data_3DB3
# 
_entry.id   3DB3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DB3         
RCSB  RCSB047816   
WWPDB D_1000047816 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3BI7 
;CRYSTAL STRUCTURE OF THE SRA DOMAIN OF E3 UBIQUITIN-PROTEIN 
LIGASE UHRF1
;
unspecified 
PDB 3CLZ 
;THE SET AND RING ASSOCIATED (SRA) DOMAIN OF UHRF1 BOUND TO 
METHYLATED DNA
;
unspecified 
PDB 2FAZ 
;UBIQUITIN-LIKE DOMAIN OF HUMAN NUCLEAR ZINC FINGER PROTEIN    
NP95
;
unspecified 
PDB 3DB4 'STRUCTURE OF THE TANDEM TUDOR DOMAINS OF THE E3 UBIQUITIN-PROTEIN LIGASE UHRF1' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DB3 
_pdbx_database_status.recvd_initial_deposition_date   2008-05-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Walker, J.R.'                         1  
'Avvakumov, G.V.'                      2  
'Xue, S.'                              3  
'Dong, A.'                             4  
'Li, Y.'                               5  
'Bountra, C.'                          6  
'Weigelt, J.'                          7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.M.'                        9  
'Bochkarev, A.'                        10 
'Dhe-Paganon, S.'                      11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.id                        primary 
_citation.title                     'Recognition of multivalent histone states associated with heterochromatin by UHRF1 protein.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                24300 
_citation.page_last                 24311 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21489993 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.234104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nady, N.'           1  
primary 'Lemak, A.'          2  
primary 'Walker, J.R.'       3  
primary 'Avvakumov, G.V.'    4  
primary 'Kareta, M.S.'       5  
primary 'Achour, M.'         6  
primary 'Xue, S.'            7  
primary 'Duan, S.'           8  
primary 'Allali-Hassani, A.' 9  
primary 'Zuo, X.'            10 
primary 'Wang, Y.X.'         11 
primary 'Bronner, C.'        12 
primary 'Chedin, F.'         13 
primary 'Arrowsmith, C.H.'   14 
primary 'Dhe-Paganon, S.'    15 
# 
_cell.entry_id           3DB3 
_cell.length_a           99.622 
_cell.length_b           99.622 
_cell.length_c           41.232 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DB3 
_symmetry.space_group_name_H-M             'P 62' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                171 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'E3 ubiquitin-protein ligase UHRF1'   19011.543 1  6.3.2.- ? 'Tandem Tudor Domains (UNP residues 126-285)' ? 
2 polymer syn 'Trimethylated histone H3-K9 peptide' 706.832   1  ?       ? ?                                             ? 
3 water   nat water                                 18.015    73 ?       ? ?                                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Ubiquitin-like PHD and RING finger domain-containing protein 1, Ubiquitin-like-containing PHD and RING finger domains protein 1, Inverted CCAAT box-binding protein of 90 kDa, Transcription factor ICBP90, Nuclear zinc finger protein Np95, Nuclear protein 95, HuNp95, RING finger protein 106
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;G(MSE)WDETELGLYKVNEYVDARDTN(MSE)GAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGV
VQ(MSE)NSRDVRARARTIIKWQDLEVGQVV(MSE)LNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLND
CRIIFVDEVFKIERPGE
;
;GMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDV
RARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPG
E
;
A ? 
2 'polypeptide(L)' no yes 'TAR(M3L)ST' TARKST B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MSE n 
1 3   TRP n 
1 4   ASP n 
1 5   GLU n 
1 6   THR n 
1 7   GLU n 
1 8   LEU n 
1 9   GLY n 
1 10  LEU n 
1 11  TYR n 
1 12  LYS n 
1 13  VAL n 
1 14  ASN n 
1 15  GLU n 
1 16  TYR n 
1 17  VAL n 
1 18  ASP n 
1 19  ALA n 
1 20  ARG n 
1 21  ASP n 
1 22  THR n 
1 23  ASN n 
1 24  MSE n 
1 25  GLY n 
1 26  ALA n 
1 27  TRP n 
1 28  PHE n 
1 29  GLU n 
1 30  ALA n 
1 31  GLN n 
1 32  VAL n 
1 33  VAL n 
1 34  ARG n 
1 35  VAL n 
1 36  THR n 
1 37  ARG n 
1 38  LYS n 
1 39  ALA n 
1 40  PRO n 
1 41  SER n 
1 42  ARG n 
1 43  ASP n 
1 44  GLU n 
1 45  PRO n 
1 46  CYS n 
1 47  SER n 
1 48  SER n 
1 49  THR n 
1 50  SER n 
1 51  ARG n 
1 52  PRO n 
1 53  ALA n 
1 54  LEU n 
1 55  GLU n 
1 56  GLU n 
1 57  ASP n 
1 58  VAL n 
1 59  ILE n 
1 60  TYR n 
1 61  HIS n 
1 62  VAL n 
1 63  LYS n 
1 64  TYR n 
1 65  ASP n 
1 66  ASP n 
1 67  TYR n 
1 68  PRO n 
1 69  GLU n 
1 70  ASN n 
1 71  GLY n 
1 72  VAL n 
1 73  VAL n 
1 74  GLN n 
1 75  MSE n 
1 76  ASN n 
1 77  SER n 
1 78  ARG n 
1 79  ASP n 
1 80  VAL n 
1 81  ARG n 
1 82  ALA n 
1 83  ARG n 
1 84  ALA n 
1 85  ARG n 
1 86  THR n 
1 87  ILE n 
1 88  ILE n 
1 89  LYS n 
1 90  TRP n 
1 91  GLN n 
1 92  ASP n 
1 93  LEU n 
1 94  GLU n 
1 95  VAL n 
1 96  GLY n 
1 97  GLN n 
1 98  VAL n 
1 99  VAL n 
1 100 MSE n 
1 101 LEU n 
1 102 ASN n 
1 103 TYR n 
1 104 ASN n 
1 105 PRO n 
1 106 ASP n 
1 107 ASN n 
1 108 PRO n 
1 109 LYS n 
1 110 GLU n 
1 111 ARG n 
1 112 GLY n 
1 113 PHE n 
1 114 TRP n 
1 115 TYR n 
1 116 ASP n 
1 117 ALA n 
1 118 GLU n 
1 119 ILE n 
1 120 SER n 
1 121 ARG n 
1 122 LYS n 
1 123 ARG n 
1 124 GLU n 
1 125 THR n 
1 126 ARG n 
1 127 THR n 
1 128 ALA n 
1 129 ARG n 
1 130 GLU n 
1 131 LEU n 
1 132 TYR n 
1 133 ALA n 
1 134 ASN n 
1 135 VAL n 
1 136 VAL n 
1 137 LEU n 
1 138 GLY n 
1 139 ASP n 
1 140 ASP n 
1 141 SER n 
1 142 LEU n 
1 143 ASN n 
1 144 ASP n 
1 145 CYS n 
1 146 ARG n 
1 147 ILE n 
1 148 ILE n 
1 149 PHE n 
1 150 VAL n 
1 151 ASP n 
1 152 GLU n 
1 153 VAL n 
1 154 PHE n 
1 155 LYS n 
1 156 ILE n 
1 157 GLU n 
1 158 ARG n 
1 159 PRO n 
1 160 GLY n 
1 161 GLU n 
2 1   THR n 
2 2   ALA n 
2 3   ARG n 
2 4   M3L n 
2 5   SER n 
2 6   THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'UHRF1, ICBP90, NP95, RNF106' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'Trimethylated histone peptide H3-K9 was chemically synthesized. The sequence naturally occurs in Homo sapiens (human)' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP UHRF1_HUMAN Q96T88 1 
;MWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVR
ARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE

;
126 ? 
2 UNP H32_HUMAN   Q71DI3 2 TARKST 7   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3DB3 A 2 ? 161 ? Q96T88 126 ? 285 ? 126 285 
2 2 3DB3 B 1 ? 6   ? Q71DI3 7   ? 12  ? 6   11  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3DB3 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q96T88 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION TAG' 
_struct_ref_seq_dif.pdbx_auth_seq_num            125 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 
MSE 'L-peptide linking' n SELENOMETHIONINE  ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3DB3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.00 
_exptl_crystal.density_percent_sol   58.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.00 
_exptl_crystal_grow.pdbx_details    
'3 M SODIUM FORMATE, 0.1 M SODIUM ACETATE, pH 5.00, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-04-09 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             0.99987 
_diffrn_source.pdbx_wavelength_list        0.99987 
# 
_reflns.entry_id                     3DB3 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             32.00 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   9214 
_reflns.number_all                   9214 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.117 
_reflns.pdbx_netI_over_sigmaI        22.52 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   92.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.501 
_reflns_shell.meanI_over_sigI_obs    3.62 
_reflns_shell.pdbx_redundancy        5.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      852 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3DB3 
_refine.ls_number_reflns_obs                     8755 
_refine.ls_number_reflns_all                     9124 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.77 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    98.50 
_refine.ls_R_factor_obs                          0.21512 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21188 
_refine.ls_R_factor_R_free                       0.28198 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  433 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.886 
_refine.B_iso_mean                               35.940 
_refine.aniso_B[1][1]                            -3.68 
_refine.aniso_B[2][2]                            -3.68 
_refine.aniso_B[3][3]                            5.52 
_refine.aniso_B[1][2]                            -1.84 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS, ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.296 
_refine.pdbx_overall_ESU_R_Free                  0.260 
_refine.overall_SU_ML                            0.195 
_refine.overall_SU_B                             15.638 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1164 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             73 
_refine_hist.number_atoms_total               1237 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        31.77 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 1184 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.298  1.944  ? 1604 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.481  5.000  ? 140  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.460 23.538 ? 65   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.770 15.000 ? 196  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.009 15.000 ? 13   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.091  0.200  ? 175  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 913  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.205  0.200  ? 424  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.309  0.200  ? 767  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.147  0.200  ? 74   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.158  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.167  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.424  3.000  ? 726  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.176  4.000  ? 1144 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.047  5.000  ? 523  'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.604  7.000  ? 460  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.462 
_refine_ls_shell.number_reflns_R_work             569 
_refine_ls_shell.R_factor_R_work                  0.248 
_refine_ls_shell.percent_reflns_obs               87.82 
_refine_ls_shell.R_factor_R_free                  0.223 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             22 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DB3 
_struct.title                     
;Crystal structure of the tandem tudor domains of the E3 ubiquitin-protein ligase UHRF1 in complex with trimethylated histone H3-K9 peptide
;
_struct.pdbx_descriptor           'E3 ubiquitin-protein ligase UHRF1 (E.C.6.3.2.-), Trimethylated histone H3-K9 peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DB3 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
;CELL CYCLE, DNA DAMAGE, DNA REPAIR, TANDEM TUDOR DOMAINS, LIGASE, METAL BINDING, DNA REPLICATION, TRANSCRIPTIONAL SILENCING, CHROMATIN, PHOSPHORYLATION, TRANSCRIPTION, TRANSCRIPTION REGULATION, UBL CONJUGATION PATHWAY, ZINC-FINGER, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, DNA-binding, Metal-binding, Nucleus, Phosphoprotein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TYR A 67 ? ASN A 70 ? TYR A 191 ASN A 194 5 ? 4 
HELX_P HELX_P2 2 LYS A 89 ? LEU A 93 ? LYS A 213 LEU A 217 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ASN 23  C ? ? ? 1_555 A MSE 24  N ? ? A ASN 147 A MSE 148 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2 covale ? ? A MSE 24  C ? ? ? 1_555 A GLY 25  N ? ? A MSE 148 A GLY 149 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale3 covale ? ? A GLN 74  C ? ? ? 1_555 A MSE 75  N ? ? A GLN 198 A MSE 199 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale4 covale ? ? A MSE 75  C ? ? ? 1_555 A ASN 76  N ? ? A MSE 199 A ASN 200 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale5 covale ? ? A VAL 99  C ? ? ? 1_555 A MSE 100 N ? ? A VAL 223 A MSE 224 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale6 covale ? ? A MSE 100 C ? ? ? 1_555 A LEU 101 N ? ? A MSE 224 A LEU 225 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale7 covale ? ? B ARG 3   C ? ? ? 1_555 B M3L 4   N ? ? B ARG 8   B M3L 9   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale8 covale ? ? B M3L 4   C ? ? ? 1_555 B SER 5   N ? ? B M3L 9   B SER 10  1_555 ? ? ? ? ? ? ? 1.336 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 72  ? ASN A 76  ? VAL A 196 ASN A 200 
A 2 VAL A 58  ? TYR A 64  ? VAL A 182 TYR A 188 
A 3 TRP A 27  ? ARG A 37  ? TRP A 151 ARG A 161 
A 4 TYR A 16  ? ARG A 20  ? TYR A 140 ARG A 144 
A 5 VAL A 80  ? ARG A 81  ? VAL A 204 ARG A 205 
B 1 VAL A 98  ? TYR A 103 ? VAL A 222 TYR A 227 
B 2 PHE A 113 ? GLU A 124 ? PHE A 237 GLU A 248 
B 3 ARG A 129 ? VAL A 136 ? ARG A 253 VAL A 260 
B 4 SER A 141 ? ILE A 147 ? SER A 265 ILE A 271 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MSE A 75  ? O MSE A 199 N TYR A 60  ? N TYR A 184 
A 2 3 O HIS A 61  ? O HIS A 185 N VAL A 33  ? N VAL A 157 
A 3 4 O ALA A 30  ? O ALA A 154 N VAL A 17  ? N VAL A 141 
A 4 5 N ASP A 18  ? N ASP A 142 O ARG A 81  ? O ARG A 205 
B 1 2 N VAL A 99  ? N VAL A 223 O ALA A 117 ? O ALA A 241 
B 2 3 N ARG A 123 ? N ARG A 247 O GLU A 130 ? O GLU A 254 
B 3 4 N ALA A 133 ? N ALA A 257 O CYS A 145 ? O CYS A 269 
# 
_database_PDB_matrix.entry_id          3DB3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DB3 
_atom_sites.fract_transf_matrix[1][1]   0.010038 
_atom_sites.fract_transf_matrix[1][2]   0.005795 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011591 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024253 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TRP A 1 3   ? 23.927 8.408   14.669  1.00 98.00  ? 127 TRP A N   1 
ATOM   2    C  CA  . TRP A 1 3   ? 25.362 7.982   14.830  1.00 88.76  ? 127 TRP A CA  1 
ATOM   3    C  C   . TRP A 1 3   ? 25.893 8.415   16.266  1.00 85.54  ? 127 TRP A C   1 
ATOM   4    O  O   . TRP A 1 3   ? 27.095 8.191   16.656  1.00 81.48  ? 127 TRP A O   1 
ATOM   5    C  CB  . TRP A 1 3   ? 26.253 8.548   13.670  1.00 85.36  ? 127 TRP A CB  1 
ATOM   6    N  N   . ASP A 1 4   ? 25.001 9.016   17.054  1.00 90.97  ? 128 ASP A N   1 
ATOM   7    C  CA  . ASP A 1 4   ? 25.386 9.568   18.359  1.00 90.70  ? 128 ASP A CA  1 
ATOM   8    C  C   . ASP A 1 4   ? 24.674 8.923   19.559  1.00 96.26  ? 128 ASP A C   1 
ATOM   9    O  O   . ASP A 1 4   ? 24.614 9.509   20.648  1.00 101.94 ? 128 ASP A O   1 
ATOM   10   C  CB  . ASP A 1 4   ? 25.241 11.106  18.371  1.00 92.75  ? 128 ASP A CB  1 
ATOM   11   C  CG  . ASP A 1 4   ? 26.122 11.788  17.294  1.00 85.88  ? 128 ASP A CG  1 
ATOM   12   O  OD1 . ASP A 1 4   ? 25.678 13.025  16.945  1.00 88.56  ? 128 ASP A OD1 1 
ATOM   13   O  OD2 . ASP A 1 4   ? 27.209 11.200  16.868  1.00 77.56  ? 128 ASP A OD2 1 
ATOM   14   N  N   . GLU A 1 5   ? 24.158 7.712   19.356  1.00 96.01  ? 129 GLU A N   1 
ATOM   15   C  CA  . GLU A 1 5   ? 23.451 6.975   20.406  1.00 101.14 ? 129 GLU A CA  1 
ATOM   16   C  C   . GLU A 1 5   ? 24.207 5.724   20.873  1.00 94.86  ? 129 GLU A C   1 
ATOM   17   O  O   . GLU A 1 5   ? 23.667 4.617   20.840  1.00 96.11  ? 129 GLU A O   1 
ATOM   18   C  CB  . GLU A 1 5   ? 22.031 6.617   19.947  1.00 109.64 ? 129 GLU A CB  1 
ATOM   19   N  N   . THR A 1 6   ? 25.456 5.925   21.310  1.00 89.33  ? 130 THR A N   1 
ATOM   20   C  CA  . THR A 1 6   ? 26.334 4.877   21.877  1.00 84.19  ? 130 THR A CA  1 
ATOM   21   C  C   . THR A 1 6   ? 25.601 3.898   22.822  1.00 88.99  ? 130 THR A C   1 
ATOM   22   O  O   . THR A 1 6   ? 24.781 4.325   23.653  1.00 97.70  ? 130 THR A O   1 
ATOM   23   C  CB  . THR A 1 6   ? 27.575 5.529   22.592  1.00 83.87  ? 130 THR A CB  1 
ATOM   24   O  OG1 . THR A 1 6   ? 28.610 5.800   21.636  1.00 75.52  ? 130 THR A OG1 1 
ATOM   25   C  CG2 . THR A 1 6   ? 28.141 4.647   23.719  1.00 86.24  ? 130 THR A CG2 1 
ATOM   26   N  N   . GLU A 1 7   ? 25.903 2.603   22.674  1.00 82.69  ? 131 GLU A N   1 
ATOM   27   C  CA  . GLU A 1 7   ? 25.300 1.517   23.462  1.00 86.63  ? 131 GLU A CA  1 
ATOM   28   C  C   . GLU A 1 7   ? 26.274 0.349   23.649  1.00 81.62  ? 131 GLU A C   1 
ATOM   29   O  O   . GLU A 1 7   ? 27.465 0.485   23.359  1.00 76.25  ? 131 GLU A O   1 
ATOM   30   C  CB  . GLU A 1 7   ? 24.009 1.023   22.800  1.00 89.11  ? 131 GLU A CB  1 
ATOM   31   N  N   . LEU A 1 8   ? 25.763 -0.790  24.137  1.00 85.47  ? 132 LEU A N   1 
ATOM   32   C  CA  . LEU A 1 8   ? 26.555 -2.034  24.305  1.00 80.94  ? 132 LEU A CA  1 
ATOM   33   C  C   . LEU A 1 8   ? 25.811 -3.338  23.930  1.00 80.42  ? 132 LEU A C   1 
ATOM   34   O  O   . LEU A 1 8   ? 24.898 -3.754  24.649  1.00 86.23  ? 132 LEU A O   1 
ATOM   35   C  CB  . LEU A 1 8   ? 27.121 -2.141  25.732  1.00 85.31  ? 132 LEU A CB  1 
ATOM   36   C  CG  . LEU A 1 8   ? 28.205 -1.130  26.136  1.00 85.83  ? 132 LEU A CG  1 
ATOM   37   C  CD1 . LEU A 1 8   ? 27.632 0.002   26.978  1.00 92.47  ? 132 LEU A CD1 1 
ATOM   38   C  CD2 . LEU A 1 8   ? 29.341 -1.826  26.876  1.00 87.48  ? 132 LEU A CD2 1 
ATOM   39   N  N   . GLY A 1 9   ? 26.230 -3.974  22.821  1.00 74.09  ? 133 GLY A N   1 
ATOM   40   C  CA  . GLY A 1 9   ? 25.631 -5.229  22.313  1.00 72.71  ? 133 GLY A CA  1 
ATOM   41   C  C   . GLY A 1 9   ? 26.579 -6.384  21.950  1.00 67.74  ? 133 GLY A C   1 
ATOM   42   O  O   . GLY A 1 9   ? 27.621 -6.573  22.573  1.00 67.22  ? 133 GLY A O   1 
ATOM   43   N  N   . LEU A 1 10  ? 26.205 -7.160  20.936  1.00 65.53  ? 134 LEU A N   1 
ATOM   44   C  CA  . LEU A 1 10  ? 26.900 -8.405  20.538  1.00 63.27  ? 134 LEU A CA  1 
ATOM   45   C  C   . LEU A 1 10  ? 28.459 -8.343  20.485  1.00 59.43  ? 134 LEU A C   1 
ATOM   46   O  O   . LEU A 1 10  ? 29.140 -9.033  21.251  1.00 59.22  ? 134 LEU A O   1 
ATOM   47   C  CB  . LEU A 1 10  ? 26.276 -8.978  19.231  1.00 65.26  ? 134 LEU A CB  1 
ATOM   48   C  CG  . LEU A 1 10  ? 25.459 -8.068  18.252  1.00 68.36  ? 134 LEU A CG  1 
ATOM   49   C  CD1 . LEU A 1 10  ? 25.208 -8.725  16.887  1.00 70.68  ? 134 LEU A CD1 1 
ATOM   50   C  CD2 . LEU A 1 10  ? 24.124 -7.538  18.816  1.00 70.49  ? 134 LEU A CD2 1 
ATOM   51   N  N   . TYR A 1 11  ? 29.013 -7.512  19.601  1.00 56.12  ? 135 TYR A N   1 
ATOM   52   C  CA  . TYR A 1 11  ? 30.460 -7.253  19.571  1.00 52.87  ? 135 TYR A CA  1 
ATOM   53   C  C   . TYR A 1 11  ? 30.785 -5.893  20.204  1.00 53.30  ? 135 TYR A C   1 
ATOM   54   O  O   . TYR A 1 11  ? 29.932 -4.997  20.257  1.00 53.19  ? 135 TYR A O   1 
ATOM   55   C  CB  . TYR A 1 11  ? 31.006 -7.370  18.142  1.00 52.60  ? 135 TYR A CB  1 
ATOM   56   C  CG  . TYR A 1 11  ? 30.539 -8.643  17.467  1.00 51.89  ? 135 TYR A CG  1 
ATOM   57   C  CD1 . TYR A 1 11  ? 31.042 -9.875  17.863  1.00 51.80  ? 135 TYR A CD1 1 
ATOM   58   C  CD2 . TYR A 1 11  ? 29.559 -8.618  16.477  1.00 52.14  ? 135 TYR A CD2 1 
ATOM   59   C  CE1 . TYR A 1 11  ? 30.595 -11.056 17.287  1.00 56.52  ? 135 TYR A CE1 1 
ATOM   60   C  CE2 . TYR A 1 11  ? 29.105 -9.800  15.881  1.00 56.39  ? 135 TYR A CE2 1 
ATOM   61   C  CZ  . TYR A 1 11  ? 29.633 -11.017 16.294  1.00 57.60  ? 135 TYR A CZ  1 
ATOM   62   O  OH  . TYR A 1 11  ? 29.213 -12.207 15.746  1.00 57.98  ? 135 TYR A OH  1 
ATOM   63   N  N   . LYS A 1 12  ? 32.018 -5.750  20.689  1.00 53.44  ? 136 LYS A N   1 
ATOM   64   C  CA  . LYS A 1 12  ? 32.408 -4.604  21.519  1.00 53.76  ? 136 LYS A CA  1 
ATOM   65   C  C   . LYS A 1 12  ? 33.368 -3.647  20.804  1.00 52.81  ? 136 LYS A C   1 
ATOM   66   O  O   . LYS A 1 12  ? 33.978 -4.022  19.792  1.00 50.88  ? 136 LYS A O   1 
ATOM   67   C  CB  . LYS A 1 12  ? 33.021 -5.110  22.830  1.00 57.75  ? 136 LYS A CB  1 
ATOM   68   C  CG  . LYS A 1 12  ? 32.037 -5.891  23.691  1.00 58.82  ? 136 LYS A CG  1 
ATOM   69   C  CD  . LYS A 1 12  ? 32.758 -6.898  24.556  1.00 67.08  ? 136 LYS A CD  1 
ATOM   70   N  N   . VAL A 1 13  ? 33.486 -2.418  21.325  1.00 52.08  ? 137 VAL A N   1 
ATOM   71   C  CA  . VAL A 1 13  ? 34.413 -1.419  20.775  1.00 52.25  ? 137 VAL A CA  1 
ATOM   72   C  C   . VAL A 1 13  ? 35.845 -1.948  20.827  1.00 55.12  ? 137 VAL A C   1 
ATOM   73   O  O   . VAL A 1 13  ? 36.325 -2.360  21.896  1.00 60.97  ? 137 VAL A O   1 
ATOM   74   C  CB  . VAL A 1 13  ? 34.319 -0.054  21.516  1.00 55.30  ? 137 VAL A CB  1 
ATOM   75   C  CG1 . VAL A 1 13  ? 35.472 0.889   21.131  1.00 57.61  ? 137 VAL A CG1 1 
ATOM   76   C  CG2 . VAL A 1 13  ? 33.012 0.618   21.199  1.00 57.01  ? 137 VAL A CG2 1 
ATOM   77   N  N   . ASN A 1 14  ? 36.507 -1.940  19.670  1.00 57.54  ? 138 ASN A N   1 
ATOM   78   C  CA  . ASN A 1 14  ? 37.898 -2.386  19.519  1.00 56.47  ? 138 ASN A CA  1 
ATOM   79   C  C   . ASN A 1 14  ? 38.099 -3.860  19.164  1.00 55.15  ? 138 ASN A C   1 
ATOM   80   O  O   . ASN A 1 14  ? 39.244 -4.312  18.977  1.00 54.92  ? 138 ASN A O   1 
ATOM   81   C  CB  . ASN A 1 14  ? 38.742 -2.004  20.732  1.00 58.43  ? 138 ASN A CB  1 
ATOM   82   C  CG  . ASN A 1 14  ? 39.040 -0.539  20.768  1.00 60.69  ? 138 ASN A CG  1 
ATOM   83   O  OD1 . ASN A 1 14  ? 39.584 0.010   19.815  1.00 60.32  ? 138 ASN A OD1 1 
ATOM   84   N  ND2 . ASN A 1 14  ? 38.678 0.114   21.865  1.00 63.27  ? 138 ASN A ND2 1 
ATOM   85   N  N   . GLU A 1 15  ? 36.990 -4.589  19.066  1.00 52.24  ? 139 GLU A N   1 
ATOM   86   C  CA  . GLU A 1 15  ? 37.017 -5.996  18.700  1.00 52.77  ? 139 GLU A CA  1 
ATOM   87   C  C   . GLU A 1 15  ? 37.346 -6.182  17.219  1.00 51.11  ? 139 GLU A C   1 
ATOM   88   O  O   . GLU A 1 15  ? 36.825 -5.481  16.340  1.00 50.00  ? 139 GLU A O   1 
ATOM   89   C  CB  . GLU A 1 15  ? 35.678 -6.652  19.033  1.00 53.78  ? 139 GLU A CB  1 
ATOM   90   C  CG  . GLU A 1 15  ? 35.639 -8.153  18.827  1.00 58.85  ? 139 GLU A CG  1 
ATOM   91   C  CD  . GLU A 1 15  ? 34.636 -8.846  19.728  1.00 65.93  ? 139 GLU A CD  1 
ATOM   92   O  OE1 . GLU A 1 15  ? 34.332 -8.320  20.829  1.00 71.39  ? 139 GLU A OE1 1 
ATOM   93   O  OE2 . GLU A 1 15  ? 34.164 -9.933  19.345  1.00 69.05  ? 139 GLU A OE2 1 
ATOM   94   N  N   . TYR A 1 16  ? 38.234 -7.123  16.950  1.00 52.40  ? 140 TYR A N   1 
ATOM   95   C  CA  . TYR A 1 16  ? 38.495 -7.534  15.587  1.00 51.42  ? 140 TYR A CA  1 
ATOM   96   C  C   . TYR A 1 16  ? 37.375 -8.448  15.114  1.00 49.74  ? 140 TYR A C   1 
ATOM   97   O  O   . TYR A 1 16  ? 37.074 -9.461  15.754  1.00 53.25  ? 140 TYR A O   1 
ATOM   98   C  CB  . TYR A 1 16  ? 39.860 -8.213  15.495  1.00 55.41  ? 140 TYR A CB  1 
ATOM   99   C  CG  . TYR A 1 16  ? 40.980 -7.260  15.835  1.00 57.74  ? 140 TYR A CG  1 
ATOM   100  C  CD1 . TYR A 1 16  ? 41.367 -6.263  14.932  1.00 56.24  ? 140 TYR A CD1 1 
ATOM   101  C  CD2 . TYR A 1 16  ? 41.638 -7.337  17.066  1.00 58.43  ? 140 TYR A CD2 1 
ATOM   102  C  CE1 . TYR A 1 16  ? 42.395 -5.381  15.232  1.00 59.25  ? 140 TYR A CE1 1 
ATOM   103  C  CE2 . TYR A 1 16  ? 42.658 -6.459  17.381  1.00 61.09  ? 140 TYR A CE2 1 
ATOM   104  C  CZ  . TYR A 1 16  ? 43.035 -5.480  16.459  1.00 62.74  ? 140 TYR A CZ  1 
ATOM   105  O  OH  . TYR A 1 16  ? 44.055 -4.597  16.764  1.00 68.05  ? 140 TYR A OH  1 
ATOM   106  N  N   . VAL A 1 17  ? 36.735 -8.062  14.016  1.00 43.88  ? 141 VAL A N   1 
ATOM   107  C  CA  . VAL A 1 17  ? 35.634 -8.831  13.461  1.00 42.34  ? 141 VAL A CA  1 
ATOM   108  C  C   . VAL A 1 17  ? 35.788 -9.005  11.946  1.00 40.93  ? 141 VAL A C   1 
ATOM   109  O  O   . VAL A 1 17  ? 36.770 -8.566  11.350  1.00 41.61  ? 141 VAL A O   1 
ATOM   110  C  CB  . VAL A 1 17  ? 34.249 -8.178  13.757  1.00 41.12  ? 141 VAL A CB  1 
ATOM   111  C  CG1 . VAL A 1 17  ? 33.999 -8.045  15.260  1.00 41.22  ? 141 VAL A CG1 1 
ATOM   112  C  CG2 . VAL A 1 17  ? 34.127 -6.842  13.045  1.00 40.31  ? 141 VAL A CG2 1 
ATOM   113  N  N   . ASP A 1 18  ? 34.814 -9.673  11.341  1.00 41.07  ? 142 ASP A N   1 
ATOM   114  C  CA  . ASP A 1 18  ? 34.681 -9.746  9.903   1.00 39.15  ? 142 ASP A CA  1 
ATOM   115  C  C   . ASP A 1 18  ? 33.512 -8.837  9.553   1.00 37.05  ? 142 ASP A C   1 
ATOM   116  O  O   . ASP A 1 18  ? 32.555 -8.763  10.319  1.00 36.52  ? 142 ASP A O   1 
ATOM   117  C  CB  . ASP A 1 18  ? 34.428 -11.189 9.477   1.00 40.05  ? 142 ASP A CB  1 
ATOM   118  C  CG  . ASP A 1 18  ? 35.689 -11.885 8.975   1.00 47.43  ? 142 ASP A CG  1 
ATOM   119  O  OD1 . ASP A 1 18  ? 36.616 -11.170 8.551   1.00 49.75  ? 142 ASP A OD1 1 
ATOM   120  O  OD2 . ASP A 1 18  ? 35.763 -13.143 8.990   1.00 52.40  ? 142 ASP A OD2 1 
ATOM   121  N  N   . ALA A 1 19  ? 33.588 -8.132  8.419   1.00 35.39  ? 143 ALA A N   1 
ATOM   122  C  CA  . ALA A 1 19  ? 32.526 -7.188  8.036   1.00 34.87  ? 143 ALA A CA  1 
ATOM   123  C  C   . ALA A 1 19  ? 32.144 -7.354  6.583   1.00 36.82  ? 143 ALA A C   1 
ATOM   124  O  O   . ALA A 1 19  ? 33.015 -7.425  5.705   1.00 37.47  ? 143 ALA A O   1 
ATOM   125  C  CB  . ALA A 1 19  ? 32.956 -5.741  8.315   1.00 34.06  ? 143 ALA A CB  1 
ATOM   126  N  N   . ARG A 1 20  ? 30.839 -7.413  6.324   1.00 39.44  ? 144 ARG A N   1 
ATOM   127  C  CA  . ARG A 1 20  ? 30.338 -7.690  4.987   1.00 42.11  ? 144 ARG A CA  1 
ATOM   128  C  C   . ARG A 1 20  ? 30.123 -6.405  4.227   1.00 42.56  ? 144 ARG A C   1 
ATOM   129  O  O   . ARG A 1 20  ? 29.353 -5.551  4.656   1.00 45.41  ? 144 ARG A O   1 
ATOM   130  C  CB  . ARG A 1 20  ? 29.021 -8.487  5.026   1.00 44.22  ? 144 ARG A CB  1 
ATOM   131  C  CG  . ARG A 1 20  ? 28.745 -9.289  3.744   1.00 47.86  ? 144 ARG A CG  1 
ATOM   132  C  CD  . ARG A 1 20  ? 27.264 -9.586  3.481   1.00 53.62  ? 144 ARG A CD  1 
ATOM   133  N  NE  . ARG A 1 20  ? 26.468 -9.794  4.693   1.00 64.40  ? 144 ARG A NE  1 
ATOM   134  C  CZ  . ARG A 1 20  ? 25.891 -10.942 5.058   1.00 71.78  ? 144 ARG A CZ  1 
ATOM   135  N  NH1 . ARG A 1 20  ? 26.005 -12.041 4.314   1.00 75.38  ? 144 ARG A NH1 1 
ATOM   136  N  NH2 . ARG A 1 20  ? 25.187 -10.991 6.186   1.00 75.82  ? 144 ARG A NH2 1 
ATOM   137  N  N   . ASP A 1 21  ? 30.793 -6.280  3.087   1.00 43.52  ? 145 ASP A N   1 
ATOM   138  C  CA  . ASP A 1 21  ? 30.529 -5.191  2.164   1.00 46.10  ? 145 ASP A CA  1 
ATOM   139  C  C   . ASP A 1 21  ? 29.175 -5.411  1.506   1.00 48.66  ? 145 ASP A C   1 
ATOM   140  O  O   . ASP A 1 21  ? 28.951 -6.437  0.873   1.00 49.21  ? 145 ASP A O   1 
ATOM   141  C  CB  . ASP A 1 21  ? 31.603 -5.115  1.090   1.00 46.76  ? 145 ASP A CB  1 
ATOM   142  C  CG  . ASP A 1 21  ? 31.431 -3.916  0.201   1.00 53.16  ? 145 ASP A CG  1 
ATOM   143  O  OD1 . ASP A 1 21  ? 30.978 -4.056  -0.959  1.00 55.10  ? 145 ASP A OD1 1 
ATOM   144  O  OD2 . ASP A 1 21  ? 31.710 -2.809  0.689   1.00 60.88  ? 145 ASP A OD2 1 
ATOM   145  N  N   . THR A 1 22  ? 28.284 -4.437  1.661   1.00 51.37  ? 146 THR A N   1 
ATOM   146  C  CA  . THR A 1 22  ? 26.925 -4.491  1.130   1.00 55.02  ? 146 THR A CA  1 
ATOM   147  C  C   . THR A 1 22  ? 26.868 -4.556  -0.397  1.00 56.88  ? 146 THR A C   1 
ATOM   148  O  O   . THR A 1 22  ? 26.070 -5.311  -0.953  1.00 59.37  ? 146 THR A O   1 
ATOM   149  C  CB  . THR A 1 22  ? 26.113 -3.290  1.645   1.00 59.67  ? 146 THR A CB  1 
ATOM   150  O  OG1 . THR A 1 22  ? 25.688 -3.566  2.978   1.00 62.02  ? 146 THR A OG1 1 
ATOM   151  C  CG2 . THR A 1 22  ? 24.879 -3.024  0.794   1.00 69.25  ? 146 THR A CG2 1 
ATOM   152  N  N   . ASN A 1 23  ? 27.702 -3.772  -1.070  1.00 56.94  ? 147 ASN A N   1 
ATOM   153  C  CA  . ASN A 1 23  ? 27.697 -3.744  -2.525  1.00 61.47  ? 147 ASN A CA  1 
ATOM   154  C  C   . ASN A 1 23  ? 28.135 -5.059  -3.185  1.00 59.21  ? 147 ASN A C   1 
ATOM   155  O  O   . ASN A 1 23  ? 27.503 -5.514  -4.127  1.00 60.73  ? 147 ASN A O   1 
ATOM   156  C  CB  . ASN A 1 23  ? 28.512 -2.561  -3.057  1.00 65.69  ? 147 ASN A CB  1 
ATOM   157  C  CG  . ASN A 1 23  ? 28.685 -2.599  -4.580  1.00 72.69  ? 147 ASN A CG  1 
ATOM   158  O  OD1 . ASN A 1 23  ? 29.808 -2.728  -5.082  1.00 74.96  ? 147 ASN A OD1 1 
ATOM   159  N  ND2 . ASN A 1 23  ? 27.573 -2.499  -5.316  1.00 76.57  ? 147 ASN A ND2 1 
HETATM 160  N  N   . MSE A 1 24  ? 29.196 -5.681  -2.685  1.00 56.68  ? 148 MSE A N   1 
HETATM 161  C  CA  . MSE A 1 24  ? 29.712 -6.885  -3.333  1.00 55.59  ? 148 MSE A CA  1 
HETATM 162  C  C   . MSE A 1 24  ? 29.385 -8.192  -2.597  1.00 50.82  ? 148 MSE A C   1 
HETATM 163  O  O   . MSE A 1 24  ? 29.414 -9.277  -3.191  1.00 50.63  ? 148 MSE A O   1 
HETATM 164  C  CB  . MSE A 1 24  ? 31.209 -6.740  -3.616  1.00 54.82  ? 148 MSE A CB  1 
HETATM 165  C  CG  . MSE A 1 24  ? 32.053 -6.369  -2.425  1.00 55.76  ? 148 MSE A CG  1 
HETATM 166  SE SE  . MSE A 1 24  ? 33.871 -5.825  -2.932  1.00 63.38  ? 148 MSE A SE  1 
HETATM 167  C  CE  . MSE A 1 24  ? 34.603 -7.578  -3.351  1.00 57.37  ? 148 MSE A CE  1 
ATOM   168  N  N   . GLY A 1 25  ? 29.057 -8.081  -1.314  1.00 47.41  ? 149 GLY A N   1 
ATOM   169  C  CA  . GLY A 1 25  ? 28.709 -9.236  -0.492  1.00 44.20  ? 149 GLY A CA  1 
ATOM   170  C  C   . GLY A 1 25  ? 29.898 -10.018 0.059   1.00 41.40  ? 149 GLY A C   1 
ATOM   171  O  O   . GLY A 1 25  ? 29.711 -11.080 0.640   1.00 42.35  ? 149 GLY A O   1 
ATOM   172  N  N   . ALA A 1 26  ? 31.113 -9.500  -0.119  1.00 35.34  ? 150 ALA A N   1 
ATOM   173  C  CA  . ALA A 1 26  ? 32.327 -10.164 0.382   1.00 33.65  ? 150 ALA A CA  1 
ATOM   174  C  C   . ALA A 1 26  ? 32.679 -9.745  1.815   1.00 30.80  ? 150 ALA A C   1 
ATOM   175  O  O   . ALA A 1 26  ? 32.396 -8.617  2.234   1.00 31.52  ? 150 ALA A O   1 
ATOM   176  C  CB  . ALA A 1 26  ? 33.486 -9.879  -0.537  1.00 34.09  ? 150 ALA A CB  1 
ATOM   177  N  N   . TRP A 1 27  ? 33.305 -10.646 2.552   1.00 31.03  ? 151 TRP A N   1 
ATOM   178  C  CA  . TRP A 1 27  ? 33.678 -10.411 3.964   1.00 30.85  ? 151 TRP A CA  1 
ATOM   179  C  C   . TRP A 1 27  ? 35.136 -9.964  4.134   1.00 33.10  ? 151 TRP A C   1 
ATOM   180  O  O   . TRP A 1 27  ? 36.070 -10.563 3.537   1.00 33.20  ? 151 TRP A O   1 
ATOM   181  C  CB  . TRP A 1 27  ? 33.445 -11.670 4.772   1.00 29.97  ? 151 TRP A CB  1 
ATOM   182  C  CG  . TRP A 1 27  ? 31.997 -11.955 4.989   1.00 34.19  ? 151 TRP A CG  1 
ATOM   183  C  CD1 . TRP A 1 27  ? 31.176 -12.698 4.183   1.00 33.66  ? 151 TRP A CD1 1 
ATOM   184  C  CD2 . TRP A 1 27  ? 31.188 -11.518 6.098   1.00 36.92  ? 151 TRP A CD2 1 
ATOM   185  N  NE1 . TRP A 1 27  ? 29.913 -12.741 4.711   1.00 36.64  ? 151 TRP A NE1 1 
ATOM   186  C  CE2 . TRP A 1 27  ? 29.886 -12.027 5.885   1.00 37.86  ? 151 TRP A CE2 1 
ATOM   187  C  CE3 . TRP A 1 27  ? 31.440 -10.747 7.254   1.00 32.93  ? 151 TRP A CE3 1 
ATOM   188  C  CZ2 . TRP A 1 27  ? 28.831 -11.798 6.787   1.00 35.02  ? 151 TRP A CZ2 1 
ATOM   189  C  CZ3 . TRP A 1 27  ? 30.386 -10.490 8.131   1.00 30.29  ? 151 TRP A CZ3 1 
ATOM   190  C  CH2 . TRP A 1 27  ? 29.101 -11.025 7.897   1.00 33.87  ? 151 TRP A CH2 1 
ATOM   191  N  N   . PHE A 1 28  ? 35.338 -8.926  4.955   1.00 31.09  ? 152 PHE A N   1 
ATOM   192  C  CA  . PHE A 1 28  ? 36.674 -8.359  5.145   1.00 33.15  ? 152 PHE A CA  1 
ATOM   193  C  C   . PHE A 1 28  ? 37.021 -8.266  6.622   1.00 34.67  ? 152 PHE A C   1 
ATOM   194  O  O   . PHE A 1 28  ? 36.138 -8.006  7.442   1.00 36.60  ? 152 PHE A O   1 
ATOM   195  C  CB  . PHE A 1 28  ? 36.770 -6.975  4.497   1.00 31.60  ? 152 PHE A CB  1 
ATOM   196  C  CG  . PHE A 1 28  ? 36.553 -6.977  3.010   1.00 32.13  ? 152 PHE A CG  1 
ATOM   197  C  CD1 . PHE A 1 28  ? 37.640 -7.006  2.131   1.00 33.84  ? 152 PHE A CD1 1 
ATOM   198  C  CD2 . PHE A 1 28  ? 35.265 -6.931  2.476   1.00 32.35  ? 152 PHE A CD2 1 
ATOM   199  C  CE1 . PHE A 1 28  ? 37.439 -7.018  0.747   1.00 36.90  ? 152 PHE A CE1 1 
ATOM   200  C  CE2 . PHE A 1 28  ? 35.060 -6.917  1.095   1.00 35.02  ? 152 PHE A CE2 1 
ATOM   201  C  CZ  . PHE A 1 28  ? 36.139 -6.966  0.235   1.00 35.77  ? 152 PHE A CZ  1 
ATOM   202  N  N   . GLU A 1 29  ? 38.291 -8.483  6.972   1.00 36.57  ? 153 GLU A N   1 
ATOM   203  C  CA  . GLU A 1 29  ? 38.732 -8.275  8.357   1.00 38.76  ? 153 GLU A CA  1 
ATOM   204  C  C   . GLU A 1 29  ? 38.584 -6.813  8.689   1.00 38.03  ? 153 GLU A C   1 
ATOM   205  O  O   . GLU A 1 29  ? 38.944 -5.942  7.873   1.00 37.67  ? 153 GLU A O   1 
ATOM   206  C  CB  . GLU A 1 29  ? 40.198 -8.665  8.591   1.00 42.81  ? 153 GLU A CB  1 
ATOM   207  C  CG  . GLU A 1 29  ? 40.585 -10.045 8.078   1.00 49.25  ? 153 GLU A CG  1 
ATOM   208  C  CD  . GLU A 1 29  ? 41.132 -10.000 6.647   1.00 53.99  ? 153 GLU A CD  1 
ATOM   209  O  OE1 . GLU A 1 29  ? 40.404 -9.540  5.705   1.00 45.39  ? 153 GLU A OE1 1 
ATOM   210  O  OE2 . GLU A 1 29  ? 42.306 -10.422 6.489   1.00 53.14  ? 153 GLU A OE2 1 
ATOM   211  N  N   . ALA A 1 30  ? 38.070 -6.552  9.889   1.00 36.50  ? 154 ALA A N   1 
ATOM   212  C  CA  . ALA A 1 30  ? 37.756 -5.192  10.302  1.00 37.87  ? 154 ALA A CA  1 
ATOM   213  C  C   . ALA A 1 30  ? 37.776 -5.016  11.827  1.00 39.93  ? 154 ALA A C   1 
ATOM   214  O  O   . ALA A 1 30  ? 38.028 -5.966  12.586  1.00 39.73  ? 154 ALA A O   1 
ATOM   215  C  CB  . ALA A 1 30  ? 36.401 -4.769  9.703   1.00 35.80  ? 154 ALA A CB  1 
ATOM   216  N  N   . GLN A 1 31  ? 37.532 -3.794  12.278  1.00 41.46  ? 155 GLN A N   1 
ATOM   217  C  CA  . GLN A 1 31  ? 37.560 -3.517  13.722  1.00 44.50  ? 155 GLN A CA  1 
ATOM   218  C  C   . GLN A 1 31  ? 36.462 -2.540  14.103  1.00 42.81  ? 155 GLN A C   1 
ATOM   219  O  O   . GLN A 1 31  ? 36.229 -1.564  13.410  1.00 43.47  ? 155 GLN A O   1 
ATOM   220  C  CB  . GLN A 1 31  ? 38.940 -3.011  14.174  1.00 45.09  ? 155 GLN A CB  1 
ATOM   221  C  CG  . GLN A 1 31  ? 39.119 -2.996  15.675  1.00 45.91  ? 155 GLN A CG  1 
ATOM   222  C  CD  . GLN A 1 31  ? 40.404 -2.328  16.096  1.00 51.74  ? 155 GLN A CD  1 
ATOM   223  O  OE1 . GLN A 1 31  ? 41.191 -1.904  15.256  1.00 53.49  ? 155 GLN A OE1 1 
ATOM   224  N  NE2 . GLN A 1 31  ? 40.632 -2.236  17.403  1.00 55.52  ? 155 GLN A NE2 1 
ATOM   225  N  N   . VAL A 1 32  ? 35.779 -2.842  15.200  1.00 44.18  ? 156 VAL A N   1 
ATOM   226  C  CA  . VAL A 1 32  ? 34.666 -2.034  15.667  1.00 43.68  ? 156 VAL A CA  1 
ATOM   227  C  C   . VAL A 1 32  ? 35.239 -0.809  16.346  1.00 47.52  ? 156 VAL A C   1 
ATOM   228  O  O   . VAL A 1 32  ? 36.010 -0.925  17.319  1.00 48.62  ? 156 VAL A O   1 
ATOM   229  C  CB  . VAL A 1 32  ? 33.769 -2.804  16.672  1.00 44.34  ? 156 VAL A CB  1 
ATOM   230  C  CG1 . VAL A 1 32  ? 32.662 -1.893  17.190  1.00 43.07  ? 156 VAL A CG1 1 
ATOM   231  C  CG2 . VAL A 1 32  ? 33.182 -4.086  16.029  1.00 41.80  ? 156 VAL A CG2 1 
ATOM   232  N  N   . VAL A 1 33  ? 34.879 0.363   15.824  1.00 46.31  ? 157 VAL A N   1 
ATOM   233  C  CA  . VAL A 1 33  ? 35.365 1.610   16.395  1.00 50.30  ? 157 VAL A CA  1 
ATOM   234  C  C   . VAL A 1 33  ? 34.361 2.212   17.388  1.00 50.77  ? 157 VAL A C   1 
ATOM   235  O  O   . VAL A 1 33  ? 34.767 2.737   18.413  1.00 54.36  ? 157 VAL A O   1 
ATOM   236  C  CB  . VAL A 1 33  ? 35.800 2.646   15.325  1.00 50.80  ? 157 VAL A CB  1 
ATOM   237  C  CG1 . VAL A 1 33  ? 36.941 3.439   15.862  1.00 57.00  ? 157 VAL A CG1 1 
ATOM   238  C  CG2 . VAL A 1 33  ? 36.248 1.953   14.050  1.00 51.71  ? 157 VAL A CG2 1 
ATOM   239  N  N   . ARG A 1 34  ? 33.067 2.152   17.069  1.00 48.97  ? 158 ARG A N   1 
ATOM   240  C  CA  . ARG A 1 34  ? 32.006 2.422   18.049  1.00 50.50  ? 158 ARG A CA  1 
ATOM   241  C  C   . ARG A 1 34  ? 30.751 1.599   17.789  1.00 47.48  ? 158 ARG A C   1 
ATOM   242  O  O   . ARG A 1 34  ? 30.559 1.052   16.706  1.00 42.99  ? 158 ARG A O   1 
ATOM   243  C  CB  . ARG A 1 34  ? 31.678 3.938   18.252  1.00 54.23  ? 158 ARG A CB  1 
ATOM   244  C  CG  . ARG A 1 34  ? 31.609 4.832   16.999  1.00 56.12  ? 158 ARG A CG  1 
ATOM   245  C  CD  . ARG A 1 34  ? 31.480 6.350   17.353  1.00 59.10  ? 158 ARG A CD  1 
ATOM   246  N  NE  . ARG A 1 34  ? 30.167 6.722   17.889  1.00 66.80  ? 158 ARG A NE  1 
ATOM   247  C  CZ  . ARG A 1 34  ? 29.945 7.324   19.071  1.00 76.30  ? 158 ARG A CZ  1 
ATOM   248  N  NH1 . ARG A 1 34  ? 28.698 7.610   19.449  1.00 79.45  ? 158 ARG A NH1 1 
ATOM   249  N  NH2 . ARG A 1 34  ? 30.946 7.671   19.880  1.00 76.98  ? 158 ARG A NH2 1 
ATOM   250  N  N   . VAL A 1 35  ? 29.927 1.483   18.826  1.00 49.25  ? 159 VAL A N   1 
ATOM   251  C  CA  . VAL A 1 35  ? 28.672 0.734   18.774  1.00 48.21  ? 159 VAL A CA  1 
ATOM   252  C  C   . VAL A 1 35  ? 27.547 1.673   19.202  1.00 51.65  ? 159 VAL A C   1 
ATOM   253  O  O   . VAL A 1 35  ? 27.610 2.258   20.277  1.00 51.62  ? 159 VAL A O   1 
ATOM   254  C  CB  . VAL A 1 35  ? 28.707 -0.486  19.726  1.00 47.71  ? 159 VAL A CB  1 
ATOM   255  C  CG1 . VAL A 1 35  ? 27.594 -1.431  19.404  1.00 48.25  ? 159 VAL A CG1 1 
ATOM   256  C  CG2 . VAL A 1 35  ? 30.006 -1.217  19.619  1.00 46.36  ? 159 VAL A CG2 1 
ATOM   257  N  N   . THR A 1 36  ? 26.540 1.836   18.350  1.00 53.55  ? 160 THR A N   1 
ATOM   258  C  CA  . THR A 1 36  ? 25.387 2.683   18.665  1.00 58.87  ? 160 THR A CA  1 
ATOM   259  C  C   . THR A 1 36  ? 24.076 1.909   18.522  1.00 62.06  ? 160 THR A C   1 
ATOM   260  O  O   . THR A 1 36  ? 24.061 0.808   17.984  1.00 59.82  ? 160 THR A O   1 
ATOM   261  C  CB  . THR A 1 36  ? 25.345 3.959   17.790  1.00 60.11  ? 160 THR A CB  1 
ATOM   262  O  OG1 . THR A 1 36  ? 25.312 3.605   16.399  1.00 58.55  ? 160 THR A OG1 1 
ATOM   263  C  CG2 . THR A 1 36  ? 26.555 4.839   18.065  1.00 61.07  ? 160 THR A CG2 1 
ATOM   264  N  N   . ARG A 1 37  ? 22.979 2.489   19.002  1.00 68.64  ? 161 ARG A N   1 
ATOM   265  C  CA  . ARG A 1 37  ? 21.676 1.829   18.958  1.00 74.27  ? 161 ARG A CA  1 
ATOM   266  C  C   . ARG A 1 37  ? 20.781 2.458   17.896  1.00 78.65  ? 161 ARG A C   1 
ATOM   267  O  O   . ARG A 1 37  ? 20.449 3.639   17.995  1.00 83.34  ? 161 ARG A O   1 
ATOM   268  C  CB  . ARG A 1 37  ? 20.990 1.897   20.330  1.00 78.10  ? 161 ARG A CB  1 
ATOM   269  N  N   . LYS A 1 38  ? 20.400 1.670   16.886  1.00 79.18  ? 162 LYS A N   1 
ATOM   270  C  CA  . LYS A 1 38  ? 19.409 2.095   15.880  1.00 83.41  ? 162 LYS A CA  1 
ATOM   271  C  C   . LYS A 1 38  ? 18.006 2.158   16.483  1.00 89.59  ? 162 LYS A C   1 
ATOM   272  O  O   . LYS A 1 38  ? 17.386 3.217   16.526  1.00 94.65  ? 162 LYS A O   1 
ATOM   273  C  CB  . LYS A 1 38  ? 19.405 1.151   14.673  1.00 81.31  ? 162 LYS A CB  1 
ATOM   274  N  N   . GLU A 1 56  ? 20.737 -6.710  18.853  1.00 103.39 ? 180 GLU A N   1 
ATOM   275  C  CA  . GLU A 1 56  ? 19.839 -7.245  17.830  1.00 106.78 ? 180 GLU A CA  1 
ATOM   276  C  C   . GLU A 1 56  ? 19.648 -6.264  16.664  1.00 102.80 ? 180 GLU A C   1 
ATOM   277  O  O   . GLU A 1 56  ? 19.816 -6.635  15.497  1.00 102.66 ? 180 GLU A O   1 
ATOM   278  C  CB  . GLU A 1 56  ? 18.471 -7.627  18.426  1.00 115.02 ? 180 GLU A CB  1 
ATOM   279  C  CG  . GLU A 1 56  ? 18.431 -7.853  19.948  1.00 118.85 ? 180 GLU A CG  1 
ATOM   280  C  CD  . GLU A 1 56  ? 17.734 -6.718  20.692  1.00 120.09 ? 180 GLU A CD  1 
ATOM   281  O  OE1 . GLU A 1 56  ? 16.548 -6.443  20.391  1.00 123.79 ? 180 GLU A OE1 1 
ATOM   282  O  OE2 . GLU A 1 56  ? 18.361 -6.109  21.587  1.00 117.76 ? 180 GLU A OE2 1 
ATOM   283  N  N   . ASP A 1 57  ? 19.277 -5.021  16.987  1.00 99.71  ? 181 ASP A N   1 
ATOM   284  C  CA  . ASP A 1 57  ? 19.167 -3.949  15.992  1.00 95.22  ? 181 ASP A CA  1 
ATOM   285  C  C   . ASP A 1 57  ? 20.209 -2.849  16.255  1.00 88.19  ? 181 ASP A C   1 
ATOM   286  O  O   . ASP A 1 57  ? 19.934 -1.655  16.106  1.00 86.75  ? 181 ASP A O   1 
ATOM   287  C  CB  . ASP A 1 57  ? 17.749 -3.371  15.969  1.00 100.41 ? 181 ASP A CB  1 
ATOM   288  N  N   . VAL A 1 58  ? 21.406 -3.283  16.650  1.00 83.28  ? 182 VAL A N   1 
ATOM   289  C  CA  . VAL A 1 58  ? 22.551 -2.408  16.918  1.00 75.85  ? 182 VAL A CA  1 
ATOM   290  C  C   . VAL A 1 58  ? 23.219 -2.003  15.603  1.00 70.29  ? 182 VAL A C   1 
ATOM   291  O  O   . VAL A 1 58  ? 23.090 -2.705  14.599  1.00 70.62  ? 182 VAL A O   1 
ATOM   292  C  CB  . VAL A 1 58  ? 23.585 -3.136  17.827  1.00 75.40  ? 182 VAL A CB  1 
ATOM   293  C  CG1 . VAL A 1 58  ? 24.837 -2.323  18.006  1.00 71.16  ? 182 VAL A CG1 1 
ATOM   294  C  CG2 . VAL A 1 58  ? 22.976 -3.451  19.187  1.00 81.55  ? 182 VAL A CG2 1 
ATOM   295  N  N   . ILE A 1 59  ? 23.913 -0.865  15.614  1.00 63.94  ? 183 ILE A N   1 
ATOM   296  C  CA  . ILE A 1 59  ? 24.724 -0.439  14.480  1.00 58.19  ? 183 ILE A CA  1 
ATOM   297  C  C   . ILE A 1 59  ? 26.211 -0.430  14.855  1.00 53.35  ? 183 ILE A C   1 
ATOM   298  O  O   . ILE A 1 59  ? 26.609 0.179   15.839  1.00 51.62  ? 183 ILE A O   1 
ATOM   299  C  CB  . ILE A 1 59  ? 24.304 0.960   13.949  1.00 58.42  ? 183 ILE A CB  1 
ATOM   300  C  CG1 . ILE A 1 59  ? 22.839 0.966   13.489  1.00 62.82  ? 183 ILE A CG1 1 
ATOM   301  C  CG2 . ILE A 1 59  ? 25.260 1.450   12.832  1.00 53.81  ? 183 ILE A CG2 1 
ATOM   302  C  CD1 . ILE A 1 59  ? 22.560 0.216   12.183  1.00 66.09  ? 183 ILE A CD1 1 
ATOM   303  N  N   . TYR A 1 60  ? 27.021 -1.116  14.056  1.00 50.08  ? 184 TYR A N   1 
ATOM   304  C  CA  . TYR A 1 60  ? 28.455 -1.157  14.271  1.00 45.15  ? 184 TYR A CA  1 
ATOM   305  C  C   . TYR A 1 60  ? 29.134 -0.136  13.382  1.00 43.39  ? 184 TYR A C   1 
ATOM   306  O  O   . TYR A 1 60  ? 28.840 -0.049  12.184  1.00 43.76  ? 184 TYR A O   1 
ATOM   307  C  CB  . TYR A 1 60  ? 29.002 -2.566  14.011  1.00 43.39  ? 184 TYR A CB  1 
ATOM   308  C  CG  . TYR A 1 60  ? 28.484 -3.549  15.027  1.00 46.80  ? 184 TYR A CG  1 
ATOM   309  C  CD1 . TYR A 1 60  ? 28.959 -3.532  16.336  1.00 45.83  ? 184 TYR A CD1 1 
ATOM   310  C  CD2 . TYR A 1 60  ? 27.469 -4.458  14.702  1.00 48.85  ? 184 TYR A CD2 1 
ATOM   311  C  CE1 . TYR A 1 60  ? 28.466 -4.405  17.285  1.00 50.91  ? 184 TYR A CE1 1 
ATOM   312  C  CE2 . TYR A 1 60  ? 26.973 -5.343  15.647  1.00 52.57  ? 184 TYR A CE2 1 
ATOM   313  C  CZ  . TYR A 1 60  ? 27.477 -5.306  16.938  1.00 54.21  ? 184 TYR A CZ  1 
ATOM   314  O  OH  . TYR A 1 60  ? 27.003 -6.170  17.892  1.00 57.70  ? 184 TYR A OH  1 
ATOM   315  N  N   . HIS A 1 61  ? 30.025 0.651   13.973  1.00 40.59  ? 185 HIS A N   1 
ATOM   316  C  CA  . HIS A 1 61  ? 30.845 1.553   13.186  1.00 40.88  ? 185 HIS A CA  1 
ATOM   317  C  C   . HIS A 1 61  ? 32.219 0.928   13.067  1.00 38.20  ? 185 HIS A C   1 
ATOM   318  O  O   . HIS A 1 61  ? 32.902 0.731   14.059  1.00 38.43  ? 185 HIS A O   1 
ATOM   319  C  CB  . HIS A 1 61  ? 30.871 2.954   13.785  1.00 40.62  ? 185 HIS A CB  1 
ATOM   320  C  CG  . HIS A 1 61  ? 29.505 3.536   13.958  1.00 49.42  ? 185 HIS A CG  1 
ATOM   321  N  ND1 . HIS A 1 61  ? 28.902 4.324   12.998  1.00 53.38  ? 185 HIS A ND1 1 
ATOM   322  C  CD2 . HIS A 1 61  ? 28.605 3.413   14.966  1.00 52.77  ? 185 HIS A CD2 1 
ATOM   323  C  CE1 . HIS A 1 61  ? 27.700 4.680   13.417  1.00 55.29  ? 185 HIS A CE1 1 
ATOM   324  N  NE2 . HIS A 1 61  ? 27.496 4.142   14.609  1.00 57.26  ? 185 HIS A NE2 1 
ATOM   325  N  N   . VAL A 1 62  ? 32.609 0.639   11.831  1.00 35.62  ? 186 VAL A N   1 
ATOM   326  C  CA  . VAL A 1 62  ? 33.673 -0.316  11.545  1.00 36.88  ? 186 VAL A CA  1 
ATOM   327  C  C   . VAL A 1 62  ? 34.736 0.318   10.651  1.00 36.15  ? 186 VAL A C   1 
ATOM   328  O  O   . VAL A 1 62  ? 34.418 1.104   9.768   1.00 36.59  ? 186 VAL A O   1 
ATOM   329  C  CB  . VAL A 1 62  ? 33.029 -1.617  10.902  1.00 37.65  ? 186 VAL A CB  1 
ATOM   330  C  CG1 . VAL A 1 62  ? 33.810 -2.147  9.769   1.00 37.52  ? 186 VAL A CG1 1 
ATOM   331  C  CG2 . VAL A 1 62  ? 32.755 -2.681  11.944  1.00 37.07  ? 186 VAL A CG2 1 
ATOM   332  N  N   . LYS A 1 63  ? 35.999 -0.003  10.897  1.00 37.83  ? 187 LYS A N   1 
ATOM   333  C  CA  . LYS A 1 63  ? 37.076 0.328   9.952   1.00 38.70  ? 187 LYS A CA  1 
ATOM   334  C  C   . LYS A 1 63  ? 37.698 -0.978  9.460   1.00 38.78  ? 187 LYS A C   1 
ATOM   335  O  O   . LYS A 1 63  ? 37.835 -1.928  10.235  1.00 41.03  ? 187 LYS A O   1 
ATOM   336  C  CB  . LYS A 1 63  ? 38.146 1.225   10.589  1.00 38.19  ? 187 LYS A CB  1 
ATOM   337  C  CG  . LYS A 1 63  ? 38.913 0.548   11.710  1.00 42.86  ? 187 LYS A CG  1 
ATOM   338  C  CD  . LYS A 1 63  ? 39.819 1.498   12.451  1.00 49.04  ? 187 LYS A CD  1 
ATOM   339  C  CE  . LYS A 1 63  ? 40.562 0.763   13.543  1.00 51.32  ? 187 LYS A CE  1 
ATOM   340  N  NZ  . LYS A 1 63  ? 41.282 1.706   14.428  1.00 54.03  ? 187 LYS A NZ  1 
ATOM   341  N  N   . TYR A 1 64  ? 38.060 -1.014  8.180   1.00 37.56  ? 188 TYR A N   1 
ATOM   342  C  CA  . TYR A 1 64  ? 38.669 -2.186  7.569   1.00 38.95  ? 188 TYR A CA  1 
ATOM   343  C  C   . TYR A 1 64  ? 40.176 -2.209  7.845   1.00 40.83  ? 188 TYR A C   1 
ATOM   344  O  O   . TYR A 1 64  ? 40.838 -1.173  7.789   1.00 42.06  ? 188 TYR A O   1 
ATOM   345  C  CB  . TYR A 1 64  ? 38.417 -2.163  6.065   1.00 41.52  ? 188 TYR A CB  1 
ATOM   346  C  CG  . TYR A 1 64  ? 36.961 -2.371  5.659   1.00 44.73  ? 188 TYR A CG  1 
ATOM   347  C  CD1 . TYR A 1 64  ? 36.206 -1.338  5.077   1.00 46.51  ? 188 TYR A CD1 1 
ATOM   348  C  CD2 . TYR A 1 64  ? 36.341 -3.609  5.849   1.00 46.26  ? 188 TYR A CD2 1 
ATOM   349  C  CE1 . TYR A 1 64  ? 34.848 -1.550  4.693   1.00 45.17  ? 188 TYR A CE1 1 
ATOM   350  C  CE2 . TYR A 1 64  ? 35.016 -3.826  5.478   1.00 47.08  ? 188 TYR A CE2 1 
ATOM   351  C  CZ  . TYR A 1 64  ? 34.277 -2.804  4.903   1.00 47.38  ? 188 TYR A CZ  1 
ATOM   352  O  OH  . TYR A 1 64  ? 32.970 -3.074  4.553   1.00 52.58  ? 188 TYR A OH  1 
ATOM   353  N  N   . ASP A 1 65  ? 40.716 -3.385  8.147   1.00 41.39  ? 189 ASP A N   1 
ATOM   354  C  CA  . ASP A 1 65  ? 42.134 -3.526  8.443   1.00 42.41  ? 189 ASP A CA  1 
ATOM   355  C  C   . ASP A 1 65  ? 43.034 -3.093  7.302   1.00 42.94  ? 189 ASP A C   1 
ATOM   356  O  O   . ASP A 1 65  ? 43.974 -2.348  7.524   1.00 43.04  ? 189 ASP A O   1 
ATOM   357  C  CB  . ASP A 1 65  ? 42.451 -4.959  8.853   1.00 45.19  ? 189 ASP A CB  1 
ATOM   358  C  CG  . ASP A 1 65  ? 42.049 -5.256  10.290  1.00 50.76  ? 189 ASP A CG  1 
ATOM   359  O  OD1 . ASP A 1 65  ? 41.258 -4.485  10.879  1.00 50.61  ? 189 ASP A OD1 1 
ATOM   360  O  OD2 . ASP A 1 65  ? 42.527 -6.278  10.833  1.00 59.78  ? 189 ASP A OD2 1 
ATOM   361  N  N   . ASP A 1 66  ? 42.739 -3.540  6.083   1.00 43.75  ? 190 ASP A N   1 
ATOM   362  C  CA  . ASP A 1 66  ? 43.602 -3.238  4.940   1.00 46.93  ? 190 ASP A CA  1 
ATOM   363  C  C   . ASP A 1 66  ? 43.102 -2.118  4.025   1.00 45.71  ? 190 ASP A C   1 
ATOM   364  O  O   . ASP A 1 66  ? 43.677 -1.887  2.949   1.00 45.64  ? 190 ASP A O   1 
ATOM   365  C  CB  . ASP A 1 66  ? 43.894 -4.510  4.141   1.00 48.39  ? 190 ASP A CB  1 
ATOM   366  C  CG  . ASP A 1 66  ? 44.446 -5.606  5.012   1.00 54.92  ? 190 ASP A CG  1 
ATOM   367  O  OD1 . ASP A 1 66  ? 45.394 -5.307  5.782   1.00 59.19  ? 190 ASP A OD1 1 
ATOM   368  O  OD2 . ASP A 1 66  ? 43.918 -6.747  4.953   1.00 56.83  ? 190 ASP A OD2 1 
ATOM   369  N  N   . TYR A 1 67  ? 42.054 -1.417  4.457   1.00 43.74  ? 191 TYR A N   1 
ATOM   370  C  CA  . TYR A 1 67  ? 41.491 -0.325  3.652   1.00 43.15  ? 191 TYR A CA  1 
ATOM   371  C  C   . TYR A 1 67  ? 41.161 0.929   4.492   1.00 42.98  ? 191 TYR A C   1 
ATOM   372  O  O   . TYR A 1 67  ? 39.980 1.310   4.609   1.00 43.66  ? 191 TYR A O   1 
ATOM   373  C  CB  . TYR A 1 67  ? 40.256 -0.828  2.889   1.00 41.35  ? 191 TYR A CB  1 
ATOM   374  C  CG  . TYR A 1 67  ? 40.519 -2.059  2.047   1.00 42.85  ? 191 TYR A CG  1 
ATOM   375  C  CD1 . TYR A 1 67  ? 40.840 -1.947  0.684   1.00 43.88  ? 191 TYR A CD1 1 
ATOM   376  C  CD2 . TYR A 1 67  ? 40.436 -3.349  2.606   1.00 42.73  ? 191 TYR A CD2 1 
ATOM   377  C  CE1 . TYR A 1 67  ? 41.082 -3.091  -0.103  1.00 44.99  ? 191 TYR A CE1 1 
ATOM   378  C  CE2 . TYR A 1 67  ? 40.681 -4.493  1.833   1.00 43.46  ? 191 TYR A CE2 1 
ATOM   379  C  CZ  . TYR A 1 67  ? 41.000 -4.360  0.482   1.00 46.60  ? 191 TYR A CZ  1 
ATOM   380  O  OH  . TYR A 1 67  ? 41.239 -5.494  -0.274  1.00 49.02  ? 191 TYR A OH  1 
ATOM   381  N  N   . PRO A 1 68  ? 42.196 1.584   5.071   1.00 42.33  ? 192 PRO A N   1 
ATOM   382  C  CA  . PRO A 1 68  ? 41.966 2.775   5.894   1.00 41.64  ? 192 PRO A CA  1 
ATOM   383  C  C   . PRO A 1 68  ? 41.347 3.956   5.130   1.00 42.40  ? 192 PRO A C   1 
ATOM   384  O  O   . PRO A 1 68  ? 40.634 4.779   5.714   1.00 39.91  ? 192 PRO A O   1 
ATOM   385  C  CB  . PRO A 1 68  ? 43.379 3.161   6.362   1.00 45.54  ? 192 PRO A CB  1 
ATOM   386  C  CG  . PRO A 1 68  ? 44.313 2.523   5.408   1.00 42.60  ? 192 PRO A CG  1 
ATOM   387  C  CD  . PRO A 1 68  ? 43.634 1.257   4.973   1.00 43.84  ? 192 PRO A CD  1 
ATOM   388  N  N   . GLU A 1 69  ? 41.637 4.039   3.837   1.00 44.51  ? 193 GLU A N   1 
ATOM   389  C  CA  . GLU A 1 69  ? 41.128 5.112   2.983   1.00 47.63  ? 193 GLU A CA  1 
ATOM   390  C  C   . GLU A 1 69  ? 39.604 5.042   2.766   1.00 46.41  ? 193 GLU A C   1 
ATOM   391  O  O   . GLU A 1 69  ? 39.005 5.978   2.234   1.00 49.45  ? 193 GLU A O   1 
ATOM   392  C  CB  . GLU A 1 69  ? 41.874 5.115   1.639   1.00 49.68  ? 193 GLU A CB  1 
ATOM   393  C  CG  . GLU A 1 69  ? 41.532 3.934   0.718   1.00 55.78  ? 193 GLU A CG  1 
ATOM   394  C  CD  . GLU A 1 69  ? 42.216 2.617   1.105   1.00 59.35  ? 193 GLU A CD  1 
ATOM   395  O  OE1 . GLU A 1 69  ? 42.044 1.640   0.347   1.00 63.97  ? 193 GLU A OE1 1 
ATOM   396  O  OE2 . GLU A 1 69  ? 42.920 2.548   2.145   1.00 58.93  ? 193 GLU A OE2 1 
ATOM   397  N  N   . ASN A 1 70  ? 38.991 3.934   3.175   1.00 43.70  ? 194 ASN A N   1 
ATOM   398  C  CA  . ASN A 1 70  ? 37.538 3.778   3.123   1.00 43.38  ? 194 ASN A CA  1 
ATOM   399  C  C   . ASN A 1 70  ? 36.819 4.359   4.343   1.00 41.36  ? 194 ASN A C   1 
ATOM   400  O  O   . ASN A 1 70  ? 35.586 4.409   4.380   1.00 41.70  ? 194 ASN A O   1 
ATOM   401  C  CB  . ASN A 1 70  ? 37.167 2.305   2.943   1.00 44.71  ? 194 ASN A CB  1 
ATOM   402  C  CG  . ASN A 1 70  ? 37.221 1.868   1.501   1.00 47.93  ? 194 ASN A CG  1 
ATOM   403  O  OD1 . ASN A 1 70  ? 36.204 1.880   0.813   1.00 54.30  ? 194 ASN A OD1 1 
ATOM   404  N  ND2 . ASN A 1 70  ? 38.411 1.492   1.024   1.00 49.98  ? 194 ASN A ND2 1 
ATOM   405  N  N   . GLY A 1 71  ? 37.597 4.793   5.330   1.00 38.63  ? 195 GLY A N   1 
ATOM   406  C  CA  . GLY A 1 71  ? 37.072 5.470   6.495   1.00 36.43  ? 195 GLY A CA  1 
ATOM   407  C  C   . GLY A 1 71  ? 36.377 4.561   7.479   1.00 36.38  ? 195 GLY A C   1 
ATOM   408  O  O   . GLY A 1 71  ? 36.684 3.370   7.564   1.00 33.33  ? 195 GLY A O   1 
ATOM   409  N  N   . VAL A 1 72  ? 35.436 5.141   8.232   1.00 37.87  ? 196 VAL A N   1 
ATOM   410  C  CA  . VAL A 1 72  ? 34.577 4.394   9.140   1.00 35.22  ? 196 VAL A CA  1 
ATOM   411  C  C   . VAL A 1 72  ? 33.211 4.195   8.490   1.00 37.11  ? 196 VAL A C   1 
ATOM   412  O  O   . VAL A 1 72  ? 32.598 5.154   8.010   1.00 39.35  ? 196 VAL A O   1 
ATOM   413  C  CB  . VAL A 1 72  ? 34.410 5.115   10.493  1.00 36.96  ? 196 VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 72  ? 33.287 4.480   11.283  1.00 29.88  ? 196 VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 72  ? 35.727 5.089   11.280  1.00 35.46  ? 196 VAL A CG2 1 
ATOM   416  N  N   . VAL A 1 73  ? 32.733 2.957   8.499   1.00 36.14  ? 197 VAL A N   1 
ATOM   417  C  CA  . VAL A 1 73  ? 31.505 2.583   7.802   1.00 40.00  ? 197 VAL A CA  1 
ATOM   418  C  C   . VAL A 1 73  ? 30.488 2.021   8.797   1.00 40.51  ? 197 VAL A C   1 
ATOM   419  O  O   . VAL A 1 73  ? 30.848 1.300   9.728   1.00 39.95  ? 197 VAL A O   1 
ATOM   420  C  CB  . VAL A 1 73  ? 31.813 1.548   6.638   1.00 41.16  ? 197 VAL A CB  1 
ATOM   421  C  CG1 . VAL A 1 73  ? 30.528 1.038   5.969   1.00 43.18  ? 197 VAL A CG1 1 
ATOM   422  C  CG2 . VAL A 1 73  ? 32.700 2.193   5.603   1.00 38.80  ? 197 VAL A CG2 1 
ATOM   423  N  N   . GLN A 1 74  ? 29.222 2.372   8.597   1.00 43.22  ? 198 GLN A N   1 
ATOM   424  C  CA  . GLN A 1 74  ? 28.128 1.905   9.461   1.00 45.83  ? 198 GLN A CA  1 
ATOM   425  C  C   . GLN A 1 74  ? 27.648 0.540   9.021   1.00 46.85  ? 198 GLN A C   1 
ATOM   426  O  O   . GLN A 1 74  ? 27.296 0.341   7.855   1.00 45.86  ? 198 GLN A O   1 
ATOM   427  C  CB  . GLN A 1 74  ? 26.943 2.865   9.418   1.00 47.66  ? 198 GLN A CB  1 
ATOM   428  C  CG  . GLN A 1 74  ? 27.298 4.287   9.770   1.00 54.04  ? 198 GLN A CG  1 
ATOM   429  C  CD  . GLN A 1 74  ? 26.078 5.157   9.901   1.00 59.85  ? 198 GLN A CD  1 
ATOM   430  O  OE1 . GLN A 1 74  ? 25.703 5.871   8.967   1.00 63.42  ? 198 GLN A OE1 1 
ATOM   431  N  NE2 . GLN A 1 74  ? 25.432 5.090   11.059  1.00 63.87  ? 198 GLN A NE2 1 
HETATM 432  N  N   . MSE A 1 75  ? 27.621 -0.386  9.969   1.00 56.01  ? 199 MSE A N   1 
HETATM 433  C  CA  . MSE A 1 75  ? 27.239 -1.755  9.691   1.00 57.22  ? 199 MSE A CA  1 
HETATM 434  C  C   . MSE A 1 75  ? 25.957 -2.117  10.413  1.00 57.88  ? 199 MSE A C   1 
HETATM 435  O  O   . MSE A 1 75  ? 25.798 -1.837  11.616  1.00 57.15  ? 199 MSE A O   1 
HETATM 436  C  CB  . MSE A 1 75  ? 28.341 -2.724  10.114  1.00 56.13  ? 199 MSE A CB  1 
HETATM 437  C  CG  . MSE A 1 75  ? 29.690 -2.522  9.419   1.00 64.33  ? 199 MSE A CG  1 
HETATM 438  SE SE  . MSE A 1 75  ? 29.788 -2.991  7.510   1.00 78.64  ? 199 MSE A SE  1 
HETATM 439  C  CE  . MSE A 1 75  ? 29.067 -4.741  7.554   1.00 71.77  ? 199 MSE A CE  1 
ATOM   440  N  N   . ASN A 1 76  ? 25.042 -2.731  9.666   1.00 57.58  ? 200 ASN A N   1 
ATOM   441  C  CA  . ASN A 1 76  ? 23.928 -3.444  10.277  1.00 59.00  ? 200 ASN A CA  1 
ATOM   442  C  C   . ASN A 1 76  ? 24.478 -4.698  10.948  1.00 55.96  ? 200 ASN A C   1 
ATOM   443  O  O   . ASN A 1 76  ? 25.388 -5.351  10.411  1.00 52.94  ? 200 ASN A O   1 
ATOM   444  C  CB  . ASN A 1 76  ? 22.866 -3.817  9.244   1.00 60.09  ? 200 ASN A CB  1 
ATOM   445  C  CG  . ASN A 1 76  ? 21.539 -4.184  9.885   1.00 63.27  ? 200 ASN A CG  1 
ATOM   446  O  OD1 . ASN A 1 76  ? 21.215 -5.368  10.063  1.00 63.51  ? 200 ASN A OD1 1 
ATOM   447  N  ND2 . ASN A 1 76  ? 20.767 -3.165  10.252  1.00 67.30  ? 200 ASN A ND2 1 
ATOM   448  N  N   . SER A 1 77  ? 23.936 -5.026  12.117  1.00 55.95  ? 201 SER A N   1 
ATOM   449  C  CA  . SER A 1 77  ? 24.453 -6.147  12.911  1.00 55.56  ? 201 SER A CA  1 
ATOM   450  C  C   . SER A 1 77  ? 24.495 -7.493  12.162  1.00 53.07  ? 201 SER A C   1 
ATOM   451  O  O   . SER A 1 77  ? 25.263 -8.371  12.537  1.00 51.03  ? 201 SER A O   1 
ATOM   452  C  CB  . SER A 1 77  ? 23.698 -6.273  14.235  1.00 57.77  ? 201 SER A CB  1 
ATOM   453  O  OG  . SER A 1 77  ? 22.321 -6.485  14.005  1.00 63.19  ? 201 SER A OG  1 
ATOM   454  N  N   . ARG A 1 78  ? 23.703 -7.644  11.097  1.00 53.53  ? 202 ARG A N   1 
ATOM   455  C  CA  . ARG A 1 78  ? 23.758 -8.864  10.274  1.00 52.83  ? 202 ARG A CA  1 
ATOM   456  C  C   . ARG A 1 78  ? 25.014 -8.928  9.418   1.00 51.37  ? 202 ARG A C   1 
ATOM   457  O  O   . ARG A 1 78  ? 25.352 -9.970  8.866   1.00 51.29  ? 202 ARG A O   1 
ATOM   458  C  CB  . ARG A 1 78  ? 22.502 -9.032  9.404   1.00 53.73  ? 202 ARG A CB  1 
ATOM   459  C  CG  . ARG A 1 78  ? 22.313 -8.016  8.273   1.00 55.66  ? 202 ARG A CG  1 
ATOM   460  C  CD  . ARG A 1 78  ? 20.903 -8.142  7.667   1.00 58.60  ? 202 ARG A CD  1 
ATOM   461  N  NE  . ARG A 1 78  ? 20.181 -6.857  7.664   1.00 61.45  ? 202 ARG A NE  1 
ATOM   462  N  N   . ASP A 1 79  ? 25.716 -7.806  9.326   1.00 51.84  ? 203 ASP A N   1 
ATOM   463  C  CA  . ASP A 1 79  ? 26.859 -7.699  8.431   1.00 49.54  ? 203 ASP A CA  1 
ATOM   464  C  C   . ASP A 1 79  ? 28.203 -7.677  9.152   1.00 46.91  ? 203 ASP A C   1 
ATOM   465  O  O   . ASP A 1 79  ? 29.221 -7.352  8.545   1.00 43.20  ? 203 ASP A O   1 
ATOM   466  C  CB  . ASP A 1 79  ? 26.697 -6.484  7.521   1.00 49.97  ? 203 ASP A CB  1 
ATOM   467  C  CG  . ASP A 1 79  ? 25.550 -6.645  6.546   1.00 54.26  ? 203 ASP A CG  1 
ATOM   468  O  OD1 . ASP A 1 79  ? 25.455 -7.727  5.920   1.00 52.29  ? 203 ASP A OD1 1 
ATOM   469  O  OD2 . ASP A 1 79  ? 24.742 -5.694  6.414   1.00 57.09  ? 203 ASP A OD2 1 
ATOM   470  N  N   . VAL A 1 80  ? 28.192 -8.015  10.444  1.00 45.59  ? 204 VAL A N   1 
ATOM   471  C  CA  . VAL A 1 80  ? 29.424 -8.268  11.184  1.00 42.83  ? 204 VAL A CA  1 
ATOM   472  C  C   . VAL A 1 80  ? 29.327 -9.511  12.078  1.00 44.89  ? 204 VAL A C   1 
ATOM   473  O  O   . VAL A 1 80  ? 28.283 -9.789  12.702  1.00 43.06  ? 204 VAL A O   1 
ATOM   474  C  CB  . VAL A 1 80  ? 30.014 -6.987  11.903  1.00 44.46  ? 204 VAL A CB  1 
ATOM   475  C  CG1 . VAL A 1 80  ? 29.176 -5.752  11.659  1.00 42.39  ? 204 VAL A CG1 1 
ATOM   476  C  CG2 . VAL A 1 80  ? 30.294 -7.201  13.391  1.00 42.71  ? 204 VAL A CG2 1 
ATOM   477  N  N   . ARG A 1 81  ? 30.421 -10.273 12.091  1.00 43.07  ? 205 ARG A N   1 
ATOM   478  C  CA  . ARG A 1 81  ? 30.520 -11.483 12.886  1.00 43.04  ? 205 ARG A CA  1 
ATOM   479  C  C   . ARG A 1 81  ? 31.954 -11.695 13.304  1.00 45.29  ? 205 ARG A C   1 
ATOM   480  O  O   . ARG A 1 81  ? 32.852 -11.042 12.773  1.00 45.38  ? 205 ARG A O   1 
ATOM   481  C  CB  . ARG A 1 81  ? 30.020 -12.697 12.112  1.00 41.29  ? 205 ARG A CB  1 
ATOM   482  C  CG  . ARG A 1 81  ? 30.789 -13.032 10.827  1.00 38.61  ? 205 ARG A CG  1 
ATOM   483  C  CD  . ARG A 1 81  ? 30.040 -14.089 10.041  1.00 31.81  ? 205 ARG A CD  1 
ATOM   484  N  NE  . ARG A 1 81  ? 30.795 -14.535 8.871   1.00 37.01  ? 205 ARG A NE  1 
ATOM   485  C  CZ  . ARG A 1 81  ? 30.250 -14.916 7.710   1.00 38.66  ? 205 ARG A CZ  1 
ATOM   486  N  NH1 . ARG A 1 81  ? 28.926 -14.890 7.543   1.00 32.19  ? 205 ARG A NH1 1 
ATOM   487  N  NH2 . ARG A 1 81  ? 31.034 -15.321 6.703   1.00 38.66  ? 205 ARG A NH2 1 
ATOM   488  N  N   . ALA A 1 82  ? 32.162 -12.587 14.275  1.00 47.85  ? 206 ALA A N   1 
ATOM   489  C  CA  . ALA A 1 82  ? 33.503 -13.016 14.677  1.00 48.00  ? 206 ALA A CA  1 
ATOM   490  C  C   . ALA A 1 82  ? 34.256 -13.473 13.438  1.00 45.06  ? 206 ALA A C   1 
ATOM   491  O  O   . ALA A 1 82  ? 33.652 -14.034 12.546  1.00 45.40  ? 206 ALA A O   1 
ATOM   492  C  CB  . ALA A 1 82  ? 33.414 -14.156 15.697  1.00 48.63  ? 206 ALA A CB  1 
ATOM   493  N  N   . ARG A 1 83  ? 35.559 -13.210 13.390  1.00 43.29  ? 207 ARG A N   1 
ATOM   494  C  CA  . ARG A 1 83  ? 36.423 -13.639 12.304  1.00 42.15  ? 207 ARG A CA  1 
ATOM   495  C  C   . ARG A 1 83  ? 36.508 -15.148 12.153  1.00 44.15  ? 207 ARG A C   1 
ATOM   496  O  O   . ARG A 1 83  ? 36.669 -15.870 13.143  1.00 43.14  ? 207 ARG A O   1 
ATOM   497  C  CB  . ARG A 1 83  ? 37.830 -13.100 12.511  1.00 42.42  ? 207 ARG A CB  1 
ATOM   498  C  CG  . ARG A 1 83  ? 37.895 -11.635 12.222  1.00 47.50  ? 207 ARG A CG  1 
ATOM   499  C  CD  . ARG A 1 83  ? 39.277 -11.190 11.905  1.00 48.21  ? 207 ARG A CD  1 
ATOM   500  N  NE  . ARG A 1 83  ? 39.392 -9.749  12.044  1.00 47.60  ? 207 ARG A NE  1 
ATOM   501  C  CZ  . ARG A 1 83  ? 40.544 -9.097  11.982  1.00 48.12  ? 207 ARG A CZ  1 
ATOM   502  N  NH1 . ARG A 1 83  ? 40.552 -7.778  12.117  1.00 43.26  ? 207 ARG A NH1 1 
ATOM   503  N  NH2 . ARG A 1 83  ? 41.680 -9.773  11.768  1.00 42.97  ? 207 ARG A NH2 1 
ATOM   504  N  N   . ALA A 1 84  ? 36.425 -15.611 10.902  1.00 44.32  ? 208 ALA A N   1 
ATOM   505  C  CA  . ALA A 1 84  ? 36.638 -17.028 10.580  1.00 45.62  ? 208 ALA A CA  1 
ATOM   506  C  C   . ALA A 1 84  ? 37.983 -17.473 11.141  1.00 47.27  ? 208 ALA A C   1 
ATOM   507  O  O   . ALA A 1 84  ? 38.967 -16.744 11.023  1.00 49.32  ? 208 ALA A O   1 
ATOM   508  C  CB  . ALA A 1 84  ? 36.598 -17.245 9.082   1.00 43.18  ? 208 ALA A CB  1 
ATOM   509  N  N   . ARG A 1 85  ? 38.013 -18.648 11.767  1.00 48.02  ? 209 ARG A N   1 
ATOM   510  C  CA  . ARG A 1 85  ? 39.248 -19.217 12.296  1.00 51.02  ? 209 ARG A CA  1 
ATOM   511  C  C   . ARG A 1 85  ? 39.425 -20.684 11.895  1.00 51.13  ? 209 ARG A C   1 
ATOM   512  O  O   . ARG A 1 85  ? 40.544 -21.195 11.886  1.00 52.91  ? 209 ARG A O   1 
ATOM   513  C  CB  . ARG A 1 85  ? 39.342 -19.052 13.829  1.00 52.50  ? 209 ARG A CB  1 
ATOM   514  C  CG  . ARG A 1 85  ? 38.109 -19.478 14.645  1.00 54.51  ? 209 ARG A CG  1 
ATOM   515  C  CD  . ARG A 1 85  ? 38.338 -19.270 16.162  1.00 61.45  ? 209 ARG A CD  1 
ATOM   516  N  NE  . ARG A 1 85  ? 37.148 -18.744 16.846  1.00 72.61  ? 209 ARG A NE  1 
ATOM   517  C  CZ  . ARG A 1 85  ? 36.755 -17.459 16.842  1.00 77.10  ? 209 ARG A CZ  1 
ATOM   518  N  NH1 . ARG A 1 85  ? 37.434 -16.515 16.183  1.00 74.39  ? 209 ARG A NH1 1 
ATOM   519  N  NH2 . ARG A 1 85  ? 35.653 -17.107 17.497  1.00 80.64  ? 209 ARG A NH2 1 
ATOM   520  N  N   . THR A 1 86  ? 38.323 -21.344 11.539  1.00 49.86  ? 210 THR A N   1 
ATOM   521  C  CA  . THR A 1 86  ? 38.316 -22.792 11.342  1.00 49.54  ? 210 THR A CA  1 
ATOM   522  C  C   . THR A 1 86  ? 38.103 -23.163 9.878   1.00 48.41  ? 210 THR A C   1 
ATOM   523  O  O   . THR A 1 86  ? 37.094 -22.791 9.276   1.00 47.34  ? 210 THR A O   1 
ATOM   524  C  CB  . THR A 1 86  ? 37.255 -23.490 12.256  1.00 50.72  ? 210 THR A CB  1 
ATOM   525  O  OG1 . THR A 1 86  ? 37.456 -23.099 13.634  1.00 55.55  ? 210 THR A OG1 1 
ATOM   526  C  CG2 . THR A 1 86  ? 37.332 -25.015 12.138  1.00 47.17  ? 210 THR A CG2 1 
ATOM   527  N  N   . ILE A 1 87  ? 39.080 -23.879 9.326   1.00 47.25  ? 211 ILE A N   1 
ATOM   528  C  CA  . ILE A 1 87  ? 39.012 -24.439 7.992   1.00 47.39  ? 211 ILE A CA  1 
ATOM   529  C  C   . ILE A 1 87  ? 38.304 -25.790 8.022   1.00 47.77  ? 211 ILE A C   1 
ATOM   530  O  O   . ILE A 1 87  ? 38.649 -26.662 8.804   1.00 50.56  ? 211 ILE A O   1 
ATOM   531  C  CB  . ILE A 1 87  ? 40.431 -24.682 7.416   1.00 48.82  ? 211 ILE A CB  1 
ATOM   532  C  CG1 . ILE A 1 87  ? 41.115 -23.365 7.045   1.00 49.08  ? 211 ILE A CG1 1 
ATOM   533  C  CG2 . ILE A 1 87  ? 40.377 -25.622 6.199   1.00 48.16  ? 211 ILE A CG2 1 
ATOM   534  C  CD1 . ILE A 1 87  ? 40.760 -22.838 5.637   1.00 51.64  ? 211 ILE A CD1 1 
ATOM   535  N  N   . ILE A 1 88  ? 37.323 -25.975 7.158   1.00 46.99  ? 212 ILE A N   1 
ATOM   536  C  CA  . ILE A 1 88  ? 36.759 -27.303 6.990   1.00 48.50  ? 212 ILE A CA  1 
ATOM   537  C  C   . ILE A 1 88  ? 37.531 -28.055 5.907   1.00 49.77  ? 212 ILE A C   1 
ATOM   538  O  O   . ILE A 1 88  ? 37.561 -27.642 4.731   1.00 49.32  ? 212 ILE A O   1 
ATOM   539  C  CB  . ILE A 1 88  ? 35.259 -27.266 6.656   1.00 47.89  ? 212 ILE A CB  1 
ATOM   540  C  CG1 . ILE A 1 88  ? 34.515 -26.369 7.648   1.00 46.20  ? 212 ILE A CG1 1 
ATOM   541  C  CG2 . ILE A 1 88  ? 34.680 -28.687 6.666   1.00 47.38  ? 212 ILE A CG2 1 
ATOM   542  C  CD1 . ILE A 1 88  ? 33.233 -25.810 7.092   1.00 45.58  ? 212 ILE A CD1 1 
ATOM   543  N  N   . LYS A 1 89  ? 38.163 -29.149 6.325   1.00 51.45  ? 213 LYS A N   1 
ATOM   544  C  CA  . LYS A 1 89  ? 38.889 -30.043 5.424   1.00 52.98  ? 213 LYS A CA  1 
ATOM   545  C  C   . LYS A 1 89  ? 37.963 -30.648 4.386   1.00 49.83  ? 213 LYS A C   1 
ATOM   546  O  O   . LYS A 1 89  ? 36.796 -30.918 4.671   1.00 47.33  ? 213 LYS A O   1 
ATOM   547  C  CB  . LYS A 1 89  ? 39.571 -31.168 6.211   1.00 56.15  ? 213 LYS A CB  1 
ATOM   548  C  CG  . LYS A 1 89  ? 40.855 -30.739 6.910   1.00 63.57  ? 213 LYS A CG  1 
ATOM   549  C  CD  . LYS A 1 89  ? 41.018 -31.367 8.306   1.00 71.66  ? 213 LYS A CD  1 
ATOM   550  C  CE  . LYS A 1 89  ? 41.157 -32.896 8.268   1.00 76.72  ? 213 LYS A CE  1 
ATOM   551  N  NZ  . LYS A 1 89  ? 39.853 -33.597 8.029   1.00 75.43  ? 213 LYS A NZ  1 
ATOM   552  N  N   . TRP A 1 90  ? 38.518 -30.857 3.193   1.00 49.12  ? 214 TRP A N   1 
ATOM   553  C  CA  . TRP A 1 90  ? 37.841 -31.489 2.060   1.00 47.84  ? 214 TRP A CA  1 
ATOM   554  C  C   . TRP A 1 90  ? 36.946 -32.657 2.451   1.00 48.87  ? 214 TRP A C   1 
ATOM   555  O  O   . TRP A 1 90  ? 35.802 -32.745 2.004   1.00 47.30  ? 214 TRP A O   1 
ATOM   556  C  CB  . TRP A 1 90  ? 38.872 -31.954 1.011   1.00 47.83  ? 214 TRP A CB  1 
ATOM   557  C  CG  . TRP A 1 90  ? 38.256 -32.771 -0.096  1.00 46.42  ? 214 TRP A CG  1 
ATOM   558  C  CD1 . TRP A 1 90  ? 38.302 -34.122 -0.229  1.00 47.38  ? 214 TRP A CD1 1 
ATOM   559  C  CD2 . TRP A 1 90  ? 37.457 -32.285 -1.186  1.00 45.49  ? 214 TRP A CD2 1 
ATOM   560  N  NE1 . TRP A 1 90  ? 37.599 -34.516 -1.349  1.00 49.36  ? 214 TRP A NE1 1 
ATOM   561  C  CE2 . TRP A 1 90  ? 37.067 -33.407 -1.951  1.00 44.33  ? 214 TRP A CE2 1 
ATOM   562  C  CE3 . TRP A 1 90  ? 37.044 -31.009 -1.599  1.00 45.62  ? 214 TRP A CE3 1 
ATOM   563  C  CZ2 . TRP A 1 90  ? 36.289 -33.297 -3.110  1.00 41.59  ? 214 TRP A CZ2 1 
ATOM   564  C  CZ3 . TRP A 1 90  ? 36.256 -30.903 -2.755  1.00 42.69  ? 214 TRP A CZ3 1 
ATOM   565  C  CH2 . TRP A 1 90  ? 35.893 -32.047 -3.493  1.00 41.39  ? 214 TRP A CH2 1 
ATOM   566  N  N   . GLN A 1 91  ? 37.481 -33.553 3.274   1.00 51.80  ? 215 GLN A N   1 
ATOM   567  C  CA  . GLN A 1 91  ? 36.788 -34.782 3.645   1.00 54.47  ? 215 GLN A CA  1 
ATOM   568  C  C   . GLN A 1 91  ? 35.490 -34.475 4.394   1.00 51.36  ? 215 GLN A C   1 
ATOM   569  O  O   . GLN A 1 91  ? 34.511 -35.212 4.272   1.00 50.68  ? 215 GLN A O   1 
ATOM   570  C  CB  . GLN A 1 91  ? 37.685 -35.689 4.505   1.00 58.53  ? 215 GLN A CB  1 
ATOM   571  C  CG  . GLN A 1 91  ? 39.125 -35.858 4.012   1.00 67.36  ? 215 GLN A CG  1 
ATOM   572  C  CD  . GLN A 1 91  ? 40.112 -34.861 4.644   1.00 72.66  ? 215 GLN A CD  1 
ATOM   573  O  OE1 . GLN A 1 91  ? 40.622 -35.082 5.753   1.00 75.72  ? 215 GLN A OE1 1 
ATOM   574  N  NE2 . GLN A 1 91  ? 40.404 -33.773 3.923   1.00 70.18  ? 215 GLN A NE2 1 
ATOM   575  N  N   . ASP A 1 92  ? 35.506 -33.381 5.150   1.00 48.68  ? 216 ASP A N   1 
ATOM   576  C  CA  . ASP A 1 92  ? 34.403 -32.981 6.014   1.00 49.37  ? 216 ASP A CA  1 
ATOM   577  C  C   . ASP A 1 92  ? 33.363 -32.075 5.326   1.00 46.96  ? 216 ASP A C   1 
ATOM   578  O  O   . ASP A 1 92  ? 32.379 -31.676 5.951   1.00 46.65  ? 216 ASP A O   1 
ATOM   579  C  CB  . ASP A 1 92  ? 34.944 -32.275 7.264   1.00 49.91  ? 216 ASP A CB  1 
ATOM   580  C  CG  . ASP A 1 92  ? 35.825 -33.168 8.128   1.00 56.91  ? 216 ASP A CG  1 
ATOM   581  O  OD1 . ASP A 1 92  ? 35.614 -34.406 8.166   1.00 64.23  ? 216 ASP A OD1 1 
ATOM   582  O  OD2 . ASP A 1 92  ? 36.736 -32.624 8.789   1.00 57.98  ? 216 ASP A OD2 1 
ATOM   583  N  N   . LEU A 1 93  ? 33.586 -31.742 4.057   1.00 47.12  ? 217 LEU A N   1 
ATOM   584  C  CA  . LEU A 1 93  ? 32.658 -30.901 3.311   1.00 45.51  ? 217 LEU A CA  1 
ATOM   585  C  C   . LEU A 1 93  ? 31.432 -31.706 2.870   1.00 46.85  ? 217 LEU A C   1 
ATOM   586  O  O   . LEU A 1 93  ? 31.569 -32.815 2.342   1.00 48.59  ? 217 LEU A O   1 
ATOM   587  C  CB  . LEU A 1 93  ? 33.355 -30.275 2.092   1.00 44.09  ? 217 LEU A CB  1 
ATOM   588  C  CG  . LEU A 1 93  ? 34.455 -29.220 2.287   1.00 46.42  ? 217 LEU A CG  1 
ATOM   589  C  CD1 . LEU A 1 93  ? 35.133 -28.879 0.956   1.00 41.41  ? 217 LEU A CD1 1 
ATOM   590  C  CD2 . LEU A 1 93  ? 33.924 -27.937 2.971   1.00 43.04  ? 217 LEU A CD2 1 
ATOM   591  N  N   . GLU A 1 94  ? 30.241 -31.153 3.098   1.00 46.84  ? 218 GLU A N   1 
ATOM   592  C  CA  . GLU A 1 94  ? 28.983 -31.815 2.729   1.00 48.53  ? 218 GLU A CA  1 
ATOM   593  C  C   . GLU A 1 94  ? 28.091 -30.894 1.934   1.00 46.39  ? 218 GLU A C   1 
ATOM   594  O  O   . GLU A 1 94  ? 27.956 -29.715 2.260   1.00 45.49  ? 218 GLU A O   1 
ATOM   595  C  CB  . GLU A 1 94  ? 28.198 -32.251 3.959   1.00 51.11  ? 218 GLU A CB  1 
ATOM   596  C  CG  . GLU A 1 94  ? 28.823 -33.373 4.743   1.00 59.31  ? 218 GLU A CG  1 
ATOM   597  C  CD  . GLU A 1 94  ? 28.228 -33.491 6.127   1.00 66.13  ? 218 GLU A CD  1 
ATOM   598  O  OE1 . GLU A 1 94  ? 28.265 -34.605 6.695   1.00 70.72  ? 218 GLU A OE1 1 
ATOM   599  O  OE2 . GLU A 1 94  ? 27.721 -32.466 6.642   1.00 67.26  ? 218 GLU A OE2 1 
ATOM   600  N  N   . VAL A 1 95  ? 27.465 -31.451 0.907   1.00 45.52  ? 219 VAL A N   1 
ATOM   601  C  CA  . VAL A 1 95  ? 26.438 -30.760 0.169   1.00 44.29  ? 219 VAL A CA  1 
ATOM   602  C  C   . VAL A 1 95  ? 25.452 -30.154 1.176   1.00 46.16  ? 219 VAL A C   1 
ATOM   603  O  O   . VAL A 1 95  ? 25.067 -30.801 2.156   1.00 48.09  ? 219 VAL A O   1 
ATOM   604  C  CB  . VAL A 1 95  ? 25.740 -31.708 -0.850  1.00 46.26  ? 219 VAL A CB  1 
ATOM   605  C  CG1 . VAL A 1 95  ? 24.485 -31.072 -1.418  1.00 47.22  ? 219 VAL A CG1 1 
ATOM   606  C  CG2 . VAL A 1 95  ? 26.699 -32.092 -1.978  1.00 41.28  ? 219 VAL A CG2 1 
ATOM   607  N  N   . GLY A 1 96  ? 25.091 -28.891 0.954   1.00 45.75  ? 220 GLY A N   1 
ATOM   608  C  CA  . GLY A 1 96  ? 24.139 -28.198 1.797   1.00 46.25  ? 220 GLY A CA  1 
ATOM   609  C  C   . GLY A 1 96  ? 24.749 -27.430 2.950   1.00 46.56  ? 220 GLY A C   1 
ATOM   610  O  O   . GLY A 1 96  ? 24.028 -26.729 3.665   1.00 48.10  ? 220 GLY A O   1 
ATOM   611  N  N   . GLN A 1 97  ? 26.061 -27.571 3.150   1.00 45.46  ? 221 GLN A N   1 
ATOM   612  C  CA  . GLN A 1 97  ? 26.778 -26.795 4.165   1.00 45.43  ? 221 GLN A CA  1 
ATOM   613  C  C   . GLN A 1 97  ? 26.869 -25.352 3.723   1.00 40.98  ? 221 GLN A C   1 
ATOM   614  O  O   . GLN A 1 97  ? 27.147 -25.089 2.555   1.00 38.15  ? 221 GLN A O   1 
ATOM   615  C  CB  . GLN A 1 97  ? 28.197 -27.321 4.354   1.00 45.51  ? 221 GLN A CB  1 
ATOM   616  C  CG  . GLN A 1 97  ? 28.440 -28.122 5.625   1.00 51.14  ? 221 GLN A CG  1 
ATOM   617  C  CD  . GLN A 1 97  ? 29.766 -28.883 5.588   1.00 51.01  ? 221 GLN A CD  1 
ATOM   618  O  OE1 . GLN A 1 97  ? 30.566 -28.717 4.668   1.00 52.10  ? 221 GLN A OE1 1 
ATOM   619  N  NE2 . GLN A 1 97  ? 29.994 -29.725 6.586   1.00 55.53  ? 221 GLN A NE2 1 
ATOM   620  N  N   . VAL A 1 98  ? 26.635 -24.419 4.642   1.00 40.40  ? 222 VAL A N   1 
ATOM   621  C  CA  . VAL A 1 98  ? 26.857 -22.996 4.332   1.00 39.20  ? 222 VAL A CA  1 
ATOM   622  C  C   . VAL A 1 98  ? 28.174 -22.519 4.963   1.00 38.58  ? 222 VAL A C   1 
ATOM   623  O  O   . VAL A 1 98  ? 28.347 -22.557 6.183   1.00 41.96  ? 222 VAL A O   1 
ATOM   624  C  CB  . VAL A 1 98  ? 25.640 -22.111 4.693   1.00 41.81  ? 222 VAL A CB  1 
ATOM   625  C  CG1 . VAL A 1 98  ? 26.013 -20.613 4.707   1.00 36.32  ? 222 VAL A CG1 1 
ATOM   626  C  CG2 . VAL A 1 98  ? 24.501 -22.383 3.709   1.00 39.54  ? 222 VAL A CG2 1 
ATOM   627  N  N   . VAL A 1 99  ? 29.082 -22.071 4.101   1.00 35.82  ? 223 VAL A N   1 
ATOM   628  C  CA  . VAL A 1 99  ? 30.483 -21.847 4.424   1.00 34.24  ? 223 VAL A CA  1 
ATOM   629  C  C   . VAL A 1 99  ? 30.953 -20.505 3.878   1.00 35.08  ? 223 VAL A C   1 
ATOM   630  O  O   . VAL A 1 99  ? 30.194 -19.833 3.194   1.00 35.80  ? 223 VAL A O   1 
ATOM   631  C  CB  . VAL A 1 99  ? 31.373 -22.976 3.853   1.00 34.10  ? 223 VAL A CB  1 
ATOM   632  C  CG1 . VAL A 1 99  ? 31.010 -24.312 4.524   1.00 30.09  ? 223 VAL A CG1 1 
ATOM   633  C  CG2 . VAL A 1 99  ? 31.259 -23.065 2.297   1.00 29.58  ? 223 VAL A CG2 1 
HETATM 634  N  N   . MSE A 1 100 ? 32.181 -20.104 4.221   1.00 34.92  ? 224 MSE A N   1 
HETATM 635  C  CA  . MSE A 1 100 ? 32.812 -18.919 3.647   1.00 35.15  ? 224 MSE A CA  1 
HETATM 636  C  C   . MSE A 1 100 ? 33.992 -19.429 2.846   1.00 34.76  ? 224 MSE A C   1 
HETATM 637  O  O   . MSE A 1 100 ? 34.791 -20.234 3.336   1.00 36.00  ? 224 MSE A O   1 
HETATM 638  C  CB  . MSE A 1 100 ? 33.269 -17.912 4.714   1.00 35.90  ? 224 MSE A CB  1 
HETATM 639  C  CG  . MSE A 1 100 ? 33.669 -16.546 4.111   1.00 39.66  ? 224 MSE A CG  1 
HETATM 640  SE SE  . MSE A 1 100 ? 34.471 -15.283 5.410   1.00 44.37  ? 224 MSE A SE  1 
HETATM 641  C  CE  . MSE A 1 100 ? 36.229 -16.127 5.503   1.00 39.39  ? 224 MSE A CE  1 
ATOM   642  N  N   . LEU A 1 101 ? 34.083 -19.003 1.597   1.00 33.79  ? 225 LEU A N   1 
ATOM   643  C  CA  . LEU A 1 101 ? 35.071 -19.565 0.697   1.00 33.79  ? 225 LEU A CA  1 
ATOM   644  C  C   . LEU A 1 101 ? 35.468 -18.492 -0.297  1.00 34.12  ? 225 LEU A C   1 
ATOM   645  O  O   . LEU A 1 101 ? 34.808 -17.468 -0.400  1.00 33.06  ? 225 LEU A O   1 
ATOM   646  C  CB  . LEU A 1 101 ? 34.534 -20.823 -0.011  1.00 32.86  ? 225 LEU A CB  1 
ATOM   647  C  CG  . LEU A 1 101 ? 33.159 -20.807 -0.716  1.00 35.16  ? 225 LEU A CG  1 
ATOM   648  C  CD1 . LEU A 1 101 ? 33.133 -19.885 -1.927  1.00 32.84  ? 225 LEU A CD1 1 
ATOM   649  C  CD2 . LEU A 1 101 ? 32.708 -22.203 -1.136  1.00 33.75  ? 225 LEU A CD2 1 
ATOM   650  N  N   . ASN A 1 102 ? 36.558 -18.733 -1.016  1.00 34.09  ? 226 ASN A N   1 
ATOM   651  C  CA  . ASN A 1 102 ? 37.128 -17.735 -1.871  1.00 34.91  ? 226 ASN A CA  1 
ATOM   652  C  C   . ASN A 1 102 ? 36.759 -17.991 -3.339  1.00 35.54  ? 226 ASN A C   1 
ATOM   653  O  O   . ASN A 1 102 ? 36.906 -19.112 -3.852  1.00 34.27  ? 226 ASN A O   1 
ATOM   654  C  CB  . ASN A 1 102 ? 38.636 -17.683 -1.632  1.00 36.60  ? 226 ASN A CB  1 
ATOM   655  C  CG  . ASN A 1 102 ? 39.321 -16.606 -2.442  1.00 40.80  ? 226 ASN A CG  1 
ATOM   656  O  OD1 . ASN A 1 102 ? 39.413 -16.694 -3.673  1.00 37.41  ? 226 ASN A OD1 1 
ATOM   657  N  ND2 . ASN A 1 102 ? 39.826 -15.582 -1.751  1.00 41.55  ? 226 ASN A ND2 1 
ATOM   658  N  N   . TYR A 1 103 ? 36.249 -16.942 -3.989  1.00 36.78  ? 227 TYR A N   1 
ATOM   659  C  CA  . TYR A 1 103 ? 35.728 -17.006 -5.354  1.00 36.55  ? 227 TYR A CA  1 
ATOM   660  C  C   . TYR A 1 103 ? 35.946 -15.684 -6.075  1.00 38.88  ? 227 TYR A C   1 
ATOM   661  O  O   . TYR A 1 103 ? 35.966 -14.626 -5.438  1.00 39.49  ? 227 TYR A O   1 
ATOM   662  C  CB  . TYR A 1 103 ? 34.225 -17.358 -5.365  1.00 34.55  ? 227 TYR A CB  1 
ATOM   663  C  CG  . TYR A 1 103 ? 33.674 -17.634 -6.756  1.00 37.26  ? 227 TYR A CG  1 
ATOM   664  C  CD1 . TYR A 1 103 ? 34.136 -18.716 -7.519  1.00 37.05  ? 227 TYR A CD1 1 
ATOM   665  C  CD2 . TYR A 1 103 ? 32.699 -16.807 -7.321  1.00 39.01  ? 227 TYR A CD2 1 
ATOM   666  C  CE1 . TYR A 1 103 ? 33.630 -18.960 -8.823  1.00 39.30  ? 227 TYR A CE1 1 
ATOM   667  C  CE2 . TYR A 1 103 ? 32.196 -17.044 -8.617  1.00 40.37  ? 227 TYR A CE2 1 
ATOM   668  C  CZ  . TYR A 1 103 ? 32.665 -18.115 -9.353  1.00 39.04  ? 227 TYR A CZ  1 
ATOM   669  O  OH  . TYR A 1 103 ? 32.144 -18.338 -10.614 1.00 46.25  ? 227 TYR A OH  1 
ATOM   670  N  N   . ASN A 1 104 ? 36.080 -15.757 -7.404  1.00 39.14  ? 228 ASN A N   1 
ATOM   671  C  CA  . ASN A 1 104 ? 36.255 -14.586 -8.263  1.00 42.26  ? 228 ASN A CA  1 
ATOM   672  C  C   . ASN A 1 104 ? 35.246 -14.566 -9.419  1.00 45.33  ? 228 ASN A C   1 
ATOM   673  O  O   . ASN A 1 104 ? 35.445 -15.221 -10.437 1.00 43.92  ? 228 ASN A O   1 
ATOM   674  C  CB  . ASN A 1 104 ? 37.686 -14.531 -8.819  1.00 42.04  ? 228 ASN A CB  1 
ATOM   675  C  CG  . ASN A 1 104 ? 38.030 -13.186 -9.427  1.00 42.72  ? 228 ASN A CG  1 
ATOM   676  O  OD1 . ASN A 1 104 ? 37.163 -12.472 -9.923  1.00 39.13  ? 228 ASN A OD1 1 
ATOM   677  N  ND2 . ASN A 1 104 ? 39.311 -12.824 -9.374  1.00 42.08  ? 228 ASN A ND2 1 
ATOM   678  N  N   . PRO A 1 105 ? 34.137 -13.831 -9.244  1.00 48.80  ? 229 PRO A N   1 
ATOM   679  C  CA  . PRO A 1 105 ? 33.048 -13.718 -10.230 1.00 50.21  ? 229 PRO A CA  1 
ATOM   680  C  C   . PRO A 1 105 ? 33.485 -13.342 -11.652 1.00 55.28  ? 229 PRO A C   1 
ATOM   681  O  O   . PRO A 1 105 ? 33.007 -13.928 -12.637 1.00 54.52  ? 229 PRO A O   1 
ATOM   682  C  CB  . PRO A 1 105 ? 32.162 -12.630 -9.624  1.00 51.36  ? 229 PRO A CB  1 
ATOM   683  C  CG  . PRO A 1 105 ? 32.354 -12.833 -8.110  1.00 49.47  ? 229 PRO A CG  1 
ATOM   684  C  CD  . PRO A 1 105 ? 33.828 -13.108 -7.991  1.00 48.00  ? 229 PRO A CD  1 
ATOM   685  N  N   . ASP A 1 106 ? 34.380 -12.370 -11.752 1.00 57.71  ? 230 ASP A N   1 
ATOM   686  C  CA  . ASP A 1 106 ? 34.783 -11.866 -13.044 1.00 63.43  ? 230 ASP A CA  1 
ATOM   687  C  C   . ASP A 1 106 ? 35.824 -12.771 -13.690 1.00 63.82  ? 230 ASP A C   1 
ATOM   688  O  O   . ASP A 1 106 ? 35.875 -12.876 -14.925 1.00 64.77  ? 230 ASP A O   1 
ATOM   689  C  CB  . ASP A 1 106 ? 35.297 -10.433 -12.917 1.00 67.56  ? 230 ASP A CB  1 
ATOM   690  C  CG  . ASP A 1 106 ? 34.199 -9.460  -12.514 1.00 72.94  ? 230 ASP A CG  1 
ATOM   691  O  OD1 . ASP A 1 106 ? 33.476 -8.957  -13.418 1.00 77.85  ? 230 ASP A OD1 1 
ATOM   692  O  OD2 . ASP A 1 106 ? 34.059 -9.206  -11.291 1.00 73.11  ? 230 ASP A OD2 1 
ATOM   693  N  N   . ASN A 1 107 ? 36.645 -13.416 -12.854 1.00 60.30  ? 231 ASN A N   1 
ATOM   694  C  CA  . ASN A 1 107 ? 37.711 -14.307 -13.339 1.00 60.42  ? 231 ASN A CA  1 
ATOM   695  C  C   . ASN A 1 107 ? 37.800 -15.593 -12.529 1.00 56.12  ? 231 ASN A C   1 
ATOM   696  O  O   . ASN A 1 107 ? 38.778 -15.799 -11.808 1.00 55.32  ? 231 ASN A O   1 
ATOM   697  C  CB  . ASN A 1 107 ? 39.064 -13.582 -13.363 1.00 62.13  ? 231 ASN A CB  1 
ATOM   698  C  CG  . ASN A 1 107 ? 39.085 -12.423 -14.348 1.00 67.85  ? 231 ASN A CG  1 
ATOM   699  O  OD1 . ASN A 1 107 ? 38.813 -12.604 -15.536 1.00 73.84  ? 231 ASN A OD1 1 
ATOM   700  N  ND2 . ASN A 1 107 ? 39.394 -11.225 -13.857 1.00 64.80  ? 231 ASN A ND2 1 
ATOM   701  N  N   . PRO A 1 108 ? 36.793 -16.476 -12.677 1.00 54.20  ? 232 PRO A N   1 
ATOM   702  C  CA  . PRO A 1 108 ? 36.548 -17.652 -11.840 1.00 52.46  ? 232 PRO A CA  1 
ATOM   703  C  C   . PRO A 1 108 ? 37.716 -18.620 -11.679 1.00 53.53  ? 232 PRO A C   1 
ATOM   704  O  O   . PRO A 1 108 ? 37.689 -19.449 -10.775 1.00 53.54  ? 232 PRO A O   1 
ATOM   705  C  CB  . PRO A 1 108 ? 35.387 -18.352 -12.562 1.00 52.39  ? 232 PRO A CB  1 
ATOM   706  C  CG  . PRO A 1 108 ? 34.688 -17.273 -13.259 1.00 52.90  ? 232 PRO A CG  1 
ATOM   707  C  CD  . PRO A 1 108 ? 35.787 -16.382 -13.748 1.00 56.09  ? 232 PRO A CD  1 
ATOM   708  N  N   . LYS A 1 109 ? 38.726 -18.528 -12.532 1.00 57.67  ? 233 LYS A N   1 
ATOM   709  C  CA  . LYS A 1 109 ? 39.889 -19.411 -12.410 1.00 59.41  ? 233 LYS A CA  1 
ATOM   710  C  C   . LYS A 1 109 ? 40.964 -18.781 -11.546 1.00 58.96  ? 233 LYS A C   1 
ATOM   711  O  O   . LYS A 1 109 ? 41.972 -19.414 -11.219 1.00 59.93  ? 233 LYS A O   1 
ATOM   712  C  CB  . LYS A 1 109 ? 40.432 -19.788 -13.789 1.00 61.76  ? 233 LYS A CB  1 
ATOM   713  C  CG  . LYS A 1 109 ? 39.378 -20.498 -14.644 1.00 66.72  ? 233 LYS A CG  1 
ATOM   714  C  CD  . LYS A 1 109 ? 39.755 -20.572 -16.119 1.00 73.21  ? 233 LYS A CD  1 
ATOM   715  C  CE  . LYS A 1 109 ? 40.741 -21.710 -16.370 1.00 78.66  ? 233 LYS A CE  1 
ATOM   716  N  NZ  . LYS A 1 109 ? 40.361 -22.953 -15.622 1.00 77.21  ? 233 LYS A NZ  1 
ATOM   717  N  N   . GLU A 1 110 ? 40.738 -17.529 -11.172 1.00 58.47  ? 234 GLU A N   1 
ATOM   718  C  CA  . GLU A 1 110 ? 41.682 -16.812 -10.329 1.00 59.88  ? 234 GLU A CA  1 
ATOM   719  C  C   . GLU A 1 110 ? 41.164 -16.588 -8.903  1.00 55.46  ? 234 GLU A C   1 
ATOM   720  O  O   . GLU A 1 110 ? 39.968 -16.723 -8.624  1.00 51.80  ? 234 GLU A O   1 
ATOM   721  C  CB  . GLU A 1 110 ? 42.100 -15.495 -10.992 1.00 62.89  ? 234 GLU A CB  1 
ATOM   722  C  CG  . GLU A 1 110 ? 43.298 -15.633 -11.917 1.00 71.89  ? 234 GLU A CG  1 
ATOM   723  C  CD  . GLU A 1 110 ? 44.618 -15.910 -11.164 1.00 79.93  ? 234 GLU A CD  1 
ATOM   724  O  OE1 . GLU A 1 110 ? 44.651 -15.796 -9.910  1.00 78.67  ? 234 GLU A OE1 1 
ATOM   725  O  OE2 . GLU A 1 110 ? 45.631 -16.237 -11.833 1.00 84.16  ? 234 GLU A OE2 1 
ATOM   726  N  N   . ARG A 1 111 ? 42.106 -16.287 -8.018  1.00 55.45  ? 235 ARG A N   1 
ATOM   727  C  CA  . ARG A 1 111 ? 41.874 -15.865 -6.641  1.00 53.77  ? 235 ARG A CA  1 
ATOM   728  C  C   . ARG A 1 111 ? 40.967 -14.622 -6.581  1.00 53.28  ? 235 ARG A C   1 
ATOM   729  O  O   . ARG A 1 111 ? 41.076 -13.723 -7.419  1.00 55.04  ? 235 ARG A O   1 
ATOM   730  C  CB  . ARG A 1 111 ? 43.231 -15.534 -6.031  1.00 55.44  ? 235 ARG A CB  1 
ATOM   731  C  CG  . ARG A 1 111 ? 43.259 -15.379 -4.532  1.00 61.49  ? 235 ARG A CG  1 
ATOM   732  C  CD  . ARG A 1 111 ? 43.781 -16.632 -3.872  1.00 65.02  ? 235 ARG A CD  1 
ATOM   733  N  NE  . ARG A 1 111 ? 43.603 -16.571 -2.429  1.00 66.39  ? 235 ARG A NE  1 
ATOM   734  C  CZ  . ARG A 1 111 ? 43.606 -17.630 -1.630  1.00 63.35  ? 235 ARG A CZ  1 
ATOM   735  N  NH1 . ARG A 1 111 ? 43.783 -18.844 -2.125  1.00 64.56  ? 235 ARG A NH1 1 
ATOM   736  N  NH2 . ARG A 1 111 ? 43.430 -17.470 -0.331  1.00 63.20  ? 235 ARG A NH2 1 
ATOM   737  N  N   . GLY A 1 112 ? 40.069 -14.580 -5.601  1.00 50.24  ? 236 GLY A N   1 
ATOM   738  C  CA  . GLY A 1 112 ? 39.161 -13.443 -5.449  1.00 49.19  ? 236 GLY A CA  1 
ATOM   739  C  C   . GLY A 1 112 ? 38.942 -13.028 -4.006  1.00 47.51  ? 236 GLY A C   1 
ATOM   740  O  O   . GLY A 1 112 ? 39.904 -12.829 -3.248  1.00 46.94  ? 236 GLY A O   1 
ATOM   741  N  N   . PHE A 1 113 ? 37.673 -12.895 -3.626  1.00 45.39  ? 237 PHE A N   1 
ATOM   742  C  CA  . PHE A 1 113 ? 37.310 -12.474 -2.260  1.00 44.83  ? 237 PHE A CA  1 
ATOM   743  C  C   . PHE A 1 113 ? 36.501 -13.556 -1.582  1.00 41.52  ? 237 PHE A C   1 
ATOM   744  O  O   . PHE A 1 113 ? 36.137 -14.548 -2.213  1.00 39.88  ? 237 PHE A O   1 
ATOM   745  C  CB  . PHE A 1 113 ? 36.536 -11.143 -2.258  1.00 46.42  ? 237 PHE A CB  1 
ATOM   746  C  CG  . PHE A 1 113 ? 37.259 -10.014 -2.972  1.00 51.10  ? 237 PHE A CG  1 
ATOM   747  C  CD1 . PHE A 1 113 ? 38.151 -9.193  -2.283  1.00 53.67  ? 237 PHE A CD1 1 
ATOM   748  C  CD2 . PHE A 1 113 ? 37.069 -9.797  -4.333  1.00 50.08  ? 237 PHE A CD2 1 
ATOM   749  C  CE1 . PHE A 1 113 ? 38.829 -8.161  -2.933  1.00 55.24  ? 237 PHE A CE1 1 
ATOM   750  C  CE2 . PHE A 1 113 ? 37.735 -8.764  -4.988  1.00 56.11  ? 237 PHE A CE2 1 
ATOM   751  C  CZ  . PHE A 1 113 ? 38.620 -7.945  -4.280  1.00 55.10  ? 237 PHE A CZ  1 
ATOM   752  N  N   . TRP A 1 114 ? 36.220 -13.335 -0.301  1.00 40.16  ? 238 TRP A N   1 
ATOM   753  C  CA  . TRP A 1 114 ? 35.575 -14.305 0.559   1.00 36.94  ? 238 TRP A CA  1 
ATOM   754  C  C   . TRP A 1 114 ? 34.085 -14.061 0.636   1.00 38.02  ? 238 TRP A C   1 
ATOM   755  O  O   . TRP A 1 114 ? 33.636 -13.022 1.120   1.00 38.71  ? 238 TRP A O   1 
ATOM   756  C  CB  . TRP A 1 114 ? 36.225 -14.285 1.951   1.00 35.30  ? 238 TRP A CB  1 
ATOM   757  C  CG  . TRP A 1 114 ? 37.670 -14.635 1.836   1.00 35.60  ? 238 TRP A CG  1 
ATOM   758  C  CD1 . TRP A 1 114 ? 38.712 -13.768 1.620   1.00 38.21  ? 238 TRP A CD1 1 
ATOM   759  C  CD2 . TRP A 1 114 ? 38.238 -15.953 1.820   1.00 33.41  ? 238 TRP A CD2 1 
ATOM   760  N  NE1 . TRP A 1 114 ? 39.894 -14.464 1.517   1.00 39.47  ? 238 TRP A NE1 1 
ATOM   761  C  CE2 . TRP A 1 114 ? 39.632 -15.806 1.625   1.00 35.25  ? 238 TRP A CE2 1 
ATOM   762  C  CE3 . TRP A 1 114 ? 37.705 -17.241 1.965   1.00 30.97  ? 238 TRP A CE3 1 
ATOM   763  C  CZ2 . TRP A 1 114 ? 40.506 -16.900 1.589   1.00 35.32  ? 238 TRP A CZ2 1 
ATOM   764  C  CZ3 . TRP A 1 114 ? 38.567 -18.326 1.928   1.00 31.98  ? 238 TRP A CZ3 1 
ATOM   765  C  CH2 . TRP A 1 114 ? 39.958 -18.149 1.741   1.00 33.67  ? 238 TRP A CH2 1 
ATOM   766  N  N   . TYR A 1 115 ? 33.318 -15.045 0.172   1.00 36.76  ? 239 TYR A N   1 
ATOM   767  C  CA  . TYR A 1 115 ? 31.858 -14.940 0.156   1.00 37.47  ? 239 TYR A CA  1 
ATOM   768  C  C   . TYR A 1 115 ? 31.240 -16.086 0.919   1.00 37.61  ? 239 TYR A C   1 
ATOM   769  O  O   . TYR A 1 115 ? 31.849 -17.159 1.044   1.00 37.70  ? 239 TYR A O   1 
ATOM   770  C  CB  . TYR A 1 115 ? 31.327 -15.011 -1.274  1.00 37.65  ? 239 TYR A CB  1 
ATOM   771  C  CG  . TYR A 1 115 ? 31.823 -13.943 -2.190  1.00 36.80  ? 239 TYR A CG  1 
ATOM   772  C  CD1 . TYR A 1 115 ? 31.140 -12.747 -2.320  1.00 39.92  ? 239 TYR A CD1 1 
ATOM   773  C  CD2 . TYR A 1 115 ? 32.963 -14.136 -2.949  1.00 40.99  ? 239 TYR A CD2 1 
ATOM   774  C  CE1 . TYR A 1 115 ? 31.581 -11.755 -3.182  1.00 43.35  ? 239 TYR A CE1 1 
ATOM   775  C  CE2 . TYR A 1 115 ? 33.414 -13.152 -3.838  1.00 42.45  ? 239 TYR A CE2 1 
ATOM   776  C  CZ  . TYR A 1 115 ? 32.722 -11.967 -3.938  1.00 43.26  ? 239 TYR A CZ  1 
ATOM   777  O  OH  . TYR A 1 115 ? 33.162 -10.992 -4.799  1.00 45.88  ? 239 TYR A OH  1 
ATOM   778  N  N   . ASP A 1 116 ? 30.021 -15.865 1.407   1.00 37.31  ? 240 ASP A N   1 
ATOM   779  C  CA  . ASP A 1 116 ? 29.200 -16.960 1.887   1.00 36.83  ? 240 ASP A CA  1 
ATOM   780  C  C   . ASP A 1 116 ? 28.610 -17.775 0.727   1.00 36.48  ? 240 ASP A C   1 
ATOM   781  O  O   . ASP A 1 116 ? 28.272 -17.240 -0.349  1.00 35.56  ? 240 ASP A O   1 
ATOM   782  C  CB  . ASP A 1 116 ? 28.140 -16.459 2.854   1.00 38.21  ? 240 ASP A CB  1 
ATOM   783  C  CG  . ASP A 1 116 ? 28.730 -16.094 4.194   1.00 42.41  ? 240 ASP A CG  1 
ATOM   784  O  OD1 . ASP A 1 116 ? 29.957 -16.279 4.372   1.00 46.96  ? 240 ASP A OD1 1 
ATOM   785  O  OD2 . ASP A 1 116 ? 27.987 -15.631 5.073   1.00 43.19  ? 240 ASP A OD2 1 
ATOM   786  N  N   . ALA A 1 117 ? 28.545 -19.084 0.934   1.00 34.08  ? 241 ALA A N   1 
ATOM   787  C  CA  . ALA A 1 117 ? 28.129 -19.984 -0.127  1.00 35.35  ? 241 ALA A CA  1 
ATOM   788  C  C   . ALA A 1 117 ? 27.580 -21.269 0.450   1.00 35.38  ? 241 ALA A C   1 
ATOM   789  O  O   . ALA A 1 117 ? 27.914 -21.660 1.572   1.00 36.63  ? 241 ALA A O   1 
ATOM   790  C  CB  . ALA A 1 117 ? 29.308 -20.285 -1.084  1.00 32.62  ? 241 ALA A CB  1 
ATOM   791  N  N   . GLU A 1 118 ? 26.738 -21.915 -0.353  1.00 36.54  ? 242 GLU A N   1 
ATOM   792  C  CA  . GLU A 1 118 ? 26.155 -23.207 -0.063  1.00 35.58  ? 242 GLU A CA  1 
ATOM   793  C  C   . GLU A 1 118 ? 26.798 -24.247 -0.986  1.00 35.12  ? 242 GLU A C   1 
ATOM   794  O  O   . GLU A 1 118 ? 26.789 -24.126 -2.246  1.00 29.95  ? 242 GLU A O   1 
ATOM   795  C  CB  . GLU A 1 118 ? 24.658 -23.104 -0.301  1.00 39.01  ? 242 GLU A CB  1 
ATOM   796  C  CG  . GLU A 1 118 ? 23.798 -24.337 -0.067  1.00 40.79  ? 242 GLU A CG  1 
ATOM   797  C  CD  . GLU A 1 118 ? 22.342 -24.085 -0.504  1.00 45.36  ? 242 GLU A CD  1 
ATOM   798  O  OE1 . GLU A 1 118 ? 22.116 -23.517 -1.612  1.00 45.67  ? 242 GLU A OE1 1 
ATOM   799  O  OE2 . GLU A 1 118 ? 21.417 -24.455 0.258   1.00 49.77  ? 242 GLU A OE2 1 
ATOM   800  N  N   . ILE A 1 119 ? 27.384 -25.261 -0.355  1.00 34.03  ? 243 ILE A N   1 
ATOM   801  C  CA  . ILE A 1 119 ? 27.992 -26.363 -1.104  1.00 34.56  ? 243 ILE A CA  1 
ATOM   802  C  C   . ILE A 1 119 ? 26.906 -27.113 -1.827  1.00 36.31  ? 243 ILE A C   1 
ATOM   803  O  O   . ILE A 1 119 ? 25.882 -27.459 -1.256  1.00 36.59  ? 243 ILE A O   1 
ATOM   804  C  CB  . ILE A 1 119 ? 28.812 -27.288 -0.221  1.00 35.25  ? 243 ILE A CB  1 
ATOM   805  C  CG1 . ILE A 1 119 ? 29.946 -26.475 0.428   1.00 33.84  ? 243 ILE A CG1 1 
ATOM   806  C  CG2 . ILE A 1 119 ? 29.392 -28.430 -1.044  1.00 31.60  ? 243 ILE A CG2 1 
ATOM   807  C  CD1 . ILE A 1 119 ? 30.774 -27.284 1.388   1.00 39.45  ? 243 ILE A CD1 1 
ATOM   808  N  N   . SER A 1 120 ? 27.166 -27.349 -3.102  1.00 37.41  ? 244 SER A N   1 
ATOM   809  C  CA  . SER A 1 120 ? 26.173 -27.724 -4.062  1.00 38.13  ? 244 SER A CA  1 
ATOM   810  C  C   . SER A 1 120 ? 26.486 -29.089 -4.717  1.00 40.81  ? 244 SER A C   1 
ATOM   811  O  O   . SER A 1 120 ? 25.603 -29.936 -4.859  1.00 42.43  ? 244 SER A O   1 
ATOM   812  C  CB  . SER A 1 120 ? 26.157 -26.634 -5.109  1.00 34.38  ? 244 SER A CB  1 
ATOM   813  O  OG  . SER A 1 120 ? 25.258 -26.981 -6.108  1.00 47.50  ? 244 SER A OG  1 
ATOM   814  N  N   . ARG A 1 121 ? 27.740 -29.268 -5.141  1.00 40.67  ? 245 ARG A N   1 
ATOM   815  C  CA  . ARG A 1 121 ? 28.216 -30.509 -5.733  1.00 41.41  ? 245 ARG A CA  1 
ATOM   816  C  C   . ARG A 1 121 ? 29.582 -30.791 -5.194  1.00 41.81  ? 245 ARG A C   1 
ATOM   817  O  O   . ARG A 1 121 ? 30.386 -29.883 -5.027  1.00 42.87  ? 245 ARG A O   1 
ATOM   818  C  CB  . ARG A 1 121 ? 28.336 -30.389 -7.243  1.00 43.70  ? 245 ARG A CB  1 
ATOM   819  C  CG  . ARG A 1 121 ? 27.028 -30.264 -7.973  1.00 44.34  ? 245 ARG A CG  1 
ATOM   820  C  CD  . ARG A 1 121 ? 27.300 -29.805 -9.353  1.00 43.76  ? 245 ARG A CD  1 
ATOM   821  N  NE  . ARG A 1 121 ? 27.809 -30.906 -10.154 1.00 52.13  ? 245 ARG A NE  1 
ATOM   822  C  CZ  . ARG A 1 121 ? 28.282 -30.776 -11.389 1.00 51.79  ? 245 ARG A CZ  1 
ATOM   823  N  NH1 . ARG A 1 121 ? 28.327 -29.568 -11.953 1.00 47.49  ? 245 ARG A NH1 1 
ATOM   824  N  NH2 . ARG A 1 121 ? 28.713 -31.850 -12.048 1.00 50.10  ? 245 ARG A NH2 1 
ATOM   825  N  N   . LYS A 1 122 ? 29.848 -32.059 -4.930  1.00 45.69  ? 246 LYS A N   1 
ATOM   826  C  CA  . LYS A 1 122 ? 31.158 -32.514 -4.486  1.00 47.72  ? 246 LYS A CA  1 
ATOM   827  C  C   . LYS A 1 122 ? 31.513 -33.817 -5.232  1.00 51.90  ? 246 LYS A C   1 
ATOM   828  O  O   . LYS A 1 122 ? 30.877 -34.851 -5.046  1.00 51.29  ? 246 LYS A O   1 
ATOM   829  C  CB  . LYS A 1 122 ? 31.167 -32.699 -2.958  1.00 46.86  ? 246 LYS A CB  1 
ATOM   830  C  CG  . LYS A 1 122 ? 32.530 -32.925 -2.372  1.00 46.99  ? 246 LYS A CG  1 
ATOM   831  C  CD  . LYS A 1 122 ? 32.457 -33.315 -0.899  1.00 48.45  ? 246 LYS A CD  1 
ATOM   832  C  CE  . LYS A 1 122 ? 33.813 -33.794 -0.439  1.00 48.52  ? 246 LYS A CE  1 
ATOM   833  N  NZ  . LYS A 1 122 ? 33.816 -34.320 0.949   1.00 55.18  ? 246 LYS A NZ  1 
ATOM   834  N  N   . ARG A 1 123 ? 32.526 -33.736 -6.090  1.00 45.39  ? 247 ARG A N   1 
ATOM   835  C  CA  . ARG A 1 123 ? 32.942 -34.855 -6.931  1.00 48.09  ? 247 ARG A CA  1 
ATOM   836  C  C   . ARG A 1 123 ? 34.404 -35.127 -6.685  1.00 46.43  ? 247 ARG A C   1 
ATOM   837  O  O   . ARG A 1 123 ? 35.154 -34.204 -6.377  1.00 43.61  ? 247 ARG A O   1 
ATOM   838  C  CB  . ARG A 1 123 ? 32.766 -34.526 -8.416  1.00 50.30  ? 247 ARG A CB  1 
ATOM   839  C  CG  . ARG A 1 123 ? 31.395 -34.035 -8.787  1.00 56.60  ? 247 ARG A CG  1 
ATOM   840  C  CD  . ARG A 1 123 ? 31.060 -34.499 -10.175 1.00 65.01  ? 247 ARG A CD  1 
ATOM   841  N  NE  . ARG A 1 123 ? 31.691 -33.669 -11.193 1.00 67.48  ? 247 ARG A NE  1 
ATOM   842  C  CZ  . ARG A 1 123 ? 31.804 -34.028 -12.465 1.00 71.75  ? 247 ARG A CZ  1 
ATOM   843  N  NH1 . ARG A 1 123 ? 31.353 -35.210 -12.862 1.00 74.36  ? 247 ARG A NH1 1 
ATOM   844  N  NH2 . ARG A 1 123 ? 32.381 -33.215 -13.336 1.00 74.80  ? 247 ARG A NH2 1 
ATOM   845  N  N   . GLU A 1 124 ? 34.797 -36.389 -6.868  1.00 46.46  ? 248 GLU A N   1 
ATOM   846  C  CA  . GLU A 1 124 ? 36.129 -36.870 -6.523  1.00 48.19  ? 248 GLU A CA  1 
ATOM   847  C  C   . GLU A 1 124 ? 36.479 -38.110 -7.358  1.00 48.05  ? 248 GLU A C   1 
ATOM   848  O  O   . GLU A 1 124 ? 35.701 -39.066 -7.426  1.00 46.72  ? 248 GLU A O   1 
ATOM   849  C  CB  . GLU A 1 124 ? 36.187 -37.189 -5.012  1.00 47.73  ? 248 GLU A CB  1 
ATOM   850  C  CG  . GLU A 1 124 ? 37.543 -37.647 -4.517  1.00 51.57  ? 248 GLU A CG  1 
ATOM   851  C  CD  . GLU A 1 124 ? 37.720 -37.505 -3.010  1.00 55.66  ? 248 GLU A CD  1 
ATOM   852  O  OE1 . GLU A 1 124 ? 36.744 -37.157 -2.304  1.00 61.21  ? 248 GLU A OE1 1 
ATOM   853  O  OE2 . GLU A 1 124 ? 38.853 -37.734 -2.525  1.00 62.17  ? 248 GLU A OE2 1 
ATOM   854  N  N   . THR A 1 125 ? 37.638 -38.076 -8.018  1.00 48.27  ? 249 THR A N   1 
ATOM   855  C  CA  . THR A 1 125 ? 38.206 -39.276 -8.641  1.00 47.28  ? 249 THR A CA  1 
ATOM   856  C  C   . THR A 1 125 ? 39.443 -39.638 -7.839  1.00 45.16  ? 249 THR A C   1 
ATOM   857  O  O   . THR A 1 125 ? 39.639 -39.099 -6.755  1.00 45.48  ? 249 THR A O   1 
ATOM   858  C  CB  . THR A 1 125 ? 38.528 -39.088 -10.139 1.00 48.48  ? 249 THR A CB  1 
ATOM   859  O  OG1 . THR A 1 125 ? 39.315 -37.917 -10.311 1.00 50.57  ? 249 THR A OG1 1 
ATOM   860  C  CG2 . THR A 1 125 ? 37.254 -38.940 -10.959 1.00 51.15  ? 249 THR A CG2 1 
ATOM   861  N  N   . ARG A 1 126 ? 40.269 -40.551 -8.340  1.00 45.21  ? 250 ARG A N   1 
ATOM   862  C  CA  . ARG A 1 126 ? 41.536 -40.861 -7.667  1.00 44.19  ? 250 ARG A CA  1 
ATOM   863  C  C   . ARG A 1 126 ? 42.489 -39.658 -7.616  1.00 45.06  ? 250 ARG A C   1 
ATOM   864  O  O   . ARG A 1 126 ? 43.274 -39.527 -6.678  1.00 46.25  ? 250 ARG A O   1 
ATOM   865  C  CB  . ARG A 1 126 ? 42.248 -42.018 -8.358  1.00 44.53  ? 250 ARG A CB  1 
ATOM   866  C  CG  . ARG A 1 126 ? 41.576 -43.357 -8.219  1.00 43.20  ? 250 ARG A CG  1 
ATOM   867  C  CD  . ARG A 1 126 ? 42.550 -44.424 -8.654  1.00 41.84  ? 250 ARG A CD  1 
ATOM   868  N  NE  . ARG A 1 126 ? 41.976 -45.771 -8.696  1.00 44.33  ? 250 ARG A NE  1 
ATOM   869  C  CZ  . ARG A 1 126 ? 41.888 -46.591 -7.651  1.00 37.94  ? 250 ARG A CZ  1 
ATOM   870  N  NH1 . ARG A 1 126 ? 41.394 -47.794 -7.820  1.00 33.10  ? 250 ARG A NH1 1 
ATOM   871  N  NH2 . ARG A 1 126 ? 42.306 -46.213 -6.446  1.00 36.09  ? 250 ARG A NH2 1 
ATOM   872  N  N   . THR A 1 127 ? 42.423 -38.788 -8.622  1.00 44.86  ? 251 THR A N   1 
ATOM   873  C  CA  . THR A 1 127 ? 43.417 -37.729 -8.780  1.00 47.77  ? 251 THR A CA  1 
ATOM   874  C  C   . THR A 1 127 ? 42.826 -36.311 -8.775  1.00 48.72  ? 251 THR A C   1 
ATOM   875  O  O   . THR A 1 127 ? 43.532 -35.340 -8.521  1.00 51.88  ? 251 THR A O   1 
ATOM   876  C  CB  . THR A 1 127 ? 44.250 -37.951 -10.056 1.00 49.45  ? 251 THR A CB  1 
ATOM   877  O  OG1 . THR A 1 127 ? 43.375 -38.230 -11.158 1.00 49.56  ? 251 THR A OG1 1 
ATOM   878  C  CG2 . THR A 1 127 ? 45.191 -39.137 -9.869  1.00 50.46  ? 251 THR A CG2 1 
ATOM   879  N  N   . ALA A 1 128 ? 41.531 -36.192 -9.036  1.00 47.31  ? 252 ALA A N   1 
ATOM   880  C  CA  . ALA A 1 128 ? 40.887 -34.881 -9.080  1.00 46.45  ? 252 ALA A CA  1 
ATOM   881  C  C   . ALA A 1 128 ? 39.789 -34.734 -8.015  1.00 44.18  ? 252 ALA A C   1 
ATOM   882  O  O   . ALA A 1 128 ? 39.245 -35.718 -7.521  1.00 44.09  ? 252 ALA A O   1 
ATOM   883  C  CB  . ALA A 1 128 ? 40.346 -34.603 -10.466 1.00 46.10  ? 252 ALA A CB  1 
ATOM   884  N  N   . ARG A 1 129 ? 39.516 -33.486 -7.650  1.00 43.64  ? 253 ARG A N   1 
ATOM   885  C  CA  . ARG A 1 129 ? 38.482 -33.118 -6.697  1.00 42.35  ? 253 ARG A CA  1 
ATOM   886  C  C   . ARG A 1 129 ? 37.737 -31.935 -7.316  1.00 43.36  ? 253 ARG A C   1 
ATOM   887  O  O   . ARG A 1 129 ? 38.371 -31.037 -7.857  1.00 45.18  ? 253 ARG A O   1 
ATOM   888  C  CB  . ARG A 1 129 ? 39.111 -32.740 -5.343  1.00 42.88  ? 253 ARG A CB  1 
ATOM   889  C  CG  . ARG A 1 129 ? 39.725 -33.943 -4.592  1.00 41.90  ? 253 ARG A CG  1 
ATOM   890  C  CD  . ARG A 1 129 ? 40.457 -33.580 -3.303  1.00 43.92  ? 253 ARG A CD  1 
ATOM   891  N  NE  . ARG A 1 129 ? 41.414 -32.497 -3.514  1.00 47.21  ? 253 ARG A NE  1 
ATOM   892  C  CZ  . ARG A 1 129 ? 41.894 -31.691 -2.564  1.00 49.28  ? 253 ARG A CZ  1 
ATOM   893  N  NH1 . ARG A 1 129 ? 41.539 -31.830 -1.286  1.00 46.47  ? 253 ARG A NH1 1 
ATOM   894  N  NH2 . ARG A 1 129 ? 42.741 -30.726 -2.904  1.00 49.64  ? 253 ARG A NH2 1 
ATOM   895  N  N   . GLU A 1 130 ? 36.405 -31.963 -7.288  1.00 42.38  ? 254 GLU A N   1 
ATOM   896  C  CA  . GLU A 1 130 ? 35.591 -30.872 -7.829  1.00 44.68  ? 254 GLU A CA  1 
ATOM   897  C  C   . GLU A 1 130 ? 34.533 -30.422 -6.823  1.00 42.10  ? 254 GLU A C   1 
ATOM   898  O  O   . GLU A 1 130 ? 33.777 -31.226 -6.272  1.00 40.30  ? 254 GLU A O   1 
ATOM   899  C  CB  . GLU A 1 130 ? 34.932 -31.245 -9.171  1.00 45.55  ? 254 GLU A CB  1 
ATOM   900  C  CG  . GLU A 1 130 ? 35.891 -31.215 -10.373 1.00 52.63  ? 254 GLU A CG  1 
ATOM   901  C  CD  . GLU A 1 130 ? 35.182 -31.369 -11.729 1.00 60.15  ? 254 GLU A CD  1 
ATOM   902  O  OE1 . GLU A 1 130 ? 35.816 -31.079 -12.778 1.00 70.93  ? 254 GLU A OE1 1 
ATOM   903  O  OE2 . GLU A 1 130 ? 33.995 -31.788 -11.761 1.00 67.63  ? 254 GLU A OE2 1 
ATOM   904  N  N   . LEU A 1 131 ? 34.496 -29.117 -6.592  1.00 42.00  ? 255 LEU A N   1 
ATOM   905  C  CA  . LEU A 1 131 ? 33.565 -28.539 -5.650  1.00 39.36  ? 255 LEU A CA  1 
ATOM   906  C  C   . LEU A 1 131 ? 32.800 -27.458 -6.364  1.00 38.38  ? 255 LEU A C   1 
ATOM   907  O  O   . LEU A 1 131 ? 33.384 -26.602 -7.019  1.00 38.15  ? 255 LEU A O   1 
ATOM   908  C  CB  . LEU A 1 131 ? 34.306 -27.962 -4.431  1.00 39.98  ? 255 LEU A CB  1 
ATOM   909  C  CG  . LEU A 1 131 ? 33.462 -27.545 -3.212  1.00 39.34  ? 255 LEU A CG  1 
ATOM   910  C  CD1 . LEU A 1 131 ? 32.823 -28.771 -2.582  1.00 38.26  ? 255 LEU A CD1 1 
ATOM   911  C  CD2 . LEU A 1 131 ? 34.306 -26.823 -2.196  1.00 36.36  ? 255 LEU A CD2 1 
ATOM   912  N  N   . TYR A 1 132 ? 31.481 -27.524 -6.262  1.00 38.20  ? 256 TYR A N   1 
ATOM   913  C  CA  . TYR A 1 132 ? 30.646 -26.442 -6.742  1.00 37.77  ? 256 TYR A CA  1 
ATOM   914  C  C   . TYR A 1 132 ? 29.860 -25.874 -5.567  1.00 36.75  ? 256 TYR A C   1 
ATOM   915  O  O   . TYR A 1 132 ? 29.552 -26.597 -4.621  1.00 35.32  ? 256 TYR A O   1 
ATOM   916  C  CB  . TYR A 1 132 ? 29.704 -26.918 -7.847  1.00 40.35  ? 256 TYR A CB  1 
ATOM   917  C  CG  . TYR A 1 132 ? 30.394 -27.382 -9.113  1.00 40.91  ? 256 TYR A CG  1 
ATOM   918  C  CD1 . TYR A 1 132 ? 31.003 -28.640 -9.181  1.00 42.57  ? 256 TYR A CD1 1 
ATOM   919  C  CD2 . TYR A 1 132 ? 30.412 -26.580 -10.246 1.00 41.74  ? 256 TYR A CD2 1 
ATOM   920  C  CE1 . TYR A 1 132 ? 31.622 -29.075 -10.340 1.00 44.61  ? 256 TYR A CE1 1 
ATOM   921  C  CE2 . TYR A 1 132 ? 31.023 -27.007 -11.416 1.00 43.85  ? 256 TYR A CE2 1 
ATOM   922  C  CZ  . TYR A 1 132 ? 31.625 -28.246 -11.452 1.00 44.88  ? 256 TYR A CZ  1 
ATOM   923  O  OH  . TYR A 1 132 ? 32.226 -28.667 -12.598 1.00 51.36  ? 256 TYR A OH  1 
ATOM   924  N  N   . ALA A 1 133 ? 29.543 -24.579 -5.636  1.00 35.81  ? 257 ALA A N   1 
ATOM   925  C  CA  . ALA A 1 133 ? 28.739 -23.941 -4.614  1.00 33.23  ? 257 ALA A CA  1 
ATOM   926  C  C   . ALA A 1 133 ? 27.847 -22.880 -5.231  1.00 35.23  ? 257 ALA A C   1 
ATOM   927  O  O   . ALA A 1 133 ? 28.179 -22.301 -6.263  1.00 36.55  ? 257 ALA A O   1 
ATOM   928  C  CB  . ALA A 1 133 ? 29.647 -23.338 -3.513  1.00 30.74  ? 257 ALA A CB  1 
ATOM   929  N  N   . ASN A 1 134 ? 26.695 -22.652 -4.604  1.00 36.89  ? 258 ASN A N   1 
ATOM   930  C  CA  . ASN A 1 134 ? 25.888 -21.463 -4.852  1.00 36.91  ? 258 ASN A CA  1 
ATOM   931  C  C   . ASN A 1 134 ? 26.429 -20.317 -4.005  1.00 35.87  ? 258 ASN A C   1 
ATOM   932  O  O   . ASN A 1 134 ? 26.358 -20.348 -2.772  1.00 36.80  ? 258 ASN A O   1 
ATOM   933  C  CB  . ASN A 1 134 ? 24.417 -21.749 -4.545  1.00 38.23  ? 258 ASN A CB  1 
ATOM   934  C  CG  . ASN A 1 134 ? 23.921 -23.023 -5.247  1.00 43.61  ? 258 ASN A CG  1 
ATOM   935  O  OD1 . ASN A 1 134 ? 24.249 -23.267 -6.409  1.00 45.27  ? 258 ASN A OD1 1 
ATOM   936  N  ND2 . ASN A 1 134 ? 23.153 -23.840 -4.537  1.00 44.68  ? 258 ASN A ND2 1 
ATOM   937  N  N   . VAL A 1 135 ? 26.992 -19.319 -4.675  1.00 42.25  ? 259 VAL A N   1 
ATOM   938  C  CA  . VAL A 1 135 ? 27.665 -18.229 -4.002  1.00 40.16  ? 259 VAL A CA  1 
ATOM   939  C  C   . VAL A 1 135 ? 26.774 -16.984 -3.877  1.00 42.70  ? 259 VAL A C   1 
ATOM   940  O  O   . VAL A 1 135 ? 26.249 -16.485 -4.881  1.00 43.29  ? 259 VAL A O   1 
ATOM   941  C  CB  . VAL A 1 135 ? 29.016 -17.910 -4.678  1.00 38.73  ? 259 VAL A CB  1 
ATOM   942  C  CG1 . VAL A 1 135 ? 29.682 -16.694 -4.041  1.00 35.82  ? 259 VAL A CG1 1 
ATOM   943  C  CG2 . VAL A 1 135 ? 29.942 -19.106 -4.581  1.00 37.75  ? 259 VAL A CG2 1 
ATOM   944  N  N   . VAL A 1 136 ? 26.612 -16.507 -2.638  1.00 40.98  ? 260 VAL A N   1 
ATOM   945  C  CA  . VAL A 1 136 ? 25.819 -15.314 -2.341  1.00 46.67  ? 260 VAL A CA  1 
ATOM   946  C  C   . VAL A 1 136 ? 26.652 -14.040 -2.480  1.00 49.14  ? 260 VAL A C   1 
ATOM   947  O  O   . VAL A 1 136 ? 27.642 -13.843 -1.762  1.00 46.13  ? 260 VAL A O   1 
ATOM   948  C  CB  . VAL A 1 136 ? 25.205 -15.384 -0.920  1.00 48.51  ? 260 VAL A CB  1 
ATOM   949  C  CG1 . VAL A 1 136 ? 24.269 -14.180 -0.660  1.00 47.06  ? 260 VAL A CG1 1 
ATOM   950  C  CG2 . VAL A 1 136 ? 24.459 -16.728 -0.739  1.00 49.28  ? 260 VAL A CG2 1 
ATOM   951  N  N   . LEU A 1 137 ? 26.250 -13.159 -3.389  1.00 54.35  ? 261 LEU A N   1 
ATOM   952  C  CA  . LEU A 1 137 ? 27.093 -12.001 -3.660  1.00 59.34  ? 261 LEU A CA  1 
ATOM   953  C  C   . LEU A 1 137 ? 26.400 -10.627 -3.649  1.00 64.86  ? 261 LEU A C   1 
ATOM   954  O  O   . LEU A 1 137 ? 26.284 -9.950  -4.676  1.00 69.06  ? 261 LEU A O   1 
ATOM   955  C  CB  . LEU A 1 137 ? 27.956 -12.244 -4.917  1.00 59.66  ? 261 LEU A CB  1 
ATOM   956  C  CG  . LEU A 1 137 ? 27.501 -12.024 -6.361  1.00 62.30  ? 261 LEU A CG  1 
ATOM   957  C  CD1 . LEU A 1 137 ? 28.436 -12.795 -7.264  1.00 61.87  ? 261 LEU A CD1 1 
ATOM   958  C  CD2 . LEU A 1 137 ? 26.045 -12.413 -6.631  1.00 68.62  ? 261 LEU A CD2 1 
ATOM   959  N  N   . GLY A 1 138 ? 25.959 -10.205 -2.472  1.00 66.75  ? 262 GLY A N   1 
ATOM   960  C  CA  . GLY A 1 138 ? 25.444 -8.848  -2.328  1.00 73.10  ? 262 GLY A CA  1 
ATOM   961  C  C   . GLY A 1 138 ? 23.957 -8.744  -2.578  1.00 77.86  ? 262 GLY A C   1 
ATOM   962  O  O   . GLY A 1 138 ? 23.166 -8.730  -1.635  1.00 80.52  ? 262 GLY A O   1 
ATOM   963  N  N   . ASP A 1 139 ? 23.577 -8.683  -3.850  1.00 81.14  ? 263 ASP A N   1 
ATOM   964  C  CA  . ASP A 1 139 ? 22.180 -8.480  -4.224  1.00 85.72  ? 263 ASP A CA  1 
ATOM   965  C  C   . ASP A 1 139 ? 21.451 -9.778  -4.579  1.00 84.75  ? 263 ASP A C   1 
ATOM   966  O  O   . ASP A 1 139 ? 20.219 -9.829  -4.534  1.00 87.87  ? 263 ASP A O   1 
ATOM   967  C  CB  . ASP A 1 139 ? 22.078 -7.477  -5.381  1.00 89.97  ? 263 ASP A CB  1 
ATOM   968  N  N   . ASP A 1 140 ? 22.205 -10.824 -4.919  1.00 80.43  ? 264 ASP A N   1 
ATOM   969  C  CA  . ASP A 1 140 ? 21.598 -12.040 -5.462  1.00 80.01  ? 264 ASP A CA  1 
ATOM   970  C  C   . ASP A 1 140 ? 22.410 -13.294 -5.152  1.00 74.13  ? 264 ASP A C   1 
ATOM   971  O  O   . ASP A 1 140 ? 23.274 -13.297 -4.282  1.00 72.49  ? 264 ASP A O   1 
ATOM   972  C  CB  . ASP A 1 140 ? 21.390 -11.885 -6.987  1.00 83.47  ? 264 ASP A CB  1 
ATOM   973  C  CG  . ASP A 1 140 ? 20.063 -12.475 -7.472  1.00 87.74  ? 264 ASP A CG  1 
ATOM   974  O  OD1 . ASP A 1 140 ? 20.019 -13.681 -7.792  1.00 87.04  ? 264 ASP A OD1 1 
ATOM   975  O  OD2 . ASP A 1 140 ? 19.065 -11.723 -7.554  1.00 93.62  ? 264 ASP A OD2 1 
ATOM   976  N  N   . SER A 1 141 ? 22.119 -14.360 -5.882  1.00 72.87  ? 265 SER A N   1 
ATOM   977  C  CA  . SER A 1 141 ? 22.767 -15.648 -5.704  1.00 67.19  ? 265 SER A CA  1 
ATOM   978  C  C   . SER A 1 141 ? 23.240 -16.170 -7.070  1.00 65.05  ? 265 SER A C   1 
ATOM   979  O  O   . SER A 1 141 ? 22.535 -16.059 -8.081  1.00 67.15  ? 265 SER A O   1 
ATOM   980  C  CB  . SER A 1 141 ? 21.784 -16.624 -5.040  1.00 67.71  ? 265 SER A CB  1 
ATOM   981  O  OG  . SER A 1 141 ? 22.372 -17.886 -4.780  1.00 66.60  ? 265 SER A OG  1 
ATOM   982  N  N   . LEU A 1 142 ? 24.444 -16.727 -7.087  1.00 58.82  ? 266 LEU A N   1 
ATOM   983  C  CA  . LEU A 1 142 ? 25.033 -17.259 -8.293  1.00 56.30  ? 266 LEU A CA  1 
ATOM   984  C  C   . LEU A 1 142 ? 25.199 -18.770 -8.142  1.00 53.37  ? 266 LEU A C   1 
ATOM   985  O  O   . LEU A 1 142 ? 26.023 -19.247 -7.356  1.00 49.01  ? 266 LEU A O   1 
ATOM   986  C  CB  . LEU A 1 142 ? 26.375 -16.576 -8.541  1.00 56.11  ? 266 LEU A CB  1 
ATOM   987  C  CG  . LEU A 1 142 ? 27.044 -16.613 -9.913  1.00 60.40  ? 266 LEU A CG  1 
ATOM   988  C  CD1 . LEU A 1 142 ? 26.180 -15.971 -11.001 1.00 65.57  ? 266 LEU A CD1 1 
ATOM   989  C  CD2 . LEU A 1 142 ? 28.368 -15.883 -9.799  1.00 62.49  ? 266 LEU A CD2 1 
ATOM   990  N  N   . ASN A 1 143 ? 24.404 -19.518 -8.901  1.00 54.01  ? 267 ASN A N   1 
ATOM   991  C  CA  . ASN A 1 143 ? 24.351 -20.972 -8.777  1.00 52.94  ? 267 ASN A CA  1 
ATOM   992  C  C   . ASN A 1 143 ? 25.420 -21.728 -9.559  1.00 50.71  ? 267 ASN A C   1 
ATOM   993  O  O   . ASN A 1 143 ? 25.815 -21.320 -10.660 1.00 49.92  ? 267 ASN A O   1 
ATOM   994  C  CB  . ASN A 1 143 ? 22.953 -21.492 -9.155  1.00 55.92  ? 267 ASN A CB  1 
ATOM   995  C  CG  . ASN A 1 143 ? 21.871 -21.040 -8.177  1.00 58.87  ? 267 ASN A CG  1 
ATOM   996  O  OD1 . ASN A 1 143 ? 20.700 -20.989 -8.531  1.00 66.17  ? 267 ASN A OD1 1 
ATOM   997  N  ND2 . ASN A 1 143 ? 22.261 -20.700 -6.949  1.00 57.26  ? 267 ASN A ND2 1 
ATOM   998  N  N   . ASP A 1 144 ? 25.876 -22.833 -8.965  1.00 49.96  ? 268 ASP A N   1 
ATOM   999  C  CA  . ASP A 1 144 ? 26.761 -23.806 -9.625  1.00 49.99  ? 268 ASP A CA  1 
ATOM   1000 C  C   . ASP A 1 144 ? 28.108 -23.200 -9.994  1.00 47.98  ? 268 ASP A C   1 
ATOM   1001 O  O   . ASP A 1 144 ? 28.539 -23.308 -11.154 1.00 48.28  ? 268 ASP A O   1 
ATOM   1002 C  CB  . ASP A 1 144 ? 26.074 -24.403 -10.870 1.00 53.52  ? 268 ASP A CB  1 
ATOM   1003 C  CG  . ASP A 1 144 ? 26.675 -25.745 -11.309 1.00 57.34  ? 268 ASP A CG  1 
ATOM   1004 O  OD1 . ASP A 1 144 ? 26.929 -26.601 -10.425 1.00 54.08  ? 268 ASP A OD1 1 
ATOM   1005 O  OD2 . ASP A 1 144 ? 26.875 -25.946 -12.547 1.00 56.32  ? 268 ASP A OD2 1 
ATOM   1006 N  N   . CYS A 1 145 ? 28.758 -22.543 -9.022  1.00 43.49  ? 269 CYS A N   1 
ATOM   1007 C  CA  . CYS A 1 145 ? 30.104 -21.992 -9.247  1.00 42.15  ? 269 CYS A CA  1 
ATOM   1008 C  C   . CYS A 1 145 ? 31.145 -23.016 -8.887  1.00 40.75  ? 269 CYS A C   1 
ATOM   1009 O  O   . CYS A 1 145 ? 31.092 -23.621 -7.806  1.00 43.20  ? 269 CYS A O   1 
ATOM   1010 C  CB  . CYS A 1 145 ? 30.373 -20.732 -8.424  1.00 40.71  ? 269 CYS A CB  1 
ATOM   1011 S  SG  . CYS A 1 145 ? 29.199 -19.403 -8.633  1.00 47.23  ? 269 CYS A SG  1 
ATOM   1012 N  N   . ARG A 1 146 ? 32.103 -23.198 -9.786  1.00 41.72  ? 270 ARG A N   1 
ATOM   1013 C  CA  . ARG A 1 146 ? 33.221 -24.095 -9.560  1.00 40.55  ? 270 ARG A CA  1 
ATOM   1014 C  C   . ARG A 1 146 ? 34.235 -23.422 -8.625  1.00 40.35  ? 270 ARG A C   1 
ATOM   1015 O  O   . ARG A 1 146 ? 34.852 -22.408 -8.987  1.00 39.71  ? 270 ARG A O   1 
ATOM   1016 C  CB  . ARG A 1 146 ? 33.868 -24.458 -10.893 1.00 42.17  ? 270 ARG A CB  1 
ATOM   1017 C  CG  . ARG A 1 146 ? 35.126 -25.300 -10.777 1.00 42.49  ? 270 ARG A CG  1 
ATOM   1018 C  CD  . ARG A 1 146 ? 34.818 -26.738 -10.378 1.00 44.01  ? 270 ARG A CD  1 
ATOM   1019 N  NE  . ARG A 1 146 ? 36.060 -27.502 -10.290 1.00 47.90  ? 270 ARG A NE  1 
ATOM   1020 C  CZ  . ARG A 1 146 ? 36.624 -28.155 -11.305 1.00 52.09  ? 270 ARG A CZ  1 
ATOM   1021 N  NH1 . ARG A 1 146 ? 36.055 -28.178 -12.508 1.00 54.61  ? 270 ARG A NH1 1 
ATOM   1022 N  NH2 . ARG A 1 146 ? 37.757 -28.805 -11.105 1.00 52.83  ? 270 ARG A NH2 1 
ATOM   1023 N  N   . ILE A 1 147 ? 34.402 -23.988 -7.434  1.00 37.64  ? 271 ILE A N   1 
ATOM   1024 C  CA  . ILE A 1 147 ? 35.326 -23.444 -6.442  1.00 38.10  ? 271 ILE A CA  1 
ATOM   1025 C  C   . ILE A 1 147 ? 36.717 -24.051 -6.644  1.00 42.53  ? 271 ILE A C   1 
ATOM   1026 O  O   . ILE A 1 147 ? 36.888 -25.284 -6.653  1.00 44.34  ? 271 ILE A O   1 
ATOM   1027 C  CB  . ILE A 1 147 ? 34.823 -23.702 -5.006  1.00 36.29  ? 271 ILE A CB  1 
ATOM   1028 C  CG1 . ILE A 1 147 ? 33.350 -23.275 -4.852  1.00 34.54  ? 271 ILE A CG1 1 
ATOM   1029 C  CG2 . ILE A 1 147 ? 35.764 -23.064 -3.957  1.00 36.26  ? 271 ILE A CG2 1 
ATOM   1030 C  CD1 . ILE A 1 147 ? 33.050 -21.821 -5.238  1.00 33.10  ? 271 ILE A CD1 1 
ATOM   1031 N  N   . ILE A 1 148 ? 37.697 -23.175 -6.840  1.00 44.11  ? 272 ILE A N   1 
ATOM   1032 C  CA  . ILE A 1 148 ? 39.055 -23.577 -7.170  1.00 48.03  ? 272 ILE A CA  1 
ATOM   1033 C  C   . ILE A 1 148 ? 39.806 -23.869 -5.869  1.00 47.99  ? 272 ILE A C   1 
ATOM   1034 O  O   . ILE A 1 148 ? 40.516 -24.868 -5.766  1.00 49.87  ? 272 ILE A O   1 
ATOM   1035 C  CB  . ILE A 1 148 ? 39.782 -22.464 -8.019  1.00 50.11  ? 272 ILE A CB  1 
ATOM   1036 C  CG1 . ILE A 1 148 ? 39.166 -22.323 -9.429  1.00 52.88  ? 272 ILE A CG1 1 
ATOM   1037 C  CG2 . ILE A 1 148 ? 41.287 -22.685 -8.086  1.00 52.40  ? 272 ILE A CG2 1 
ATOM   1038 C  CD1 . ILE A 1 148 ? 39.287 -23.541 -10.354 1.00 49.62  ? 272 ILE A CD1 1 
ATOM   1039 N  N   . PHE A 1 149 ? 39.597 -23.012 -4.872  1.00 46.61  ? 273 PHE A N   1 
ATOM   1040 C  CA  . PHE A 1 149 ? 40.346 -23.044 -3.605  1.00 46.18  ? 273 PHE A CA  1 
ATOM   1041 C  C   . PHE A 1 149 ? 39.699 -23.950 -2.592  1.00 43.64  ? 273 PHE A C   1 
ATOM   1042 O  O   . PHE A 1 149 ? 39.165 -23.548 -1.562  1.00 44.11  ? 273 PHE A O   1 
ATOM   1043 C  CB  . PHE A 1 149 ? 40.636 -21.620 -3.114  1.00 45.62  ? 273 PHE A CB  1 
ATOM   1044 C  CG  . PHE A 1 149 ? 41.350 -20.812 -4.146  1.00 49.47  ? 273 PHE A CG  1 
ATOM   1045 C  CD1 . PHE A 1 149 ? 40.649 -19.946 -4.974  1.00 48.83  ? 273 PHE A CD1 1 
ATOM   1046 C  CD2 . PHE A 1 149 ? 42.707 -21.018 -4.382  1.00 51.54  ? 273 PHE A CD2 1 
ATOM   1047 C  CE1 . PHE A 1 149 ? 41.299 -19.257 -5.981  1.00 51.28  ? 273 PHE A CE1 1 
ATOM   1048 C  CE2 . PHE A 1 149 ? 43.375 -20.319 -5.381  1.00 51.76  ? 273 PHE A CE2 1 
ATOM   1049 C  CZ  . PHE A 1 149 ? 42.674 -19.439 -6.178  1.00 53.04  ? 273 PHE A CZ  1 
ATOM   1050 N  N   . VAL A 1 150 ? 39.817 -25.223 -2.918  1.00 43.60  ? 274 VAL A N   1 
ATOM   1051 C  CA  . VAL A 1 150 ? 39.083 -26.301 -2.276  1.00 43.48  ? 274 VAL A CA  1 
ATOM   1052 C  C   . VAL A 1 150 ? 39.570 -26.696 -0.866  1.00 43.95  ? 274 VAL A C   1 
ATOM   1053 O  O   . VAL A 1 150 ? 38.853 -27.393 -0.129  1.00 42.32  ? 274 VAL A O   1 
ATOM   1054 C  CB  . VAL A 1 150 ? 39.015 -27.479 -3.294  1.00 44.61  ? 274 VAL A CB  1 
ATOM   1055 C  CG1 . VAL A 1 150 ? 39.811 -28.731 -2.872  1.00 45.56  ? 274 VAL A CG1 1 
ATOM   1056 C  CG2 . VAL A 1 150 ? 37.618 -27.715 -3.672  1.00 44.14  ? 274 VAL A CG2 1 
ATOM   1057 N  N   . ASP A 1 151 ? 40.772 -26.230 -0.502  1.00 43.56  ? 275 ASP A N   1 
ATOM   1058 C  CA  . ASP A 1 151 ? 41.366 -26.514 0.799   1.00 44.09  ? 275 ASP A CA  1 
ATOM   1059 C  C   . ASP A 1 151 ? 41.336 -25.288 1.719   1.00 43.80  ? 275 ASP A C   1 
ATOM   1060 O  O   . ASP A 1 151 ? 41.896 -25.294 2.838   1.00 43.24  ? 275 ASP A O   1 
ATOM   1061 C  CB  . ASP A 1 151 ? 42.788 -27.075 0.634   1.00 47.59  ? 275 ASP A CB  1 
ATOM   1062 C  CG  . ASP A 1 151 ? 42.792 -28.508 0.085   1.00 52.15  ? 275 ASP A CG  1 
ATOM   1063 O  OD1 . ASP A 1 151 ? 42.207 -29.398 0.738   1.00 53.26  ? 275 ASP A OD1 1 
ATOM   1064 O  OD2 . ASP A 1 151 ? 43.368 -28.746 -1.006  1.00 53.68  ? 275 ASP A OD2 1 
ATOM   1065 N  N   . GLU A 1 152 ? 40.654 -24.241 1.257   1.00 42.94  ? 276 GLU A N   1 
ATOM   1066 C  CA  . GLU A 1 152 ? 40.564 -22.999 2.024   1.00 44.01  ? 276 GLU A CA  1 
ATOM   1067 C  C   . GLU A 1 152 ? 39.120 -22.582 2.249   1.00 41.44  ? 276 GLU A C   1 
ATOM   1068 O  O   . GLU A 1 152 ? 38.728 -21.433 1.968   1.00 42.17  ? 276 GLU A O   1 
ATOM   1069 C  CB  . GLU A 1 152 ? 41.349 -21.883 1.332   1.00 44.95  ? 276 GLU A CB  1 
ATOM   1070 C  CG  . GLU A 1 152 ? 42.804 -22.214 1.101   1.00 51.02  ? 276 GLU A CG  1 
ATOM   1071 C  CD  . GLU A 1 152 ? 43.459 -21.226 0.170   1.00 59.40  ? 276 GLU A CD  1 
ATOM   1072 O  OE1 . GLU A 1 152 ? 43.226 -20.013 0.346   1.00 61.56  ? 276 GLU A OE1 1 
ATOM   1073 O  OE2 . GLU A 1 152 ? 44.196 -21.654 -0.743  1.00 63.81  ? 276 GLU A OE2 1 
ATOM   1074 N  N   . VAL A 1 153 ? 38.330 -23.531 2.733   1.00 37.63  ? 277 VAL A N   1 
ATOM   1075 C  CA  . VAL A 1 153 ? 36.932 -23.296 3.031   1.00 35.19  ? 277 VAL A CA  1 
ATOM   1076 C  C   . VAL A 1 153 ? 36.779 -23.173 4.546   1.00 37.11  ? 277 VAL A C   1 
ATOM   1077 O  O   . VAL A 1 153 ? 37.129 -24.098 5.294   1.00 35.79  ? 277 VAL A O   1 
ATOM   1078 C  CB  . VAL A 1 153 ? 36.039 -24.442 2.497   1.00 36.64  ? 277 VAL A CB  1 
ATOM   1079 C  CG1 . VAL A 1 153 ? 34.610 -24.261 2.959   1.00 35.29  ? 277 VAL A CG1 1 
ATOM   1080 C  CG2 . VAL A 1 153 ? 36.136 -24.569 0.943   1.00 32.25  ? 277 VAL A CG2 1 
ATOM   1081 N  N   . PHE A 1 154 ? 36.274 -22.013 4.979   1.00 36.86  ? 278 PHE A N   1 
ATOM   1082 C  CA  . PHE A 1 154 ? 36.088 -21.696 6.383   1.00 36.86  ? 278 PHE A CA  1 
ATOM   1083 C  C   . PHE A 1 154 ? 34.694 -22.041 6.915   1.00 36.66  ? 278 PHE A C   1 
ATOM   1084 O  O   . PHE A 1 154 ? 33.687 -21.847 6.234   1.00 35.15  ? 278 PHE A O   1 
ATOM   1085 C  CB  . PHE A 1 154 ? 36.376 -20.208 6.632   1.00 37.41  ? 278 PHE A CB  1 
ATOM   1086 C  CG  . PHE A 1 154 ? 37.839 -19.879 6.741   1.00 38.86  ? 278 PHE A CG  1 
ATOM   1087 C  CD1 . PHE A 1 154 ? 38.505 -19.997 7.965   1.00 44.24  ? 278 PHE A CD1 1 
ATOM   1088 C  CD2 . PHE A 1 154 ? 38.560 -19.461 5.620   1.00 43.01  ? 278 PHE A CD2 1 
ATOM   1089 C  CE1 . PHE A 1 154 ? 39.864 -19.705 8.082   1.00 43.10  ? 278 PHE A CE1 1 
ATOM   1090 C  CE2 . PHE A 1 154 ? 39.923 -19.167 5.717   1.00 44.88  ? 278 PHE A CE2 1 
ATOM   1091 C  CZ  . PHE A 1 154 ? 40.576 -19.285 6.958   1.00 44.90  ? 278 PHE A CZ  1 
ATOM   1092 N  N   . LYS A 1 155 ? 34.656 -22.532 8.158   1.00 37.18  ? 279 LYS A N   1 
ATOM   1093 C  CA  . LYS A 1 155 ? 33.434 -22.587 8.949   1.00 37.59  ? 279 LYS A CA  1 
ATOM   1094 C  C   . LYS A 1 155 ? 32.972 -21.166 9.232   1.00 35.99  ? 279 LYS A C   1 
ATOM   1095 O  O   . LYS A 1 155 ? 33.795 -20.283 9.422   1.00 37.62  ? 279 LYS A O   1 
ATOM   1096 C  CB  . LYS A 1 155 ? 33.698 -23.299 10.275  1.00 41.96  ? 279 LYS A CB  1 
ATOM   1097 C  CG  . LYS A 1 155 ? 32.453 -23.621 11.085  1.00 45.89  ? 279 LYS A CG  1 
ATOM   1098 C  CD  . LYS A 1 155 ? 32.747 -23.588 12.568  1.00 56.56  ? 279 LYS A CD  1 
ATOM   1099 C  CE  . LYS A 1 155 ? 31.443 -23.467 13.374  1.00 64.94  ? 279 LYS A CE  1 
ATOM   1100 N  NZ  . LYS A 1 155 ? 31.513 -22.464 14.503  1.00 68.51  ? 279 LYS A NZ  1 
ATOM   1101 N  N   . ILE A 1 156 ? 31.663 -20.943 9.254   1.00 36.46  ? 280 ILE A N   1 
ATOM   1102 C  CA  . ILE A 1 156 ? 31.114 -19.640 9.624   1.00 38.35  ? 280 ILE A CA  1 
ATOM   1103 C  C   . ILE A 1 156 ? 30.848 -19.558 11.140  1.00 43.04  ? 280 ILE A C   1 
ATOM   1104 O  O   . ILE A 1 156 ? 30.083 -20.344 11.693  1.00 45.50  ? 280 ILE A O   1 
ATOM   1105 C  CB  . ILE A 1 156 ? 29.847 -19.281 8.799   1.00 37.22  ? 280 ILE A CB  1 
ATOM   1106 C  CG1 . ILE A 1 156 ? 30.249 -18.830 7.388   1.00 36.96  ? 280 ILE A CG1 1 
ATOM   1107 C  CG2 . ILE A 1 156 ? 29.058 -18.154 9.454   1.00 39.22  ? 280 ILE A CG2 1 
ATOM   1108 C  CD1 . ILE A 1 156 ? 29.125 -18.947 6.397   1.00 41.73  ? 280 ILE A CD1 1 
ATOM   1109 N  N   . GLU A 1 157 ? 31.491 -18.595 11.793  1.00 45.66  ? 281 GLU A N   1 
ATOM   1110 C  CA  . GLU A 1 157 ? 31.296 -18.338 13.226  1.00 49.63  ? 281 GLU A CA  1 
ATOM   1111 C  C   . GLU A 1 157 ? 29.884 -17.839 13.599  1.00 52.15  ? 281 GLU A C   1 
ATOM   1112 O  O   . GLU A 1 157 ? 29.461 -16.741 13.206  1.00 51.27  ? 281 GLU A O   1 
ATOM   1113 C  CB  . GLU A 1 157 ? 32.372 -17.361 13.719  1.00 50.37  ? 281 GLU A CB  1 
ATOM   1114 C  CG  . GLU A 1 157 ? 33.780 -17.958 13.718  1.00 50.54  ? 281 GLU A CG  1 
ATOM   1115 C  CD  . GLU A 1 157 ? 33.858 -19.178 14.621  1.00 56.49  ? 281 GLU A CD  1 
ATOM   1116 O  OE1 . GLU A 1 157 ? 33.422 -19.064 15.806  1.00 60.89  ? 281 GLU A OE1 1 
ATOM   1117 O  OE2 . GLU A 1 157 ? 34.315 -20.251 14.143  1.00 51.83  ? 281 GLU A OE2 1 
ATOM   1118 N  N   . ARG A 1 158 ? 29.163 -18.648 14.368  1.00 54.63  ? 282 ARG A N   1 
ATOM   1119 C  CA  . ARG A 1 158 ? 27.818 -18.277 14.817  1.00 60.03  ? 282 ARG A CA  1 
ATOM   1120 C  C   . ARG A 1 158 ? 27.734 -18.159 16.355  1.00 63.95  ? 282 ARG A C   1 
ATOM   1121 O  O   . ARG A 1 158 ? 28.442 -18.870 17.065  1.00 64.88  ? 282 ARG A O   1 
ATOM   1122 C  CB  . ARG A 1 158 ? 26.780 -19.258 14.240  1.00 60.00  ? 282 ARG A CB  1 
ATOM   1123 C  CG  . ARG A 1 158 ? 26.707 -19.202 12.704  1.00 58.23  ? 282 ARG A CG  1 
ATOM   1124 C  CD  . ARG A 1 158 ? 25.630 -20.102 12.113  1.00 61.25  ? 282 ARG A CD  1 
ATOM   1125 N  NE  . ARG A 1 158 ? 25.303 -19.714 10.741  1.00 60.49  ? 282 ARG A NE  1 
ATOM   1126 C  CZ  . ARG A 1 158 ? 25.837 -20.262 9.649   1.00 62.75  ? 282 ARG A CZ  1 
ATOM   1127 N  NH1 . ARG A 1 158 ? 26.742 -21.240 9.746   1.00 63.47  ? 282 ARG A NH1 1 
ATOM   1128 N  NH2 . ARG A 1 158 ? 25.468 -19.829 8.444   1.00 62.55  ? 282 ARG A NH2 1 
ATOM   1129 N  N   . PRO A 1 159 ? 26.903 -17.233 16.873  1.00 67.90  ? 283 PRO A N   1 
ATOM   1130 C  CA  . PRO A 1 159 ? 26.761 -17.151 18.340  1.00 73.45  ? 283 PRO A CA  1 
ATOM   1131 C  C   . PRO A 1 159 ? 25.745 -18.159 18.889  1.00 77.41  ? 283 PRO A C   1 
ATOM   1132 O  O   . PRO A 1 159 ? 26.047 -18.890 19.834  1.00 80.28  ? 283 PRO A O   1 
ATOM   1133 C  CB  . PRO A 1 159 ? 26.261 -15.721 18.567  1.00 74.91  ? 283 PRO A CB  1 
ATOM   1134 C  CG  . PRO A 1 159 ? 25.483 -15.394 17.312  1.00 73.46  ? 283 PRO A CG  1 
ATOM   1135 C  CD  . PRO A 1 159 ? 26.086 -16.217 16.177  1.00 68.19  ? 283 PRO A CD  1 
ATOM   1136 N  N   . ARG B 2 3   ? 40.329 -4.560  -8.425  1.00 88.14  ? 8   ARG B N   1 
ATOM   1137 C  CA  . ARG B 2 3   ? 39.624 -5.754  -7.859  1.00 88.20  ? 8   ARG B CA  1 
ATOM   1138 C  C   . ARG B 2 3   ? 38.407 -5.373  -7.010  1.00 87.76  ? 8   ARG B C   1 
ATOM   1139 O  O   . ARG B 2 3   ? 37.279 -5.742  -7.347  1.00 87.98  ? 8   ARG B O   1 
ATOM   1140 C  CB  . ARG B 2 3   ? 40.591 -6.647  -7.070  1.00 87.75  ? 8   ARG B CB  1 
ATOM   1141 C  CG  . ARG B 2 3   ? 40.977 -7.920  -7.801  1.00 88.01  ? 8   ARG B CG  1 
ATOM   1142 C  CD  . ARG B 2 3   ? 42.129 -8.621  -7.113  1.00 90.06  ? 8   ARG B CD  1 
ATOM   1143 N  NE  . ARG B 2 3   ? 43.314 -7.768  -7.071  1.00 91.92  ? 8   ARG B NE  1 
ATOM   1144 C  CZ  . ARG B 2 3   ? 44.566 -8.202  -6.931  1.00 92.47  ? 8   ARG B CZ  1 
ATOM   1145 N  NH1 . ARG B 2 3   ? 44.831 -9.498  -6.823  1.00 92.47  ? 8   ARG B NH1 1 
ATOM   1146 N  NH2 . ARG B 2 3   ? 45.564 -7.328  -6.912  1.00 92.48  ? 8   ARG B NH2 1 
HETATM 1147 N  N   . M3L B 2 4   ? 38.639 -4.636  -5.922  1.00 87.05  ? 9   M3L B N   1 
HETATM 1148 C  CA  . M3L B 2 4   ? 37.556 -4.115  -5.091  1.00 86.99  ? 9   M3L B CA  1 
HETATM 1149 C  CB  . M3L B 2 4   ? 38.122 -3.179  -4.031  1.00 86.01  ? 9   M3L B CB  1 
HETATM 1150 C  CG  . M3L B 2 4   ? 38.172 -3.892  -2.686  1.00 81.36  ? 9   M3L B CG  1 
HETATM 1151 C  CD  . M3L B 2 4   ? 36.982 -3.491  -1.830  1.00 76.74  ? 9   M3L B CD  1 
HETATM 1152 C  CE  . M3L B 2 4   ? 37.364 -3.510  -0.353  1.00 73.33  ? 9   M3L B CE  1 
HETATM 1153 N  NZ  . M3L B 2 4   ? 36.364 -2.903  0.543   1.00 71.94  ? 9   M3L B NZ  1 
HETATM 1154 C  C   . M3L B 2 4   ? 36.510 -3.432  -5.938  1.00 88.73  ? 9   M3L B C   1 
HETATM 1155 O  O   . M3L B 2 4   ? 36.826 -2.525  -6.716  1.00 88.88  ? 9   M3L B O   1 
HETATM 1156 C  CM1 . M3L B 2 4   ? 36.557 -3.454  1.891   1.00 72.11  ? 9   M3L B CM1 1 
HETATM 1157 C  CM2 . M3L B 2 4   ? 36.564 -1.454  0.612   1.00 72.28  ? 9   M3L B CM2 1 
HETATM 1158 C  CM3 . M3L B 2 4   ? 34.981 -3.163  0.122   1.00 71.21  ? 9   M3L B CM3 1 
ATOM   1159 N  N   . SER B 2 5   ? 35.262 -3.886  -5.792  1.00 89.91  ? 10  SER B N   1 
ATOM   1160 C  CA  . SER B 2 5   ? 34.147 -3.529  -6.684  1.00 90.83  ? 10  SER B CA  1 
ATOM   1161 C  C   . SER B 2 5   ? 34.092 -2.053  -7.072  1.00 91.57  ? 10  SER B C   1 
ATOM   1162 O  O   . SER B 2 5   ? 33.603 -1.705  -8.150  1.00 92.31  ? 10  SER B O   1 
ATOM   1163 C  CB  . SER B 2 5   ? 32.813 -3.944  -6.060  1.00 91.14  ? 10  SER B CB  1 
ATOM   1164 O  OG  . SER B 2 5   ? 32.489 -3.114  -4.953  1.00 92.48  ? 10  SER B OG  1 
HETATM 1165 O  O   . HOH C 3 .   ? 42.002 -31.476 -8.221  1.00 48.87  ? 301 HOH A O   1 
HETATM 1166 O  O   . HOH C 3 .   ? 45.384 -32.080 -4.505  1.00 56.26  ? 302 HOH A O   1 
HETATM 1167 O  O   . HOH C 3 .   ? 37.940 -21.187 -0.656  1.00 29.47  ? 303 HOH A O   1 
HETATM 1168 O  O   . HOH C 3 .   ? 28.853 -2.766  3.725   1.00 45.73  ? 304 HOH A O   1 
HETATM 1169 O  O   . HOH C 3 .   ? 41.667 -29.868 3.251   1.00 43.46  ? 305 HOH A O   1 
HETATM 1170 O  O   . HOH C 3 .   ? 40.993 -37.380 -5.097  1.00 49.30  ? 306 HOH A O   1 
HETATM 1171 O  O   . HOH C 3 .   ? 24.133 -30.678 4.833   1.00 51.04  ? 307 HOH A O   1 
HETATM 1172 O  O   . HOH C 3 .   ? 37.503 -20.348 -6.332  1.00 31.68  ? 308 HOH A O   1 
HETATM 1173 O  O   . HOH C 3 .   ? 40.726 5.362   8.179   1.00 31.17  ? 309 HOH A O   1 
HETATM 1174 O  O   . HOH C 3 .   ? 36.921 -10.718 0.991   1.00 27.10  ? 310 HOH A O   1 
HETATM 1175 O  O   . HOH C 3 .   ? 46.523 -6.698  8.169   1.00 61.37  ? 311 HOH A O   1 
HETATM 1176 O  O   . HOH C 3 .   ? 39.509 -10.130 0.886   1.00 28.17  ? 312 HOH A O   1 
HETATM 1177 O  O   . HOH C 3 .   ? 28.657 -10.245 23.867  1.00 56.58  ? 313 HOH A O   1 
HETATM 1178 O  O   . HOH C 3 .   ? 29.030 -24.387 -13.783 1.00 77.34  ? 314 HOH A O   1 
HETATM 1179 O  O   . HOH C 3 .   ? 40.771 -11.805 -0.952  1.00 58.66  ? 315 HOH A O   1 
HETATM 1180 O  O   . HOH C 3 .   ? 39.946 -31.150 -10.719 1.00 45.32  ? 316 HOH A O   1 
HETATM 1181 O  O   . HOH C 3 .   ? 25.673 -26.956 -8.450  1.00 45.80  ? 317 HOH A O   1 
HETATM 1182 O  O   . HOH C 3 .   ? 39.675 -11.124 3.407   1.00 35.66  ? 318 HOH A O   1 
HETATM 1183 O  O   . HOH C 3 .   ? 27.452 -33.768 -5.529  1.00 43.41  ? 319 HOH A O   1 
HETATM 1184 O  O   . HOH C 3 .   ? 43.726 -11.448 4.777   1.00 54.98  ? 320 HOH A O   1 
HETATM 1185 O  O   . HOH C 3 .   ? 42.907 -24.702 -1.914  1.00 43.39  ? 321 HOH A O   1 
HETATM 1186 O  O   . HOH C 3 .   ? 27.980 -34.162 -8.882  1.00 37.49  ? 322 HOH A O   1 
HETATM 1187 O  O   . HOH C 3 .   ? 40.145 -5.193  5.686   1.00 39.00  ? 323 HOH A O   1 
HETATM 1188 O  O   . HOH C 3 .   ? 38.055 1.429   6.630   1.00 37.84  ? 324 HOH A O   1 
HETATM 1189 O  O   . HOH C 3 .   ? 36.795 -27.584 -7.855  1.00 39.01  ? 325 HOH A O   1 
HETATM 1190 O  O   . HOH C 3 .   ? 31.267 -1.863  23.619  1.00 54.27  ? 326 HOH A O   1 
HETATM 1191 O  O   . HOH C 3 .   ? 25.196 -3.122  6.865   1.00 46.27  ? 327 HOH A O   1 
HETATM 1192 O  O   . HOH C 3 .   ? 37.566 -30.439 8.980   1.00 39.75  ? 328 HOH A O   1 
HETATM 1193 O  O   . HOH C 3 .   ? 30.991 -9.207  -5.643  1.00 47.38  ? 329 HOH A O   1 
HETATM 1194 O  O   . HOH C 3 .   ? 26.213 -11.110 13.377  1.00 53.96  ? 330 HOH A O   1 
HETATM 1195 O  O   . HOH C 3 .   ? 43.546 -33.993 -5.638  1.00 67.14  ? 331 HOH A O   1 
HETATM 1196 O  O   . HOH C 3 .   ? 36.526 -12.047 15.997  1.00 47.09  ? 332 HOH A O   1 
HETATM 1197 O  O   . HOH C 3 .   ? 38.981 -8.791  19.307  1.00 44.41  ? 333 HOH A O   1 
HETATM 1198 O  O   . HOH C 3 .   ? 28.570 -13.489 0.778   1.00 49.66  ? 334 HOH A O   1 
HETATM 1199 O  O   . HOH C 3 .   ? 37.580 -18.230 -8.583  1.00 47.19  ? 335 HOH A O   1 
HETATM 1200 O  O   . HOH C 3 .   ? 32.267 -30.085 9.054   1.00 55.50  ? 336 HOH A O   1 
HETATM 1201 O  O   . HOH C 3 .   ? 28.143 -34.211 0.214   1.00 53.40  ? 337 HOH A O   1 
HETATM 1202 O  O   . HOH C 3 .   ? 42.738 -32.367 4.008   1.00 66.65  ? 338 HOH A O   1 
HETATM 1203 O  O   . HOH C 3 .   ? 43.404 -40.936 -4.506  1.00 39.16  ? 339 HOH A O   1 
HETATM 1204 O  O   . HOH C 3 .   ? 30.121 1.143   23.158  1.00 47.10  ? 340 HOH A O   1 
HETATM 1205 O  O   . HOH C 3 .   ? 32.637 -2.293  -2.204  1.00 63.49  ? 341 HOH A O   1 
HETATM 1206 O  O   . HOH C 3 .   ? 34.966 -11.131 -17.133 1.00 63.82  ? 342 HOH A O   1 
HETATM 1207 O  O   . HOH C 3 .   ? 23.226 -18.292 -11.546 1.00 55.56  ? 343 HOH A O   1 
HETATM 1208 O  O   . HOH C 3 .   ? 41.882 -12.768 9.439   1.00 48.96  ? 344 HOH A O   1 
HETATM 1209 O  O   . HOH C 3 .   ? 46.112 -5.688  18.141  1.00 63.82  ? 345 HOH A O   1 
HETATM 1210 O  O   . HOH C 3 .   ? 21.274 -3.153  12.862  1.00 50.48  ? 346 HOH A O   1 
HETATM 1211 O  O   . HOH C 3 .   ? 26.393 -14.285 9.222   1.00 42.63  ? 347 HOH A O   1 
HETATM 1212 O  O   . HOH C 3 .   ? 44.230 -24.105 3.857   1.00 43.83  ? 348 HOH A O   1 
HETATM 1213 O  O   . HOH C 3 .   ? 38.077 2.344   23.396  1.00 49.67  ? 349 HOH A O   1 
HETATM 1214 O  O   . HOH C 3 .   ? 30.999 2.717   21.252  1.00 46.61  ? 350 HOH A O   1 
HETATM 1215 O  O   . HOH C 3 .   ? 41.470 -22.611 14.513  1.00 65.06  ? 351 HOH A O   1 
HETATM 1216 O  O   . HOH C 3 .   ? 23.708 -33.709 2.330   1.00 60.49  ? 352 HOH A O   1 
HETATM 1217 O  O   . HOH C 3 .   ? 30.288 -28.763 -14.277 1.00 58.18  ? 353 HOH A O   1 
HETATM 1218 O  O   . HOH C 3 .   ? 26.301 -25.038 7.404   1.00 53.94  ? 354 HOH A O   1 
HETATM 1219 O  O   . HOH C 3 .   ? 28.244 4.456   6.905   1.00 41.77  ? 356 HOH A O   1 
HETATM 1220 O  O   . HOH C 3 .   ? 42.018 0.770   9.016   1.00 45.62  ? 357 HOH A O   1 
HETATM 1221 O  O   . HOH C 3 .   ? 41.883 -24.346 10.958  1.00 45.62  ? 358 HOH A O   1 
HETATM 1222 O  O   . HOH C 3 .   ? 43.780 -12.356 -8.115  1.00 51.95  ? 359 HOH A O   1 
HETATM 1223 O  O   . HOH C 3 .   ? 33.565 -14.704 8.504   1.00 44.16  ? 360 HOH A O   1 
HETATM 1224 O  O   . HOH C 3 .   ? 45.888 -27.651 -2.151  1.00 63.61  ? 361 HOH A O   1 
HETATM 1225 O  O   . HOH C 3 .   ? 33.528 -40.571 -7.672  1.00 56.94  ? 362 HOH A O   1 
HETATM 1226 O  O   . HOH C 3 .   ? 32.611 4.721   21.817  1.00 50.26  ? 363 HOH A O   1 
HETATM 1227 O  O   . HOH C 3 .   ? 45.083 -23.909 10.915  1.00 66.71  ? 364 HOH A O   1 
HETATM 1228 O  O   . HOH C 3 .   ? 45.571 -23.815 13.377  1.00 60.70  ? 365 HOH A O   1 
HETATM 1229 O  O   . HOH C 3 .   ? 46.557 -9.612  8.155   1.00 45.98  ? 366 HOH A O   1 
HETATM 1230 O  O   . HOH C 3 .   ? 44.290 -25.215 8.744   1.00 54.67  ? 367 HOH A O   1 
HETATM 1231 O  O   . HOH C 3 .   ? 44.274 -8.097  8.354   1.00 46.34  ? 368 HOH A O   1 
HETATM 1232 O  O   . HOH C 3 .   ? 33.470 -14.403 -15.662 1.00 48.35  ? 369 HOH A O   1 
HETATM 1233 O  O   . HOH C 3 .   ? 41.335 -4.788  -3.685  1.00 63.15  ? 370 HOH A O   1 
HETATM 1234 O  O   . HOH C 3 .   ? 32.929 -16.855 10.545  1.00 42.05  ? 371 HOH A O   1 
HETATM 1235 O  O   . HOH C 3 .   ? 35.620 -20.070 11.688  1.00 42.95  ? 372 HOH A O   1 
HETATM 1236 O  O   A HOH C 3 .   ? 43.261 -15.066 1.841   0.50 24.00  ? 373 HOH A O   1 
HETATM 1237 O  O   B HOH C 3 .   ? 39.706 -42.285 -10.799 0.50 35.89  ? 374 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . TRP A 3   ? 1.2869 0.6962 1.7403 -0.1877 -0.5274 -0.0195 127 TRP A N   
2    C  CA  . TRP A 3   ? 1.2702 0.6855 1.4167 -0.1882 -0.4623 -0.0847 127 TRP A CA  
3    C  C   . TRP A 3   ? 1.2185 0.7081 1.3238 -0.1096 -0.3236 -0.1319 127 TRP A C   
4    O  O   . TRP A 3   ? 1.2286 0.7302 1.1370 -0.1024 -0.2795 -0.1765 127 TRP A O   
5    C  CB  . TRP A 3   ? 1.3442 0.6440 1.2553 -0.2613 -0.5485 -0.1113 127 TRP A CB  
6    N  N   . ASP A 4   ? 1.2203 0.7265 1.5097 -0.0556 -0.2576 -0.1158 128 ASP A N   
7    C  CA  . ASP A 4   ? 1.2582 0.7475 1.4403 0.0068  -0.1354 -0.1587 128 ASP A CA  
8    C  C   . ASP A 4   ? 1.3035 0.7865 1.5674 0.0716  0.0150  -0.1430 128 ASP A C   
9    O  O   . ASP A 4   ? 1.4311 0.8302 1.6121 0.1227  0.1327  -0.1678 128 ASP A O   
10   C  CB  . ASP A 4   ? 1.2912 0.7304 1.5026 0.0162  -0.1478 -0.1736 128 ASP A CB  
11   C  CG  . ASP A 4   ? 1.2542 0.6777 1.3312 -0.0485 -0.2803 -0.1956 128 ASP A CG  
12   O  OD1 . ASP A 4   ? 1.2669 0.6547 1.4434 -0.0553 -0.3283 -0.1886 128 ASP A OD1 
13   O  OD2 . ASP A 4   ? 1.2064 0.6389 1.1017 -0.0870 -0.3172 -0.2175 128 ASP A OD2 
14   N  N   . GLU A 5   ? 1.2393 0.7770 1.6316 0.0650  0.0168  -0.1022 129 GLU A N   
15   C  CA  . GLU A 5   ? 1.2772 0.8049 1.7606 0.1210  0.1668  -0.0800 129 GLU A CA  
16   C  C   . GLU A 5   ? 1.2633 0.8020 1.5387 0.1197  0.1906  -0.0996 129 GLU A C   
17   O  O   . GLU A 5   ? 1.2207 0.8068 1.6243 0.1215  0.2118  -0.0608 129 GLU A O   
18   C  CB  . GLU A 5   ? 1.2334 0.8142 2.1180 0.1220  0.1614  -0.0001 129 GLU A CB  
19   N  N   . THR A 6   ? 1.3076 0.7980 1.2885 0.1140  0.1748  -0.1527 130 THR A N   
20   C  CA  . THR A 6   ? 1.3103 0.7923 1.0962 0.1118  0.1826  -0.1692 130 THR A CA  
21   C  C   . THR A 6   ? 1.3744 0.8192 1.1875 0.1524  0.3089  -0.1438 130 THR A C   
22   O  O   . THR A 6   ? 1.5098 0.8535 1.3487 0.1979  0.4443  -0.1366 130 THR A O   
23   C  CB  . THR A 6   ? 1.4329 0.8150 0.9389 0.1089  0.1547  -0.2152 130 THR A CB  
24   O  OG1 . THR A 6   ? 1.3080 0.7597 0.8015 0.0615  0.0343  -0.2299 130 THR A OG1 
25   C  CG2 . THR A 6   ? 1.5606 0.8543 0.8618 0.1207  0.1878  -0.2201 130 THR A CG2 
26   N  N   . GLU A 7   ? 1.2757 0.7844 1.0817 0.1359  0.2801  -0.1298 131 GLU A N   
27   C  CA  . GLU A 7   ? 1.3265 0.8099 1.1552 0.1661  0.3855  -0.1026 131 GLU A CA  
28   C  C   . GLU A 7   ? 1.3078 0.8107 0.9826 0.1461  0.3345  -0.1110 131 GLU A C   
29   O  O   . GLU A 7   ? 1.2749 0.7924 0.8298 0.1161  0.2373  -0.1377 131 GLU A O   
30   C  CB  . GLU A 7   ? 1.2142 0.7923 1.3793 0.1680  0.4028  -0.0441 131 GLU A CB  
31   N  N   . LEU A 8   ? 1.3446 0.8466 1.0563 0.1635  0.4055  -0.0823 132 LEU A N   
32   C  CA  . LEU A 8   ? 1.3135 0.8397 0.9221 0.1464  0.3600  -0.0815 132 LEU A CA  
33   C  C   . LEU A 8   ? 1.2152 0.8321 1.0081 0.1456  0.3818  -0.0385 132 LEU A C   
34   O  O   . LEU A 8   ? 1.2857 0.8564 1.1341 0.1775  0.4963  -0.0097 132 LEU A O   
35   C  CB  . LEU A 8   ? 1.5244 0.8753 0.8417 0.1610  0.4019  -0.0978 132 LEU A CB  
36   C  CG  . LEU A 8   ? 1.6440 0.8806 0.7364 0.1443  0.3234  -0.1334 132 LEU A CG  
37   C  CD1 . LEU A 8   ? 1.8490 0.8889 0.7756 0.1720  0.4250  -0.1511 132 LEU A CD1 
38   C  CD2 . LEU A 8   ? 1.7617 0.9075 0.6547 0.1209  0.2380  -0.1312 132 LEU A CD2 
39   N  N   . GLY A 9   ? 1.0766 0.7930 0.9454 0.1072  0.2824  -0.0337 133 GLY A N   
40   C  CA  . GLY A 9   ? 0.9899 0.7695 1.0032 0.0947  0.2727  0.0062  133 GLY A CA  
41   C  C   . GLY A 9   ? 0.9439 0.7530 0.8770 0.0691  0.2191  -0.0022 133 GLY A C   
42   O  O   . GLY A 9   ? 0.9926 0.7772 0.7842 0.0747  0.2161  -0.0253 133 GLY A O   
43   N  N   . LEU A 10  ? 0.8739 0.7118 0.9042 0.0373  0.1699  0.0227  134 LEU A N   
44   C  CA  . LEU A 10  ? 0.8623 0.7058 0.8358 0.0159  0.1455  0.0205  134 LEU A CA  
45   C  C   . LEU A 10  ? 0.8570 0.6919 0.7090 0.0076  0.1337  -0.0194 134 LEU A C   
46   O  O   . LEU A 10  ? 0.8625 0.7092 0.6784 0.0244  0.1511  -0.0199 134 LEU A O   
47   C  CB  . LEU A 10  ? 0.8797 0.6863 0.9138 -0.0317 0.0780  0.0486  134 LEU A CB  
48   C  CG  . LEU A 10  ? 0.9131 0.6661 1.0182 -0.0694 -0.0016 0.0684  134 LEU A CG  
49   C  CD1 . LEU A 10  ? 1.0034 0.6335 1.0486 -0.1374 -0.1001 0.0908  134 LEU A CD1 
50   C  CD2 . LEU A 10  ? 0.8472 0.6479 1.1832 -0.0411 0.0160  0.1152  134 LEU A CD2 
51   N  N   . TYR A 11  ? 0.8377 0.6428 0.6519 -0.0206 0.1017  -0.0448 135 TYR A N   
52   C  CA  . TYR A 11  ? 0.8126 0.6144 0.5819 -0.0259 0.1030  -0.0724 135 TYR A CA  
53   C  C   . TYR A 11  ? 0.8280 0.6316 0.5655 -0.0110 0.0842  -0.0910 135 TYR A C   
54   O  O   . TYR A 11  ? 0.8315 0.6237 0.5658 -0.0043 0.0798  -0.0925 135 TYR A O   
55   C  CB  . TYR A 11  ? 0.8450 0.5757 0.5778 -0.0697 0.1100  -0.0865 135 TYR A CB  
56   C  CG  . TYR A 11  ? 0.8644 0.5361 0.5711 -0.0920 0.1210  -0.0690 135 TYR A CG  
57   C  CD1 . TYR A 11  ? 0.8408 0.5408 0.5865 -0.0756 0.1593  -0.0595 135 TYR A CD1 
58   C  CD2 . TYR A 11  ? 0.9232 0.4922 0.5655 -0.1340 0.0732  -0.0552 135 TYR A CD2 
59   C  CE1 . TYR A 11  ? 0.9358 0.5683 0.6432 -0.0959 0.1676  -0.0437 135 TYR A CE1 
60   C  CE2 . TYR A 11  ? 1.0245 0.5030 0.6151 -0.1625 0.0610  -0.0341 135 TYR A CE2 
61   C  CZ  . TYR A 11  ? 1.0193 0.5332 0.6361 -0.1406 0.1176  -0.0320 135 TYR A CZ  
62   O  OH  . TYR A 11  ? 1.0780 0.4926 0.6323 -0.1678 0.1073  -0.0125 135 TYR A OH  
63   N  N   . LYS A 12  ? 0.8298 0.6366 0.5642 -0.0080 0.0658  -0.0987 136 LYS A N   
64   C  CA  . LYS A 12  ? 0.8642 0.6401 0.5384 0.0025  0.0260  -0.1096 136 LYS A CA  
65   C  C   . LYS A 12  ? 0.8377 0.6146 0.5541 -0.0219 -0.0010 -0.1264 136 LYS A C   
66   O  O   . LYS A 12  ? 0.7832 0.5724 0.5778 -0.0446 0.0297  -0.1277 136 LYS A O   
67   C  CB  . LYS A 12  ? 0.9453 0.6797 0.5691 0.0151  -0.0136 -0.0909 136 LYS A CB  
68   C  CG  . LYS A 12  ? 1.0007 0.6963 0.5379 0.0392  0.0291  -0.0756 136 LYS A CG  
69   C  CD  . LYS A 12  ? 1.1273 0.7834 0.6381 0.0368  -0.0161 -0.0494 136 LYS A CD  
70   N  N   . VAL A 13  ? 0.8629 0.6017 0.5142 -0.0180 -0.0434 -0.1389 137 VAL A N   
71   C  CA  . VAL A 13  ? 0.8487 0.5868 0.5497 -0.0409 -0.0755 -0.1501 137 VAL A CA  
72   C  C   . VAL A 13  ? 0.8273 0.5890 0.6778 -0.0539 -0.1009 -0.1253 137 VAL A C   
73   O  O   . VAL A 13  ? 0.9069 0.6445 0.7652 -0.0473 -0.1677 -0.0992 137 VAL A O   
74   C  CB  . VAL A 13  ? 0.9452 0.6193 0.5364 -0.0340 -0.1303 -0.1640 137 VAL A CB  
75   C  CG1 . VAL A 13  ? 0.9486 0.6236 0.6168 -0.0596 -0.1823 -0.1656 137 VAL A CG1 
76   C  CG2 . VAL A 13  ? 0.9922 0.6539 0.5201 -0.0222 -0.0888 -0.1835 137 VAL A CG2 
77   N  N   . ASN A 14  ? 0.7276 0.6762 0.7825 -0.0247 0.0192  -0.1266 138 ASN A N   
78   C  CA  . ASN A 14  ? 0.7036 0.6713 0.7709 -0.0296 -0.0041 -0.1247 138 ASN A CA  
79   C  C   . ASN A 14  ? 0.6845 0.6609 0.7501 -0.0141 -0.0171 -0.1135 138 ASN A C   
80   O  O   . ASN A 14  ? 0.6660 0.6752 0.7454 0.0006  -0.0421 -0.1223 138 ASN A O   
81   C  CB  . ASN A 14  ? 0.7410 0.7019 0.7772 -0.0368 -0.0230 -0.1397 138 ASN A CB  
82   C  CG  . ASN A 14  ? 0.7771 0.7197 0.8093 -0.0598 -0.0219 -0.1534 138 ASN A CG  
83   O  OD1 . ASN A 14  ? 0.7592 0.7168 0.8159 -0.0829 -0.0220 -0.1533 138 ASN A OD1 
84   N  ND2 . ASN A 14  ? 0.8409 0.7383 0.8246 -0.0592 -0.0216 -0.1661 138 ASN A ND2 
85   N  N   . GLU A 15  ? 0.6638 0.6144 0.7066 -0.0169 -0.0032 -0.1001 139 GLU A N   
86   C  CA  . GLU A 15  ? 0.6916 0.6107 0.7026 -0.0085 -0.0194 -0.0878 139 GLU A CA  
87   C  C   . GLU A 15  ? 0.6407 0.5956 0.7058 0.0075  -0.0219 -0.0876 139 GLU A C   
88   O  O   . GLU A 15  ? 0.6004 0.5866 0.7125 -0.0012 -0.0002 -0.0858 139 GLU A O   
89   C  CB  . GLU A 15  ? 0.7337 0.6168 0.6929 -0.0397 -0.0002 -0.0747 139 GLU A CB  
90   C  CG  . GLU A 15  ? 0.8497 0.6534 0.7330 -0.0457 -0.0229 -0.0590 139 GLU A CG  
91   C  CD  . GLU A 15  ? 0.9926 0.7360 0.7764 -0.1010 -0.0100 -0.0457 139 GLU A CD  
92   O  OE1 . GLU A 15  ? 1.0645 0.8239 0.8241 -0.1231 0.0085  -0.0514 139 GLU A OE1 
93   O  OE2 . GLU A 15  ? 1.0767 0.7527 0.7940 -0.1299 -0.0180 -0.0309 139 GLU A OE2 
94   N  N   . TYR A 16  ? 0.6658 0.6118 0.7134 0.0381  -0.0530 -0.0936 140 TYR A N   
95   C  CA  . TYR A 16  ? 0.6308 0.6088 0.7141 0.0571  -0.0556 -0.0976 140 TYR A CA  
96   C  C   . TYR A 16  ? 0.6466 0.5566 0.6867 0.0450  -0.0514 -0.0791 140 TYR A C   
97   O  O   . TYR A 16  ? 0.7516 0.5690 0.7026 0.0410  -0.0717 -0.0697 140 TYR A O   
98   C  CB  . TYR A 16  ? 0.6713 0.6824 0.7516 0.1082  -0.0944 -0.1237 140 TYR A CB  
99   C  CG  . TYR A 16  ? 0.6464 0.7629 0.7845 0.1054  -0.0952 -0.1486 140 TYR A CG  
100  C  CD1 . TYR A 16  ? 0.5716 0.7845 0.7809 0.0733  -0.0666 -0.1571 140 TYR A CD1 
101  C  CD2 . TYR A 16  ? 0.6671 0.7789 0.7739 0.1247  -0.1262 -0.1634 140 TYR A CD2 
102  C  CE1 . TYR A 16  ? 0.5642 0.8732 0.8140 0.0489  -0.0657 -0.1807 140 TYR A CE1 
103  C  CE2 . TYR A 16  ? 0.6465 0.8669 0.8077 0.1121  -0.1285 -0.1902 140 TYR A CE2 
104  C  CZ  . TYR A 16  ? 0.6092 0.9315 0.8430 0.0680  -0.0964 -0.1992 140 TYR A CZ  
105  O  OH  . TYR A 16  ? 0.6268 1.0564 0.9023 0.0343  -0.0972 -0.2266 140 TYR A OH  
106  N  N   . VAL A 17  ? 0.5441 0.4904 0.6329 0.0314  -0.0278 -0.0737 141 VAL A N   
107  C  CA  . VAL A 17  ? 0.5475 0.4531 0.6079 0.0123  -0.0232 -0.0611 141 VAL A CA  
108  C  C   . VAL A 17  ? 0.5097 0.4418 0.6038 0.0306  -0.0247 -0.0649 141 VAL A C   
109  O  O   . VAL A 17  ? 0.4866 0.4734 0.6212 0.0541  -0.0255 -0.0777 141 VAL A O   
110  C  CB  . VAL A 17  ? 0.5140 0.4520 0.5962 -0.0259 0.0077  -0.0559 141 VAL A CB  
111  C  CG1 . VAL A 17  ? 0.5346 0.4562 0.5756 -0.0489 0.0151  -0.0560 141 VAL A CG1 
112  C  CG2 . VAL A 17  ? 0.4592 0.4600 0.6124 -0.0128 0.0238  -0.0627 141 VAL A CG2 
113  N  N   . ASP A 18  ? 0.5298 0.4299 0.6006 0.0114  -0.0239 -0.0563 142 ASP A N   
114  C  CA  . ASP A 18  ? 0.4888 0.4120 0.5867 0.0222  -0.0225 -0.0587 142 ASP A CA  
115  C  C   . ASP A 18  ? 0.4286 0.4043 0.5750 -0.0014 0.0007  -0.0540 142 ASP A C   
116  O  O   . ASP A 18  ? 0.4187 0.4068 0.5622 -0.0300 0.0114  -0.0530 142 ASP A O   
117  C  CB  . ASP A 18  ? 0.5533 0.3916 0.5768 0.0212  -0.0480 -0.0575 142 ASP A CB  
118  C  CG  . ASP A 18  ? 0.6655 0.4773 0.6593 0.0791  -0.0775 -0.0763 142 ASP A CG  
119  O  OD1 . ASP A 18  ? 0.6439 0.5460 0.7005 0.1078  -0.0669 -0.0915 142 ASP A OD1 
120  O  OD2 . ASP A 18  ? 0.7970 0.4984 0.6956 0.0955  -0.1132 -0.0804 142 ASP A OD2 
121  N  N   . ALA A 19  ? 0.3844 0.3940 0.5664 0.0131  0.0061  -0.0553 143 ALA A N   
122  C  CA  . ALA A 19  ? 0.3560 0.3999 0.5689 0.0105  0.0146  -0.0560 143 ALA A CA  
123  C  C   . ALA A 19  ? 0.3802 0.4258 0.5928 0.0185  0.0060  -0.0548 143 ALA A C   
124  O  O   . ALA A 19  ? 0.3977 0.4293 0.5965 0.0289  0.0040  -0.0524 143 ALA A O   
125  C  CB  . ALA A 19  ? 0.3415 0.3871 0.5654 0.0214  0.0215  -0.0569 143 ALA A CB  
126  N  N   . ARG A 20  ? 0.3968 0.4762 0.6254 0.0127  0.0012  -0.0618 144 ARG A N   
127  C  CA  . ARG A 20  ? 0.4311 0.5137 0.6551 0.0190  -0.0128 -0.0632 144 ARG A CA  
128  C  C   . ARG A 20  ? 0.4371 0.5179 0.6623 0.0512  -0.0220 -0.0637 144 ARG A C   
129  O  O   . ARG A 20  ? 0.4565 0.5678 0.7012 0.0721  -0.0279 -0.0765 144 ARG A O   
130  C  CB  . ARG A 20  ? 0.4367 0.5696 0.6736 -0.0106 -0.0191 -0.0759 144 ARG A CB  
131  C  CG  . ARG A 20  ? 0.4969 0.6112 0.7102 -0.0174 -0.0373 -0.0765 144 ARG A CG  
132  C  CD  . ARG A 20  ? 0.5321 0.7311 0.7742 -0.0438 -0.0481 -0.0967 144 ARG A CD  
133  N  NE  . ARG A 20  ? 0.6348 0.9104 0.9018 -0.0891 -0.0316 -0.1108 144 ARG A NE  
134  C  CZ  . ARG A 20  ? 0.7368 1.0191 0.9714 -0.1638 -0.0281 -0.1146 144 ARG A CZ  
135  N  NH1 . ARG A 20  ? 0.8318 1.0300 1.0024 -0.1950 -0.0466 -0.1059 144 ARG A NH1 
136  N  NH2 . ARG A 20  ? 0.7545 1.1207 1.0058 -0.2140 -0.0061 -0.1287 144 ARG A NH2 
137  N  N   . ASP A 21  ? 0.4756 0.5131 0.6649 0.0577  -0.0265 -0.0530 145 ASP A N   
138  C  CA  . ASP A 21  ? 0.5333 0.5324 0.6858 0.0807  -0.0431 -0.0487 145 ASP A CA  
139  C  C   . ASP A 21  ? 0.5481 0.5854 0.7153 0.1027  -0.0700 -0.0635 145 ASP A C   
140  O  O   . ASP A 21  ? 0.5469 0.6046 0.7181 0.0879  -0.0742 -0.0663 145 ASP A O   
141  C  CB  . ASP A 21  ? 0.5762 0.5275 0.6731 0.0656  -0.0353 -0.0339 145 ASP A CB  
142  C  CG  . ASP A 21  ? 0.7087 0.5818 0.7294 0.0761  -0.0542 -0.0226 145 ASP A CG  
143  O  OD1 . ASP A 21  ? 0.7533 0.6043 0.7360 0.0880  -0.0734 -0.0207 145 ASP A OD1 
144  O  OD2 . ASP A 21  ? 0.8387 0.6537 0.8209 0.0726  -0.0557 -0.0157 145 ASP A OD2 
145  N  N   . THR A 22  ? 0.5776 0.6262 0.7480 0.1431  -0.0931 -0.0788 146 THR A N   
146  C  CA  . THR A 22  ? 0.5916 0.7103 0.7886 0.1767  -0.1254 -0.1052 146 THR A CA  
147  C  C   . THR A 22  ? 0.6522 0.7169 0.7920 0.1891  -0.1525 -0.0958 146 THR A C   
148  O  O   . THR A 22  ? 0.6501 0.7853 0.8205 0.1855  -0.1682 -0.1124 146 THR A O   
149  C  CB  . THR A 22  ? 0.6417 0.7816 0.8440 0.2406  -0.1526 -0.1334 146 THR A CB  
150  O  OG1 . THR A 22  ? 0.6090 0.8606 0.8869 0.2263  -0.1279 -0.1570 146 THR A OG1 
151  C  CG2 . THR A 22  ? 0.7430 0.9381 0.9501 0.3004  -0.2020 -0.1654 146 THR A CG2 
152  N  N   . ASN A 23  ? 0.7255 0.6654 0.7727 0.1939  -0.1575 -0.0700 147 ASN A N   
153  C  CA  . ASN A 23  ? 0.8304 0.7047 0.8007 0.2014  -0.1817 -0.0587 147 ASN A CA  
154  C  C   . ASN A 23  ? 0.7862 0.6929 0.7704 0.1596  -0.1600 -0.0531 147 ASN A C   
155  O  O   . ASN A 23  ? 0.8050 0.7261 0.7764 0.1707  -0.1857 -0.0622 147 ASN A O   
156  C  CB  . ASN A 23  ? 0.9780 0.6986 0.8192 0.1971  -0.1883 -0.0304 147 ASN A CB  
157  C  CG  . ASN A 23  ? 1.1261 0.7694 0.8662 0.1880  -0.2045 -0.0138 147 ASN A CG  
158  O  OD1 . ASN A 23  ? 1.1862 0.7906 0.8714 0.1337  -0.1702 0.0077  147 ASN A OD1 
159  N  ND2 . ASN A 23  ? 1.1851 0.8228 0.9016 0.2418  -0.2570 -0.0293 147 ASN A ND2 
160  N  N   . MSE A 24  ? 0.7440 0.6608 0.7488 0.1198  -0.1193 -0.0438 148 MSE A N   
161  C  CA  . MSE A 24  ? 0.7290 0.6567 0.7264 0.0970  -0.1061 -0.0454 148 MSE A CA  
162  C  C   . MSE A 24  ? 0.6304 0.6129 0.6877 0.0796  -0.1012 -0.0607 148 MSE A C   
163  O  O   . MSE A 24  ? 0.6379 0.6111 0.6748 0.0694  -0.1074 -0.0686 148 MSE A O   
164  C  CB  . MSE A 24  ? 0.7442 0.6422 0.6964 0.0746  -0.0733 -0.0334 148 MSE A CB  
165  C  CG  . MSE A 24  ? 0.7388 0.6551 0.7248 0.0592  -0.0461 -0.0301 148 MSE A CG  
166  SE SE  . MSE A 24  ? 0.8534 0.7729 0.7818 0.0176  -0.0059 -0.0239 148 MSE A SE  
167  C  CE  . MSE A 24  ? 0.7417 0.7386 0.6997 0.0370  0.0056  -0.0554 148 MSE A CE  
168  N  N   . GLY A 25  ? 0.5557 0.5785 0.6671 0.0725  -0.0928 -0.0653 149 GLY A N   
169  C  CA  . GLY A 25  ? 0.4956 0.5479 0.6358 0.0405  -0.0883 -0.0752 149 GLY A CA  
170  C  C   . GLY A 25  ? 0.4846 0.4884 0.5999 0.0300  -0.0711 -0.0693 149 GLY A C   
171  O  O   . GLY A 25  ? 0.5092 0.4912 0.6089 0.0030  -0.0756 -0.0739 149 GLY A O   
172  N  N   . ALA A 26  ? 0.6007 0.4376 0.3045 0.0147  -0.0803 0.0257  150 ALA A N   
173  C  CA  . ALA A 26  ? 0.5748 0.3946 0.3090 -0.0042 -0.0506 0.0201  150 ALA A CA  
174  C  C   . ALA A 26  ? 0.5153 0.3524 0.3026 0.0006  -0.0453 0.0254  150 ALA A C   
175  O  O   . ALA A 26  ? 0.5233 0.3626 0.3117 0.0152  -0.0487 0.0355  150 ALA A O   
176  C  CB  . ALA A 26  ? 0.6136 0.3761 0.3056 -0.0099 -0.0202 0.0187  150 ALA A CB  
177  N  N   . TRP A 27  ? 0.5057 0.3462 0.3270 -0.0088 -0.0385 0.0180  151 TRP A N   
178  C  CA  . TRP A 27  ? 0.4882 0.3389 0.3450 -0.0033 -0.0406 0.0208  151 TRP A CA  
179  C  C   . TRP A 27  ? 0.5116 0.3524 0.3938 0.0004  -0.0266 0.0127  151 TRP A C   
180  O  O   . TRP A 27  ? 0.5123 0.3425 0.4065 -0.0030 -0.0133 -0.0008 151 TRP A O   
181  C  CB  . TRP A 27  ? 0.4761 0.3240 0.3388 -0.0100 -0.0470 0.0180  151 TRP A CB  
182  C  CG  . TRP A 27  ? 0.5250 0.3930 0.3809 -0.0219 -0.0525 0.0172  151 TRP A CG  
183  C  CD1 . TRP A 27  ? 0.5178 0.3972 0.3639 -0.0379 -0.0533 0.0058  151 TRP A CD1 
184  C  CD2 . TRP A 27  ? 0.5504 0.4357 0.4166 -0.0234 -0.0538 0.0198  151 TRP A CD2 
185  N  NE1 . TRP A 27  ? 0.5388 0.4520 0.4014 -0.0500 -0.0551 -0.0026 151 TRP A NE1 
186  C  CE2 . TRP A 27  ? 0.5499 0.4644 0.4241 -0.0412 -0.0521 0.0065  151 TRP A CE2 
187  C  CE3 . TRP A 27  ? 0.5002 0.3802 0.3707 -0.0146 -0.0534 0.0269  151 TRP A CE3 
188  C  CZ2 . TRP A 27  ? 0.4985 0.4394 0.3928 -0.0509 -0.0442 -0.0014 151 TRP A CZ2 
189  C  CZ3 . TRP A 27  ? 0.4600 0.3553 0.3356 -0.0227 -0.0465 0.0236  151 TRP A CZ3 
190  C  CH2 . TRP A 27  ? 0.4898 0.4161 0.3809 -0.0408 -0.0392 0.0090  151 TRP A CH2 
191  N  N   . PHE A 28  ? 0.4780 0.3271 0.3761 0.0051  -0.0270 0.0143  152 PHE A N   
192  C  CA  . PHE A 28  ? 0.4907 0.3437 0.4249 0.0025  -0.0128 -0.0031 152 PHE A CA  
193  C  C   . PHE A 28  ? 0.4930 0.3679 0.4565 0.0096  -0.0333 -0.0093 152 PHE A C   
194  O  O   . PHE A 28  ? 0.5256 0.3984 0.4667 0.0123  -0.0451 0.0040  152 PHE A O   
195  C  CB  . PHE A 28  ? 0.4877 0.3140 0.3988 -0.0055 0.0151  -0.0026 152 PHE A CB  
196  C  CG  . PHE A 28  ? 0.5258 0.3115 0.3833 -0.0101 0.0344  0.0039  152 PHE A CG  
197  C  CD1 . PHE A 28  ? 0.5545 0.3169 0.4142 -0.0267 0.0702  -0.0155 152 PHE A CD1 
198  C  CD2 . PHE A 28  ? 0.5513 0.3230 0.3548 0.0021  0.0168  0.0247  152 PHE A CD2 
199  C  CE1 . PHE A 28  ? 0.6356 0.3438 0.4226 -0.0329 0.0906  -0.0091 152 PHE A CE1 
200  C  CE2 . PHE A 28  ? 0.6221 0.3497 0.3586 0.0016  0.0263  0.0303  152 PHE A CE2 
201  C  CZ  . PHE A 28  ? 0.6516 0.3387 0.3688 -0.0169 0.0643  0.0160  152 PHE A CZ  
202  N  N   . GLU A 29  ? 0.4927 0.3908 0.5061 0.0137  -0.0389 -0.0333 153 GLU A N   
203  C  CA  . GLU A 29  ? 0.5067 0.4259 0.5400 0.0230  -0.0661 -0.0437 153 GLU A CA  
204  C  C   . GLU A 29  ? 0.4985 0.4180 0.5284 0.0074  -0.0498 -0.0480 153 GLU A C   
205  O  O   . GLU A 29  ? 0.4920 0.4048 0.5343 -0.0096 -0.0151 -0.0592 153 GLU A O   
206  C  CB  . GLU A 29  ? 0.5209 0.4816 0.6240 0.0356  -0.0823 -0.0781 153 GLU A CB  
207  C  CG  . GLU A 29  ? 0.5991 0.5553 0.7169 0.0553  -0.0907 -0.0806 153 GLU A CG  
208  C  CD  . GLU A 29  ? 0.6437 0.6081 0.7995 0.0385  -0.0480 -0.0996 153 GLU A CD  
209  O  OE1 . GLU A 29  ? 0.5620 0.4924 0.6704 0.0163  -0.0151 -0.0827 153 GLU A OE1 
210  O  OE2 . GLU A 29  ? 0.5948 0.5984 0.8258 0.0502  -0.0487 -0.1342 153 GLU A OE2 
211  N  N   . ALA A 30  ? 0.4903 0.4040 0.4927 0.0114  -0.0690 -0.0400 154 ALA A N   
212  C  CA  . ALA A 30  ? 0.5150 0.4186 0.5053 -0.0021 -0.0512 -0.0427 154 ALA A CA  
213  C  C   . ALA A 30  ? 0.5461 0.4523 0.5186 0.0001  -0.0766 -0.0504 154 ALA A C   
214  O  O   . ALA A 30  ? 0.5477 0.4561 0.5058 0.0154  -0.1121 -0.0503 154 ALA A O   
215  C  CB  . ALA A 30  ? 0.5134 0.3852 0.4616 -0.0010 -0.0303 -0.0152 154 ALA A CB  
216  N  N   . GLN A 31  ? 0.5737 0.4670 0.5346 -0.0139 -0.0577 -0.0571 155 GLN A N   
217  C  CA  . GLN A 31  ? 0.6229 0.5117 0.5560 -0.0166 -0.0778 -0.0684 155 GLN A CA  
218  C  C   . GLN A 31  ? 0.6269 0.4792 0.5206 -0.0252 -0.0483 -0.0571 155 GLN A C   
219  O  O   . GLN A 31  ? 0.6372 0.4735 0.5408 -0.0317 -0.0141 -0.0560 155 GLN A O   
220  C  CB  . GLN A 31  ? 0.6014 0.5299 0.5818 -0.0282 -0.0929 -0.1115 155 GLN A CB  
221  C  CG  . GLN A 31  ? 0.6257 0.5519 0.5665 -0.0256 -0.1298 -0.1260 155 GLN A CG  
222  C  CD  . GLN A 31  ? 0.6635 0.6418 0.6608 -0.0411 -0.1460 -0.1779 155 GLN A CD  
223  O  OE1 . GLN A 31  ? 0.6466 0.6643 0.7213 -0.0578 -0.1222 -0.2057 155 GLN A OE1 
224  N  NE2 . GLN A 31  ? 0.7253 0.7029 0.6814 -0.0391 -0.1846 -0.1960 155 GLN A NE2 
225  N  N   . VAL A 32  ? 0.6689 0.4986 0.5110 -0.0230 -0.0591 -0.0490 156 VAL A N   
226  C  CA  . VAL A 32  ? 0.6827 0.4823 0.4946 -0.0292 -0.0284 -0.0430 156 VAL A CA  
227  C  C   . VAL A 32  ? 0.7363 0.5249 0.5443 -0.0466 -0.0170 -0.0706 156 VAL A C   
228  O  O   . VAL A 32  ? 0.7556 0.5489 0.5427 -0.0550 -0.0452 -0.0922 156 VAL A O   
229  C  CB  . VAL A 32  ? 0.7201 0.4918 0.4729 -0.0296 -0.0321 -0.0318 156 VAL A CB  
230  C  CG1 . VAL A 32  ? 0.7170 0.4660 0.4537 -0.0373 0.0065  -0.0349 156 VAL A CG1 
231  C  CG2 . VAL A 32  ? 0.6849 0.4628 0.4405 -0.0203 -0.0373 -0.0105 156 VAL A CG2 
232  N  N   . VAL A 33  ? 0.7232 0.4912 0.5449 -0.0501 0.0219  -0.0716 157 VAL A N   
233  C  CA  . VAL A 33  ? 0.7840 0.5287 0.5985 -0.0718 0.0437  -0.1004 157 VAL A CA  
234  C  C   . VAL A 33  ? 0.8185 0.5232 0.5873 -0.0739 0.0673  -0.1012 157 VAL A C   
235  O  O   . VAL A 33  ? 0.8791 0.5676 0.6187 -0.0953 0.0683  -0.1283 157 VAL A O   
236  C  CB  . VAL A 33  ? 0.7893 0.5106 0.6302 -0.0798 0.0811  -0.1073 157 VAL A CB  
237  C  CG1 . VAL A 33  ? 0.8628 0.5858 0.7172 -0.1148 0.0906  -0.1516 157 VAL A CG1 
238  C  CG2 . VAL A 33  ? 0.7812 0.5275 0.6559 -0.0707 0.0724  -0.0944 157 VAL A CG2 
239  N  N   . ARG A 34  ? 0.7996 0.4934 0.5676 -0.0526 0.0867  -0.0773 158 ARG A N   
240  C  CA  . ARG A 34  ? 0.8380 0.5065 0.5742 -0.0535 0.1106  -0.0813 158 ARG A CA  
241  C  C   . ARG A 34  ? 0.7862 0.4787 0.5392 -0.0350 0.1134  -0.0618 158 ARG A C   
242  O  O   . ARG A 34  ? 0.7063 0.4309 0.4963 -0.0168 0.0988  -0.0435 158 ARG A O   
243  C  CB  . ARG A 34  ? 0.9033 0.5239 0.6334 -0.0541 0.1556  -0.0964 158 ARG A CB  
244  C  CG  . ARG A 34  ? 0.9264 0.5224 0.6837 -0.0309 0.1770  -0.0842 158 ARG A CG  
245  C  CD  . ARG A 34  ? 0.9958 0.5207 0.7289 -0.0340 0.2245  -0.1020 158 ARG A CD  
246  N  NE  . ARG A 34  ? 1.0975 0.6082 0.8322 -0.0113 0.2514  -0.1030 158 ARG A NE  
247  C  CZ  . ARG A 34  ? 1.2398 0.7152 0.9438 -0.0308 0.2826  -0.1292 158 ARG A CZ  
248  N  NH1 . ARG A 34  ? 1.2764 0.7464 0.9960 -0.0073 0.3122  -0.1332 158 ARG A NH1 
249  N  NH2 . ARG A 34  ? 1.2714 0.7204 0.9333 -0.0738 0.2856  -0.1572 158 ARG A NH2 
250  N  N   . VAL A 35  ? 0.8240 0.5002 0.5470 -0.0454 0.1353  -0.0715 159 VAL A N   
251  C  CA  . VAL A 35  ? 0.7945 0.4970 0.5403 -0.0391 0.1496  -0.0659 159 VAL A CA  
252  C  C   . VAL A 35  ? 0.8327 0.5276 0.6020 -0.0315 0.1968  -0.0839 159 VAL A C   
253  O  O   . VAL A 35  ? 0.8639 0.5128 0.5847 -0.0508 0.2232  -0.1025 159 VAL A O   
254  C  CB  . VAL A 35  ? 0.8185 0.4972 0.4971 -0.0656 0.1429  -0.0660 159 VAL A CB  
255  C  CG1 . VAL A 35  ? 0.8039 0.5140 0.5153 -0.0669 0.1585  -0.0628 159 VAL A CG1 
256  C  CG2 . VAL A 35  ? 0.8154 0.4872 0.4589 -0.0675 0.0940  -0.0543 159 VAL A CG2 
257  N  N   . THR A 36  ? 0.8162 0.5578 0.6608 -0.0003 0.2047  -0.0818 160 THR A N   
258  C  CA  . THR A 36  ? 0.8664 0.6152 0.7551 0.0178  0.2464  -0.1032 160 THR A CA  
259  C  C   . THR A 36  ? 0.8591 0.6794 0.8193 0.0219  0.2589  -0.1181 160 THR A C   
260  O  O   . THR A 36  ? 0.8130 0.6726 0.7872 0.0136  0.2334  -0.1081 160 THR A O   
261  C  CB  . THR A 36  ? 0.8762 0.6106 0.7971 0.0645  0.2448  -0.0957 160 THR A CB  
262  O  OG1 . THR A 36  ? 0.8307 0.6053 0.7887 0.0968  0.2050  -0.0732 160 THR A OG1 
263  C  CG2 . THR A 36  ? 0.9361 0.5939 0.7904 0.0487  0.2502  -0.0929 160 THR A CG2 
264  N  N   . ARG A 37  ? 0.9186 0.7585 0.9308 0.0325  0.3021  -0.1478 161 ARG A N   
265  C  CA  . ARG A 37  ? 0.9334 0.8550 1.0335 0.0303  0.3230  -0.1762 161 ARG A CA  
266  C  C   . ARG A 37  ? 0.9244 0.9247 1.1393 0.0939  0.3031  -0.1855 161 ARG A C   
267  O  O   . ARG A 37  ? 0.9808 0.9642 1.2217 0.1324  0.3205  -0.1956 161 ARG A O   
268  C  CB  . ARG A 37  ? 0.9939 0.8920 1.0814 -0.0073 0.3926  -0.2140 161 ARG A CB  
269  N  N   . LYS A 38  ? 0.8844 0.9639 1.1602 0.1076  0.2640  -0.1832 162 LYS A N   
270  C  CA  . LYS A 38  ? 0.8707 1.0401 1.2585 0.1710  0.2346  -0.1988 162 LYS A CA  
271  C  C   . LYS A 38  ? 0.8803 1.1367 1.3870 0.1720  0.2798  -0.2566 162 LYS A C   
272  O  O   . LYS A 38  ? 0.9187 1.1912 1.4864 0.2239  0.2904  -0.2755 162 LYS A O   
273  C  CB  . LYS A 38  ? 0.8147 1.0472 1.2276 0.1778  0.1786  -0.1868 162 LYS A CB  
274  N  N   . GLU A 56  ? 1.1342 1.1772 1.6168 -0.1716 0.4216  0.0223  180 GLU A N   
275  C  CA  . GLU A 56  ? 1.1129 1.2333 1.7109 -0.2240 0.4226  -0.0264 180 GLU A CA  
276  C  C   . GLU A 56  ? 1.0188 1.2444 1.6429 -0.2107 0.3584  -0.0654 180 GLU A C   
277  O  O   . GLU A 56  ? 0.9951 1.2489 1.6567 -0.2363 0.3270  -0.1055 180 GLU A O   
278  C  CB  . GLU A 56  ? 1.1722 1.3448 1.8534 -0.2578 0.4828  -0.0263 180 GLU A CB  
279  C  CG  . GLU A 56  ? 1.2659 1.3596 1.8901 -0.2389 0.5467  0.0307  180 GLU A CG  
280  C  CD  . GLU A 56  ? 1.2663 1.4243 1.8721 -0.2006 0.5535  0.0477  180 GLU A CD  
281  O  OE1 . GLU A 56  ? 1.2430 1.5153 1.9451 -0.2194 0.5622  0.0214  180 GLU A OE1 
282  O  OE2 . GLU A 56  ? 1.2927 1.3924 1.7893 -0.1513 0.5517  0.0849  180 GLU A OE2 
283  N  N   . ASP A 57  ? 0.9702 1.2491 1.5692 -0.1675 0.3442  -0.0525 181 ASP A N   
284  C  CA  . ASP A 57  ? 0.8838 1.2461 1.4880 -0.1386 0.2901  -0.0753 181 ASP A CA  
285  C  C   . ASP A 57  ? 0.8541 1.1490 1.3478 -0.0856 0.2628  -0.0503 181 ASP A C   
286  O  O   . ASP A 57  ? 0.8281 1.1648 1.3033 -0.0457 0.2460  -0.0480 181 ASP A O   
287  C  CB  . ASP A 57  ? 0.8806 1.3720 1.5624 -0.1302 0.3003  -0.0852 181 ASP A CB  
288  N  N   . VAL A 58  ? 0.8495 1.0410 1.2737 -0.0861 0.2624  -0.0324 182 VAL A N   
289  C  CA  . VAL A 58  ? 0.8088 0.9382 1.1351 -0.0488 0.2368  -0.0159 182 VAL A CA  
290  C  C   . VAL A 58  ? 0.7352 0.8791 1.0565 -0.0425 0.1878  -0.0390 182 VAL A C   
291  O  O   . VAL A 58  ? 0.7098 0.8877 1.0859 -0.0691 0.1737  -0.0648 182 VAL A O   
292  C  CB  . VAL A 58  ? 0.8553 0.8912 1.1183 -0.0502 0.2528  0.0126  182 VAL A CB  
293  C  CG1 . VAL A 58  ? 0.8452 0.8375 1.0212 -0.0213 0.2208  0.0202  182 VAL A CG1 
294  C  CG2 . VAL A 58  ? 0.9449 0.9602 1.1933 -0.0480 0.3048  0.0426  182 VAL A CG2 
295  N  N   . ILE A 59  ? 0.6865 0.8026 0.9404 -0.0097 0.1664  -0.0324 183 ILE A N   
296  C  CA  . ILE A 59  ? 0.6210 0.7334 0.8564 -0.0014 0.1280  -0.0469 183 ILE A CA  
297  C  C   . ILE A 59  ? 0.6078 0.6435 0.7756 0.0011  0.1168  -0.0359 183 ILE A C   
298  O  O   . ILE A 59  ? 0.6180 0.6153 0.7278 0.0154  0.1255  -0.0219 183 ILE A O   
299  C  CB  . ILE A 59  ? 0.6169 0.7643 0.8387 0.0348  0.1163  -0.0496 183 ILE A CB  
300  C  CG1 . ILE A 59  ? 0.6137 0.8634 0.9098 0.0405  0.1214  -0.0592 183 ILE A CG1 
301  C  CG2 . ILE A 59  ? 0.5753 0.7037 0.7654 0.0454  0.0846  -0.0579 183 ILE A CG2 
302  C  CD1 . ILE A 59  ? 0.6097 0.9333 0.9680 0.0182  0.0943  -0.0873 183 ILE A CD1 
303  N  N   . TYR A 60  ? 0.5678 0.5898 0.7453 -0.0132 0.0977  -0.0456 184 TYR A N   
304  C  CA  . TYR A 60  ? 0.5391 0.5091 0.6672 -0.0090 0.0847  -0.0362 184 TYR A CA  
305  C  C   . TYR A 60  ? 0.5251 0.4958 0.6279 0.0037  0.0592  -0.0482 184 TYR A C   
306  O  O   . TYR A 60  ? 0.5101 0.5129 0.6397 0.0045  0.0460  -0.0640 184 TYR A O   
307  C  CB  . TYR A 60  ? 0.5165 0.4627 0.6694 -0.0266 0.0885  -0.0349 184 TYR A CB  
308  C  CG  . TYR A 60  ? 0.5629 0.4864 0.7288 -0.0362 0.1241  -0.0147 184 TYR A CG  
309  C  CD1 . TYR A 60  ? 0.5795 0.4700 0.6916 -0.0189 0.1370  0.0166  184 TYR A CD1 
310  C  CD2 . TYR A 60  ? 0.5622 0.5013 0.7927 -0.0640 0.1479  -0.0280 184 TYR A CD2 
311  C  CE1 . TYR A 60  ? 0.6519 0.5160 0.7664 -0.0219 0.1762  0.0425  184 TYR A CE1 
312  C  CE2 . TYR A 60  ? 0.6153 0.5235 0.8587 -0.0753 0.1910  -0.0063 184 TYR A CE2 
313  C  CZ  . TYR A 60  ? 0.6707 0.5370 0.8519 -0.0505 0.2068  0.0331  184 TYR A CZ  
314  O  OH  . TYR A 60  ? 0.7264 0.5558 0.9100 -0.0555 0.2551  0.0621  184 TYR A OH  
315  N  N   . HIS A 61  ? 0.5182 0.4563 0.5677 0.0124  0.0547  -0.0420 185 HIS A N   
316  C  CA  . HIS A 61  ? 0.5334 0.4595 0.5603 0.0179  0.0390  -0.0521 185 HIS A CA  
317  C  C   . HIS A 61  ? 0.5048 0.4187 0.5281 0.0077  0.0246  -0.0511 185 HIS A C   
318  O  O   . HIS A 61  ? 0.5189 0.4231 0.5181 0.0056  0.0236  -0.0419 185 HIS A O   
319  C  CB  . HIS A 61  ? 0.5554 0.4538 0.5343 0.0281  0.0495  -0.0544 185 HIS A CB  
320  C  CG  . HIS A 61  ? 0.6611 0.5718 0.6450 0.0469  0.0692  -0.0510 185 HIS A CG  
321  N  ND1 . HIS A 61  ? 0.7044 0.6276 0.6962 0.0695  0.0723  -0.0517 185 HIS A ND1 
322  C  CD2 . HIS A 61  ? 0.7005 0.6198 0.6846 0.0518  0.0894  -0.0435 185 HIS A CD2 
323  C  CE1 . HIS A 61  ? 0.7184 0.6626 0.7197 0.0894  0.0917  -0.0453 185 HIS A CE1 
324  N  NE2 . HIS A 61  ? 0.7453 0.6865 0.7439 0.0764  0.1038  -0.0420 185 HIS A NE2 
325  N  N   . VAL A 62  ? 0.4620 0.3843 0.5072 0.0056  0.0135  -0.0602 186 VAL A N   
326  C  CA  . VAL A 62  ? 0.4750 0.3927 0.5338 -0.0001 0.0058  -0.0585 186 VAL A CA  
327  C  C   . VAL A 62  ? 0.4696 0.3857 0.5182 0.0008  -0.0043 -0.0671 186 VAL A C   
328  O  O   . VAL A 62  ? 0.4776 0.3946 0.5182 0.0062  -0.0038 -0.0751 186 VAL A O   
329  C  CB  . VAL A 62  ? 0.4683 0.3924 0.5697 -0.0078 0.0121  -0.0658 186 VAL A CB  
330  C  CG1 . VAL A 62  ? 0.4635 0.3847 0.5773 -0.0092 0.0051  -0.0780 186 VAL A CG1 
331  C  CG2 . VAL A 62  ? 0.4633 0.3690 0.5761 -0.0121 0.0304  -0.0489 186 VAL A CG2 
332  N  N   . LYS A 63  ? 0.4901 0.4083 0.5391 -0.0013 -0.0106 -0.0621 187 LYS A N   
333  C  CA  . LYS A 63  ? 0.4979 0.4212 0.5512 -0.0031 -0.0148 -0.0700 187 LYS A CA  
334  C  C   . LYS A 63  ? 0.4875 0.4164 0.5695 0.0035  -0.0148 -0.0666 187 LYS A C   
335  O  O   . LYS A 63  ? 0.5130 0.4409 0.6048 0.0106  -0.0127 -0.0520 187 LYS A O   
336  C  CB  . LYS A 63  ? 0.4928 0.4267 0.5313 -0.0140 -0.0191 -0.0728 187 LYS A CB  
337  C  CG  . LYS A 63  ? 0.5398 0.5050 0.5838 -0.0109 -0.0306 -0.0616 187 LYS A CG  
338  C  CD  . LYS A 63  ? 0.6132 0.6071 0.6432 -0.0283 -0.0397 -0.0743 187 LYS A CD  
339  C  CE  . LYS A 63  ? 0.6238 0.6699 0.6562 -0.0169 -0.0570 -0.0604 187 LYS A CE  
340  N  NZ  . LYS A 63  ? 0.6499 0.7386 0.6641 -0.0390 -0.0708 -0.0817 187 LYS A NZ  
341  N  N   . TYR A 64  ? 0.4698 0.3983 0.5591 0.0053  -0.0121 -0.0778 188 TYR A N   
342  C  CA  . TYR A 64  ? 0.4807 0.4061 0.5930 0.0134  -0.0061 -0.0797 188 TYR A CA  
343  C  C   . TYR A 64  ? 0.4917 0.4414 0.6182 0.0208  -0.0075 -0.0683 188 TYR A C   
344  O  O   . TYR A 64  ? 0.5018 0.4725 0.6236 0.0116  -0.0110 -0.0714 188 TYR A O   
345  C  CB  . TYR A 64  ? 0.5169 0.4381 0.6228 0.0139  -0.0019 -0.0998 188 TYR A CB  
346  C  CG  . TYR A 64  ? 0.5585 0.4801 0.6610 0.0079  -0.0050 -0.1164 188 TYR A CG  
347  C  CD1 . TYR A 64  ? 0.5831 0.5224 0.6619 0.0122  -0.0118 -0.1215 188 TYR A CD1 
348  C  CD2 . TYR A 64  ? 0.5743 0.4826 0.7008 -0.0011 0.0022  -0.1268 188 TYR A CD2 
349  C  CE1 . TYR A 64  ? 0.5555 0.5207 0.6400 0.0096  -0.0190 -0.1381 188 TYR A CE1 
350  C  CE2 . TYR A 64  ? 0.5758 0.5015 0.7117 -0.0142 -0.0011 -0.1488 188 TYR A CE2 
351  C  CZ  . TYR A 64  ? 0.5726 0.5373 0.6903 -0.0080 -0.0155 -0.1552 188 TYR A CZ  
352  O  OH  . TYR A 64  ? 0.6189 0.6236 0.7551 -0.0191 -0.0224 -0.1784 188 TYR A OH  
353  N  N   . ASP A 65  ? 0.4920 0.4410 0.6395 0.0379  -0.0012 -0.0549 189 ASP A N   
354  C  CA  . ASP A 65  ? 0.4835 0.4748 0.6531 0.0530  -0.0041 -0.0408 189 ASP A CA  
355  C  C   . ASP A 65  ? 0.4787 0.4899 0.6630 0.0499  0.0027  -0.0540 189 ASP A C   
356  O  O   . ASP A 65  ? 0.4583 0.5190 0.6579 0.0418  -0.0042 -0.0537 189 ASP A O   
357  C  CB  . ASP A 65  ? 0.5178 0.4952 0.7041 0.0837  0.0087  -0.0178 189 ASP A CB  
358  C  CG  . ASP A 65  ? 0.5934 0.5713 0.7639 0.0944  0.0032  0.0082  189 ASP A CG  
359  O  OD1 . ASP A 65  ? 0.5997 0.5778 0.7454 0.0742  -0.0081 0.0021  189 ASP A OD1 
360  O  OD2 . ASP A 65  ? 0.7058 0.6809 0.8846 0.1283  0.0145  0.0380  189 ASP A OD2 
361  N  N   . ASP A 66  ? 0.5023 0.4785 0.6814 0.0532  0.0183  -0.0688 190 ASP A N   
362  C  CA  . ASP A 66  ? 0.5353 0.5261 0.7217 0.0553  0.0315  -0.0784 190 ASP A CA  
363  C  C   . ASP A 66  ? 0.5357 0.5127 0.6885 0.0388  0.0343  -0.0930 190 ASP A C   
364  O  O   . ASP A 66  ? 0.5356 0.5152 0.6833 0.0426  0.0511  -0.0992 190 ASP A O   
365  C  CB  . ASP A 66  ? 0.5592 0.5240 0.7555 0.0775  0.0526  -0.0845 190 ASP A CB  
366  C  CG  . ASP A 66  ? 0.6305 0.5994 0.8568 0.1043  0.0583  -0.0616 190 ASP A CG  
367  O  OD1 . ASP A 66  ? 0.6551 0.6850 0.9090 0.1143  0.0477  -0.0409 190 ASP A OD1 
368  O  OD2 . ASP A 66  ? 0.6748 0.5879 0.8966 0.1153  0.0748  -0.0645 190 ASP A OD2 
369  N  N   . TYR A 67  ? 0.5241 0.4862 0.6514 0.0261  0.0223  -0.0943 191 TYR A N   
370  C  CA  . TYR A 67  ? 0.5344 0.4804 0.6247 0.0212  0.0279  -0.1000 191 TYR A CA  
371  C  C   . TYR A 67  ? 0.5392 0.4786 0.6153 0.0065  0.0240  -0.0932 191 TYR A C   
372  O  O   . TYR A 67  ? 0.5621 0.4840 0.6129 0.0097  0.0185  -0.0932 191 TYR A O   
373  C  CB  . TYR A 67  ? 0.5247 0.4563 0.5901 0.0302  0.0227  -0.1141 191 TYR A CB  
374  C  CG  . TYR A 67  ? 0.5428 0.4701 0.6151 0.0390  0.0306  -0.1310 191 TYR A CG  
375  C  CD1 . TYR A 67  ? 0.5650 0.4929 0.6093 0.0498  0.0438  -0.1418 191 TYR A CD1 
376  C  CD2 . TYR A 67  ? 0.5362 0.4502 0.6371 0.0384  0.0311  -0.1362 191 TYR A CD2 
377  C  CE1 . TYR A 67  ? 0.5823 0.5004 0.6264 0.0572  0.0548  -0.1641 191 TYR A CE1 
378  C  CE2 . TYR A 67  ? 0.5509 0.4450 0.6555 0.0455  0.0465  -0.1561 191 TYR A CE2 
379  C  CZ  . TYR A 67  ? 0.5990 0.4966 0.6751 0.0535  0.0570  -0.1734 191 TYR A CZ  
380  O  OH  . TYR A 67  ? 0.6387 0.5111 0.7126 0.0596  0.0755  -0.1991 191 TYR A OH  
381  N  N   . PRO A 68  ? 0.5188 0.4761 0.6136 -0.0108 0.0289  -0.0909 192 PRO A N   
382  C  CA  . PRO A 68  ? 0.5206 0.4626 0.5990 -0.0304 0.0305  -0.0932 192 PRO A CA  
383  C  C   . PRO A 68  ? 0.5611 0.4526 0.5973 -0.0272 0.0534  -0.0898 192 PRO A C   
384  O  O   . PRO A 68  ? 0.5484 0.4088 0.5592 -0.0311 0.0574  -0.0897 192 PRO A O   
385  C  CB  . PRO A 68  ? 0.5446 0.5271 0.6586 -0.0557 0.0343  -0.1009 192 PRO A CB  
386  C  CG  . PRO A 68  ? 0.4879 0.4985 0.6321 -0.0451 0.0448  -0.0973 192 PRO A CG  
387  C  CD  . PRO A 68  ? 0.5103 0.5093 0.6462 -0.0147 0.0351  -0.0908 192 PRO A CD  
388  N  N   . GLU A 69  ? 0.5953 0.4765 0.6193 -0.0148 0.0722  -0.0843 193 GLU A N   
389  C  CA  . GLU A 69  ? 0.6668 0.5001 0.6429 -0.0005 0.0987  -0.0718 193 GLU A CA  
390  C  C   . GLU A 69  ? 0.6651 0.4919 0.6062 0.0300  0.0844  -0.0648 193 GLU A C   
391  O  O   . GLU A 69  ? 0.7295 0.5220 0.6275 0.0521  0.1037  -0.0486 193 GLU A O   
392  C  CB  . GLU A 69  ? 0.6971 0.5281 0.6625 0.0098  0.1239  -0.0644 193 GLU A CB  
393  C  CG  . GLU A 69  ? 0.7674 0.6285 0.7235 0.0363  0.1069  -0.0692 193 GLU A CG  
394  C  CD  . GLU A 69  ? 0.7821 0.6838 0.7893 0.0266  0.0893  -0.0844 193 GLU A CD  
395  O  OE1 . GLU A 69  ? 0.8390 0.7528 0.8388 0.0434  0.0834  -0.0943 193 GLU A OE1 
396  O  OE2 . GLU A 69  ? 0.7553 0.6775 0.8064 0.0052  0.0830  -0.0870 193 GLU A OE2 
397  N  N   . ASN A 70  ? 0.6117 0.4743 0.5745 0.0327  0.0542  -0.0753 194 ASN A N   
398  C  CA  . ASN A 70  ? 0.6081 0.4842 0.5558 0.0531  0.0386  -0.0747 194 ASN A CA  
399  C  C   . ASN A 70  ? 0.5875 0.4486 0.5356 0.0483  0.0373  -0.0706 194 ASN A C   
400  O  O   . ASN A 70  ? 0.5887 0.4659 0.5297 0.0668  0.0293  -0.0675 194 ASN A O   
401  C  CB  . ASN A 70  ? 0.6028 0.5182 0.5776 0.0511  0.0155  -0.0927 194 ASN A CB  
402  C  CG  . ASN A 70  ? 0.6444 0.5780 0.5989 0.0667  0.0156  -0.1023 194 ASN A CG  
403  O  OD1 . ASN A 70  ? 0.7224 0.6855 0.6552 0.0853  0.0045  -0.1078 194 ASN A OD1 
404  N  ND2 . ASN A 70  ? 0.6711 0.5962 0.6315 0.0612  0.0281  -0.1058 194 ASN A ND2 
405  N  N   . GLY A 71  ? 0.5572 0.3961 0.5146 0.0232  0.0454  -0.0736 195 GLY A N   
406  C  CA  . GLY A 71  ? 0.5404 0.3566 0.4870 0.0167  0.0499  -0.0742 195 GLY A CA  
407  C  C   . GLY A 71  ? 0.5226 0.3698 0.4900 0.0141  0.0282  -0.0784 195 GLY A C   
408  O  O   . GLY A 71  ? 0.4639 0.3421 0.4604 0.0077  0.0116  -0.0821 195 GLY A O   
409  N  N   . VAL A 72  ? 0.5524 0.3838 0.5028 0.0217  0.0353  -0.0755 196 VAL A N   
410  C  CA  . VAL A 72  ? 0.5048 0.3619 0.4713 0.0224  0.0235  -0.0754 196 VAL A CA  
411  C  C   . VAL A 72  ? 0.5153 0.4020 0.4925 0.0469  0.0210  -0.0699 196 VAL A C   
412  O  O   . VAL A 72  ? 0.5547 0.4308 0.5097 0.0721  0.0340  -0.0610 196 VAL A O   
413  C  CB  . VAL A 72  ? 0.5442 0.3744 0.4856 0.0144  0.0350  -0.0788 196 VAL A CB  
414  C  CG1 . VAL A 72  ? 0.4427 0.2966 0.3960 0.0224  0.0322  -0.0730 196 VAL A CG1 
415  C  CG2 . VAL A 72  ? 0.5266 0.3567 0.4640 -0.0138 0.0279  -0.0907 196 VAL A CG2 
416  N  N   . VAL A 73  ? 0.4780 0.4041 0.4910 0.0401  0.0069  -0.0755 197 VAL A N   
417  C  CA  . VAL A 73  ? 0.5022 0.4785 0.5392 0.0532  -0.0005 -0.0804 197 VAL A CA  
418  C  C   . VAL A 73  ? 0.4904 0.4905 0.5583 0.0446  0.0038  -0.0810 197 VAL A C   
419  O  O   . VAL A 73  ? 0.4869 0.4674 0.5636 0.0255  0.0080  -0.0789 197 VAL A O   
420  C  CB  . VAL A 73  ? 0.5010 0.5051 0.5580 0.0444  -0.0156 -0.0975 197 VAL A CB  
421  C  CG1 . VAL A 73  ? 0.4932 0.5662 0.5812 0.0479  -0.0276 -0.1142 197 VAL A CG1 
422  C  CG2 . VAL A 73  ? 0.4890 0.4738 0.5113 0.0581  -0.0139 -0.0934 197 VAL A CG2 
423  N  N   . GLN A 74  ? 0.5038 0.5507 0.5878 0.0628  0.0055  -0.0802 198 GLN A N   
424  C  CA  . GLN A 74  ? 0.5131 0.5933 0.6348 0.0547  0.0153  -0.0807 198 GLN A CA  
425  C  C   . GLN A 74  ? 0.4910 0.6200 0.6690 0.0271  0.0064  -0.1024 198 GLN A C   
426  O  O   . GLN A 74  ? 0.4536 0.6381 0.6507 0.0292  -0.0113 -0.1211 198 GLN A O   
427  C  CB  . GLN A 74  ? 0.5205 0.6441 0.6463 0.0886  0.0236  -0.0713 198 GLN A CB  
428  C  CG  . GLN A 74  ? 0.6412 0.7028 0.7091 0.1174  0.0418  -0.0530 198 GLN A CG  
429  C  CD  . GLN A 74  ? 0.7017 0.7975 0.7746 0.1576  0.0587  -0.0393 198 GLN A CD  
430  O  OE1 . GLN A 74  ? 0.7413 0.8644 0.8040 0.1972  0.0565  -0.0280 198 GLN A OE1 
431  N  NE2 . GLN A 74  ? 0.7473 0.8452 0.8342 0.1534  0.0786  -0.0367 198 GLN A NE2 
432  N  N   . MSE A 75  ? 0.7055 0.4773 0.9453 0.0343  0.0448  -0.1278 199 MSE A N   
433  C  CA  . MSE A 75  ? 0.7251 0.5078 0.9410 0.0351  0.0383  -0.1183 199 MSE A CA  
434  C  C   . MSE A 75  ? 0.7148 0.5113 0.9729 0.0343  0.0550  -0.1384 199 MSE A C   
435  O  O   . MSE A 75  ? 0.7001 0.5033 0.9680 0.0251  0.0823  -0.1643 199 MSE A O   
436  C  CB  . MSE A 75  ? 0.7324 0.5218 0.8783 0.0269  0.0444  -0.1158 199 MSE A CB  
437  C  CG  . MSE A 75  ? 0.8525 0.6329 0.9588 0.0255  0.0312  -0.1013 199 MSE A CG  
438  SE SE  . MSE A 75  ? 1.0428 0.8122 1.1328 0.0292  0.0002  -0.0698 199 MSE A SE  
439  C  CE  . MSE A 75  ? 0.9542 0.7412 1.0313 0.0310  -0.0008 -0.0669 199 MSE A CE  
440  N  N   . ASN A 76  ? 0.7015 0.5022 0.9839 0.0415  0.0398  -0.1285 200 ASN A N   
441  C  CA  . ASN A 76  ? 0.7051 0.5214 1.0153 0.0380  0.0571  -0.1472 200 ASN A CA  
442  C  C   . ASN A 76  ? 0.6883 0.5097 0.9283 0.0263  0.0720  -0.1471 200 ASN A C   
443  O  O   . ASN A 76  ? 0.6696 0.4866 0.8553 0.0273  0.0569  -0.1261 200 ASN A O   
444  C  CB  . ASN A 76  ? 0.7026 0.5234 1.0571 0.0488  0.0342  -0.1367 200 ASN A CB  
445  C  CG  . ASN A 76  ? 0.7188 0.5566 1.1284 0.0456  0.0545  -0.1639 200 ASN A CG  
446  O  OD1 . ASN A 76  ? 0.7268 0.5742 1.1120 0.0391  0.0641  -0.1660 200 ASN A OD1 
447  N  ND2 . ASN A 76  ? 0.7428 0.5838 1.2306 0.0489  0.0631  -0.1873 200 ASN A ND2 
448  N  N   . SER A 77  ? 0.6852 0.5135 0.9269 0.0136  0.1014  -0.1715 201 SER A N   
449  C  CA  . SER A 77  ? 0.7050 0.5307 0.8752 0.0001  0.1147  -0.1710 201 SER A CA  
450  C  C   . SER A 77  ? 0.6840 0.5103 0.8221 0.0046  0.0977  -0.1491 201 SER A C   
451  O  O   . SER A 77  ? 0.6813 0.5007 0.7570 -0.0019 0.0976  -0.1403 201 SER A O   
452  C  CB  . SER A 77  ? 0.7308 0.5589 0.9054 -0.0188 0.1505  -0.2011 201 SER A CB  
453  O  OG  . SER A 77  ? 0.7752 0.6145 1.0111 -0.0176 0.1589  -0.2149 201 SER A OG  
454  N  N   . ARG A 78  ? 0.6727 0.5063 0.8548 0.0157  0.0812  -0.1407 202 ARG A N   
455  C  CA  . ARG A 78  ? 0.6722 0.5077 0.8273 0.0193  0.0649  -0.1212 202 ARG A CA  
456  C  C   . ARG A 78  ? 0.6697 0.4985 0.7835 0.0252  0.0414  -0.0976 202 ARG A C   
457  O  O   . ARG A 78  ? 0.6788 0.5085 0.7615 0.0255  0.0310  -0.0839 202 ARG A O   
458  C  CB  . ARG A 78  ? 0.6603 0.5071 0.8739 0.0273  0.0537  -0.1215 202 ARG A CB  
459  C  CG  . ARG A 78  ? 0.6702 0.5155 0.9293 0.0408  0.0254  -0.1100 202 ARG A CG  
460  C  CD  . ARG A 78  ? 0.6809 0.5385 1.0073 0.0479  0.0144  -0.1160 202 ARG A CD  
461  N  NE  . ARG A 78  ? 0.6915 0.5491 1.0943 0.0563  0.0084  -0.1288 202 ARG A NE  
462  N  N   . ASP A 79  ? 0.6771 0.4993 0.7934 0.0280  0.0356  -0.0958 203 ASP A N   
463  C  CA  . ASP A 79  ? 0.6606 0.4765 0.7453 0.0310  0.0161  -0.0773 203 ASP A CA  
464  C  C   . ASP A 79  ? 0.6441 0.4559 0.6825 0.0252  0.0232  -0.0807 203 ASP A C   
465  O  O   . ASP A 79  ? 0.6046 0.4121 0.6245 0.0258  0.0118  -0.0720 203 ASP A O   
466  C  CB  . ASP A 79  ? 0.6573 0.4646 0.7768 0.0373  -0.0006 -0.0691 203 ASP A CB  
467  C  CG  . ASP A 79  ? 0.6979 0.5075 0.8562 0.0439  -0.0186 -0.0601 203 ASP A CG  
468  O  OD1 . ASP A 79  ? 0.6778 0.4935 0.8155 0.0428  -0.0273 -0.0502 203 ASP A OD1 
469  O  OD2 . ASP A 79  ? 0.7171 0.5224 0.9297 0.0504  -0.0254 -0.0642 203 ASP A OD2 
470  N  N   . VAL A 80  ? 0.6336 0.4458 0.6528 0.0177  0.0417  -0.0947 204 VAL A N   
471  C  CA  . VAL A 80  ? 0.6161 0.4242 0.5870 0.0122  0.0431  -0.0967 204 VAL A CA  
472  C  C   . VAL A 80  ? 0.6566 0.4601 0.5888 0.0045  0.0504  -0.0983 204 VAL A C   
473  O  O   . VAL A 80  ? 0.6316 0.4334 0.5713 -0.0028 0.0673  -0.1078 204 VAL A O   
474  C  CB  . VAL A 80  ? 0.6367 0.4422 0.6105 0.0082  0.0525  -0.1106 204 VAL A CB  
475  C  CG1 . VAL A 80  ? 0.5920 0.3976 0.6210 0.0114  0.0593  -0.1186 204 VAL A CG1 
476  C  CG2 . VAL A 80  ? 0.6282 0.4295 0.5650 -0.0040 0.0674  -0.1248 204 VAL A CG2 
477  N  N   . ARG A 81  ? 0.6478 0.4478 0.5410 0.0053  0.0369  -0.0896 205 ARG A N   
478  C  CA  . ARG A 81  ? 0.6650 0.4539 0.5162 -0.0012 0.0370  -0.0867 205 ARG A CA  
479  C  C   . ARG A 81  ? 0.7071 0.4908 0.5231 -0.0006 0.0215  -0.0845 205 ARG A C   
480  O  O   . ARG A 81  ? 0.7009 0.4936 0.5297 0.0053  0.0120  -0.0859 205 ARG A O   
481  C  CB  . ARG A 81  ? 0.6410 0.4311 0.4966 0.0030  0.0303  -0.0747 205 ARG A CB  
482  C  CG  . ARG A 81  ? 0.6006 0.4001 0.4663 0.0129  0.0108  -0.0638 205 ARG A CG  
483  C  CD  . ARG A 81  ? 0.5095 0.3125 0.3864 0.0149  0.0085  -0.0555 205 ARG A CD  
484  N  NE  . ARG A 81  ? 0.5711 0.3824 0.4529 0.0201  -0.0071 -0.0482 205 ARG A NE  
485  C  CZ  . ARG A 81  ? 0.5823 0.4027 0.4839 0.0216  -0.0112 -0.0424 205 ARG A CZ  
486  N  NH1 . ARG A 81  ? 0.4919 0.3156 0.4156 0.0210  -0.0041 -0.0424 205 ARG A NH1 
487  N  NH2 . ARG A 81  ? 0.5802 0.4074 0.4814 0.0220  -0.0222 -0.0392 205 ARG A NH2 
488  N  N   . ALA A 82  ? 0.7597 0.5270 0.5315 -0.0080 0.0180  -0.0818 206 ALA A N   
489  C  CA  . ALA A 82  ? 0.7739 0.5343 0.5154 -0.0057 -0.0039 -0.0782 206 ALA A CA  
490  C  C   . ALA A 82  ? 0.7236 0.4972 0.4915 0.0077  -0.0217 -0.0714 206 ALA A C   
491  O  O   . ALA A 82  ? 0.7196 0.4983 0.5070 0.0117  -0.0196 -0.0643 206 ALA A O   
492  C  CB  . ALA A 82  ? 0.8079 0.5419 0.4979 -0.0150 -0.0099 -0.0702 206 ALA A CB  
493  N  N   . ARG A 83  ? 0.6979 0.4785 0.4683 0.0126  -0.0374 -0.0766 207 ARG A N   
494  C  CA  . ARG A 83  ? 0.6705 0.4643 0.4668 0.0216  -0.0515 -0.0762 207 ARG A CA  
495  C  C   . ARG A 83  ? 0.7006 0.4859 0.4910 0.0260  -0.0658 -0.0666 207 ARG A C   
496  O  O   . ARG A 83  ? 0.7047 0.4706 0.4639 0.0245  -0.0782 -0.0610 207 ARG A O   
497  C  CB  . ARG A 83  ? 0.6690 0.4715 0.4712 0.0239  -0.0643 -0.0887 207 ARG A CB  
498  C  CG  . ARG A 83  ? 0.7240 0.5375 0.5432 0.0204  -0.0497 -0.0989 207 ARG A CG  
499  C  CD  . ARG A 83  ? 0.7223 0.5495 0.5601 0.0222  -0.0586 -0.1131 207 ARG A CD  
500  N  NE  . ARG A 83  ? 0.7109 0.5424 0.5554 0.0168  -0.0450 -0.1236 207 ARG A NE  
501  C  CZ  . ARG A 83  ? 0.7090 0.5516 0.5676 0.0155  -0.0481 -0.1395 207 ARG A CZ  
502  N  NH1 . ARG A 83  ? 0.6451 0.4888 0.5097 0.0097  -0.0337 -0.1484 207 ARG A NH1 
503  N  NH2 . ARG A 83  ? 0.6358 0.4887 0.5082 0.0196  -0.0648 -0.1486 207 ARG A NH2 
504  N  N   . ALA A 84  ? 0.6892 0.4868 0.5079 0.0300  -0.0649 -0.0647 208 ALA A N   
505  C  CA  . ALA A 84  ? 0.7053 0.4986 0.5294 0.0346  -0.0776 -0.0593 208 ALA A CA  
506  C  C   . ALA A 84  ? 0.7275 0.5166 0.5521 0.0406  -0.1017 -0.0653 208 ALA A C   
507  O  O   . ALA A 84  ? 0.7430 0.5464 0.5847 0.0422  -0.1065 -0.0788 208 ALA A O   
508  C  CB  . ALA A 84  ? 0.6575 0.4691 0.5142 0.0350  -0.0720 -0.0624 208 ALA A CB  
509  N  N   . ARG A 85  ? 0.7498 0.5177 0.5572 0.0436  -0.1179 -0.0557 209 ARG A N   
510  C  CA  . ARG A 85  ? 0.7883 0.5487 0.6014 0.0514  -0.1478 -0.0595 209 ARG A CA  
511  C  C   . ARG A 85  ? 0.7856 0.5375 0.6198 0.0586  -0.1626 -0.0547 209 ARG A C   
512  O  O   . ARG A 85  ? 0.7971 0.5518 0.6616 0.0678  -0.1870 -0.0635 209 ARG A O   
513  C  CB  . ARG A 85  ? 0.8331 0.5663 0.5953 0.0470  -0.1626 -0.0513 209 ARG A CB  
514  C  CG  . ARG A 85  ? 0.8872 0.5887 0.5951 0.0356  -0.1519 -0.0336 209 ARG A CG  
515  C  CD  . ARG A 85  ? 1.0043 0.6766 0.6537 0.0262  -0.1669 -0.0276 209 ARG A CD  
516  N  NE  . ARG A 85  ? 1.1652 0.8239 0.7696 0.0084  -0.1387 -0.0244 209 ARG A NE  
517  C  CZ  . ARG A 85  ? 1.2133 0.8916 0.8245 0.0019  -0.1136 -0.0374 209 ARG A CZ  
518  N  NH1 . ARG A 85  ? 1.1541 0.8638 0.8084 0.0108  -0.1125 -0.0518 209 ARG A NH1 
519  N  NH2 . ARG A 85  ? 1.2737 0.9390 0.8511 -0.0150 -0.0876 -0.0378 209 ARG A NH2 
520  N  N   . THR A 86  ? 0.7755 0.5186 0.6004 0.0544  -0.1476 -0.0433 210 THR A N   
521  C  CA  . THR A 86  ? 0.7721 0.5004 0.6097 0.0593  -0.1599 -0.0365 210 THR A CA  
522  C  C   . THR A 86  ? 0.7341 0.4886 0.6167 0.0594  -0.1437 -0.0466 210 THR A C   
523  O  O   . THR A 86  ? 0.7188 0.4842 0.5959 0.0519  -0.1197 -0.0444 210 THR A O   
524  C  CB  . THR A 86  ? 0.8174 0.5074 0.6024 0.0517  -0.1573 -0.0153 210 THR A CB  
525  O  OG1 . THR A 86  ? 0.9047 0.5677 0.6383 0.0466  -0.1711 -0.0067 210 THR A OG1 
526  C  CG2 . THR A 86  ? 0.7755 0.4441 0.5726 0.0569  -0.1727 -0.0069 210 THR A CG2 
527  N  N   . ILE A 87  ? 0.7006 0.4652 0.6294 0.0669  -0.1581 -0.0595 211 ILE A N   
528  C  CA  . ILE A 87  ? 0.6810 0.4676 0.6518 0.0643  -0.1444 -0.0719 211 ILE A CA  
529  C  C   . ILE A 87  ? 0.6939 0.4594 0.6617 0.0651  -0.1457 -0.0596 211 ILE A C   
530  O  O   . ILE A 87  ? 0.7397 0.4773 0.7042 0.0728  -0.1687 -0.0509 211 ILE A O   
531  C  CB  . ILE A 87  ? 0.6723 0.4801 0.7024 0.0698  -0.1565 -0.0973 211 ILE A CB  
532  C  CG1 . ILE A 87  ? 0.6637 0.4974 0.7038 0.0646  -0.1473 -0.1147 211 ILE A CG1 
533  C  CG2 . ILE A 87  ? 0.6443 0.4680 0.7175 0.0654  -0.1442 -0.1111 211 ILE A CG2 
534  C  CD1 . ILE A 87  ? 0.6846 0.5439 0.7334 0.0498  -0.1181 -0.1259 211 ILE A CD1 
535  N  N   . ILE A 88  ? 0.6799 0.4568 0.6489 0.0566  -0.1227 -0.0589 212 ILE A N   
536  C  CA  . ILE A 88  ? 0.7013 0.4636 0.6781 0.0563  -0.1213 -0.0527 212 ILE A CA  
537  C  C   . ILE A 88  ? 0.6903 0.4741 0.7266 0.0576  -0.1219 -0.0745 212 ILE A C   
538  O  O   . ILE A 88  ? 0.6671 0.4824 0.7246 0.0483  -0.1041 -0.0910 212 ILE A O   
539  C  CB  . ILE A 88  ? 0.7011 0.4649 0.6536 0.0461  -0.0972 -0.0432 212 ILE A CB  
540  C  CG1 . ILE A 88  ? 0.7011 0.4496 0.6046 0.0426  -0.0916 -0.0288 212 ILE A CG1 
541  C  CG2 . ILE A 88  ? 0.6997 0.4437 0.6569 0.0452  -0.0958 -0.0365 212 ILE A CG2 
542  C  CD1 . ILE A 88  ? 0.6903 0.4546 0.5871 0.0337  -0.0681 -0.0278 212 ILE A CD1 
543  N  N   . LYS A 89  ? 0.7095 0.4736 0.7717 0.0674  -0.1431 -0.0751 213 LYS A N   
544  C  CA  . LYS A 89  ? 0.7014 0.4826 0.8291 0.0690  -0.1441 -0.0985 213 LYS A CA  
545  C  C   . LYS A 89  ? 0.6543 0.4488 0.7903 0.0571  -0.1184 -0.1032 213 LYS A C   
546  O  O   . LYS A 89  ? 0.6411 0.4179 0.7394 0.0532  -0.1096 -0.0839 213 LYS A O   
547  C  CB  . LYS A 89  ? 0.7433 0.4929 0.8972 0.0837  -0.1758 -0.0938 213 LYS A CB  
548  C  CG  . LYS A 89  ? 0.8317 0.5786 1.0051 0.0963  -0.2062 -0.1007 213 LYS A CG  
549  C  CD  . LYS A 89  ? 0.9602 0.6565 1.1061 0.1088  -0.2441 -0.0751 213 LYS A CD  
550  C  CE  . LYS A 89  ? 1.0191 0.6898 1.2062 0.1170  -0.2612 -0.0736 213 LYS A CE  
551  N  NZ  . LYS A 89  ? 1.0190 0.6727 1.1741 0.1063  -0.2373 -0.0580 213 LYS A NZ  
552  N  N   . TRP A 90  ? 0.6179 0.4441 0.8042 0.0495  -0.1058 -0.1315 214 TRP A N   
553  C  CA  . TRP A 90  ? 0.5910 0.4343 0.7924 0.0357  -0.0823 -0.1424 214 TRP A CA  
554  C  C   . TRP A 90  ? 0.6159 0.4319 0.8091 0.0390  -0.0835 -0.1259 214 TRP A C   
555  O  O   . TRP A 90  ? 0.6023 0.4231 0.7717 0.0284  -0.0650 -0.1191 214 TRP A O   
556  C  CB  . TRP A 90  ? 0.5591 0.4309 0.8275 0.0284  -0.0744 -0.1794 214 TRP A CB  
557  C  CG  . TRP A 90  ? 0.5300 0.4173 0.8163 0.0128  -0.0516 -0.1930 214 TRP A CG  
558  C  CD1 . TRP A 90  ? 0.5296 0.4095 0.8611 0.0157  -0.0523 -0.2032 214 TRP A CD1 
559  C  CD2 . TRP A 90  ? 0.5204 0.4307 0.7774 -0.0085 -0.0271 -0.1967 214 TRP A CD2 
560  N  NE1 . TRP A 90  ? 0.5473 0.4475 0.8805 -0.0036 -0.0268 -0.2157 214 TRP A NE1 
561  C  CE2 . TRP A 90  ? 0.4934 0.4120 0.7791 -0.0189 -0.0128 -0.2111 214 TRP A CE2 
562  C  CE3 . TRP A 90  ? 0.5335 0.4562 0.7438 -0.0201 -0.0182 -0.1889 214 TRP A CE3 
563  C  CZ2 . TRP A 90  ? 0.4582 0.3985 0.7237 -0.0414 0.0090  -0.2183 214 TRP A CZ2 
564  C  CZ3 . TRP A 90  ? 0.4969 0.4376 0.6874 -0.0414 0.0006  -0.1936 214 TRP A CZ3 
565  C  CH2 . TRP A 90  ? 0.4687 0.4188 0.6853 -0.0522 0.0134  -0.2083 214 TRP A CH2 
566  N  N   . GLN A 91  ? 0.6560 0.4417 0.8704 0.0532  -0.1068 -0.1200 215 GLN A N   
567  C  CA  . GLN A 91  ? 0.7017 0.4555 0.9125 0.0554  -0.1091 -0.1057 215 GLN A CA  
568  C  C   . GLN A 91  ? 0.6942 0.4233 0.8339 0.0507  -0.1016 -0.0764 215 GLN A C   
569  O  O   . GLN A 91  ? 0.6927 0.4104 0.8225 0.0437  -0.0875 -0.0697 215 GLN A O   
570  C  CB  . GLN A 91  ? 0.7550 0.4727 0.9963 0.0723  -0.1423 -0.1007 215 GLN A CB  
571  C  CG  . GLN A 91  ? 0.8326 0.5736 1.1530 0.0803  -0.1553 -0.1322 215 GLN A CG  
572  C  CD  . GLN A 91  ? 0.8999 0.6446 1.2164 0.0903  -0.1781 -0.1330 215 GLN A CD  
573  O  OE1 . GLN A 91  ? 0.9526 0.6618 1.2624 0.1054  -0.2134 -0.1165 215 GLN A OE1 
574  N  NE2 . GLN A 91  ? 0.8538 0.6396 1.1733 0.0804  -0.1590 -0.1526 215 GLN A NE2 
575  N  N   . ASP A 92  ? 0.6772 0.4001 0.7724 0.0533  -0.1090 -0.0626 216 ASP A N   
576  C  CA  . ASP A 92  ? 0.7153 0.4142 0.7463 0.0479  -0.1020 -0.0387 216 ASP A CA  
577  C  C   . ASP A 92  ? 0.6800 0.4103 0.6939 0.0361  -0.0751 -0.0424 216 ASP A C   
578  O  O   . ASP A 92  ? 0.6949 0.4114 0.6660 0.0306  -0.0655 -0.0282 216 ASP A O   
579  C  CB  . ASP A 92  ? 0.7435 0.4174 0.7353 0.0549  -0.1239 -0.0237 216 ASP A CB  
580  C  CG  . ASP A 92  ? 0.8436 0.4770 0.8415 0.0664  -0.1573 -0.0139 216 ASP A CG  
581  O  OD1 . ASP A 92  ? 0.9413 0.5480 0.9512 0.0670  -0.1616 -0.0081 216 ASP A OD1 
582  O  OD2 . ASP A 92  ? 0.8618 0.4882 0.8532 0.0749  -0.1817 -0.0117 216 ASP A OD2 
583  N  N   . LEU A 93  ? 0.6574 0.4694 0.6636 0.0285  -0.0687 0.0357  217 LEU A N   
584  C  CA  . LEU A 93  ? 0.6228 0.4637 0.6428 0.0132  -0.0592 0.0174  217 LEU A CA  
585  C  C   . LEU A 93  ? 0.6391 0.4625 0.6787 -0.0030 -0.0442 0.0113  217 LEU A C   
586  O  O   . LEU A 93  ? 0.6629 0.4616 0.7216 -0.0012 -0.0440 0.0063  217 LEU A O   
587  C  CB  . LEU A 93  ? 0.5865 0.4610 0.6277 0.0200  -0.0680 -0.0033 217 LEU A CB  
588  C  CG  . LEU A 93  ? 0.6094 0.5115 0.6427 0.0291  -0.0796 -0.0039 217 LEU A CG  
589  C  CD1 . LEU A 93  ? 0.5292 0.4584 0.5857 0.0333  -0.0821 -0.0224 217 LEU A CD1 
590  C  CD2 . LEU A 93  ? 0.5691 0.4851 0.5810 0.0200  -0.0763 -0.0008 217 LEU A CD2 
591  N  N   . GLU A 94  ? 0.6342 0.4718 0.6735 -0.0187 -0.0315 0.0093  218 GLU A N   
592  C  CA  . GLU A 94  ? 0.6489 0.4803 0.7147 -0.0374 -0.0172 0.0005  218 GLU A CA  
593  C  C   . GLU A 94  ? 0.6000 0.4749 0.6877 -0.0445 -0.0171 -0.0201 218 GLU A C   
594  O  O   . GLU A 94  ? 0.5848 0.4841 0.6596 -0.0409 -0.0175 -0.0187 218 GLU A O   
595  C  CB  . GLU A 94  ? 0.6951 0.5014 0.7454 -0.0517 0.0025  0.0209  218 GLU A CB  
596  C  CG  . GLU A 94  ? 0.8244 0.5777 0.8515 -0.0465 0.0043  0.0460  218 GLU A CG  
597  C  CD  . GLU A 94  ? 0.9293 0.6609 0.9222 -0.0578 0.0241  0.0720  218 GLU A CD  
598  O  OE1 . GLU A 94  ? 1.0092 0.6900 0.9879 -0.0617 0.0333  0.0946  218 GLU A OE1 
599  O  OE2 . GLU A 94  ? 0.9381 0.7010 0.9164 -0.0624 0.0319  0.0701  218 GLU A OE2 
600  N  N   . VAL A 95  ? 0.5754 0.4581 0.6960 -0.0536 -0.0177 -0.0401 219 VAL A N   
601  C  CA  . VAL A 95  ? 0.5380 0.4622 0.6825 -0.0600 -0.0197 -0.0589 219 VAL A CA  
602  C  C   . VAL A 95  ? 0.5568 0.4951 0.7021 -0.0692 -0.0042 -0.0498 219 VAL A C   
603  O  O   . VAL A 95  ? 0.5901 0.5050 0.7323 -0.0820 0.0138  -0.0361 219 VAL A O   
604  C  CB  . VAL A 95  ? 0.5493 0.4777 0.7309 -0.0732 -0.0219 -0.0827 219 VAL A CB  
605  C  CG1 . VAL A 95  ? 0.5359 0.5118 0.7466 -0.0805 -0.0254 -0.1006 219 VAL A CG1 
606  C  CG2 . VAL A 95  ? 0.4897 0.4121 0.6667 -0.0612 -0.0367 -0.0975 219 VAL A CG2 
607  N  N   . GLY A 96  ? 0.5392 0.5131 0.6859 -0.0613 -0.0095 -0.0562 220 GLY A N   
608  C  CA  . GLY A 96  ? 0.5373 0.5303 0.6896 -0.0662 0.0054  -0.0532 220 GLY A CA  
609  C  C   . GLY A 96  ? 0.5595 0.5389 0.6706 -0.0575 0.0114  -0.0367 220 GLY A C   
610  O  O   . GLY A 96  ? 0.5735 0.5690 0.6850 -0.0590 0.0248  -0.0371 220 GLY A O   
611  N  N   . GLN A 97  ? 0.5652 0.5183 0.6436 -0.0483 0.0014  -0.0250 221 GLN A N   
612  C  CA  . GLN A 97  ? 0.5809 0.5252 0.6200 -0.0396 0.0011  -0.0135 221 GLN A CA  
613  C  C   . GLN A 97  ? 0.5162 0.4839 0.5569 -0.0290 -0.0081 -0.0244 221 GLN A C   
614  O  O   . GLN A 97  ? 0.4717 0.4505 0.5272 -0.0229 -0.0215 -0.0329 221 GLN A O   
615  C  CB  . GLN A 97  ? 0.5990 0.5175 0.6127 -0.0310 -0.0119 -0.0014 221 GLN A CB  
616  C  CG  . GLN A 97  ? 0.6918 0.5787 0.6728 -0.0337 -0.0037 0.0198  221 GLN A CG  
617  C  CD  . GLN A 97  ? 0.7020 0.5652 0.6709 -0.0216 -0.0202 0.0305  221 GLN A CD  
618  O  OE1 . GLN A 97  ? 0.7062 0.5814 0.6920 -0.0120 -0.0354 0.0197  221 GLN A OE1 
619  N  NE2 . GLN A 97  ? 0.7800 0.6102 0.7198 -0.0207 -0.0164 0.0525  221 GLN A NE2 
620  N  N   . VAL A 98  ? 0.5136 0.4853 0.5363 -0.0269 0.0003  -0.0243 222 VAL A N   
621  C  CA  . VAL A 98  ? 0.4951 0.4780 0.5164 -0.0163 -0.0081 -0.0333 222 VAL A CA  
622  C  C   . VAL A 98  ? 0.5039 0.4710 0.4907 -0.0119 -0.0173 -0.0284 222 VAL A C   
623  O  O   . VAL A 98  ? 0.5603 0.5171 0.5167 -0.0142 -0.0110 -0.0234 222 VAL A O   
624  C  CB  . VAL A 98  ? 0.5172 0.5182 0.5530 -0.0143 0.0056  -0.0437 222 VAL A CB  
625  C  CG1 . VAL A 98  ? 0.4521 0.4502 0.4777 -0.0030 -0.0008 -0.0510 222 VAL A CG1 
626  C  CG2 . VAL A 98  ? 0.4648 0.4920 0.5457 -0.0151 0.0057  -0.0524 222 VAL A CG2 
627  N  N   . VAL A 99  ? 0.4670 0.4353 0.4587 -0.0065 -0.0321 -0.0307 223 VAL A N   
628  C  CA  . VAL A 99  ? 0.4558 0.4166 0.4286 -0.0045 -0.0438 -0.0281 223 VAL A CA  
629  C  C   . VAL A 99  ? 0.4636 0.4277 0.4417 -0.0021 -0.0495 -0.0361 223 VAL A C   
630  O  O   . VAL A 99  ? 0.4668 0.4345 0.4591 0.0009  -0.0456 -0.0403 223 VAL A O   
631  C  CB  . VAL A 99  ? 0.4522 0.4108 0.4327 -0.0026 -0.0535 -0.0216 223 VAL A CB  
632  C  CG1 . VAL A 99  ? 0.4091 0.3530 0.3811 -0.0051 -0.0476 -0.0106 223 VAL A CG1 
633  C  CG2 . VAL A 99  ? 0.3828 0.3520 0.3889 -0.0010 -0.0561 -0.0273 223 VAL A CG2 
634  N  N   . MSE A 100 ? 0.4655 0.4278 0.4334 -0.0036 -0.0588 -0.0379 224 MSE A N   
635  C  CA  . MSE A 100 ? 0.4659 0.4276 0.4421 -0.0058 -0.0623 -0.0441 224 MSE A CA  
636  C  C   . MSE A 100 ? 0.4527 0.4255 0.4424 -0.0069 -0.0702 -0.0408 224 MSE A C   
637  O  O   . MSE A 100 ? 0.4666 0.4467 0.4546 -0.0055 -0.0785 -0.0388 224 MSE A O   
638  C  CB  . MSE A 100 ? 0.4830 0.4374 0.4436 -0.0106 -0.0646 -0.0547 224 MSE A CB  
639  C  CG  . MSE A 100 ? 0.5300 0.4745 0.5025 -0.0157 -0.0636 -0.0615 224 MSE A CG  
640  SE SE  . MSE A 100 ? 0.5975 0.5317 0.5568 -0.0265 -0.0689 -0.0823 224 MSE A SE  
641  C  CE  . MSE A 100 ? 0.5209 0.4849 0.4909 -0.0331 -0.0873 -0.0812 224 MSE A CE  
642  N  N   . LEU A 101 ? 0.4355 0.4103 0.4379 -0.0075 -0.0672 -0.0396 225 LEU A N   
643  C  CA  . LEU A 101 ? 0.4264 0.4153 0.4422 -0.0080 -0.0696 -0.0382 225 LEU A CA  
644  C  C   . LEU A 101 ? 0.4298 0.4167 0.4499 -0.0138 -0.0635 -0.0371 225 LEU A C   
645  O  O   . LEU A 101 ? 0.4246 0.3944 0.4370 -0.0144 -0.0593 -0.0349 225 LEU A O   
646  C  CB  . LEU A 101 ? 0.4115 0.4052 0.4320 -0.0013 -0.0689 -0.0358 225 LEU A CB  
647  C  CG  . LEU A 101 ? 0.4423 0.4325 0.4610 0.0020  -0.0649 -0.0348 225 LEU A CG  
648  C  CD1 . LEU A 101 ? 0.4140 0.4048 0.4292 0.0026  -0.0625 -0.0324 225 LEU A CD1 
649  C  CD2 . LEU A 101 ? 0.4201 0.4150 0.4471 0.0048  -0.0660 -0.0376 225 LEU A CD2 
650  N  N   . ASN A 102 ? 0.4199 0.4228 0.4526 -0.0175 -0.0615 -0.0379 226 ASN A N   
651  C  CA  . ASN A 102 ? 0.4302 0.4308 0.4655 -0.0269 -0.0519 -0.0348 226 ASN A CA  
652  C  C   . ASN A 102 ? 0.4412 0.4435 0.4655 -0.0220 -0.0444 -0.0276 226 ASN A C   
653  O  O   . ASN A 102 ? 0.4181 0.4376 0.4465 -0.0158 -0.0451 -0.0320 226 ASN A O   
654  C  CB  . ASN A 102 ? 0.4361 0.4589 0.4955 -0.0373 -0.0515 -0.0425 226 ASN A CB  
655  C  CG  . ASN A 102 ? 0.4882 0.5080 0.5539 -0.0524 -0.0370 -0.0389 226 ASN A CG  
656  O  OD1 . ASN A 102 ? 0.4463 0.4699 0.5052 -0.0526 -0.0247 -0.0316 226 ASN A OD1 
657  N  ND2 . ASN A 102 ? 0.4966 0.5085 0.5736 -0.0669 -0.0371 -0.0448 226 ASN A ND2 
658  N  N   . TYR A 103 ? 0.4693 0.4511 0.4769 -0.0233 -0.0384 -0.0171 227 TYR A N   
659  C  CA  . TYR A 103 ? 0.4739 0.4544 0.4603 -0.0165 -0.0348 -0.0080 227 TYR A CA  
660  C  C   . TYR A 103 ? 0.5169 0.4741 0.4861 -0.0233 -0.0238 0.0076  227 TYR A C   
661  O  O   . TYR A 103 ? 0.5314 0.4637 0.5053 -0.0295 -0.0219 0.0111  227 TYR A O   
662  C  CB  . TYR A 103 ? 0.4526 0.4294 0.4305 -0.0022 -0.0464 -0.0080 227 TYR A CB  
663  C  CG  . TYR A 103 ? 0.4919 0.4759 0.4479 0.0064  -0.0488 -0.0032 227 TYR A CG  
664  C  CD1 . TYR A 103 ? 0.4827 0.4889 0.4360 0.0062  -0.0465 -0.0125 227 TYR A CD1 
665  C  CD2 . TYR A 103 ? 0.5254 0.4945 0.4624 0.0166  -0.0547 0.0092  227 TYR A CD2 
666  C  CE1 . TYR A 103 ? 0.5173 0.5319 0.4441 0.0137  -0.0501 -0.0116 227 TYR A CE1 
667  C  CE2 . TYR A 103 ? 0.5480 0.5269 0.4592 0.0259  -0.0610 0.0135  227 TYR A CE2 
668  C  CZ  . TYR A 103 ? 0.5257 0.5279 0.4297 0.0231  -0.0586 0.0021  227 TYR A CZ  
669  O  OH  . TYR A 103 ? 0.6235 0.6368 0.4968 0.0321  -0.0665 0.0028  227 TYR A OH  
670  N  N   . ASN A 104 ? 0.5266 0.4882 0.4725 -0.0220 -0.0160 0.0170  228 ASN A N   
671  C  CA  . ASN A 104 ? 0.5837 0.5185 0.5033 -0.0277 -0.0034 0.0378  228 ASN A CA  
672  C  C   . ASN A 104 ? 0.6384 0.5659 0.5179 -0.0111 -0.0108 0.0519  228 ASN A C   
673  O  O   . ASN A 104 ? 0.6211 0.5691 0.4786 -0.0090 -0.0067 0.0508  228 ASN A O   
674  C  CB  . ASN A 104 ? 0.5745 0.5238 0.4990 -0.0463 0.0187  0.0387  228 ASN A CB  
675  C  CG  . ASN A 104 ? 0.6021 0.5160 0.5051 -0.0592 0.0367  0.0620  228 ASN A CG  
676  O  OD1 . ASN A 104 ? 0.5793 0.4587 0.4486 -0.0484 0.0321  0.0823  228 ASN A OD1 
677  N  ND2 . ASN A 104 ? 0.5836 0.5056 0.5095 -0.0825 0.0572  0.0597  228 ASN A ND2 
678  N  N   . PRO A 105 ? 0.6942 0.5953 0.5648 0.0025  -0.0233 0.0626  229 PRO A N   
679  C  CA  . PRO A 105 ? 0.7247 0.6215 0.5614 0.0224  -0.0370 0.0759  229 PRO A CA  
680  C  C   . PRO A 105 ? 0.8090 0.6954 0.5961 0.0210  -0.0262 0.0979  229 PRO A C   
681  O  O   . PRO A 105 ? 0.8028 0.7096 0.5589 0.0328  -0.0363 0.0977  229 PRO A O   
682  C  CB  . PRO A 105 ? 0.7479 0.6105 0.5930 0.0347  -0.0460 0.0861  229 PRO A CB  
683  C  CG  . PRO A 105 ? 0.7076 0.5759 0.5961 0.0251  -0.0441 0.0647  229 PRO A CG  
684  C  CD  . PRO A 105 ? 0.6830 0.5610 0.5797 0.0019  -0.0269 0.0586  229 PRO A CD  
685  N  N   . ASP A 106 ? 0.8532 0.7081 0.6314 0.0052  -0.0049 0.1156  230 ASP A N   
686  C  CA  . ASP A 106 ? 0.9489 0.7863 0.6750 0.0019  0.0101  0.1419  230 ASP A CA  
687  C  C   . ASP A 106 ? 0.9435 0.8196 0.6618 -0.0127 0.0291  0.1294  230 ASP A C   
688  O  O   . ASP A 106 ? 0.9715 0.8519 0.6376 -0.0090 0.0360  0.1422  230 ASP A O   
689  C  CB  . ASP A 106 ? 1.0210 0.8038 0.7423 -0.0121 0.0290  0.1674  230 ASP A CB  
690  C  CG  . ASP A 106 ? 1.1043 0.8421 0.8249 0.0079  0.0110  0.1822  230 ASP A CG  
691  O  OD1 . ASP A 106 ? 1.1907 0.9028 0.8645 0.0280  0.0009  0.2096  230 ASP A OD1 
692  O  OD2 . ASP A 106 ? 1.0942 0.8236 0.8600 0.0053  0.0062  0.1655  230 ASP A OD2 
693  N  N   . ASN A 107 ? 0.8727 0.7773 0.6412 -0.0272 0.0369  0.1039  231 ASN A N   
694  C  CA  . ASN A 107 ? 0.8588 0.8036 0.6331 -0.0389 0.0558  0.0877  231 ASN A CA  
695  C  C   . ASN A 107 ? 0.7761 0.7591 0.5969 -0.0344 0.0432  0.0548  231 ASN A C   
696  O  O   . ASN A 107 ? 0.7454 0.7461 0.6105 -0.0475 0.0529  0.0410  231 ASN A O   
697  C  CB  . ASN A 107 ? 0.8774 0.8165 0.6667 -0.0657 0.0878  0.0963  231 ASN A CB  
698  C  CG  . ASN A 107 ? 0.9816 0.8791 0.7172 -0.0727 0.1065  0.1324  231 ASN A CG  
699  O  OD1 . ASN A 107 ? 1.0761 0.9755 0.7541 -0.0634 0.1106  0.1453  231 ASN A OD1 
700  N  ND2 . ASN A 107 ? 0.9516 0.8080 0.7024 -0.0890 0.1175  0.1490  231 ASN A ND2 
701  N  N   . PRO A 108 ? 0.7506 0.7466 0.5620 -0.0161 0.0212  0.0425  232 PRO A N   
702  C  CA  . PRO A 108 ? 0.7078 0.7267 0.5587 -0.0097 0.0061  0.0164  232 PRO A CA  
703  C  C   . PRO A 108 ? 0.7003 0.7502 0.5833 -0.0168 0.0189  -0.0050 232 PRO A C   
704  O  O   . PRO A 108 ? 0.6850 0.7453 0.6040 -0.0127 0.0078  -0.0215 232 PRO A O   
705  C  CB  . PRO A 108 ? 0.7129 0.7409 0.5368 0.0066  -0.0127 0.0088  232 PRO A CB  
706  C  CG  . PRO A 108 ? 0.7419 0.7459 0.5220 0.0139  -0.0181 0.0343  232 PRO A CG  
707  C  CD  . PRO A 108 ? 0.7945 0.7833 0.5533 -0.0006 0.0088  0.0541  232 PRO A CD  
708  N  N   . LYS A 109 ? 0.7518 0.8166 0.6227 -0.0260 0.0429  -0.0041 233 LYS A N   
709  C  CA  . LYS A 109 ? 0.7498 0.8491 0.6586 -0.0298 0.0561  -0.0262 233 LYS A CA  
710  C  C   . LYS A 109 ? 0.7270 0.8326 0.6804 -0.0457 0.0670  -0.0236 233 LYS A C   
711  O  O   . LYS A 109 ? 0.7142 0.8521 0.7108 -0.0473 0.0738  -0.0415 233 LYS A O   
712  C  CB  . LYS A 109 ? 0.7823 0.9038 0.6603 -0.0303 0.0786  -0.0334 233 LYS A CB  
713  C  CG  . LYS A 109 ? 0.8606 0.9801 0.6942 -0.0147 0.0641  -0.0423 233 LYS A CG  
714  C  CD  . LYS A 109 ? 0.9548 1.0897 0.7374 -0.0158 0.0862  -0.0447 233 LYS A CD  
715  C  CE  . LYS A 109 ? 1.0016 1.1731 0.8139 -0.0135 0.1038  -0.0771 233 LYS A CE  
716  N  NZ  . LYS A 109 ? 0.9679 1.1429 0.8228 -0.0001 0.0809  -0.1033 233 LYS A NZ  
717  N  N   . GLU A 110 ? 0.7335 0.8088 0.6792 -0.0563 0.0668  -0.0031 234 GLU A N   
718  C  CA  . GLU A 110 ? 0.7363 0.8150 0.7239 -0.0746 0.0748  -0.0032 234 GLU A CA  
719  C  C   . GLU A 110 ? 0.6788 0.7395 0.6889 -0.0713 0.0507  -0.0062 234 GLU A C   
720  O  O   . GLU A 110 ? 0.6466 0.6854 0.6361 -0.0570 0.0321  -0.0023 234 GLU A O   
721  C  CB  . GLU A 110 ? 0.7887 0.8451 0.7557 -0.0952 0.0999  0.0191  234 GLU A CB  
722  C  CG  . GLU A 110 ? 0.8891 0.9795 0.8631 -0.1096 0.1325  0.0153  234 GLU A CG  
723  C  CD  . GLU A 110 ? 0.9516 1.0875 0.9979 -0.1225 0.1393  -0.0073 234 GLU A CD  
724  O  OE1 . GLU A 110 ? 0.9234 1.0581 1.0076 -0.1233 0.1183  -0.0164 234 GLU A OE1 
725  O  OE2 . GLU A 110 ? 0.9854 1.1616 1.0507 -0.1309 0.1656  -0.0172 234 GLU A OE2 
726  N  N   . ARG A 111 ? 0.6591 0.7349 0.7130 -0.0850 0.0519  -0.0157 235 ARG A N   
727  C  CA  . ARG A 111 ? 0.6364 0.6973 0.7092 -0.0869 0.0332  -0.0203 235 ARG A CA  
728  C  C   . ARG A 111 ? 0.6571 0.6674 0.7000 -0.0907 0.0326  -0.0029 235 ARG A C   
729  O  O   . ARG A 111 ? 0.6937 0.6810 0.7167 -0.1021 0.0509  0.0140  235 ARG A O   
730  C  CB  . ARG A 111 ? 0.6314 0.7215 0.7536 -0.1059 0.0386  -0.0337 235 ARG A CB  
731  C  CG  . ARG A 111 ? 0.7006 0.7902 0.8454 -0.1066 0.0162  -0.0462 235 ARG A CG  
732  C  CD  . ARG A 111 ? 0.7220 0.8525 0.8958 -0.0920 -0.0010 -0.0625 235 ARG A CD  
733  N  NE  . ARG A 111 ? 0.7395 0.8649 0.9183 -0.0887 -0.0251 -0.0708 235 ARG A NE  
734  C  CZ  . ARG A 111 ? 0.6934 0.8354 0.8780 -0.0708 -0.0455 -0.0776 235 ARG A CZ  
735  N  NH1 . ARG A 111 ? 0.6995 0.8615 0.8921 -0.0542 -0.0454 -0.0786 235 ARG A NH1 
736  N  NH2 . ARG A 111 ? 0.6957 0.8308 0.8749 -0.0691 -0.0655 -0.0833 235 ARG A NH2 
737  N  N   . GLY A 112 ? 0.6262 0.6176 0.6650 -0.0800 0.0131  -0.0063 236 GLY A N   
738  C  CA  . GLY A 112 ? 0.6358 0.5804 0.6526 -0.0790 0.0113  0.0063  236 GLY A CA  
739  C  C   . GLY A 112 ? 0.6134 0.5456 0.6461 -0.0807 -0.0019 -0.0070 236 GLY A C   
740  O  O   . GLY A 112 ? 0.5917 0.5387 0.6532 -0.0961 -0.0027 -0.0215 236 GLY A O   
741  N  N   . PHE A 113 ? 0.6002 0.5094 0.6150 -0.0646 -0.0124 -0.0042 237 PHE A N   
742  C  CA  . PHE A 113 ? 0.5952 0.4908 0.6175 -0.0642 -0.0221 -0.0182 237 PHE A CA  
743  C  C   . PHE A 113 ? 0.5485 0.4630 0.5662 -0.0476 -0.0355 -0.0256 237 PHE A C   
744  O  O   . PHE A 113 ? 0.5236 0.4563 0.5353 -0.0370 -0.0378 -0.0201 237 PHE A O   
745  C  CB  . PHE A 113 ? 0.6357 0.4823 0.6456 -0.0613 -0.0177 -0.0108 237 PHE A CB  
746  C  CG  . PHE A 113 ? 0.7050 0.5207 0.7160 -0.0791 -0.0017 0.0013  237 PHE A CG  
747  C  CD1 . PHE A 113 ? 0.7343 0.5374 0.7676 -0.1020 0.0036  -0.0128 237 PHE A CD1 
748  C  CD2 . PHE A 113 ? 0.7050 0.5047 0.6931 -0.0747 0.0084  0.0265  237 PHE A CD2 
749  C  CE1 . PHE A 113 ? 0.7631 0.5346 0.8012 -0.1227 0.0217  -0.0013 237 PHE A CE1 
750  C  CE2 . PHE A 113 ? 0.7938 0.5599 0.7783 -0.0929 0.0268  0.0418  237 PHE A CE2 
751  C  CZ  . PHE A 113 ? 0.7768 0.5275 0.7893 -0.1184 0.0350  0.0281  237 PHE A CZ  
752  N  N   . TRP A 114 ? 0.5330 0.4411 0.5519 -0.0471 -0.0424 -0.0390 238 TRP A N   
753  C  CA  . TRP A 114 ? 0.4890 0.4127 0.5017 -0.0358 -0.0515 -0.0454 238 TRP A CA  
754  C  C   . TRP A 114 ? 0.5120 0.4188 0.5139 -0.0215 -0.0497 -0.0425 238 TRP A C   
755  O  O   . TRP A 114 ? 0.5300 0.4118 0.5290 -0.0203 -0.0463 -0.0485 238 TRP A O   
756  C  CB  . TRP A 114 ? 0.4649 0.3971 0.4795 -0.0437 -0.0598 -0.0618 238 TRP A CB  
757  C  CG  . TRP A 114 ? 0.4532 0.4121 0.4874 -0.0548 -0.0647 -0.0659 238 TRP A CG  
758  C  CD1 . TRP A 114 ? 0.4794 0.4388 0.5334 -0.0726 -0.0606 -0.0723 238 TRP A CD1 
759  C  CD2 . TRP A 114 ? 0.4121 0.4025 0.4548 -0.0486 -0.0728 -0.0640 238 TRP A CD2 
760  N  NE1 . TRP A 114 ? 0.4750 0.4721 0.5527 -0.0775 -0.0662 -0.0764 238 TRP A NE1 
761  C  CE2 . TRP A 114 ? 0.4179 0.4329 0.4884 -0.0607 -0.0745 -0.0711 238 TRP A CE2 
762  C  CE3 . TRP A 114 ? 0.3818 0.3803 0.4147 -0.0342 -0.0780 -0.0576 238 TRP A CE3 
763  C  CZ2 . TRP A 114 ? 0.4008 0.4506 0.4907 -0.0547 -0.0829 -0.0728 238 TRP A CZ2 
764  C  CZ3 . TRP A 114 ? 0.3810 0.4053 0.4288 -0.0292 -0.0859 -0.0576 238 TRP A CZ3 
765  C  CH2 . TRP A 114 ? 0.3839 0.4349 0.4605 -0.0373 -0.0891 -0.0654 238 TRP A CH2 
766  N  N   . TYR A 115 ? 0.4913 0.4138 0.4916 -0.0105 -0.0519 -0.0362 239 TYR A N   
767  C  CA  . TYR A 115 ? 0.5021 0.4199 0.5017 0.0032  -0.0510 -0.0351 239 TYR A CA  
768  C  C   . TYR A 115 ? 0.4970 0.4340 0.4981 0.0061  -0.0520 -0.0405 239 TYR A C   
769  O  O   . TYR A 115 ? 0.4936 0.4448 0.4941 0.0012  -0.0554 -0.0397 239 TYR A O   
770  C  CB  . TYR A 115 ? 0.5035 0.4245 0.5027 0.0124  -0.0533 -0.0228 239 TYR A CB  
771  C  CG  . TYR A 115 ? 0.5034 0.4011 0.4936 0.0106  -0.0501 -0.0108 239 TYR A CG  
772  C  CD1 . TYR A 115 ? 0.5535 0.4222 0.5411 0.0207  -0.0489 -0.0049 239 TYR A CD1 
773  C  CD2 . TYR A 115 ? 0.5565 0.4596 0.5412 -0.0006 -0.0462 -0.0044 239 TYR A CD2 
774  C  CE1 . TYR A 115 ? 0.6111 0.4498 0.5862 0.0187  -0.0444 0.0108  239 TYR A CE1 
775  C  CE2 . TYR A 115 ? 0.5869 0.4661 0.5596 -0.0050 -0.0388 0.0100  239 TYR A CE2 
776  C  CZ  . TYR A 115 ? 0.6115 0.4552 0.5772 0.0041  -0.0382 0.0193  239 TYR A CZ  
777  O  OH  . TYR A 115 ? 0.6604 0.4723 0.6104 -0.0007 -0.0295 0.0378  239 TYR A OH  
778  N  N   . ASP A 116 ? 0.4920 0.4284 0.4973 0.0144  -0.0474 -0.0455 240 ASP A N   
779  C  CA  . ASP A 116 ? 0.4778 0.4329 0.4885 0.0156  -0.0441 -0.0479 240 ASP A CA  
780  C  C   . ASP A 116 ? 0.4624 0.4353 0.4882 0.0198  -0.0492 -0.0427 240 ASP A C   
781  O  O   . ASP A 116 ? 0.4486 0.4223 0.4801 0.0282  -0.0549 -0.0386 240 ASP A O   
782  C  CB  . ASP A 116 ? 0.4945 0.4489 0.5083 0.0210  -0.0336 -0.0577 240 ASP A CB  
783  C  CG  . ASP A 116 ? 0.5595 0.5014 0.5505 0.0142  -0.0288 -0.0665 240 ASP A CG  
784  O  OD1 . ASP A 116 ? 0.6234 0.5605 0.6003 0.0056  -0.0367 -0.0643 240 ASP A OD1 
785  O  OD2 . ASP A 116 ? 0.5710 0.5113 0.5586 0.0180  -0.0176 -0.0776 240 ASP A OD2 
786  N  N   . ALA A 117 ? 0.4270 0.4116 0.4563 0.0137  -0.0482 -0.0428 241 ALA A N   
787  C  CA  . ALA A 117 ? 0.4331 0.4333 0.4768 0.0144  -0.0538 -0.0429 241 ALA A CA  
788  C  C   . ALA A 117 ? 0.4275 0.4348 0.4819 0.0066  -0.0474 -0.0456 241 ALA A C   
789  O  O   . ALA A 117 ? 0.4514 0.4475 0.4930 0.0008  -0.0401 -0.0420 241 ALA A O   
790  C  CB  . ALA A 117 ? 0.4026 0.4002 0.4366 0.0128  -0.0610 -0.0391 241 ALA A CB  
791  N  N   . GLU A 118 ? 0.4290 0.4538 0.5055 0.0060  -0.0509 -0.0517 242 GLU A N   
792  C  CA  . GLU A 118 ? 0.4095 0.4391 0.5031 -0.0048 -0.0442 -0.0556 242 GLU A CA  
793  C  C   . GLU A 118 ? 0.4052 0.4303 0.4991 -0.0078 -0.0527 -0.0589 242 GLU A C   
794  O  O   . GLU A 118 ? 0.3342 0.3726 0.4312 -0.0025 -0.0643 -0.0661 242 GLU A O   
795  C  CB  . GLU A 118 ? 0.4322 0.4903 0.5596 -0.0049 -0.0422 -0.0662 242 GLU A CB  
796  C  CG  . GLU A 118 ? 0.4418 0.5101 0.5980 -0.0204 -0.0326 -0.0733 242 GLU A CG  
797  C  CD  . GLU A 118 ? 0.4716 0.5804 0.6713 -0.0191 -0.0348 -0.0879 242 GLU A CD  
798  O  OE1 . GLU A 118 ? 0.4663 0.5953 0.6736 -0.0062 -0.0539 -0.0945 242 GLU A OE1 
799  O  OE2 . GLU A 118 ? 0.5137 0.6366 0.7406 -0.0308 -0.0174 -0.0924 242 GLU A OE2 
800  N  N   . ILE A 119 ? 0.4004 0.4048 0.4876 -0.0146 -0.0470 -0.0534 243 ILE A N   
801  C  CA  . ILE A 119 ? 0.4088 0.4042 0.5002 -0.0159 -0.0526 -0.0589 243 ILE A CA  
802  C  C   . ILE A 119 ? 0.4169 0.4260 0.5368 -0.0245 -0.0537 -0.0743 243 ILE A C   
803  O  O   . ILE A 119 ? 0.4124 0.4254 0.5524 -0.0354 -0.0441 -0.0758 243 ILE A O   
804  C  CB  . ILE A 119 ? 0.4309 0.3972 0.5114 -0.0175 -0.0478 -0.0480 243 ILE A CB  
805  C  CG1 . ILE A 119 ? 0.4228 0.3846 0.4784 -0.0088 -0.0517 -0.0369 243 ILE A CG1 
806  C  CG2 . ILE A 119 ? 0.3851 0.3401 0.4756 -0.0160 -0.0528 -0.0570 243 ILE A CG2 
807  C  CD1 . ILE A 119 ? 0.5065 0.4440 0.5486 -0.0061 -0.0519 -0.0242 243 ILE A CD1 
808  N  N   . SER A 120 ? 0.4271 0.4459 0.5485 -0.0206 -0.0648 -0.0876 244 SER A N   
809  C  CA  . SER A 120 ? 0.4209 0.4628 0.5651 -0.0259 -0.0728 -0.1072 244 SER A CA  
810  C  C   . SER A 120 ? 0.4564 0.4845 0.6097 -0.0325 -0.0748 -0.1241 244 SER A C   
811  O  O   . SER A 120 ? 0.4659 0.4978 0.6484 -0.0462 -0.0741 -0.1397 244 SER A O   
812  C  CB  . SER A 120 ? 0.3703 0.4370 0.4988 -0.0128 -0.0867 -0.1095 244 SER A CB  
813  O  OG  . SER A 120 ? 0.5220 0.6154 0.6675 -0.0154 -0.0995 -0.1295 244 SER A OG  
814  N  N   . ARG A 121 ? 0.4665 0.4803 0.5985 -0.0231 -0.0763 -0.1236 245 ARG A N   
815  C  CA  . ARG A 121 ? 0.4793 0.4759 0.6183 -0.0251 -0.0764 -0.1412 245 ARG A CA  
816  C  C   . ARG A 121 ? 0.4972 0.4672 0.6242 -0.0152 -0.0701 -0.1282 245 ARG A C   
817  O  O   . ARG A 121 ? 0.5141 0.4925 0.6221 -0.0053 -0.0704 -0.1146 245 ARG A O   
818  C  CB  . ARG A 121 ? 0.5045 0.5252 0.6307 -0.0192 -0.0874 -0.1629 245 ARG A CB  
819  C  CG  . ARG A 121 ? 0.4981 0.5499 0.6367 -0.0263 -0.1001 -0.1807 245 ARG A CG  
820  C  CD  . ARG A 121 ? 0.4928 0.5688 0.6011 -0.0159 -0.1120 -0.1931 245 ARG A CD  
821  N  NE  . ARG A 121 ? 0.6029 0.6690 0.7087 -0.0175 -0.1115 -0.2200 245 ARG A NE  
822  C  CZ  . ARG A 121 ? 0.6042 0.6863 0.6774 -0.0089 -0.1169 -0.2349 245 ARG A CZ  
823  N  NH1 . ARG A 121 ? 0.5538 0.6588 0.5917 0.0013  -0.1234 -0.2203 245 ARG A NH1 
824  N  NH2 . ARG A 121 ? 0.5861 0.6578 0.6597 -0.0103 -0.1142 -0.2639 245 ARG A NH2 
825  N  N   . LYS A 122 ? 0.5523 0.4900 0.6939 -0.0176 -0.0651 -0.1332 246 LYS A N   
826  C  CA  . LYS A 122 ? 0.5878 0.5010 0.7244 -0.0040 -0.0624 -0.1234 246 LYS A CA  
827  C  C   . LYS A 122 ? 0.6425 0.5338 0.7956 -0.0008 -0.0614 -0.1471 246 LYS A C   
828  O  O   . LYS A 122 ? 0.6386 0.4994 0.8108 -0.0117 -0.0574 -0.1541 246 LYS A O   
829  C  CB  . LYS A 122 ? 0.5876 0.4719 0.7209 -0.0055 -0.0570 -0.0957 246 LYS A CB  
830  C  CG  . LYS A 122 ? 0.5972 0.4651 0.7231 0.0121  -0.0599 -0.0817 246 LYS A CG  
831  C  CD  . LYS A 122 ? 0.6306 0.4645 0.7459 0.0114  -0.0567 -0.0542 246 LYS A CD  
832  C  CE  . LYS A 122 ? 0.6380 0.4545 0.7510 0.0327  -0.0646 -0.0431 246 LYS A CE  
833  N  NZ  . LYS A 122 ? 0.7412 0.5192 0.8363 0.0356  -0.0643 -0.0139 246 LYS A NZ  
834  N  N   . ARG A 123 ? 0.4982 0.5222 0.7042 -0.0522 -0.0420 -0.1169 247 ARG A N   
835  C  CA  . ARG A 123 ? 0.5306 0.5532 0.7433 -0.0524 -0.0422 -0.1289 247 ARG A CA  
836  C  C   . ARG A 123 ? 0.5233 0.5388 0.7021 -0.0509 -0.0301 -0.1094 247 ARG A C   
837  O  O   . ARG A 123 ? 0.4948 0.5118 0.6503 -0.0487 -0.0339 -0.0967 247 ARG A O   
838  C  CB  . ARG A 123 ? 0.5683 0.5894 0.7536 -0.0403 -0.0721 -0.1495 247 ARG A CB  
839  C  CG  . ARG A 123 ? 0.6354 0.6657 0.8495 -0.0315 -0.1009 -0.1780 247 ARG A CG  
840  C  CD  . ARG A 123 ? 0.7498 0.7706 0.9498 -0.0073 -0.1371 -0.2153 247 ARG A CD  
841  N  NE  . ARG A 123 ? 0.8292 0.8146 0.9200 0.0217  -0.1471 -0.2038 247 ARG A NE  
842  C  CZ  . ARG A 123 ? 0.9156 0.8673 0.9434 0.0570  -0.1703 -0.2251 247 ARG A CZ  
843  N  NH1 . ARG A 123 ? 0.9291 0.8904 1.0058 0.0628  -0.1964 -0.2651 247 ARG A NH1 
844  N  NH2 . ARG A 123 ? 1.0097 0.9087 0.9235 0.0911  -0.1621 -0.2066 247 ARG A NH2 
845  N  N   . GLU A 124 ? 0.5219 0.5314 0.7120 -0.0516 -0.0173 -0.1127 248 GLU A N   
846  C  CA  . GLU A 124 ? 0.5520 0.5559 0.7231 -0.0469 -0.0065 -0.0988 248 GLU A CA  
847  C  C   . GLU A 124 ? 0.5500 0.5484 0.7273 -0.0484 0.0016  -0.1073 248 GLU A C   
848  O  O   . GLU A 124 ? 0.5240 0.5167 0.7344 -0.0519 0.0112  -0.1205 248 GLU A O   
849  C  CB  . GLU A 124 ? 0.5549 0.5413 0.7174 -0.0336 0.0094  -0.0856 248 GLU A CB  
850  C  CG  . GLU A 124 ? 0.6130 0.5925 0.7538 -0.0171 0.0078  -0.0795 248 GLU A CG  
851  C  CD  . GLU A 124 ? 0.6880 0.6391 0.7877 0.0150  0.0062  -0.0715 248 GLU A CD  
852  O  OE1 . GLU A 124 ? 0.7719 0.7001 0.8539 0.0232  0.0193  -0.0637 248 GLU A OE1 
853  O  OE2 . GLU A 124 ? 0.7780 0.7244 0.8597 0.0390  -0.0102 -0.0760 248 GLU A OE2 
854  N  N   . THR A 125 ? 0.5599 0.5572 0.7170 -0.0457 0.0020  -0.1020 249 THR A N   
855  C  CA  . THR A 125 ? 0.5511 0.5388 0.7065 -0.0439 0.0133  -0.1056 249 THR A CA  
856  C  C   . THR A 125 ? 0.5211 0.5118 0.6830 -0.0385 0.0239  -0.0929 249 THR A C   
857  O  O   . THR A 125 ? 0.5222 0.5186 0.6871 -0.0311 0.0162  -0.0879 249 THR A O   
858  C  CB  . THR A 125 ? 0.5842 0.5544 0.7036 -0.0357 0.0114  -0.1108 249 THR A CB  
859  O  OG1 . THR A 125 ? 0.6164 0.5815 0.7234 -0.0327 0.0216  -0.0961 249 THR A OG1 
860  C  CG2 . THR A 125 ? 0.6269 0.5874 0.7290 -0.0258 -0.0138 -0.1350 249 THR A CG2 
861  N  N   . ARG A 126 ? 0.5239 0.5081 0.6857 -0.0360 0.0360  -0.0923 250 ARG A N   
862  C  CA  . ARG A 126 ? 0.5040 0.4941 0.6809 -0.0253 0.0384  -0.0874 250 ARG A CA  
863  C  C   . ARG A 126 ? 0.4973 0.5053 0.7096 -0.0248 0.0296  -0.0901 250 ARG A C   
864  O  O   . ARG A 126 ? 0.4983 0.5195 0.7394 -0.0103 0.0124  -0.0987 250 ARG A O   
865  C  CB  . ARG A 126 ? 0.5115 0.4919 0.6885 -0.0239 0.0557  -0.0869 250 ARG A CB  
866  C  CG  . ARG A 126 ? 0.5053 0.4673 0.6688 -0.0227 0.0687  -0.0883 250 ARG A CG  
867  C  CD  . ARG A 126 ? 0.4906 0.4445 0.6546 -0.0173 0.0836  -0.0865 250 ARG A CD  
868  N  NE  . ARG A 126 ? 0.5307 0.4628 0.6908 -0.0178 0.1023  -0.0899 250 ARG A NE  
869  C  CZ  . ARG A 126 ? 0.4592 0.3702 0.6122 -0.0036 0.1210  -0.0817 250 ARG A CZ  
870  N  NH1 . ARG A 126 ? 0.4019 0.2888 0.5668 -0.0070 0.1482  -0.0857 250 ARG A NH1 
871  N  NH2 . ARG A 126 ? 0.4456 0.3507 0.5750 0.0206  0.1137  -0.0718 250 ARG A NH2 
872  N  N   . THR A 127 ? 0.4967 0.4986 0.7093 -0.0345 0.0419  -0.0869 251 THR A N   
873  C  CA  . THR A 127 ? 0.5126 0.5218 0.7808 -0.0367 0.0534  -0.0891 251 THR A CA  
874  C  C   . THR A 127 ? 0.5260 0.5333 0.7918 -0.0419 0.0504  -0.0873 251 THR A C   
875  O  O   . THR A 127 ? 0.5403 0.5587 0.8723 -0.0449 0.0555  -0.0948 251 THR A O   
876  C  CB  . THR A 127 ? 0.5406 0.5226 0.8157 -0.0360 0.0963  -0.0803 251 THR A CB  
877  O  OG1 . THR A 127 ? 0.5842 0.5274 0.7713 -0.0287 0.1070  -0.0706 251 THR A OG1 
878  C  CG2 . THR A 127 ? 0.5387 0.5317 0.8469 -0.0317 0.0991  -0.0857 251 THR A CG2 
879  N  N   . ALA A 128 ? 0.5331 0.5279 0.7365 -0.0420 0.0408  -0.0822 252 ALA A N   
880  C  CA  . ALA A 128 ? 0.5280 0.5177 0.7192 -0.0435 0.0373  -0.0795 252 ALA A CA  
881  C  C   . ALA A 128 ? 0.4965 0.5050 0.6770 -0.0456 0.0057  -0.0847 252 ALA A C   
882  O  O   . ALA A 128 ? 0.4980 0.5102 0.6670 -0.0440 -0.0035 -0.0875 252 ALA A O   
883  C  CB  . ALA A 128 ? 0.5606 0.5077 0.6834 -0.0309 0.0553  -0.0717 252 ALA A CB  
884  N  N   . ARG A 129 ? 0.4853 0.4984 0.6746 -0.0477 -0.0014 -0.0844 253 ARG A N   
885  C  CA  . ARG A 129 ? 0.4702 0.4926 0.6463 -0.0469 -0.0236 -0.0863 253 ARG A CA  
886  C  C   . ARG A 129 ? 0.4942 0.5058 0.6474 -0.0483 -0.0216 -0.0824 253 ARG A C   
887  O  O   . ARG A 129 ? 0.5181 0.5167 0.6819 -0.0482 -0.0030 -0.0777 253 ARG A O   
888  C  CB  . ARG A 129 ? 0.4625 0.4982 0.6687 -0.0382 -0.0429 -0.0947 253 ARG A CB  
889  C  CG  . ARG A 129 ? 0.4510 0.4855 0.6554 -0.0218 -0.0511 -0.1001 253 ARG A CG  
890  C  CD  . ARG A 129 ? 0.4705 0.5086 0.6897 0.0044  -0.0839 -0.1184 253 ARG A CD  
891  N  NE  . ARG A 129 ? 0.4773 0.5390 0.7772 -0.0034 -0.0949 -0.1389 253 ARG A NE  
892  C  CZ  . ARG A 129 ? 0.4881 0.5593 0.8249 0.0158  -0.1324 -0.1664 253 ARG A CZ  
893  N  NH1 . ARG A 129 ? 0.4814 0.5314 0.7528 0.0532  -0.1664 -0.1738 253 ARG A NH1 
894  N  NH2 . ARG A 129 ? 0.4501 0.5440 0.8918 0.0022  -0.1321 -0.1891 253 ARG A NH2 
895  N  N   . GLU A 130 ? 0.4899 0.5014 0.6189 -0.0467 -0.0352 -0.0857 254 GLU A N   
896  C  CA  . GLU A 130 ? 0.5320 0.5324 0.6331 -0.0409 -0.0410 -0.0856 254 GLU A CA  
897  C  C   . GLU A 130 ? 0.4902 0.5053 0.6043 -0.0447 -0.0564 -0.0880 254 GLU A C   
898  O  O   . GLU A 130 ? 0.4582 0.4809 0.5922 -0.0469 -0.0592 -0.0942 254 GLU A O   
899  C  CB  . GLU A 130 ? 0.5654 0.5438 0.6216 -0.0235 -0.0489 -0.0966 254 GLU A CB  
900  C  CG  . GLU A 130 ? 0.6846 0.6220 0.6929 -0.0064 -0.0231 -0.0871 254 GLU A CG  
901  C  CD  . GLU A 130 ? 0.8201 0.7163 0.7488 0.0303  -0.0394 -0.1015 254 GLU A CD  
902  O  OE1 . GLU A 130 ? 1.0000 0.8381 0.8567 0.0588  -0.0103 -0.0884 254 GLU A OE1 
903  O  OE2 . GLU A 130 ? 0.9053 0.8198 0.8448 0.0372  -0.0804 -0.1297 254 GLU A OE2 
904  N  N   . LEU A 131 ? 0.4919 0.5041 0.5997 -0.0443 -0.0576 -0.0821 255 LEU A N   
905  C  CA  . LEU A 131 ? 0.4540 0.4740 0.5676 -0.0451 -0.0685 -0.0819 255 LEU A CA  
906  C  C   . LEU A 131 ? 0.4532 0.4638 0.5412 -0.0380 -0.0748 -0.0828 255 LEU A C   
907  O  O   . LEU A 131 ? 0.4645 0.4555 0.5294 -0.0325 -0.0623 -0.0752 255 LEU A O   
908  C  CB  . LEU A 131 ? 0.4566 0.4792 0.5834 -0.0445 -0.0717 -0.0784 255 LEU A CB  
909  C  CG  . LEU A 131 ? 0.4542 0.4710 0.5696 -0.0365 -0.0788 -0.0756 255 LEU A CG  
910  C  CD1 . LEU A 131 ? 0.4460 0.4505 0.5571 -0.0289 -0.0651 -0.0720 255 LEU A CD1 
911  C  CD2 . LEU A 131 ? 0.4173 0.4298 0.5342 -0.0251 -0.0945 -0.0816 255 LEU A CD2 
912  N  N   . TYR A 132 ? 0.4450 0.4638 0.5427 -0.0346 -0.0890 -0.0932 256 TYR A N   
913  C  CA  . TYR A 132 ? 0.4500 0.4613 0.5237 -0.0223 -0.1021 -0.0974 256 TYR A CA  
914  C  C   . TYR A 132 ? 0.4241 0.4469 0.5252 -0.0296 -0.1022 -0.0933 256 TYR A C   
915  O  O   . TYR A 132 ? 0.3918 0.4214 0.5288 -0.0370 -0.0916 -0.0928 256 TYR A O   
916  C  CB  . TYR A 132 ? 0.4853 0.4948 0.5532 -0.0018 -0.1290 -0.1246 256 TYR A CB  
917  C  CG  . TYR A 132 ? 0.5203 0.5012 0.5327 0.0188  -0.1302 -0.1288 256 TYR A CG  
918  C  CD1 . TYR A 132 ? 0.5316 0.5195 0.5666 0.0086  -0.1223 -0.1323 256 TYR A CD1 
919  C  CD2 . TYR A 132 ? 0.5754 0.5103 0.5000 0.0556  -0.1343 -0.1274 256 TYR A CD2 
920  C  CE1 . TYR A 132 ? 0.5875 0.5424 0.5650 0.0310  -0.1203 -0.1351 256 TYR A CE1 
921  C  CE2 . TYR A 132 ? 0.6412 0.5308 0.4940 0.0855  -0.1275 -0.1280 256 TYR A CE2 
922  C  CZ  . TYR A 132 ? 0.6400 0.5425 0.5229 0.0711  -0.1215 -0.1324 256 TYR A CZ  
923  O  OH  . TYR A 132 ? 0.7646 0.6162 0.5706 0.1035  -0.1116 -0.1317 256 TYR A OH  
924  N  N   . ALA A 133 ? 0.4237 0.4377 0.4992 -0.0228 -0.1067 -0.0878 257 ALA A N   
925  C  CA  . ALA A 133 ? 0.3833 0.4028 0.4767 -0.0260 -0.1062 -0.0837 257 ALA A CA  
926  C  C   . ALA A 133 ? 0.4170 0.4315 0.4900 -0.0115 -0.1215 -0.0899 257 ALA A C   
927  O  O   . ALA A 133 ? 0.4583 0.4509 0.4795 0.0048  -0.1249 -0.0883 257 ALA A O   
928  C  CB  . ALA A 133 ? 0.3587 0.3690 0.4404 -0.0319 -0.0955 -0.0683 257 ALA A CB  
929  N  N   . ASN A 134 ? 0.4221 0.4479 0.5318 -0.0117 -0.1252 -0.0960 258 ASN A N   
930  C  CA  . ASN A 134 ? 0.4299 0.4511 0.5215 0.0023  -0.1388 -0.0990 258 ASN A CA  
931  C  C   . ASN A 134 ? 0.4331 0.4378 0.4919 -0.0052 -0.1214 -0.0745 258 ASN A C   
932  O  O   . ASN A 134 ? 0.4394 0.4432 0.5158 -0.0137 -0.1079 -0.0653 258 ASN A O   
933  C  CB  . ASN A 134 ? 0.4135 0.4569 0.5820 0.0046  -0.1478 -0.1211 258 ASN A CB  
934  C  CG  . ASN A 134 ? 0.4517 0.5168 0.6884 0.0090  -0.1669 -0.1568 258 ASN A CG  
935  O  OD1 . ASN A 134 ? 0.4879 0.5474 0.6846 0.0279  -0.1953 -0.1736 258 ASN A OD1 
936  N  ND2 . ASN A 134 ? 0.4256 0.5065 0.7654 -0.0047 -0.1457 -0.1692 258 ASN A ND2 
937  N  N   . VAL A 135 ? 0.5007 0.5837 0.5210 -0.0182 -0.0523 -0.0705 259 VAL A N   
938  C  CA  . VAL A 135 ? 0.4916 0.5355 0.4986 -0.0097 -0.0466 -0.0596 259 VAL A CA  
939  C  C   . VAL A 135 ? 0.5243 0.5696 0.5285 0.0224  -0.0614 -0.0641 259 VAL A C   
940  O  O   . VAL A 135 ? 0.5403 0.5804 0.5242 0.0448  -0.0793 -0.0622 259 VAL A O   
941  C  CB  . VAL A 135 ? 0.5021 0.4945 0.4748 -0.0175 -0.0398 -0.0420 259 VAL A CB  
942  C  CG1 . VAL A 135 ? 0.4840 0.4329 0.4441 -0.0141 -0.0365 -0.0324 259 VAL A CG1 
943  C  CG2 . VAL A 135 ? 0.4852 0.4819 0.4673 -0.0415 -0.0256 -0.0425 259 VAL A CG2 
944  N  N   . VAL A 136 ? 0.4957 0.5457 0.5157 0.0281  -0.0555 -0.0713 260 VAL A N   
945  C  CA  . VAL A 136 ? 0.5691 0.6172 0.5870 0.0636  -0.0687 -0.0803 260 VAL A CA  
946  C  C   . VAL A 136 ? 0.6426 0.6073 0.6172 0.0745  -0.0744 -0.0656 260 VAL A C   
947  O  O   . VAL A 136 ? 0.6185 0.5480 0.5864 0.0558  -0.0627 -0.0603 260 VAL A O   
948  C  CB  . VAL A 136 ? 0.5660 0.6602 0.6168 0.0664  -0.0576 -0.0990 260 VAL A CB  
949  C  CG1 . VAL A 136 ? 0.5449 0.6462 0.5971 0.1113  -0.0722 -0.1150 260 VAL A CG1 
950  C  CG2 . VAL A 136 ? 0.5367 0.7077 0.6281 0.0435  -0.0468 -0.1099 260 VAL A CG2 
951  N  N   . LEU A 137 ? 0.7307 0.6608 0.6736 0.1037  -0.0943 -0.0590 261 LEU A N   
952  C  CA  . LEU A 137 ? 0.8414 0.6786 0.7347 0.1058  -0.0983 -0.0401 261 LEU A CA  
953  C  C   . LEU A 137 ? 0.9378 0.7247 0.8017 0.1507  -0.1214 -0.0439 261 LEU A C   
954  O  O   . LEU A 137 ? 1.0256 0.7570 0.8413 0.1706  -0.1388 -0.0273 261 LEU A O   
955  C  CB  . LEU A 137 ? 0.8693 0.6717 0.7260 0.0829  -0.0929 -0.0152 261 LEU A CB  
956  C  CG  . LEU A 137 ? 0.9241 0.7065 0.7365 0.1036  -0.1104 -0.0015 261 LEU A CG  
957  C  CD1 . LEU A 137 ? 0.9245 0.7071 0.7191 0.0706  -0.0933 0.0140  261 LEU A CD1 
958  C  CD2 . LEU A 137 ? 0.9730 0.8237 0.8105 0.1376  -0.1326 -0.0215 261 LEU A CD2 
959  N  N   . GLY A 138 ? 0.9499 0.7502 0.8361 0.1692  -0.1220 -0.0658 262 GLY A N   
960  C  CA  . GLY A 138 ? 1.0608 0.8007 0.9160 0.2145  -0.1438 -0.0730 262 GLY A CA  
961  C  C   . GLY A 138 ? 1.0943 0.8940 0.9701 0.2673  -0.1655 -0.0934 262 GLY A C   
962  O  O   . GLY A 138 ? 1.0941 0.9554 1.0099 0.2909  -0.1635 -0.1227 262 GLY A O   
963  N  N   . ASP A 139 ? 1.1484 0.9370 0.9974 0.2865  -0.1862 -0.0793 263 ASP A N   
964  C  CA  . ASP A 139 ? 1.1818 1.0266 1.0487 0.3425  -0.2144 -0.0992 263 ASP A CA  
965  C  C   . ASP A 139 ? 1.1085 1.0775 1.0342 0.3292  -0.2112 -0.1133 263 ASP A C   
966  O  O   . ASP A 139 ? 1.1047 1.1595 1.0744 0.3667  -0.2278 -0.1403 263 ASP A O   
967  C  CB  . ASP A 139 ? 1.2921 1.0417 1.0847 0.3820  -0.2477 -0.0774 263 ASP A CB  
968  N  N   . ASP A 140 ? 1.0487 1.0293 0.9780 0.2759  -0.1906 -0.0979 264 ASP A N   
969  C  CA  . ASP A 140 ? 0.9977 1.0733 0.9692 0.2599  -0.1918 -0.1090 264 ASP A CA  
970  C  C   . ASP A 140 ? 0.9089 1.0054 0.9022 0.1996  -0.1602 -0.1029 264 ASP A C   
971  O  O   . ASP A 140 ? 0.9000 0.9629 0.8914 0.1737  -0.1369 -0.0960 264 ASP A O   
972  C  CB  . ASP A 140 ? 1.0660 1.1153 0.9901 0.2817  -0.2214 -0.0951 264 ASP A CB  
973  C  CG  . ASP A 140 ? 1.0675 1.2258 1.0404 0.3034  -0.2454 -0.1222 264 ASP A CG  
974  O  OD1 . ASP A 140 ? 1.0291 1.2462 1.0318 0.2664  -0.2368 -0.1293 264 ASP A OD1 
975  O  OD2 . ASP A 140 ? 1.1303 1.3149 1.1119 0.3588  -0.2752 -0.1385 264 ASP A OD2 
976  N  N   . SER A 141 ? 0.8693 1.0188 0.8807 0.1803  -0.1632 -0.1075 265 SER A N   
977  C  CA  . SER A 141 ? 0.7857 0.9521 0.8151 0.1291  -0.1385 -0.1046 265 SER A CA  
978  C  C   . SER A 141 ? 0.7805 0.9205 0.7707 0.1171  -0.1466 -0.0917 265 SER A C   
979  O  O   . SER A 141 ? 0.8054 0.9645 0.7815 0.1414  -0.1734 -0.0972 265 SER A O   
980  C  CB  . SER A 141 ? 0.7361 1.0022 0.8342 0.1120  -0.1305 -0.1307 265 SER A CB  
981  O  OG  . SER A 141 ? 0.7173 0.9865 0.8267 0.0640  -0.1083 -0.1270 265 SER A OG  
982  N  N   . LEU A 142 ? 0.7216 0.8207 0.6925 0.0828  -0.1245 -0.0767 266 LEU A N   
983  C  CA  . LEU A 142 ? 0.7108 0.7856 0.6426 0.0707  -0.1258 -0.0668 266 LEU A CA  
984  C  C   . LEU A 142 ? 0.6508 0.7622 0.6146 0.0351  -0.1119 -0.0801 266 LEU A C   
985  O  O   . LEU A 142 ? 0.5963 0.6926 0.5731 0.0101  -0.0891 -0.0756 266 LEU A O   
986  C  CB  . LEU A 142 ? 0.7519 0.7479 0.6323 0.0635  -0.1106 -0.0397 266 LEU A CB  
987  C  CG  . LEU A 142 ? 0.8390 0.7968 0.6592 0.0604  -0.1100 -0.0233 266 LEU A CG  
988  C  CD1 . LEU A 142 ? 0.9232 0.8706 0.6975 0.0962  -0.1408 -0.0193 266 LEU A CD1 
989  C  CD2 . LEU A 142 ? 0.8978 0.7911 0.6856 0.0446  -0.0878 0.0016  266 LEU A CD2 
990  N  N   . ASN A 143 ? 0.6410 0.7964 0.6147 0.0342  -0.1292 -0.0978 267 ASN A N   
991  C  CA  . ASN A 143 ? 0.6079 0.7923 0.6111 0.0002  -0.1209 -0.1140 267 ASN A CA  
992  C  C   . ASN A 143 ? 0.6070 0.7487 0.5708 -0.0152 -0.1114 -0.1088 267 ASN A C   
993  O  O   . ASN A 143 ? 0.6238 0.7367 0.5361 0.0008  -0.1187 -0.0997 267 ASN A O   
994  C  CB  . ASN A 143 ? 0.6093 0.8659 0.6494 0.0001  -0.1446 -0.1411 267 ASN A CB  
995  C  CG  . ASN A 143 ? 0.6065 0.9269 0.7034 0.0087  -0.1467 -0.1531 267 ASN A CG  
996  O  OD1 . ASN A 143 ? 0.6657 1.0538 0.7945 0.0219  -0.1699 -0.1741 267 ASN A OD1 
997  N  ND2 . ASN A 143 ? 0.5867 0.8919 0.6971 0.0032  -0.1231 -0.1426 267 ASN A ND2 
998  N  N   . ASP A 144 ? 0.5925 0.7287 0.5769 -0.0442 -0.0946 -0.1146 268 ASP A N   
999  C  CA  . ASP A 144 ? 0.6130 0.7171 0.5694 -0.0566 -0.0872 -0.1185 268 ASP A CA  
1000 C  C   . ASP A 144 ? 0.6154 0.6763 0.5312 -0.0459 -0.0711 -0.0984 268 ASP A C   
1001 O  O   . ASP A 144 ? 0.6385 0.6846 0.5113 -0.0380 -0.0726 -0.0995 268 ASP A O   
1002 C  CB  . ASP A 144 ? 0.6572 0.7803 0.5958 -0.0545 -0.1103 -0.1398 268 ASP A CB  
1003 C  CG  . ASP A 144 ? 0.7201 0.8160 0.6424 -0.0717 -0.1050 -0.1551 268 ASP A CG  
1004 O  OD1 . ASP A 144 ? 0.6754 0.7561 0.6233 -0.0938 -0.0925 -0.1581 268 ASP A OD1 
1005 O  OD2 . ASP A 144 ? 0.7256 0.8108 0.6034 -0.0605 -0.1146 -0.1647 268 ASP A OD2 
1006 N  N   . CYS A 145 ? 0.5596 0.6044 0.4882 -0.0472 -0.0551 -0.0817 269 CYS A N   
1007 C  CA  . CYS A 145 ? 0.5626 0.5747 0.4642 -0.0451 -0.0372 -0.0644 269 CYS A CA  
1008 C  C   . CYS A 145 ? 0.5432 0.5478 0.4574 -0.0583 -0.0211 -0.0705 269 CYS A C   
1009 O  O   . CYS A 145 ? 0.5628 0.5701 0.5086 -0.0688 -0.0191 -0.0754 269 CYS A O   
1010 C  CB  . CYS A 145 ? 0.5473 0.5434 0.4559 -0.0414 -0.0311 -0.0467 269 CYS A CB  
1011 S  SG  . CYS A 145 ? 0.6359 0.6293 0.5293 -0.0169 -0.0523 -0.0399 269 CYS A SG  
1012 N  N   . ARG A 146 ? 0.5681 0.5631 0.4538 -0.0554 -0.0095 -0.0700 270 ARG A N   
1013 C  CA  . ARG A 146 ? 0.5505 0.5423 0.4477 -0.0595 0.0050  -0.0783 270 ARG A CA  
1014 C  C   . ARG A 146 ? 0.5401 0.5318 0.4613 -0.0646 0.0196  -0.0641 270 ARG A C   
1015 O  O   . ARG A 146 ? 0.5368 0.5274 0.4447 -0.0668 0.0316  -0.0495 270 ARG A O   
1016 C  CB  . ARG A 146 ? 0.5831 0.5762 0.4431 -0.0513 0.0145  -0.0867 270 ARG A CB  
1017 C  CG  . ARG A 146 ? 0.5813 0.5789 0.4543 -0.0475 0.0304  -0.0985 270 ARG A CG  
1018 C  CD  . ARG A 146 ? 0.6021 0.5825 0.4877 -0.0454 0.0172  -0.1202 270 ARG A CD  
1019 N  NE  . ARG A 146 ? 0.6479 0.6291 0.5429 -0.0328 0.0290  -0.1328 270 ARG A NE  
1020 C  CZ  . ARG A 146 ? 0.7080 0.6928 0.5782 -0.0173 0.0365  -0.1529 270 ARG A CZ  
1021 N  NH1 . ARG A 146 ? 0.7545 0.7380 0.5825 -0.0149 0.0328  -0.1622 270 ARG A NH1 
1022 N  NH2 . ARG A 146 ? 0.7098 0.7016 0.5960 -0.0004 0.0460  -0.1663 270 ARG A NH2 
1023 N  N   . ILE A 147 ? 0.4959 0.4858 0.4485 -0.0688 0.0175  -0.0682 271 ILE A N   
1024 C  CA  . ILE A 147 ? 0.4925 0.4857 0.4693 -0.0727 0.0256  -0.0593 271 ILE A CA  
1025 C  C   . ILE A 147 ? 0.5406 0.5476 0.5278 -0.0671 0.0376  -0.0679 271 ILE A C   
1026 O  O   . ILE A 147 ? 0.5653 0.5660 0.5534 -0.0575 0.0335  -0.0826 271 ILE A O   
1027 C  CB  . ILE A 147 ? 0.4651 0.4508 0.4628 -0.0767 0.0160  -0.0589 271 ILE A CB  
1028 C  CG1 . ILE A 147 ? 0.4438 0.4306 0.4382 -0.0796 0.0061  -0.0566 271 ILE A CG1 
1029 C  CG2 . ILE A 147 ? 0.4567 0.4462 0.4748 -0.0791 0.0198  -0.0523 271 ILE A CG2 
1030 C  CD1 . ILE A 147 ? 0.4295 0.4157 0.4124 -0.0749 0.0051  -0.0458 271 ILE A CD1 
1031 N  N   . ILE A 148 ? 0.5518 0.5774 0.5469 -0.0731 0.0524  -0.0600 272 ILE A N   
1032 C  CA  . ILE A 148 ? 0.5851 0.6426 0.5973 -0.0679 0.0675  -0.0703 272 ILE A CA  
1033 C  C   . ILE A 148 ? 0.5669 0.6371 0.6193 -0.0637 0.0597  -0.0760 272 ILE A C   
1034 O  O   . ILE A 148 ? 0.5809 0.6654 0.6484 -0.0460 0.0579  -0.0917 272 ILE A O   
1035 C  CB  . ILE A 148 ? 0.6068 0.6860 0.6111 -0.0837 0.0907  -0.0586 272 ILE A CB  
1036 C  CG1 . ILE A 148 ? 0.6642 0.7290 0.6158 -0.0822 0.0979  -0.0531 272 ILE A CG1 
1037 C  CG2 . ILE A 148 ? 0.6063 0.7380 0.6466 -0.0836 0.1093  -0.0704 272 ILE A CG2 
1038 C  CD1 . ILE A 148 ? 0.6249 0.7026 0.5577 -0.0634 0.1021  -0.0745 272 ILE A CD1 
1039 N  N   . PHE A 149 ? 0.5488 0.6093 0.6129 -0.0758 0.0520  -0.0647 273 PHE A N   
1040 C  CA  . PHE A 149 ? 0.5278 0.6021 0.6247 -0.0735 0.0423  -0.0691 273 PHE A CA  
1041 C  C   . PHE A 149 ? 0.5090 0.5527 0.5964 -0.0612 0.0236  -0.0711 273 PHE A C   
1042 O  O   . PHE A 149 ? 0.5221 0.5483 0.6056 -0.0670 0.0137  -0.0640 273 PHE A O   
1043 C  CB  . PHE A 149 ? 0.5144 0.5939 0.6251 -0.0945 0.0445  -0.0596 273 PHE A CB  
1044 C  CG  . PHE A 149 ? 0.5538 0.6569 0.6690 -0.1128 0.0662  -0.0547 273 PHE A CG  
1045 C  CD1 . PHE A 149 ? 0.5682 0.6402 0.6469 -0.1253 0.0749  -0.0386 273 PHE A CD1 
1046 C  CD2 . PHE A 149 ? 0.5489 0.7077 0.7016 -0.1153 0.0790  -0.0665 273 PHE A CD2 
1047 C  CE1 . PHE A 149 ? 0.5976 0.6827 0.6682 -0.1447 0.0978  -0.0298 273 PHE A CE1 
1048 C  CE2 . PHE A 149 ? 0.5418 0.7278 0.6970 -0.1376 0.1053  -0.0608 273 PHE A CE2 
1049 C  CZ  . PHE A 149 ? 0.5874 0.7312 0.6968 -0.1543 0.1157  -0.0403 273 PHE A CZ  
1050 N  N   . VAL A 150 ? 0.5138 0.5490 0.5936 -0.0439 0.0203  -0.0818 274 VAL A N   
1051 C  CA  . VAL A 150 ? 0.5341 0.5259 0.5922 -0.0365 0.0059  -0.0817 274 VAL A CA  
1052 C  C   . VAL A 150 ? 0.5426 0.5219 0.6052 -0.0257 -0.0100 -0.0798 274 VAL A C   
1053 O  O   . VAL A 150 ? 0.5451 0.4813 0.5816 -0.0267 -0.0197 -0.0729 274 VAL A O   
1054 C  CB  . VAL A 150 ? 0.5601 0.5344 0.6006 -0.0234 0.0070  -0.0954 274 VAL A CB  
1055 C  CG1 . VAL A 150 ? 0.5793 0.5329 0.6187 0.0034  -0.0055 -0.1074 274 VAL A CG1 
1056 C  CG2 . VAL A 150 ? 0.5727 0.5171 0.5873 -0.0383 0.0050  -0.0920 274 VAL A CG2 
1057 N  N   . ASP A 151 ? 0.5143 0.5330 0.6080 -0.0176 -0.0126 -0.0855 275 ASP A N   
1058 C  CA  . ASP A 151 ? 0.5214 0.5356 0.6185 -0.0031 -0.0321 -0.0860 275 ASP A CA  
1059 C  C   . ASP A 151 ? 0.5094 0.5388 0.6161 -0.0202 -0.0358 -0.0794 275 ASP A C   
1060 O  O   . ASP A 151 ? 0.5000 0.5335 0.6093 -0.0099 -0.0538 -0.0816 275 ASP A O   
1061 C  CB  . ASP A 151 ? 0.5424 0.5951 0.6709 0.0253  -0.0397 -0.1038 275 ASP A CB  
1062 C  CG  . ASP A 151 ? 0.6194 0.6363 0.7259 0.0521  -0.0443 -0.1128 275 ASP A CG  
1063 O  OD1 . ASP A 151 ? 0.6691 0.6200 0.7344 0.0600  -0.0591 -0.1039 275 ASP A OD1 
1064 O  OD2 . ASP A 151 ? 0.6210 0.6716 0.7469 0.0642  -0.0320 -0.1291 275 ASP A OD2 
1065 N  N   . GLU A 152 ? 0.4977 0.5299 0.6039 -0.0434 -0.0215 -0.0727 276 GLU A N   
1066 C  CA  . GLU A 152 ? 0.5080 0.5451 0.6191 -0.0586 -0.0248 -0.0696 276 GLU A CA  
1067 C  C   . GLU A 152 ? 0.4965 0.5006 0.5774 -0.0687 -0.0205 -0.0593 276 GLU A C   
1068 O  O   . GLU A 152 ? 0.5055 0.5090 0.5878 -0.0816 -0.0137 -0.0566 276 GLU A O   
1069 C  CB  . GLU A 152 ? 0.4971 0.5700 0.6407 -0.0757 -0.0137 -0.0739 276 GLU A CB  
1070 C  CG  . GLU A 152 ? 0.5426 0.6681 0.7280 -0.0683 -0.0144 -0.0879 276 GLU A CG  
1071 C  CD  . GLU A 152 ? 0.6271 0.7887 0.8410 -0.0932 0.0055  -0.0890 276 GLU A CD  
1072 O  OE1 . GLU A 152 ? 0.6615 0.8062 0.8711 -0.1174 0.0078  -0.0823 276 GLU A OE1 
1073 O  OE2 . GLU A 152 ? 0.6616 0.8647 0.8982 -0.0889 0.0200  -0.0967 276 GLU A OE2 
1074 N  N   . VAL A 153 ? 0.4666 0.4430 0.5201 -0.0626 -0.0241 -0.0540 277 VAL A N   
1075 C  CA  . VAL A 153 ? 0.4485 0.4080 0.4804 -0.0720 -0.0184 -0.0472 277 VAL A CA  
1076 C  C   . VAL A 153 ? 0.4834 0.4319 0.4946 -0.0699 -0.0266 -0.0452 277 VAL A C   
1077 O  O   . VAL A 153 ? 0.4795 0.4096 0.4706 -0.0615 -0.0359 -0.0414 277 VAL A O   
1078 C  CB  . VAL A 153 ? 0.4782 0.4193 0.4946 -0.0753 -0.0129 -0.0435 277 VAL A CB  
1079 C  CG1 . VAL A 153 ? 0.4663 0.4055 0.4693 -0.0871 -0.0062 -0.0391 277 VAL A CG1 
1080 C  CG2 . VAL A 153 ? 0.4151 0.3666 0.4438 -0.0751 -0.0063 -0.0486 277 VAL A CG2 
1081 N  N   . PHE A 154 ? 0.4787 0.4334 0.4884 -0.0746 -0.0242 -0.0482 278 PHE A N   
1082 C  CA  . PHE A 154 ? 0.4890 0.4368 0.4748 -0.0714 -0.0302 -0.0503 278 PHE A CA  
1083 C  C   . PHE A 154 ? 0.4968 0.4397 0.4564 -0.0763 -0.0177 -0.0447 278 PHE A C   
1084 O  O   . PHE A 154 ? 0.4696 0.4252 0.4407 -0.0819 -0.0060 -0.0452 278 PHE A O   
1085 C  CB  . PHE A 154 ? 0.4905 0.4442 0.4867 -0.0721 -0.0356 -0.0618 278 PHE A CB  
1086 C  CG  . PHE A 154 ? 0.4983 0.4623 0.5160 -0.0727 -0.0504 -0.0700 278 PHE A CG  
1087 C  CD1 . PHE A 154 ? 0.5709 0.5356 0.5742 -0.0649 -0.0683 -0.0771 278 PHE A CD1 
1088 C  CD2 . PHE A 154 ? 0.5347 0.5129 0.5866 -0.0823 -0.0464 -0.0714 278 PHE A CD2 
1089 C  CE1 . PHE A 154 ? 0.5395 0.5265 0.5717 -0.0661 -0.0850 -0.0888 278 PHE A CE1 
1090 C  CE2 . PHE A 154 ? 0.5407 0.5423 0.6221 -0.0877 -0.0574 -0.0814 278 PHE A CE2 
1091 C  CZ  . PHE A 154 ? 0.5399 0.5498 0.6163 -0.0794 -0.0784 -0.0918 278 PHE A CZ  
1092 N  N   . LYS A 155 ? 0.5200 0.4490 0.4437 -0.0742 -0.0203 -0.0399 279 LYS A N   
1093 C  CA  . LYS A 155 ? 0.5326 0.4664 0.4291 -0.0812 -0.0048 -0.0369 279 LYS A CA  
1094 C  C   . LYS A 155 ? 0.5024 0.4581 0.4072 -0.0735 -0.0020 -0.0530 279 LYS A C   
1095 O  O   . LYS A 155 ? 0.5231 0.4732 0.4332 -0.0644 -0.0166 -0.0638 279 LYS A O   
1096 C  CB  . LYS A 155 ? 0.6139 0.5219 0.4585 -0.0793 -0.0091 -0.0267 279 LYS A CB  
1097 C  CG  . LYS A 155 ? 0.6734 0.5868 0.4833 -0.0929 0.0136  -0.0192 279 LYS A CG  
1098 C  CD  . LYS A 155 ? 0.8338 0.7299 0.5855 -0.0846 0.0087  -0.0161 279 LYS A CD  
1099 C  CE  . LYS A 155 ? 0.9412 0.8617 0.6645 -0.0969 0.0375  -0.0157 279 LYS A CE  
1100 N  NZ  . LYS A 155 ? 0.9929 0.9260 0.6841 -0.0794 0.0346  -0.0322 279 LYS A NZ  
1101 N  N   . ILE A 156 ? 0.4988 0.4799 0.4066 -0.0767 0.0156  -0.0571 280 ILE A N   
1102 C  CA  . ILE A 156 ? 0.5161 0.5147 0.4263 -0.0622 0.0177  -0.0753 280 ILE A CA  
1103 C  C   . ILE A 156 ? 0.5888 0.5912 0.4554 -0.0572 0.0249  -0.0812 280 ILE A C   
1104 O  O   . ILE A 156 ? 0.6215 0.6402 0.4671 -0.0690 0.0443  -0.0725 280 ILE A O   
1105 C  CB  . ILE A 156 ? 0.4795 0.5135 0.4212 -0.0592 0.0296  -0.0823 280 ILE A CB  
1106 C  CG1 . ILE A 156 ? 0.4707 0.4917 0.4420 -0.0554 0.0171  -0.0809 280 ILE A CG1 
1107 C  CG2 . ILE A 156 ? 0.4992 0.5550 0.4359 -0.0385 0.0347  -0.1030 280 ILE A CG2 
1108 C  CD1 . ILE A 156 ? 0.5109 0.5649 0.5096 -0.0549 0.0236  -0.0825 280 ILE A CD1 
1109 N  N   . GLU A 157 ? 0.6330 0.6187 0.4830 -0.0425 0.0097  -0.0966 281 GLU A N   
1110 C  CA  . GLU A 157 ? 0.6986 0.6864 0.5005 -0.0330 0.0137  -0.1075 281 GLU A CA  
1111 C  C   . GLU A 157 ? 0.7181 0.7461 0.5174 -0.0230 0.0377  -0.1228 281 GLU A C   
1112 O  O   . GLU A 157 ? 0.6962 0.7323 0.5194 -0.0047 0.0345  -0.1430 281 GLU A O   
1113 C  CB  . GLU A 157 ? 0.7218 0.6809 0.5112 -0.0206 -0.0131 -0.1257 281 GLU A CB  
1114 C  CG  . GLU A 157 ? 0.7317 0.6685 0.5200 -0.0281 -0.0363 -0.1146 281 GLU A CG  
1115 C  CD  . GLU A 157 ? 0.8261 0.7559 0.5645 -0.0307 -0.0334 -0.0966 281 GLU A CD  
1116 O  OE1 . GLU A 157 ? 0.8991 0.8301 0.5842 -0.0233 -0.0265 -0.1029 281 GLU A OE1 
1117 O  OE2 . GLU A 157 ? 0.7680 0.6867 0.5144 -0.0388 -0.0371 -0.0760 281 GLU A OE2 
1118 N  N   . ARG A 158 ? 0.7516 0.8042 0.5199 -0.0341 0.0620  -0.1134 282 ARG A N   
1119 C  CA  . ARG A 158 ? 0.8014 0.9089 0.5706 -0.0262 0.0899  -0.1299 282 ARG A CA  
1120 C  C   . ARG A 158 ? 0.8722 0.9829 0.5747 -0.0182 0.1017  -0.1390 282 ARG A C   
1121 O  O   . ARG A 158 ? 0.9133 0.9886 0.5632 -0.0294 0.0959  -0.1209 282 ARG A O   
1122 C  CB  . ARG A 158 ? 0.7751 0.9280 0.5766 -0.0521 0.1162  -0.1145 282 ARG A CB  
1123 C  CG  . ARG A 158 ? 0.7306 0.8875 0.5944 -0.0534 0.1032  -0.1127 282 ARG A CG  
1124 C  CD  . ARG A 158 ? 0.7402 0.9471 0.6401 -0.0794 0.1249  -0.1041 282 ARG A CD  
1125 N  NE  . ARG A 158 ? 0.7055 0.9310 0.6618 -0.0696 0.1115  -0.1123 282 ARG A NE  
1126 C  CZ  . ARG A 158 ? 0.7388 0.9330 0.7126 -0.0821 0.0961  -0.0978 282 ARG A CZ  
1127 N  NH1 . ARG A 158 ? 0.7742 0.9177 0.7197 -0.1026 0.0912  -0.0762 282 ARG A NH1 
1128 N  NH2 . ARG A 158 ? 0.7161 0.9288 0.7317 -0.0703 0.0841  -0.1062 282 ARG A NH2 
1129 N  N   . PRO A 159 ? 0.9099 1.0606 0.6094 0.0058  0.1160  -0.1688 283 PRO A N   
1130 C  CA  . PRO A 159 ? 1.0011 1.1596 0.6301 0.0140  0.1311  -0.1794 283 PRO A CA  
1131 C  C   . PRO A 159 ? 1.0408 1.2520 0.6483 -0.0124 0.1753  -0.1621 283 PRO A C   
1132 O  O   . PRO A 159 ? 1.1086 1.2960 0.6456 -0.0283 0.1846  -0.1423 283 PRO A O   
1133 C  CB  . PRO A 159 ? 1.0095 1.1893 0.6475 0.0538  0.1288  -0.2226 283 PRO A CB  
1134 C  CG  . PRO A 159 ? 0.9525 1.1692 0.6693 0.0610  0.1316  -0.2289 283 PRO A CG  
1135 C  CD  . PRO A 159 ? 0.8837 1.0707 0.6367 0.0315  0.1169  -0.1956 283 PRO A CD  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   125 ?   ?   ?   A . n 
A 1 2   MSE 2   126 ?   ?   ?   A . n 
A 1 3   TRP 3   127 127 TRP TRP A . n 
A 1 4   ASP 4   128 128 ASP ASP A . n 
A 1 5   GLU 5   129 129 GLU GLU A . n 
A 1 6   THR 6   130 130 THR THR A . n 
A 1 7   GLU 7   131 131 GLU GLU A . n 
A 1 8   LEU 8   132 132 LEU LEU A . n 
A 1 9   GLY 9   133 133 GLY GLY A . n 
A 1 10  LEU 10  134 134 LEU LEU A . n 
A 1 11  TYR 11  135 135 TYR TYR A . n 
A 1 12  LYS 12  136 136 LYS LYS A . n 
A 1 13  VAL 13  137 137 VAL VAL A . n 
A 1 14  ASN 14  138 138 ASN ASN A . n 
A 1 15  GLU 15  139 139 GLU GLU A . n 
A 1 16  TYR 16  140 140 TYR TYR A . n 
A 1 17  VAL 17  141 141 VAL VAL A . n 
A 1 18  ASP 18  142 142 ASP ASP A . n 
A 1 19  ALA 19  143 143 ALA ALA A . n 
A 1 20  ARG 20  144 144 ARG ARG A . n 
A 1 21  ASP 21  145 145 ASP ASP A . n 
A 1 22  THR 22  146 146 THR THR A . n 
A 1 23  ASN 23  147 147 ASN ASN A . n 
A 1 24  MSE 24  148 148 MSE MSE A . n 
A 1 25  GLY 25  149 149 GLY GLY A . n 
A 1 26  ALA 26  150 150 ALA ALA A . n 
A 1 27  TRP 27  151 151 TRP TRP A . n 
A 1 28  PHE 28  152 152 PHE PHE A . n 
A 1 29  GLU 29  153 153 GLU GLU A . n 
A 1 30  ALA 30  154 154 ALA ALA A . n 
A 1 31  GLN 31  155 155 GLN GLN A . n 
A 1 32  VAL 32  156 156 VAL VAL A . n 
A 1 33  VAL 33  157 157 VAL VAL A . n 
A 1 34  ARG 34  158 158 ARG ARG A . n 
A 1 35  VAL 35  159 159 VAL VAL A . n 
A 1 36  THR 36  160 160 THR THR A . n 
A 1 37  ARG 37  161 161 ARG ARG A . n 
A 1 38  LYS 38  162 162 LYS LYS A . n 
A 1 39  ALA 39  163 ?   ?   ?   A . n 
A 1 40  PRO 40  164 ?   ?   ?   A . n 
A 1 41  SER 41  165 ?   ?   ?   A . n 
A 1 42  ARG 42  166 ?   ?   ?   A . n 
A 1 43  ASP 43  167 ?   ?   ?   A . n 
A 1 44  GLU 44  168 ?   ?   ?   A . n 
A 1 45  PRO 45  169 ?   ?   ?   A . n 
A 1 46  CYS 46  170 ?   ?   ?   A . n 
A 1 47  SER 47  171 ?   ?   ?   A . n 
A 1 48  SER 48  172 ?   ?   ?   A . n 
A 1 49  THR 49  173 ?   ?   ?   A . n 
A 1 50  SER 50  174 ?   ?   ?   A . n 
A 1 51  ARG 51  175 ?   ?   ?   A . n 
A 1 52  PRO 52  176 ?   ?   ?   A . n 
A 1 53  ALA 53  177 ?   ?   ?   A . n 
A 1 54  LEU 54  178 ?   ?   ?   A . n 
A 1 55  GLU 55  179 ?   ?   ?   A . n 
A 1 56  GLU 56  180 180 GLU GLU A . n 
A 1 57  ASP 57  181 181 ASP ASP A . n 
A 1 58  VAL 58  182 182 VAL VAL A . n 
A 1 59  ILE 59  183 183 ILE ILE A . n 
A 1 60  TYR 60  184 184 TYR TYR A . n 
A 1 61  HIS 61  185 185 HIS HIS A . n 
A 1 62  VAL 62  186 186 VAL VAL A . n 
A 1 63  LYS 63  187 187 LYS LYS A . n 
A 1 64  TYR 64  188 188 TYR TYR A . n 
A 1 65  ASP 65  189 189 ASP ASP A . n 
A 1 66  ASP 66  190 190 ASP ASP A . n 
A 1 67  TYR 67  191 191 TYR TYR A . n 
A 1 68  PRO 68  192 192 PRO PRO A . n 
A 1 69  GLU 69  193 193 GLU GLU A . n 
A 1 70  ASN 70  194 194 ASN ASN A . n 
A 1 71  GLY 71  195 195 GLY GLY A . n 
A 1 72  VAL 72  196 196 VAL VAL A . n 
A 1 73  VAL 73  197 197 VAL VAL A . n 
A 1 74  GLN 74  198 198 GLN GLN A . n 
A 1 75  MSE 75  199 199 MSE MSE A . n 
A 1 76  ASN 76  200 200 ASN ASN A . n 
A 1 77  SER 77  201 201 SER SER A . n 
A 1 78  ARG 78  202 202 ARG ARG A . n 
A 1 79  ASP 79  203 203 ASP ASP A . n 
A 1 80  VAL 80  204 204 VAL VAL A . n 
A 1 81  ARG 81  205 205 ARG ARG A . n 
A 1 82  ALA 82  206 206 ALA ALA A . n 
A 1 83  ARG 83  207 207 ARG ARG A . n 
A 1 84  ALA 84  208 208 ALA ALA A . n 
A 1 85  ARG 85  209 209 ARG ARG A . n 
A 1 86  THR 86  210 210 THR THR A . n 
A 1 87  ILE 87  211 211 ILE ILE A . n 
A 1 88  ILE 88  212 212 ILE ILE A . n 
A 1 89  LYS 89  213 213 LYS LYS A . n 
A 1 90  TRP 90  214 214 TRP TRP A . n 
A 1 91  GLN 91  215 215 GLN GLN A . n 
A 1 92  ASP 92  216 216 ASP ASP A . n 
A 1 93  LEU 93  217 217 LEU LEU A . n 
A 1 94  GLU 94  218 218 GLU GLU A . n 
A 1 95  VAL 95  219 219 VAL VAL A . n 
A 1 96  GLY 96  220 220 GLY GLY A . n 
A 1 97  GLN 97  221 221 GLN GLN A . n 
A 1 98  VAL 98  222 222 VAL VAL A . n 
A 1 99  VAL 99  223 223 VAL VAL A . n 
A 1 100 MSE 100 224 224 MSE MSE A . n 
A 1 101 LEU 101 225 225 LEU LEU A . n 
A 1 102 ASN 102 226 226 ASN ASN A . n 
A 1 103 TYR 103 227 227 TYR TYR A . n 
A 1 104 ASN 104 228 228 ASN ASN A . n 
A 1 105 PRO 105 229 229 PRO PRO A . n 
A 1 106 ASP 106 230 230 ASP ASP A . n 
A 1 107 ASN 107 231 231 ASN ASN A . n 
A 1 108 PRO 108 232 232 PRO PRO A . n 
A 1 109 LYS 109 233 233 LYS LYS A . n 
A 1 110 GLU 110 234 234 GLU GLU A . n 
A 1 111 ARG 111 235 235 ARG ARG A . n 
A 1 112 GLY 112 236 236 GLY GLY A . n 
A 1 113 PHE 113 237 237 PHE PHE A . n 
A 1 114 TRP 114 238 238 TRP TRP A . n 
A 1 115 TYR 115 239 239 TYR TYR A . n 
A 1 116 ASP 116 240 240 ASP ASP A . n 
A 1 117 ALA 117 241 241 ALA ALA A . n 
A 1 118 GLU 118 242 242 GLU GLU A . n 
A 1 119 ILE 119 243 243 ILE ILE A . n 
A 1 120 SER 120 244 244 SER SER A . n 
A 1 121 ARG 121 245 245 ARG ARG A . n 
A 1 122 LYS 122 246 246 LYS LYS A . n 
A 1 123 ARG 123 247 247 ARG ARG A . n 
A 1 124 GLU 124 248 248 GLU GLU A . n 
A 1 125 THR 125 249 249 THR THR A . n 
A 1 126 ARG 126 250 250 ARG ARG A . n 
A 1 127 THR 127 251 251 THR THR A . n 
A 1 128 ALA 128 252 252 ALA ALA A . n 
A 1 129 ARG 129 253 253 ARG ARG A . n 
A 1 130 GLU 130 254 254 GLU GLU A . n 
A 1 131 LEU 131 255 255 LEU LEU A . n 
A 1 132 TYR 132 256 256 TYR TYR A . n 
A 1 133 ALA 133 257 257 ALA ALA A . n 
A 1 134 ASN 134 258 258 ASN ASN A . n 
A 1 135 VAL 135 259 259 VAL VAL A . n 
A 1 136 VAL 136 260 260 VAL VAL A . n 
A 1 137 LEU 137 261 261 LEU LEU A . n 
A 1 138 GLY 138 262 262 GLY GLY A . n 
A 1 139 ASP 139 263 263 ASP ASP A . n 
A 1 140 ASP 140 264 264 ASP ASP A . n 
A 1 141 SER 141 265 265 SER SER A . n 
A 1 142 LEU 142 266 266 LEU LEU A . n 
A 1 143 ASN 143 267 267 ASN ASN A . n 
A 1 144 ASP 144 268 268 ASP ASP A . n 
A 1 145 CYS 145 269 269 CYS CYS A . n 
A 1 146 ARG 146 270 270 ARG ARG A . n 
A 1 147 ILE 147 271 271 ILE ILE A . n 
A 1 148 ILE 148 272 272 ILE ILE A . n 
A 1 149 PHE 149 273 273 PHE PHE A . n 
A 1 150 VAL 150 274 274 VAL VAL A . n 
A 1 151 ASP 151 275 275 ASP ASP A . n 
A 1 152 GLU 152 276 276 GLU GLU A . n 
A 1 153 VAL 153 277 277 VAL VAL A . n 
A 1 154 PHE 154 278 278 PHE PHE A . n 
A 1 155 LYS 155 279 279 LYS LYS A . n 
A 1 156 ILE 156 280 280 ILE ILE A . n 
A 1 157 GLU 157 281 281 GLU GLU A . n 
A 1 158 ARG 158 282 282 ARG ARG A . n 
A 1 159 PRO 159 283 283 PRO PRO A . n 
A 1 160 GLY 160 284 ?   ?   ?   A . n 
A 1 161 GLU 161 285 ?   ?   ?   A . n 
B 2 1   THR 1   6   ?   ?   ?   B . n 
B 2 2   ALA 2   7   ?   ?   ?   B . n 
B 2 3   ARG 3   8   8   ARG ARG B . n 
B 2 4   M3L 4   9   9   M3L M3L B . n 
B 2 5   SER 5   10  10  SER SER B . n 
B 2 6   THR 6   11  ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  301 301 HOH HOH A . 
C 3 HOH 2  302 302 HOH HOH A . 
C 3 HOH 3  303 303 HOH HOH A . 
C 3 HOH 4  304 304 HOH HOH A . 
C 3 HOH 5  305 305 HOH HOH A . 
C 3 HOH 6  306 306 HOH HOH A . 
C 3 HOH 7  307 307 HOH HOH A . 
C 3 HOH 8  308 308 HOH HOH A . 
C 3 HOH 9  309 309 HOH HOH A . 
C 3 HOH 10 310 310 HOH HOH A . 
C 3 HOH 11 311 311 HOH HOH A . 
C 3 HOH 12 312 312 HOH HOH A . 
C 3 HOH 13 313 313 HOH HOH A . 
C 3 HOH 14 314 314 HOH HOH A . 
C 3 HOH 15 315 315 HOH HOH A . 
C 3 HOH 16 316 316 HOH HOH A . 
C 3 HOH 17 317 317 HOH HOH A . 
C 3 HOH 18 318 318 HOH HOH A . 
C 3 HOH 19 319 319 HOH HOH A . 
C 3 HOH 20 320 320 HOH HOH A . 
C 3 HOH 21 321 321 HOH HOH A . 
C 3 HOH 22 322 322 HOH HOH A . 
C 3 HOH 23 323 323 HOH HOH A . 
C 3 HOH 24 324 324 HOH HOH A . 
C 3 HOH 25 325 325 HOH HOH A . 
C 3 HOH 26 326 326 HOH HOH A . 
C 3 HOH 27 327 327 HOH HOH A . 
C 3 HOH 28 328 328 HOH HOH A . 
C 3 HOH 29 329 329 HOH HOH A . 
C 3 HOH 30 330 330 HOH HOH A . 
C 3 HOH 31 331 331 HOH HOH A . 
C 3 HOH 32 332 332 HOH HOH A . 
C 3 HOH 33 333 333 HOH HOH A . 
C 3 HOH 34 334 334 HOH HOH A . 
C 3 HOH 35 335 335 HOH HOH A . 
C 3 HOH 36 336 336 HOH HOH A . 
C 3 HOH 37 337 337 HOH HOH A . 
C 3 HOH 38 338 338 HOH HOH A . 
C 3 HOH 39 339 339 HOH HOH A . 
C 3 HOH 40 340 340 HOH HOH A . 
C 3 HOH 41 341 341 HOH HOH A . 
C 3 HOH 42 342 342 HOH HOH A . 
C 3 HOH 43 343 343 HOH HOH A . 
C 3 HOH 44 344 344 HOH HOH A . 
C 3 HOH 45 345 345 HOH HOH A . 
C 3 HOH 46 346 346 HOH HOH A . 
C 3 HOH 47 347 347 HOH HOH A . 
C 3 HOH 48 348 348 HOH HOH A . 
C 3 HOH 49 349 349 HOH HOH A . 
C 3 HOH 50 350 350 HOH HOH A . 
C 3 HOH 51 351 351 HOH HOH A . 
C 3 HOH 52 352 352 HOH HOH A . 
C 3 HOH 53 353 353 HOH HOH A . 
C 3 HOH 54 354 354 HOH HOH A . 
C 3 HOH 55 356 356 HOH HOH A . 
C 3 HOH 56 357 357 HOH HOH A . 
C 3 HOH 57 358 358 HOH HOH A . 
C 3 HOH 58 359 359 HOH HOH A . 
C 3 HOH 59 360 360 HOH HOH A . 
C 3 HOH 60 361 361 HOH HOH A . 
C 3 HOH 61 362 362 HOH HOH A . 
C 3 HOH 62 363 363 HOH HOH A . 
C 3 HOH 63 364 364 HOH HOH A . 
C 3 HOH 64 365 365 HOH HOH A . 
C 3 HOH 65 366 366 HOH HOH A . 
C 3 HOH 66 367 367 HOH HOH A . 
C 3 HOH 67 368 368 HOH HOH A . 
C 3 HOH 68 369 369 HOH HOH A . 
C 3 HOH 69 370 370 HOH HOH A . 
C 3 HOH 70 371 371 HOH HOH A . 
C 3 HOH 71 372 372 HOH HOH A . 
C 3 HOH 72 373 373 HOH HOH A . 
C 3 HOH 73 374 374 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 24  A MSE 148 ? MET SELENOMETHIONINE  
2 A MSE 75  A MSE 199 ? MET SELENOMETHIONINE  
3 A MSE 100 A MSE 224 ? MET SELENOMETHIONINE  
4 B M3L 4   B M3L 9   ? LYS N-TRIMETHYLLYSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 530  ? 
1 MORE         -6.4 ? 
1 'SSA (A^2)'  8640 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-16 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 28.0556 -0.6752  20.5866 0.2682  -0.0187 0.0335 0.0275  0.0737  -0.1192 2.4227 42.3760 3.0403  5.7516  0.5587  -7.8179 
-0.7935 -0.8142 0.2144  1.4510  1.0206  2.7258  -0.6698 -0.1124 -0.2271 'X-RAY DIFFRACTION' 
2 ? refined 33.0352 -6.6195  7.8505  -0.0064 0.0356  0.2101 0.0188  0.0166  -0.0549 4.1551 6.8888  21.7632 1.2594  4.8994  5.9467  
0.2137  -0.0139 0.1202  -0.0331 -0.1573 0.2263  0.1832  -0.3221 -0.0564 'X-RAY DIFFRACTION' 
3 ? refined 32.4740 -3.1657  12.0750 0.1437  -0.0196 0.0160 0.0099  -0.0075 0.0131  3.8692 11.2789 9.5482  0.3710  -3.0512 5.4679  
0.4256  -0.1986 0.3873  0.3700  -0.0336 -0.0255 -0.3589 -0.1399 -0.3920 'X-RAY DIFFRACTION' 
4 ? refined 33.4396 -0.2793  9.5177  0.0819  0.0186  0.1620 0.0019  -0.0030 -0.0804 8.3427 5.9341  9.6671  -1.8807 -5.2850 0.5944  
0.0145  0.1132  -0.6022 0.1757  -0.1031 0.2898  -0.0301 -0.4058 0.0886  'X-RAY DIFFRACTION' 
5 ? refined 33.4613 -18.4890 8.7983  0.2462  0.0430  0.0905 0.0279  -0.0463 -0.0397 3.0946 4.8554  1.5442  2.3640  0.0699  2.2223  
0.1010  -0.2008 -0.1076 0.5993  0.0643  -0.0475 0.1797  0.0606  -0.1653 'X-RAY DIFFRACTION' 
6 ? refined 33.2903 -20.4219 -3.1923 0.0780  0.0795  0.0927 0.0049  -0.0624 -0.0336 5.1187 4.8493  4.3799  -0.2452 -0.4938 1.3318  
0.0701  0.2857  0.0196  -0.1337 -0.0298 -0.0484 -0.2041 0.0792  -0.0402 'X-RAY DIFFRACTION' 
7 ? refined 35.5952 -32.8890 -7.2742 0.0438  0.0580  0.1736 -0.0466 -0.0412 -0.0936 4.9679 15.3126 2.4486  -8.2626 -3.0329 4.0760  
0.0105  0.2433  -0.2258 -0.4986 -0.2006 -0.0044 -0.0290 -0.0509 0.1901  'X-RAY DIFFRACTION' 
8 ? refined 31.6191 -20.0237 -0.4756 0.0980  0.0904  0.1245 -0.0721 -0.0022 -0.0472 4.5652 5.2364  8.1511  -0.6866 1.0698  1.9592  
-0.0230 0.0775  0.1244  -0.1184 -0.1095 0.0842  -0.2454 -0.4368 0.1325  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 127 A 3   A 137 A 13  ? 'X-RAY DIFFRACTION' ? 
2 2 A 138 A 14  A 149 A 25  ? 'X-RAY DIFFRACTION' ? 
3 3 A 150 A 26  A 162 A 38  ? 'X-RAY DIFFRACTION' ? 
4 4 A 180 A 56  A 198 A 74  ? 'X-RAY DIFFRACTION' ? 
5 5 A 199 A 75  A 216 A 92  ? 'X-RAY DIFFRACTION' ? 
6 6 A 217 A 93  A 246 A 122 ? 'X-RAY DIFFRACTION' ? 
7 7 A 247 A 123 A 258 A 134 ? 'X-RAY DIFFRACTION' ? 
8 8 A 259 A 135 A 283 A 159 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
HKL-3000 'data collection' .        ? 2 
HKL-3000 'data reduction'  .        ? 3 
HKL-3000 'data scaling'    .        ? 4 
REFMAC   phasing           5.2.0019 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 129 ? ? -112.29 56.05   
2 1 ASN A 138 ? ? 91.15   -1.77   
3 1 THR A 249 ? ? -110.84 -168.41 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TRP 127 ? CG  ? A TRP 3   CG  
2  1 Y 1 A TRP 127 ? CD1 ? A TRP 3   CD1 
3  1 Y 1 A TRP 127 ? CD2 ? A TRP 3   CD2 
4  1 Y 1 A TRP 127 ? NE1 ? A TRP 3   NE1 
5  1 Y 1 A TRP 127 ? CE2 ? A TRP 3   CE2 
6  1 Y 1 A TRP 127 ? CE3 ? A TRP 3   CE3 
7  1 Y 1 A TRP 127 ? CZ2 ? A TRP 3   CZ2 
8  1 Y 1 A TRP 127 ? CZ3 ? A TRP 3   CZ3 
9  1 Y 1 A TRP 127 ? CH2 ? A TRP 3   CH2 
10 1 Y 1 A GLU 129 ? CG  ? A GLU 5   CG  
11 1 Y 1 A GLU 129 ? CD  ? A GLU 5   CD  
12 1 Y 1 A GLU 129 ? OE1 ? A GLU 5   OE1 
13 1 Y 1 A GLU 129 ? OE2 ? A GLU 5   OE2 
14 1 Y 1 A GLU 131 ? CG  ? A GLU 7   CG  
15 1 Y 1 A GLU 131 ? CD  ? A GLU 7   CD  
16 1 Y 1 A GLU 131 ? OE1 ? A GLU 7   OE1 
17 1 Y 1 A GLU 131 ? OE2 ? A GLU 7   OE2 
18 1 Y 1 A LYS 136 ? CE  ? A LYS 12  CE  
19 1 Y 1 A LYS 136 ? NZ  ? A LYS 12  NZ  
20 1 Y 1 A ARG 161 ? CG  ? A ARG 37  CG  
21 1 Y 1 A ARG 161 ? CD  ? A ARG 37  CD  
22 1 Y 1 A ARG 161 ? NE  ? A ARG 37  NE  
23 1 Y 1 A ARG 161 ? CZ  ? A ARG 37  CZ  
24 1 Y 1 A ARG 161 ? NH1 ? A ARG 37  NH1 
25 1 Y 1 A ARG 161 ? NH2 ? A ARG 37  NH2 
26 1 Y 1 A LYS 162 ? CG  ? A LYS 38  CG  
27 1 Y 1 A LYS 162 ? CD  ? A LYS 38  CD  
28 1 Y 1 A LYS 162 ? CE  ? A LYS 38  CE  
29 1 Y 1 A LYS 162 ? NZ  ? A LYS 38  NZ  
30 1 Y 1 A ASP 181 ? CG  ? A ASP 57  CG  
31 1 Y 1 A ASP 181 ? OD1 ? A ASP 57  OD1 
32 1 Y 1 A ASP 181 ? OD2 ? A ASP 57  OD2 
33 1 Y 1 A ARG 202 ? CZ  ? A ARG 78  CZ  
34 1 Y 1 A ARG 202 ? NH1 ? A ARG 78  NH1 
35 1 Y 1 A ARG 202 ? NH2 ? A ARG 78  NH2 
36 1 Y 1 A ASP 263 ? CG  ? A ASP 139 CG  
37 1 Y 1 A ASP 263 ? OD1 ? A ASP 139 OD1 
38 1 Y 1 A ASP 263 ? OD2 ? A ASP 139 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 125 ? A GLY 1   
2  1 Y 1 A MSE 126 ? A MSE 2   
3  1 Y 1 A ALA 163 ? A ALA 39  
4  1 Y 1 A PRO 164 ? A PRO 40  
5  1 Y 1 A SER 165 ? A SER 41  
6  1 Y 1 A ARG 166 ? A ARG 42  
7  1 Y 1 A ASP 167 ? A ASP 43  
8  1 Y 1 A GLU 168 ? A GLU 44  
9  1 Y 1 A PRO 169 ? A PRO 45  
10 1 Y 1 A CYS 170 ? A CYS 46  
11 1 Y 1 A SER 171 ? A SER 47  
12 1 Y 1 A SER 172 ? A SER 48  
13 1 Y 1 A THR 173 ? A THR 49  
14 1 Y 1 A SER 174 ? A SER 50  
15 1 Y 1 A ARG 175 ? A ARG 51  
16 1 Y 1 A PRO 176 ? A PRO 52  
17 1 Y 1 A ALA 177 ? A ALA 53  
18 1 Y 1 A LEU 178 ? A LEU 54  
19 1 Y 1 A GLU 179 ? A GLU 55  
20 1 Y 1 A GLY 284 ? A GLY 160 
21 1 Y 1 A GLU 285 ? A GLU 161 
22 1 Y 1 B THR 6   ? B THR 1   
23 1 Y 1 B ALA 7   ? B ALA 2   
24 1 Y 1 B THR 11  ? B THR 6   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#