA D 1 77  ? -24.088 38.649  -52.440 1.00 10.94 ? 76  ALA D N   1 
ATOM   9347  C CA  . ALA D 1 77  ? -24.357 39.657  -53.440 1.00 11.10 ? 76  ALA D CA  1 
ATOM   9348  C C   . ALA D 1 77  ? -23.741 40.989  -53.033 1.00 11.52 ? 76  ALA D C   1 
ATOM   9349  O O   . ALA D 1 77  ? -23.040 41.632  -53.832 1.00 11.92 ? 76  ALA D O   1 
ATOM   9350  C CB  . ALA D 1 77  ? -25.867 39.800  -53.672 1.00 10.64 ? 76  ALA D CB  1 
ATOM   9351  N N   . ALA D 1 78  ? -23.992 41.412  -51.802 1.00 10.97 ? 77  ALA D N   1 
ATOM   9352  C CA  . ALA D 1 78  ? -23.423 42.644  -51.293 1.00 11.55 ? 77  ALA D CA  1 
ATOM   9353  C C   . ALA D 1 78  ? -21.915 42.647  -51.330 1.00 11.34 ? 77  ALA D C   1 
ATOM   9354  O O   . ALA D 1 78  ? -21.318 43.649  -51.670 1.00 11.14 ? 77  ALA D O   1 
ATOM   9355  C CB  . ALA D 1 78  ? -23.900 42.936  -49.882 1.00 10.81 ? 77  ALA D CB  1 
ATOM   9356  N N   . LEU D 1 79  ? -21.304 41.518  -50.988 1.00 11.46 ? 78  LEU D N   1 
ATOM   9357  C CA  . LEU D 1 79  ? -19.853 41.417  -50.948 1.00 12.05 ? 78  LEU D CA  1 
ATOM   9358  C C   . LEU D 1 79  ? -19.239 41.524  -52.341 1.00 11.86 ? 78  LEU D C   1 
ATOM   9359  O O   . LEU D 1 79  ? -18.157 42.128  -52.499 1.00 11.95 ? 78  LEU D O   1 
ATOM   9360  C CB  . LEU D 1 79  ? -19.421 40.139  -50.186 1.00 11.55 ? 78  LEU D CB  1 
ATOM   9361  C CG  . LEU D 1 79  ? -19.825 40.195  -48.693 1.00 13.01 ? 78  LEU D CG  1 
ATOM   9362  C CD1 . LEU D 1 79  ? -19.175 39.063  -47.911 1.00 10.67 ? 78  LEU D CD1 1 
ATOM   9363  C CD2 . LEU D 1 79  ? -19.518 41.552  -48.056 1.00 9.99  ? 78  LEU D CD2 1 
ATOM   9364  N N   . ASP D 1 80  ? -19.973 41.033  -53.344 1.00 12.35 ? 79  ASP D N   1 
ATOM   9365  C CA  . ASP D 1 80  ? -19.603 41.145  -54.763 1.00 12.69 ? 79  ASP D CA  1 
ATOM   9366  C C   . ASP D 1 80  ? -19.944 42.479  -55.420 1.00 13.44 ? 79  ASP D C   1 
ATOM   9367  O O   . ASP D 1 80  ? -19.526 42.729  -56.567 1.00 12.93 ? 79  ASP D O   1 
ATOM   9368  C CB  . ASP D 1 80  ? -20.278 40.034  -55.572 1.00 13.03 ? 79  ASP D CB  1 
ATOM   9369  C CG  . ASP D 1 80  ? -19.431 38.775  -55.650 1.00 14.95 ? 79  ASP D CG  1 
ATOM   9370  O OD1 . ASP D 1 80  ? -18.256 38.876  -56.098 1.00 18.81 ? 79  ASP D OD1 1 
ATOM   9371  O OD2 . ASP D 1 80  ? -19.939 37.703  -55.276 1.00 15.20 ? 79  ASP D OD2 1 
ATOM   9372  N N   . GLY D 1 81  ? -20.706 43.306  -54.701 1.00 13.69 ? 80  GLY D N   1 
ATOM   9373  C CA  . GLY D 1 81  ? -21.305 44.503  -55.250 1.00 13.67 ? 80  GLY D CA  1 
ATOM   9374  C C   . GLY D 1 81  ? -22.390 44.194  -56.258 1.00 14.04 ? 80  GLY D C   1 
ATOM   9375  O O   . GLY D 1 81  ? -22.628 44.987  -57.166 1.00 14.58 ? 80  GLY D O   1 
ATOM   9376  N N   . ALA D 1 82  ? -23.066 43.063  -56.086 1.00 14.14 ? 81  ALA D N   1 
ATOM   9377  C CA  . ALA D 1 82  ? -24.062 42.570  -57.035 1.00 14.07 ? 81  ALA D CA  1 
ATOM   9378  C C   . ALA D 1 82  ? -25.503 42.805  -56.555 1.00 14.46 ? 81  ALA D C   1 
ATOM   9379  O O   . ALA D 1 82  ? -25.749 42.946  -55.362 1.00 14.50 ? 81  ALA D O   1 
ATOM   9380  C CB  . ALA D 1 82  ? -23.839 41.059  -57.289 1.00 13.84 ? 81  ALA D CB  1 
ATOM   9381  N N   . LYS D 1 83  ? -26.448 42.834  -57.496 1.00 15.80 ? 82  LYS D N   1 
ATOM   9382  C CA  . LYS D 1 83  ? -27.869 42.862  -57.172 1.00 16.64 ? 82  LYS D CA  1 
ATOM   9383  C C   . LYS D 1 83  ? -28.302 41.500  -56.615 1.00 15.33 ? 82  LYS D C   1 
ATOM   9384  O O   . LYS D 1 83  ? -29.090 41.446  -55.688 1.00 14.26 ? 82  LYS D O   1 
ATOM   9385  C CB  . LYS D 1 83  ? -28.750 43.156  -58.403 1.00 17.30 ? 82  LYS D CB  1 
ATOM   9386  C CG  . LYS D 1 83  ? -28.505 44.464  -59.134 1.00 20.35 ? 82  LYS D CG  1 
ATOM   9387  C CD  . LYS D 1 83  ? -29.824 45.083  -59.705 1.00 21.19 ? 82  LYS D CD  1 
ATOM   9388  C CE  . LYS D 1 83  ? -30.465 44.321  -60.864 1.00 26.44 ? 82  LYS D CE  1 
ATOM   9389  N NZ  . LYS D 1 83  ? -30.111 44.873  -62.246 1.00 27.28 ? 82  LYS D NZ  1 
ATOM   9390  N N   . TYR D 1 84  ? -27.784 40.415  -57.192 1.00 14.35 ? 83  TYR D N   1 
ATOM   9391  C CA  . TYR D 1 84  ? -28.239 39.055  -56.867 1.00 14.13 ? 83  TYR D CA  1 
ATOM   9392  C C   . TYR D 1 84  ? -27.108 38.059  -56.666 1.00 13.22 ? 83  TYR D C   1 
ATOM   9393  O O   . TYR D 1 84  ? -26.013 38.192  -57.227 1.00 12.95 ? 83  TYR D O   1 
ATOM   9394  C CB  . TYR D 1 84  ? -29.144 38.515  -57.987 1.00 15.05 ? 83  TYR D CB  1 
ATOM   9395  C CG  . TYR D 1 84  ? -30.249 39.466  -58.440 1.00 15.20 ? 83  TYR D CG  1 
ATOM   9396  C CD1 . TYR D 1 84  ? -30.179 40.131  -59.661 1.00 17.01 ? 83  TYR D CD1 1 
ATOM   9397  C CD2 . TYR D 1 84  ? -31.366 39.680  -57.645 1.00 16.58 ? 83  TYR D CD2 1 
ATOM   9398  C CE1 . TYR D 1 84  ? -31.193 40.999  -60.078 1.00 15.84 ? 83  TYR D CE1 1 
ATOM   9399  C CE2 . TYR D 1 84  ? -32.379 40.542  -58.045 1.00 17.10 ? 83  TYR D CE2 1 
ATOM   9400  C CZ  . TYR D 1 84  ? -32.289 41.192  -59.259 1.00 17.28 ? 83  TYR D CZ  1 
ATOM   9401  O OH  . TYR D 1 84  ? -33.319 42.043  -59.618 1.00 19.05 ? 83  TYR D OH  1 
ATOM   9402  N N   . CYS D 1 85  ? -27.387 37.043  -55.858 1.00 12.20 ? 84  CYS D N   1 
ATOM   9403  C CA  . CYS D 1 85  ? -26.527 35.881  -55.786 1.00 11.94 ? 84  CYS D CA  1 
ATOM   9404  C C   . CYS D 1 85  ? -27.353 34.596  -55.682 1.00 10.78 ? 84  CYS D C   1 
ATOM   9405  O O   . CYS D 1 85  ? -28.490 34.621  -55.162 1.00 9.99  ? 84  CYS D O   1 
ATOM   9406  C CB  . CYS D 1 85  ? -25.543 36.022  -54.633 1.00 11.13 ? 84  CYS D CB  1 
ATOM   9407  S SG  . CYS D 1 85  ? -24.455 34.618  -54.465 1.00 12.71 ? 84  CYS D SG  1 
ATOM   9408  N N   . LEU D 1 86  ? -26.803 33.513  -56.239 1.00 10.04 ? 85  LEU D N   1 
ATOM   9409  C CA  . LEU D 1 86  ? -27.387 32.161  -56.166 1.00 9.99  ? 85  LEU D CA  1 
ATOM   9410  C C   . LEU D 1 86  ? -26.373 31.176  -55.588 1.00 9.31  ? 85  LEU D C   1 
ATOM   9411  O O   . LEU D 1 86  ? -25.226 31.131  -56.028 1.00 9.28  ? 85  LEU D O   1 
ATOM   9412  C CB  . LEU D 1 86  ? -27.859 31.651  -57.538 1.00 10.55 ? 85  LEU D CB  1 
ATOM   9413  C CG  . LEU D 1 86  ? -28.665 32.625  -58.393 1.00 10.51 ? 85  LEU D CG  1 
ATOM   9414  C CD1 . LEU D 1 86  ? -27.750 33.488  -59.285 1.00 8.91  ? 85  LEU D CD1 1 
ATOM   9415  C CD2 . LEU D 1 86  ? -29.677 31.849  -59.245 1.00 10.52 ? 85  LEU D CD2 1 
ATOM   9416  N N   . ALA D 1 87  ? -26.814 30.397  -54.600 1.00 8.06  ? 86  ALA D N   1 
ATOM   9417  C CA  . ALA D 1 87  ? -25.976 29.395  -53.933 1.00 8.45  ? 86  ALA D CA  1 
ATOM   9418  C C   . ALA D 1 87  ? -26.240 27.990  -54.503 1.00 8.75  ? 86  ALA D C   1 
ATOM   9419  O O   . ALA D 1 87  ? -27.367 27.664  -54.863 1.00 10.34 ? 86  ALA D O   1 
ATOM   9420  C CB  . ALA D 1 87  ? -26.211 29.429  -52.426 1.00 6.30  ? 86  ALA D CB  1 
ATOM   9421  N N   . PHE D 1 88  ? -25.183 27.178  -54.552 1.00 9.38  ? 87  PHE D N   1 
ATOM   9422  C CA  . PHE D 1 88  ? -25.173 25.871  -55.204 1.00 9.02  ? 87  PHE D CA  1 
ATOM   9423  C C   . PHE D 1 88  ? -24.422 24.864  -54.363 1.00 9.37  ? 87  PHE D C   1 
ATOM   9424  O O   . PHE D 1 88  ? -23.646 25.229  -53.462 1.00 8.79  ? 87  PHE D O   1 
ATOM   9425  C CB  . PHE D 1 88  ? -24.550 25.950  -56.606 1.00 9.61  ? 87  PHE D CB  1 
ATOM   9426  C CG  . PHE D 1 88  ? -25.340 26.800  -57.559 1.00 9.08  ? 87  PHE D CG  1 
ATOM   9427  C CD1 . PHE D 1 88  ? -24.932 28.074  -57.879 1.00 8.59  ? 87  PHE D CD1 1 
ATOM   9428  C CD2 . PHE D 1 88  ? -26.510 26.334  -58.107 1.00 10.96 ? 87  PHE D CD2 1 
ATOM   9429  C CE1 . PHE D 1 88  ? -25.668 28.877  -58.713 1.00 8.22  ? 87  PHE D CE1 1 
ATOM   9430  C CE2 . PHE D 1 88  ? -27.274 27.146  -58.952 1.00 9.78  ? 87  PHE D CE2 1 
ATOM   9431  C CZ  . PHE D 1 88  ? -26.852 28.426  -59.244 1.00 9.51  ? 87  PHE D CZ  1 
ATOM   9432  N N   . ALA D 1 89  ? -24.701 23.593  -54.651 1.00 10.07 ? 88  ALA D N   1 
ATOM   9433  C CA  . ALA D 1 89  ? -24.143 22.440  -53.929 1.00 10.34 ? 88  ALA D CA  1 
ATOM   9434  C C   . ALA D 1 89  ? -22.612 22.347  -53.953 1.00 10.43 ? 88  ALA D C   1 
ATOM   9435  O O   . ALA D 1 89  ? -22.037 21.714  -53.081 1.00 10.87 ? 88  ALA D O   1 
ATOM   9436  C CB  . ALA D 1 89  ? -24.724 21.155  -54.509 1.00 10.49 ? 88  ALA D CB  1 
ATOM   9437  N N   . SER D 1 90  ? -21.996 22.947  -54.975 1.00 10.44 ? 89  SER D N   1 
ATOM   9438  C CA  . SER D 1 90  ? -20.537 22.971  -55.174 1.00 10.12 ? 89  SER D CA  1 
ATOM   9439  C C   . SER D 1 90  ? -20.174 24.028  -56.188 1.00 10.09 ? 89  SER D C   1 
ATOM   9440  O O   . SER D 1 90  ? -21.034 24.490  -56.948 1.00 10.01 ? 89  SER D O   1 
ATOM   9441  C CB  . SER D 1 90  ? -19.987 21.603  -55.624 1.00 9.85  ? 89  SER D CB  1 
ATOM   9442  O OG  . SER D 1 90  ? -20.500 21.188  -56.887 1.00 9.94  ? 89  SER D OG  1 
ATOM   9443  N N   . GLY D 1 91  ? -18.902 24.413  -56.220 1.00 10.89 ? 90  GLY D N   1 
ATOM   9444  C CA  . GLY D 1 91  ? -18.408 25.232  -57.342 1.00 11.19 ? 90  GLY D CA  1 
ATOM   9445  C C   . GLY D 1 91  ? -18.635 24.572  -58.698 1.00 11.28 ? 90  GLY D C   1 
ATOM   9446  O O   . GLY D 1 91  ? -19.043 25.232  -59.681 1.00 12.25 ? 90  GLY D O   1 
ATOM   9447  N N   . LEU D 1 92  ? -18.380 23.271  -58.787 1.00 11.80 ? 91  LEU D N   1 
ATOM   9448  C CA  . LEU D 1 92  ? -18.639 22.550  -60.036 1.00 11.94 ? 91  LEU D CA  1 
ATOM   9449  C C   . LEU D 1 92  ? -20.131 22.567  -60.405 1.00 11.90 ? 91  LEU D C   1 
ATOM   9450  O O   . LEU D 1 92  ? -20.492 22.653  -61.589 1.00 12.72 ? 91  LEU D O   1 
ATOM   9451  C CB  . LEU D 1 92  ? -18.130 21.098  -59.978 1.00 12.90 ? 91  LEU D CB  1 
ATOM   9452  C CG  . LEU D 1 92  ? -16.629 20.803  -60.181 1.00 13.29 ? 91  LEU D CG  1 
ATOM   9453  C CD1 . LEU D 1 92  ? -16.401 19.300  -60.244 1.00 12.16 ? 91  LEU D CD1 1 
ATOM   9454  C CD2 . LEU D 1 92  ? -16.060 21.437  -61.446 1.00 12.41 ? 91  LEU D CD2 1 
ATOM   9455  N N   . ALA D 1 93  ? -21.014 22.461  -59.412 1.00 11.88 ? 92  ALA D N   1 
ATOM   9456  C CA  . ALA D 1 93  ? -22.452 22.563  -59.690 1.00 11.28 ? 92  ALA D CA  1 
ATOM   9457  C C   . ALA D 1 93  ? -22.844 23.974  -60.168 1.00 10.68 ? 92  ALA D C   1 
ATOM   9458  O O   . ALA D 1 93  ? -23.737 24.107  -60.985 1.00 11.00 ? 92  ALA D O   1 
ATOM   9459  C CB  . ALA D 1 93  ? -23.306 22.122  -58.477 1.00 11.33 ? 92  ALA D CB  1 
ATOM   9460  N N   . ALA D 1 94  ? -22.173 25.007  -59.671 1.00 10.51 ? 93  ALA D N   1 
ATOM   9461  C CA  . ALA D 1 94  ? -22.356 26.371  -60.158 1.00 10.52 ? 93  ALA D CA  1 
ATOM   9462  C C   . ALA D 1 94  ? -21.984 26.465  -61.628 1.00 10.07 ? 93  ALA D C   1 
ATOM   9463  O O   . ALA D 1 94  ? -22.712 27.020  -62.428 1.00 10.37 ? 93  ALA D O   1 
ATOM   9464  C CB  . ALA D 1 94  ? -21.502 27.381  -59.329 1.00 10.13 ? 93  ALA D CB  1 
ATOM   9465  N N   . THR D 1 95  ? -20.853 25.885  -61.975 1.00 10.76 ? 94  THR D N   1 
ATOM   9466  C CA  . THR D 1 95  ? -20.352 25.830  -63.368 1.00 10.44 ? 94  THR D CA  1 
ATOM   9467  C C   . THR D 1 95  ? -21.320 25.107  -64.351 1.00 9.97  ? 94  THR D C   1 
ATOM   9468  O O   . THR D 1 95  ? -21.602 25.579  -65.451 1.00 11.33 ? 94  THR D O   1 
ATOM   9469  C CB  . THR D 1 95  ? -18.984 25.107  -63.366 1.00 10.01 ? 94  THR D CB  1 
ATOM   9470  O OG1 . THR D 1 95  ? -18.118 25.773  -62.466 1.00 10.32 ? 94  THR D OG1 1 
ATOM   9471  C CG2 . THR D 1 95  ? -18.323 25.106  -64.755 1.00 9.96  ? 94  THR D CG2 1 
ATOM   9472  N N   . VAL D 1 96  ? -21.788 23.943  -63.948 1.00 10.24 ? 95  VAL D N   1 
ATOM   9473  C CA  . VAL D 1 96  ? -22.793 23.194  -64.682 1.00 9.61  ? 95  VAL D CA  1 
ATOM   9474  C C   . VAL D 1 96  ? -24.049 24.001  -64.881 1.00 9.67  ? 95  VAL D C   1 
ATOM   9475  O O   . VAL D 1 96  ? -24.607 24.057  -65.989 1.00 11.10 ? 95  VAL D O   1 
ATOM   9476  C CB  . VAL D 1 96  ? -23.135 21.869  -63.950 1.00 9.05  ? 95  VAL D CB  1 
ATOM   9477  C CG1 . VAL D 1 96  ? -24.233 21.102  -64.689 1.00 7.72  ? 95  VAL D CG1 1 
ATOM   9478  C CG2 . VAL D 1 96  ? -21.863 21.022  -63.797 1.00 7.08  ? 95  VAL D CG2 1 
ATOM   9479  N N   . THR D 1 97  ? -24.495 24.658  -63.822 1.00 10.13 ? 96  THR D N   1 
ATOM   9480  C CA  . THR D 1 97  ? -25.728 25.432  -63.887 1.00 9.56  ? 96  THR D CA  1 
ATOM   9481  C C   . THR D 1 97  ? -25.537 26.595  -64.831 1.00 10.70 ? 96  THR D C   1 
ATOM   9482  O O   . THR D 1 97  ? -26.403 26.866  -65.670 1.00 11.46 ? 96  THR D O   1 
ATOM   9483  C CB  . THR D 1 97  ? -26.181 25.921  -62.473 1.00 9.65  ? 96  THR D CB  1 
ATOM   9484  O OG1 . THR D 1 97  ? -26.362 24.790  -61.619 1.00 7.59  ? 96  THR D OG1 1 
ATOM   9485  C CG2 . THR D 1 97  ? -27.493 26.649  -62.540 1.00 6.23  ? 96  THR D CG2 1 
ATOM   9486  N N   . ILE D 1 98  ? -24.399 27.295  -64.718 1.00 11.56 ? 97  ILE D N   1 
ATOM   9487  C CA  . ILE D 1 98  ? -24.119 28.386  -65.648 1.00 10.94 ? 97  ILE D CA  1 
ATOM   9488  C C   . ILE D 1 98  ? -24.067 27.877  -67.099 1.00 11.42 ? 97  ILE D C   1 
ATOM   9489  O O   . ILE D 1 98  ? -24.522 28.537  -68.000 1.00 13.48 ? 97  ILE D O   1 
ATOM   9490  C CB  . ILE D 1 98  ? -22.796 29.132  -65.318 1.00 11.15 ? 97  ILE D CB  1 
ATOM   9491  C CG1 . ILE D 1 98  ? -22.882 29.908  -63.994 1.00 10.53 ? 97  ILE D CG1 1 
ATOM   9492  C CG2 . ILE D 1 98  ? -22.484 30.113  -66.423 1.00 10.27 ? 97  ILE D CG2 1 
ATOM   9493  C CD1 . ILE D 1 98  ? -21.533 30.326  -63.402 1.00 8.71  ? 97  ILE D CD1 1 
ATOM   9494  N N   . THR D 1 99  ? -23.474 26.721  -67.328 1.00 12.27 ? 98  THR D N   1 
ATOM   9495  C CA  . THR D 1 99  ? -23.349 26.166  -68.675 1.00 11.91 ? 98  THR D CA  1 
ATOM   9496  C C   . THR D 1 99  ? -24.723 25.833  -69.276 1.00 12.00 ? 98  THR D C   1 
ATOM   9497  O O   . THR D 1 99  ? -24.931 25.965  -70.486 1.00 12.01 ? 98  THR D O   1 
ATOM   9498  C CB  . THR D 1 99  ? -22.405 24.956  -68.658 1.00 12.63 ? 98  THR D CB  1 
ATOM   9499  O OG1 . THR D 1 99  ? -21.135 25.398  -68.148 1.00 12.10 ? 98  THR D OG1 1 
ATOM   9500  C CG2 . THR D 1 99  ? -22.249 24.312  -70.069 1.00 11.67 ? 98  THR D CG2 1 
ATOM   9501  N N   . HIS D 1 100 ? -25.677 25.456  -68.437 1.00 11.60 ? 99  HIS D N   1 
ATOM   9502  C CA  . HIS D 1 100 ? -27.069 25.301  -68.884 1.00 11.82 ? 99  HIS D CA  1 
ATOM   9503  C C   . HIS D 1 100 ? -27.803 26.591  -69.294 1.00 12.03 ? 99  HIS D C   1 
ATOM   9504  O O   . HIS D 1 100 ? -28.952 26.523  -69.740 1.00 12.43 ? 99  HIS D O   1 
ATOM   9505  C CB  . HIS D 1 100 ? -27.890 24.578  -67.829 1.00 11.31 ? 99  HIS D CB  1 
ATOM   9506  C CG  . HIS D 1 100 ? -27.627 23.122  -67.792 1.00 10.81 ? 99  HIS D CG  1 
ATOM   9507  N ND1 . HIS D 1 100 ? -26.460 22.596  -67.286 1.00 11.94 ? 99  HIS D ND1 1 
ATOM   9508  C CD2 . HIS D 1 100 ? -28.363 22.077  -68.222 1.00 11.78 ? 99  HIS D CD2 1 
ATOM   9509  C CE1 . HIS D 1 100 ? -26.498 21.281  -67.396 1.00 13.00 ? 99  HIS D CE1 1 
ATOM   9510  N NE2 . HIS D 1 100 ? -27.636 20.939  -67.977 1.00 11.92 ? 99  HIS D NE2 1 
ATOM   9511  N N   . LEU D 1 101 ? -27.176 27.745  -69.123 1.00 12.12 ? 100 LEU D N   1 
ATOM   9512  C CA  . LEU D 1 101 ? -27.682 28.953  -69.746 1.00 13.02 ? 100 LEU D CA  1 
ATOM   9513  C C   . LEU D 1 101 ? -27.646 28.857  -71.275 1.00 13.97 ? 100 LEU D C   1 
ATOM   9514  O O   . LEU D 1 101 ? -28.347 29.606  -71.966 1.00 15.40 ? 100 LEU D O   1 
ATOM   9515  C CB  . LEU D 1 101 ? -26.877 30.182  -69.300 1.00 12.30 ? 100 LEU D CB  1 
ATOM   9516  C CG  . LEU D 1 101 ? -26.946 30.614  -67.834 1.00 12.97 ? 100 LEU D CG  1 
ATOM   9517  C CD1 . LEU D 1 101 ? -25.912 31.741  -67.523 1.00 11.58 ? 100 LEU D CD1 1 
ATOM   9518  C CD2 . LEU D 1 101 ? -28.360 31.067  -67.459 1.00 10.94 ? 100 LEU D CD2 1 
ATOM   9519  N N   . LEU D 1 102 ? -26.805 27.963  -71.805 1.00 15.29 ? 101 LEU D N   1 
ATOM   9520  C CA  . LEU D 1 102 ? -26.574 27.873  -73.240 1.00 15.55 ? 101 LEU D CA  1 
ATOM   9521  C C   . LEU D 1 102 ? -27.566 26.933  -73.933 1.00 16.01 ? 101 LEU D C   1 
ATOM   9522  O O   . LEU D 1 102 ? -28.597 26.564  -73.361 1.00 15.26 ? 101 LEU D O   1 
ATOM   9523  C CB  . LEU D 1 102 ? -25.100 27.482  -73.503 1.00 15.62 ? 101 LEU D CB  1 
ATOM   9524  C CG  . LEU D 1 102 ? -24.066 28.401  -72.816 1.00 15.99 ? 101 LEU D CG  1 
ATOM   9525  C CD1 . LEU D 1 102 ? -22.621 28.069  -73.272 1.00 14.66 ? 101 LEU D CD1 1 
ATOM   9526  C CD2 . LEU D 1 102 ? -24.373 29.892  -73.028 1.00 15.56 ? 101 LEU D CD2 1 
ATOM   9527  N N   . LYS D 1 103 ? -27.267 26.588  -75.181 1.00 16.00 ? 102 LYS D N   1 
ATOM   9528  C CA  . LYS D 1 103 ? -28.017 25.577  -75.906 1.00 16.91 ? 102 LYS D CA  1 
ATOM   9529  C C   . LYS D 1 103 ? -27.116 24.914  -76.958 1.00 16.65 ? 102 LYS D C   1 
ATOM   9530  O O   . LYS D 1 103 ? -26.051 25.433  -77.291 1.00 15.92 ? 102 LYS D O   1 
ATOM   9531  C CB  . LYS D 1 103 ? -29.227 26.219  -76.580 1.00 16.93 ? 102 LYS D CB  1 
ATOM   9532  C CG  . LYS D 1 103 ? -28.818 27.296  -77.592 1.00 17.34 ? 102 LYS D CG  1 
ATOM   9533  C CD  . LYS D 1 103 ? -29.974 27.759  -78.422 1.00 20.04 ? 102 LYS D CD  1 
ATOM   9534  C CE  . LYS D 1 103 ? -30.828 28.761  -77.711 1.00 22.98 ? 102 LYS D CE  1 
ATOM   9535  N NZ  . LYS D 1 103 ? -32.203 28.763  -78.307 1.00 27.49 ? 102 LYS D NZ  1 
ATOM   9536  N N   . ALA D 1 104 ? -27.562 23.776  -77.491 1.00 17.04 ? 103 ALA D N   1 
ATOM   9537  C CA  . ALA D 1 104 ? -26.823 23.069  -78.549 1.00 17.17 ? 103 ALA D CA  1 
ATOM   9538  C C   . ALA D 1 104 ? -26.509 24.042  -79.678 1.00 17.54 ? 103 ALA D C   1 
ATOM   9539  O O   . ALA D 1 104 ? -27.378 24.813  -80.082 1.00 17.48 ? 103 ALA D O   1 
ATOM   9540  C CB  . ALA D 1 104 ? -27.633 21.892  -79.073 1.00 16.73 ? 103 ALA D CB  1 
ATOM   9541  N N   . GLY D 1 105 ? -25.262 24.013  -80.161 1.00 18.18 ? 104 GLY D N   1 
ATOM   9542  C CA  . GLY D 1 105 ? -24.783 24.924  -81.207 1.00 17.98 ? 104 GLY D CA  1 
ATOM   9543  C C   . GLY D 1 105 ? -23.897 26.048  -80.679 1.00 18.43 ? 104 GLY D C   1 
ATOM   9544  O O   . GLY D 1 105 ? -23.112 26.646  -81.435 1.00 18.83 ? 104 GLY D O   1 
ATOM   9545  N N   . ASP D 1 106 ? -24.023 26.352  -79.384 1.00 17.96 ? 105 ASP D N   1 
ATOM   9546  C CA  . ASP D 1 106 ? -23.228 27.394  -78.756 1.00 17.35 ? 105 ASP D CA  1 
ATOM   9547  C C   . ASP D 1 106 ? -21.788 26.946  -78.525 1.00 16.24 ? 105 ASP D C   1 
ATOM   9548  O O   . ASP D 1 106 ? -21.486 25.766  -78.451 1.00 16.69 ? 105 ASP D O   1 
ATOM   9549  C CB  . ASP D 1 106 ? -23.830 27.822  -77.414 1.00 17.45 ? 105 ASP D CB  1 
ATOM   9550  C CG  . ASP D 1 106 ? -25.170 28.549  -77.549 1.00 19.00 ? 105 ASP D CG  1 
ATOM   9551  O OD1 . ASP D 1 106 ? -25.656 28.869  -78.675 1.00 17.81 ? 105 ASP D OD1 1 
ATOM   9552  O OD2 . ASP D 1 106 ? -25.749 28.807  -76.480 1.00 19.27 ? 105 ASP D OD2 1 
ATOM   9553  N N   . GLN D 1 107 ? -20.908 27.928  -78.427 1.00 16.14 ? 106 GLN D N   1 
ATOM   9554  C CA  . GLN D 1 107 ? -19.514 27.693  -78.191 1.00 16.74 ? 106 GLN D CA  1 
ATOM   9555  C C   . GLN D 1 107 ? -19.131 28.301  -76.860 1.00 15.33 ? 106 GLN D C   1 
ATOM   9556  O O   . GLN D 1 107 ? -19.584 29.375  -76.508 1.00 15.82 ? 106 GLN D O   1 
ATOM   9557  C CB  . GLN D 1 107 ? -18.639 28.337  -79.266 1.00 16.75 ? 106 GLN D CB  1 
ATOM   9558  C CG  . GLN D 1 107 ? -17.166 28.024  -79.027 1.00 18.27 ? 106 GLN D CG  1 
ATOM   9559  C CD  . GLN D 1 107 ? -16.164 28.943  -79.703 1.00 19.39 ? 106 GLN D CD  1 
ATOM   9560  O OE1 . GLN D 1 107 ? -16.439 30.119  -79.995 1.00 21.61 ? 106 GLN D OE1 1 
ATOM   9561  N NE2 . GLN D 1 107 ? -14.950 28.403  -79.917 1.00 20.93 ? 106 GLN D NE2 1 
ATOM   9562  N N   . ILE D 1 108 ? -18.248 27.606  -76.162 1.00 15.09 ? 107 ILE D N   1 
ATOM   9563  C CA  . ILE D 1 108 ? -17.674 28.078  -74.929 1.00 14.93 ? 107 ILE D CA  1 
ATOM   9564  C C   . ILE D 1 108 ? -16.188 28.267  -75.102 1.00 15.06 ? 107 ILE D C   1 
ATOM   9565  O O   . ILE D 1 108 ? -15.528 27.376  -75.569 1.00 14.93 ? 107 ILE D O   1 
ATOM   9566  C CB  . ILE D 1 108 ? -17.874 27.045  -73.795 1.00 14.86 ? 107 ILE D CB  1 
ATOM   9567  C CG1 . ILE D 1 108 ? -19.368 26.794  -73.553 1.00 14.63 ? 107 ILE D CG1 1 
ATOM   9568  C CG2 . ILE D 1 108 ? -17.175 27.520  -72.509 1.00 14.29 ? 107 ILE D CG2 1 
ATOM   9569  C CD1 . ILE D 1 108 ? -19.661 25.675  -72.535 1.00 15.07 ? 107 ILE D CD1 1 
ATOM   9570  N N   . ILE D 1 109 ? -15.677 29.427  -74.689 1.00 15.73 ? 108 ILE D N   1 
ATOM   9571  C CA  . ILE D 1 109 ? -14.256 29.657  -74.547 1.00 16.17 ? 108 ILE D CA  1 
ATOM   9572  C C   . ILE D 1 109 ? -13.861 29.636  -73.073 1.00 15.88 ? 108 ILE D C   1 
ATOM   9573  O O   . ILE D 1 109 ? -14.388 30.385  -72.251 1.00 16.31 ? 108 ILE D O   1 
ATOM   9574  C CB  . ILE D 1 109 ? -13.809 31.002  -75.223 1.00 16.25 ? 108 ILE D CB  1 
ATOM   9575  C CG1 . ILE D 1 109 ? -14.087 30.939  -76.731 1.00 16.40 ? 108 ILE D CG1 1 
ATOM   9576  C CG2 . ILE D 1 109 ? -12.332 31.316  -74.925 1.00 15.92 ? 108 ILE D CG2 1 
ATOM   9577  C CD1 . ILE D 1 109 ? -13.868 32.269  -77.485 1.00 16.96 ? 108 ILE D CD1 1 
ATOM   9578  N N   . CYS D 1 110 ? -12.928 28.757  -72.744 1.00 15.47 ? 109 CYS D N   1 
ATOM   9579  C CA  . CYS D 1 110 ? -12.463 28.605  -71.388 1.00 15.02 ? 109 CYS D CA  1 
ATOM   9580  C C   . CYS D 1 110 ? -10.994 28.976  -71.340 1.00 15.37 ? 109 CYS D C   1 
ATOM   9581  O O   . CYS D 1 110 ? -10.227 28.558  -72.200 1.00 15.84 ? 109 CYS D O   1 
ATOM   9582  C CB  . CYS D 1 110 ? -12.644 27.157  -70.933 1.00 15.21 ? 109 CYS D CB  1 
ATOM   9583  S SG  . CYS D 1 110 ? -12.169 26.876  -69.188 1.00 15.31 ? 109 CYS D SG  1 
ATOM   9584  N N   . MET D 1 111 ? -10.607 29.742  -70.326 1.00 15.09 ? 110 MET D N   1 
ATOM   9585  C CA  . MET D 1 111 ? -9.202  29.989  -70.022 1.00 15.05 ? 110 MET D CA  1 
ATOM   9586  C C   . MET D 1 111 ? -8.416  28.668  -70.055 1.00 15.47 ? 110 MET D C   1 
ATOM   9587  O O   . MET D 1 111 ? -8.901  27.634  -69.575 1.00 15.40 ? 110 MET D O   1 
ATOM   9588  C CB  . MET D 1 111 ? -9.124  30.669  -68.653 1.00 14.93 ? 110 MET D CB  1 
ATOM   9589  C CG  . MET D 1 111 ? -7.757  31.071  -68.190 1.00 15.88 ? 110 MET D CG  1 
ATOM   9590  S SD  . MET D 1 111 ? -6.857  32.068  -69.391 1.00 15.75 ? 110 MET D SD  1 
ATOM   9591  C CE  . MET D 1 111 ? -5.196  31.952  -68.688 1.00 15.90 ? 110 MET D CE  1 
ATOM   9592  N N   . ASP D 1 112 ? -7.204  28.688  -70.624 1.00 15.17 ? 111 ASP D N   1 
ATOM   9593  C CA  . ASP D 1 112 ? -6.460  27.444  -70.828 1.00 15.31 ? 111 ASP D CA  1 
ATOM   9594  C C   . ASP D 1 112 ? -6.013  26.787  -69.513 1.00 14.41 ? 111 ASP D C   1 
ATOM   9595  O O   . ASP D 1 112 ? -5.996  25.577  -69.417 1.00 13.87 ? 111 ASP D O   1 
ATOM   9596  C CB  . ASP D 1 112 ? -5.280  27.611  -71.809 1.00 15.42 ? 111 ASP D CB  1 
ATOM   9597  C CG  . ASP D 1 112 ? -4.208  28.596  -71.318 1.00 15.84 ? 111 ASP D CG  1 
ATOM   9598  O OD1 . ASP D 1 112 ? -3.158  28.697  -71.976 1.00 21.32 ? 111 ASP D OD1 1 
ATOM   9599  O OD2 . ASP D 1 112 ? -4.369  29.272  -70.313 1.00 14.41 ? 111 ASP D OD2 1 
ATOM   9600  N N   . ASP D 1 113 ? -5.696  27.585  -68.503 1.00 14.30 ? 112 ASP D N   1 
ATOM   9601  C CA  . ASP D 1 113 ? -5.335  27.054  -67.199 1.00 14.33 ? 112 ASP D CA  1 
ATOM   9602  C C   . ASP D 1 113 ? -6.483  27.306  -66.223 1.00 13.81 ? 112 ASP D C   1 
ATOM   9603  O O   . ASP D 1 113 ? -6.746  28.434  -65.818 1.00 13.73 ? 112 ASP D O   1 
ATOM   9604  C CB  . ASP D 1 113 ? -4.046  27.694  -66.691 1.00 14.50 ? 112 ASP D CB  1 
ATOM   9605  C CG  . ASP D 1 113 ? -3.497  27.021  -65.443 1.00 14.78 ? 112 ASP D CG  1 
ATOM   9606  O OD1 . ASP D 1 113 ? -3.504  25.781  -65.396 1.00 15.96 ? 112 ASP D OD1 1 
ATOM   9607  O OD2 . ASP D 1 113 ? -3.023  27.728  -64.510 1.00 13.75 ? 112 ASP D OD2 1 
ATOM   9608  N N   . VAL D 1 114 ? -7.157  26.226  -65.853 1.00 14.12 ? 113 VAL D N   1 
ATOM   9609  C CA  . VAL D 1 114 ? -8.224  26.273  -64.860 1.00 13.12 ? 113 VAL D CA  1 
ATOM   9610  C C   . VAL D 1 114 ? -8.178  25.088  -63.901 1.00 13.96 ? 113 VAL D C   1 
ATOM   9611  O O   . VAL D 1 114 ? -7.485  24.073  -64.150 1.00 14.49 ? 113 VAL D O   1 
ATOM   9612  C CB  . VAL D 1 114 ? -9.619  26.362  -65.544 1.00 12.93 ? 113 VAL D CB  1 
ATOM   9613  C CG1 . VAL D 1 114 ? -9.799  27.706  -66.282 1.00 12.85 ? 113 VAL D CG1 1 
ATOM   9614  C CG2 . VAL D 1 114 ? -9.839  25.179  -66.476 1.00 10.73 ? 113 VAL D CG2 1 
ATOM   9615  N N   . TYR D 1 115 ? -8.904  25.236  -62.789 1.00 13.36 ? 114 TYR D N   1 
ATOM   9616  C CA  . TYR D 1 115 ? -9.213  24.138  -61.904 1.00 13.63 ? 114 TYR D CA  1 
ATOM   9617  C C   . TYR D 1 115 ? -9.409  22.867  -62.745 1.00 13.12 ? 114 TYR D C   1 
ATOM   9618  O O   . TYR D 1 115 ? -10.198 22.868  -63.695 1.00 12.85 ? 114 TYR D O   1 
ATOM   9619  C CB  . TYR D 1 115 ? -10.487 24.430  -61.096 1.00 14.52 ? 114 TYR D CB  1 
ATOM   9620  C CG  . TYR D 1 115 ? -10.844 23.271  -60.219 1.00 16.76 ? 114 TYR D CG  1 
ATOM   9621  C CD1 . TYR D 1 115 ? -9.911  22.759  -59.321 1.00 18.13 ? 114 TYR D CD1 1 
ATOM   9622  C CD2 . TYR D 1 115 ? -12.088 22.654  -60.311 1.00 18.60 ? 114 TYR D CD2 1 
ATOM   9623  C CE1 . TYR D 1 115 ? -10.198 21.675  -58.549 1.00 19.49 ? 114 TYR D CE1 1 
ATOM   9624  C CE2 . TYR D 1 115 ? -12.391 21.589  -59.526 1.00 20.25 ? 114 TYR D CE2 1 
ATOM   9625  C CZ  . TYR D 1 115 ? -11.443 21.099  -58.647 1.00 19.32 ? 114 TYR D CZ  1 
ATOM   9626  O OH  . TYR D 1 115 ? -11.727 20.010  -57.875 1.00 19.84 ? 114 TYR D OH  1 
ATOM   9627  N N   . GLY D 1 116 ? -8.702  21.799  -62.401 1.00 12.52 ? 115 GLY D N   1 
ATOM   9628  C CA  . GLY D 1 116 ? -8.787  20.537  -63.156 1.00 12.82 ? 115 GLY D CA  1 
ATOM   9629  C C   . GLY D 1 116 ? -10.214 20.035  -63.369 1.00 13.40 ? 115 GLY D C   1 
ATOM   9630  O O   . GLY D 1 116 ? -10.542 19.473  -64.429 1.00 14.09 ? 115 GLY D O   1 
ATOM   9631  N N   . GLY D 1 117 ? -11.070 20.203  -62.367 1.00 13.72 ? 116 GLY D N   1 
ATOM   9632  C CA  . GLY D 1 117 ? -12.503 19.849  -62.506 1.00 13.74 ? 116 GLY D CA  1 
ATOM   9633  C C   . GLY D 1 117 ? -13.284 20.674  -63.520 1.00 13.26 ? 116 GLY D C   1 
ATOM   9634  O O   . GLY D 1 117 ? -14.263 20.186  -64.100 1.00 13.77 ? 116 GLY D O   1 
ATOM   9635  N N   . THR D 1 118 ? -12.871 21.921  -63.748 1.00 13.09 ? 117 THR D N   1 
ATOM   9636  C CA  . THR D 1 118 ? -13.509 22.786  -64.747 1.00 13.17 ? 117 THR D CA  1 
ATOM   9637  C C   . THR D 1 118 ? -13.131 22.320  -66.151 1.00 13.15 ? 117 THR D C   1 
ATOM   9638  O O   . THR D 1 118 ? -14.000 22.199  -67.025 1.00 12.85 ? 117 THR D O   1 
ATOM   9639  C CB  . THR D 1 118 ? -13.126 24.274  -64.562 1.00 13.54 ? 117 THR D CB  1 
ATOM   9640  O OG1 . THR D 1 118 ? -13.494 24.700  -63.241 1.00 12.61 ? 117 THR D OG1 1 
ATOM   9641  C CG2 . THR D 1 118 ? -13.828 25.151  -65.568 1.00 14.03 ? 117 THR D CG2 1 
ATOM   9642  N N   . ASN D 1 119 ? -11.836 22.043  -66.322 1.00 12.70 ? 118 ASN D N   1 
ATOM   9643  C CA  . ASN D 1 119 ? -11.303 21.463  -67.538 1.00 13.20 ? 118 ASN D CA  1 
ATOM   9644  C C   . ASN D 1 119 ? -12.041 20.178  -67.884 1.00 12.93 ? 118 ASN D C   1 
ATOM   9645  O O   . ASN D 1 119 ? -12.520 20.015  -68.994 1.00 13.37 ? 118 ASN D O   1 
ATOM   9646  C CB  . ASN D 1 119 ? -9.794  21.182  -67.367 1.00 13.13 ? 118 ASN D CB  1 
ATOM   9647  C CG  . ASN D 1 119 ? -9.116  20.806  -68.660 1.00 14.08 ? 118 ASN D CG  1 
ATOM   9648  O OD1 . ASN D 1 119 ? -9.437  19.782  -69.272 1.00 13.33 ? 118 ASN D OD1 1 
ATOM   9649  N ND2 . ASN D 1 119 ? -8.159  21.633  -69.082 1.00 13.11 ? 118 ASN D ND2 1 
ATOM   9650  N N   . ARG D 1 120 ? -12.156 19.292  -66.906 1.00 12.96 ? 119 ARG D N   1 
ATOM   9651  C CA  . ARG D 1 120 ? -12.819 18.010  -67.104 1.00 13.62 ? 119 ARG D CA  1 
ATOM   9652  C C   . ARG D 1 120 ? -14.282 18.150  -67.547 1.00 13.23 ? 119 ARG D C   1 
ATOM   9653  O O   . ARG D 1 120 ? -14.697 17.516  -68.523 1.00 12.64 ? 119 ARG D O   1 
ATOM   9654  C CB  . ARG D 1 120 ? -12.718 17.206  -65.810 1.00 14.33 ? 119 ARG D CB  1 
ATOM   9655  C CG  . ARG D 1 120 ? -13.513 15.911  -65.785 1.00 15.17 ? 119 ARG D CG  1 
ATOM   9656  C CD  . ARG D 1 120 ? -13.302 15.230  -64.459 1.00 16.55 ? 119 ARG D CD  1 
ATOM   9657  N NE  . ARG D 1 120 ? -13.855 16.019  -63.357 1.00 18.65 ? 119 ARG D NE  1 
ATOM   9658  C CZ  . ARG D 1 120 ? -13.355 16.062  -62.122 1.00 19.13 ? 119 ARG D CZ  1 
ATOM   9659  N NH1 . ARG D 1 120 ? -12.295 15.333  -61.807 1.00 22.27 ? 119 ARG D NH1 1 
ATOM   9660  N NH2 . ARG D 1 120 ? -13.918 16.828  -61.189 1.00 19.47 ? 119 ARG D NH2 1 
ATOM   9661  N N   . TYR D 1 121 ? -15.049 18.982  -66.839 1.00 13.22 ? 120 TYR D N   1 
ATOM   9662  C CA  . TYR D 1 121 ? -16.467 19.154  -67.130 1.00 13.19 ? 120 TYR D CA  1 
ATOM   9663  C C   . TYR D 1 121 ? -16.694 19.648  -68.551 1.00 13.82 ? 120 TYR D C   1 
ATOM   9664  O O   . TYR D 1 121 ? -17.501 19.083  -69.292 1.00 13.88 ? 120 TYR D O   1 
ATOM   9665  C CB  . TYR D 1 121 ? -17.149 20.129  -66.150 1.00 12.68 ? 120 TYR D CB  1 
ATOM   9666  C CG  . TYR D 1 121 ? -18.536 20.546  -66.646 1.00 12.57 ? 120 TYR D CG  1 
ATOM   9667  C CD1 . TYR D 1 121 ? -19.558 19.597  -66.794 1.00 13.08 ? 120 TYR D CD1 1 
ATOM   9668  C CD2 . TYR D 1 121 ? -18.806 21.858  -67.015 1.00 11.30 ? 120 TYR D CD2 1 
ATOM   9669  C CE1 . TYR D 1 121 ? -20.799 19.955  -67.279 1.00 10.26 ? 120 TYR D CE1 1 
ATOM   9670  C CE2 . TYR D 1 121 ? -20.054 22.228  -67.473 1.00 12.28 ? 120 TYR D CE2 1 
ATOM   9671  C CZ  . TYR D 1 121 ? -21.045 21.271  -67.600 1.00 10.86 ? 120 TYR D CZ  1 
ATOM   9672  O OH  . TYR D 1 121 ? -22.276 21.623  -68.077 1.00 10.83 ? 120 TYR D OH  1 
ATOM   9673  N N   . PHE D 1 122 ? -15.996 20.721  -68.923 1.00 14.62 ? 121 PHE D N   1 
ATOM   9674  C CA  . PHE D 1 122 ? -16.102 21.240  -70.288 1.00 15.07 ? 121 PHE D CA  1 
ATOM   9675  C C   . PHE D 1 122 ? -15.615 20.228  -71.335 1.00 15.87 ? 121 PHE D C   1 
ATOM   9676  O O   . PHE D 1 122 ? -16.355 19.879  -72.264 1.00 16.10 ? 121 PHE D O   1 
ATOM   9677  C CB  . PHE D 1 122 ? -15.334 22.560  -70.442 1.00 14.56 ? 121 PHE D CB  1 
ATOM   9678  C CG  . PHE D 1 122 ? -15.976 23.734  -69.760 1.00 14.40 ? 121 PHE D CG  1 
ATOM   9679  C CD1 . PHE D 1 122 ? -17.360 23.910  -69.768 1.00 13.14 ? 121 PHE D CD1 1 
ATOM   9680  C CD2 . PHE D 1 122 ? -15.183 24.697  -69.130 1.00 13.97 ? 121 PHE D CD2 1 
ATOM   9681  C CE1 . PHE D 1 122 ? -17.928 25.012  -69.178 1.00 13.48 ? 121 PHE D CE1 1 
ATOM   9682  C CE2 . PHE D 1 122 ? -15.752 25.787  -68.505 1.00 12.69 ? 121 PHE D CE2 1 
ATOM   9683  C CZ  . PHE D 1 122 ? -17.124 25.943  -68.511 1.00 13.09 ? 121 PHE D CZ  1 
ATOM   9684  N N   . ARG D 1 123 ? -14.395 19.730  -71.150 1.00 16.90 ? 122 ARG D N   1 
ATOM   9685  C CA  . ARG D 1 123 ? -13.750 18.878  -72.145 1.00 17.32 ? 122 ARG D CA  1 
ATOM   9686  C C   . ARG D 1 123 ? -14.506 17.565  -72.330 1.00 16.36 ? 122 ARG D C   1 
ATOM   9687  O O   . ARG D 1 123 ? -14.793 17.155  -73.467 1.00 16.51 ? 122 ARG D O   1 
ATOM   9688  C CB  . ARG D 1 123 ? -12.294 18.587  -71.748 1.00 17.02 ? 122 ARG D CB  1 
ATOM   9689  C CG  . ARG D 1 123 ? -11.494 17.920  -72.854 1.00 19.02 ? 122 ARG D CG  1 
ATOM   9690  C CD  . ARG D 1 123 ? -10.051 17.694  -72.475 1.00 20.45 ? 122 ARG D CD  1 
ATOM   9691  N NE  . ARG D 1 123 ? -9.912  16.613  -71.506 1.00 24.12 ? 122 ARG D NE  1 
ATOM   9692  C CZ  . ARG D 1 123 ? -10.060 15.321  -71.789 1.00 25.97 ? 122 ARG D CZ  1 
ATOM   9693  N NH1 . ARG D 1 123 ? -10.338 14.904  -73.024 1.00 29.62 ? 122 ARG D NH1 1 
ATOM   9694  N NH2 . ARG D 1 123 ? -9.922  14.430  -70.822 1.00 27.83 ? 122 ARG D NH2 1 
ATOM   9695  N N   . GLN D 1 124 ? -14.865 16.921  -71.222 1.00 15.44 ? 123 GLN D N   1 
ATOM   9696  C CA  . GLN D 1 124 ? -15.410 15.561  -71.266 1.00 14.87 ? 123 GLN D CA  1 
ATOM   9697  C C   . GLN D 1 124 ? -16.927 15.444  -71.186 1.00 15.35 ? 123 GLN D C   1 
ATOM   9698  O O   . GLN D 1 124 ? -17.484 14.472  -71.694 1.00 15.02 ? 123 GLN D O   1 
ATOM   9699  C CB  . GLN D 1 124 ? -14.775 14.710  -70.191 1.00 15.14 ? 123 GLN D CB  1 
ATOM   9700  C CG  . GLN D 1 124 ? -13.281 14.597  -70.372 1.00 16.21 ? 123 GLN D CG  1 
ATOM   9701  C CD  . GLN D 1 124 ? -12.604 13.975  -69.181 1.00 18.37 ? 123 GLN D CD  1 
ATOM   9702  O OE1 . GLN D 1 124 ? -11.712 14.578  -68.568 1.00 26.12 ? 123 GLN D OE1 1 
ATOM   9703  N NE2 . GLN D 1 124 ? -13.003 12.779  -68.847 1.00 15.19 ? 123 GLN D NE2 1 
ATOM   9704  N N   . VAL D 1 125 ? -17.602 16.410  -70.563 1.00 15.43 ? 124 VAL D N   1 
ATOM   9705  C CA  . VAL D 1 125 ? -19.054 16.307  -70.381 1.00 15.53 ? 124 VAL D CA  1 
ATOM   9706  C C   . VAL D 1 125 ? -19.845 17.279  -71.264 1.00 15.93 ? 124 VAL D C   1 
ATOM   9707  O O   . VAL D 1 125 ? -20.629 16.832  -72.094 1.00 16.26 ? 124 VAL D O   1 
ATOM   9708  C CB  . VAL D 1 125 ? -19.456 16.506  -68.913 1.00 15.29 ? 124 VAL D CB  1 
ATOM   9709  C CG1 . VAL D 1 125 ? -20.979 16.329  -68.754 1.00 15.20 ? 124 VAL D CG1 1 
ATOM   9710  C CG2 . VAL D 1 125 ? -18.683 15.505  -68.029 1.00 14.22 ? 124 VAL D CG2 1 
ATOM   9711  N N   . ALA D 1 126 ? -19.648 18.582  -71.060 1.00 15.32 ? 125 ALA D N   1 
ATOM   9712  C CA  . ALA D 1 126 ? -20.385 19.620  -71.798 1.00 15.98 ? 125 ALA D CA  1 
ATOM   9713  C C   . ALA D 1 126 ? -20.283 19.452  -73.313 1.00 16.56 ? 125 ALA D C   1 
ATOM   9714  O O   . ALA D 1 126 ? -21.243 19.699  -74.050 1.00 17.59 ? 125 ALA D O   1 
ATOM   9715  C CB  . ALA D 1 126 ? -19.884 21.001  -71.406 1.00 14.73 ? 125 ALA D CB  1 
ATOM   9716  N N   . SER D 1 127 ? -19.097 19.055  -73.754 1.00 17.21 ? 126 SER D N   1 
ATOM   9717  C CA  . SER D 1 127 ? -18.789 18.911  -75.164 1.00 18.20 ? 126 SER D CA  1 
ATOM   9718  C C   . SER D 1 127 ? -19.649 17.822  -75.847 1.00 18.48 ? 126 SER D C   1 
ATOM   9719  O O   . SER D 1 127 ? -19.812 17.836  -77.062 1.00 19.05 ? 126 SER D O   1 
ATOM   9720  C CB  . SER D 1 127 ? -17.304 18.617  -75.314 1.00 17.14 ? 126 SER D CB  1 
ATOM   9721  O OG  . SER D 1 127 ? -16.982 17.403  -74.688 1.00 18.83 ? 126 SER D OG  1 
ATOM   9722  N N   . GLU D 1 128 ? -20.217 16.905  -75.065 1.00 18.85 ? 127 GLU D N   1 
ATOM   9723  C CA  . GLU D 1 128 ? -21.107 15.872  -75.607 1.00 19.02 ? 127 GLU D CA  1 
ATOM   9724  C C   . GLU D 1 128 ? -22.554 16.314  -75.812 1.00 18.68 ? 127 GLU D C   1 
ATOM   9725  O O   . GLU D 1 128 ? -23.372 15.504  -76.288 1.00 18.43 ? 127 GLU D O   1 
ATOM   9726  C CB  . GLU D 1 128 ? -21.071 14.626  -74.722 1.00 19.43 ? 127 GLU D CB  1 
ATOM   9727  C CG  . GLU D 1 128 ? -19.674 14.034  -74.598 1.00 22.04 ? 127 GLU D CG  1 
ATOM   9728  C CD  . GLU D 1 128 ? -19.258 13.183  -75.781 1.00 26.11 ? 127 GLU D CD  1 
ATOM   9729  O OE1 . GLU D 1 128 ? -18.079 12.733  -75.785 1.00 27.90 ? 127 GLU D OE1 1 
ATOM   9730  O OE2 . GLU D 1 128 ? -20.098 12.948  -76.686 1.00 27.17 ? 127 GLU D OE2 1 
ATOM   9731  N N   . PHE D 1 129 ? -22.863 17.579  -75.502 1.00 18.38 ? 128 PHE D N   1 
ATOM   9732  C CA  . PHE D 1 129 ? -24.234 18.081  -75.567 1.00 18.45 ? 128 PHE D CA  1 
ATOM   9733  C C   . PHE D 1 129 ? -24.417 19.260  -76.516 1.00 18.34 ? 128 PHE D C   1 
ATOM   9734  O O   . PHE D 1 129 ? -25.166 20.187  -76.237 1.00 18.44 ? 128 PHE D O   1 
ATOM   9735  C CB  . PHE D 1 129 ? -24.764 18.382  -74.151 1.00 17.87 ? 128 PHE D CB  1 
ATOM   9736  C CG  . PHE D 1 129 ? -24.906 17.153  -73.311 1.00 17.64 ? 128 PHE D CG  1 
ATOM   9737  C CD1 . PHE D 1 129 ? -23.946 16.823  -72.371 1.00 17.54 ? 128 PHE D CD1 1 
ATOM   9738  C CD2 . PHE D 1 129 ? -25.991 16.290  -73.496 1.00 17.10 ? 128 PHE D CD2 1 
ATOM   9739  C CE1 . PHE D 1 129 ? -24.061 15.659  -71.635 1.00 17.74 ? 128 PHE D CE1 1 
ATOM   9740  C CE2 . PHE D 1 129 ? -26.113 15.146  -72.758 1.00 16.72 ? 128 PHE D CE2 1 
ATOM   9741  C CZ  . PHE D 1 129 ? -25.144 14.829  -71.814 1.00 17.12 ? 128 PHE D CZ  1 
ATOM   9742  N N   . GLY D 1 130 ? -23.735 19.206  -77.654 1.00 18.64 ? 129 GLY D N   1 
ATOM   9743  C CA  . GLY D 1 130 ? -23.893 20.217  -78.683 1.00 18.96 ? 129 GLY D CA  1 
ATOM   9744  C C   . GLY D 1 130 ? -23.103 21.477  -78.413 1.00 19.22 ? 129 GLY D C   1 
ATOM   9745  O O   . GLY D 1 130 ? -23.282 22.495  -79.114 1.00 19.89 ? 129 GLY D O   1 
ATOM   9746  N N   . LEU D 1 131 ? -22.233 21.425  -77.407 1.00 19.10 ? 130 LEU D N   1 
ATOM   9747  C CA  . LEU D 1 131 ? -21.459 22.594  -77.010 1.00 19.39 ? 130 LEU D CA  1 
ATOM   9748  C C   . LEU D 1 131 ? -20.028 22.395  -77.477 1.00 19.44 ? 130 LEU D C   1 
ATOM   9749  O O   . LEU D 1 131 ? -19.451 21.357  -77.223 1.00 19.31 ? 130 LEU D O   1 
ATOM   9750  C CB  . LEU D 1 131 ? -21.532 22.821  -75.492 1.00 19.01 ? 130 LEU D CB  1 
ATOM   9751  C CG  . LEU D 1 131 ? -22.909 23.124  -74.918 1.00 18.85 ? 130 LEU D CG  1 
ATOM   9752  C CD1 . LEU D 1 131 ? -22.914 23.141  -73.370 1.00 17.46 ? 130 LEU D CD1 1 
ATOM   9753  C CD2 . LEU D 1 131 ? -23.454 24.456  -75.472 1.00 19.30 ? 130 LEU D CD2 1 
ATOM   9754  N N   . LYS D 1 132 ? -19.501 23.375  -78.218 1.00 19.96 ? 131 LYS D N   1 
ATOM   9755  C CA  . LYS D 1 132 ? -18.117 23.366  -78.684 1.00 20.19 ? 131 LYS D CA  1 
ATOM   9756  C C   . LYS D 1 132 ? -17.237 24.047  -77.649 1.00 18.98 ? 131 LYS D C   1 
ATOM   9757  O O   . LYS D 1 132 ? -17.530 25.148  -77.232 1.00 18.84 ? 131 LYS D O   1 
ATOM   9758  C CB  . LYS D 1 132 ? -17.977 24.119  -80.020 1.00 20.47 ? 131 LYS D CB  1 
ATOM   9759  C CG  . LYS D 1 132 ? -16.527 24.508  -80.393 1.00 21.81 ? 131 LYS D CG  1 
ATOM   9760  C CD  . LYS D 1 132 ? -16.465 25.231  -81.751 1.00 22.00 ? 131 LYS D CD  1 
ATOM   9761  C CE  . LYS D 1 132 ? -15.053 25.260  -82.301 1.00 24.73 ? 131 LYS D CE  1 
ATOM   9762  N NZ  . LYS D 1 132 ? -15.034 25.803  -83.720 1.00 27.27 ? 131 LYS D NZ  1 
ATOM   9763  N N   . ILE D 1 133 ? -16.143 23.403  -77.277 1.00 18.57 ? 132 ILE D N   1 
ATOM   9764  C CA  . ILE D 1 133 ? -15.256 23.904  -76.208 1.00 18.48 ? 132 ILE D CA  1 
ATOM   9765  C C   . ILE D 1 133 ? -13.914 24.293  -76.806 1.00 18.33 ? 132 ILE D C   1 
ATOM   9766  O O   . ILE D 1 133 ? -13.284 23.483  -77.471 1.00 19.05 ? 132 ILE D O   1 
ATOM   9767  C CB  . ILE D 1 133 ? -15.013 22.808  -75.142 1.00 18.88 ? 132 ILE D CB  1 
ATOM   9768  C CG1 . ILE D 1 133 ? -16.346 22.171  -74.729 1.00 19.74 ? 132 ILE D CG1 1 
ATOM   9769  C CG2 . ILE D 1 133 ? -14.289 23.359  -73.905 1.00 17.53 ? 132 ILE D CG2 1 
ATOM   9770  C CD1 . ILE D 1 133 ? -17.358 23.156  -74.174 1.00 16.56 ? 132 ILE D CD1 1 
ATOM   9771  N N   . SER D 1 134 ? -13.486 25.531  -76.580 1.00 18.29 ? 133 SER D N   1 
ATOM   9772  C CA  . SER D 1 134 ? -12.155 25.970  -76.969 1.00 18.30 ? 133 SER D CA  1 
ATOM   9773  C C   . SER D 1 134 ? -11.415 26.503  -75.754 1.00 17.26 ? 133 SER D C   1 
ATOM   9774  O O   . SER D 1 134 ? -11.878 27.432  -75.096 1.00 16.98 ? 133 SER D O   1 
ATOM   9775  C CB  . SER D 1 134 ? -12.259 27.060  -78.038 1.00 18.21 ? 133 SER D CB  1 
ATOM   9776  O OG  . SER D 1 134 ? -13.139 26.636  -79.077 1.00 20.46 ? 133 SER D OG  1 
ATOM   9777  N N   . PHE D 1 135 ? -10.247 25.946  -75.486 1.00 17.26 ? 134 PHE D N   1 
ATOM   9778  C CA  . PHE D 1 135 ? -9.387  26.471  -74.437 1.00 17.51 ? 134 PHE D CA  1 
ATOM   9779  C C   . PHE D 1 135 ? -8.437  27.489  -75.038 1.00 17.54 ? 134 PHE D C   1 
ATOM   9780  O O   . PHE D 1 135 ? -7.697  27.167  -75.963 1.00 16.16 ? 134 PHE D O   1 
ATOM   9781  C CB  . PHE D 1 135 ? -8.602  25.359  -73.742 1.00 17.56 ? 134 PHE D CB  1 
ATOM   9782  C CG  . PHE D 1 135 ? -9.463  24.421  -72.953 1.00 17.71 ? 134 PHE D CG  1 
ATOM   9783  C CD1 . PHE D 1 135 ? -9.769  24.687  -71.631 1.00 17.78 ? 134 PHE D CD1 1 
ATOM   9784  C CD2 . PHE D 1 135 ? -9.959  23.261  -73.534 1.00 18.70 ? 134 PHE D CD2 1 
ATOM   9785  C CE1 . PHE D 1 135 ? -10.582 23.814  -70.895 1.00 17.82 ? 134 PHE D CE1 1 
ATOM   9786  C CE2 . PHE D 1 135 ? -10.753 22.384  -72.800 1.00 18.44 ? 134 PHE D CE2 1 
ATOM   9787  C CZ  . PHE D 1 135 ? -11.065 22.678  -71.477 1.00 18.29 ? 134 PHE D CZ  1 
ATOM   9788  N N   . VAL D 1 136 ? -8.437  28.704  -74.478 1.00 17.51 ? 135 VAL D N   1 
ATOM   9789  C CA  . VAL D 1 136 ? -7.658  29.826  -75.020 1.00 17.17 ? 135 VAL D CA  1 
ATOM   9790  C C   . VAL D 1 136 ? -6.905  30.528  -73.893 1.00 17.24 ? 135 VAL D C   1 
ATOM   9791  O O   . VAL D 1 136 ? -7.454  30.745  -72.794 1.00 16.61 ? 135 VAL D O   1 
ATOM   9792  C CB  . VAL D 1 136 ? -8.582  30.873  -75.756 1.00 17.56 ? 135 VAL D CB  1 
ATOM   9793  C CG1 . VAL D 1 136 ? -7.756  32.063  -76.275 1.00 17.41 ? 135 VAL D CG1 1 
ATOM   9794  C CG2 . VAL D 1 136 ? -9.367  30.235  -76.908 1.00 16.71 ? 135 VAL D CG2 1 
ATOM   9795  N N   . ASP D 1 137 ? -5.637  30.866  -74.135 1.00 17.28 ? 136 ASP D N   1 
ATOM   9796  C CA  . ASP D 1 137 ? -4.890  31.659  -73.176 1.00 18.02 ? 136 ASP D CA  1 
ATOM   9797  C C   . ASP D 1 137 ? -5.410  33.077  -73.219 1.00 18.51 ? 136 ASP D C   1 
ATOM   9798  O O   . ASP D 1 137 ? -4.957  33.880  -74.013 1.00 18.57 ? 136 ASP D O   1 
ATOM   9799  C CB  . ASP D 1 137 ? -3.392  31.635  -73.472 1.00 18.67 ? 136 ASP D CB  1 
ATOM   9800  C CG  . ASP D 1 137 ? -2.584  32.403  -72.455 1.00 17.90 ? 136 ASP D CG  1 
ATOM   9801  O OD1 . ASP D 1 137 ? -3.167  32.977  -71.524 1.00 21.14 ? 136 ASP D OD1 1 
ATOM   9802  O OD2 . ASP D 1 137 ? -1.353  32.459  -72.603 1.00 19.85 ? 136 ASP D OD2 1 
ATOM   9803  N N   . CYS D 1 138 ? -6.353  33.388  -72.333 1.00 19.17 ? 137 CYS D N   1 
ATOM   9804  C CA  . CYS D 1 138 ? -6.967  34.715  -72.298 1.00 19.25 ? 137 CYS D CA  1 
ATOM   9805  C C   . CYS D 1 138 ? -6.114  35.755  -71.575 1.00 20.09 ? 137 CYS D C   1 
ATOM   9806  O O   . CYS D 1 138 ? -6.530  36.903  -71.433 1.00 19.65 ? 137 CYS D O   1 
ATOM   9807  C CB  . CYS D 1 138 ? -8.344  34.639  -71.646 1.00 19.18 ? 137 CYS D CB  1 
ATOM   9808  S SG  . CYS D 1 138 ? -9.472  33.564  -72.545 1.00 17.58 ? 137 CYS D SG  1 
ATOM   9809  N N   . SER D 1 139 ? -4.940  35.350  -71.098 1.00 20.81 ? 138 SER D N   1 
ATOM   9810  C CA  . SER D 1 139 ? -3.993  36.284  -70.507 1.00 21.80 ? 138 SER D CA  1 
ATOM   9811  C C   . SER D 1 139 ? -3.341  37.155  -71.603 1.00 22.50 ? 138 SER D C   1 
ATOM   9812  O O   . SER D 1 139 ? -2.754  38.200  -71.315 1.00 22.96 ? 138 SER D O   1 
ATOM   9813  C CB  . SER D 1 139 ? -2.943  35.553  -69.648 1.00 22.14 ? 138 SER D CB  1 
ATOM   9814  O OG  . SER D 1 139 ? -2.064  34.742  -70.415 1.00 22.17 ? 138 SER D OG  1 
ATOM   9815  N N   . LYS D 1 140 ? -3.456  36.706  -72.846 1.00 23.34 ? 139 LYS D N   1 
ATOM   9816  C CA  . LYS D 1 140 ? -3.146  37.495  -74.027 1.00 24.18 ? 139 LYS D CA  1 
ATOM   9817  C C   . LYS D 1 140 ? -4.463  37.931  -74.656 1.00 23.63 ? 139 LYS D C   1 
ATOM   9818  O O   . LYS D 1 140 ? -5.120  37.157  -75.349 1.00 23.47 ? 139 LYS D O   1 
ATOM   9819  C CB  . LYS D 1 140 ? -2.347  36.650  -75.015 1.00 24.24 ? 139 LYS D CB  1 
ATOM   9820  C CG  . LYS D 1 140 ? -1.020  36.115  -74.462 1.00 25.20 ? 139 LYS D CG  1 
ATOM   9821  C CD  . LYS D 1 140 ? -0.419  35.081  -75.437 1.00 26.20 ? 139 LYS D CD  1 
ATOM   9822  C CE  . LYS D 1 140 ? 1.028   34.706  -75.075 1.00 27.25 ? 139 LYS D CE  1 
ATOM   9823  N NZ  . LYS D 1 140 ? 1.658   33.893  -76.167 1.00 27.61 ? 139 LYS D NZ  1 
ATOM   9824  N N   . ILE D 1 141 ? -4.851  39.177  -74.419 1.00 23.51 ? 140 ILE D N   1 
ATOM   9825  C CA  . ILE D 1 141 ? -6.193  39.622  -74.802 1.00 23.89 ? 140 ILE D CA  1 
ATOM   9826  C C   . ILE D 1 141 ? -6.490  39.368  -76.292 1.00 22.59 ? 140 ILE D C   1 
ATOM   9827  O O   . ILE D 1 141 ? -7.587  38.932  -76.665 1.00 21.42 ? 140 ILE D O   1 
ATOM   9828  C CB  . ILE D 1 141 ? -6.444  41.094  -74.370 1.00 24.17 ? 140 ILE D CB  1 
ATOM   9829  C CG1 . ILE D 1 141 ? -6.904  41.127  -72.909 1.00 25.52 ? 140 ILE D CG1 1 
ATOM   9830  C CG2 . ILE D 1 141 ? -7.515  41.760  -75.236 1.00 26.12 ? 140 ILE D CG2 1 
ATOM   9831  C CD1 . ILE D 1 141 ? -7.113  42.532  -72.346 1.00 25.47 ? 140 ILE D CD1 1 
ATOM   9832  N N   . LYS D 1 142 ? -5.497  39.580  -77.147 1.00 21.87 ? 141 LYS D N   1 
ATOM   9833  C CA  . LYS D 1 142 ? -5.735  39.442  -78.580 1.00 21.68 ? 141 LYS D CA  1 
ATOM   9834  C C   . LYS D 1 142 ? -6.023  38.017  -79.026 1.00 20.45 ? 141 LYS D C   1 
ATOM   9835  O O   . LYS D 1 142 ? -6.672  37.830  -80.045 1.00 20.40 ? 141 LYS D O   1 
ATOM   9836  C CB  . LYS D 1 142 ? -4.574  40.022  -79.377 1.00 22.32 ? 141 LYS D CB  1 
ATOM   9837  C CG  . LYS D 1 142 ? -4.457  41.521  -79.228 1.00 24.73 ? 141 LYS D CG  1 
ATOM   9838  C CD  . LYS D 1 142 ? -3.736  42.112  -80.409 1.00 28.23 ? 141 LYS D CD  1 
ATOM   9839  C CE  . LYS D 1 142 ? -2.825  43.255  -80.005 1.00 31.62 ? 141 LYS D CE  1 
ATOM   9840  N NZ  . LYS D 1 142 ? -3.553  44.366  -79.344 1.00 33.32 ? 141 LYS D NZ  1 
ATOM   9841  N N   . LEU D 1 143 ? -5.557  37.016  -78.269 1.00 19.52 ? 142 LEU D N   1 
ATOM   9842  C CA  . LEU D 1 143 ? -5.928  35.624  -78.550 1.00 18.58 ? 142 LEU D CA  1 
ATOM   9843  C C   . LEU D 1 143 ? -7.395  35.351  -78.235 1.00 18.39 ? 142 LEU D C   1 
ATOM   9844  O O   . LEU D 1 143 ? -8.063  34.614  -78.962 1.00 18.17 ? 142 LEU D O   1 
ATOM   9845  C CB  . LEU D 1 143 ? -5.058  34.637  -77.766 1.00 18.64 ? 142 LEU D CB  1 
ATOM   9846  C CG  . LEU D 1 143 ? -3.634  34.445  -78.258 1.00 17.33 ? 142 LEU D CG  1 
ATOM   9847  C CD1 . LEU D 1 143 ? -2.947  33.439  -77.352 1.00 16.38 ? 142 LEU D CD1 1 
ATOM   9848  C CD2 . LEU D 1 143 ? -3.625  34.000  -79.748 1.00 14.15 ? 142 LEU D CD2 1 
ATOM   9849  N N   . LEU D 1 144 ? -7.889  35.918  -77.147 1.00 18.05 ? 143 LEU D N   1 
ATOM   9850  C CA  . LEU D 1 144 ? -9.333  35.859  -76.862 1.00 18.21 ? 143 LEU D CA  1 
ATOM   9851  C C   . LEU D 1 144 ? -10.109 36.504  -78.014 1.00 18.67 ? 143 LEU D C   1 
ATOM   9852  O O   . LEU D 1 144 ? -11.011 35.897  -78.586 1.00 19.16 ? 143 LEU D O   1 
ATOM   9853  C CB  . LEU D 1 144 ? -9.679  36.551  -75.539 1.00 17.25 ? 143 LEU D CB  1 
ATOM   9854  C CG  . LEU D 1 144 ? -11.181 36.652  -75.223 1.00 17.62 ? 143 LEU D CG  1 
ATOM   9855  C CD1 . LEU D 1 144 ? -11.850 35.269  -75.296 1.00 14.97 ? 143 LEU D CD1 1 
ATOM   9856  C CD2 . LEU D 1 144 ? -11.441 37.323  -73.882 1.00 17.06 ? 143 LEU D CD2 1 
ATOM   9857  N N   . GLU D 1 145 ? -9.733  37.732  -78.354 1.00 19.37 ? 144 GLU D N   1 
ATOM   9858  C CA  . GLU D 1 145 ? -10.327 38.430  -79.485 1.00 20.34 ? 144 GLU D CA  1 
ATOM   9859  C C   . GLU D 1 145 ? -10.372 37.582  -80.792 1.00 20.22 ? 144 GLU D C   1 
ATOM   9860  O O   . GLU D 1 145 ? -11.416 37.472  -81.455 1.00 19.99 ? 144 GLU D O   1 
ATOM   9861  C CB  . GLU D 1 145 ? -9.570  39.735  -79.674 1.00 20.20 ? 144 GLU D CB  1 
ATOM   9862  C CG  . GLU D 1 145 ? -10.124 40.643  -80.734 1.00 22.30 ? 144 GLU D CG  1 
ATOM   9863  C CD  . GLU D 1 145 ? -9.279  41.902  -80.881 1.00 23.24 ? 144 GLU D CD  1 
ATOM   9864  O OE1 . GLU D 1 145 ? -9.878  42.981  -80.966 1.00 28.58 ? 144 GLU D OE1 1 
ATOM   9865  O OE2 . GLU D 1 145 ? -8.023  41.821  -80.875 1.00 27.02 ? 144 GLU D OE2 1 
ATOM   9866  N N   . ALA D 1 146 ? -9.248  36.964  -81.152 1.00 20.23 ? 145 ALA D N   1 
ATOM   9867  C CA  . ALA D 1 146 ? -9.181  36.159  -82.381 1.00 20.14 ? 145 ALA D CA  1 
ATOM   9868  C C   . ALA D 1 146 ? -9.962  34.852  -82.274 1.00 20.48 ? 145 ALA D C   1 
ATOM   9869  O O   . ALA D 1 146 ? -10.306 34.251  -83.289 1.00 20.71 ? 145 ALA D O   1 
ATOM   9870  C CB  . ALA D 1 146 ? -7.744  35.882  -82.752 1.00 19.43 ? 145 ALA D CB  1 
ATOM   9871  N N   . ALA D 1 147 ? -10.235 34.406  -81.048 1.00 20.57 ? 146 ALA D N   1 
ATOM   9872  C CA  . ALA D 1 147 ? -10.926 33.136  -80.803 1.00 20.91 ? 146 ALA D CA  1 
ATOM   9873  C C   . ALA D 1 147 ? -12.457 33.246  -80.816 1.00 20.61 ? 146 ALA D C   1 
ATOM   9874  O O   . ALA D 1 147 ? -13.139 32.247  -81.040 1.00 21.23 ? 146 ALA D O   1 
ATOM   9875  C CB  . ALA D 1 147 ? -10.462 32.542  -79.478 1.00 20.32 ? 146 ALA D CB  1 
ATOM   9876  N N   . ILE D 1 148 ? -12.987 34.441  -80.558 1.00 21.02 ? 147 ILE D N   1 
ATOM   9877  C CA  . ILE D 1 148 ? -14.441 34.644  -80.521 1.00 20.93 ? 147 ILE D CA  1 
ATOM   9878  C C   . ILE D 1 148 ? -15.010 34.370  -81.914 1.00 21.94 ? 147 ILE D C   1 
ATOM   9879  O O   . ILE D 1 148 ? -14.397 34.772  -82.936 1.00 22.17 ? 147 ILE D O   1 
ATOM   9880  C CB  . ILE D 1 148 ? -14.806 36.057  -80.023 1.00 21.21 ? 147 ILE D CB  1 
ATOM   9881  C CG1 . ILE D 1 148 ? -14.409 36.215  -78.536 1.00 20.39 ? 147 ILE D CG1 1 
ATOM   9882  C CG2 . ILE D 1 148 ? -16.307 36.340  -80.244 1.00 19.79 ? 147 ILE D CG2 1 
ATOM   9883  C CD1 . ILE D 1 148 ? -14.353 37.652  -78.034 1.00 20.39 ? 147 ILE D CD1 1 
ATOM   9884  N N   . THR D 1 149 ? -16.127 33.634  -81.949 1.00 22.13 ? 148 THR D N   1 
ATOM   9885  C CA  . THR D 1 149 ? -16.847 33.312  -83.173 1.00 22.79 ? 148 THR D CA  1 
ATOM   9886  C C   . THR D 1 149 ? -18.296 33.768  -83.038 1.00 23.24 ? 148 THR D C   1 
ATOM   9887  O O   . THR D 1 149 ? -18.735 34.154  -81.943 1.00 22.33 ? 148 THR D O   1 
ATOM   9888  C CB  . THR D 1 149 ? -16.832 31.794  -83.491 1.00 23.56 ? 148 THR D CB  1 
ATOM   9889  O OG1 . THR D 1 149 ? -17.628 31.061  -82.528 1.00 24.55 ? 148 THR D OG1 1 
ATOM   9890  C CG2 . THR D 1 149 ? -15.410 31.257  -83.515 1.00 21.90 ? 148 THR D CG2 1 
ATOM   9891  N N   . PRO D 1 150 ? -19.048 33.753  -84.154 1.00 23.89 ? 149 PRO D N   1 
ATOM   9892  C CA  . PRO D 1 150 ? -20.466 34.069  -84.031 1.00 23.82 ? 149 PRO D CA  1 
ATOM   9893  C C   . PRO D 1 150 ? -21.208 33.153  -83.046 1.00 23.45 ? 149 PRO D C   1 
ATOM   9894  O O   . PRO D 1 150 ? -22.193 33.564  -82.477 1.00 23.91 ? 149 PRO D O   1 
ATOM   9895  C CB  . PRO D 1 150 ? -20.997 33.853  -85.448 1.00 24.08 ? 149 PRO D CB  1 
ATOM   9896  C CG  . PRO D 1 150 ? -19.807 33.990  -86.334 1.00 24.54 ? 149 PRO D CG  1 
ATOM   9897  C CD  . PRO D 1 150 ? -18.661 33.477  -85.553 1.00 23.92 ? 149 PRO D CD  1 
ATOM   9898  N N   . GLU D 1 151 ? -20.725 31.935  -82.855 1.00 23.39 ? 150 GLU D N   1 
ATOM   9899  C CA  . GLU D 1 151 ? -21.368 30.948  -81.971 1.00 23.78 ? 150 GLU D CA  1 
ATOM   9900  C C   . GLU D 1 151 ? -20.962 31.092  -80.502 1.00 23.12 ? 150 GLU D C   1 
ATOM   9901  O O   . GLU D 1 151 ? -21.523 30.408  -79.633 1.00 23.39 ? 150 GLU D O   1 
ATOM   9902  C CB  . GLU D 1 151 ? -21.009 29.530  -82.418 1.00 23.86 ? 150 GLU D CB  1 
ATOM   9903  C CG  . GLU D 1 151 ? -21.592 29.137  -83.764 1.00 25.74 ? 150 GLU D CG  1 
ATOM   9904  C CD  . GLU D 1 151 ? -20.910 29.822  -84.938 1.00 29.17 ? 150 GLU D CD  1 
ATOM   9905  O OE1 . GLU D 1 151 ? -21.611 30.140  -85.917 1.00 31.69 ? 150 GLU D OE1 1 
ATOM   9906  O OE2 . GLU D 1 151 ? -19.685 30.063  -84.869 1.00 31.12 ? 150 GLU D OE2 1 
ATOM   9907  N N   . THR D 1 152 ? -19.990 31.965  -80.230 1.00 22.06 ? 151 THR D N   1 
ATOM   9908  C CA  . THR D 1 152 ? -19.497 32.173  -78.863 1.00 21.41 ? 151 THR D CA  1 
ATOM   9909  C C   . THR D 1 152 ? -20.560 32.819  -77.987 1.00 20.56 ? 151 THR D C   1 
ATOM   9910  O O   . THR D 1 152 ? -21.115 33.860  -78.306 1.00 20.06 ? 151 THR D O   1 
ATOM   9911  C CB  . THR D 1 152 ? -18.184 32.967  -78.830 1.00 21.62 ? 151 THR D CB  1 
ATOM   9912  O OG1 . THR D 1 152 ? -17.209 32.278  -79.637 1.00 21.31 ? 151 THR D OG1 1 
ATOM   9913  C CG2 . THR D 1 152 ? -17.660 33.103  -77.374 1.00 21.46 ? 151 THR D CG2 1 
ATOM   9914  N N   . LYS D 1 153 ? -20.859 32.136  -76.893 1.00 19.74 ? 152 LYS D N   1 
ATOM   9915  C CA  . LYS D 1 153 ? -21.913 32.543  -75.978 1.00 18.99 ? 152 LYS D CA  1 
ATOM   9916  C C   . LYS D 1 153 ? -21.444 32.691  -74.543 1.00 17.62 ? 152 LYS D C   1 
ATOM   9917  O O   . LYS D 1 153 ? -22.037 33.442  -73.805 1.00 17.64 ? 152 LYS D O   1 
ATOM   9918  C CB  . LYS D 1 153 ? -23.045 31.535  -76.043 1.00 18.91 ? 152 LYS D CB  1 
ATOM   9919  C CG  . LYS D 1 153 ? -24.317 32.115  -76.509 1.00 22.27 ? 152 LYS D CG  1 
ATOM   9920  C CD  . LYS D 1 153 ? -24.304 32.541  -77.949 1.00 22.16 ? 152 LYS D CD  1 
ATOM   9921  C CE  . LYS D 1 153 ? -25.099 33.807  -78.105 1.00 24.87 ? 152 LYS D CE  1 
ATOM   9922  N NZ  . LYS D 1 153 ? -25.718 33.924  -79.444 1.00 25.44 ? 152 LYS D NZ  1 
ATOM   9923  N N   . LEU D 1 154 ? -20.362 32.002  -74.182 1.00 16.65 ? 153 LEU D N   1 
ATOM   9924  C CA  . LEU D 1 154 ? -19.823 32.011  -72.831 1.00 15.52 ? 153 LEU D CA  1 
ATOM   9925  C C   . LEU D 1 154 ? -18.309 32.058  -72.916 1.00 15.42 ? 153 LEU D C   1 
ATOM   9926  O O   . LEU D 1 154 ? -17.705 31.301  -73.681 1.00 14.63 ? 153 LEU D O   1 
ATOM   9927  C CB  . LEU D 1 154 ? -20.237 30.740  -72.082 1.00 15.34 ? 153 LEU D CB  1 
ATOM   9928  C CG  . LEU D 1 154 ? -19.691 30.544  -70.655 1.00 14.94 ? 153 LEU D CG  1 
ATOM   9929  C CD1 . LEU D 1 154 ? -20.181 31.656  -69.805 1.00 13.83 ? 153 LEU D CD1 1 
ATOM   9930  C CD2 . LEU D 1 154 ? -20.126 29.151  -70.108 1.00 16.23 ? 153 LEU D CD2 1 
ATOM   9931  N N   . VAL D 1 155 ? -17.710 32.934  -72.110 1.00 15.17 ? 154 VAL D N   1 
ATOM   9932  C CA  . VAL D 1 155 ? -16.270 32.972  -71.885 1.00 14.01 ? 154 VAL D CA  1 
ATOM   9933  C C   . VAL D 1 155 ? -16.039 32.782  -70.374 1.00 14.66 ? 154 VAL D C   1 
ATOM   9934  O O   . VAL D 1 155 ? -16.566 33.545  -69.568 1.00 14.30 ? 154 VAL D O   1 
ATOM   9935  C CB  . VAL D 1 155 ? -15.644 34.288  -72.418 1.00 14.64 ? 154 VAL D CB  1 
ATOM   9936  C CG1 . VAL D 1 155 ? -14.160 34.396  -72.050 1.00 11.60 ? 154 VAL D CG1 1 
ATOM   9937  C CG2 . VAL D 1 155 ? -15.816 34.382  -73.958 1.00 10.92 ? 154 VAL D CG2 1 
ATOM   9938  N N   . TRP D 1 156 ? -15.265 31.744  -70.032 1.00 13.50 ? 155 TRP D N   1 
ATOM   9939  C CA  . TRP D 1 156 ? -15.028 31.289  -68.684 1.00 14.09 ? 155 TRP D CA  1 
ATOM   9940  C C   . TRP D 1 156 ? -13.576 31.533  -68.301 1.00 13.96 ? 155 TRP D C   1 
ATOM   9941  O O   . TRP D 1 156 ? -12.672 30.875  -68.808 1.00 14.41 ? 155 TRP D O   1 
ATOM   9942  C CB  . TRP D 1 156 ? -15.327 29.783  -68.549 1.00 13.55 ? 155 TRP D CB  1 
ATOM   9943  C CG  . TRP D 1 156 ? -15.272 29.334  -67.140 1.00 12.37 ? 155 TRP D CG  1 
ATOM   9944  C CD1 . TRP D 1 156 ? -14.150 29.003  -66.425 1.00 12.73 ? 155 TRP D CD1 1 
ATOM   9945  C CD2 . TRP D 1 156 ? -16.383 29.203  -66.236 1.00 11.57 ? 155 TRP D CD2 1 
ATOM   9946  N NE1 . TRP D 1 156 ? -14.494 28.678  -65.140 1.00 12.52 ? 155 TRP D NE1 1 
ATOM   9947  C CE2 . TRP D 1 156 ? -15.856 28.795  -64.992 1.00 13.03 ? 155 TRP D CE2 1 
ATOM   9948  C CE3 . TRP D 1 156 ? -17.766 29.388  -66.363 1.00 11.38 ? 155 TRP D CE3 1 
ATOM   9949  C CZ2 . TRP D 1 156 ? -16.670 28.554  -63.870 1.00 12.92 ? 155 TRP D CZ2 1 
ATOM   9950  C CZ3 . TRP D 1 156 ? -18.580 29.158  -65.265 1.00 12.45 ? 155 TRP D CZ3 1 
ATOM   9951  C CH2 . TRP D 1 156 ? -18.030 28.733  -64.025 1.00 12.73 ? 155 TRP D CH2 1 
ATOM   9952  N N   . ILE D 1 157 ? -13.351 32.467  -67.398 1.00 13.57 ? 156 ILE D N   1 
ATOM   9953  C CA  . ILE D 1 157 ? -11.988 32.719  -66.953 1.00 14.18 ? 156 ILE D CA  1 
ATOM   9954  C C   . ILE D 1 157 ? -11.825 32.596  -65.450 1.00 13.58 ? 156 ILE D C   1 
ATOM   9955  O O   . ILE D 1 157 ? -12.775 32.792  -64.685 1.00 11.82 ? 156 ILE D O   1 
ATOM   9956  C CB  . ILE D 1 157 ? -11.432 34.091  -67.444 1.00 14.80 ? 156 ILE D CB  1 
ATOM   9957  C CG1 . ILE D 1 157 ? -12.113 35.250  -66.765 1.00 17.14 ? 156 ILE D CG1 1 
ATOM   9958  C CG2 . ILE D 1 157 ? -11.523 34.230  -68.969 1.00 14.64 ? 156 ILE D CG2 1 
ATOM   9959  C CD1 . ILE D 1 157 ? -11.125 36.246  -66.301 1.00 20.34 ? 156 ILE D CD1 1 
ATOM   9960  N N   . GLU D 1 158 ? -10.620 32.175  -65.066 1.00 13.15 ? 157 GLU D N   1 
ATOM   9961  C CA  . GLU D 1 158 ? -10.114 32.255  -63.722 1.00 12.80 ? 157 GLU D CA  1 
ATOM   9962  C C   . GLU D 1 158 ? -8.999  33.305  -63.725 1.00 13.59 ? 157 GLU D C   1 
ATOM   9963  O O   . GLU D 1 158 ? -8.206  33.351  -64.654 1.00 13.66 ? 157 GLU D O   1 
ATOM   9964  C CB  . GLU D 1 158 ? -9.487  30.928  -63.308 1.00 12.97 ? 157 GLU D CB  1 
ATOM   9965  C CG  . GLU D 1 158 ? -10.459 29.870  -62.851 1.00 12.00 ? 157 GLU D CG  1 
ATOM   9966  C CD  . GLU D 1 158 ? -9.756  28.598  -62.452 1.00 12.65 ? 157 GLU D CD  1 
ATOM   9967  O OE1 . GLU D 1 158 ? -8.594  28.708  -62.011 1.00 15.02 ? 157 GLU D OE1 1 
ATOM   9968  O OE2 . GLU D 1 158 ? -10.356 27.508  -62.592 1.00 8.78  ? 157 GLU D OE2 1 
ATOM   9969  N N   . THR D 1 159 ? -8.952  34.152  -62.708 1.00 13.17 ? 158 THR D N   1 
ATOM   9970  C CA  . THR D 1 159 ? -7.763  34.956  -62.464 1.00 12.72 ? 158 THR D CA  1 
ATOM   9971  C C   . THR D 1 159 ? -7.589  35.292  -60.967 1.00 12.43 ? 158 THR D C   1 
ATOM   9972  O O   . THR D 1 159 ? -8.509  35.812  -60.332 1.00 13.22 ? 158 THR D O   1 
ATOM   9973  C CB  . THR D 1 159 ? -7.734  36.244  -63.321 1.00 13.02 ? 158 THR D CB  1 
ATOM   9974  O OG1 . THR D 1 159 ? -6.534  36.982  -63.030 1.00 11.50 ? 158 THR D OG1 1 
ATOM   9975  C CG2 . THR D 1 159 ? -8.984  37.137  -63.061 1.00 11.58 ? 158 THR D CG2 1 
ATOM   9976  N N   . PRO D 1 160 ? -6.411  34.972  -60.387 1.00 12.59 ? 159 PRO D N   1 
ATOM   9977  C CA  . PRO D 1 160 ? -5.331  34.198  -60.994 1.00 12.49 ? 159 PRO D CA  1 
ATOM   9978  C C   . PRO D 1 160 ? -5.762  32.737  -61.229 1.00 12.80 ? 159 PRO D C   1 
ATOM   9979  O O   . PRO D 1 160 ? -6.653  32.222  -60.541 1.00 13.36 ? 159 PRO D O   1 
ATOM   9980  C CB  . PRO D 1 160 ? -4.183  34.294  -59.972 1.00 12.55 ? 159 PRO D CB  1 
ATOM   9981  C CG  . PRO D 1 160 ? -4.583  35.287  -58.970 1.00 12.53 ? 159 PRO D CG  1 
ATOM   9982  C CD  . PRO D 1 160 ? -6.075  35.382  -59.016 1.00 11.93 ? 159 PRO D CD  1 
ATOM   9983  N N   . THR D 1 161 ? -5.150  32.099  -62.214 1.00 12.27 ? 160 THR D N   1 
ATOM   9984  C CA  . THR D 1 161 ? -5.524  30.764  -62.611 1.00 12.35 ? 160 THR D CA  1 
ATOM   9985  C C   . THR D 1 161 ? -4.989  29.724  -61.627 1.00 13.17 ? 160 THR D C   1 
ATOM   9986  O O   . THR D 1 161 ? -3.955  29.909  -60.966 1.00 12.48 ? 160 THR D O   1 
ATOM   9987  C CB  . THR D 1 161 ? -5.046  30.421  -64.055 1.00 12.89 ? 160 THR D CB  1 
ATOM   9988  O OG1 . THR D 1 161 ? -3.611  30.372  -64.096 1.00 12.14 ? 160 THR D OG1 1 
ATOM   9989  C CG2 . THR D 1 161 ? -5.585  31.474  -65.076 1.00 9.52  ? 160 THR D CG2 1 
ATOM   9990  N N   . ASN D 1 162 ? -5.754  28.647  -61.517 1.00 13.44 ? 161 ASN D N   1 
ATOM   9991  C CA  . ASN D 1 162 ? -5.407  27.532  -60.670 1.00 13.39 ? 161 ASN D CA  1 
ATOM   9992  C C   . ASN D 1 162 ? -4.798  26.455  -61.566 1.00 13.31 ? 161 ASN D C   1 
ATOM   9993  O O   . ASN D 1 162 ? -5.512  25.912  -62.420 1.00 13.60 ? 161 ASN D O   1 
ATOM   9994  C CB  . ASN D 1 162 ? -6.687  27.023  -59.983 1.00 13.34 ? 161 ASN D CB  1 
ATOM   9995  C CG  . ASN D 1 162 ? -6.416  25.947  -58.970 1.00 13.21 ? 161 ASN D CG  1 
ATOM   9996  O OD1 . ASN D 1 162 ? -5.259  25.530  -58.793 1.00 12.94 ? 161 ASN D OD1 1 
ATOM   9997  N ND2 . ASN D 1 162 ? -7.481  25.443  -58.327 1.00 9.63  ? 161 ASN D ND2 1 
ATOM   9998  N N   . PRO D 1 163 ? -3.500  26.093  -61.355 1.00 12.77 ? 162 PRO D N   1 
ATOM   9999  C CA  . PRO D 1 163 ? -2.549  26.494  -60.326 1.00 12.03 ? 162 PRO D CA  1 
ATOM   10000 C C   . PRO D 1 163 ? -1.377  27.387  -60.751 1.00 11.83 ? 162 PRO D C   1 
ATOM   10001 O O   . PRO D 1 163 ? -0.579  27.751  -59.909 1.00 10.47 ? 162 PRO D O   1 
ATOM   10002 C CB  . PRO D 1 163 ? -1.979  25.148  -59.924 1.00 11.97 ? 162 PRO D CB  1 
ATOM   10003 C CG  . PRO D 1 163 ? -1.772  24.466  -61.291 1.00 11.73 ? 162 PRO D CG  1 
ATOM   10004 C CD  . PRO D 1 163 ? -2.902  25.022  -62.176 1.00 12.63 ? 162 PRO D CD  1 
ATOM   10005 N N   . THR D 1 164 ? -1.241  27.739  -62.021 1.00 12.58 ? 163 THR D N   1 
ATOM   10006 C CA  . THR D 1 164 ? -0.030  28.480  -62.444 1.00 12.44 ? 163 THR D CA  1 
ATOM   10007 C C   . THR D 1 164 ? -0.140  30.004  -62.258 1.00 12.63 ? 163 THR D C   1 
ATOM   10008 O O   . THR D 1 164 ? 0.851   30.724  -62.443 1.00 12.21 ? 163 THR D O   1 
ATOM   10009 C CB  . THR D 1 164 ? 0.392   28.141  -63.882 1.00 12.31 ? 163 THR D CB  1 
ATOM   10010 O OG1 . THR D 1 164 ? -0.526  28.712  -64.821 1.00 12.25 ? 163 THR D OG1 1 
ATOM   10011 C CG2 . THR D 1 164 ? 0.463   26.607  -64.080 1.00 13.72 ? 163 THR D CG2 1 
ATOM   10012 N N   . GLN D 1 165 ? -1.326  30.477  -61.866 1.00 13.07 ? 164 GLN D N   1 
ATOM   10013 C CA  . GLN D 1 165 ? -1.537  31.864  -61.466 1.00 13.19 ? 164 GLN D CA  1 
ATOM   10014 C C   . GLN D 1 165 ? -1.143  32.876  -62.535 1.00 14.02 ? 164 GLN D C   1 
ATOM   10015 O O   . GLN D 1 165 ? -0.527  33.896  -62.257 1.00 13.77 ? 164 GLN D O   1 
ATOM   10016 C CB  . GLN D 1 165 ? -0.836  32.155  -60.146 1.00 13.68 ? 164 GLN D CB  1 
ATOM   10017 C CG  . GLN D 1 165 ? -1.366  31.313  -59.013 1.00 12.82 ? 164 GLN D CG  1 
ATOM   10018 C CD  . GLN D 1 165 ? -1.167  31.921  -57.664 1.00 13.51 ? 164 GLN D CD  1 
ATOM   10019 O OE1 . GLN D 1 165 ? -1.710  32.985  -57.377 1.00 16.87 ? 164 GLN D OE1 1 
ATOM   10020 N NE2 . GLN D 1 165 ? -0.437  31.223  -56.786 1.00 13.18 ? 164 GLN D NE2 1 
ATOM   10021 N N   . LYS D 1 166 ? -1.539  32.586  -63.766 1.00 14.33 ? 165 LYS D N   1 
ATOM   10022 C CA  . LYS D 1 166 ? -1.569  33.588  -64.820 1.00 15.27 ? 165 LYS D CA  1 
ATOM   10023 C C   . LYS D 1 166 ? -2.694  34.554  -64.479 1.00 14.71 ? 165 LYS D C   1 
ATOM   10024 O O   . LYS D 1 166 ? -3.738  34.140  -63.960 1.00 14.13 ? 165 LYS D O   1 
ATOM   10025 C CB  . LYS D 1 166 ? -1.868  32.929  -66.168 1.00 15.16 ? 165 LYS D CB  1 
ATOM   10026 C CG  . LYS D 1 166 ? -0.738  32.038  -66.699 1.00 16.32 ? 165 LYS D CG  1 
ATOM   10027 C CD  . LYS D 1 166 ? -1.300  30.921  -67.586 1.00 19.02 ? 165 LYS D CD  1 
ATOM   10028 C CE  . LYS D 1 166 ? -1.661  31.384  -68.972 1.00 22.28 ? 165 LYS D CE  1 
ATOM   10029 N NZ  . LYS D 1 166 ? -2.111  30.227  -69.793 1.00 21.82 ? 165 LYS D NZ  1 
ATOM   10030 N N   . VAL D 1 167 ? -2.468  35.832  -64.742 1.00 14.62 ? 166 VAL D N   1 
ATOM   10031 C CA  . VAL D 1 167 ? -3.425  36.875  -64.388 1.00 14.84 ? 166 VAL D CA  1 
ATOM   10032 C C   . VAL D 1 167 ? -4.040  37.461  -65.656 1.00 15.45 ? 166 VAL D C   1 
ATOM   10033 O O   . VAL D 1 167 ? -3.345  37.780  -66.633 1.00 15.32 ? 166 VAL D O   1 
ATOM   10034 C CB  . VAL D 1 167 ? -2.767  37.945  -63.497 1.00 14.95 ? 166 VAL D CB  1 
ATOM   10035 C CG1 . VAL D 1 167 ? -3.714  39.077  -63.193 1.00 12.62 ? 166 VAL D CG1 1 
ATOM   10036 C CG2 . VAL D 1 167 ? -2.279  37.299  -62.218 1.00 13.44 ? 166 VAL D CG2 1 
ATOM   10037 N N   . ILE D 1 168 ? -5.359  37.587  -65.632 1.00 15.48 ? 167 ILE D N   1 
ATOM   10038 C CA  . ILE D 1 168 ? -6.120  38.054  -66.792 1.00 15.70 ? 167 ILE D CA  1 
ATOM   10039 C C   . ILE D 1 168 ? -6.668  39.479  -66.540 1.00 15.46 ? 167 ILE D C   1 
ATOM   10040 O O   . ILE D 1 168 ? -7.158  39.774  -65.449 1.00 14.51 ? 167 ILE D O   1 
ATOM   10041 C CB  . ILE D 1 168 ? -7.292  37.084  -67.082 1.00 15.58 ? 167 ILE D CB  1 
ATOM   10042 C CG1 . ILE D 1 168 ? -6.825  35.724  -67.633 1.00 15.58 ? 167 ILE D CG1 1 
ATOM   10043 C CG2 . ILE D 1 168 ? -8.243  37.685  -68.095 1.00 16.47 ? 167 ILE D CG2 1 
ATOM   10044 C CD1 . ILE D 1 168 ? -5.783  34.973  -66.824 1.00 17.76 ? 167 ILE D CD1 1 
ATOM   10045 N N   . ASP D 1 169 ? -6.581  40.355  -67.540 1.00 15.21 ? 168 ASP D N   1 
ATOM   10046 C CA  . ASP D 1 169 ? -7.148  41.705  -67.449 1.00 15.73 ? 168 ASP D CA  1 
ATOM   10047 C C   . ASP D 1 169 ? -8.663  41.615  -67.638 1.00 15.57 ? 168 ASP D C   1 
ATOM   10048 O O   . ASP D 1 169 ? -9.154  41.426  -68.750 1.00 14.94 ? 168 ASP D O   1 
ATOM   10049 C CB  . ASP D 1 169 ? -6.502  42.616  -68.499 1.00 16.18 ? 168 ASP D CB  1 
ATOM   10050 C CG  . ASP D 1 169 ? -6.970  44.063  -68.425 1.00 19.10 ? 168 ASP D CG  1 
ATOM   10051 O OD1 . ASP D 1 169 ? -7.969  44.400  -67.731 1.00 19.08 ? 168 ASP D OD1 1 
ATOM   10052 O OD2 . ASP D 1 169 ? -6.316  44.878  -69.111 1.00 22.04 ? 168 ASP D OD2 1 
ATOM   10053 N N   . ILE D 1 170 ? -9.405  41.756  -66.542 1.00 16.20 ? 169 ILE D N   1 
ATOM   10054 C CA  . ILE D 1 170 ? -10.846 41.514  -66.574 1.00 16.31 ? 169 ILE D CA  1 
ATOM   10055 C C   . ILE D 1 170 ? -11.591 42.575  -67.390 1.00 16.49 ? 169 ILE D C   1 
ATOM   10056 O O   . ILE D 1 170 ? -12.432 42.231  -68.212 1.00 15.41 ? 169 ILE D O   1 
ATOM   10057 C CB  . ILE D 1 170 ? -11.444 41.376  -65.148 1.00 16.31 ? 169 ILE D CB  1 
ATOM   10058 C CG1 . ILE D 1 170 ? -10.914 40.104  -64.475 1.00 16.56 ? 169 ILE D CG1 1 
ATOM   10059 C CG2 . ILE D 1 170 ? -12.979 41.315  -65.202 1.00 16.12 ? 169 ILE D CG2 1 
ATOM   10060 C CD1 . ILE D 1 170 ? -11.163 40.087  -62.929 1.00 16.05 ? 169 ILE D CD1 1 
ATOM   10061 N N   . GLU D 1 171 ? -11.263 43.842  -67.164 1.00 17.92 ? 170 GLU D N   1 
ATOM   10062 C CA  . GLU D 1 171 ? -11.850 44.956  -67.932 1.00 19.36 ? 170 GLU D CA  1 
ATOM   10063 C C   . GLU D 1 171 ? -11.543 44.848  -69.415 1.00 18.91 ? 170 GLU D C   1 
ATOM   10064 O O   . GLU D 1 171 ? -12.444 44.956  -70.252 1.00 18.56 ? 170 GLU D O   1 
ATOM   10065 C CB  . GLU D 1 171 ? -11.362 46.276  -67.390 1.00 20.31 ? 170 GLU D CB  1 
ATOM   10066 C CG  . GLU D 1 171 ? -12.209 47.486  -67.772 1.00 25.00 ? 170 GLU D CG  1 
ATOM   10067 C CD  . GLU D 1 171 ? -12.139 48.563  -66.696 1.00 31.12 ? 170 GLU D CD  1 
ATOM   10068 O OE1 . GLU D 1 171 ? -12.778 48.402  -65.626 1.00 35.39 ? 170 GLU D OE1 1 
ATOM   10069 O OE2 . GLU D 1 171 ? -11.429 49.569  -66.911 1.00 35.07 ? 170 GLU D OE2 1 
ATOM   10070 N N   . GLY D 1 172 ? -10.282 44.596  -69.743 1.00 19.20 ? 171 GLY D N   1 
ATOM   10071 C CA  . GLY D 1 172 ? -9.880  44.365  -71.133 1.00 19.43 ? 171 GLY D CA  1 
ATOM   10072 C C   . GLY D 1 172 ? -10.626 43.223  -71.797 1.00 20.34 ? 171 GLY D C   1 
ATOM   10073 O O   . GLY D 1 172 ? -11.052 43.334  -72.945 1.00 21.06 ? 171 GLY D O   1 
ATOM   10074 N N   . CYS D 1 173 ? -10.797 42.109  -71.085 1.00 20.81 ? 172 CYS D N   1 
ATOM   10075 C CA  . CYS D 1 173 ? -11.529 40.952  -71.632 1.00 21.09 ? 172 CYS D CA  1 
ATOM   10076 C C   . CYS D 1 173 ? -12.998 41.257  -71.778 1.00 20.14 ? 172 CYS D C   1 
ATOM   10077 O O   . CYS D 1 173 ? -13.614 40.878  -72.778 1.00 19.97 ? 172 CYS D O   1 
ATOM   10078 C CB  . CYS D 1 173 ? -11.365 39.712  -70.749 1.00 21.55 ? 172 CYS D CB  1 
ATOM   10079 S SG  . CYS D 1 173 ? -9.767  38.957  -70.907 1.00 28.15 ? 172 CYS D SG  1 
ATOM   10080 N N   . ALA D 1 174 ? -13.551 41.922  -70.762 1.00 19.09 ? 173 ALA D N   1 
ATOM   10081 C CA  . ALA D 1 174 ? -14.946 42.355  -70.761 1.00 19.10 ? 173 ALA D CA  1 
ATOM   10082 C C   . ALA D 1 174 ? -15.256 43.212  -71.990 1.00 19.16 ? 173 ALA D C   1 
ATOM   10083 O O   . ALA D 1 174 ? -16.241 42.984  -72.672 1.00 18.82 ? 173 ALA D O   1 
ATOM   10084 C CB  . ALA D 1 174 ? -15.248 43.135  -69.492 1.00 18.15 ? 173 ALA D CB  1 
ATOM   10085 N N   . HIS D 1 175 ? -14.399 44.192  -72.262 1.00 20.08 ? 174 HIS D N   1 
ATOM   10086 C CA  A HIS D 1 175 ? -14.536 45.049  -73.451 0.50 20.32 ? 174 HIS D CA  1 
ATOM   10087 C CA  B HIS D 1 175 ? -14.553 45.040  -73.443 0.50 20.38 ? 174 HIS D CA  1 
ATOM   10088 C C   . HIS D 1 175 ? -14.559 44.232  -74.740 1.00 20.62 ? 174 HIS D C   1 
ATOM   10089 O O   . HIS D 1 175 ? -15.399 44.457  -75.630 1.00 21.05 ? 174 HIS D O   1 
ATOM   10090 C CB  A HIS D 1 175 ? -13.410 46.094  -73.519 0.50 20.61 ? 174 HIS D CB  1 
ATOM   10091 C CB  B HIS D 1 175 ? -13.463 46.114  -73.469 0.50 20.83 ? 174 HIS D CB  1 
ATOM   10092 C CG  A HIS D 1 175 ? -13.537 47.039  -74.681 0.50 20.52 ? 174 HIS D CG  1 
ATOM   10093 C CG  B HIS D 1 175 ? -13.625 47.156  -72.408 0.50 20.59 ? 174 HIS D CG  1 
ATOM   10094 N ND1 A HIS D 1 175 ? -12.787 46.914  -75.832 0.50 20.80 ? 174 HIS D ND1 1 
ATOM   10095 N ND1 B HIS D 1 175 ? -14.848 47.706  -72.088 0.50 22.80 ? 174 HIS D ND1 1 
ATOM   10096 C CD2 A HIS D 1 175 ? -14.345 48.109  -74.874 0.50 20.11 ? 174 HIS D CD2 1 
ATOM   10097 C CD2 B HIS D 1 175 ? -12.722 47.756  -71.599 0.50 21.95 ? 174 HIS D CD2 1 
ATOM   10098 C CE1 A HIS D 1 175 ? -13.127 47.868  -76.682 0.50 20.21 ? 174 HIS D CE1 1 
ATOM   10099 C CE1 B HIS D 1 175 ? -14.693 48.590  -71.121 0.50 21.86 ? 174 HIS D CE1 1 
ATOM   10100 N NE2 A HIS D 1 175 ? -14.071 48.606  -76.125 0.50 19.25 ? 174 HIS D NE2 1 
ATOM   10101 N NE2 B HIS D 1 175 ? -13.412 48.641  -70.806 0.50 22.04 ? 174 HIS D NE2 1 
ATOM   10102 N N   . ILE D 1 176 ? -13.641 43.283  -74.845 1.00 20.93 ? 175 ILE D N   1 
ATOM   10103 C CA  . ILE D 1 176 ? -13.546 42.418  -76.005 1.00 21.31 ? 175 ILE D CA  1 
ATOM   10104 C C   . ILE D 1 176 ? -14.785 41.540  -76.168 1.00 21.46 ? 175 ILE D C   1 
ATOM   10105 O O   . ILE D 1 176 ? -15.358 41.448  -77.260 1.00 21.36 ? 175 ILE D O   1 
ATOM   10106 C CB  . ILE D 1 176 ? -12.278 41.497  -75.933 1.00 21.21 ? 175 ILE D CB  1 
ATOM   10107 C CG1 . ILE D 1 176 ? -10.989 42.266  -76.286 1.00 21.90 ? 175 ILE D CG1 1 
ATOM   10108 C CG2 . ILE D 1 176 ? -12.427 40.274  -76.829 1.00 22.13 ? 175 ILE D CG2 1 
ATOM   10109 C CD1 . ILE D 1 176 ? -11.094 43.220  -77.464 1.00 21.59 ? 175 ILE D CD1 1 
ATOM   10110 N N   . VAL D 1 177 ? -15.177 40.886  -75.081 1.00 21.62 ? 176 VAL D N   1 
ATOM   10111 C CA  . VAL D 1 177 ? -16.302 39.930  -75.083 1.00 21.72 ? 176 VAL D CA  1 
ATOM   10112 C C   . VAL D 1 177 ? -17.625 40.629  -75.396 1.00 21.56 ? 176 VAL D C   1 
ATOM   10113 O O   . VAL D 1 177 ? -18.460 40.092  -76.128 1.00 21.40 ? 176 VAL D O   1 
ATOM   10114 C CB  . VAL D 1 177 ? -16.359 39.153  -73.718 1.00 21.90 ? 176 VAL D CB  1 
ATOM   10115 C CG1 . VAL D 1 177 ? -17.692 38.403  -73.530 1.00 22.64 ? 176 VAL D CG1 1 
ATOM   10116 C CG2 . VAL D 1 177 ? -15.157 38.198  -73.613 1.00 20.81 ? 176 VAL D CG2 1 
ATOM   10117 N N   . HIS D 1 178 ? -17.793 41.836  -74.865 1.00 22.05 ? 177 HIS D N   1 
ATOM   10118 C CA  . HIS D 1 178 ? -19.039 42.578  -75.020 1.00 22.59 ? 177 HIS D CA  1 
ATOM   10119 C C   . HIS D 1 178 ? -19.098 43.421  -76.301 1.00 23.63 ? 177 HIS D C   1 
ATOM   10120 O O   . HIS D 1 178 ? -20.168 43.928  -76.647 1.00 23.50 ? 177 HIS D O   1 
ATOM   10121 C CB  . HIS D 1 178 ? -19.303 43.436  -73.785 1.00 21.48 ? 177 HIS D CB  1 
ATOM   10122 C CG  . HIS D 1 178 ? -19.517 42.629  -72.536 1.00 20.08 ? 177 HIS D CG  1 
ATOM   10123 N ND1 . HIS D 1 178 ? -19.107 43.052  -71.288 1.00 17.40 ? 177 HIS D ND1 1 
ATOM   10124 C CD2 . HIS D 1 178 ? -20.072 41.404  -72.354 1.00 17.37 ? 177 HIS D CD2 1 
ATOM   10125 C CE1 . HIS D 1 178 ? -19.406 42.127  -70.393 1.00 16.75 ? 177 HIS D CE1 1 
ATOM   10126 N NE2 . HIS D 1 178 ? -19.998 41.121  -71.010 1.00 16.32 ? 177 HIS D NE2 1 
ATOM   10127 N N   . LYS D 1 179 ? -17.972 43.548  -77.010 1.00 24.87 ? 178 LYS D N   1 
ATOM   10128 C CA  . LYS D 1 179 ? -17.902 44.394  -78.210 1.00 25.23 ? 178 LYS D CA  1 
ATOM   10129 C C   . LYS D 1 179 ? -18.938 44.004  -79.242 1.00 25.59 ? 178 LYS D C   1 
ATOM   10130 O O   . LYS D 1 179 ? -19.604 44.860  -79.797 1.00 25.78 ? 178 LYS D O   1 
ATOM   10131 C CB  . LYS D 1 179 ? -16.508 44.325  -78.835 1.00 25.88 ? 178 LYS D CB  1 
ATOM   10132 C CG  . LYS D 1 179 ? -16.356 45.120  -80.135 1.00 27.52 ? 178 LYS D CG  1 
ATOM   10133 C CD  . LYS D 1 179 ? -15.871 46.524  -79.910 1.00 30.94 ? 178 LYS D CD  1 
ATOM   10134 C CE  . LYS D 1 179 ? -14.347 46.621  -79.989 1.00 33.20 ? 178 LYS D CE  1 
ATOM   10135 N NZ  . LYS D 1 179 ? -13.893 48.063  -80.061 1.00 34.72 ? 178 LYS D NZ  1 
ATOM   10136 N N   . HIS D 1 180 ? -19.062 42.709  -79.504 1.00 26.06 ? 179 HIS D N   1 
ATOM   10137 C CA  . HIS D 1 180 ? -20.067 42.211  -80.429 1.00 26.33 ? 179 HIS D CA  1 
ATOM   10138 C C   . HIS D 1 180 ? -20.799 41.023  -79.840 1.00 25.89 ? 179 HIS D C   1 
ATOM   10139 O O   . HIS D 1 180 ? -20.278 40.322  -78.972 1.00 25.52 ? 179 HIS D O   1 
ATOM   10140 C CB  . HIS D 1 180 ? -19.423 41.778  -81.764 1.00 27.02 ? 179 HIS D CB  1 
ATOM   10141 C CG  . HIS D 1 180 ? -18.603 42.849  -82.429 1.00 27.69 ? 179 HIS D CG  1 
ATOM   10142 N ND1 . HIS D 1 180 ? -19.146 44.031  -82.890 1.00 28.78 ? 179 HIS D ND1 1 
ATOM   10143 C CD2 . HIS D 1 180 ? -17.282 42.901  -82.728 1.00 28.83 ? 179 HIS D CD2 1 
ATOM   10144 C CE1 . HIS D 1 180 ? -18.188 44.776  -83.413 1.00 29.41 ? 179 HIS D CE1 1 
ATOM   10145 N NE2 . HIS D 1 180 ? -17.049 44.113  -83.334 1.00 28.21 ? 179 HIS D NE2 1 
ATOM   10146 N N   . GLY D 1 181 ? -22.005 40.791  -80.345 1.00 25.43 ? 180 GLY D N   1 
ATOM   10147 C CA  . GLY D 1 181 ? -22.773 39.594  -80.015 1.00 25.26 ? 180 GLY D CA  1 
ATOM   10148 C C   . GLY D 1 181 ? -23.357 39.694  -78.625 1.00 24.62 ? 180 GLY D C   1 
ATOM   10149 O O   . GLY D 1 181 ? -23.335 40.763  -78.027 1.00 24.34 ? 180 GLY D O   1 
ATOM   10150 N N   . ASP D 1 182 ? -23.867 38.569  -78.133 1.00 24.07 ? 181 ASP D N   1 
ATOM   10151 C CA  . ASP D 1 182 ? -24.459 38.466  -76.789 1.00 23.64 ? 181 ASP D CA  1 
ATOM   10152 C C   . ASP D 1 182 ? -23.742 37.346  -76.027 1.00 21.74 ? 181 ASP D C   1 
ATOM   10153 O O   . ASP D 1 182 ? -24.151 36.195  -76.056 1.00 21.24 ? 181 ASP D O   1 
ATOM   10154 C CB  . ASP D 1 182 ? -25.951 38.180  -76.896 1.00 24.78 ? 181 ASP D CB  1 
ATOM   10155 C CG  . ASP D 1 182 ? -26.641 38.175  -75.545 1.00 28.41 ? 181 ASP D CG  1 
ATOM   10156 O OD1 . ASP D 1 182 ? -26.279 39.020  -74.692 1.00 31.46 ? 181 ASP D OD1 1 
ATOM   10157 O OD2 . ASP D 1 182 ? -27.550 37.329  -75.353 1.00 33.06 ? 181 ASP D OD2 1 
ATOM   10158 N N   . ILE D 1 183 ? -22.640 37.713  -75.386 1.00 19.78 ? 182 ILE D N   1 
ATOM   10159 C CA  . ILE D 1 183 ? -21.709 36.759  -74.822 1.00 18.50 ? 182 ILE D CA  1 
ATOM   10160 C C   . ILE D 1 183 ? -21.578 37.031  -73.337 1.00 17.18 ? 182 ILE D C   1 
ATOM   10161 O O   . ILE D 1 183 ? -21.406 38.173  -72.941 1.00 17.56 ? 182 ILE D O   1 
ATOM   10162 C CB  . ILE D 1 183 ? -20.305 36.889  -75.473 1.00 18.31 ? 182 ILE D CB  1 
ATOM   10163 C CG1 . ILE D 1 183 ? -20.420 36.964  -77.012 1.00 18.40 ? 182 ILE D CG1 1 
ATOM   10164 C CG2 . ILE D 1 183 ? -19.398 35.759  -74.979 1.00 17.03 ? 182 ILE D CG2 1 
ATOM   10165 C CD1 . ILE D 1 183 ? -19.108 36.862  -77.756 1.00 18.90 ? 182 ILE D CD1 1 
ATOM   10166 N N   . ILE D 1 184 ? -21.651 35.978  -72.527 1.00 16.63 ? 183 ILE D N   1 
ATOM   10167 C CA  . ILE D 1 184 ? -21.510 36.087  -71.048 1.00 15.33 ? 183 ILE D CA  1 
ATOM   10168 C C   . ILE D 1 184 ? -20.058 35.898  -70.657 1.00 14.33 ? 183 ILE D C   1 
ATOM   10169 O O   . ILE D 1 184 ? -19.410 34.946  -71.104 1.00 13.84 ? 183 ILE D O   1 
ATOM   10170 C CB  . ILE D 1 184 ? -22.370 35.025  -70.318 1.00 15.28 ? 183 ILE D CB  1 
ATOM   10171 C CG1 . ILE D 1 184 ? -23.862 35.253  -70.618 1.00 16.50 ? 183 ILE D CG1 1 
ATOM   10172 C CG2 . ILE D 1 184 ? -22.109 35.048  -68.825 1.00 15.23 ? 183 ILE D CG2 1 
ATOM   10173 C CD1 . ILE D 1 184 ? -24.661 33.942  -70.752 1.00 15.97 ? 183 ILE D CD1 1 
ATOM   10174 N N   . LEU D 1 185 ? -19.530 36.830  -69.866 1.00 14.20 ? 184 LEU D N   1 
ATOM   10175 C CA  . LEU D 1 185 ? -18.193 36.691  -69.280 1.00 14.24 ? 184 LEU D CA  1 
ATOM   10176 C C   . LEU D 1 185 ? -18.336 36.303  -67.830 1.00 13.25 ? 184 LEU D C   1 
ATOM   10177 O O   . LEU D 1 185 ? -18.883 37.081  -67.024 1.00 13.68 ? 184 LEU D O   1 
ATOM   10178 C CB  . LEU D 1 185 ? -17.385 37.990  -69.355 1.00 13.64 ? 184 LEU D CB  1 
ATOM   10179 C CG  . LEU D 1 185 ? -15.999 37.991  -68.678 1.00 14.26 ? 184 LEU D CG  1 
ATOM   10180 C CD1 . LEU D 1 185 ? -15.085 36.961  -69.271 1.00 14.18 ? 184 LEU D CD1 1 
ATOM   10181 C CD2 . LEU D 1 185 ? -15.361 39.387  -68.802 1.00 14.75 ? 184 LEU D CD2 1 
ATOM   10182 N N   . VAL D 1 186 ? -17.863 35.094  -67.517 1.00 12.78 ? 185 VAL D N   1 
ATOM   10183 C CA  . VAL D 1 186 ? -17.721 34.627  -66.136 1.00 11.28 ? 185 VAL D CA  1 
ATOM   10184 C C   . VAL D 1 186 ? -16.290 34.762  -65.625 1.00 10.80 ? 185 VAL D C   1 
ATOM   10185 O O   . VAL D 1 186 ? -15.333 34.347  -66.297 1.00 10.57 ? 185 VAL D O   1 
ATOM   10186 C CB  . VAL D 1 186 ? -18.107 33.145  -65.973 1.00 11.52 ? 185 VAL D CB  1 
ATOM   10187 C CG1 . VAL D 1 186 ? -17.871 32.691  -64.499 1.00 9.13  ? 185 VAL D CG1 1 
ATOM   10188 C CG2 . VAL D 1 186 ? -19.573 32.893  -66.394 1.00 9.00  ? 185 VAL D CG2 1 
ATOM   10189 N N   . VAL D 1 187 ? -16.153 35.300  -64.415 1.00 10.37 ? 186 VAL D N   1 
ATOM   10190 C CA  . VAL D 1 187 ? -14.903 35.213  -63.670 1.00 10.17 ? 186 VAL D CA  1 
ATOM   10191 C C   . VAL D 1 187 ? -15.108 34.324  -62.432 1.00 10.26 ? 186 VAL D C   1 
ATOM   10192 O O   . VAL D 1 187 ? -15.952 34.591  -61.580 1.00 10.64 ? 186 VAL D O   1 
ATOM   10193 C CB  . VAL D 1 187 ? -14.362 36.567  -63.214 1.00 9.80  ? 186 VAL D CB  1 
ATOM   10194 C CG1 . VAL D 1 187 ? -13.016 36.381  -62.490 1.00 8.74  ? 186 VAL D CG1 1 
ATOM   10195 C CG2 . VAL D 1 187 ? -14.167 37.539  -64.404 1.00 10.86 ? 186 VAL D CG2 1 
ATOM   10196 N N   . ASP D 1 188 ? -14.343 33.257  -62.380 1.00 9.79  ? 187 ASP D N   1 
ATOM   10197 C CA  . ASP D 1 188 ? -14.255 32.392  -61.220 1.00 9.93  ? 187 ASP D CA  1 
ATOM   10198 C C   . ASP D 1 188 ? -13.246 33.051  -60.323 1.00 10.36 ? 187 ASP D C   1 
ATOM   10199 O O   . ASP D 1 188 ? -12.038 33.060  -60.597 1.00 10.11 ? 187 ASP D O   1 
ATOM   10200 C CB  . ASP D 1 188 ? -13.817 30.998  -61.665 1.00 9.67  ? 187 ASP D CB  1 
ATOM   10201 C CG  . ASP D 1 188 ? -13.573 30.048  -60.517 1.00 8.94  ? 187 ASP D CG  1 
ATOM   10202 O OD1 . ASP D 1 188 ? -13.405 30.468  -59.363 1.00 11.06 ? 187 ASP D OD1 1 
ATOM   10203 O OD2 . ASP D 1 188 ? -13.556 28.837  -60.783 1.00 7.79  ? 187 ASP D OD2 1 
ATOM   10204 N N   . ASN D 1 189 ? -13.773 33.631  -59.256 1.00 10.83 ? 188 ASN D N   1 
ATOM   10205 C CA  . ASN D 1 189 ? -13.057 34.489  -58.343 1.00 11.17 ? 188 ASN D CA  1 
ATOM   10206 C C   . ASN D 1 189 ? -12.709 33.760  -57.027 1.00 11.41 ? 188 ASN D C   1 
ATOM   10207 O O   . ASN D 1 189 ? -12.455 34.386  -56.000 1.00 11.42 ? 188 ASN D O   1 
ATOM   10208 C CB  . ASN D 1 189 ? -13.971 35.687  -58.077 1.00 11.06 ? 188 ASN D CB  1 
ATOM   10209 C CG  . ASN D 1 189 ? -13.261 36.858  -57.460 1.00 11.95 ? 188 ASN D CG  1 
ATOM   10210 O OD1 . ASN D 1 189 ? -12.101 37.172  -57.798 1.00 13.66 ? 188 ASN D OD1 1 
ATOM   10211 N ND2 . ASN D 1 189 ? -13.963 37.532  -56.528 1.00 9.46  ? 188 ASN D ND2 1 
ATOM   10212 N N   . THR D 1 190 ? -12.719 32.435  -57.073 1.00 12.38 ? 189 THR D N   1 
ATOM   10213 C CA  . THR D 1 190 ? -12.404 31.591  -55.924 1.00 12.56 ? 189 THR D CA  1 
ATOM   10214 C C   . THR D 1 190 ? -11.107 31.937  -55.190 1.00 13.32 ? 189 THR D C   1 
ATOM   10215 O O   . THR D 1 190 ? -11.081 31.955  -53.951 1.00 13.50 ? 189 THR D O   1 
ATOM   10216 C CB  . THR D 1 190 ? -12.328 30.145  -56.395 1.00 12.91 ? 189 THR D CB  1 
ATOM   10217 O OG1 . THR D 1 190 ? -13.621 29.754  -56.867 1.00 12.37 ? 189 THR D OG1 1 
ATOM   10218 C CG2 . THR D 1 190 ? -11.814 29.179  -55.281 1.00 10.56 ? 189 THR D CG2 1 
ATOM   10219 N N   . PHE D 1 191 ? -10.042 32.196  -55.944 1.00 13.74 ? 190 PHE D N   1 
ATOM   10220 C CA  . PHE D 1 191 ? -8.724  32.472  -55.356 1.00 13.90 ? 190 PHE D CA  1 
ATOM   10221 C C   . PHE D 1 191 ? -8.709  33.801  -54.634 1.00 14.09 ? 190 PHE D C   1 
ATOM   10222 O O   . PHE D 1 191 ? -8.156  33.903  -53.538 1.00 14.01 ? 190 PHE D O   1 
ATOM   10223 C CB  . PHE D 1 191 ? -7.624  32.462  -56.438 1.00 14.23 ? 190 PHE D CB  1 
ATOM   10224 C CG  . PHE D 1 191 ? -6.917  31.141  -56.615 1.00 13.54 ? 190 PHE D CG  1 
ATOM   10225 C CD1 . PHE D 1 191 ? -7.548  29.925  -56.358 1.00 16.06 ? 190 PHE D CD1 1 
ATOM   10226 C CD2 . PHE D 1 191 ? -5.622  31.114  -57.119 1.00 14.72 ? 190 PHE D CD2 1 
ATOM   10227 C CE1 . PHE D 1 191 ? -6.869  28.715  -56.551 1.00 15.83 ? 190 PHE D CE1 1 
ATOM   10228 C CE2 . PHE D 1 191 ? -4.947  29.908  -57.321 1.00 15.36 ? 190 PHE D CE2 1 
ATOM   10229 C CZ  . PHE D 1 191 ? -5.569  28.721  -57.040 1.00 14.66 ? 190 PHE D CZ  1 
ATOM   10230 N N   . MET D 1 192 ? -9.336  34.827  -55.221 1.00 13.71 ? 191 MET D N   1 
ATOM   10231 C CA  . MET D 1 192 ? -9.212  36.168  -54.653 1.00 13.23 ? 191 MET D CA  1 
ATOM   10232 C C   . MET D 1 192 ? -10.212 36.465  -53.548 1.00 12.82 ? 191 MET D C   1 
ATOM   10233 O O   . MET D 1 192 ? -9.848  37.082  -52.552 1.00 12.27 ? 191 MET D O   1 
ATOM   10234 C CB  . MET D 1 192 ? -9.278  37.247  -55.740 1.00 13.21 ? 191 MET D CB  1 
ATOM   10235 C CG  . MET D 1 192 ? -8.190  37.135  -56.780 1.00 12.54 ? 191 MET D CG  1 
ATOM   10236 S SD  . MET D 1 192 ? -6.519  37.133  -56.060 1.00 15.12 ? 191 MET D SD  1 
ATOM   10237 C CE  . MET D 1 192 ? -6.487  38.680  -55.177 1.00 12.78 ? 191 MET D CE  1 
ATOM   10238 N N   . SER D 1 193 ? -11.453 36.011  -53.721 1.00 13.10 ? 192 SER D N   1 
ATOM   10239 C CA  . SER D 1 193 ? -12.605 36.390  -52.886 1.00 12.73 ? 192 SER D CA  1 
ATOM   10240 C C   . SER D 1 193 ? -12.948 37.827  -53.235 1.00 12.52 ? 192 SER D C   1 
ATOM   10241 O O   . SER D 1 193 ? -12.090 38.574  -53.674 1.00 10.88 ? 192 SER D O   1 
ATOM   10242 C CB  . SER D 1 193 ? -12.321 36.280  -51.378 1.00 13.04 ? 192 SER D CB  1 
ATOM   10243 O OG  . SER D 1 193 ? -11.696 37.462  -50.912 1.00 11.41 ? 192 SER D OG  1 
ATOM   10244 N N   . PRO D 1 194 ? -14.182 38.237  -52.953 1.00 12.90 ? 193 PRO D N   1 
ATOM   10245 C CA  . PRO D 1 194 ? -14.610 39.588  -53.277 1.00 13.06 ? 193 PRO D CA  1 
ATOM   10246 C C   . PRO D 1 194 ? -13.969 40.674  -52.425 1.00 12.48 ? 193 PRO D C   1 
ATOM   10247 O O   . PRO D 1 194 ? -14.092 41.855  -52.752 1.00 11.88 ? 193 PRO D O   1 
ATOM   10248 C CB  . PRO D 1 194 ? -16.133 39.541  -53.053 1.00 13.90 ? 193 PRO D CB  1 
ATOM   10249 C CG  . PRO D 1 194 ? -16.324 38.513  -52.106 1.00 13.28 ? 193 PRO D CG  1 
ATOM   10250 C CD  . PRO D 1 194 ? -15.252 37.482  -52.296 1.00 13.56 ? 193 PRO D CD  1 
ATOM   10251 N N   . TYR D 1 195 ? -13.328 40.280  -51.324 1.00 12.02 ? 194 TYR D N   1 
ATOM   10252 C CA  . TYR D 1 195 ? -12.532 41.202  -50.531 1.00 12.42 ? 194 TYR D CA  1 
ATOM   10253 C C   . TYR D 1 195 ? -11.385 41.821  -51.341 1.00 12.02 ? 194 TYR D C   1 
ATOM   10254 O O   . TYR D 1 195 ? -11.086 42.998  -51.188 1.00 10.85 ? 194 TYR D O   1 
ATOM   10255 C CB  . TYR D 1 195 ? -11.975 40.504  -49.274 1.00 12.11 ? 194 TYR D CB  1 
ATOM   10256 C CG  . TYR D 1 195 ? -11.278 41.447  -48.303 1.00 12.57 ? 194 TYR D CG  1 
ATOM   10257 C CD1 . TYR D 1 195 ? -12.009 42.349  -47.528 1.00 11.02 ? 194 TYR D CD1 1 
ATOM   10258 C CD2 . TYR D 1 195 ? -9.895  41.423  -48.145 1.00 11.07 ? 194 TYR D CD2 1 
ATOM   10259 C CE1 . TYR D 1 195 ? -11.391 43.207  -46.671 1.00 11.33 ? 194 TYR D CE1 1 
ATOM   10260 C CE2 . TYR D 1 195 ? -9.267  42.280  -47.257 1.00 12.84 ? 194 TYR D CE2 1 
ATOM   10261 C CZ  . TYR D 1 195 ? -10.015 43.182  -46.536 1.00 11.99 ? 194 TYR D CZ  1 
ATOM   10262 O OH  . TYR D 1 195 ? -9.412  44.031  -45.617 1.00 11.35 ? 194 TYR D OH  1 
ATOM   10263 N N   . PHE D 1 196 ? -10.783 41.026  -52.220 1.00 12.40 ? 195 PHE D N   1 
ATOM   10264 C CA  . PHE D 1 196 ? -9.597  41.462  -52.971 1.00 13.24 ? 195 PHE D CA  1 
ATOM   10265 C C   . PHE D 1 196 ? -9.844  41.721  -54.449 1.00 13.19 ? 195 PHE D C   1 
ATOM   10266 O O   . PHE D 1 196 ? -9.041  42.363  -55.106 1.00 12.95 ? 195 PHE D O   1 
ATOM   10267 C CB  . PHE D 1 196 ? -8.461  40.450  -52.829 1.00 12.82 ? 195 PHE D CB  1 
ATOM   10268 C CG  . PHE D 1 196 ? -7.789  40.434  -51.483 1.00 12.85 ? 195 PHE D CG  1 
ATOM   10269 C CD1 . PHE D 1 196 ? -7.483  39.226  -50.871 1.00 13.69 ? 195 PHE D CD1 1 
ATOM   10270 C CD2 . PHE D 1 196 ? -7.387  41.615  -50.849 1.00 11.60 ? 195 PHE D CD2 1 
ATOM   10271 C CE1 . PHE D 1 196 ? -6.805  39.207  -49.639 1.00 11.68 ? 195 PHE D CE1 1 
ATOM   10272 C CE2 . PHE D 1 196 ? -6.732  41.590  -49.651 1.00 12.18 ? 195 PHE D CE2 1 
ATOM   10273 C CZ  . PHE D 1 196 ? -6.444  40.379  -49.034 1.00 13.29 ? 195 PHE D CZ  1 
ATOM   10274 N N   . GLN D 1 197 ? -10.952 41.224  -54.981 1.00 13.76 ? 196 GLN D N   1 
ATOM   10275 C CA  . GLN D 1 197 ? -11.260 41.392  -56.386 1.00 13.29 ? 196 GLN D CA  1 
ATOM   10276 C C   . GLN D 1 197 ? -12.782 41.387  -56.619 1.00 13.13 ? 196 GLN D C   1 
ATOM   10277 O O   . GLN D 1 197 ? -13.474 40.502  -56.117 1.00 12.54 ? 196 GLN D O   1 
ATOM   10278 C CB  . GLN D 1 197 ? -10.593 40.270  -57.169 1.00 13.31 ? 196 GLN D CB  1 
ATOM   10279 C CG  . GLN D 1 197 ? -10.645 40.425  -58.673 1.00 13.72 ? 196 GLN D CG  1 
ATOM   10280 C CD  . GLN D 1 197 ? -9.693  39.475  -59.404 1.00 15.04 ? 196 GLN D CD  1 
ATOM   10281 O OE1 . GLN D 1 197 ? -8.656  39.891  -59.899 1.00 16.80 ? 196 GLN D OE1 1 
ATOM   10282 N NE2 . GLN D 1 197 ? -10.064 38.203  -59.493 1.00 15.59 ? 196 GLN D NE2 1 
ATOM   10283 N N   . ARG D 1 198 ? -13.284 42.377  -57.360 1.00 12.70 ? 197 ARG D N   1 
ATOM   10284 C CA  . ARG D 1 198 ? -14.699 42.440  -57.771 1.00 13.13 ? 197 ARG D CA  1 
ATOM   10285 C C   . ARG D 1 198 ? -14.908 42.426  -59.287 1.00 12.84 ? 197 ARG D C   1 
ATOM   10286 O O   . ARG D 1 198 ? -15.071 43.484  -59.883 1.00 11.75 ? 197 ARG D O   1 
ATOM   10287 C CB  . ARG D 1 198 ? -15.378 43.687  -57.192 1.00 12.89 ? 197 ARG D CB  1 
ATOM   10288 C CG  . ARG D 1 198 ? -15.794 43.527  -55.762 1.00 14.57 ? 197 ARG D CG  1 
ATOM   10289 C CD  . ARG D 1 198 ? -16.471 44.776  -55.234 1.00 14.78 ? 197 ARG D CD  1 
ATOM   10290 N NE  . ARG D 1 198 ? -16.950 44.511  -53.898 1.00 15.43 ? 197 ARG D NE  1 
ATOM   10291 C CZ  . ARG D 1 198 ? -17.448 45.412  -53.074 1.00 16.70 ? 197 ARG D CZ  1 
ATOM   10292 N NH1 . ARG D 1 198 ? -17.527 46.689  -53.418 1.00 18.22 ? 197 ARG D NH1 1 
ATOM   10293 N NH2 . ARG D 1 198 ? -17.868 45.024  -51.889 1.00 17.60 ? 197 ARG D NH2 1 
ATOM   10294 N N   . PRO D 1 199 ? -14.972 41.221  -59.893 1.00 13.18 ? 198 PRO D N   1 
ATOM   10295 C CA  . PRO D 1 199 ? -15.156 41.045  -61.315 1.00 13.39 ? 198 PRO D CA  1 
ATOM   10296 C C   . PRO D 1 199 ? -16.354 41.820  -61.861 1.00 14.45 ? 198 PRO D C   1 
ATOM   10297 O O   . PRO D 1 199 ? -16.262 42.354  -62.945 1.00 13.67 ? 198 PRO D O   1 
ATOM   10298 C CB  . PRO D 1 199 ? -15.350 39.530  -61.450 1.00 14.06 ? 198 PRO D CB  1 
ATOM   10299 C CG  . PRO D 1 199 ? -14.615 38.968  -60.322 1.00 13.22 ? 198 PRO D CG  1 
ATOM   10300 C CD  . PRO D 1 199 ? -14.830 39.919  -59.219 1.00 12.55 ? 198 PRO D CD  1 
ATOM   10301 N N   . LEU D 1 200 ? -17.438 41.943  -61.093 1.00 14.36 ? 199 LEU D N   1 
ATOM   10302 C CA  . LEU D 1 200 ? -18.619 42.652  -61.595 1.00 15.01 ? 199 LEU D CA  1 
ATOM   10303 C C   . LEU D 1 200 ? -18.317 44.132  -61.794 1.00 15.10 ? 199 LEU D C   1 
ATOM   10304 O O   . LEU D 1 200 ? -18.762 44.713  -62.771 1.00 16.62 ? 199 LEU D O   1 
ATOM   10305 C CB  . LEU D 1 200 ? -19.863 42.428  -60.697 1.00 14.83 ? 199 LEU D CB  1 
ATOM   10306 C CG  . LEU D 1 200 ? -20.439 40.986  -60.692 1.00 14.91 ? 199 LEU D CG  1 
ATOM   10307 C CD1 . LEU D 1 200 ? -21.523 40.837  -59.642 1.00 12.92 ? 199 LEU D CD1 1 
ATOM   10308 C CD2 . LEU D 1 200 ? -20.944 40.529  -62.058 1.00 11.28 ? 199 LEU D CD2 1 
ATOM   10309 N N   . ALA D 1 201 ? -17.498 44.716  -60.930 1.00 15.00 ? 200 ALA D N   1 
ATOM   10310 C CA  . ALA D 1 201 ? -17.081 46.106  -61.086 1.00 15.72 ? 200 ALA D CA  1 
ATOM   10311 C C   . ALA D 1 201 ? -16.179 46.337  -62.307 1.00 16.74 ? 200 ALA D C   1 
ATOM   10312 O O   . ALA D 1 201 ? -16.088 47.466  -62.807 1.00 16.35 ? 200 ALA D O   1 
ATOM   10313 C CB  . ALA D 1 201 ? -16.396 46.601  -59.808 1.00 16.21 ? 200 ALA D CB  1 
ATOM   10314 N N   . LEU D 1 202 ? -15.547 45.267  -62.787 1.00 16.27 ? 201 LEU D N   1 
ATOM   10315 C CA  . LEU D 1 202 ? -14.554 45.325  -63.834 1.00 17.08 ? 201 LEU D CA  1 
ATOM   10316 C C   . LEU D 1 202 ? -15.168 44.934  -65.175 1.00 17.14 ? 201 LEU D C   1 
ATOM   10317 O O   . LEU D 1 202 ? -14.444 44.854  -66.169 1.00 17.87 ? 201 LEU D O   1 
ATOM   10318 C CB  . LEU D 1 202 ? -13.389 44.395  -63.492 1.00 16.83 ? 201 LEU D CB  1 
ATOM   10319 C CG  . LEU D 1 202 ? -12.590 44.767  -62.221 1.00 18.26 ? 201 LEU D CG  1 
ATOM   10320 C CD1 . LEU D 1 202 ? -11.606 43.658  -61.802 1.00 14.53 ? 201 LEU D CD1 1 
ATOM   10321 C CD2 . LEU D 1 202 ? -11.845 46.087  -62.466 1.00 18.55 ? 201 LEU D CD2 1 
ATOM   10322 N N   . GLY D 1 203 ? -16.485 44.675  -65.175 1.00 16.57 ? 202 GLY D N   1 
ATOM   10323 C CA  . GLY D 1 203 ? -17.268 44.384  -66.365 1.00 16.70 ? 202 GLY D CA  1 
ATOM   10324 C C   . GLY D 1 203 ? -17.649 42.935  -66.626 1.00 15.93 ? 202 GLY D C   1 
ATOM   10325 O O   . GLY D 1 203 ? -18.233 42.638  -67.660 1.00 17.22 ? 202 GLY D O   1 
ATOM   10326 N N   . ALA D 1 204 ? -17.312 42.013  -65.736 1.00 15.16 ? 203 ALA D N   1 
ATOM   10327 C CA  . ALA D 1 204 ? -17.785 40.639  -65.900 1.00 14.25 ? 203 ALA D CA  1 
ATOM   10328 C C   . ALA D 1 204 ? -19.298 40.609  -65.667 1.00 13.30 ? 203 ALA D C   1 
ATOM   10329 O O   . ALA D 1 204 ? -19.829 41.446  -64.966 1.00 12.17 ? 203 ALA D O   1 
ATOM   10330 C CB  . ALA D 1 204 ? -17.051 39.684  -64.948 1.00 14.04 ? 203 ALA D CB  1 
ATOM   10331 N N   . ASP D 1 205 ? -19.975 39.647  -66.277 1.00 13.23 ? 204 ASP D N   1 
ATOM   10332 C CA  . ASP D 1 205 ? -21.415 39.462  -66.110 1.00 13.27 ? 204 ASP D CA  1 
ATOM   10333 C C   . ASP D 1 205 ? -21.715 38.596  -64.891 1.00 13.20 ? 204 ASP D C   1 
ATOM   10334 O O   . ASP D 1 205 ? -22.789 38.720  -64.298 1.00 14.05 ? 204 ASP D O   1 
ATOM   10335 C CB  . ASP D 1 205 ? -22.010 38.783  -67.336 1.00 12.66 ? 204 ASP D CB  1 
ATOM   10336 C CG  . ASP D 1 205 ? -21.763 39.575  -68.603 1.00 14.15 ? 204 ASP D CG  1 
ATOM   10337 O OD1 . ASP D 1 205 ? -22.266 40.717  -68.642 1.00 15.17 ? 204 ASP D OD1 1 
ATOM   10338 O OD2 . ASP D 1 205 ? -21.038 39.084  -69.508 1.00 14.85 ? 204 ASP D OD2 1 
ATOM   10339 N N   . ILE D 1 206 ? -20.761 37.739  -64.536 1.00 12.87 ? 205 ILE D N   1 
ATOM   10340 C CA  . ILE D 1 206 ? -20.915 36.795  -63.429 1.00 12.61 ? 205 ILE D CA  1 
ATOM   10341 C C   . ILE D 1 206 ? -19.617 36.691  -62.664 1.00 12.99 ? 205 ILE D C   1 
ATOM   10342 O O   . ILE D 1 206 ? -18.546 36.550  -63.255 1.00 13.25 ? 205 ILE D O   1 
ATOM   10343 C CB  . ILE D 1 206 ? -21.299 35.390  -63.934 1.00 12.42 ? 205 ILE D CB  1 
ATOM   10344 C CG1 . ILE D 1 206 ? -22.682 35.404  -64.582 1.00 11.89 ? 205 ILE D CG1 1 
ATOM   10345 C CG2 . ILE D 1 206 ? -21.230 34.318  -62.788 1.00 12.40 ? 205 ILE D CG2 1 
ATOM   10346 C CD1 . ILE D 1 206 ? -23.115 34.023  -65.079 1.00 12.46 ? 205 ILE D CD1 1 
ATOM   10347 N N   . SER D 1 207 ? -19.726 36.773  -61.340 1.00 13.03 ? 206 SER D N   1 
ATOM   10348 C CA  . SER D 1 207 ? -18.625 36.487  -60.416 1.00 13.23 ? 206 SER D CA  1 
ATOM   10349 C C   . SER D 1 207 ? -18.988 35.179  -59.719 1.00 12.74 ? 206 SER D C   1 
ATOM   10350 O O   . SER D 1 207 ? -20.001 35.109  -59.032 1.00 11.86 ? 206 SER D O   1 
ATOM   10351 C CB  . SER D 1 207 ? -18.483 37.638  -59.410 1.00 13.31 ? 206 SER D CB  1 
ATOM   10352 O OG  . SER D 1 207 ? -17.344 37.487  -58.576 1.00 14.81 ? 206 SER D OG  1 
ATOM   10353 N N   . MET D 1 208 ? -18.192 34.142  -59.947 1.00 12.73 ? 207 MET D N   1 
ATOM   10354 C CA  . MET D 1 208 ? -18.461 32.819  -59.423 1.00 12.93 ? 207 MET D CA  1 
ATOM   10355 C C   . MET D 1 208 ? -17.407 32.386  -58.406 1.00 12.85 ? 207 MET D C   1 
ATOM   10356 O O   . MET D 1 208 ? -16.236 32.792  -58.494 1.00 11.77 ? 207 MET D O   1 
ATOM   10357 C CB  . MET D 1 208 ? -18.581 31.835  -60.601 1.00 13.43 ? 207 MET D CB  1 
ATOM   10358 C CG  . MET D 1 208 ? -18.606 30.336  -60.270 1.00 14.07 ? 207 MET D CG  1 
ATOM   10359 S SD  . MET D 1 208 ? -16.946 29.664  -60.109 1.00 13.79 ? 207 MET D SD  1 
ATOM   10360 C CE  . MET D 1 208 ? -17.314 28.022  -59.457 1.00 13.38 ? 207 MET D CE  1 
ATOM   10361 N N   . TYR D 1 209 ? -17.845 31.557  -57.439 1.00 13.37 ? 208 TYR D N   1 
ATOM   10362 C CA  . TYR D 1 209 ? -16.954 30.951  -56.432 1.00 13.61 ? 208 TYR D CA  1 
ATOM   10363 C C   . TYR D 1 209 ? -17.175 29.469  -56.239 1.00 13.86 ? 208 TYR D C   1 
ATOM   10364 O O   . TYR D 1 209 ? -18.296 28.970  -56.341 1.00 14.07 ? 208 TYR D O   1 
ATOM   10365 C CB  . TYR D 1 209 ? -17.137 31.607  -55.064 1.00 13.60 ? 208 TYR D CB  1 
ATOM   10366 C CG  . TYR D 1 209 ? -16.950 33.082  -55.134 1.00 13.61 ? 208 TYR D CG  1 
ATOM   10367 C CD1 . TYR D 1 209 ? -17.993 33.896  -55.516 1.00 14.27 ? 208 TYR D CD1 1 
ATOM   10368 C CD2 . TYR D 1 209 ? -15.722 33.662  -54.860 1.00 13.86 ? 208 TYR D CD2 1 
ATOM   10369 C CE1 . TYR D 1 209 ? -17.834 35.251  -55.618 1.00 14.03 ? 208 TYR D CE1 1 
ATOM   10370 C CE2 . TYR D 1 209 ? -15.554 35.023  -54.969 1.00 14.78 ? 208 TYR D CE2 1 
ATOM   10371 C CZ  . TYR D 1 209 ? -16.627 35.810  -55.346 1.00 13.71 ? 208 TYR D CZ  1 
ATOM   10372 O OH  . TYR D 1 209 ? -16.489 37.162  -55.471 1.00 13.80 ? 208 TYR D OH  1 
ATOM   10373 N N   . SER D 1 210 ? -16.072 28.777  -55.985 1.00 13.69 ? 209 SER D N   1 
ATOM   10374 C CA  . SER D 1 210 ? -16.088 27.626  -55.138 1.00 13.96 ? 209 SER D CA  1 
ATOM   10375 C C   . SER D 1 210 ? -16.001 28.212  -53.711 1.00 13.12 ? 209 SER D C   1 
ATOM   10376 O O   . SER D 1 210 ? -14.961 28.690  -53.275 1.00 13.87 ? 209 SER D O   1 
ATOM   10377 C CB  . SER D 1 210 ? -14.922 26.701  -55.447 1.00 13.36 ? 209 SER D CB  1 
ATOM   10378 O OG  . SER D 1 210 ? -14.867 25.657  -54.492 1.00 14.86 ? 209 SER D OG  1 
ATOM   10379 N N   . ALA D 1 211 ? -17.137 28.252  -53.038 1.00 13.80 ? 210 ALA D N   1 
ATOM   10380 C CA  . ALA D 1 211 ? -17.225 28.727  -51.653 1.00 12.84 ? 210 ALA D CA  1 
ATOM   10381 C C   . ALA D 1 211 ? -16.535 27.743  -50.699 1.00 12.59 ? 210 ALA D C   1 
ATOM   10382 O O   . ALA D 1 211 ? -16.205 28.093  -49.565 1.00 12.77 ? 210 ALA D O   1 
ATOM   10383 C CB  . ALA D 1 211 ? -18.684 28.917  -51.262 1.00 13.56 ? 210 ALA D CB  1 
ATOM   10384 N N   . THR D 1 212 ? -16.338 26.516  -51.184 1.00 11.99 ? 211 THR D N   1 
ATOM   10385 C CA  . THR D 1 212 ? -15.559 25.466  -50.521 1.00 11.79 ? 211 THR D CA  1 
ATOM   10386 C C   . THR D 1 212 ? -14.161 25.919  -50.055 1.00 12.16 ? 211 THR D C   1 
ATOM   10387 O O   . THR D 1 212 ? -13.622 25.411  -49.079 1.00 12.83 ? 211 THR D O   1 
ATOM   10388 C CB  . THR D 1 212 ? -15.345 24.294  -51.497 1.00 11.24 ? 211 THR D CB  1 
ATOM   10389 O OG1 . THR D 1 212 ? -16.583 24.012  -52.187 1.00 10.57 ? 211 THR D OG1 1 
ATOM   10390 C CG2 . THR D 1 212 ? -14.838 23.049  -50.759 1.00 9.64  ? 211 THR D CG2 1 
ATOM   10391 N N   . LYS D 1 213 ? -13.606 26.887  -50.758 1.00 12.51 ? 212 LYS D N   1 
ATOM   10392 C CA  . LYS D 1 213 ? -12.270 27.367  -50.495 1.00 13.30 ? 212 LYS D CA  1 
ATOM   10393 C C   . LYS D 1 213 ? -12.352 28.569  -49.519 1.00 13.19 ? 212 LYS D C   1 
ATOM   10394 O O   . LYS D 1 213 ? -12.717 28.375  -48.346 1.00 13.24 ? 212 LYS D O   1 
ATOM   10395 C CB  . LYS D 1 213 ? -11.578 27.675  -51.848 1.00 13.66 ? 212 LYS D CB  1 
ATOM   10396 C CG  . LYS D 1 213 ? -11.792 26.571  -52.941 1.00 14.56 ? 212 LYS D CG  1 
ATOM   10397 C CD  . LYS D 1 213 ? -11.293 25.207  -52.528 1.00 15.39 ? 212 LYS D CD  1 
ATOM   10398 C CE  . LYS D 1 213 ? -11.700 24.108  -53.504 1.00 17.18 ? 212 LYS D CE  1 
ATOM   10399 N NZ  . LYS D 1 213 ? -11.434 24.447  -54.920 1.00 18.09 ? 212 LYS D NZ  1 
ATOM   10400 N N   . TYR D 1 214 ? -12.035 29.780  -49.973 1.00 13.39 ? 213 TYR D N   1 
ATOM   10401 C CA  . TYR D 1 214 ? -11.889 30.946  -49.071 1.00 14.24 ? 213 TYR D CA  1 
ATOM   10402 C C   . TYR D 1 214 ? -13.205 31.475  -48.487 1.00 14.14 ? 213 TYR D C   1 
ATOM   10403 O O   . TYR D 1 214 ? -13.259 31.872  -47.310 1.00 14.79 ? 213 TYR D O   1 
ATOM   10404 C CB  . TYR D 1 214 ? -11.191 32.116  -49.795 1.00 14.52 ? 213 TYR D CB  1 
ATOM   10405 C CG  . TYR D 1 214 ? -9.679  31.985  -49.910 1.00 15.18 ? 213 TYR D CG  1 
ATOM   10406 C CD1 . TYR D 1 214 ? -9.068  31.833  -51.160 1.00 15.57 ? 213 TYR D CD1 1 
ATOM   10407 C CD2 . TYR D 1 214 ? -8.859  32.037  -48.778 1.00 14.36 ? 213 TYR D CD2 1 
ATOM   10408 C CE1 . TYR D 1 214 ? -7.680  31.717  -51.288 1.00 14.17 ? 213 TYR D CE1 1 
ATOM   10409 C CE2 . TYR D 1 214 ? -7.450  31.946  -48.909 1.00 15.33 ? 213 TYR D CE2 1 
ATOM   10410 C CZ  . TYR D 1 214 ? -6.885  31.782  -50.160 1.00 14.43 ? 213 TYR D CZ  1 
ATOM   10411 O OH  . TYR D 1 214 ? -5.526  31.681  -50.310 1.00 15.79 ? 213 TYR D OH  1 
ATOM   10412 N N   . MET D 1 215 ? -14.244 31.534  -49.316 1.00 14.23 ? 214 MET D N   1 
ATOM   10413 C CA  . MET D 1 215 ? -15.513 32.154  -48.890 1.00 14.56 ? 214 MET D CA  1 
ATOM   10414 C C   . MET D 1 215 ? -15.988 31.580  -47.555 1.00 13.54 ? 214 MET D C   1 
ATOM   10415 O O   . MET D 1 215 ? -16.161 32.315  -46.583 1.00 13.30 ? 214 MET D O   1 
ATOM   10416 C CB  . MET D 1 215 ? -16.589 31.978  -49.946 1.00 14.79 ? 214 MET D CB  1 
ATOM   10417 C CG  . MET D 1 215 ? -16.271 32.630  -51.303 1.00 16.91 ? 214 MET D CG  1 
ATOM   10418 S SD  . MET D 1 215 ? -16.135 34.418  -51.134 1.00 20.51 ? 214 MET D SD  1 
ATOM   10419 C CE  . MET D 1 215 ? -17.863 34.920  -51.453 1.00 18.50 ? 214 MET D CE  1 
ATOM   10420 N N   . ASN D 1 216 ? -16.174 30.266  -47.509 1.00 13.04 ? 215 ASN D N   1 
ATOM   10421 C CA  . ASN D 1 216 ? -16.439 29.597  -46.234 1.00 13.55 ? 215 ASN D CA  1 
ATOM   10422 C C   . ASN D 1 216 ? -15.205 29.592  -45.321 1.00 12.90 ? 215 ASN D C   1 
ATOM   10423 O O   . ASN D 1 216 ? -15.279 30.003  -44.155 1.00 11.98 ? 215 ASN D O   1 
ATOM   10424 C CB  . ASN D 1 216 ? -16.912 28.163  -46.465 1.00 13.94 ? 215 ASN D CB  1 
ATOM   10425 C CG  . ASN D 1 216 ? -17.196 27.454  -45.171 1.00 14.72 ? 215 ASN D CG  1 
ATOM   10426 O OD1 . ASN D 1 216 ? -18.087 27.866  -44.422 1.00 15.68 ? 215 ASN D OD1 1 
ATOM   10427 N ND2 . ASN D 1 216 ? -16.397 26.422  -44.859 1.00 14.48 ? 215 ASN D ND2 1 
ATOM   10428 N N   . GLY D 1 217 ? -14.092 29.074  -45.851 1.00 13.04 ? 216 GLY D N   1 
ATOM   10429 C CA  . GLY D 1 217 ? -12.768 29.255  -45.232 1.00 13.13 ? 216 GLY D CA  1 
ATOM   10430 C C   . GLY D 1 217 ? -12.443 28.333  -44.071 1.00 13.22 ? 216 GLY D C   1 
ATOM   10431 O O   . GLY D 1 217 ? -11.380 28.444  -43.445 1.00 12.08 ? 216 GLY D O   1 
ATOM   10432 N N   . HIS D 1 218 ? -13.329 27.376  -43.823 1.00 12.75 ? 217 HIS D N   1 
ATOM   10433 C CA  . HIS D 1 218 ? -13.241 26.532  -42.639 1.00 12.96 ? 217 HIS D CA  1 
ATOM   10434 C C   . HIS D 1 218 ? -13.187 25.061  -42.959 1.00 13.37 ? 217 HIS D C   1 
ATOM   10435 O O   . HIS D 1 218 ? -13.337 24.235  -42.079 1.00 14.30 ? 217 HIS D O   1 
ATOM   10436 C CB  . HIS D 1 218 ? -14.379 26.879  -41.680 1.00 12.93 ? 217 HIS D CB  1 
ATOM   10437 C CG  . HIS D 1 218 ? -14.188 28.214  -41.050 1.00 12.43 ? 217 HIS D CG  1 
ATOM   10438 N ND1 . HIS D 1 218 ? -14.425 29.386  -41.734 1.00 12.22 ? 217 HIS D ND1 1 
ATOM   10439 C CD2 . HIS D 1 218 ? -13.716 28.574  -39.829 1.00 13.73 ? 217 HIS D CD2 1 
ATOM   10440 C CE1 . HIS D 1 218 ? -14.120 30.414  -40.958 1.00 14.21 ? 217 HIS D CE1 1 
ATOM   10441 N NE2 . HIS D 1 218 ? -13.701 29.949  -39.791 1.00 14.04 ? 217 HIS D NE2 1 
ATOM   10442 N N   . SER D 1 219 ? -12.911 24.749  -44.220 1.00 14.41 ? 218 SER D N   1 
ATOM   10443 C CA  . SER D 1 219 ? -12.591 23.394  -44.620 1.00 14.75 ? 218 SER D CA  1 
ATOM   10444 C C   . SER D 1 219 ? -13.672 22.419  -44.179 1.00 15.05 ? 218 SER D C   1 
ATOM   10445 O O   . SER D 1 219 ? -13.380 21.295  -43.777 1.00 15.91 ? 218 SER D O   1 
ATOM   10446 C CB  . SER D 1 219 ? -11.213 23.008  -44.068 1.00 15.64 ? 218 SER D CB  1 
ATOM   10447 O OG  . SER D 1 219 ? -10.289 24.083  -44.271 1.00 14.03 ? 218 SER D OG  1 
ATOM   10448 N N   . ASP D 1 220 ? -14.930 22.866  -44.243 1.00 14.28 ? 219 ASP D N   1 
ATOM   10449 C CA  . ASP D 1 220 ? -16.035 22.034  -43.806 1.00 13.85 ? 219 ASP D CA  1 
ATOM   10450 C C   . ASP D 1 220 ? -17.354 22.224  -44.541 1.00 13.31 ? 219 ASP D C   1 
ATOM   10451 O O   . ASP D 1 220 ? -18.392 21.772  -44.050 1.00 12.53 ? 219 ASP D O   1 
ATOM   10452 C CB  . ASP D 1 220 ? -16.264 22.199  -42.312 1.00 13.21 ? 219 ASP D CB  1 
ATOM   10453 C CG  . ASP D 1 220 ? -16.648 23.618  -41.902 1.00 14.05 ? 219 ASP D CG  1 
ATOM   10454 O OD1 . ASP D 1 220 ? -16.874 23.766  -40.684 1.00 14.04 ? 219 ASP D OD1 1 
ATOM   10455 O OD2 . ASP D 1 220 ? -16.735 24.564  -42.735 1.00 12.33 ? 219 ASP D OD2 1 
ATOM   10456 N N   . VAL D 1 221 ? -17.306 22.892  -45.690 1.00 13.14 ? 220 VAL D N   1 
ATOM   10457 C CA  . VAL D 1 221 ? -18.455 23.079  -46.557 1.00 11.99 ? 220 VAL D CA  1 
ATOM   10458 C C   . VAL D 1 221 ? -18.006 23.013  -47.993 1.00 11.94 ? 220 VAL D C   1 
ATOM   10459 O O   . VAL D 1 221 ? -17.040 23.669  -48.364 1.00 12.44 ? 220 VAL D O   1 
ATOM   10460 C CB  . VAL D 1 221 ? -19.162 24.435  -46.308 1.00 11.51 ? 220 VAL D CB  1 
ATOM   10461 C CG1 . VAL D 1 221 ? -20.294 24.652  -47.330 1.00 11.18 ? 220 VAL D CG1 1 
ATOM   10462 C CG2 . VAL D 1 221 ? -19.713 24.478  -44.882 1.00 12.34 ? 220 VAL D CG2 1 
ATOM   10463 N N   . VAL D 1 222 ? -18.744 22.243  -48.790 1.00 11.02 ? 221 VAL D N   1 
ATOM   10464 C CA  . VAL D 1 222 ? -18.610 22.196  -50.226 1.00 11.61 ? 221 VAL D CA  1 
ATOM   10465 C C   . VAL D 1 222 ? -19.776 23.006  -50.777 1.00 11.51 ? 221 VAL D C   1 
ATOM   10466 O O   . VAL D 1 222 ? -20.921 22.732  -50.438 1.00 11.78 ? 221 VAL D O   1 
ATOM   10467 C CB  . VAL D 1 222 ? -18.640 20.727  -50.735 1.00 10.99 ? 221 VAL D CB  1 
ATOM   10468 C CG1 . VAL D 1 222 ? -18.800 20.679  -52.273 1.00 11.54 ? 221 VAL D CG1 1 
ATOM   10469 C CG2 . VAL D 1 222 ? -17.381 19.936  -50.241 1.00 10.53 ? 221 VAL D CG2 1 
ATOM   10470 N N   . MET D 1 223 ? -19.488 24.049  -51.550 1.00 12.18 ? 222 MET D N   1 
ATOM   10471 C CA  . MET D 1 223 ? -20.523 24.967  -51.998 1.00 12.96 ? 222 MET D CA  1 
ATOM   10472 C C   . MET D 1 223 ? -20.034 25.822  -53.169 1.00 12.31 ? 222 MET D C   1 
ATOM   10473 O O   . MET D 1 223 ? -18.841 26.061  -53.310 1.00 12.21 ? 222 MET D O   1 
ATOM   10474 C CB  . MET D 1 223 ? -20.953 25.890  -50.846 1.00 13.25 ? 222 MET D CB  1 
ATOM   10475 C CG  . MET D 1 223 ? -21.982 26.958  -51.217 1.00 14.03 ? 222 MET D CG  1 
ATOM   10476 S SD  . MET D 1 223 ? -22.564 27.843  -49.773 1.00 18.23 ? 222 MET D SD  1 
ATOM   10477 C CE  . MET D 1 223 ? -23.442 26.529  -48.958 1.00 5.05  ? 222 MET D CE  1 
ATOM   10478 N N   . GLY D 1 224 ? -20.972 26.252  -54.011 1.00 11.76 ? 223 GLY D N   1 
ATOM   10479 C CA  . GLY D 1 224 ? -20.698 27.245  -55.052 1.00 11.98 ? 223 GLY D CA  1 
ATOM   10480 C C   . GLY D 1 224 ? -21.611 28.450  -54.902 1.00 12.29 ? 223 GLY D C   1 
ATOM   10481 O O   . GLY D 1 224 ? -22.669 28.366  -54.245 1.00 12.76 ? 223 GLY D O   1 
ATOM   10482 N N   . LEU D 1 225 ? -21.167 29.574  -55.463 1.00 12.04 ? 224 LEU D N   1 
ATOM   10483 C CA  . LEU D 1 225 ? -21.859 30.857  -55.387 1.00 11.46 ? 224 LEU D CA  1 
ATOM   10484 C C   . LEU D 1 225 ? -21.706 31.576  -56.715 1.00 11.63 ? 224 LEU D C   1 
ATOM   10485 O O   . LEU D 1 225 ? -20.635 31.519  -57.347 1.00 12.71 ? 224 LEU D O   1 
ATOM   10486 C CB  . LEU D 1 225 ? -21.290 31.742  -54.259 1.00 10.96 ? 224 LEU D CB  1 
ATOM   10487 C CG  . LEU D 1 225 ? -21.372 31.251  -52.805 1.00 10.72 ? 224 LEU D CG  1 
ATOM   10488 C CD1 . LEU D 1 225 ? -20.403 32.073  -51.915 1.00 9.84  ? 224 LEU D CD1 1 
ATOM   10489 C CD2 . LEU D 1 225 ? -22.807 31.239  -52.229 1.00 11.45 ? 224 LEU D CD2 1 
ATOM   10490 N N   . VAL D 1 226 ? -22.776 32.246  -57.146 1.00 11.62 ? 225 VAL D N   1 
ATOM   10491 C CA  . VAL D 1 226 ? -22.816 32.943  -58.429 1.00 11.16 ? 225 VAL D CA  1 
ATOM   10492 C C   . VAL D 1 226 ? -23.502 34.289  -58.245 1.00 11.98 ? 225 VAL D C   1 
ATOM   10493 O O   . VAL D 1 226 ? -24.693 34.334  -57.960 1.00 11.89 ? 225 VAL D O   1 
ATOM   10494 C CB  . VAL D 1 226 ? -23.612 32.112  -59.489 1.00 11.08 ? 225 VAL D CB  1 
ATOM   10495 C CG1 . VAL D 1 226 ? -23.792 32.884  -60.798 1.00 11.45 ? 225 VAL D CG1 1 
ATOM   10496 C CG2 . VAL D 1 226 ? -22.927 30.762  -59.729 1.00 7.05  ? 225 VAL D CG2 1 
ATOM   10497 N N   . SER D 1 227 ? -22.733 35.370  -58.357 1.00 12.10 ? 226 SER D N   1 
ATOM   10498 C CA  . SER D 1 227 ? -23.259 36.727  -58.241 1.00 12.47 ? 226 SER D CA  1 
ATOM   10499 C C   . SER D 1 227 ? -23.395 37.383  -59.597 1.00 12.51 ? 226 SER D C   1 
ATOM   10500 O O   . SER D 1 227 ? -22.545 37.179  -60.499 1.00 11.84 ? 226 SER D O   1 
ATOM   10501 C CB  . SER D 1 227 ? -22.357 37.572  -57.372 1.00 13.06 ? 226 SER D CB  1 
ATOM   10502 O OG  . SER D 1 227 ? -22.417 37.128  -56.043 1.00 12.56 ? 226 SER D OG  1 
ATOM   10503 N N   . VAL D 1 228 ? -24.456 38.174  -59.732 1.00 12.50 ? 227 VAL D N   1 
ATOM   10504 C CA  . VAL D 1 228 ? -24.908 38.674  -61.022 1.00 12.93 ? 227 VAL D CA  1 
ATOM   10505 C C   . VAL D 1 228 ? -25.702 39.978  -60.836 1.00 14.50 ? 227 VAL D C   1 
ATOM   10506 O O   . VAL D 1 228 ? -26.345 40.195  -59.805 1.00 13.59 ? 227 VAL D O   1 
ATOM   10507 C CB  . VAL D 1 228 ? -25.719 37.557  -61.792 1.00 13.78 ? 227 VAL D CB  1 
ATOM   10508 C CG1 . VAL D 1 228 ? -27.052 37.227  -61.084 1.00 12.67 ? 227 VAL D CG1 1 
ATOM   10509 C CG2 . VAL D 1 228 ? -25.958 37.920  -63.255 1.00 11.56 ? 227 VAL D CG2 1 
ATOM   10510 N N   . ASN D 1 229 ? -25.612 40.863  -61.832 1.00 16.14 ? 228 ASN D N   1 
ATOM   10511 C CA  . ASN D 1 229 ? -26.366 42.112  -61.854 1.00 16.77 ? 228 ASN D CA  1 
ATOM   10512 C C   . ASN D 1 229 ? -27.532 42.140  -62.834 1.00 17.97 ? 228 ASN D C   1 
ATOM   10513 O O   . ASN D 1 229 ? -28.593 42.637  -62.496 1.00 17.96 ? 228 ASN D O   1 
ATOM   10514 C CB  . ASN D 1 229 ? -25.419 43.259  -62.191 1.00 17.43 ? 228 ASN D CB  1 
ATOM   10515 C CG  . ASN D 1 229 ? -24.559 43.648  -61.018 1.00 16.86 ? 228 ASN D CG  1 
ATOM   10516 O OD1 . ASN D 1 229 ? -25.007 43.612  -59.872 1.00 17.75 ? 228 ASN D OD1 1 
ATOM   10517 N ND2 . ASN D 1 229 ? -23.327 44.019  -61.291 1.00 17.70 ? 228 ASN D ND2 1 
ATOM   10518 N N   . CYS D 1 230 ? -27.288 41.641  -64.045 1.00 19.06 ? 229 CYS D N   1 
ATOM   10519 C CA  . CYS D 1 230 ? -28.218 41.709  -65.164 1.00 19.63 ? 229 CYS D CA  1 
ATOM   10520 C C   . CYS D 1 230 ? -29.509 40.932  -64.900 1.00 19.34 ? 229 CYS D C   1 
ATOM   10521 O O   . CYS D 1 230 ? -29.491 39.768  -64.522 1.00 18.59 ? 229 CYS D O   1 
ATOM   10522 C CB  . CYS D 1 230 ? -27.543 41.181  -66.444 1.00 19.13 ? 229 CYS D CB  1 
ATOM   10523 S SG  . CYS D 1 230 ? -28.602 41.156  -67.923 1.00 22.60 ? 229 CYS D SG  1 
ATOM   10524 N N   . GLU D 1 231 ? -30.620 41.587  -65.177 1.00 19.15 ? 230 GLU D N   1 
ATOM   10525 C CA  . GLU D 1 231 ? -31.909 41.095  -64.771 1.00 19.64 ? 230 GLU D CA  1 
ATOM   10526 C C   . GLU D 1 231 ? -32.300 39.798  -65.498 1.00 18.46 ? 230 GLU D C   1 
ATOM   10527 O O   . GLU D 1 231 ? -32.719 38.818  -64.869 1.00 18.85 ? 230 GLU D O   1 
ATOM   10528 C CB  . GLU D 1 231 ? -32.928 42.200  -65.023 1.00 20.36 ? 230 GLU D CB  1 
ATOM   10529 C CG  . GLU D 1 231 ? -34.146 42.069  -64.215 1.00 23.65 ? 230 GLU D CG  1 
ATOM   10530 C CD  . GLU D 1 231 ? -33.901 42.236  -62.749 1.00 24.18 ? 230 GLU D CD  1 
ATOM   10531 O OE1 . GLU D 1 231 ? -34.597 41.545  -62.000 1.00 31.02 ? 230 GLU D OE1 1 
ATOM   10532 O OE2 . GLU D 1 231 ? -33.062 43.057  -62.336 1.00 26.05 ? 230 GLU D OE2 1 
ATOM   10533 N N   . SER D 1 232 ? -32.145 39.757  -66.815 1.00 17.10 ? 231 SER D N   1 
ATOM   10534 C CA  . SER D 1 232 ? -32.560 38.566  -67.529 1.00 17.39 ? 231 SER D CA  1 
ATOM   10535 C C   . SER D 1 232 ? -31.623 37.403  -67.248 1.00 16.37 ? 231 SER D C   1 
ATOM   10536 O O   . SER D 1 232 ? -32.061 36.262  -67.165 1.00 16.20 ? 231 SER D O   1 
ATOM   10537 C CB  . SER D 1 232 ? -32.676 38.799  -69.032 1.00 17.14 ? 231 SER D CB  1 
ATOM   10538 O OG  . SER D 1 232 ? -31.484 39.342  -69.501 1.00 20.91 ? 231 SER D OG  1 
ATOM   10539 N N   . LEU D 1 233 ? -30.340 37.690  -67.102 1.00 15.82 ? 232 LEU D N   1 
ATOM   10540 C CA  . LEU D 1 233 ? -29.370 36.663  -66.795 1.00 15.58 ? 232 LEU D CA  1 
ATOM   10541 C C   . LEU D 1 233 ? -29.657 36.058  -65.421 1.00 14.93 ? 232 LEU D C   1 
ATOM   10542 O O   . LEU D 1 233 ? -29.594 34.845  -65.257 1.00 14.78 ? 232 LEU D O   1 
ATOM   10543 C CB  . LEU D 1 233 ? -27.956 37.243  -66.843 1.00 15.91 ? 232 LEU D CB  1 
ATOM   10544 C CG  . LEU D 1 233 ? -26.771 36.276  -66.751 1.00 16.40 ? 232 LEU D CG  1 
ATOM   10545 C CD1 . LEU D 1 233 ? -26.839 35.179  -67.797 1.00 17.57 ? 232 LEU D CD1 1 
ATOM   10546 C CD2 . LEU D 1 233 ? -25.461 37.070  -66.860 1.00 16.68 ? 232 LEU D CD2 1 
ATOM   10547 N N   . HIS D 1 234 ? -29.942 36.905  -64.437 1.00 14.65 ? 233 HIS D N   1 
ATOM   10548 C CA  . HIS D 1 234 ? -30.413 36.434  -63.136 1.00 14.88 ? 233 HIS D CA  1 
ATOM   10549 C C   . HIS D 1 234 ? -31.646 35.570  -63.279 1.00 14.61 ? 233 HIS D C   1 
ATOM   10550 O O   . HIS D 1 234 ? -31.678 34.480  -62.730 1.00 14.50 ? 233 HIS D O   1 
ATOM   10551 C CB  . HIS D 1 234 ? -30.720 37.591  -62.198 1.00 15.10 ? 233 HIS D CB  1 
ATOM   10552 C CG  . HIS D 1 234 ? -31.338 37.164  -60.909 1.00 16.94 ? 233 HIS D CG  1 
ATOM   10553 N ND1 . HIS D 1 234 ? -32.558 37.635  -60.484 1.00 14.90 ? 233 HIS D ND1 1 
ATOM   10554 C CD2 . HIS D 1 234 ? -30.919 36.289  -59.959 1.00 17.35 ? 233 HIS D CD2 1 
ATOM   10555 C CE1 . HIS D 1 234 ? -32.866 37.071  -59.327 1.00 16.61 ? 233 HIS D CE1 1 
ATOM   10556 N NE2 . HIS D 1 234 ? -31.886 36.254  -58.986 1.00 15.78 ? 233 HIS D NE2 1 
ATOM   10557 N N   . ASN D 1 235 ? -32.637 36.017  -64.065 1.00 14.87 ? 234 ASN D N   1 
ATOM   10558 C CA  . ASN D 1 235 ? -33.861 35.246  -64.208 1.00 14.26 ? 234 ASN D CA  1 
ATOM   10559 C C   . ASN D 1 235 ? -33.587 33.874  -64.779 1.00 14.09 ? 234 ASN D C   1 
ATOM   10560 O O   . ASN D 1 235 ? -34.128 32.874  -64.308 1.00 13.71 ? 234 ASN D O   1 
ATOM   10561 C CB  . ASN D 1 235 ? -34.926 36.012  -64.997 1.00 14.85 ? 234 ASN D CB  1 
ATOM   10562 C CG  . ASN D 1 235 ? -35.446 37.232  -64.247 1.00 15.04 ? 234 ASN D CG  1 
ATOM   10563 O OD1 . ASN D 1 235 ? -35.316 37.314  -63.041 1.00 16.85 ? 234 ASN D OD1 1 
ATOM   10564 N ND2 . ASN D 1 235 ? -36.023 38.195  -64.977 1.00 17.37 ? 234 ASN D ND2 1 
ATOM   10565 N N   . ARG D 1 236 ? -32.706 33.817  -65.763 1.00 13.81 ? 235 ARG D N   1 
ATOM   10566 C CA  . ARG D 1 236 ? -32.275 32.555  -66.357 1.00 13.36 ? 235 ARG D CA  1 
ATOM   10567 C C   . ARG D 1 236 ? -31.530 31.643  -65.377 1.00 13.35 ? 235 ARG D C   1 
ATOM   10568 O O   . ARG D 1 236 ? -31.769 30.435  -65.329 1.00 12.17 ? 235 ARG D O   1 
ATOM   10569 C CB  . ARG D 1 236 ? -31.389 32.846  -67.575 1.00 13.66 ? 235 ARG D CB  1 
ATOM   10570 C CG  . ARG D 1 236 ? -32.145 33.510  -68.716 1.00 13.50 ? 235 ARG D CG  1 
ATOM   10571 C CD  . ARG D 1 236 ? -31.200 34.128  -69.734 1.00 13.93 ? 235 ARG D CD  1 
ATOM   10572 N NE  . ARG D 1 236 ? -30.346 33.118  -70.337 1.00 13.54 ? 235 ARG D NE  1 
ATOM   10573 C CZ  . ARG D 1 236 ? -29.358 33.367  -71.190 1.00 15.11 ? 235 ARG D CZ  1 
ATOM   10574 N NH1 . ARG D 1 236 ? -29.064 34.612  -71.560 1.00 15.06 ? 235 ARG D NH1 1 
ATOM   10575 N NH2 . ARG D 1 236 ? -28.666 32.361  -71.687 1.00 16.43 ? 235 ARG D NH2 1 
ATOM   10576 N N   . LEU D 1 237 ? -30.613 32.225  -64.610 1.00 13.00 ? 236 LEU D N   1 
ATOM   10577 C CA  . LEU D 1 237 ? -29.896 31.477  -63.574 1.00 13.23 ? 236 LEU D CA  1 
ATOM   10578 C C   . LEU D 1 237 ? -30.825 30.969  -62.453 1.00 12.32 ? 236 LEU D C   1 
ATOM   10579 O O   . LEU D 1 237 ? -30.687 29.848  -61.990 1.00 11.61 ? 236 LEU D O   1 
ATOM   10580 C CB  . LEU D 1 237 ? -28.793 32.358  -62.969 1.00 13.42 ? 236 LEU D CB  1 
ATOM   10581 C CG  . LEU D 1 237 ? -27.527 32.556  -63.801 1.00 13.65 ? 236 LEU D CG  1 
ATOM   10582 C CD1 . LEU D 1 237 ? -26.767 33.822  -63.361 1.00 14.28 ? 236 LEU D CD1 1 
ATOM   10583 C CD2 . LEU D 1 237 ? -26.655 31.268  -63.694 1.00 14.83 ? 236 LEU D CD2 1 
ATOM   10584 N N   . ARG D 1 238 ? -31.758 31.804  -62.020 1.00 12.26 ? 237 ARG D N   1 
ATOM   10585 C CA  . ARG D 1 238 ? -32.657 31.438  -60.930 1.00 12.44 ? 237 ARG D CA  1 
ATOM   10586 C C   . ARG D 1 238 ? -33.537 30.259  -61.335 1.00 12.35 ? 237 ARG D C   1 
ATOM   10587 O O   . ARG D 1 238 ? -33.783 29.344  -60.539 1.00 12.57 ? 237 ARG D O   1 
ATOM   10588 C CB  . ARG D 1 238 ? -33.500 32.648  -60.505 1.00 12.35 ? 237 ARG D CB  1 
ATOM   10589 C CG  . ARG D 1 238 ? -34.237 32.457  -59.168 1.00 13.10 ? 237 ARG D CG  1 
ATOM   10590 C CD  . ARG D 1 238 ? -33.278 32.247  -57.994 1.00 11.61 ? 237 ARG D CD  1 
ATOM   10591 N NE  . ARG D 1 238 ? -32.501 33.449  -57.718 1.00 12.36 ? 237 ARG D NE  1 
ATOM   10592 C CZ  . ARG D 1 238 ? -31.683 33.601  -56.682 1.00 9.22  ? 237 ARG D CZ  1 
ATOM   10593 N NH1 . ARG D 1 238 ? -31.474 32.600  -55.828 1.00 12.72 ? 237 ARG D NH1 1 
ATOM   10594 N NH2 . ARG D 1 238 ? -31.049 34.748  -56.516 1.00 10.45 ? 237 ARG D NH2 1 
ATOM   10595 N N   . PHE D 1 239 ? -33.985 30.280  -62.587 1.00 11.93 ? 238 PHE D N   1 
ATOM   10596 C CA  . PHE D 1 239 ? -34.788 29.198  -63.155 1.00 11.94 ? 238 PHE D CA  1 
ATOM   10597 C C   . PHE D 1 239 ? -34.058 27.849  -63.094 1.00 10.79 ? 238 PHE D C   1 
ATOM   10598 O O   . PHE D 1 239 ? -34.635 26.832  -62.772 1.00 9.64  ? 238 PHE D O   1 
ATOM   10599 C CB  . PHE D 1 239 ? -35.137 29.523  -64.601 1.00 11.77 ? 238 PHE D CB  1 
ATOM   10600 C CG  . PHE D 1 239 ? -35.936 28.444  -65.288 1.00 12.02 ? 238 PHE D CG  1 
ATOM   10601 C CD1 . PHE D 1 239 ? -37.314 28.372  -65.124 1.00 12.15 ? 238 PHE D CD1 1 
ATOM   10602 C CD2 . PHE D 1 239 ? -35.313 27.485  -66.057 1.00 9.88  ? 238 PHE D CD2 1 
ATOM   10603 C CE1 . PHE D 1 239 ? -38.043 27.368  -65.722 1.00 11.31 ? 238 PHE D CE1 1 
ATOM   10604 C CE2 . PHE D 1 239 ? -36.047 26.495  -66.671 1.00 11.84 ? 238 PHE D CE2 1 
ATOM   10605 C CZ  . PHE D 1 239 ? -37.414 26.445  -66.498 1.00 10.24 ? 238 PHE D CZ  1 
ATOM   10606 N N   . LEU D 1 240 ? -32.773 27.880  -63.414 1.00 10.96 ? 239 LEU D N   1 
ATOM   10607 C CA  . LEU D 1 240 ? -31.927 26.697  -63.384 1.00 10.30 ? 239 LEU D CA  1 
ATOM   10608 C C   . LEU D 1 240 ? -31.499 26.281  -61.983 1.00 10.58 ? 239 LEU D C   1 
ATOM   10609 O O   . LEU D 1 240 ? -31.248 25.105  -61.757 1.00 11.24 ? 239 LEU D O   1 
ATOM   10610 C CB  . LEU D 1 240 ? -30.687 26.939  -64.257 1.00 10.34 ? 239 LEU D CB  1 
ATOM   10611 C CG  . LEU D 1 240 ? -30.975 27.078  -65.738 1.00 9.15  ? 239 LEU D CG  1 
ATOM   10612 C CD1 . LEU D 1 240 ? -29.787 27.668  -66.522 1.00 6.99  ? 239 LEU D CD1 1 
ATOM   10613 C CD2 . LEU D 1 240 ? -31.387 25.734  -66.318 1.00 10.37 ? 239 LEU D CD2 1 
ATOM   10614 N N   . GLN D 1 241 ? -31.350 27.231  -61.053 1.00 10.33 ? 240 GLN D N   1 
ATOM   10615 C CA  . GLN D 1 241 ? -31.126 26.857  -59.662 1.00 10.26 ? 240 GLN D CA  1 
ATOM   10616 C C   . GLN D 1 241 ? -32.259 25.934  -59.214 1.00 10.14 ? 240 GLN D C   1 
ATOM   10617 O O   . GLN D 1 241 ? -32.028 24.861  -58.673 1.00 9.75  ? 240 GLN D O   1 
ATOM   10618 C CB  . GLN D 1 241 ? -31.059 28.070  -58.752 1.00 10.36 ? 240 GLN D CB  1 
ATOM   10619 C CG  . GLN D 1 241 ? -30.653 27.742  -57.318 1.00 10.81 ? 240 GLN D CG  1 
ATOM   10620 C CD  . GLN D 1 241 ? -30.840 28.905  -56.384 1.00 10.45 ? 240 GLN D CD  1 
ATOM   10621 O OE1 . GLN D 1 241 ? -31.837 29.627  -56.481 1.00 8.99  ? 240 GLN D OE1 1 
ATOM   10622 N NE2 . GLN D 1 241 ? -29.895 29.088  -55.453 1.00 8.80  ? 240 GLN D NE2 1 
ATOM   10623 N N   . ASN D 1 242 ? -33.484 26.334  -59.503 1.00 10.48 ? 241 ASN D N   1 
ATOM   10624 C CA  . ASN D 1 242 ? -34.631 25.563  -59.091 1.00 10.65 ? 241 ASN D CA  1 
ATOM   10625 C C   . ASN D 1 242 ? -34.799 24.285  -59.910 1.00 10.93 ? 241 ASN D C   1 
ATOM   10626 O O   . ASN D 1 242 ? -35.051 23.207  -59.363 1.00 11.35 ? 241 ASN D O   1 
ATOM   10627 C CB  . ASN D 1 242 ? -35.863 26.440  -59.236 1.00 10.58 ? 241 ASN D CB  1 
ATOM   10628 C CG  . ASN D 1 242 ? -37.103 25.790  -58.674 1.00 11.32 ? 241 ASN D CG  1 
ATOM   10629 O OD1 . ASN D 1 242 ? -37.092 25.194  -57.588 1.00 11.56 ? 241 ASN D OD1 1 
ATOM   10630 N ND2 . ASN D 1 242 ? -38.173 25.860  -59.445 1.00 11.03 ? 241 ASN D ND2 1 
ATOM   10631 N N   . SER D 1 243 ? -34.650 24.420  -61.227 1.00 11.32 ? 242 SER D N   1 
ATOM   10632 C CA  . SER D 1 243 ? -34.999 23.350  -62.171 1.00 11.93 ? 242 SER D CA  1 
ATOM   10633 C C   . SER D 1 243 ? -33.960 22.243  -62.291 1.00 11.06 ? 242 SER D C   1 
ATOM   10634 O O   . SER D 1 243 ? -34.310 21.114  -62.614 1.00 11.42 ? 242 SER D O   1 
ATOM   10635 C CB  . SER D 1 243 ? -35.215 23.942  -63.560 1.00 12.04 ? 242 SER D CB  1 
ATOM   10636 O OG  . SER D 1 243 ? -36.312 24.813  -63.464 1.00 15.81 ? 242 SER D OG  1 
ATOM   10637 N N   . LEU D 1 244 ? -32.686 22.575  -62.108 1.00 10.85 ? 243 LEU D N   1 
ATOM   10638 C CA  . LEU D 1 244 ? -31.644 21.544  -62.027 1.00 10.14 ? 243 LEU D CA  1 
ATOM   10639 C C   . LEU D 1 244 ? -31.416 21.102  -60.603 1.00 9.09  ? 243 LEU D C   1 
ATOM   10640 O O   . LEU D 1 244 ? -30.901 20.017  -60.376 1.00 9.16  ? 243 LEU D O   1 
ATOM   10641 C CB  . LEU D 1 244 ? -30.311 22.024  -62.609 1.00 9.93  ? 243 LEU D CB  1 
ATOM   10642 C CG  . LEU D 1 244 ? -30.283 22.606  -64.020 1.00 10.66 ? 243 LEU D CG  1 
ATOM   10643 C CD1 . LEU D 1 244 ? -28.859 23.080  -64.325 1.00 10.37 ? 243 LEU D CD1 1 
ATOM   10644 C CD2 . LEU D 1 244 ? -30.786 21.623  -65.065 1.00 9.58  ? 243 LEU D CD2 1 
ATOM   10645 N N   . GLY D 1 245 ? -31.738 21.952  -59.631 1.00 9.62  ? 244 GLY D N   1 
ATOM   10646 C CA  . GLY D 1 245 ? -31.722 21.527  -58.222 1.00 9.46  ? 244 GLY D CA  1 
ATOM   10647 C C   . GLY D 1 245 ? -30.390 21.189  -57.548 1.00 8.84  ? 244 GLY D C   1 
ATOM   10648 O O   . GLY D 1 245 ? -30.351 20.407  -56.585 1.00 8.28  ? 244 GLY D O   1 
ATOM   10649 N N   . ALA D 1 246 ? -29.303 21.779  -58.031 1.00 8.84  ? 245 ALA D N   1 
ATOM   10650 C CA  . ALA D 1 246 ? -27.983 21.531  -57.476 1.00 9.84  ? 245 ALA D CA  1 
ATOM   10651 C C   . ALA D 1 246 ? -27.747 22.500  -56.332 1.00 10.10 ? 245 ALA D C   1 
ATOM   10652 O O   . ALA D 1 246 ? -26.822 23.326  -56.349 1.00 10.36 ? 245 ALA D O   1 
ATOM   10653 C CB  . ALA D 1 246 ? -26.881 21.634  -58.574 1.00 10.09 ? 245 ALA D CB  1 
ATOM   10654 N N   . VAL D 1 247 ? -28.606 22.376  -55.319 1.00 10.25 ? 246 VAL D N   1 
ATOM   10655 C CA  . VAL D 1 247 ? -28.730 23.363  -54.261 1.00 10.20 ? 246 VAL D CA  1 
ATOM   10656 C C   . VAL D 1 247 ? -28.031 22.904  -52.982 1.00 10.56 ? 246 VAL D C   1 
ATOM   10657 O O   . VAL D 1 247 ? -27.947 21.704  -52.711 1.00 11.24 ? 246 VAL D O   1 
ATOM   10658 C CB  . VAL D 1 247 ? -30.238 23.672  -53.991 1.00 10.98 ? 246 VAL D CB  1 
ATOM   10659 C CG1 . VAL D 1 247 ? -30.838 24.371  -55.235 1.00 9.65  ? 246 VAL D CG1 1 
ATOM   10660 C CG2 . VAL D 1 247 ? -31.017 22.374  -53.614 1.00 9.04  ? 246 VAL D CG2 1 
ATOM   10661 N N   . PRO D 1 248 ? -27.540 23.859  -52.175 1.00 11.06 ? 247 PRO D N   1 
ATOM   10662 C CA  . PRO D 1 248 ? -26.827 23.581  -50.938 1.00 10.92 ? 247 PRO D CA  1 
ATOM   10663 C C   . PRO D 1 248 ? -27.791 23.327  -49.765 1.00 11.29 ? 247 PRO D C   1 
ATOM   10664 O O   . PRO D 1 248 ? -28.904 23.872  -49.739 1.00 12.75 ? 247 PRO D O   1 
ATOM   10665 C CB  . PRO D 1 248 ? -26.061 24.891  -50.704 1.00 11.03 ? 247 PRO D CB  1 
ATOM   10666 C CG  . PRO D 1 248 ? -26.995 25.930  -51.180 1.00 10.98 ? 247 PRO D CG  1 
ATOM   10667 C CD  . PRO D 1 248 ? -27.683 25.307  -52.387 1.00 11.17 ? 247 PRO D CD  1 
ATOM   10668 N N   . SER D 1 249 ? -27.370 22.507  -48.818 1.00 10.89 ? 248 SER D N   1 
ATOM   10669 C CA  . SER D 1 249 ? -28.061 22.372  -47.545 1.00 11.28 ? 248 SER D CA  1 
ATOM   10670 C C   . SER D 1 249 ? -28.250 23.736  -46.858 1.00 10.50 ? 248 SER D C   1 
ATOM   10671 O O   . SER D 1 249 ? -27.331 24.548  -46.839 1.00 9.02  ? 248 SER D O   1 
ATOM   10672 C CB  . SER D 1 249 ? -27.226 21.509  -46.597 1.00 10.95 ? 248 SER D CB  1 
ATOM   10673 O OG  . SER D 1 249 ? -27.927 21.284  -45.386 1.00 14.59 ? 248 SER D OG  1 
ATOM   10674 N N   . PRO D 1 250 ? -29.405 23.961  -46.223 1.00 10.83 ? 249 PRO D N   1 
ATOM   10675 C CA  . PRO D 1 250 ? -29.478 25.163  -45.400 1.00 11.02 ? 249 PRO D CA  1 
ATOM   10676 C C   . PRO D 1 250 ? -28.443 25.222  -44.274 1.00 11.17 ? 249 PRO D C   1 
ATOM   10677 O O   . PRO D 1 250 ? -28.055 26.316  -43.842 1.00 10.58 ? 249 PRO D O   1 
ATOM   10678 C CB  . PRO D 1 250 ? -30.900 25.114  -44.824 1.00 10.79 ? 249 PRO D CB  1 
ATOM   10679 C CG  . PRO D 1 250 ? -31.655 24.217  -45.788 1.00 11.36 ? 249 PRO D CG  1 
ATOM   10680 C CD  . PRO D 1 250 ? -30.663 23.201  -46.199 1.00 11.02 ? 249 PRO D CD  1 
ATOM   10681 N N   . ILE D 1 251 ? -28.003 24.069  -43.783 1.00 10.79 ? 250 ILE D N   1 
ATOM   10682 C CA  . ILE D 1 251 ? -27.030 24.081  -42.700 1.00 11.15 ? 250 ILE D CA  1 
ATOM   10683 C C   . ILE D 1 251 ? -25.680 24.524  -43.232 1.00 10.57 ? 250 ILE D C   1 
ATOM   10684 O O   . ILE D 1 251 ? -24.985 25.246  -42.540 1.00 10.71 ? 250 ILE D O   1 
ATOM   10685 C CB  . ILE D 1 251 ? -26.836 22.728  -42.001 1.00 11.08 ? 250 ILE D CB  1 
ATOM   10686 C CG1 . ILE D 1 251 ? -28.137 22.155  -41.500 1.00 11.75 ? 250 ILE D CG1 1 
ATOM   10687 C CG2 . ILE D 1 251 ? -25.871 22.898  -40.798 1.00 13.06 ? 250 ILE D CG2 1 
ATOM   10688 C CD1 . ILE D 1 251 ? -27.984 20.707  -41.054 1.00 12.12 ? 250 ILE D CD1 1 
ATOM   10689 N N   . ASP D 1 252 ? -25.302 24.063  -44.426 1.00 9.96  ? 251 ASP D N   1 
ATOM   10690 C CA  . ASP D 1 252 ? -24.071 24.514  -45.104 1.00 10.47 ? 251 ASP D CA  1 
ATOM   10691 C C   . ASP D 1 252 ? -24.141 26.006  -45.409 1.00 9.93  ? 251 ASP D C   1 
ATOM   10692 O O   . ASP D 1 252 ? -23.138 26.701  -45.317 1.00 10.45 ? 251 ASP D O   1 
ATOM   10693 C CB  . ASP D 1 252 ? -23.823 23.746  -46.414 1.00 10.37 ? 251 ASP D CB  1 
ATOM   10694 C CG  . ASP D 1 252 ? -23.375 22.306  -46.189 1.00 13.79 ? 251 ASP D CG  1 
ATOM   10695 O OD1 . ASP D 1 252 ? -22.967 21.648  -47.167 1.00 15.65 ? 251 ASP D OD1 1 
ATOM   10696 O OD2 . ASP D 1 252 ? -23.454 21.809  -45.044 1.00 16.91 ? 251 ASP D OD2 1 
ATOM   10697 N N   . CYS D 1 253 ? -25.334 26.488  -45.750 1.00 9.89  ? 252 CYS D N   1 
ATOM   10698 C CA  . CYS D 1 253 ? -25.566 27.902  -45.989 1.00 9.99  ? 252 CYS D CA  1 
ATOM   10699 C C   . CYS D 1 253 ? -25.286 28.715  -44.722 1.00 10.76 ? 252 CYS D C   1 
ATOM   10700 O O   . CYS D 1 253 ? -24.639 29.753  -44.754 1.00 10.48 ? 252 CYS D O   1 
ATOM   10701 C CB  . CYS D 1 253 ? -27.005 28.128  -46.453 1.00 10.36 ? 252 CYS D CB  1 
ATOM   10702 S SG  . CYS D 1 253 ? -27.325 27.606  -48.157 1.00 10.18 ? 252 CYS D SG  1 
ATOM   10703 N N   . TYR D 1 254 ? -25.762 28.210  -43.600 1.00 10.44 ? 253 TYR D N   1 
ATOM   10704 C CA  . TYR D 1 254 ? -25.456 28.825  -42.323 1.00 11.79 ? 253 TYR D CA  1 
ATOM   10705 C C   . TYR D 1 254 ? -23.959 28.850  -42.035 1.00 11.76 ? 253 TYR D C   1 
ATOM   10706 O O   . TYR D 1 254 ? -23.415 29.873  -41.642 1.00 11.35 ? 253 TYR D O   1 
ATOM   10707 C CB  . TYR D 1 254 ? -26.150 28.085  -41.195 1.00 12.35 ? 253 TYR D CB  1 
ATOM   10708 C CG  . TYR D 1 254 ? -25.814 28.693  -39.872 1.00 13.89 ? 253 TYR D CG  1 
ATOM   10709 C CD1 . TYR D 1 254 ? -26.496 29.814  -39.423 1.00 17.12 ? 253 TYR D CD1 1 
ATOM   10710 C CD2 . TYR D 1 254 ? -24.796 28.173  -39.076 1.00 15.80 ? 253 TYR D CD2 1 
ATOM   10711 C CE1 . TYR D 1 254 ? -26.170 30.398  -38.209 1.00 16.60 ? 253 TYR D CE1 1 
ATOM   10712 C CE2 . TYR D 1 254 ? -24.448 28.777  -37.854 1.00 13.55 ? 253 TYR D CE2 1 
ATOM   10713 C CZ  . TYR D 1 254 ? -25.138 29.871  -37.431 1.00 15.96 ? 253 TYR D CZ  1 
ATOM   10714 O OH  . TYR D 1 254 ? -24.821 30.475  -36.203 1.00 16.11 ? 253 TYR D OH  1 
ATOM   10715 N N   . LEU D 1 255 ? -23.317 27.705  -42.204 1.00 11.68 ? 254 LEU D N   1 
ATOM   10716 C CA  . LEU D 1 255 ? -21.874 27.580  -41.951 1.00 11.73 ? 254 LEU D CA  1 
ATOM   10717 C C   . LEU D 1 255 ? -21.060 28.532  -42.816 1.00 11.39 ? 254 LEU D C   1 
ATOM   10718 O O   . LEU D 1 255 ? -20.107 29.166  -42.337 1.00 11.62 ? 254 LEU D O   1 
ATOM   10719 C CB  . LEU D 1 255 ? -21.419 26.125  -42.154 1.00 12.17 ? 254 LEU D CB  1 
ATOM   10720 C CG  . LEU D 1 255 ? -21.810 25.196  -40.996 1.00 12.81 ? 254 LEU D CG  1 
ATOM   10721 C CD1 . LEU D 1 255 ? -21.576 23.743  -41.355 1.00 12.30 ? 254 LEU D CD1 1 
ATOM   10722 C CD2 . LEU D 1 255 ? -21.023 25.559  -39.721 1.00 14.46 ? 254 LEU D CD2 1 
ATOM   10723 N N   . CYS D 1 256 ? -21.428 28.628  -44.090 1.00 10.52 ? 255 CYS D N   1 
ATOM   10724 C CA  . CYS D 1 256 ? -20.757 29.520  -45.014 1.00 10.56 ? 255 CYS D CA  1 
ATOM   10725 C C   . CYS D 1 256 ? -20.996 30.971  -44.641 1.00 10.96 ? 255 CYS D C   1 
ATOM   10726 O O   . CYS D 1 256 ? -20.090 31.792  -44.687 1.00 11.67 ? 255 CYS D O   1 
ATOM   10727 C CB  . CYS D 1 256 ? -21.255 29.267  -46.438 1.00 10.17 ? 255 CYS D CB  1 
ATOM   10728 S SG  . CYS D 1 256 ? -20.336 30.182  -47.679 1.00 10.63 ? 255 CYS D SG  1 
ATOM   10729 N N   . ASN D 1 257 ? -22.223 31.285  -44.259 1.00 10.40 ? 256 ASN D N   1 
ATOM   10730 C CA  . ASN D 1 257 ? -22.558 32.640  -43.878 1.00 9.86  ? 256 ASN D CA  1 
ATOM   10731 C C   . ASN D 1 257 ? -21.798 33.027  -42.604 1.00 9.64  ? 256 ASN D C   1 
ATOM   10732 O O   . ASN D 1 257 ? -21.352 34.143  -42.478 1.00 9.50  ? 256 ASN D O   1 
ATOM   10733 C CB  . ASN D 1 257 ? -24.074 32.781  -43.699 1.00 9.46  ? 256 ASN D CB  1 
ATOM   10734 C CG  . ASN D 1 257 ? -24.563 34.213  -43.907 1.00 10.42 ? 256 ASN D CG  1 
ATOM   10735 O OD1 . ASN D 1 257 ? -25.725 34.441  -44.252 1.00 12.64 ? 256 ASN D OD1 1 
ATOM   10736 N ND2 . ASN D 1 257 ? -23.675 35.176  -43.708 1.00 9.63  ? 256 ASN D ND2 1 
ATOM   10737 N N   . ARG D 1 258 ? -21.603 32.068  -41.707 1.00 9.90  ? 257 ARG D N   1 
ATOM   10738 C CA  . ARG D 1 258 ? -20.825 32.262  -40.485 1.00 10.28 ? 257 ARG D CA  1 
ATOM   10739 C C   . ARG D 1 258 ? -19.358 32.533  -40.827 1.00 10.16 ? 257 ARG D C   1 
ATOM   10740 O O   . ARG D 1 258 ? -18.725 33.418  -40.223 1.00 9.60  ? 257 ARG D O   1 
ATOM   10741 C CB  . ARG D 1 258 ? -20.929 31.020  -39.596 1.00 10.30 ? 257 ARG D CB  1 
ATOM   10742 C CG  . ARG D 1 258 ? -20.329 31.122  -38.190 1.00 10.61 ? 257 ARG D CG  1 
ATOM   10743 C CD  . ARG D 1 258 ? -20.196 29.743  -37.622 1.00 10.48 ? 257 ARG D CD  1 
ATOM   10744 N NE  . ARG D 1 258 ? -20.273 29.616  -36.175 1.00 9.15  ? 257 ARG D NE  1 
ATOM   10745 C CZ  . ARG D 1 258 ? -19.304 29.155  -35.389 1.00 10.80 ? 257 ARG D CZ  1 
ATOM   10746 N NH1 . ARG D 1 258 ? -18.076 28.867  -35.853 1.00 10.63 ? 257 ARG D NH1 1 
ATOM   10747 N NH2 . ARG D 1 258 ? -19.552 29.015  -34.108 1.00 9.40  ? 257 ARG D NH2 1 
ATOM   10748 N N   . GLY D 1 259 ? -18.814 31.741  -41.752 1.00 9.32  ? 258 GLY D N   1 
ATOM   10749 C CA  . GLY D 1 259 ? -17.431 31.915  -42.186 1.00 9.79  ? 258 GLY D CA  1 
ATOM   10750 C C   . GLY D 1 259 ? -17.216 33.273  -42.826 1.00 9.97  ? 258 GLY D C   1 
ATOM   10751 O O   . GLY D 1 259 ? -16.166 33.871  -42.668 1.00 9.24  ? 258 GLY D O   1 
ATOM   10752 N N   . LEU D 1 260 ? -18.216 33.732  -43.574 1.00 10.74 ? 259 LEU D N   1 
ATOM   10753 C CA  . LEU D 1 260 ? -18.190 35.037  -44.234 1.00 12.25 ? 259 LEU D CA  1 
ATOM   10754 C C   . LEU D 1 260 ? -17.949 36.189  -43.265 1.00 10.62 ? 259 LEU D C   1 
ATOM   10755 O O   . LEU D 1 260 ? -17.358 37.169  -43.637 1.00 10.81 ? 259 LEU D O   1 
ATOM   10756 C CB  . LEU D 1 260 ? -19.485 35.276  -45.047 1.00 12.55 ? 259 LEU D CB  1 
ATOM   10757 C CG  . LEU D 1 260 ? -19.427 35.276  -46.587 1.00 16.51 ? 259 LEU D CG  1 
ATOM   10758 C CD1 . LEU D 1 260 ? -18.378 34.379  -47.203 1.00 16.54 ? 259 LEU D CD1 1 
ATOM   10759 C CD2 . LEU D 1 260 ? -20.812 35.011  -47.160 1.00 15.35 ? 259 LEU D CD2 1 
ATOM   10760 N N   . LYS D 1 261 ? -18.357 36.046  -42.011 1.00 10.68 ? 260 LYS D N   1 
ATOM   10761 C CA  . LYS D 1 261 ? -18.284 37.153  -41.053 1.00 10.54 ? 260 LYS D CA  1 
ATOM   10762 C C   . LYS D 1 261 ? -16.844 37.459  -40.603 1.00 10.41 ? 260 LYS D C   1 
ATOM   10763 O O   . LYS D 1 261 ? -16.615 38.484  -39.948 1.00 9.97  ? 260 LYS D O   1 
ATOM   10764 C CB  . LYS D 1 261 ? -19.156 36.862  -39.832 1.00 10.41 ? 260 LYS D CB  1 
ATOM   10765 C CG  . LYS D 1 261 ? -20.582 36.402  -40.207 1.00 12.60 ? 260 LYS D CG  1 
ATOM   10766 C CD  . LYS D 1 261 ? -21.654 37.330  -39.782 1.00 12.71 ? 260 LYS D CD  1 
ATOM   10767 C CE  . LYS D 1 261 ? -23.014 36.953  -40.420 1.00 12.36 ? 260 LYS D CE  1 
ATOM   10768 N NZ  . LYS D 1 261 ? -23.934 36.269  -39.517 1.00 11.71 ? 260 LYS D NZ  1 
ATOM   10769 N N   . THR D 1 262 ? -15.920 36.533  -40.889 1.00 9.44  ? 261 THR D N   1 
ATOM   10770 C CA  . THR D 1 262 ? -14.491 36.728  -40.639 1.00 9.57  ? 261 THR D CA  1 
ATOM   10771 C C   . THR D 1 262 ? -13.705 36.813  -41.937 1.00 8.98  ? 261 THR D C   1 
ATOM   10772 O O   . THR D 1 262 ? -12.470 36.866  -41.902 1.00 10.28 ? 261 THR D O   1 
ATOM   10773 C CB  . THR D 1 262 ? -13.876 35.593  -39.756 1.00 9.03  ? 261 THR D CB  1 
ATOM   10774 O OG1 . THR D 1 262 ? -14.092 34.322  -40.360 1.00 9.15  ? 261 THR D OG1 1 
ATOM   10775 C CG2 . THR D 1 262 ? -14.491 35.605  -38.351 1.00 9.24  ? 261 THR D CG2 1 
ATOM   10776 N N   . LEU D 1 263 ? -14.387 36.901  -43.073 1.00 8.89  ? 262 LEU D N   1 
ATOM   10777 C CA  . LEU D 1 263 ? -13.687 36.871  -44.384 1.00 8.70  ? 262 LEU D CA  1 
ATOM   10778 C C   . LEU D 1 263 ? -12.605 37.968  -44.436 1.00 8.52  ? 262 LEU D C   1 
ATOM   10779 O O   . LEU D 1 263 ? -11.458 37.710  -44.782 1.00 9.38  ? 262 LEU D O   1 
ATOM   10780 C CB  . LEU D 1 263 ? -14.679 36.988  -45.558 1.00 7.73  ? 262 LEU D CB  1 
ATOM   10781 C CG  . LEU D 1 263 ? -14.058 36.940  -46.966 1.00 8.63  ? 262 LEU D CG  1 
ATOM   10782 C CD1 . LEU D 1 263 ? -13.322 35.583  -47.239 1.00 5.76  ? 262 LEU D CD1 1 
ATOM   10783 C CD2 . LEU D 1 263 ? -15.104 37.242  -48.046 1.00 9.34  ? 262 LEU D CD2 1 
ATOM   10784 N N   . HIS D 1 264 ? -12.975 39.186  -44.057 1.00 9.36  ? 263 HIS D N   1 
ATOM   10785 C CA  . HIS D 1 264 ? -12.049 40.327  -44.076 1.00 9.49  ? 263 HIS D CA  1 
ATOM   10786 C C   . HIS D 1 264 ? -10.782 40.090  -43.244 1.00 8.92  ? 263 HIS D C   1 
ATOM   10787 O O   . HIS D 1 264 ? -9.678  40.226  -43.765 1.00 8.68  ? 263 HIS D O   1 
ATOM   10788 C CB  . HIS D 1 264 ? -12.753 41.634  -43.676 1.00 9.52  ? 263 HIS D CB  1 
ATOM   10789 C CG  . HIS D 1 264 ? -13.320 41.669  -42.284 1.00 10.81 ? 263 HIS D CG  1 
ATOM   10790 N ND1 . HIS D 1 264 ? -14.244 40.750  -41.814 1.00 11.87 ? 263 HIS D ND1 1 
ATOM   10791 C CD2 . HIS D 1 264 ? -13.182 42.593  -41.301 1.00 9.97  ? 263 HIS D CD2 1 
ATOM   10792 C CE1 . HIS D 1 264 ? -14.609 41.085  -40.590 1.00 11.88 ? 263 HIS D CE1 1 
ATOM   10793 N NE2 . HIS D 1 264 ? -13.985 42.203  -40.254 1.00 11.55 ? 263 HIS D NE2 1 
ATOM   10794 N N   . VAL D 1 265 ? -10.948 39.690  -41.988 1.00 9.00  ? 264 VAL D N   1 
ATOM   10795 C CA  . VAL D 1 265 ? -9.818  39.394  -41.097 1.00 9.16  ? 264 VAL D CA  1 
ATOM   10796 C C   . VAL D 1 265 ? -8.985  38.136  -41.517 1.00 9.53  ? 264 VAL D C   1 
ATOM   10797 O O   . VAL D 1 265 ? -7.771  38.104  -41.316 1.00 9.43  ? 264 VAL D O   1 
ATOM   10798 C CB  . VAL D 1 265 ? -10.237 39.345  -39.590 1.00 9.36  ? 264 VAL D CB  1 
ATOM   10799 C CG1 . VAL D 1 265 ? -10.644 40.765  -39.132 1.00 7.87  ? 264 VAL D CG1 1 
ATOM   10800 C CG2 . VAL D 1 265 ? -11.336 38.290  -39.307 1.00 10.97 ? 264 VAL D CG2 1 
ATOM   10801 N N   . ARG D 1 266 ? -9.632  37.121  -42.084 1.00 9.18  ? 265 ARG D N   1 
ATOM   10802 C CA  . ARG D 1 266 ? -8.925  35.937  -42.585 1.00 8.56  ? 265 ARG D CA  1 
ATOM   10803 C C   . ARG D 1 266 ? -8.111  36.300  -43.817 1.00 9.17  ? 265 ARG D C   1 
ATOM   10804 O O   . ARG D 1 266 ? -6.932  35.971  -43.901 1.00 8.92  ? 265 ARG D O   1 
ATOM   10805 C CB  . ARG D 1 266 ? -9.902  34.808  -42.904 1.00 9.02  ? 265 ARG D CB  1 
ATOM   10806 C CG  . ARG D 1 266 ? -10.581 34.228  -41.670 1.00 8.87  ? 265 ARG D CG  1 
ATOM   10807 C CD  . ARG D 1 266 ? -11.446 32.978  -41.968 1.00 8.26  ? 265 ARG D CD  1 
ATOM   10808 N NE  . ARG D 1 266 ? -12.667 33.278  -42.717 1.00 10.84 ? 265 ARG D NE  1 
ATOM   10809 C CZ  . ARG D 1 266 ? -12.848 33.097  -44.030 1.00 6.93  ? 265 ARG D CZ  1 
ATOM   10810 N NH1 . ARG D 1 266 ? -11.890 32.621  -44.783 1.00 8.22  ? 265 ARG D NH1 1 
ATOM   10811 N NH2 . ARG D 1 266 ? -14.011 33.386  -44.601 1.00 9.61  ? 265 ARG D NH2 1 
ATOM   10812 N N   . MET D 1 267 ? -8.720  37.002  -44.761 1.00 9.83  ? 266 MET D N   1 
ATOM   10813 C CA  . MET D 1 267 ? -8.022  37.326  -46.006 1.00 11.26 ? 266 MET D CA  1 
ATOM   10814 C C   . MET D 1 267 ? -6.822  38.263  -45.799 1.00 12.10 ? 266 MET D C   1 
ATOM   10815 O O   . MET D 1 267 ? -5.806  38.095  -46.456 1.00 12.78 ? 266 MET D O   1 
ATOM   10816 C CB  . MET D 1 267 ? -8.973  37.920  -47.036 1.00 11.64 ? 266 MET D CB  1 
ATOM   10817 C CG  . MET D 1 267 ? -10.074 37.017  -47.470 1.00 11.48 ? 266 MET D CG  1 
ATOM   10818 S SD  . MET D 1 267 ? -9.619  35.351  -48.061 1.00 11.00 ? 266 MET D SD  1 
ATOM   10819 C CE  . MET D 1 267 ? -8.448  35.645  -49.360 1.00 10.58 ? 266 MET D CE  1 
ATOM   10820 N N   . GLU D 1 268 ? -6.920  39.232  -44.885 1.00 12.55 ? 267 GLU D N   1 
ATOM   10821 C CA  . GLU D 1 268 ? -5.762  40.063  -44.570 1.00 13.12 ? 267 GLU D CA  1 
ATOM   10822 C C   . GLU D 1 268 ? -4.587  39.235  -44.047 1.00 12.50 ? 267 GLU D C   1 
ATOM   10823 O O   . GLU D 1 268 ? -3.446  39.487  -44.432 1.00 13.05 ? 267 GLU D O   1 
ATOM   10824 C CB  . GLU D 1 268 ? -6.110  41.147  -43.550 1.00 13.56 ? 267 GLU D CB  1 
ATOM   10825 C CG  . GLU D 1 268 ? -7.008  42.240  -44.090 1.00 15.85 ? 267 GLU D CG  1 
ATOM   10826 C CD  . GLU D 1 268 ? -6.327  43.165  -45.102 1.00 19.35 ? 267 GLU D CD  1 
ATOM   10827 O OE1 . GLU D 1 268 ? -7.048  44.008  -45.663 1.00 19.11 ? 267 GLU D OE1 1 
ATOM   10828 O OE2 . GLU D 1 268 ? -5.099  43.052  -45.351 1.00 21.64 ? 267 GLU D OE2 1 
ATOM   10829 N N   . LYS D 1 269 ? -4.874  38.252  -43.199 1.00 12.85 ? 268 LYS D N   1 
ATOM   10830 C CA  . LYS D 1 269 ? -3.848  37.348  -42.672 1.00 13.05 ? 268 LYS D CA  1 
ATOM   10831 C C   . LYS D 1 269 ? -3.331  36.345  -43.719 1.00 12.99 ? 268 LYS D C   1 
ATOM   10832 O O   . LYS D 1 269 ? -2.129  36.026  -43.700 1.00 14.27 ? 268 LYS D O   1 
ATOM   10833 C CB  . LYS D 1 269 ? -4.342  36.640  -41.402 1.00 13.46 ? 268 LYS D CB  1 
ATOM   10834 C CG  . LYS D 1 269 ? -3.332  35.668  -40.741 1.00 15.19 ? 268 LYS D CG  1 
ATOM   10835 C CD  . LYS D 1 269 ? -2.026  36.338  -40.248 1.00 17.38 ? 268 LYS D CD  1 
ATOM   10836 C CE  . LYS D 1 269 ? -2.266  37.195  -38.985 1.00 20.01 ? 268 LYS D CE  1 
ATOM   10837 N NZ  . LYS D 1 269 ? -1.191  38.215  -38.664 1.00 19.66 ? 268 LYS D NZ  1 
ATOM   10838 N N   . HIS D 1 270 ? -4.197  35.863  -44.615 1.00 12.44 ? 269 HIS D N   1 
ATOM   10839 C CA  . HIS D 1 270 ? -3.734  35.063  -45.777 1.00 12.41 ? 269 HIS D CA  1 
ATOM   10840 C C   . HIS D 1 270 ? -2.732  35.873  -46.633 1.00 11.98 ? 269 HIS D C   1 
ATOM   10841 O O   . HIS D 1 270 ? -1.736  35.330  -47.119 1.00 11.93 ? 269 HIS D O   1 
ATOM   10842 C CB  . HIS D 1 270 ? -4.892  34.590  -46.667 1.00 11.96 ? 269 HIS D CB  1 
ATOM   10843 C CG  . HIS D 1 270 ? -5.697  33.472  -46.085 1.00 11.27 ? 269 HIS D CG  1 
ATOM   10844 N ND1 . HIS D 1 270 ? -5.160  32.247  -45.761 1.00 11.83 ? 269 HIS D ND1 1 
ATOM   10845 C CD2 . HIS D 1 270 ? -7.016  33.398  -45.781 1.00 10.58 ? 269 HIS D CD2 1 
ATOM   10846 C CE1 . HIS D 1 270 ? -6.113  31.478  -45.259 1.00 13.36 ? 269 HIS D CE1 1 
ATOM   10847 N NE2 . HIS D 1 270 ? -7.247  32.158  -45.252 1.00 9.13  ? 269 HIS D NE2 1 
ATOM   10848 N N   . PHE D 1 271 ? -3.007  37.166  -46.804 1.00 12.38 ? 270 PHE D N   1 
ATOM   10849 C CA  . PHE D 1 271 ? -2.122  38.085  -47.542 1.00 12.75 ? 270 PHE D CA  1 
ATOM   10850 C C   . PHE D 1 271 ? -0.766  38.262  -46.836 1.00 13.28 ? 270 PHE D C   1 
ATOM   10851 O O   . PHE D 1 271 ? 0.293   38.122  -47.471 1.00 13.62 ? 270 PHE D O   1 
ATOM   10852 C CB  . PHE D 1 271 ? -2.826  39.449  -47.725 1.00 12.75 ? 270 PHE D CB  1 
ATOM   10853 C CG  . PHE D 1 271 ? -2.134  40.415  -48.674 1.00 13.49 ? 270 PHE D CG  1 
ATOM   10854 C CD1 . PHE D 1 271 ? -1.091  40.026  -49.505 1.00 12.79 ? 270 PHE D CD1 1 
ATOM   10855 C CD2 . PHE D 1 271 ? -2.581  41.729  -48.757 1.00 13.22 ? 270 PHE D CD2 1 
ATOM   10856 C CE1 . PHE D 1 271 ? -0.478  40.923  -50.346 1.00 13.15 ? 270 PHE D CE1 1 
ATOM   10857 C CE2 . PHE D 1 271 ? -1.972  42.633  -49.613 1.00 13.07 ? 270 PHE D CE2 1 
ATOM   10858 C CZ  . PHE D 1 271 ? -0.937  42.221  -50.425 1.00 12.91 ? 270 PHE D CZ  1 
ATOM   10859 N N   . LYS D 1 272 ? -0.794  38.580  -45.545 1.00 14.24 ? 271 LYS D N   1 
ATOM   10860 C CA  . LYS D 1 272 ? 0.429   38.798  -44.789 1.00 15.00 ? 271 LYS D CA  1 
ATOM   10861 C C   . LYS D 1 272 ? 1.295   37.530  -44.856 1.00 14.04 ? 271 LYS D C   1 
ATOM   10862 O O   . LYS D 1 272 ? 2.488   37.584  -45.211 1.00 12.69 ? 271 LYS D O   1 
ATOM   10863 C CB  . LYS D 1 272 ? 0.157   39.157  -43.326 1.00 14.94 ? 271 LYS D CB  1 
ATOM   10864 C CG  . LYS D 1 272 ? -0.287  40.571  -43.019 1.00 17.73 ? 271 LYS D CG  1 
ATOM   10865 C CD  . LYS D 1 272 ? -0.893  40.752  -41.548 1.00 19.65 ? 271 LYS D CD  1 
ATOM   10866 C CE  . LYS D 1 272 ? -2.248  39.937  -41.352 1.00 22.77 ? 271 LYS D CE  1 
ATOM   10867 N NZ  . LYS D 1 272 ? -3.437  40.344  -40.470 1.00 17.26 ? 271 LYS D NZ  1 
ATOM   10868 N N   . ASN D 1 273 ? 0.692   36.401  -44.492 1.00 13.44 ? 272 ASN D N   1 
ATOM   10869 C CA  . ASN D 1 273 ? 1.400   35.111  -44.484 1.00 13.24 ? 272 ASN D CA  1 
ATOM   10870 C C   . ASN D 1 273 ? 1.836   34.658  -45.904 1.00 13.12 ? 272 ASN D C   1 
ATOM   10871 O O   . ASN D 1 273 ? 2.945   34.119  -46.085 1.00 13.28 ? 272 ASN D O   1 
ATOM   10872 C CB  . ASN D 1 273 ? 0.571   33.995  -43.806 1.00 12.89 ? 272 ASN D CB  1 
ATOM   10873 C CG  . ASN D 1 273 ? 0.621   34.010  -42.265 1.00 13.40 ? 272 ASN D CG  1 
ATOM   10874 O OD1 . ASN D 1 273 ? 1.394   34.737  -41.620 1.00 13.78 ? 272 ASN D OD1 1 
ATOM   10875 N ND2 . ASN D 1 273 ? -0.212  33.158  -41.670 1.00 11.74 ? 272 ASN D ND2 1 
ATOM   10876 N N   . GLY D 1 274 ? 0.969   34.841  -46.897 1.00 13.24 ? 273 GLY D N   1 
ATOM   10877 C CA  . GLY D 1 274 ? 1.274   34.498  -48.283 1.00 12.97 ? 273 GLY D CA  1 
ATOM   10878 C C   . GLY D 1 274 ? 2.425   35.307  -48.867 1.00 13.74 ? 273 GLY D C   1 
ATOM   10879 O O   . GLY D 1 274 ? 3.315   34.759  -49.522 1.00 13.47 ? 273 GLY D O   1 
ATOM   10880 N N   . MET D 1 275 ? 2.420   36.608  -48.626 1.00 14.16 ? 274 MET D N   1 
ATOM   10881 C CA  . MET D 1 275 ? 3.545   37.454  -49.033 1.00 14.08 ? 274 MET D CA  1 
ATOM   10882 C C   . MET D 1 275 ? 4.852   36.975  -48.350 1.00 13.76 ? 274 MET D C   1 
ATOM   10883 O O   . MET D 1 275 ? 5.881   36.831  -49.000 1.00 14.27 ? 274 MET D O   1 
ATOM   10884 C CB  . MET D 1 275 ? 3.228   38.922  -48.743 1.00 14.72 ? 274 MET D CB  1 
ATOM   10885 C CG  . MET D 1 275 ? 4.220   39.930  -49.338 1.00 16.36 ? 274 MET D CG  1 
ATOM   10886 S SD  . MET D 1 275 ? 4.140   39.914  -51.129 1.00 21.04 ? 274 MET D SD  1 
ATOM   10887 C CE  . MET D 1 275 ? 5.526   40.968  -51.551 1.00 20.15 ? 274 MET D CE  1 
ATOM   10888 N N   . ALA D 1 276 ? 4.788   36.661  -47.065 1.00 13.34 ? 275 ALA D N   1 
ATOM   10889 C CA  . ALA D 1 276 ? 5.967   36.243  -46.308 1.00 13.38 ? 275 ALA D CA  1 
ATOM   10890 C C   . ALA D 1 276 ? 6.583   34.967  -46.866 1.00 13.03 ? 275 ALA D C   1 
ATOM   10891 O O   . ALA D 1 276 ? 7.802   34.870  -47.046 1.00 11.86 ? 275 ALA D O   1 
ATOM   10892 C CB  . ALA D 1 276 ? 5.619   36.069  -44.809 1.00 13.11 ? 275 ALA D CB  1 
ATOM   10893 N N   . VAL D 1 277 ? 5.710   34.007  -47.156 1.00 13.32 ? 276 VAL D N   1 
ATOM   10894 C CA  . VAL D 1 277 ? 6.087   32.713  -47.737 1.00 12.83 ? 276 VAL D CA  1 
ATOM   10895 C C   . VAL D 1 277 ? 6.654   32.861  -49.137 1.00 13.25 ? 276 VAL D C   1 
ATOM   10896 O O   . VAL D 1 277 ? 7.656   32.225  -49.480 1.00 12.68 ? 276 VAL D O   1 
ATOM   10897 C CB  . VAL D 1 277 ? 4.861   31.774  -47.751 1.00 13.27 ? 276 VAL D CB  1 
ATOM   10898 C CG1 . VAL D 1 277 ? 5.027   30.648  -48.759 1.00 12.32 ? 276 VAL D CG1 1 
ATOM   10899 C CG2 . VAL D 1 277 ? 4.600   31.254  -46.335 1.00 10.04 ? 276 VAL D CG2 1 
ATOM   10900 N N   . ALA D 1 278 ? 5.998   33.699  -49.935 1.00 13.13 ? 277 ALA D N   1 
ATOM   10901 C CA  . ALA D 1 278 ? 6.413   33.983  -51.279 1.00 12.60 ? 277 ALA D CA  1 
ATOM   10902 C C   . ALA D 1 278 ? 7.778   34.650  -51.320 1.00 13.42 ? 277 ALA D C   1 
ATOM   10903 O O   . ALA D 1 278 ? 8.614   34.252  -52.131 1.00 11.39 ? 277 ALA D O   1 
ATOM   10904 C CB  . ALA D 1 278 ? 5.383   34.821  -52.003 1.00 12.28 ? 277 ALA D CB  1 
ATOM   10905 N N   . GLN D 1 279 ? 8.003   35.641  -50.440 1.00 14.20 ? 278 GLN D N   1 
ATOM   10906 C CA  . GLN D 1 279 ? 9.315   36.282  -50.324 1.00 15.44 ? 278 GLN D CA  1 
ATOM   10907 C C   . GLN D 1 279 ? 10.382  35.290  -49.852 1.00 14.38 ? 278 GLN D C   1 
ATOM   10908 O O   . GLN D 1 279 ? 11.490  35.280  -50.370 1.00 13.47 ? 278 GLN D O   1 
ATOM   10909 C CB  . GLN D 1 279 ? 9.278   37.518  -49.408 1.00 14.83 ? 278 GLN D CB  1 
ATOM   10910 C CG  . GLN D 1 279 ? 8.516   38.627  -50.014 1.00 16.37 ? 278 GLN D CG  1 
ATOM   10911 C CD  . GLN D 1 279 ? 8.237   39.798  -49.082 1.00 19.59 ? 278 GLN D CD  1 
ATOM   10912 O OE1 . GLN D 1 279 ? 7.868   39.618  -47.920 1.00 27.45 ? 278 GLN D OE1 1 
ATOM   10913 N NE2 . GLN D 1 279 ? 8.385   41.019  -49.614 1.00 24.19 ? 278 GLN D NE2 1 
ATOM   10914 N N   . PHE D 1 280 ? 10.034  34.451  -48.888 1.00 13.91 ? 279 PHE D N   1 
ATOM   10915 C CA  . PHE D 1 280 ? 10.968  33.482  -48.352 1.00 13.51 ? 279 PHE D CA  1 
ATOM   10916 C C   . PHE D 1 280 ? 11.417  32.490  -49.433 1.00 13.96 ? 279 PHE D C   1 
ATOM   10917 O O   . PHE D 1 280 ? 12.609  32.168  -49.559 1.00 14.20 ? 279 PHE D O   1 
ATOM   10918 C CB  . PHE D 1 280 ? 10.363  32.730  -47.169 1.00 13.36 ? 279 PHE D CB  1 
ATOM   10919 C CG  . PHE D 1 280 ? 11.136  31.507  -46.794 1.00 13.89 ? 279 PHE D CG  1 
ATOM   10920 C CD1 . PHE D 1 280 ? 12.284  31.603  -46.000 1.00 14.06 ? 279 PHE D CD1 1 
ATOM   10921 C CD2 . PHE D 1 280 ? 10.773  30.259  -47.298 1.00 13.77 ? 279 PHE D CD2 1 
ATOM   10922 C CE1 . PHE D 1 280 ? 13.030  30.480  -45.695 1.00 15.26 ? 279 PHE D CE1 1 
ATOM   10923 C CE2 . PHE D 1 280 ? 11.509  29.143  -46.999 1.00 13.12 ? 279 PHE D CE2 1 
ATOM   10924 C CZ  . PHE D 1 280 ? 12.644  29.246  -46.192 1.00 15.18 ? 279 PHE D CZ  1 
ATOM   10925 N N   . LEU D 1 281 ? 10.458  31.958  -50.177 1.00 13.44 ? 280 LEU D N   1 
ATOM   10926 C CA  . LEU D 1 281 ? 10.779  30.998  -51.224 1.00 13.30 ? 280 LEU D CA  1 
ATOM   10927 C C   . LEU D 1 281 ? 11.593  31.645  -52.343 1.00 14.25 ? 280 LEU D C   1 
ATOM   10928 O O   . LEU D 1 281 ? 12.476  31.004  -52.927 1.00 13.32 ? 280 LEU D O   1 
ATOM   10929 C CB  . LEU D 1 281 ? 9.500   30.389  -51.799 1.00 13.34 ? 280 LEU D CB  1 
ATOM   10930 C CG  . LEU D 1 281 ? 8.643   29.530  -50.870 1.00 11.73 ? 280 LEU D CG  1 
ATOM   10931 C CD1 . LEU D 1 281 ? 7.240   29.355  -51.492 1.00 10.68 ? 280 LEU D CD1 1 
ATOM   10932 C CD2 . LEU D 1 281 ? 9.307   28.201  -50.572 1.00 12.16 ? 280 LEU D CD2 1 
ATOM   10933 N N   . GLU D 1 282 ? 11.299  32.911  -52.658 1.00 14.97 ? 281 GLU D N   1 
ATOM   10934 C CA  . GLU D 1 282 ? 12.008  33.549  -53.747 1.00 16.08 ? 281 GLU D CA  1 
ATOM   10935 C C   . GLU D 1 282 ? 13.467  33.728  -53.439 1.00 16.32 ? 281 GLU D C   1 
ATOM   10936 O O   . GLU D 1 282 ? 14.285  33.647  -54.338 1.00 18.20 ? 281 GLU D O   1 
ATOM   10937 C CB  . GLU D 1 282 ? 11.408  34.888  -54.158 1.00 16.45 ? 281 GLU D CB  1 
ATOM   10938 C CG  . GLU D 1 282 ? 11.824  35.230  -55.585 1.00 16.86 ? 281 GLU D CG  1 
ATOM   10939 C CD  . GLU D 1 282 ? 10.973  36.286  -56.226 1.00 18.50 ? 281 GLU D CD  1 
ATOM   10940 O OE1 . GLU D 1 282 ? 10.265  35.950  -57.210 1.00 17.91 ? 281 GLU D OE1 1 
ATOM   10941 O OE2 . GLU D 1 282 ? 11.032  37.448  -55.753 1.00 19.75 ? 281 GLU D OE2 1 
ATOM   10942 N N   . SER D 1 283 ? 13.801  33.987  -52.186 1.00 16.62 ? 282 SER D N   1 
ATOM   10943 C CA  . SER D 1 283 ? 15.200  34.169  -51.810 1.00 16.42 ? 282 SER D CA  1 
ATOM   10944 C C   . SER D 1 283 ? 15.872  32.841  -51.380 1.00 15.86 ? 282 SER D C   1 
ATOM   10945 O O   . SER D 1 283 ? 16.918  32.870  -50.758 1.00 15.53 ? 282 SER D O   1 
ATOM   10946 C CB  . SER D 1 283 ? 15.304  35.235  -50.714 1.00 16.75 ? 282 SER D CB  1 
ATOM   10947 O OG  . SER D 1 283 ? 14.759  34.763  -49.491 1.00 19.78 ? 282 SER D OG  1 
ATOM   10948 N N   . ASN D 1 284 ? 15.247  31.695  -51.688 1.00 15.01 ? 283 ASN D N   1 
ATOM   10949 C CA  . ASN D 1 284 ? 15.707  30.403  -51.211 1.00 14.70 ? 283 ASN D CA  1 
ATOM   10950 C C   . ASN D 1 284 ? 16.440  29.707  -52.350 1.00 14.46 ? 283 ASN D C   1 
ATOM   10951 O O   . ASN D 1 284 ? 15.927  29.620  -53.470 1.00 14.29 ? 283 ASN D O   1 
ATOM   10952 C CB  . ASN D 1 284 ? 14.545  29.542  -50.703 1.00 14.59 ? 283 ASN D CB  1 
ATOM   10953 C CG  . ASN D 1 284 ? 15.003  28.238  -50.112 1.00 14.13 ? 283 ASN D CG  1 
ATOM   10954 O OD1 . ASN D 1 284 ? 15.342  27.305  -50.838 1.00 16.48 ? 283 ASN D OD1 1 
ATOM   10955 N ND2 . ASN D 1 284 ? 15.016  28.154  -48.794 1.00 11.89 ? 283 ASN D ND2 1 
ATOM   10956 N N   . PRO D 1 285 ? 17.660  29.234  -52.077 1.00 14.98 ? 284 PRO D N   1 
ATOM   10957 C CA  . PRO D 1 285 ? 18.502  28.695  -53.134 1.00 15.81 ? 284 PRO D CA  1 
ATOM   10958 C C   . PRO D 1 285 ? 18.050  27.343  -53.726 1.00 15.72 ? 284 PRO D C   1 
ATOM   10959 O O   . PRO D 1 285 ? 18.580  26.915  -54.756 1.00 15.10 ? 284 PRO D O   1 
ATOM   10960 C CB  . PRO D 1 285 ? 19.852  28.548  -52.426 1.00 15.53 ? 284 PRO D CB  1 
ATOM   10961 C CG  . PRO D 1 285 ? 19.503  28.277  -51.057 1.00 15.70 ? 284 PRO D CG  1 
ATOM   10962 C CD  . PRO D 1 285 ? 18.362  29.203  -50.783 1.00 15.33 ? 284 PRO D CD  1 
ATOM   10963 N N   . TRP D 1 286 ? 17.097  26.676  -53.077 1.00 15.69 ? 285 TRP D N   1 
ATOM   10964 C CA  . TRP D 1 286 ? 16.550  25.439  -53.595 1.00 15.65 ? 285 TRP D CA  1 
ATOM   10965 C C   . TRP D 1 286 ? 15.252  25.610  -54.352 1.00 15.39 ? 285 TRP D C   1 
ATOM   10966 O O   . TRP D 1 286 ? 14.649  24.615  -54.790 1.00 16.02 ? 285 TRP D O   1 
ATOM   10967 C CB  . TRP D 1 286 ? 16.361  24.462  -52.445 1.00 17.22 ? 285 TRP D CB  1 
ATOM   10968 C CG  . TRP D 1 286 ? 17.656  24.056  -51.901 1.00 17.63 ? 285 TRP D CG  1 
ATOM   10969 C CD1 . TRP D 1 286 ? 18.657  23.427  -52.574 1.00 18.91 ? 285 TRP D CD1 1 
ATOM   10970 C CD2 . TRP D 1 286 ? 18.116  24.251  -50.576 1.00 18.15 ? 285 TRP D CD2 1 
ATOM   10971 N NE1 . TRP D 1 286 ? 19.719  23.216  -51.745 1.00 19.30 ? 285 TRP D NE1 1 
ATOM   10972 C CE2 . TRP D 1 286 ? 19.397  23.691  -50.497 1.00 18.24 ? 285 TRP D CE2 1 
ATOM   10973 C CE3 . TRP D 1 286 ? 17.564  24.834  -49.444 1.00 19.18 ? 285 TRP D CE3 1 
ATOM   10974 C CZ2 . TRP D 1 286 ? 20.149  23.724  -49.338 1.00 20.04 ? 285 TRP D CZ2 1 
ATOM   10975 C CZ3 . TRP D 1 286 ? 18.308  24.857  -48.287 1.00 19.68 ? 285 TRP D CZ3 1 
ATOM   10976 C CH2 . TRP D 1 286 ? 19.590  24.300  -48.240 1.00 19.56 ? 285 TRP D CH2 1 
ATOM   10977 N N   . VAL D 1 287 ? 14.835  26.860  -54.545 1.00 15.43 ? 286 VAL D N   1 
ATOM   10978 C CA  . VAL D 1 287 ? 13.611  27.169  -55.265 1.00 14.58 ? 286 VAL D CA  1 
ATOM   10979 C C   . VAL D 1 287 ? 13.942  27.763  -56.650 1.00 14.98 ? 286 VAL D C   1 
ATOM   10980 O O   . VAL D 1 287 ? 14.610  28.776  -56.740 1.00 14.99 ? 286 VAL D O   1 
ATOM   10981 C CB  . VAL D 1 287 ? 12.736  28.130  -54.445 1.00 14.51 ? 286 VAL D CB  1 
ATOM   10982 C CG1 . VAL D 1 287 ? 11.578  28.675  -55.314 1.00 11.64 ? 286 VAL D CG1 1 
ATOM   10983 C CG2 . VAL D 1 287 ? 12.258  27.451  -53.181 1.00 13.30 ? 286 VAL D CG2 1 
ATOM   10984 N N   . GLU D 1 288 ? 13.473  27.119  -57.721 1.00 15.28 ? 287 GLU D N   1 
ATOM   10985 C CA  . GLU D 1 288 ? 13.745  27.574  -59.066 1.00 16.05 ? 287 GLU D CA  1 
ATOM   10986 C C   . GLU D 1 288 ? 13.028  28.893  -59.370 1.00 15.73 ? 287 GLU D C   1 
ATOM   10987 O O   . GLU D 1 288 ? 13.592  29.833  -59.957 1.00 14.68 ? 287 GLU D O   1 
ATOM   10988 C CB  . GLU D 1 288 ? 13.312  26.499  -60.066 1.00 16.30 ? 287 GLU D CB  1 
ATOM   10989 C CG  . GLU D 1 288 ? 13.527  26.838  -61.529 1.00 19.99 ? 287 GLU D CG  1 
ATOM   10990 C CD  . GLU D 1 288 ? 14.981  27.106  -61.880 1.00 25.11 ? 287 GLU D CD  1 
ATOM   10991 O OE1 . GLU D 1 288 ? 15.224  27.903  -62.819 1.00 31.30 ? 287 GLU D OE1 1 
ATOM   10992 O OE2 . GLU D 1 288 ? 15.882  26.542  -61.219 1.00 27.97 ? 287 GLU D OE2 1 
ATOM   10993 N N   . LYS D 1 289 ? 11.762  28.963  -58.994 1.00 15.61 ? 288 LYS D N   1 
ATOM   10994 C CA  . LYS D 1 289 ? 10.939  30.080  -59.383 1.00 15.91 ? 288 LYS D CA  1 
ATOM   10995 C C   . LYS D 1 289 ? 9.683   30.137  -58.513 1.00 15.78 ? 288 LYS D C   1 
ATOM   10996 O O   . LYS D 1 289 ? 9.127   29.094  -58.163 1.00 15.18 ? 288 LYS D O   1 
ATOM   10997 C CB  . LYS D 1 289 ? 10.547  29.917  -60.855 1.00 17.09 ? 288 LYS D CB  1 
ATOM   10998 C CG  . LYS D 1 289 ? 9.875   31.117  -61.493 1.00 17.82 ? 288 LYS D CG  1 
ATOM   10999 C CD  . LYS D 1 289 ? 9.183   30.743  -62.795 1.00 19.11 ? 288 LYS D CD  1 
ATOM   11000 C CE  . LYS D 1 289 ? 9.274   31.888  -63.811 1.00 23.52 ? 288 LYS D CE  1 
ATOM   11001 N NZ  . LYS D 1 289 ? 8.145   31.860  -64.788 1.00 26.33 ? 288 LYS D NZ  1 
ATOM   11002 N N   . VAL D 1 290 ? 9.241   31.357  -58.215 1.00 15.22 ? 289 VAL D N   1 
ATOM   11003 C CA  . VAL D 1 290 ? 8.030   31.619  -57.442 1.00 15.94 ? 289 VAL D CA  1 
ATOM   11004 C C   . VAL D 1 290 ? 7.028   32.400  -58.285 1.00 15.40 ? 289 VAL D C   1 
ATOM   11005 O O   . VAL D 1 290 ? 7.399   33.317  -59.027 1.00 15.33 ? 289 VAL D O   1 
ATOM   11006 C CB  . VAL D 1 290 ? 8.347   32.390  -56.124 1.00 15.86 ? 289 VAL D CB  1 
ATOM   11007 C CG1 . VAL D 1 290 ? 7.076   32.576  -55.258 1.00 16.01 ? 289 VAL D CG1 1 
ATOM   11008 C CG2 . VAL D 1 290 ? 9.412   31.665  -55.355 1.00 15.99 ? 289 VAL D CG2 1 
ATOM   11009 N N   . ILE D 1 291 ? 5.755   31.993  -58.214 1.00 15.26 ? 290 ILE D N   1 
ATOM   11010 C CA  . ILE D 1 291 ? 4.688   32.692  -58.887 1.00 14.51 ? 290 ILE D CA  1 
ATOM   11011 C C   . ILE D 1 291 ? 3.736   33.161  -57.787 1.00 14.13 ? 290 ILE D C   1 
ATOM   11012 O O   . ILE D 1 291 ? 2.977   32.368  -57.216 1.00 14.19 ? 290 ILE D O   1 
ATOM   11013 C CB  . ILE D 1 291 ? 3.941   31.798  -59.898 1.00 15.57 ? 290 ILE D CB  1 
ATOM   11014 C CG1 . ILE D 1 291 ? 4.905   31.133  -60.883 1.00 15.82 ? 290 ILE D CG1 1 
ATOM   11015 C CG2 . ILE D 1 291 ? 2.900   32.602  -60.708 1.00 14.11 ? 290 ILE D CG2 1 
ATOM   11016 C CD1 . ILE D 1 291 ? 4.206   29.992  -61.676 1.00 15.09 ? 290 ILE D CD1 1 
ATOM   11017 N N   . TYR D 1 292 ? 3.826   34.441  -57.464 1.00 13.53 ? 291 TYR D N   1 
ATOM   11018 C CA  . TYR D 1 292 ? 2.918   35.080  -56.514 1.00 13.70 ? 291 TYR D CA  1 
ATOM   11019 C C   . TYR D 1 292 ? 2.549   36.470  -57.002 1.00 13.73 ? 291 TYR D C   1 
ATOM   11020 O O   . TYR D 1 292 ? 3.430   37.311  -57.165 1.00 14.26 ? 291 TYR D O   1 
ATOM   11021 C CB  . TYR D 1 292 ? 3.535   35.143  -55.125 1.00 13.17 ? 291 TYR D CB  1 
ATOM   11022 C CG  . TYR D 1 292 ? 2.563   35.624  -54.063 1.00 12.80 ? 291 TYR D CG  1 
ATOM   11023 C CD1 . TYR D 1 292 ? 1.414   34.880  -53.735 1.00 12.02 ? 291 TYR D CD1 1 
ATOM   11024 C CD2 . TYR D 1 292 ? 2.785   36.813  -53.388 1.00 11.93 ? 291 TYR D CD2 1 
ATOM   11025 C CE1 . TYR D 1 292 ? 0.530   35.342  -52.769 1.00 12.19 ? 291 TYR D CE1 1 
ATOM   11026 C CE2 . TYR D 1 292 ? 1.924   37.272  -52.414 1.00 12.62 ? 291 TYR D CE2 1 
ATOM   11027 C CZ  . TYR D 1 292 ? 0.797   36.549  -52.097 1.00 11.95 ? 291 TYR D CZ  1 
ATOM   11028 O OH  . TYR D 1 292 ? -0.034  37.033  -51.099 1.00 10.01 ? 291 TYR D OH  1 
ATOM   11029 N N   . PRO D 1 293 ? 1.243   36.714  -57.257 1.00 14.05 ? 292 PRO D N   1 
ATOM   11030 C CA  . PRO D 1 293 ? 0.786   38.031  -57.752 1.00 13.96 ? 292 PRO D CA  1 
ATOM   11031 C C   . PRO D 1 293 ? 1.300   39.251  -56.982 1.00 13.98 ? 292 PRO D C   1 
ATOM   11032 O O   . PRO D 1 293 ? 1.444   40.331  -57.577 1.00 14.26 ? 292 PRO D O   1 
ATOM   11033 C CB  . PRO D 1 293 ? -0.728  37.917  -57.664 1.00 13.80 ? 292 PRO D CB  1 
ATOM   11034 C CG  . PRO D 1 293 ? -0.970  36.420  -57.947 1.00 14.30 ? 292 PRO D CG  1 
ATOM   11035 C CD  . PRO D 1 293 ? 0.125   35.749  -57.189 1.00 14.10 ? 292 PRO D CD  1 
ATOM   11036 N N   . GLY D 1 294 ? 1.555   39.065  -55.693 1.00 13.73 ? 293 GLY D N   1 
ATOM   11037 C CA  . GLY D 1 294 ? 2.060   40.111  -54.802 1.00 14.28 ? 293 GLY D CA  1 
ATOM   11038 C C   . GLY D 1 294 ? 3.540   40.426  -54.927 1.00 15.14 ? 293 GLY D C   1 
ATOM   11039 O O   . GLY D 1 294 ? 3.999   41.404  -54.360 1.00 14.97 ? 293 GLY D O   1 
ATOM   11040 N N   . LEU D 1 295 ? 4.285   39.620  -55.692 1.00 16.45 ? 294 LEU D N   1 
ATOM   11041 C CA  . LEU D 1 295 ? 5.723   39.849  -55.896 1.00 16.76 ? 294 LEU D CA  1 
ATOM   11042 C C   . LEU D 1 295 ? 5.918   40.650  -57.151 1.00 17.36 ? 294 LEU D C   1 
ATOM   11043 O O   . LEU D 1 295 ? 5.286   40.364  -58.189 1.00 18.00 ? 294 LEU D O   1 
ATOM   11044 C CB  . LEU D 1 295 ? 6.505   38.532  -56.050 1.00 16.67 ? 294 LEU D CB  1 
ATOM   11045 C CG  . LEU D 1 295 ? 6.679   37.640  -54.812 1.00 16.62 ? 294 LEU D CG  1 
ATOM   11046 C CD1 . LEU D 1 295 ? 7.399   36.356  -55.197 1.00 16.47 ? 294 LEU D CD1 1 
ATOM   11047 C CD2 . LEU D 1 295 ? 7.416   38.352  -53.695 1.00 13.07 ? 294 LEU D CD2 1 
ATOM   11048 N N   . PRO D 1 296 ? 6.813   41.649  -57.091 1.00 17.86 ? 295 PRO D N   1 
ATOM   11049 C CA  . PRO D 1 296 ? 7.244   42.336  -58.307 1.00 17.84 ? 295 PRO D CA  1 
ATOM   11050 C C   . PRO D 1 296 ? 7.688   41.376  -59.412 1.00 17.14 ? 295 PRO D C   1 
ATOM   11051 O O   . PRO D 1 296 ? 7.574   41.712  -60.575 1.00 19.09 ? 295 PRO D O   1 
ATOM   11052 C CB  . PRO D 1 296 ? 8.414   43.198  -57.818 1.00 18.06 ? 295 PRO D CB  1 
ATOM   11053 C CG  . PRO D 1 296 ? 8.149   43.428  -56.430 1.00 18.32 ? 295 PRO D CG  1 
ATOM   11054 C CD  . PRO D 1 296 ? 7.461   42.219  -55.895 1.00 17.92 ? 295 PRO D CD  1 
ATOM   11055 N N   . SER D 1 297 ? 8.202   40.198  -59.069 1.00 17.21 ? 296 SER D N   1 
ATOM   11056 C CA  . SER D 1 297 ? 8.607   39.230  -60.094 1.00 17.01 ? 296 SER D CA  1 
ATOM   11057 C C   . SER D 1 297 ? 7.428   38.664  -60.893 1.00 17.02 ? 296 SER D C   1 
ATOM   11058 O O   . SER D 1 297 ? 7.621   38.108  -61.973 1.00 16.66 ? 296 SER D O   1 
ATOM   11059 C CB  . SER D 1 297 ? 9.383   38.067  -59.477 1.00 17.33 ? 296 SER D CB  1 
ATOM   11060 O OG  . SER D 1 297 ? 8.599   37.392  -58.517 1.00 17.94 ? 296 SER D OG  1 
ATOM   11061 N N   . HIS D 1 298 ? 6.208   38.764  -60.377 1.00 16.75 ? 297 HIS D N   1 
ATOM   11062 C CA  . HIS D 1 298 ? 5.077   38.230  -61.123 1.00 16.86 ? 297 HIS D CA  1 
ATOM   11063 C C   . HIS D 1 298 ? 4.888   39.024  -62.423 1.00 17.74 ? 297 HIS D C   1 
ATOM   11064 O O   . HIS D 1 298 ? 4.887   40.250  -62.388 1.00 17.47 ? 297 HIS D O   1 
ATOM   11065 C CB  . HIS D 1 298 ? 3.796   38.246  -60.292 1.00 15.62 ? 297 HIS D CB  1 
ATOM   11066 C CG  . HIS D 1 298 ? 2.708   37.407  -60.893 1.00 11.48 ? 297 HIS D CG  1 
ATOM   11067 N ND1 . HIS D 1 298 ? 2.053   37.758  -62.047 1.00 11.72 ? 297 HIS D ND1 1 
ATOM   11068 C CD2 . HIS D 1 298 ? 2.239   36.187  -60.554 1.00 8.71  ? 297 HIS D CD2 1 
ATOM   11069 C CE1 . HIS D 1 298 ? 1.194   36.804  -62.374 1.00 11.96 ? 297 HIS D CE1 1 
ATOM   11070 N NE2 . HIS D 1 298 ? 1.283   35.841  -61.474 1.00 8.38  ? 297 HIS D NE2 1 
ATOM   11071 N N   . PRO D 1 299 ? 4.757   38.332  -63.584 1.00 19.36 ? 298 PRO D N   1 
ATOM   11072 C CA  . PRO D 1 299 ? 4.692   39.061  -64.857 1.00 19.79 ? 298 PRO D CA  1 
ATOM   11073 C C   . PRO D 1 299 ? 3.511   40.024  -64.996 1.00 21.06 ? 298 PRO D C   1 
ATOM   11074 O O   . PRO D 1 299 ? 3.591   40.977  -65.784 1.00 20.42 ? 298 PRO D O   1 
ATOM   11075 C CB  . PRO D 1 299 ? 4.657   37.948  -65.916 1.00 20.72 ? 298 PRO D CB  1 
ATOM   11076 C CG  . PRO D 1 299 ? 4.315   36.728  -65.209 1.00 20.56 ? 298 PRO D CG  1 
ATOM   11077 C CD  . PRO D 1 299 ? 4.756   36.876  -63.790 1.00 19.34 ? 298 PRO D CD  1 
ATOM   11078 N N   . GLN D 1 300 ? 2.437   39.810  -64.221 1.00 21.03 ? 299 GLN D N   1 
ATOM   11079 C CA  . GLN D 1 300 ? 1.299   40.725  -64.247 1.00 20.74 ? 299 GLN D CA  1 
ATOM   11080 C C   . GLN D 1 300 ? 1.152   41.488  -62.922 1.00 20.73 ? 299 GLN D C   1 
ATOM   11081 O O   . GLN D 1 300 ? 0.088   41.997  -62.615 1.00 20.34 ? 299 GLN D O   1 
ATOM   11082 C CB  . GLN D 1 300 ? 0.009   39.970  -64.590 1.00 21.28 ? 299 GLN D CB  1 
ATOM   11083 C CG  . GLN D 1 300 ? -0.060  39.390  -66.015 1.00 21.88 ? 299 GLN D CG  1 
ATOM   11084 C CD  . GLN D 1 300 ? 0.454   37.952  -66.143 1.00 23.62 ? 299 GLN D CD  1 
ATOM   11085 O OE1 . GLN D 1 300 ? 0.173   37.079  -65.312 1.00 23.91 ? 299 GLN D OE1 1 
ATOM   11086 N NE2 . GLN D 1 300 ? 1.183   37.696  -67.213 1.00 25.18 ? 299 GLN D NE2 1 
ATOM   11087 N N   . HIS D 1 301 ? 2.232   41.612  -62.161 1.00 20.37 ? 300 HIS D N   1 
ATOM   11088 C CA  . HIS D 1 301 ? 2.184   42.334  -60.886 1.00 20.59 ? 300 HIS D CA  1 
ATOM   11089 C C   . HIS D 1 301 ? 1.511   43.722  -60.895 1.00 20.36 ? 300 HIS D C   1 
ATOM   11090 O O   . HIS D 1 301 ? 0.774   44.075  -59.955 1.00 19.14 ? 300 HIS D O   1 
ATOM   11091 C CB  . HIS D 1 301 ? 3.588   42.463  -60.308 1.00 20.95 ? 300 HIS D CB  1 
ATOM   11092 C CG  . HIS D 1 301 ? 3.621   43.125  -58.967 1.00 21.31 ? 300 HIS D CG  1 
ATOM   11093 N ND1 . HIS D 1 301 ? 2.939   42.628  -57.874 1.00 21.90 ? 300 HIS D ND1 1 
ATOM   11094 C CD2 . HIS D 1 301 ? 4.237   44.255  -58.547 1.00 21.01 ? 300 HIS D CD2 1 
ATOM   11095 C CE1 . HIS D 1 301 ? 3.148   43.417  -56.837 1.00 20.24 ? 300 HIS D CE1 1 
ATOM   11096 N NE2 . HIS D 1 301 ? 3.921   44.417  -57.221 1.00 20.46 ? 300 HIS D NE2 1 
ATOM   11097 N N   . GLU D 1 302 ? 1.769   44.516  -61.926 1.00 20.56 ? 301 GLU D N   1 
ATOM   11098 C CA  . GLU D 1 302 ? 1.192   45.861  -61.981 1.00 20.71 ? 301 GLU D CA  1 
ATOM   11099 C C   . GLU D 1 302 ? -0.311  45.808  -62.250 1.00 19.81 ? 301 GLU D C   1 
ATOM   11100 O O   . GLU D 1 302 ? -1.067  46.575  -61.666 1.00 19.39 ? 301 GLU D O   1 
ATOM   11101 C CB  . GLU D 1 302 ? 1.904   46.750  -63.019 1.00 21.32 ? 301 GLU D CB  1 
ATOM   11102 C CG  . GLU D 1 302 ? 3.326   47.147  -62.601 1.00 23.31 ? 301 GLU D CG  1 
ATOM   11103 C CD  . GLU D 1 302 ? 3.354   47.812  -61.232 1.00 26.60 ? 301 GLU D CD  1 
ATOM   11104 O OE1 . GLU D 1 302 ? 2.448   48.616  -60.928 1.00 31.38 ? 301 GLU D OE1 1 
ATOM   11105 O OE2 . GLU D 1 302 ? 4.273   47.534  -60.445 1.00 31.98 ? 301 GLU D OE2 1 
ATOM   11106 N N   . LEU D 1 303 ? -0.715  44.906  -63.138 1.00 18.81 ? 302 LEU D N   1 
ATOM   11107 C CA  . LEU D 1 303 ? -2.138  44.690  -63.456 1.00 18.80 ? 302 LEU D CA  1 
ATOM   11108 C C   . LEU D 1 303 ? -2.896  44.275  -62.193 1.00 18.31 ? 302 LEU D C   1 
ATOM   11109 O O   . LEU D 1 303 ? -3.968  44.814  -61.888 1.00 19.00 ? 302 LEU D O   1 
ATOM   11110 C CB  . LEU D 1 303 ? -2.286  43.630  -64.554 1.00 18.06 ? 302 LEU D CB  1 
ATOM   11111 C CG  . LEU D 1 303 ? -3.699  43.094  -64.861 1.00 17.81 ? 302 LEU D CG  1 
ATOM   11112 C CD1 . LEU D 1 303 ? -4.655  44.230  -65.296 1.00 16.48 ? 302 LEU D CD1 1 
ATOM   11113 C CD2 . LEU D 1 303 ? -3.624  41.989  -65.888 1.00 13.62 ? 302 LEU D CD2 1 
ATOM   11114 N N   . VAL D 1 304 ? -2.306  43.343  -61.450 1.00 17.72 ? 303 VAL D N   1 
ATOM   11115 C CA  . VAL D 1 304 ? -2.835  42.921  -60.157 1.00 17.24 ? 303 VAL D CA  1 
ATOM   11116 C C   . VAL D 1 304 ? -3.133  44.108  -59.261 1.00 17.65 ? 303 VAL D C   1 
ATOM   11117 O O   . VAL D 1 304 ? -4.179  44.151  -58.588 1.00 16.80 ? 303 VAL D O   1 
ATOM   11118 C CB  . VAL D 1 304 ? -1.851  41.975  -59.406 1.00 16.78 ? 303 VAL D CB  1 
ATOM   11119 C CG1 . VAL D 1 304 ? -2.392  41.637  -58.029 1.00 16.85 ? 303 VAL D CG1 1 
ATOM   11120 C CG2 . VAL D 1 304 ? -1.570  40.703  -60.209 1.00 15.55 ? 303 VAL D CG2 1 
ATOM   11121 N N   . LYS D 1 305 ? -2.214  45.078  -59.224 1.00 18.27 ? 304 LYS D N   1 
ATOM   11122 C CA  . LYS D 1 305 ? -2.394  46.222  -58.332 1.00 19.10 ? 304 LYS D CA  1 
ATOM   11123 C C   . LYS D 1 305 ? -3.516  47.123  -58.836 1.00 18.15 ? 304 LYS D C   1 
ATOM   11124 O O   . LYS D 1 305 ? -4.202  47.760  -58.049 1.00 18.97 ? 304 LYS D O   1 
ATOM   11125 C CB  . LYS D 1 305 ? -1.076  46.988  -58.115 1.00 19.23 ? 304 LYS D CB  1 
ATOM   11126 C CG  . LYS D 1 305 ? -0.081  46.267  -57.196 1.00 21.20 ? 304 LYS D CG  1 
ATOM   11127 C CD  . LYS D 1 305 ? 1.145   47.124  -56.845 1.00 21.38 ? 304 LYS D CD  1 
ATOM   11128 C CE  . LYS D 1 305 ? 2.027   47.415  -58.065 1.00 24.64 ? 304 LYS D CE  1 
ATOM   11129 N NZ  . LYS D 1 305 ? 3.213   48.338  -57.733 1.00 26.03 ? 304 LYS D NZ  1 
ATOM   11130 N N   . ARG D 1 306 ? -3.706  47.161  -60.147 1.00 18.70 ? 305 ARG D N   1 
ATOM   11131 C CA  . ARG D 1 306 ? -4.792  47.914  -60.762 1.00 18.81 ? 305 ARG D CA  1 
ATOM   11132 C C   . ARG D 1 306 ? -6.187  47.298  -60.573 1.00 18.50 ? 305 ARG D C   1 
ATOM   11133 O O   . ARG D 1 306 ? -7.155  48.037  -60.511 1.00 18.03 ? 305 ARG D O   1 
ATOM   11134 C CB  . ARG D 1 306 ? -4.558  48.099  -62.273 1.00 19.18 ? 305 ARG D CB  1 
ATOM   11135 C CG  . ARG D 1 306 ? -3.362  48.993  -62.623 1.00 19.98 ? 305 ARG D CG  1 
ATOM   11136 C CD  . ARG D 1 306 ? -3.475  49.522  -64.040 1.00 20.28 ? 305 ARG D CD  1 
ATOM   11137 N NE  . ARG D 1 306 ? -3.410  48.456  -65.048 1.00 23.43 ? 305 ARG D NE  1 
ATOM   11138 C CZ  . ARG D 1 306 ? -2.290  47.904  -65.505 1.00 21.95 ? 305 ARG D CZ  1 
ATOM   11139 N NH1 . ARG D 1 306 ? -1.114  48.284  -65.037 1.00 22.40 ? 305 ARG D NH1 1 
ATOM   11140 N NH2 . ARG D 1 306 ? -2.354  46.952  -66.429 1.00 22.91 ? 305 ARG D NH2 1 
ATOM   11141 N N   . GLN D 1 307 ? -6.295  45.973  -60.500 1.00 17.83 ? 306 GLN D N   1 
ATOM   11142 C CA  . GLN D 1 307 ? -7.627  45.323  -60.454 1.00 17.89 ? 306 GLN D CA  1 
ATOM   11143 C C   . GLN D 1 307 ? -7.946  44.583  -59.168 1.00 17.31 ? 306 GLN D C   1 
ATOM   11144 O O   . GLN D 1 307 ? -9.013  43.965  -59.071 1.00 16.32 ? 306 GLN D O   1 
ATOM   11145 C CB  . GLN D 1 307 ? -7.862  44.399  -61.684 1.00 18.25 ? 306 GLN D CB  1 
ATOM   11146 C CG  . GLN D 1 307 ? -7.087