data_3DJU
# 
_entry.id   3DJU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3DJU         
RCSB  RCSB048127   
WWPDB D_1000048127 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3DJN 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3DJU 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yang, X.'     1 
'Morita, M.'   2 
'Wang, H.'     3 
'Suzuki, T.'   4 
'Bartlam, M.'  5 
'Yamamoto, T.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of human BTG2 and mouse TIS21 involved in suppression of CAF1 deadenylase activity' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            36 
_citation.page_first                6872 
_citation.page_last                 6881 
_citation.year                      2008 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18974182 
_citation.pdbx_database_id_DOI      10.1093/nar/gkn825 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yang, X.'     1  
primary 'Morita, M.'   2  
primary 'Wang, H.'     3  
primary 'Suzuki, T.'   4  
primary 'Yang, W.'     5  
primary 'Luo, Y.'      6  
primary 'Zhao, C.'     7  
primary 'Yu, Y.'       8  
primary 'Bartlam, M.'  9  
primary 'Yamamoto, T.' 10 
primary 'Rao, Z.'      11 
# 
_cell.entry_id           3DJU 
_cell.length_a           39.272 
_cell.length_b           40.751 
_cell.length_c           67.971 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3DJU 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein BTG2' 13767.766 1  ? ? 'UNP residues 7-128' ? 
2 water   nat water          18.015    49 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NGF-inducible anti-proliferative protein PC3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIG
LSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIG
LSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPL
;
_entity_poly.pdbx_strand_id                 B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   ASP n 
1 3   MET n 
1 4   LEU n 
1 5   PRO n 
1 6   GLU n 
1 7   ILE n 
1 8   ALA n 
1 9   ALA n 
1 10  ALA n 
1 11  VAL n 
1 12  GLY n 
1 13  PHE n 
1 14  LEU n 
1 15  SER n 
1 16  SER n 
1 17  LEU n 
1 18  LEU n 
1 19  ARG n 
1 20  THR n 
1 21  ARG n 
1 22  GLY n 
1 23  CYS n 
1 24  VAL n 
1 25  SER n 
1 26  GLU n 
1 27  GLN n 
1 28  ARG n 
1 29  LEU n 
1 30  LYS n 
1 31  VAL n 
1 32  PHE n 
1 33  SER n 
1 34  GLY n 
1 35  ALA n 
1 36  LEU n 
1 37  GLN n 
1 38  GLU n 
1 39  ALA n 
1 40  LEU n 
1 41  THR n 
1 42  GLU n 
1 43  HIS n 
1 44  TYR n 
1 45  LYS n 
1 46  HIS n 
1 47  HIS n 
1 48  TRP n 
1 49  PHE n 
1 50  PRO n 
1 51  GLU n 
1 52  LYS n 
1 53  PRO n 
1 54  SER n 
1 55  LYS n 
1 56  GLY n 
1 57  SER n 
1 58  GLY n 
1 59  TYR n 
1 60  ARG n 
1 61  CYS n 
1 62  ILE n 
1 63  ARG n 
1 64  ILE n 
1 65  ASN n 
1 66  HIS n 
1 67  LYS n 
1 68  MET n 
1 69  ASP n 
1 70  PRO n 
1 71  ILE n 
1 72  ILE n 
1 73  SER n 
1 74  ARG n 
1 75  VAL n 
1 76  ALA n 
1 77  SER n 
1 78  GLN n 
1 79  ILE n 
1 80  GLY n 
1 81  LEU n 
1 82  SER n 
1 83  GLN n 
1 84  PRO n 
1 85  GLN n 
1 86  LEU n 
1 87  HIS n 
1 88  GLN n 
1 89  LEU n 
1 90  LEU n 
1 91  PRO n 
1 92  SER n 
1 93  GLU n 
1 94  LEU n 
1 95  THR n 
1 96  LEU n 
1 97  TRP n 
1 98  VAL n 
1 99  ASP n 
1 100 PRO n 
1 101 TYR n 
1 102 GLU n 
1 103 VAL n 
1 104 SER n 
1 105 TYR n 
1 106 ARG n 
1 107 ILE n 
1 108 GLY n 
1 109 GLU n 
1 110 ASP n 
1 111 GLY n 
1 112 SER n 
1 113 ILE n 
1 114 CYS n 
1 115 VAL n 
1 116 LEU n 
1 117 TYR n 
1 118 GLU n 
1 119 GLU n 
1 120 ALA n 
1 121 PRO n 
1 122 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BTG2, B-cell translocation gene 2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX6P1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BTG2_HUMAN 
_struct_ref.pdbx_db_accession          P78543 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIG
LSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPL
;
_struct_ref.pdbx_align_begin           7 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3DJU 
_struct_ref_seq.pdbx_strand_id                B 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 122 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P78543 
_struct_ref_seq.db_align_beg                  7 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  128 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       7 
_struct_ref_seq.pdbx_auth_seq_align_end       128 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3DJU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.98 
_exptl_crystal.density_percent_sol   37.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.1 
_exptl_crystal_grow.pdbx_details    
'100mM BIS-TRIS, 0.2M Sodium chloride, 21% (v/v) PEG 3350, pH 6.1, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-01-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-5A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-5A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     3DJU 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.26 
_reflns.d_resolution_low             50 
_reflns.number_all                   5440 
_reflns.number_obs                   5309 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3DJU 
_refine.ls_number_reflns_obs                     5053 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.94 
_refine.ls_d_res_high                            2.26 
_refine.ls_percent_reflns_obs                    97.84 
_refine.ls_R_factor_obs                          0.19759 
_refine.ls_R_factor_all                          0.244 
_refine.ls_R_factor_R_work                       0.1944 
_refine.ls_R_factor_R_free                       0.26341 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.5 
_refine.ls_number_reflns_R_free                  238 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.B_iso_mean                               37.525 
_refine.aniso_B[1][1]                            -0.49 
_refine.aniso_B[2][2]                            0.02 
_refine.aniso_B[3][3]                            0.47 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2D5R' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.447 
_refine.pdbx_overall_ESU_R_Free                  0.273 
_refine.overall_SU_ML                            0.207 
_refine.overall_SU_B                             8.670 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        959 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             49 
_refine_hist.number_atoms_total               1008 
_refine_hist.d_res_high                       2.26 
_refine_hist.d_res_low                        34.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.014  0.022  ? 983  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.452  1.971  ? 1333 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.489  5.000  ? 120  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   36.607 23.256 ? 43   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   18.210 15.000 ? 169  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22.092 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.106  0.200  ? 146  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 742  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.218  0.200  ? 435  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.307  0.200  ? 665  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.173  0.200  ? 57   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.185  0.200  ? 35   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.053  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.949  1.500  ? 625  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.559  2.000  ? 977  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.946  3.000  ? 413  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.881  4.500  ? 356  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.264 
_refine_ls_shell.d_res_low                        2.323 
_refine_ls_shell.number_reflns_R_work             337 
_refine_ls_shell.R_factor_R_work                  0.25 
_refine_ls_shell.percent_reflns_obs               94.29 
_refine_ls_shell.R_factor_R_free                  0.317 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             10 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                5309 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3DJU 
_struct.title                     'Crystal structure of human BTG2' 
_struct.pdbx_descriptor           'Protein BTG2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3DJU 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'helix-turn-helix, Transcription, Transcription regulation' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 3  ? GLY A 22 ? MET B 9  GLY B 28 1 ? 20 
HELX_P HELX_P2 2 SER A 25 ? LYS A 45 ? SER B 31 LYS B 51 1 ? 21 
HELX_P HELX_P3 3 GLY A 56 ? CYS A 61 ? GLY B 62 CYS B 67 1 ? 6  
HELX_P HELX_P4 4 ASP A 69 ? GLN A 78 ? ASP B 75 GLN B 84 1 ? 10 
HELX_P HELX_P5 5 SER A 82 ? LEU A 90 ? SER B 88 LEU B 96 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 62  ? ILE A 64  ? ILE B 68  ILE B 70  
A 2 LEU A 94  ? ASP A 99  ? LEU B 100 ASP B 105 
A 3 GLU A 102 ? ILE A 107 ? GLU B 108 ILE B 113 
A 4 ILE A 113 ? GLU A 118 ? ILE B 119 GLU B 124 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 62  ? N ILE B 68  O LEU A 96  ? O LEU B 102 
A 2 3 N THR A 95  ? N THR B 101 O ARG A 106 ? O ARG B 112 
A 3 4 N TYR A 105 ? N TYR B 111 O CYS A 114 ? O CYS B 120 
# 
_database_PDB_matrix.entry_id          3DJU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3DJU 
_atom_sites.fract_transf_matrix[1][1]   0.025463 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024539 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014712 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 1   ? 3.414   0.785  2.984   1.00 57.00 ? 7   THR B N   1 
ATOM   2    C CA  . THR A 1 1   ? 1.969   1.226  3.015   1.00 57.23 ? 7   THR B CA  1 
ATOM   3    C C   . THR A 1 1   ? 1.776   2.555  2.251   1.00 56.61 ? 7   THR B C   1 
ATOM   4    O O   . THR A 1 1   ? 0.693   3.186  2.314   1.00 57.00 ? 7   THR B O   1 
ATOM   5    C CB  . THR A 1 1   ? 1.401   1.344  4.480   1.00 57.54 ? 7   THR B CB  1 
ATOM   6    O OG1 . THR A 1 1   ? 1.372   2.720  4.894   1.00 58.99 ? 7   THR B OG1 1 
ATOM   7    C CG2 . THR A 1 1   ? 2.223   0.493  5.500   1.00 58.25 ? 7   THR B CG2 1 
ATOM   8    N N   . ASP A 1 2   ? 2.830   2.942  1.519   1.00 55.13 ? 8   ASP B N   1 
ATOM   9    C CA  . ASP A 1 2   ? 2.939   4.237  0.829   1.00 53.35 ? 8   ASP B CA  1 
ATOM   10   C C   . ASP A 1 2   ? 1.915   4.396  -0.310  1.00 51.56 ? 8   ASP B C   1 
ATOM   11   O O   . ASP A 1 2   ? 1.193   3.443  -0.653  1.00 51.46 ? 8   ASP B O   1 
ATOM   12   C CB  . ASP A 1 2   ? 4.406   4.489  0.398   1.00 53.82 ? 8   ASP B CB  1 
ATOM   13   C CG  . ASP A 1 2   ? 4.684   4.220  -1.096  1.00 54.41 ? 8   ASP B CG  1 
ATOM   14   O OD1 . ASP A 1 2   ? 5.504   3.332  -1.425  1.00 52.57 ? 8   ASP B OD1 1 
ATOM   15   O OD2 . ASP A 1 2   ? 4.141   4.956  -1.946  1.00 57.78 ? 8   ASP B OD2 1 
ATOM   16   N N   . MET A 1 3   ? 1.817   5.597  -0.872  1.00 49.08 ? 9   MET B N   1 
ATOM   17   C CA  . MET A 1 3   ? 0.684   5.872  -1.749  1.00 46.94 ? 9   MET B CA  1 
ATOM   18   C C   . MET A 1 3   ? 0.914   5.650  -3.238  1.00 44.78 ? 9   MET B C   1 
ATOM   19   O O   . MET A 1 3   ? -0.021  5.804  -4.050  1.00 44.81 ? 9   MET B O   1 
ATOM   20   C CB  . MET A 1 3   ? 0.046   7.241  -1.470  1.00 47.14 ? 9   MET B CB  1 
ATOM   21   C CG  . MET A 1 3   ? 0.885   8.212  -0.706  1.00 48.21 ? 9   MET B CG  1 
ATOM   22   S SD  . MET A 1 3   ? -0.032  9.745  -0.589  1.00 47.76 ? 9   MET B SD  1 
ATOM   23   C CE  . MET A 1 3   ? 1.338   10.866 -0.352  1.00 48.30 ? 9   MET B CE  1 
ATOM   24   N N   . LEU A 1 4   ? 2.136   5.289  -3.600  1.00 41.60 ? 10  LEU B N   1 
ATOM   25   C CA  . LEU A 1 4   ? 2.471   5.167  -5.020  1.00 39.90 ? 10  LEU B CA  1 
ATOM   26   C C   . LEU A 1 4   ? 1.629   4.147  -5.792  1.00 37.65 ? 10  LEU B C   1 
ATOM   27   O O   . LEU A 1 4   ? 1.112   4.470  -6.860  1.00 38.72 ? 10  LEU B O   1 
ATOM   28   C CB  . LEU A 1 4   ? 3.965   4.891  -5.227  1.00 39.76 ? 10  LEU B CB  1 
ATOM   29   C CG  . LEU A 1 4   ? 4.651   5.492  -6.449  1.00 40.22 ? 10  LEU B CG  1 
ATOM   30   C CD1 . LEU A 1 4   ? 5.682   4.518  -6.963  1.00 41.14 ? 10  LEU B CD1 1 
ATOM   31   C CD2 . LEU A 1 4   ? 3.718   5.986  -7.579  1.00 39.51 ? 10  LEU B CD2 1 
ATOM   32   N N   . PRO A 1 5   ? 1.476   2.917  -5.269  1.00 35.75 ? 11  PRO B N   1 
ATOM   33   C CA  . PRO A 1 5   ? 0.796   1.907  -6.094  1.00 34.18 ? 11  PRO B CA  1 
ATOM   34   C C   . PRO A 1 5   ? -0.647  2.298  -6.473  1.00 32.86 ? 11  PRO B C   1 
ATOM   35   O O   . PRO A 1 5   ? -1.031  2.206  -7.642  1.00 32.22 ? 11  PRO B O   1 
ATOM   36   C CB  . PRO A 1 5   ? 0.822   0.658  -5.194  1.00 34.41 ? 11  PRO B CB  1 
ATOM   37   C CG  . PRO A 1 5   ? 1.977   0.906  -4.252  1.00 34.83 ? 11  PRO B CG  1 
ATOM   38   C CD  . PRO A 1 5   ? 1.867   2.364  -3.958  1.00 35.24 ? 11  PRO B CD  1 
ATOM   39   N N   . GLU A 1 6   ? -1.415  2.768  -5.495  1.00 31.03 ? 12  GLU B N   1 
ATOM   40   C CA  . GLU A 1 6   ? -2.767  3.255  -5.746  1.00 30.45 ? 12  GLU B CA  1 
ATOM   41   C C   . GLU A 1 6   ? -2.811  4.421  -6.751  1.00 29.52 ? 12  GLU B C   1 
ATOM   42   O O   . GLU A 1 6   ? -3.589  4.387  -7.710  1.00 28.78 ? 12  GLU B O   1 
ATOM   43   C CB  . GLU A 1 6   ? -3.435  3.611  -4.437  1.00 30.36 ? 12  GLU B CB  1 
ATOM   44   C CG  . GLU A 1 6   ? -3.601  2.373  -3.576  1.00 31.80 ? 12  GLU B CG  1 
ATOM   45   C CD  . GLU A 1 6   ? -2.520  2.186  -2.512  1.00 32.35 ? 12  GLU B CD  1 
ATOM   46   O OE1 . GLU A 1 6   ? -1.368  2.631  -2.712  1.00 29.92 ? 12  GLU B OE1 1 
ATOM   47   O OE2 . GLU A 1 6   ? -2.844  1.572  -1.453  1.00 34.38 ? 12  GLU B OE2 1 
ATOM   48   N N   . ILE A 1 7   ? -1.934  5.410  -6.551  1.00 28.35 ? 13  ILE B N   1 
ATOM   49   C CA  . ILE A 1 7   ? -1.852  6.582  -7.417  1.00 27.39 ? 13  ILE B CA  1 
ATOM   50   C C   . ILE A 1 7   ? -1.425  6.210  -8.834  1.00 26.72 ? 13  ILE B C   1 
ATOM   51   O O   . ILE A 1 7   ? -2.097  6.603  -9.770  1.00 25.62 ? 13  ILE B O   1 
ATOM   52   C CB  . ILE A 1 7   ? -0.930  7.666  -6.834  1.00 27.69 ? 13  ILE B CB  1 
ATOM   53   C CG1 . ILE A 1 7   ? -1.604  8.350  -5.624  1.00 26.45 ? 13  ILE B CG1 1 
ATOM   54   C CG2 . ILE A 1 7   ? -0.592  8.668  -7.872  1.00 27.00 ? 13  ILE B CG2 1 
ATOM   55   C CD1 . ILE A 1 7   ? -0.703  9.215  -4.831  1.00 26.09 ? 13  ILE B CD1 1 
ATOM   56   N N   . ALA A 1 8   ? -0.356  5.424  -8.978  1.00 26.60 ? 14  ALA B N   1 
ATOM   57   C CA  . ALA A 1 8   ? 0.060   4.883  -10.294 1.00 27.51 ? 14  ALA B CA  1 
ATOM   58   C C   . ALA A 1 8   ? -1.035  4.054  -10.994 1.00 28.14 ? 14  ALA B C   1 
ATOM   59   O O   . ALA A 1 8   ? -1.146  4.081  -12.228 1.00 29.07 ? 14  ALA B O   1 
ATOM   60   C CB  . ALA A 1 8   ? 1.327   4.051  -10.154 1.00 27.52 ? 14  ALA B CB  1 
ATOM   61   N N   . ALA A 1 9   ? -1.825  3.296  -10.235 1.00 28.24 ? 15  ALA B N   1 
ATOM   62   C CA  . ALA A 1 9   ? -2.946  2.590  -10.863 1.00 29.51 ? 15  ALA B CA  1 
ATOM   63   C C   . ALA A 1 9   ? -3.978  3.611  -11.422 1.00 29.63 ? 15  ALA B C   1 
ATOM   64   O O   . ALA A 1 9   ? -4.356  3.556  -12.594 1.00 30.54 ? 15  ALA B O   1 
ATOM   65   C CB  . ALA A 1 9   ? -3.592  1.613  -9.881  1.00 29.40 ? 15  ALA B CB  1 
ATOM   66   N N   . ALA A 1 10  ? -4.391  4.566  -10.587 1.00 29.65 ? 16  ALA B N   1 
ATOM   67   C CA  . ALA A 1 10  ? -5.270  5.652  -11.011 1.00 29.23 ? 16  ALA B CA  1 
ATOM   68   C C   . ALA A 1 10  ? -4.741  6.326  -12.290 1.00 29.26 ? 16  ALA B C   1 
ATOM   69   O O   . ALA A 1 10  ? -5.427  6.411  -13.312 1.00 29.27 ? 16  ALA B O   1 
ATOM   70   C CB  . ALA A 1 10  ? -5.409  6.659  -9.899  1.00 28.70 ? 16  ALA B CB  1 
ATOM   71   N N   . VAL A 1 11  ? -3.502  6.780  -12.230 1.00 29.24 ? 17  VAL B N   1 
ATOM   72   C CA  . VAL A 1 11  ? -2.860  7.440  -13.346 1.00 29.17 ? 17  VAL B CA  1 
ATOM   73   C C   . VAL A 1 11  ? -2.790  6.550  -14.598 1.00 29.09 ? 17  VAL B C   1 
ATOM   74   O O   . VAL A 1 11  ? -2.963  7.031  -15.714 1.00 29.75 ? 17  VAL B O   1 
ATOM   75   C CB  . VAL A 1 11  ? -1.450  7.908  -12.923 1.00 29.09 ? 17  VAL B CB  1 
ATOM   76   C CG1 . VAL A 1 11  ? -0.702  8.480  -14.104 1.00 30.03 ? 17  VAL B CG1 1 
ATOM   77   C CG2 . VAL A 1 11  ? -1.567  8.974  -11.840 1.00 29.98 ? 17  VAL B CG2 1 
ATOM   78   N N   . GLY A 1 12  ? -2.526  5.258  -14.411 1.00 29.56 ? 18  GLY B N   1 
ATOM   79   C CA  . GLY A 1 12  ? -2.431  4.303  -15.531 1.00 29.47 ? 18  GLY B CA  1 
ATOM   80   C C   . GLY A 1 12  ? -3.768  4.119  -16.208 1.00 29.72 ? 18  GLY B C   1 
ATOM   81   O O   . GLY A 1 12  ? -3.846  3.958  -17.440 1.00 29.75 ? 18  GLY B O   1 
ATOM   82   N N   . PHE A 1 13  ? -4.830  4.165  -15.403 1.00 29.80 ? 19  PHE B N   1 
ATOM   83   C CA  . PHE A 1 13  ? -6.192  4.134  -15.918 1.00 30.06 ? 19  PHE B CA  1 
ATOM   84   C C   . PHE A 1 13  ? -6.516  5.355  -16.834 1.00 30.30 ? 19  PHE B C   1 
ATOM   85   O O   . PHE A 1 13  ? -7.043  5.226  -17.948 1.00 29.67 ? 19  PHE B O   1 
ATOM   86   C CB  . PHE A 1 13  ? -7.171  4.070  -14.753 1.00 30.12 ? 19  PHE B CB  1 
ATOM   87   C CG  . PHE A 1 13  ? -8.601  4.181  -15.180 1.00 31.58 ? 19  PHE B CG  1 
ATOM   88   C CD1 . PHE A 1 13  ? -9.148  3.258  -16.089 1.00 33.43 ? 19  PHE B CD1 1 
ATOM   89   C CD2 . PHE A 1 13  ? -9.391  5.207  -14.716 1.00 31.55 ? 19  PHE B CD2 1 
ATOM   90   C CE1 . PHE A 1 13  ? -10.466 3.366  -16.496 1.00 33.83 ? 19  PHE B CE1 1 
ATOM   91   C CE2 . PHE A 1 13  ? -10.712 5.338  -15.122 1.00 33.98 ? 19  PHE B CE2 1 
ATOM   92   C CZ  . PHE A 1 13  ? -11.255 4.421  -16.017 1.00 34.40 ? 19  PHE B CZ  1 
ATOM   93   N N   . LEU A 1 14  ? -6.192  6.543  -16.349 1.00 30.49 ? 20  LEU B N   1 
ATOM   94   C CA  . LEU A 1 14  ? -6.416  7.746  -17.117 1.00 30.56 ? 20  LEU B CA  1 
ATOM   95   C C   . LEU A 1 14  ? -5.514  7.811  -18.316 1.00 31.76 ? 20  LEU B C   1 
ATOM   96   O O   . LEU A 1 14  ? -5.971  8.251  -19.363 1.00 32.43 ? 20  LEU B O   1 
ATOM   97   C CB  . LEU A 1 14  ? -6.231  8.973  -16.254 1.00 29.54 ? 20  LEU B CB  1 
ATOM   98   C CG  . LEU A 1 14  ? -7.261  9.117  -15.145 1.00 28.25 ? 20  LEU B CG  1 
ATOM   99   C CD1 . LEU A 1 14  ? -6.760  10.130 -14.085 1.00 26.74 ? 20  LEU B CD1 1 
ATOM   100  C CD2 . LEU A 1 14  ? -8.627  9.515  -15.727 1.00 21.93 ? 20  LEU B CD2 1 
ATOM   101  N N   . SER A 1 15  ? -4.250  7.377  -18.188 1.00 33.14 ? 21  SER B N   1 
ATOM   102  C CA  . SER A 1 15  ? -3.340  7.351  -19.336 1.00 34.96 ? 21  SER B CA  1 
ATOM   103  C C   . SER A 1 15  ? -3.885  6.443  -20.421 1.00 36.19 ? 21  SER B C   1 
ATOM   104  O O   . SER A 1 15  ? -3.939  6.830  -21.602 1.00 36.27 ? 21  SER B O   1 
ATOM   105  C CB  . SER A 1 15  ? -1.941  6.855  -18.977 1.00 34.21 ? 21  SER B CB  1 
ATOM   106  O OG  . SER A 1 15  ? -1.459  7.527  -17.843 1.00 37.33 ? 21  SER B OG  1 
ATOM   107  N N   . SER A 1 16  ? -4.268  5.227  -20.022 1.00 37.62 ? 22  SER B N   1 
ATOM   108  C CA  . SER A 1 16  ? -4.785  4.241  -20.977 1.00 38.76 ? 22  SER B CA  1 
ATOM   109  C C   . SER A 1 16  ? -5.941  4.805  -21.796 1.00 38.68 ? 22  SER B C   1 
ATOM   110  O O   . SER A 1 16  ? -6.040  4.517  -22.978 1.00 38.57 ? 22  SER B O   1 
ATOM   111  C CB  . SER A 1 16  ? -5.206  2.944  -20.278 1.00 38.49 ? 22  SER B CB  1 
ATOM   112  O OG  . SER A 1 16  ? -6.209  3.207  -19.298 1.00 41.93 ? 22  SER B OG  1 
ATOM   113  N N   . LEU A 1 17  ? -6.799  5.600  -21.163 1.00 39.25 ? 23  LEU B N   1 
ATOM   114  C CA  . LEU A 1 17  ? -7.914  6.242  -21.859 1.00 40.75 ? 23  LEU B CA  1 
ATOM   115  C C   . LEU A 1 17  ? -7.429  7.281  -22.876 1.00 41.01 ? 23  LEU B C   1 
ATOM   116  O O   . LEU A 1 17  ? -8.004  7.400  -23.937 1.00 41.82 ? 23  LEU B O   1 
ATOM   117  C CB  . LEU A 1 17  ? -8.886  6.912  -20.876 1.00 40.75 ? 23  LEU B CB  1 
ATOM   118  C CG  . LEU A 1 17  ? -9.690  6.036  -19.911 1.00 41.70 ? 23  LEU B CG  1 
ATOM   119  C CD1 . LEU A 1 17  ? -10.127 6.838  -18.686 1.00 41.57 ? 23  LEU B CD1 1 
ATOM   120  C CD2 . LEU A 1 17  ? -10.895 5.391  -20.606 1.00 42.04 ? 23  LEU B CD2 1 
ATOM   121  N N   . LEU A 1 18  ? -6.384  8.034  -22.547 1.00 41.27 ? 24  LEU B N   1 
ATOM   122  C CA  . LEU A 1 18  ? -5.811  8.989  -23.487 1.00 41.67 ? 24  LEU B CA  1 
ATOM   123  C C   . LEU A 1 18  ? -5.195  8.250  -24.674 1.00 43.35 ? 24  LEU B C   1 
ATOM   124  O O   . LEU A 1 18  ? -5.369  8.663  -25.819 1.00 43.30 ? 24  LEU B O   1 
ATOM   125  C CB  . LEU A 1 18  ? -4.763  9.846  -22.794 1.00 40.70 ? 24  LEU B CB  1 
ATOM   126  C CG  . LEU A 1 18  ? -5.118  11.187 -22.143 1.00 39.24 ? 24  LEU B CG  1 
ATOM   127  C CD1 . LEU A 1 18  ? -6.627  11.554 -22.205 1.00 37.81 ? 24  LEU B CD1 1 
ATOM   128  C CD2 . LEU A 1 18  ? -4.631  11.221 -20.742 1.00 35.77 ? 24  LEU B CD2 1 
ATOM   129  N N   . ARG A 1 19  ? -4.497  7.150  -24.385 1.00 44.73 ? 25  ARG B N   1 
ATOM   130  C CA  . ARG A 1 19  ? -3.829  6.349  -25.385 1.00 46.26 ? 25  ARG B CA  1 
ATOM   131  C C   . ARG A 1 19  ? -4.836  5.704  -26.325 1.00 47.63 ? 25  ARG B C   1 
ATOM   132  O O   . ARG A 1 19  ? -4.634  5.675  -27.533 1.00 48.39 ? 25  ARG B O   1 
ATOM   133  C CB  . ARG A 1 19  ? -2.984  5.267  -24.712 1.00 46.08 ? 25  ARG B CB  1 
ATOM   134  C CG  . ARG A 1 19  ? -2.455  4.198  -25.659 1.00 45.78 ? 25  ARG B CG  1 
ATOM   135  C CD  . ARG A 1 19  ? -1.544  3.199  -24.954 1.00 46.04 ? 25  ARG B CD  1 
ATOM   136  N NE  . ARG A 1 19  ? -0.363  3.864  -24.437 1.00 45.54 ? 25  ARG B NE  1 
ATOM   137  C CZ  . ARG A 1 19  ? -0.140  4.104  -23.147 1.00 44.94 ? 25  ARG B CZ  1 
ATOM   138  N NH1 . ARG A 1 19  ? 0.961   4.744  -22.775 1.00 44.81 ? 25  ARG B NH1 1 
ATOM   139  N NH2 . ARG A 1 19  ? -1.006  3.700  -22.228 1.00 42.80 ? 25  ARG B NH2 1 
ATOM   140  N N   . THR A 1 20  ? -5.919  5.200  -25.758 1.00 49.01 ? 26  THR B N   1 
ATOM   141  C CA  . THR A 1 20  ? -6.929  4.446  -26.483 1.00 50.65 ? 26  THR B CA  1 
ATOM   142  C C   . THR A 1 20  ? -7.799  5.357  -27.332 1.00 52.22 ? 26  THR B C   1 
ATOM   143  O O   . THR A 1 20  ? -8.015  5.105  -28.507 1.00 52.28 ? 26  THR B O   1 
ATOM   144  C CB  . THR A 1 20  ? -7.822  3.703  -25.464 1.00 50.51 ? 26  THR B CB  1 
ATOM   145  O OG1 . THR A 1 20  ? -7.124  2.542  -24.975 1.00 52.28 ? 26  THR B OG1 1 
ATOM   146  C CG2 . THR A 1 20  ? -9.205  3.332  -26.041 1.00 51.00 ? 26  THR B CG2 1 
ATOM   147  N N   . ARG A 1 21  ? -8.305  6.420  -26.716 1.00 54.16 ? 27  ARG B N   1 
ATOM   148  C CA  . ARG A 1 21  ? -9.337  7.230  -27.337 1.00 55.97 ? 27  ARG B CA  1 
ATOM   149  C C   . ARG A 1 21  ? -8.703  8.376  -28.081 1.00 55.59 ? 27  ARG B C   1 
ATOM   150  O O   . ARG A 1 21  ? -9.359  9.026  -28.879 1.00 56.12 ? 27  ARG B O   1 
ATOM   151  C CB  . ARG A 1 21  ? -10.369 7.729  -26.299 1.00 56.05 ? 27  ARG B CB  1 
ATOM   152  C CG  . ARG A 1 21  ? -11.034 6.587  -25.485 1.00 57.90 ? 27  ARG B CG  1 
ATOM   153  C CD  . ARG A 1 21  ? -12.264 7.042  -24.689 1.00 58.19 ? 27  ARG B CD  1 
ATOM   154  N NE  . ARG A 1 21  ? -12.722 5.995  -23.764 1.00 63.28 ? 27  ARG B NE  1 
ATOM   155  C CZ  . ARG A 1 21  ? -13.801 6.080  -22.980 1.00 64.40 ? 27  ARG B CZ  1 
ATOM   156  N NH1 . ARG A 1 21  ? -14.567 7.174  -22.999 1.00 64.14 ? 27  ARG B NH1 1 
ATOM   157  N NH2 . ARG A 1 21  ? -14.121 5.056  -22.178 1.00 65.10 ? 27  ARG B NH2 1 
ATOM   158  N N   . GLY A 1 22  ? -7.416  8.601  -27.848 1.00 55.72 ? 28  GLY B N   1 
ATOM   159  C CA  . GLY A 1 22  ? -6.747  9.767  -28.416 1.00 55.66 ? 28  GLY B CA  1 
ATOM   160  C C   . GLY A 1 22  ? -5.686  9.543  -29.479 1.00 55.76 ? 28  GLY B C   1 
ATOM   161  O O   . GLY A 1 22  ? -5.505  8.434  -30.021 1.00 56.08 ? 28  GLY B O   1 
ATOM   162  N N   . CYS A 1 23  ? -4.992  10.626 -29.780 1.00 55.62 ? 29  CYS B N   1 
ATOM   163  C CA  . CYS A 1 23  ? -3.839  10.557 -30.630 1.00 54.93 ? 29  CYS B CA  1 
ATOM   164  C C   . CYS A 1 23  ? -2.706  11.313 -29.923 1.00 53.38 ? 29  CYS B C   1 
ATOM   165  O O   . CYS A 1 23  ? -2.343  12.436 -30.301 1.00 53.35 ? 29  CYS B O   1 
ATOM   166  C CB  . CYS A 1 23  ? -4.186  11.172 -31.988 1.00 55.85 ? 29  CYS B CB  1 
ATOM   167  S SG  . CYS A 1 23  ? -3.294  10.425 -33.342 1.00 58.93 ? 29  CYS B SG  1 
ATOM   168  N N   . VAL A 1 24  ? -2.186  10.699 -28.863 1.00 51.07 ? 30  VAL B N   1 
ATOM   169  C CA  . VAL A 1 24  ? -1.161  11.305 -28.033 1.00 49.03 ? 30  VAL B CA  1 
ATOM   170  C C   . VAL A 1 24  ? 0.080   10.426 -28.161 1.00 47.52 ? 30  VAL B C   1 
ATOM   171  O O   . VAL A 1 24  ? -0.017  9.214  -27.992 1.00 47.36 ? 30  VAL B O   1 
ATOM   172  C CB  . VAL A 1 24  ? -1.626  11.370 -26.533 1.00 49.20 ? 30  VAL B CB  1 
ATOM   173  C CG1 . VAL A 1 24  ? -0.589  12.027 -25.643 1.00 49.31 ? 30  VAL B CG1 1 
ATOM   174  C CG2 . VAL A 1 24  ? -2.933  12.111 -26.401 1.00 49.71 ? 30  VAL B CG2 1 
ATOM   175  N N   . SER A 1 25  ? 1.231   11.029 -28.462 1.00 45.63 ? 31  SER B N   1 
ATOM   176  C CA  . SER A 1 25  ? 2.518   10.315 -28.460 1.00 43.83 ? 31  SER B CA  1 
ATOM   177  C C   . SER A 1 25  ? 2.830   9.769  -27.075 1.00 43.49 ? 31  SER B C   1 
ATOM   178  O O   . SER A 1 25  ? 2.425   10.371 -26.064 1.00 43.52 ? 31  SER B O   1 
ATOM   179  C CB  . SER A 1 25  ? 3.656   11.249 -28.852 1.00 43.99 ? 31  SER B CB  1 
ATOM   180  O OG  . SER A 1 25  ? 4.001   12.148 -27.792 1.00 41.59 ? 31  SER B OG  1 
ATOM   181  N N   . GLU A 1 26  ? 3.574   8.658  -27.029 1.00 42.38 ? 32  GLU B N   1 
ATOM   182  C CA  . GLU A 1 26  ? 4.049   8.094  -25.770 1.00 41.33 ? 32  GLU B CA  1 
ATOM   183  C C   . GLU A 1 26  ? 4.941   9.066  -25.034 1.00 40.21 ? 32  GLU B C   1 
ATOM   184  O O   . GLU A 1 26  ? 4.953   9.082  -23.795 1.00 40.76 ? 32  GLU B O   1 
ATOM   185  C CB  . GLU A 1 26  ? 4.766   6.753  -25.970 1.00 41.45 ? 32  GLU B CB  1 
ATOM   186  C CG  . GLU A 1 26  ? 3.863   5.593  -26.493 1.00 43.56 ? 32  GLU B CG  1 
ATOM   187  C CD  . GLU A 1 26  ? 2.710   5.198  -25.535 1.00 46.00 ? 32  GLU B CD  1 
ATOM   188  O OE1 . GLU A 1 26  ? 2.899   5.222  -24.292 1.00 46.98 ? 32  GLU B OE1 1 
ATOM   189  O OE2 . GLU A 1 26  ? 1.616   4.844  -26.034 1.00 46.12 ? 32  GLU B OE2 1 
ATOM   190  N N   . GLN A 1 27  ? 5.673   9.902  -25.761 1.00 38.74 ? 33  GLN B N   1 
ATOM   191  C CA  . GLN A 1 27  ? 6.477   10.907 -25.059 1.00 37.93 ? 33  GLN B CA  1 
ATOM   192  C C   . GLN A 1 27  ? 5.578   11.760 -24.136 1.00 36.96 ? 33  GLN B C   1 
ATOM   193  O O   . GLN A 1 27  ? 5.907   11.992 -22.968 1.00 36.23 ? 33  GLN B O   1 
ATOM   194  C CB  . GLN A 1 27  ? 7.349   11.755 -26.018 1.00 38.29 ? 33  GLN B CB  1 
ATOM   195  C CG  . GLN A 1 27  ? 8.143   12.945 -25.335 1.00 38.76 ? 33  GLN B CG  1 
ATOM   196  C CD  . GLN A 1 27  ? 7.267   14.222 -25.119 1.00 39.20 ? 33  GLN B CD  1 
ATOM   197  O OE1 . GLN A 1 27  ? 7.538   15.051 -24.245 1.00 39.78 ? 33  GLN B OE1 1 
ATOM   198  N NE2 . GLN A 1 27  ? 6.220   14.357 -25.914 1.00 37.32 ? 33  GLN B NE2 1 
ATOM   199  N N   . ARG A 1 28  ? 4.429   12.181 -24.663 1.00 35.94 ? 34  ARG B N   1 
ATOM   200  C CA  . ARG A 1 28  ? 3.498   13.043 -23.923 1.00 35.03 ? 34  ARG B CA  1 
ATOM   201  C C   . ARG A 1 28  ? 2.792   12.261 -22.826 1.00 34.75 ? 34  ARG B C   1 
ATOM   202  O O   . ARG A 1 28  ? 2.661   12.752 -21.726 1.00 34.46 ? 34  ARG B O   1 
ATOM   203  C CB  . ARG A 1 28  ? 2.482   13.679 -24.870 1.00 34.46 ? 34  ARG B CB  1 
ATOM   204  C CG  . ARG A 1 28  ? 3.070   14.726 -25.815 1.00 34.68 ? 34  ARG B CG  1 
ATOM   205  C CD  . ARG A 1 28  ? 2.135   14.972 -26.969 1.00 34.19 ? 34  ARG B CD  1 
ATOM   206  N NE  . ARG A 1 28  ? 0.969   15.707 -26.516 1.00 34.68 ? 34  ARG B NE  1 
ATOM   207  C CZ  . ARG A 1 28  ? -0.189  15.761 -27.154 1.00 36.07 ? 34  ARG B CZ  1 
ATOM   208  N NH1 . ARG A 1 28  ? -1.168  16.496 -26.645 1.00 36.08 ? 34  ARG B NH1 1 
ATOM   209  N NH2 . ARG A 1 28  ? -0.371  15.089 -28.290 1.00 36.21 ? 34  ARG B NH2 1 
ATOM   210  N N   . LEU A 1 29  ? 2.362   11.039 -23.142 1.00 35.02 ? 35  LEU B N   1 
ATOM   211  C CA  . LEU A 1 29  ? 1.711   10.146 -22.193 1.00 35.59 ? 35  LEU B CA  1 
ATOM   212  C C   . LEU A 1 29  ? 2.609   9.850  -21.008 1.00 36.03 ? 35  LEU B C   1 
ATOM   213  O O   . LEU A 1 29  ? 2.127   9.729  -19.878 1.00 36.54 ? 35  LEU B O   1 
ATOM   214  C CB  . LEU A 1 29  ? 1.291   8.830  -22.876 1.00 35.74 ? 35  LEU B CB  1 
ATOM   215  C CG  . LEU A 1 29  ? 0.091   8.899  -23.848 1.00 35.35 ? 35  LEU B CG  1 
ATOM   216  C CD1 . LEU A 1 29  ? -0.118  7.563  -24.565 1.00 34.18 ? 35  LEU B CD1 1 
ATOM   217  C CD2 . LEU A 1 29  ? -1.202  9.335  -23.124 1.00 35.55 ? 35  LEU B CD2 1 
ATOM   218  N N   . LYS A 1 30  ? 3.917   9.744  -21.266 1.00 36.44 ? 36  LYS B N   1 
ATOM   219  C CA  . LYS A 1 30  ? 4.905   9.578  -20.200 1.00 36.05 ? 36  LYS B CA  1 
ATOM   220  C C   . LYS A 1 30  ? 5.099   10.854 -19.363 1.00 35.52 ? 36  LYS B C   1 
ATOM   221  O O   . LYS A 1 30  ? 5.193   10.793 -18.116 1.00 36.37 ? 36  LYS B O   1 
ATOM   222  C CB  . LYS A 1 30  ? 6.229   9.094  -20.804 1.00 37.05 ? 36  LYS B CB  1 
ATOM   223  C CG  . LYS A 1 30  ? 7.368   8.813  -19.802 1.00 38.38 ? 36  LYS B CG  1 
ATOM   224  C CD  . LYS A 1 30  ? 7.477   7.315  -19.428 1.00 41.70 ? 36  LYS B CD  1 
ATOM   225  C CE  . LYS A 1 30  ? 6.705   6.976  -18.133 1.00 42.43 ? 36  LYS B CE  1 
ATOM   226  N NZ  . LYS A 1 30  ? 7.516   6.069  -17.260 1.00 40.43 ? 36  LYS B NZ  1 
ATOM   227  N N   . VAL A 1 31  ? 5.160   12.016 -20.012 1.00 34.00 ? 37  VAL B N   1 
ATOM   228  C CA  . VAL A 1 31  ? 5.193   13.262 -19.252 1.00 32.65 ? 37  VAL B CA  1 
ATOM   229  C C   . VAL A 1 31  ? 3.927   13.364 -18.377 1.00 32.89 ? 37  VAL B C   1 
ATOM   230  O O   . VAL A 1 31  ? 4.035   13.625 -17.188 1.00 33.70 ? 37  VAL B O   1 
ATOM   231  C CB  . VAL A 1 31  ? 5.379   14.511 -20.164 1.00 32.68 ? 37  VAL B CB  1 
ATOM   232  C CG1 . VAL A 1 31  ? 5.225   15.800 -19.361 1.00 31.05 ? 37  VAL B CG1 1 
ATOM   233  C CG2 . VAL A 1 31  ? 6.764   14.486 -20.851 1.00 31.39 ? 37  VAL B CG2 1 
ATOM   234  N N   . PHE A 1 32  ? 2.747   13.114 -18.961 1.00 32.11 ? 38  PHE B N   1 
ATOM   235  C CA  . PHE A 1 32  ? 1.458   13.160 -18.249 1.00 31.58 ? 38  PHE B CA  1 
ATOM   236  C C   . PHE A 1 32  ? 1.433   12.215 -17.047 1.00 31.41 ? 38  PHE B C   1 
ATOM   237  O O   . PHE A 1 32  ? 1.041   12.611 -15.959 1.00 32.00 ? 38  PHE B O   1 
ATOM   238  C CB  . PHE A 1 32  ? 0.290   12.858 -19.225 1.00 31.17 ? 38  PHE B CB  1 
ATOM   239  C CG  . PHE A 1 32  ? -1.089  12.757 -18.555 1.00 31.28 ? 38  PHE B CG  1 
ATOM   240  C CD1 . PHE A 1 32  ? -1.860  13.904 -18.335 1.00 30.08 ? 38  PHE B CD1 1 
ATOM   241  C CD2 . PHE A 1 32  ? -1.606  11.514 -18.156 1.00 28.92 ? 38  PHE B CD2 1 
ATOM   242  C CE1 . PHE A 1 32  ? -3.124  13.818 -17.718 1.00 30.37 ? 38  PHE B CE1 1 
ATOM   243  C CE2 . PHE A 1 32  ? -2.877  11.423 -17.520 1.00 29.48 ? 38  PHE B CE2 1 
ATOM   244  C CZ  . PHE A 1 32  ? -3.631  12.568 -17.312 1.00 29.21 ? 38  PHE B CZ  1 
ATOM   245  N N   . SER A 1 33  ? 1.854   10.968 -17.246 1.00 31.43 ? 39  SER B N   1 
ATOM   246  C CA  . SER A 1 33  ? 1.865   9.977  -16.167 1.00 31.45 ? 39  SER B CA  1 
ATOM   247  C C   . SER A 1 33  ? 2.735   10.368 -14.968 1.00 31.46 ? 39  SER B C   1 
ATOM   248  O O   . SER A 1 33  ? 2.249   10.368 -13.828 1.00 31.22 ? 39  SER B O   1 
ATOM   249  C CB  . SER A 1 33  ? 2.285   8.622  -16.698 1.00 30.99 ? 39  SER B CB  1 
ATOM   250  O OG  . SER A 1 33  ? 1.317   8.201  -17.633 1.00 31.14 ? 39  SER B OG  1 
ATOM   251  N N   . GLY A 1 34  ? 3.998   10.720 -15.223 1.00 30.76 ? 40  GLY B N   1 
ATOM   252  C CA  . GLY A 1 34  ? 4.899   11.131 -14.149 1.00 29.98 ? 40  GLY B CA  1 
ATOM   253  C C   . GLY A 1 34  ? 4.377   12.388 -13.467 1.00 30.49 ? 40  GLY B C   1 
ATOM   254  O O   . GLY A 1 34  ? 4.238   12.427 -12.233 1.00 30.54 ? 40  GLY B O   1 
ATOM   255  N N   . ALA A 1 35  ? 4.085   13.420 -14.262 1.00 29.79 ? 41  ALA B N   1 
ATOM   256  C CA  . ALA A 1 35  ? 3.498   14.671 -13.736 1.00 29.56 ? 41  ALA B CA  1 
ATOM   257  C C   . ALA A 1 35  ? 2.209   14.473 -12.931 1.00 29.08 ? 41  ALA B C   1 
ATOM   258  O O   . ALA A 1 35  ? 2.020   15.138 -11.909 1.00 28.94 ? 41  ALA B O   1 
ATOM   259  C CB  . ALA A 1 35  ? 3.259   15.669 -14.862 1.00 30.01 ? 41  ALA B CB  1 
ATOM   260  N N   . LEU A 1 36  ? 1.327   13.574 -13.374 1.00 28.97 ? 42  LEU B N   1 
ATOM   261  C CA  . LEU A 1 36  ? 0.086   13.316 -12.611 1.00 29.38 ? 42  LEU B CA  1 
ATOM   262  C C   . LEU A 1 36  ? 0.394   12.536 -11.330 1.00 29.70 ? 42  LEU B C   1 
ATOM   263  O O   . LEU A 1 36  ? -0.178  12.800 -10.288 1.00 30.26 ? 42  LEU B O   1 
ATOM   264  C CB  . LEU A 1 36  ? -0.988  12.606 -13.440 1.00 28.63 ? 42  LEU B CB  1 
ATOM   265  C CG  . LEU A 1 36  ? -2.394  12.610 -12.827 1.00 28.53 ? 42  LEU B CG  1 
ATOM   266  C CD1 . LEU A 1 36  ? -2.893  14.039 -12.579 1.00 27.03 ? 42  LEU B CD1 1 
ATOM   267  C CD2 . LEU A 1 36  ? -3.413  11.889 -13.710 1.00 28.41 ? 42  LEU B CD2 1 
ATOM   268  N N   . GLN A 1 37  ? 1.314   11.595 -11.403 1.00 30.08 ? 43  GLN B N   1 
ATOM   269  C CA  . GLN A 1 37  ? 1.738   10.908 -10.205 1.00 31.80 ? 43  GLN B CA  1 
ATOM   270  C C   . GLN A 1 37  ? 2.233   11.907 -9.152  1.00 31.41 ? 43  GLN B C   1 
ATOM   271  O O   . GLN A 1 37  ? 1.741   11.887 -8.010  1.00 31.21 ? 43  GLN B O   1 
ATOM   272  C CB  . GLN A 1 37  ? 2.754   9.782  -10.508 1.00 31.18 ? 43  GLN B CB  1 
ATOM   273  C CG  . GLN A 1 37  ? 2.078   8.508  -11.156 1.00 34.23 ? 43  GLN B CG  1 
ATOM   274  C CD  . GLN A 1 37  ? 3.083   7.383  -11.542 1.00 34.76 ? 43  GLN B CD  1 
ATOM   275  O OE1 . GLN A 1 37  ? 2.952   6.738  -12.588 1.00 35.90 ? 43  GLN B OE1 1 
ATOM   276  N NE2 . GLN A 1 37  ? 4.079   7.159  -10.684 1.00 38.00 ? 43  GLN B NE2 1 
ATOM   277  N N   . GLU A 1 38  ? 3.148   12.798 -9.544  1.00 31.45 ? 44  GLU B N   1 
ATOM   278  C CA  . GLU A 1 38  ? 3.669   13.845 -8.632  1.00 32.25 ? 44  GLU B CA  1 
ATOM   279  C C   . GLU A 1 38  ? 2.547   14.775 -8.165  1.00 30.45 ? 44  GLU B C   1 
ATOM   280  O O   . GLU A 1 38  ? 2.368   14.986 -6.961  1.00 30.11 ? 44  GLU B O   1 
ATOM   281  C CB  . GLU A 1 38  ? 4.810   14.649 -9.282  1.00 31.91 ? 44  GLU B CB  1 
ATOM   282  C CG  . GLU A 1 38  ? 6.067   13.848 -9.654  1.00 33.34 ? 44  GLU B CG  1 
ATOM   283  C CD  . GLU A 1 38  ? 6.846   14.488 -10.852 1.00 36.78 ? 44  GLU B CD  1 
ATOM   284  O OE1 . GLU A 1 38  ? 7.463   13.722 -11.646 1.00 42.52 ? 44  GLU B OE1 1 
ATOM   285  O OE2 . GLU A 1 38  ? 6.818   15.749 -11.024 1.00 41.66 ? 44  GLU B OE2 1 
ATOM   286  N N   . ALA A 1 39  ? 1.752   15.286 -9.095  1.00 29.04 ? 45  ALA B N   1 
ATOM   287  C CA  . ALA A 1 39  ? 0.617   16.118 -8.694  1.00 28.98 ? 45  ALA B CA  1 
ATOM   288  C C   . ALA A 1 39  ? -0.223  15.478 -7.606  1.00 28.93 ? 45  ALA B C   1 
ATOM   289  O O   . ALA A 1 39  ? -0.558  16.141 -6.613  1.00 29.15 ? 45  ALA B O   1 
ATOM   290  C CB  . ALA A 1 39  ? -0.267  16.463 -9.888  1.00 29.00 ? 45  ALA B CB  1 
ATOM   291  N N   . LEU A 1 40  ? -0.562  14.197 -7.779  1.00 28.69 ? 46  LEU B N   1 
ATOM   292  C CA  . LEU A 1 40  ? -1.514  13.521 -6.876  1.00 28.51 ? 46  LEU B CA  1 
ATOM   293  C C   . LEU A 1 40  ? -0.844  13.108 -5.560  1.00 29.69 ? 46  LEU B C   1 
ATOM   294  O O   . LEU A 1 40  ? -1.489  13.058 -4.515  1.00 29.54 ? 46  LEU B O   1 
ATOM   295  C CB  . LEU A 1 40  ? -2.191  12.304 -7.546  1.00 27.58 ? 46  LEU B CB  1 
ATOM   296  C CG  . LEU A 1 40  ? -3.213  12.561 -8.682  1.00 25.38 ? 46  LEU B CG  1 
ATOM   297  C CD1 . LEU A 1 40  ? -3.740  11.301 -9.306  1.00 20.07 ? 46  LEU B CD1 1 
ATOM   298  C CD2 . LEU A 1 40  ? -4.370  13.410 -8.210  1.00 23.88 ? 46  LEU B CD2 1 
ATOM   299  N N   . THR A 1 41  ? 0.450   12.803 -5.592  1.00 30.46 ? 47  THR B N   1 
ATOM   300  C CA  . THR A 1 41  ? 1.087   12.477 -4.334  1.00 31.35 ? 47  THR B CA  1 
ATOM   301  C C   . THR A 1 41  ? 1.286   13.684 -3.474  1.00 31.92 ? 47  THR B C   1 
ATOM   302  O O   . THR A 1 41  ? 1.115   13.580 -2.278  1.00 32.28 ? 47  THR B O   1 
ATOM   303  C CB  . THR A 1 41  ? 2.328   11.512 -4.396  1.00 31.62 ? 47  THR B CB  1 
ATOM   304  O OG1 . THR A 1 41  ? 3.368   12.011 -3.539  1.00 34.40 ? 47  THR B OG1 1 
ATOM   305  C CG2 . THR A 1 41  ? 2.850   11.314 -5.769  1.00 31.53 ? 47  THR B CG2 1 
ATOM   306  N N   . GLU A 1 42  ? 1.560   14.840 -4.090  1.00 32.81 ? 48  GLU B N   1 
ATOM   307  C CA  . GLU A 1 42  ? 1.515   16.128 -3.400  1.00 34.32 ? 48  GLU B CA  1 
ATOM   308  C C   . GLU A 1 42  ? 0.152   16.395 -2.818  1.00 33.03 ? 48  GLU B C   1 
ATOM   309  O O   . GLU A 1 42  ? 0.041   16.807 -1.666  1.00 33.61 ? 48  GLU B O   1 
ATOM   310  C CB  . GLU A 1 42  ? 1.873   17.281 -4.337  1.00 34.21 ? 48  GLU B CB  1 
ATOM   311  C CG  . GLU A 1 42  ? 3.300   17.185 -4.870  1.00 38.76 ? 48  GLU B CG  1 
ATOM   312  C CD  . GLU A 1 42  ? 3.789   18.415 -5.685  1.00 39.46 ? 48  GLU B CD  1 
ATOM   313  O OE1 . GLU A 1 42  ? 5.009   18.416 -6.051  1.00 43.49 ? 48  GLU B OE1 1 
ATOM   314  O OE2 . GLU A 1 42  ? 2.974   19.360 -5.950  1.00 46.99 ? 48  GLU B OE2 1 
ATOM   315  N N   . HIS A 1 43  ? -0.884  16.162 -3.617  1.00 32.03 ? 49  HIS B N   1 
ATOM   316  C CA  . HIS A 1 43  ? -2.283  16.443 -3.231  1.00 30.70 ? 49  HIS B CA  1 
ATOM   317  C C   . HIS A 1 43  ? -2.753  15.556 -2.084  1.00 30.20 ? 49  HIS B C   1 
ATOM   318  O O   . HIS A 1 43  ? -3.526  15.990 -1.209  1.00 29.42 ? 49  HIS B O   1 
ATOM   319  C CB  . HIS A 1 43  ? -3.212  16.286 -4.445  1.00 29.75 ? 49  HIS B CB  1 
ATOM   320  C CG  . HIS A 1 43  ? -4.573  16.866 -4.252  1.00 30.37 ? 49  HIS B CG  1 
ATOM   321  N ND1 . HIS A 1 43  ? -4.781  18.182 -3.899  1.00 30.35 ? 49  HIS B ND1 1 
ATOM   322  C CD2 . HIS A 1 43  ? -5.803  16.316 -4.390  1.00 29.45 ? 49  HIS B CD2 1 
ATOM   323  C CE1 . HIS A 1 43  ? -6.078  18.413 -3.812  1.00 29.19 ? 49  HIS B CE1 1 
ATOM   324  N NE2 . HIS A 1 43  ? -6.719  17.294 -4.093  1.00 29.45 ? 49  HIS B NE2 1 
ATOM   325  N N   . TYR A 1 44  ? -2.292  14.309 -2.082  1.00 29.96 ? 50  TYR B N   1 
ATOM   326  C CA  . TYR A 1 44  ? -2.783  13.328 -1.107  1.00 30.06 ? 50  TYR B CA  1 
ATOM   327  C C   . TYR A 1 44  ? -1.937  13.222 0.173   1.00 31.15 ? 50  TYR B C   1 
ATOM   328  O O   . TYR A 1 44  ? -2.317  12.512 1.121   1.00 31.70 ? 50  TYR B O   1 
ATOM   329  C CB  . TYR A 1 44  ? -2.843  11.940 -1.733  1.00 29.12 ? 50  TYR B CB  1 
ATOM   330  C CG  . TYR A 1 44  ? -3.845  11.727 -2.860  1.00 28.56 ? 50  TYR B CG  1 
ATOM   331  C CD1 . TYR A 1 44  ? -4.758  12.722 -3.252  1.00 27.93 ? 50  TYR B CD1 1 
ATOM   332  C CD2 . TYR A 1 44  ? -3.892  10.498 -3.512  1.00 28.62 ? 50  TYR B CD2 1 
ATOM   333  C CE1 . TYR A 1 44  ? -5.680  12.492 -4.293  1.00 28.46 ? 50  TYR B CE1 1 
ATOM   334  C CE2 . TYR A 1 44  ? -4.793  10.251 -4.540  1.00 29.31 ? 50  TYR B CE2 1 
ATOM   335  C CZ  . TYR A 1 44  ? -5.701  11.247 -4.927  1.00 29.46 ? 50  TYR B CZ  1 
ATOM   336  O OH  . TYR A 1 44  ? -6.590  10.961 -5.940  1.00 26.08 ? 50  TYR B OH  1 
ATOM   337  N N   . LYS A 1 45  ? -0.784  13.877 0.186   1.00 32.06 ? 51  LYS B N   1 
ATOM   338  C CA  . LYS A 1 45  ? 0.207   13.717 1.258   1.00 33.45 ? 51  LYS B CA  1 
ATOM   339  C C   . LYS A 1 45  ? -0.399  13.740 2.673   1.00 32.75 ? 51  LYS B C   1 
ATOM   340  O O   . LYS A 1 45  ? -0.199  12.813 3.475   1.00 32.41 ? 51  LYS B O   1 
ATOM   341  C CB  . LYS A 1 45  ? 1.250   14.829 1.132   1.00 34.10 ? 51  LYS B CB  1 
ATOM   342  C CG  . LYS A 1 45  ? 2.570   14.477 1.760   1.00 35.66 ? 51  LYS B CG  1 
ATOM   343  C CD  . LYS A 1 45  ? 3.472   15.656 1.772   1.00 36.88 ? 51  LYS B CD  1 
ATOM   344  C CE  . LYS A 1 45  ? 4.882   15.181 2.047   1.00 39.44 ? 51  LYS B CE  1 
ATOM   345  N NZ  . LYS A 1 45  ? 5.625   16.241 2.789   1.00 41.33 ? 51  LYS B NZ  1 
ATOM   346  N N   . HIS A 1 46  ? -1.176  14.782 2.941   1.00 32.01 ? 52  HIS B N   1 
ATOM   347  C CA  . HIS A 1 46  ? -1.699  15.018 4.268   1.00 32.64 ? 52  HIS B CA  1 
ATOM   348  C C   . HIS A 1 46  ? -3.080  14.420 4.446   1.00 33.07 ? 52  HIS B C   1 
ATOM   349  O O   . HIS A 1 46  ? -3.734  14.635 5.463   1.00 33.97 ? 52  HIS B O   1 
ATOM   350  C CB  . HIS A 1 46  ? -1.711  16.528 4.559   1.00 32.18 ? 52  HIS B CB  1 
ATOM   351  C CG  . HIS A 1 46  ? -0.357  17.156 4.453   1.00 31.61 ? 52  HIS B CG  1 
ATOM   352  N ND1 . HIS A 1 46  ? -0.154  18.423 3.956   1.00 34.35 ? 52  HIS B ND1 1 
ATOM   353  C CD2 . HIS A 1 46  ? 0.872   16.667 4.740   1.00 31.93 ? 52  HIS B CD2 1 
ATOM   354  C CE1 . HIS A 1 46  ? 1.139   18.696 3.954   1.00 33.32 ? 52  HIS B CE1 1 
ATOM   355  N NE2 . HIS A 1 46  ? 1.784   17.646 4.430   1.00 32.64 ? 52  HIS B NE2 1 
ATOM   356  N N   . HIS A 1 47  ? -3.523  13.652 3.451   1.00 33.76 ? 53  HIS B N   1 
ATOM   357  C CA  . HIS A 1 47  ? -4.894  13.143 3.421   1.00 33.02 ? 53  HIS B CA  1 
ATOM   358  C C   . HIS A 1 47  ? -4.916  11.680 3.060   1.00 33.06 ? 53  HIS B C   1 
ATOM   359  O O   . HIS A 1 47  ? -5.705  11.237 2.200   1.00 32.85 ? 53  HIS B O   1 
ATOM   360  C CB  . HIS A 1 47  ? -5.694  13.902 2.390   1.00 33.01 ? 53  HIS B CB  1 
ATOM   361  C CG  . HIS A 1 47  ? -5.752  15.377 2.618   1.00 30.92 ? 53  HIS B CG  1 
ATOM   362  N ND1 . HIS A 1 47  ? -6.817  15.986 3.247   1.00 30.84 ? 53  HIS B ND1 1 
ATOM   363  C CD2 . HIS A 1 47  ? -4.912  16.370 2.246   1.00 29.90 ? 53  HIS B CD2 1 
ATOM   364  C CE1 . HIS A 1 47  ? -6.626  17.295 3.256   1.00 30.70 ? 53  HIS B CE1 1 
ATOM   365  N NE2 . HIS A 1 47  ? -5.475  17.555 2.661   1.00 31.59 ? 53  HIS B NE2 1 
ATOM   366  N N   . TRP A 1 48  ? -4.023  10.939 3.710   1.00 32.56 ? 54  TRP B N   1 
ATOM   367  C CA  . TRP A 1 48  ? -3.815  9.539  3.424   1.00 32.09 ? 54  TRP B CA  1 
ATOM   368  C C   . TRP A 1 48  ? -3.641  8.863  4.746   1.00 32.46 ? 54  TRP B C   1 
ATOM   369  O O   . TRP A 1 48  ? -2.696  9.158  5.476   1.00 32.59 ? 54  TRP B O   1 
ATOM   370  C CB  . TRP A 1 48  ? -2.551  9.368  2.590   1.00 30.91 ? 54  TRP B CB  1 
ATOM   371  C CG  . TRP A 1 48  ? -2.366  7.986  2.003   1.00 30.00 ? 54  TRP B CG  1 
ATOM   372  C CD1 . TRP A 1 48  ? -1.573  6.985  2.484   1.00 27.72 ? 54  TRP B CD1 1 
ATOM   373  C CD2 . TRP A 1 48  ? -2.964  7.483  0.797   1.00 29.81 ? 54  TRP B CD2 1 
ATOM   374  N NE1 . TRP A 1 48  ? -1.643  5.886  1.656   1.00 28.43 ? 54  TRP B NE1 1 
ATOM   375  C CE2 . TRP A 1 48  ? -2.471  6.176  0.601   1.00 28.08 ? 54  TRP B CE2 1 
ATOM   376  C CE3 . TRP A 1 48  ? -3.852  8.027  -0.157  1.00 29.09 ? 54  TRP B CE3 1 
ATOM   377  C CZ2 . TRP A 1 48  ? -2.856  5.390  -0.484  1.00 28.83 ? 54  TRP B CZ2 1 
ATOM   378  C CZ3 . TRP A 1 48  ? -4.233  7.231  -1.251  1.00 28.19 ? 54  TRP B CZ3 1 
ATOM   379  C CH2 . TRP A 1 48  ? -3.744  5.932  -1.389  1.00 28.54 ? 54  TRP B CH2 1 
ATOM   380  N N   . PHE A 1 49  ? -4.556  7.958  5.058   1.00 33.43 ? 55  PHE B N   1 
ATOM   381  C CA  . PHE A 1 49  ? -4.567  7.318  6.366   1.00 34.22 ? 55  PHE B CA  1 
ATOM   382  C C   . PHE A 1 49  ? -4.824  5.850  6.097   1.00 35.32 ? 55  PHE B C   1 
ATOM   383  O O   . PHE A 1 49  ? -5.991  5.430  5.973   1.00 34.91 ? 55  PHE B O   1 
ATOM   384  C CB  . PHE A 1 49  ? -5.664  7.919  7.264   1.00 34.33 ? 55  PHE B CB  1 
ATOM   385  C CG  . PHE A 1 49  ? -5.696  9.443  7.277   1.00 34.08 ? 55  PHE B CG  1 
ATOM   386  C CD1 . PHE A 1 49  ? -6.419  10.154 6.311   1.00 35.95 ? 55  PHE B CD1 1 
ATOM   387  C CD2 . PHE A 1 49  ? -5.023  10.164 8.258   1.00 34.16 ? 55  PHE B CD2 1 
ATOM   388  C CE1 . PHE A 1 49  ? -6.464  11.561 6.317   1.00 34.75 ? 55  PHE B CE1 1 
ATOM   389  C CE2 . PHE A 1 49  ? -5.061  11.553 8.269   1.00 34.90 ? 55  PHE B CE2 1 
ATOM   390  C CZ  . PHE A 1 49  ? -5.787  12.255 7.283   1.00 35.25 ? 55  PHE B CZ  1 
ATOM   391  N N   . PRO A 1 50  ? -3.736  5.066  5.945   1.00 36.36 ? 56  PRO B N   1 
ATOM   392  C CA  . PRO A 1 50  ? -3.814  3.646  5.563   1.00 37.56 ? 56  PRO B CA  1 
ATOM   393  C C   . PRO A 1 50  ? -4.777  2.779  6.412   1.00 38.97 ? 56  PRO B C   1 
ATOM   394  O O   . PRO A 1 50  ? -5.395  1.846  5.874   1.00 39.27 ? 56  PRO B O   1 
ATOM   395  C CB  . PRO A 1 50  ? -2.363  3.162  5.701   1.00 37.19 ? 56  PRO B CB  1 
ATOM   396  C CG  . PRO A 1 50  ? -1.541  4.390  5.509   1.00 37.45 ? 56  PRO B CG  1 
ATOM   397  C CD  . PRO A 1 50  ? -2.342  5.526  6.082   1.00 36.24 ? 56  PRO B CD  1 
ATOM   398  N N   . GLU A 1 51  ? -4.912  3.086  7.708   1.00 39.91 ? 57  GLU B N   1 
ATOM   399  C CA  . GLU A 1 51  ? -5.671  2.218  8.632   1.00 41.47 ? 57  GLU B CA  1 
ATOM   400  C C   . GLU A 1 51  ? -7.185  2.488  8.569   1.00 40.49 ? 57  GLU B C   1 
ATOM   401  O O   . GLU A 1 51  ? -7.996  1.621  8.941   1.00 41.20 ? 57  GLU B O   1 
ATOM   402  C CB  . GLU A 1 51  ? -5.092  2.308  10.060  1.00 41.22 ? 57  GLU B CB  1 
ATOM   403  C CG  . GLU A 1 51  ? -3.641  1.740  10.131  1.00 44.10 ? 57  GLU B CG  1 
ATOM   404  C CD  . GLU A 1 51  ? -2.791  2.217  11.320  1.00 46.06 ? 57  GLU B CD  1 
ATOM   405  O OE1 . GLU A 1 51  ? -1.843  1.473  11.688  1.00 52.19 ? 57  GLU B OE1 1 
ATOM   406  O OE2 . GLU A 1 51  ? -3.025  3.325  11.882  1.00 51.74 ? 57  GLU B OE2 1 
ATOM   407  N N   . LYS A 1 52  ? -7.544  3.664  8.041   1.00 39.20 ? 58  LYS B N   1 
ATOM   408  C CA  . LYS A 1 52  ? -8.929  4.087  7.801   1.00 38.66 ? 58  LYS B CA  1 
ATOM   409  C C   . LYS A 1 52  ? -9.083  4.564  6.366   1.00 38.05 ? 58  LYS B C   1 
ATOM   410  O O   . LYS A 1 52  ? -9.083  5.762  6.120   1.00 37.58 ? 58  LYS B O   1 
ATOM   411  C CB  . LYS A 1 52  ? -9.312  5.233  8.748   1.00 38.80 ? 58  LYS B CB  1 
ATOM   412  C CG  . LYS A 1 52  ? -9.143  4.899  10.220  1.00 39.45 ? 58  LYS B CG  1 
ATOM   413  C CD  . LYS A 1 52  ? -9.097  6.133  11.075  1.00 41.49 ? 58  LYS B CD  1 
ATOM   414  C CE  . LYS A 1 52  ? -8.901  5.709  12.531  1.00 43.91 ? 58  LYS B CE  1 
ATOM   415  N NZ  . LYS A 1 52  ? -9.359  6.739  13.508  1.00 44.88 ? 58  LYS B NZ  1 
ATOM   416  N N   . PRO A 1 53  ? -9.203  3.625  5.409   1.00 38.15 ? 59  PRO B N   1 
ATOM   417  C CA  . PRO A 1 53  ? -9.125  4.001  3.994   1.00 38.40 ? 59  PRO B CA  1 
ATOM   418  C C   . PRO A 1 53  ? -10.213 4.957  3.472   1.00 39.15 ? 59  PRO B C   1 
ATOM   419  O O   . PRO A 1 53  ? -9.918  5.782  2.601   1.00 38.54 ? 59  PRO B O   1 
ATOM   420  C CB  . PRO A 1 53  ? -9.123  2.656  3.278   1.00 38.65 ? 59  PRO B CB  1 
ATOM   421  C CG  . PRO A 1 53  ? -8.646  1.658  4.357   1.00 37.54 ? 59  PRO B CG  1 
ATOM   422  C CD  . PRO A 1 53  ? -9.356  2.167  5.563   1.00 37.91 ? 59  PRO B CD  1 
ATOM   423  N N   . SER A 1 54  ? -11.420 4.915  4.044   1.00 39.81 ? 60  SER B N   1 
ATOM   424  C CA  . SER A 1 54  ? -12.495 5.846  3.638   1.00 40.19 ? 60  SER B CA  1 
ATOM   425  C C   . SER A 1 54  ? -12.279 7.262  4.157   1.00 39.55 ? 60  SER B C   1 
ATOM   426  O O   . SER A 1 54  ? -12.864 8.211  3.655   1.00 39.77 ? 60  SER B O   1 
ATOM   427  C CB  . SER A 1 54  ? -13.865 5.341  4.104   1.00 41.16 ? 60  SER B CB  1 
ATOM   428  O OG  . SER A 1 54  ? -14.130 5.804  5.435   1.00 44.75 ? 60  SER B OG  1 
ATOM   429  N N   . LYS A 1 55  ? -11.451 7.414  5.179   1.00 39.07 ? 61  LYS B N   1 
ATOM   430  C CA  . LYS A 1 55  ? -11.133 8.737  5.673   1.00 38.40 ? 61  LYS B CA  1 
ATOM   431  C C   . LYS A 1 55  ? -10.324 9.487  4.616   1.00 38.34 ? 61  LYS B C   1 
ATOM   432  O O   . LYS A 1 55  ? -9.274  9.000  4.134   1.00 37.73 ? 61  LYS B O   1 
ATOM   433  C CB  . LYS A 1 55  ? -10.340 8.629  6.974   1.00 39.30 ? 61  LYS B CB  1 
ATOM   434  C CG  . LYS A 1 55  ? -9.963  9.959  7.565   1.00 38.85 ? 61  LYS B CG  1 
ATOM   435  C CD  . LYS A 1 55  ? -9.309  9.732  8.910   1.00 41.25 ? 61  LYS B CD  1 
ATOM   436  C CE  . LYS A 1 55  ? -8.615  10.999 9.375   1.00 42.08 ? 61  LYS B CE  1 
ATOM   437  N NZ  . LYS A 1 55  ? -9.467  11.767 10.278  1.00 41.27 ? 61  LYS B NZ  1 
ATOM   438  N N   . GLY A 1 56  ? -10.806 10.674 4.260   1.00 37.36 ? 62  GLY B N   1 
ATOM   439  C CA  . GLY A 1 56  ? -10.197 11.440 3.208   1.00 37.09 ? 62  GLY B CA  1 
ATOM   440  C C   . GLY A 1 56  ? -10.597 10.947 1.816   1.00 37.50 ? 62  GLY B C   1 
ATOM   441  O O   . GLY A 1 56  ? -10.095 11.463 0.825   1.00 37.36 ? 62  GLY B O   1 
ATOM   442  N N   . SER A 1 57  ? -11.511 9.976  1.729   1.00 38.08 ? 63  SER B N   1 
ATOM   443  C CA  . SER A 1 57  ? -11.933 9.430  0.439   1.00 38.78 ? 63  SER B CA  1 
ATOM   444  C C   . SER A 1 57  ? -12.579 10.450 -0.493  1.00 38.87 ? 63  SER B C   1 
ATOM   445  O O   . SER A 1 57  ? -12.383 10.396 -1.710  1.00 39.48 ? 63  SER B O   1 
ATOM   446  C CB  . SER A 1 57  ? -12.895 8.294  0.636   1.00 39.17 ? 63  SER B CB  1 
ATOM   447  O OG  . SER A 1 57  ? -13.157 7.692  -0.611  1.00 43.26 ? 63  SER B OG  1 
ATOM   448  N N   . GLY A 1 58  ? -13.345 11.382 0.079   1.00 38.73 ? 64  GLY B N   1 
ATOM   449  C CA  . GLY A 1 58  ? -14.076 12.363 -0.691  1.00 37.60 ? 64  GLY B CA  1 
ATOM   450  C C   . GLY A 1 58  ? -13.165 13.418 -1.250  1.00 37.83 ? 64  GLY B C   1 
ATOM   451  O O   . GLY A 1 58  ? -13.406 13.917 -2.354  1.00 38.42 ? 64  GLY B O   1 
ATOM   452  N N   . TYR A 1 59  ? -12.120 13.749 -0.489  1.00 37.50 ? 65  TYR B N   1 
ATOM   453  C CA  . TYR A 1 59  ? -11.120 14.737 -0.860  1.00 37.61 ? 65  TYR B CA  1 
ATOM   454  C C   . TYR A 1 59  ? -10.259 14.261 -2.027  1.00 37.38 ? 65  TYR B C   1 
ATOM   455  O O   . TYR A 1 59  ? -9.890  15.063 -2.907  1.00 37.15 ? 65  TYR B O   1 
ATOM   456  C CB  . TYR A 1 59  ? -10.232 15.055 0.352   1.00 38.24 ? 65  TYR B CB  1 
ATOM   457  C CG  . TYR A 1 59  ? -8.957  15.810 0.027   1.00 39.29 ? 65  TYR B CG  1 
ATOM   458  C CD1 . TYR A 1 59  ? -7.792  15.133 -0.376  1.00 40.49 ? 65  TYR B CD1 1 
ATOM   459  C CD2 . TYR A 1 59  ? -8.899  17.204 0.141   1.00 40.88 ? 65  TYR B CD2 1 
ATOM   460  C CE1 . TYR A 1 59  ? -6.617  15.825 -0.673  1.00 38.28 ? 65  TYR B CE1 1 
ATOM   461  C CE2 . TYR A 1 59  ? -7.711  17.909 -0.156  1.00 39.80 ? 65  TYR B CE2 1 
ATOM   462  C CZ  . TYR A 1 59  ? -6.587  17.207 -0.560  1.00 39.15 ? 65  TYR B CZ  1 
ATOM   463  O OH  . TYR A 1 59  ? -5.426  17.907 -0.843  1.00 40.21 ? 65  TYR B OH  1 
ATOM   464  N N   . ARG A 1 60  ? -9.952  12.959 -2.021  1.00 37.23 ? 66  ARG B N   1 
ATOM   465  C CA  . ARG A 1 60  ? -9.048  12.312 -2.990  1.00 36.33 ? 66  ARG B CA  1 
ATOM   466  C C   . ARG A 1 60  ? -9.735  11.975 -4.303  1.00 36.82 ? 66  ARG B C   1 
ATOM   467  O O   . ARG A 1 60  ? -9.091  11.922 -5.352  1.00 37.46 ? 66  ARG B O   1 
ATOM   468  C CB  . ARG A 1 60  ? -8.462  11.016 -2.401  1.00 36.00 ? 66  ARG B CB  1 
ATOM   469  C CG  . ARG A 1 60  ? -7.470  11.252 -1.275  1.00 35.01 ? 66  ARG B CG  1 
ATOM   470  C CD  . ARG A 1 60  ? -6.688  9.993  -0.888  1.00 34.82 ? 66  ARG B CD  1 
ATOM   471  N NE  . ARG A 1 60  ? -7.529  8.831  -0.626  1.00 32.49 ? 66  ARG B NE  1 
ATOM   472  C CZ  . ARG A 1 60  ? -8.056  8.509  0.554   1.00 33.43 ? 66  ARG B CZ  1 
ATOM   473  N NH1 . ARG A 1 60  ? -7.835  9.257  1.639   1.00 35.44 ? 66  ARG B NH1 1 
ATOM   474  N NH2 . ARG A 1 60  ? -8.794  7.420  0.661   1.00 30.27 ? 66  ARG B NH2 1 
ATOM   475  N N   . CYS A 1 61  ? -11.029 11.690 -4.221  1.00 37.21 ? 67  CYS B N   1 
ATOM   476  C CA  . CYS A 1 61  ? -11.877 11.384 -5.369  1.00 37.02 ? 67  CYS B CA  1 
ATOM   477  C C   . CYS A 1 61  ? -11.600 12.255 -6.587  1.00 36.72 ? 67  CYS B C   1 
ATOM   478  O O   . CYS A 1 61  ? -11.537 13.481 -6.462  1.00 36.87 ? 67  CYS B O   1 
ATOM   479  C CB  . CYS A 1 61  ? -13.326 11.598 -4.958  1.00 37.16 ? 67  CYS B CB  1 
ATOM   480  S SG  . CYS A 1 61  ? -14.463 11.044 -6.183  1.00 38.47 ? 67  CYS B SG  1 
ATOM   481  N N   . ILE A 1 62  ? -11.446 11.639 -7.759  1.00 36.24 ? 68  ILE B N   1 
ATOM   482  C CA  . ILE A 1 62  ? -11.294 12.411 -8.992  1.00 36.47 ? 68  ILE B CA  1 
ATOM   483  C C   . ILE A 1 62  ? -12.597 12.404 -9.786  1.00 37.60 ? 68  ILE B C   1 
ATOM   484  O O   . ILE A 1 62  ? -13.071 11.349 -10.219 1.00 37.30 ? 68  ILE B O   1 
ATOM   485  C CB  . ILE A 1 62  ? -10.122 11.919 -9.864  1.00 36.12 ? 68  ILE B CB  1 
ATOM   486  C CG1 . ILE A 1 62  ? -8.786  12.194 -9.172  1.00 35.01 ? 68  ILE B CG1 1 
ATOM   487  C CG2 . ILE A 1 62  ? -10.139 12.604 -11.206 1.00 34.60 ? 68  ILE B CG2 1 
ATOM   488  C CD1 . ILE A 1 62  ? -7.786  11.098 -9.333  1.00 34.65 ? 68  ILE B CD1 1 
ATOM   489  N N   . ARG A 1 63  ? -13.182 13.587 -9.941  1.00 39.44 ? 69  ARG B N   1 
ATOM   490  C CA  . ARG A 1 63  ? -14.476 13.744 -10.609 1.00 41.28 ? 69  ARG B CA  1 
ATOM   491  C C   . ARG A 1 63  ? -14.327 14.432 -11.947 1.00 41.93 ? 69  ARG B C   1 
ATOM   492  O O   . ARG A 1 63  ? -13.548 15.383 -12.101 1.00 41.12 ? 69  ARG B O   1 
ATOM   493  C CB  . ARG A 1 63  ? -15.438 14.564 -9.751  1.00 42.19 ? 69  ARG B CB  1 
ATOM   494  C CG  . ARG A 1 63  ? -16.612 13.778 -9.151  1.00 45.73 ? 69  ARG B CG  1 
ATOM   495  C CD  . ARG A 1 63  ? -17.085 14.390 -7.807  1.00 50.53 ? 69  ARG B CD  1 
ATOM   496  N NE  . ARG A 1 63  ? -17.980 13.472 -7.081  1.00 53.37 ? 69  ARG B NE  1 
ATOM   497  C CZ  . ARG A 1 63  ? -17.940 13.214 -5.767  1.00 55.15 ? 69  ARG B CZ  1 
ATOM   498  N NH1 . ARG A 1 63  ? -18.820 12.354 -5.250  1.00 55.61 ? 69  ARG B NH1 1 
ATOM   499  N NH2 . ARG A 1 63  ? -17.035 13.786 -4.966  1.00 53.27 ? 69  ARG B NH2 1 
ATOM   500  N N   . ILE A 1 64  ? -15.070 13.922 -12.921 1.00 42.88 ? 70  ILE B N   1 
ATOM   501  C CA  . ILE A 1 64  ? -15.306 14.633 -14.168 1.00 44.10 ? 70  ILE B CA  1 
ATOM   502  C C   . ILE A 1 64  ? -16.827 14.759 -14.377 1.00 45.01 ? 70  ILE B C   1 
ATOM   503  O O   . ILE A 1 64  ? -17.522 13.768 -14.594 1.00 44.17 ? 70  ILE B O   1 
ATOM   504  C CB  . ILE A 1 64  ? -14.677 13.918 -15.362 1.00 43.37 ? 70  ILE B CB  1 
ATOM   505  C CG1 . ILE A 1 64  ? -13.182 13.687 -15.120 1.00 43.54 ? 70  ILE B CG1 1 
ATOM   506  C CG2 . ILE A 1 64  ? -14.940 14.740 -16.614 1.00 44.90 ? 70  ILE B CG2 1 
ATOM   507  C CD1 . ILE A 1 64  ? -12.509 12.751 -16.111 1.00 41.24 ? 70  ILE B CD1 1 
ATOM   508  N N   . ASN A 1 65  ? -17.329 15.981 -14.270 1.00 47.27 ? 71  ASN B N   1 
ATOM   509  C CA  . ASN A 1 65  ? -18.763 16.260 -14.456 1.00 49.72 ? 71  ASN B CA  1 
ATOM   510  C C   . ASN A 1 65  ? -18.905 17.257 -15.603 1.00 50.35 ? 71  ASN B C   1 
ATOM   511  O O   . ASN A 1 65  ? -18.563 16.917 -16.753 1.00 50.57 ? 71  ASN B O   1 
ATOM   512  C CB  . ASN A 1 65  ? -19.434 16.727 -13.141 1.00 50.40 ? 71  ASN B CB  1 
ATOM   513  C CG  . ASN A 1 65  ? -18.483 17.528 -12.217 1.00 52.80 ? 71  ASN B CG  1 
ATOM   514  O OD1 . ASN A 1 65  ? -18.406 17.274 -11.003 1.00 54.86 ? 71  ASN B OD1 1 
ATOM   515  N ND2 . ASN A 1 65  ? -17.773 18.503 -12.787 1.00 55.23 ? 71  ASN B ND2 1 
ATOM   516  N N   . HIS A 1 66  ? -19.359 18.479 -15.316 1.00 51.04 ? 72  HIS B N   1 
ATOM   517  C CA  . HIS A 1 66  ? -19.302 19.534 -16.334 1.00 51.65 ? 72  HIS B CA  1 
ATOM   518  C C   . HIS A 1 66  ? -18.026 20.356 -16.240 1.00 50.38 ? 72  HIS B C   1 
ATOM   519  O O   . HIS A 1 66  ? -17.604 20.988 -17.228 1.00 50.21 ? 72  HIS B O   1 
ATOM   520  C CB  . HIS A 1 66  ? -20.561 20.408 -16.371 1.00 53.32 ? 72  HIS B CB  1 
ATOM   521  C CG  . HIS A 1 66  ? -20.922 21.028 -15.059 1.00 57.45 ? 72  HIS B CG  1 
ATOM   522  N ND1 . HIS A 1 66  ? -20.329 22.186 -14.594 1.00 61.55 ? 72  HIS B ND1 1 
ATOM   523  C CD2 . HIS A 1 66  ? -21.847 20.676 -14.131 1.00 61.14 ? 72  HIS B CD2 1 
ATOM   524  C CE1 . HIS A 1 66  ? -20.858 22.509 -13.424 1.00 62.98 ? 72  HIS B CE1 1 
ATOM   525  N NE2 . HIS A 1 66  ? -21.781 21.608 -13.119 1.00 63.70 ? 72  HIS B NE2 1 
ATOM   526  N N   . LYS A 1 67  ? -17.413 20.354 -15.057 1.00 48.36 ? 73  LYS B N   1 
ATOM   527  C CA  . LYS A 1 67  ? -16.036 20.821 -14.948 1.00 47.15 ? 73  LYS B CA  1 
ATOM   528  C C   . LYS A 1 67  ? -15.045 19.624 -14.911 1.00 44.16 ? 73  LYS B C   1 
ATOM   529  O O   . LYS A 1 67  ? -15.356 18.556 -14.383 1.00 43.78 ? 73  LYS B O   1 
ATOM   530  C CB  . LYS A 1 67  ? -15.852 21.813 -13.774 1.00 47.43 ? 73  LYS B CB  1 
ATOM   531  C CG  . LYS A 1 67  ? -15.839 21.212 -12.364 1.00 49.51 ? 73  LYS B CG  1 
ATOM   532  C CD  . LYS A 1 67  ? -15.205 22.182 -11.307 1.00 49.48 ? 73  LYS B CD  1 
ATOM   533  C CE  . LYS A 1 67  ? -13.656 22.310 -11.463 1.00 51.23 ? 73  LYS B CE  1 
ATOM   534  N NZ  . LYS A 1 67  ? -13.033 23.253 -10.485 1.00 51.58 ? 73  LYS B NZ  1 
ATOM   535  N N   . MET A 1 68  ? -13.884 19.804 -15.518 1.00 40.78 ? 74  MET B N   1 
ATOM   536  C CA  . MET A 1 68  ? -12.818 18.826 -15.431 1.00 38.50 ? 74  MET B CA  1 
ATOM   537  C C   . MET A 1 68  ? -12.144 18.917 -14.042 1.00 37.56 ? 74  MET B C   1 
ATOM   538  O O   . MET A 1 68  ? -11.952 20.034 -13.521 1.00 37.57 ? 74  MET B O   1 
ATOM   539  C CB  . MET A 1 68  ? -11.809 19.116 -16.542 1.00 37.96 ? 74  MET B CB  1 
ATOM   540  C CG  . MET A 1 68  ? -10.736 18.045 -16.799 1.00 35.78 ? 74  MET B CG  1 
ATOM   541  S SD  . MET A 1 68  ? -11.346 16.373 -17.063 1.00 35.11 ? 74  MET B SD  1 
ATOM   542  C CE  . MET A 1 68  ? -12.439 16.476 -18.478 1.00 28.59 ? 74  MET B CE  1 
ATOM   543  N N   . ASP A 1 69  ? -11.779 17.775 -13.441 1.00 35.96 ? 75  ASP B N   1 
ATOM   544  C CA  . ASP A 1 69  ? -10.880 17.792 -12.262 1.00 34.15 ? 75  ASP B CA  1 
ATOM   545  C C   . ASP A 1 69  ? -9.749  18.788 -12.529 1.00 32.75 ? 75  ASP B C   1 
ATOM   546  O O   . ASP A 1 69  ? -9.141  18.748 -13.611 1.00 31.97 ? 75  ASP B O   1 
ATOM   547  C CB  . ASP A 1 69  ? -10.272 16.429 -11.971 1.00 33.82 ? 75  ASP B CB  1 
ATOM   548  C CG  . ASP A 1 69  ? -9.410  16.438 -10.700 1.00 34.67 ? 75  ASP B CG  1 
ATOM   549  O OD1 . ASP A 1 69  ? -9.968  16.449 -9.585  1.00 35.53 ? 75  ASP B OD1 1 
ATOM   550  O OD2 . ASP A 1 69  ? -8.167  16.422 -10.809 1.00 34.49 ? 75  ASP B OD2 1 
ATOM   551  N N   . PRO A 1 70  ? -9.475  19.695 -11.567 1.00 31.93 ? 76  PRO B N   1 
ATOM   552  C CA  . PRO A 1 70  ? -8.492  20.748 -11.800 1.00 31.72 ? 76  PRO B CA  1 
ATOM   553  C C   . PRO A 1 70  ? -7.026  20.281 -11.854 1.00 31.03 ? 76  PRO B C   1 
ATOM   554  O O   . PRO A 1 70  ? -6.223  20.944 -12.474 1.00 31.83 ? 76  PRO B O   1 
ATOM   555  C CB  . PRO A 1 70  ? -8.761  21.748 -10.664 1.00 31.66 ? 76  PRO B CB  1 
ATOM   556  C CG  . PRO A 1 70  ? -9.367  20.961 -9.592  1.00 32.29 ? 76  PRO B CG  1 
ATOM   557  C CD  . PRO A 1 70  ? -10.070 19.794 -10.223 1.00 32.89 ? 76  PRO B CD  1 
ATOM   558  N N   . ILE A 1 71  ? -6.693  19.144 -11.257 1.00 30.30 ? 77  ILE B N   1 
ATOM   559  C CA  . ILE A 1 71  ? -5.337  18.615 -11.313 1.00 30.25 ? 77  ILE B CA  1 
ATOM   560  C C   . ILE A 1 71  ? -5.091  17.908 -12.642 1.00 31.09 ? 77  ILE B C   1 
ATOM   561  O O   . ILE A 1 71  ? -4.033  18.088 -13.275 1.00 30.19 ? 77  ILE B O   1 
ATOM   562  C CB  . ILE A 1 71  ? -5.088  17.623 -10.162 1.00 30.73 ? 77  ILE B CB  1 
ATOM   563  C CG1 . ILE A 1 71  ? -5.457  18.276 -8.817  1.00 29.75 ? 77  ILE B CG1 1 
ATOM   564  C CG2 . ILE A 1 71  ? -3.657  17.125 -10.172 1.00 29.16 ? 77  ILE B CG2 1 
ATOM   565  C CD1 . ILE A 1 71  ? -4.923  17.535 -7.615  1.00 29.81 ? 77  ILE B CD1 1 
ATOM   566  N N   . ILE A 1 72  ? -6.064  17.101 -13.074 1.00 31.47 ? 78  ILE B N   1 
ATOM   567  C CA  . ILE A 1 72  ? -6.038  16.530 -14.437 1.00 31.91 ? 78  ILE B CA  1 
ATOM   568  C C   . ILE A 1 72  ? -5.865  17.664 -15.443 1.00 31.26 ? 78  ILE B C   1 
ATOM   569  O O   . ILE A 1 72  ? -4.953  17.635 -16.264 1.00 30.32 ? 78  ILE B O   1 
ATOM   570  C CB  . ILE A 1 72  ? -7.347  15.739 -14.783 1.00 32.52 ? 78  ILE B CB  1 
ATOM   571  C CG1 . ILE A 1 72  ? -7.478  14.461 -13.945 1.00 32.37 ? 78  ILE B CG1 1 
ATOM   572  C CG2 . ILE A 1 72  ? -7.361  15.343 -16.266 1.00 33.52 ? 78  ILE B CG2 1 
ATOM   573  C CD1 . ILE A 1 72  ? -8.777  13.647 -14.288 1.00 31.84 ? 78  ILE B CD1 1 
ATOM   574  N N   . SER A 1 73  ? -6.738  18.668 -15.364 1.00 31.55 ? 79  SER B N   1 
ATOM   575  C CA  . SER A 1 73  ? -6.682  19.786 -16.309 1.00 32.69 ? 79  SER B CA  1 
ATOM   576  C C   . SER A 1 73  ? -5.306  20.378 -16.422 1.00 32.78 ? 79  SER B C   1 
ATOM   577  O O   . SER A 1 73  ? -4.812  20.526 -17.528 1.00 33.45 ? 79  SER B O   1 
ATOM   578  C CB  . SER A 1 73  ? -7.642  20.915 -15.951 1.00 32.63 ? 79  SER B CB  1 
ATOM   579  O OG  . SER A 1 73  ? -8.962  20.437 -15.842 1.00 35.17 ? 79  SER B OG  1 
ATOM   580  N N   . ARG A 1 74  ? -4.697  20.749 -15.301 1.00 33.18 ? 80  ARG B N   1 
ATOM   581  C CA  . ARG A 1 74  ? -3.416  21.461 -15.371 1.00 34.29 ? 80  ARG B CA  1 
ATOM   582  C C   . ARG A 1 74  ? -2.237  20.601 -15.792 1.00 33.78 ? 80  ARG B C   1 
ATOM   583  O O   . ARG A 1 74  ? -1.384  21.055 -16.563 1.00 34.72 ? 80  ARG B O   1 
ATOM   584  C CB  . ARG A 1 74  ? -3.092  22.219 -14.083 1.00 34.68 ? 80  ARG B CB  1 
ATOM   585  C CG  . ARG A 1 74  ? -2.916  21.403 -12.810 1.00 36.38 ? 80  ARG B CG  1 
ATOM   586  C CD  . ARG A 1 74  ? -2.632  22.336 -11.613 1.00 36.51 ? 80  ARG B CD  1 
ATOM   587  N NE  . ARG A 1 74  ? -2.487  21.650 -10.316 1.00 41.62 ? 80  ARG B NE  1 
ATOM   588  C CZ  . ARG A 1 74  ? -1.398  20.983 -9.932  1.00 41.61 ? 80  ARG B CZ  1 
ATOM   589  N NH1 . ARG A 1 74  ? -0.345  20.865 -10.734 1.00 40.94 ? 80  ARG B NH1 1 
ATOM   590  N NH2 . ARG A 1 74  ? -1.363  20.425 -8.733  1.00 43.40 ? 80  ARG B NH2 1 
ATOM   591  N N   . VAL A 1 75  ? -2.178  19.372 -15.286 1.00 32.85 ? 81  VAL B N   1 
ATOM   592  C CA  . VAL A 1 75  ? -1.213  18.410 -15.759 1.00 31.21 ? 81  VAL B CA  1 
ATOM   593  C C   . VAL A 1 75  ? -1.422  18.136 -17.256 1.00 30.97 ? 81  VAL B C   1 
ATOM   594  O O   . VAL A 1 75  ? -0.458  18.088 -18.007 1.00 30.58 ? 81  VAL B O   1 
ATOM   595  C CB  . VAL A 1 75  ? -1.301  17.082 -14.969 1.00 31.71 ? 81  VAL B CB  1 
ATOM   596  C CG1 . VAL A 1 75  ? -0.334  16.051 -15.558 1.00 29.65 ? 81  VAL B CG1 1 
ATOM   597  C CG2 . VAL A 1 75  ? -1.028  17.318 -13.487 1.00 31.05 ? 81  VAL B CG2 1 
ATOM   598  N N   . ALA A 1 76  ? -2.665  17.949 -17.694 1.00 30.42 ? 82  ALA B N   1 
ATOM   599  C CA  . ALA A 1 76  ? -2.925  17.661 -19.108 1.00 30.18 ? 82  ALA B CA  1 
ATOM   600  C C   . ALA A 1 76  ? -2.468  18.822 -19.994 1.00 30.82 ? 82  ALA B C   1 
ATOM   601  O O   . ALA A 1 76  ? -1.892  18.609 -21.062 1.00 30.09 ? 82  ALA B O   1 
ATOM   602  C CB  . ALA A 1 76  ? -4.370  17.364 -19.318 1.00 30.51 ? 82  ALA B CB  1 
ATOM   603  N N   . SER A 1 77  ? -2.704  20.048 -19.512 1.00 31.42 ? 83  SER B N   1 
ATOM   604  C CA  . SER A 1 77  ? -2.190  21.295 -20.116 1.00 32.07 ? 83  SER B CA  1 
ATOM   605  C C   . SER A 1 77  ? -0.706  21.204 -20.373 1.00 31.47 ? 83  SER B C   1 
ATOM   606  O O   . SER A 1 77  ? -0.212  21.570 -21.448 1.00 31.02 ? 83  SER B O   1 
ATOM   607  C CB  . SER A 1 77  ? -2.405  22.449 -19.148 1.00 32.40 ? 83  SER B CB  1 
ATOM   608  O OG  . SER A 1 77  ? -3.200  23.446 -19.741 1.00 35.45 ? 83  SER B OG  1 
ATOM   609  N N   . GLN A 1 78  ? 0.007   20.672 -19.385 1.00 31.23 ? 84  GLN B N   1 
ATOM   610  C CA  . GLN A 1 78  ? 1.456   20.510 -19.500 1.00 31.15 ? 84  GLN B CA  1 
ATOM   611  C C   . GLN A 1 78  ? 1.870   19.671 -20.705 1.00 30.38 ? 84  GLN B C   1 
ATOM   612  O O   . GLN A 1 78  ? 3.004   19.777 -21.143 1.00 29.25 ? 84  GLN B O   1 
ATOM   613  C CB  . GLN A 1 78  ? 2.047   19.936 -18.232 1.00 30.99 ? 84  GLN B CB  1 
ATOM   614  C CG  . GLN A 1 78  ? 2.031   20.893 -17.086 1.00 35.42 ? 84  GLN B CG  1 
ATOM   615  C CD  . GLN A 1 78  ? 2.562   20.232 -15.855 1.00 39.26 ? 84  GLN B CD  1 
ATOM   616  O OE1 . GLN A 1 78  ? 3.756   19.957 -15.774 1.00 44.36 ? 84  GLN B OE1 1 
ATOM   617  N NE2 . GLN A 1 78  ? 1.691   19.929 -14.908 1.00 38.43 ? 84  GLN B NE2 1 
ATOM   618  N N   . ILE A 1 79  ? 0.963   18.858 -21.250 1.00 30.27 ? 85  ILE B N   1 
ATOM   619  C CA  . ILE A 1 79  ? 1.310   18.098 -22.451 1.00 30.80 ? 85  ILE B CA  1 
ATOM   620  C C   . ILE A 1 79  ? 0.506   18.580 -23.648 1.00 31.33 ? 85  ILE B C   1 
ATOM   621  O O   . ILE A 1 79  ? 0.432   17.911 -24.661 1.00 31.25 ? 85  ILE B O   1 
ATOM   622  C CB  . ILE A 1 79  ? 1.212   16.555 -22.268 1.00 31.77 ? 85  ILE B CB  1 
ATOM   623  C CG1 . ILE A 1 79  ? -0.234  16.072 -22.122 1.00 31.12 ? 85  ILE B CG1 1 
ATOM   624  C CG2 . ILE A 1 79  ? 2.079   16.091 -21.098 1.00 30.37 ? 85  ILE B CG2 1 
ATOM   625  C CD1 . ILE A 1 79  ? -0.439  14.675 -22.712 1.00 30.55 ? 85  ILE B CD1 1 
ATOM   626  N N   . GLY A 1 80  ? -0.065  19.773 -23.516 1.00 31.74 ? 86  GLY B N   1 
ATOM   627  C CA  . GLY A 1 80  ? -0.746  20.416 -24.610 1.00 32.58 ? 86  GLY B CA  1 
ATOM   628  C C   . GLY A 1 80  ? -2.128  19.898 -24.915 1.00 33.17 ? 86  GLY B C   1 
ATOM   629  O O   . GLY A 1 80  ? -2.556  19.964 -26.078 1.00 33.09 ? 86  GLY B O   1 
ATOM   630  N N   . LEU A 1 81  ? -2.817  19.371 -23.893 1.00 33.96 ? 87  LEU B N   1 
ATOM   631  C CA  . LEU A 1 81  ? -4.226  18.962 -24.023 1.00 34.35 ? 87  LEU B CA  1 
ATOM   632  C C   . LEU A 1 81  ? -5.116  19.995 -23.340 1.00 35.50 ? 87  LEU B C   1 
ATOM   633  O O   . LEU A 1 81  ? -4.975  20.241 -22.133 1.00 35.24 ? 87  LEU B O   1 
ATOM   634  C CB  . LEU A 1 81  ? -4.481  17.612 -23.360 1.00 34.37 ? 87  LEU B CB  1 
ATOM   635  C CG  . LEU A 1 81  ? -4.077  16.287 -23.987 1.00 33.45 ? 87  LEU B CG  1 
ATOM   636  C CD1 . LEU A 1 81  ? -4.518  15.157 -23.062 1.00 29.63 ? 87  LEU B CD1 1 
ATOM   637  C CD2 . LEU A 1 81  ? -4.660  16.134 -25.385 1.00 31.49 ? 87  LEU B CD2 1 
ATOM   638  N N   . SER A 1 82  ? -6.035  20.593 -24.099 1.00 36.56 ? 88  SER B N   1 
ATOM   639  C CA  . SER A 1 82  ? -6.952  21.600 -23.541 1.00 37.93 ? 88  SER B CA  1 
ATOM   640  C C   . SER A 1 82  ? -8.058  20.884 -22.825 1.00 38.27 ? 88  SER B C   1 
ATOM   641  O O   . SER A 1 82  ? -8.295  19.704 -23.078 1.00 39.33 ? 88  SER B O   1 
ATOM   642  C CB  . SER A 1 82  ? -7.571  22.435 -24.639 1.00 37.51 ? 88  SER B CB  1 
ATOM   643  O OG  . SER A 1 82  ? -8.448  21.614 -25.360 1.00 39.09 ? 88  SER B OG  1 
ATOM   644  N N   . GLN A 1 83  ? -8.747  21.592 -21.946 1.00 39.09 ? 89  GLN B N   1 
ATOM   645  C CA  . GLN A 1 83  ? -9.830  20.986 -21.207 1.00 40.02 ? 89  GLN B CA  1 
ATOM   646  C C   . GLN A 1 83  ? -10.935 20.443 -22.130 1.00 40.17 ? 89  GLN B C   1 
ATOM   647  O O   . GLN A 1 83  ? -11.398 19.320 -21.899 1.00 40.29 ? 89  GLN B O   1 
ATOM   648  C CB  . GLN A 1 83  ? -10.406 21.960 -20.187 1.00 40.43 ? 89  GLN B CB  1 
ATOM   649  C CG  . GLN A 1 83  ? -9.605  22.125 -18.945 1.00 42.03 ? 89  GLN B CG  1 
ATOM   650  C CD  . GLN A 1 83  ? -10.339 23.023 -17.969 1.00 45.24 ? 89  GLN B CD  1 
ATOM   651  O OE1 . GLN A 1 83  ? -9.851  24.096 -17.619 1.00 47.44 ? 89  GLN B OE1 1 
ATOM   652  N NE2 . GLN A 1 83  ? -11.544 22.623 -17.579 1.00 44.59 ? 89  GLN B NE2 1 
ATOM   653  N N   . PRO A 1 84  ? -11.362 21.229 -23.162 1.00 40.30 ? 90  PRO B N   1 
ATOM   654  C CA  . PRO A 1 84  ? -12.322 20.691 -24.139 1.00 40.34 ? 90  PRO B CA  1 
ATOM   655  C C   . PRO A 1 84  ? -11.901 19.359 -24.772 1.00 40.01 ? 90  PRO B C   1 
ATOM   656  O O   . PRO A 1 84  ? -12.734 18.458 -24.867 1.00 40.06 ? 90  PRO B O   1 
ATOM   657  C CB  . PRO A 1 84  ? -12.442 21.815 -25.183 1.00 40.43 ? 90  PRO B CB  1 
ATOM   658  C CG  . PRO A 1 84  ? -12.207 23.069 -24.367 1.00 41.15 ? 90  PRO B CG  1 
ATOM   659  C CD  . PRO A 1 84  ? -11.055 22.650 -23.456 1.00 40.55 ? 90  PRO B CD  1 
ATOM   660  N N   . GLN A 1 85  ? -10.645 19.217 -25.194 1.00 39.59 ? 91  GLN B N   1 
ATOM   661  C CA  . GLN A 1 85  ? -10.171 17.910 -25.688 1.00 39.46 ? 91  GLN B CA  1 
ATOM   662  C C   . GLN A 1 85  ? -10.248 16.816 -24.613 1.00 38.62 ? 91  GLN B C   1 
ATOM   663  O O   . GLN A 1 85  ? -10.638 15.697 -24.924 1.00 38.38 ? 91  GLN B O   1 
ATOM   664  C CB  . GLN A 1 85  ? -8.739  17.970 -26.188 1.00 40.03 ? 91  GLN B CB  1 
ATOM   665  C CG  . GLN A 1 85  ? -8.499  18.840 -27.379 1.00 42.40 ? 91  GLN B CG  1 
ATOM   666  C CD  . GLN A 1 85  ? -7.025  19.007 -27.623 1.00 44.82 ? 91  GLN B CD  1 
ATOM   667  O OE1 . GLN A 1 85  ? -6.311  19.587 -26.801 1.00 45.82 ? 91  GLN B OE1 1 
ATOM   668  N NE2 . GLN A 1 85  ? -6.549  18.484 -28.750 1.00 45.49 ? 91  GLN B NE2 1 
ATOM   669  N N   . LEU A 1 86  ? -9.877  17.132 -23.369 1.00 37.51 ? 92  LEU B N   1 
ATOM   670  C CA  . LEU A 1 86  ? -9.987  16.149 -22.268 1.00 37.71 ? 92  LEU B CA  1 
ATOM   671  C C   . LEU A 1 86  ? -11.397 15.667 -22.122 1.00 37.34 ? 92  LEU B C   1 
ATOM   672  O O   . LEU A 1 86  ? -11.641 14.467 -21.977 1.00 36.93 ? 92  LEU B O   1 
ATOM   673  C CB  . LEU A 1 86  ? -9.599  16.750 -20.920 1.00 37.58 ? 92  LEU B CB  1 
ATOM   674  C CG  . LEU A 1 86  ? -8.130  16.926 -20.620 1.00 38.15 ? 92  LEU B CG  1 
ATOM   675  C CD1 . LEU A 1 86  ? -7.973  17.803 -19.381 1.00 36.88 ? 92  LEU B CD1 1 
ATOM   676  C CD2 . LEU A 1 86  ? -7.489  15.540 -20.441 1.00 39.63 ? 92  LEU B CD2 1 
ATOM   677  N N   . HIS A 1 87  ? -12.315 16.635 -22.127 1.00 37.70 ? 93  HIS B N   1 
ATOM   678  C CA  . HIS A 1 87  ? -13.739 16.364 -22.072 1.00 38.43 ? 93  HIS B CA  1 
ATOM   679  C C   . HIS A 1 87  ? -14.127 15.327 -23.124 1.00 39.02 ? 93  HIS B C   1 
ATOM   680  O O   . HIS A 1 87  ? -14.817 14.341 -22.809 1.00 39.41 ? 93  HIS B O   1 
ATOM   681  C CB  . HIS A 1 87  ? -14.555 17.671 -22.184 1.00 38.09 ? 93  HIS B CB  1 
ATOM   682  C CG  . HIS A 1 87  ? -14.736 18.370 -20.868 1.00 37.40 ? 93  HIS B CG  1 
ATOM   683  N ND1 . HIS A 1 87  ? -14.234 19.629 -20.612 1.00 37.37 ? 93  HIS B ND1 1 
ATOM   684  C CD2 . HIS A 1 87  ? -15.327 17.965 -19.719 1.00 35.17 ? 93  HIS B CD2 1 
ATOM   685  C CE1 . HIS A 1 87  ? -14.521 19.978 -19.371 1.00 34.92 ? 93  HIS B CE1 1 
ATOM   686  N NE2 . HIS A 1 87  ? -15.186 18.987 -18.808 1.00 36.00 ? 93  HIS B NE2 1 
ATOM   687  N N   . GLN A 1 88  ? -13.627 15.519 -24.344 1.00 39.29 ? 94  GLN B N   1 
ATOM   688  C CA  . GLN A 1 88  ? -13.899 14.616 -25.451 1.00 40.46 ? 94  GLN B CA  1 
ATOM   689  C C   . GLN A 1 88  ? -13.247 13.259 -25.287 1.00 40.10 ? 94  GLN B C   1 
ATOM   690  O O   . GLN A 1 88  ? -13.905 12.248 -25.533 1.00 40.34 ? 94  GLN B O   1 
ATOM   691  C CB  . GLN A 1 88  ? -13.448 15.218 -26.779 1.00 39.95 ? 94  GLN B CB  1 
ATOM   692  C CG  . GLN A 1 88  ? -14.367 16.301 -27.312 1.00 42.74 ? 94  GLN B CG  1 
ATOM   693  C CD  . GLN A 1 88  ? -13.748 17.063 -28.490 1.00 43.29 ? 94  GLN B CD  1 
ATOM   694  O OE1 . GLN A 1 88  ? -13.976 18.268 -28.653 1.00 46.99 ? 94  GLN B OE1 1 
ATOM   695  N NE2 . GLN A 1 88  ? -12.954 16.364 -29.306 1.00 45.55 ? 94  GLN B NE2 1 
ATOM   696  N N   . LEU A 1 89  ? -11.966 13.236 -24.893 1.00 39.84 ? 95  LEU B N   1 
ATOM   697  C CA  . LEU A 1 89  ? -11.183 11.992 -24.782 1.00 39.34 ? 95  LEU B CA  1 
ATOM   698  C C   . LEU A 1 89  ? -11.528 11.137 -23.577 1.00 39.73 ? 95  LEU B C   1 
ATOM   699  O O   . LEU A 1 89  ? -11.532 9.913  -23.682 1.00 41.18 ? 95  LEU B O   1 
ATOM   700  C CB  . LEU A 1 89  ? -9.687  12.285 -24.754 1.00 39.29 ? 95  LEU B CB  1 
ATOM   701  C CG  . LEU A 1 89  ? -9.175  12.997 -25.995 1.00 40.47 ? 95  LEU B CG  1 
ATOM   702  C CD1 . LEU A 1 89  ? -7.778  13.616 -25.791 1.00 41.09 ? 95  LEU B CD1 1 
ATOM   703  C CD2 . LEU A 1 89  ? -9.226  12.024 -27.171 1.00 40.76 ? 95  LEU B CD2 1 
ATOM   704  N N   . LEU A 1 90  ? -11.801 11.757 -22.431 1.00 39.08 ? 96  LEU B N   1 
ATOM   705  C CA  . LEU A 1 90  ? -12.086 10.993 -21.224 1.00 38.66 ? 96  LEU B CA  1 
ATOM   706  C C   . LEU A 1 90  ? -13.600 10.760 -21.092 1.00 39.32 ? 96  LEU B C   1 
ATOM   707  O O   . LEU A 1 90  ? -14.393 11.557 -21.603 1.00 39.47 ? 96  LEU B O   1 
ATOM   708  C CB  . LEU A 1 90  ? -11.510 11.705 -19.992 1.00 37.57 ? 96  LEU B CB  1 
ATOM   709  C CG  . LEU A 1 90  ? -9.983  11.883 -19.944 1.00 37.57 ? 96  LEU B CG  1 
ATOM   710  C CD1 . LEU A 1 90  ? -9.566  12.772 -18.780 1.00 34.94 ? 96  LEU B CD1 1 
ATOM   711  C CD2 . LEU A 1 90  ? -9.235  10.541 -19.899 1.00 34.52 ? 96  LEU B CD2 1 
ATOM   712  N N   . PRO A 1 91  ? -14.017 9.683  -20.392 1.00 40.07 ? 97  PRO B N   1 
ATOM   713  C CA  . PRO A 1 91  ? -15.464 9.465  -20.218 1.00 40.72 ? 97  PRO B CA  1 
ATOM   714  C C   . PRO A 1 91  ? -16.143 10.639 -19.534 1.00 41.46 ? 97  PRO B C   1 
ATOM   715  O O   . PRO A 1 91  ? -15.518 11.347 -18.716 1.00 40.63 ? 97  PRO B O   1 
ATOM   716  C CB  . PRO A 1 91  ? -15.532 8.248  -19.296 1.00 40.52 ? 97  PRO B CB  1 
ATOM   717  C CG  . PRO A 1 91  ? -14.228 7.539  -19.529 1.00 41.09 ? 97  PRO B CG  1 
ATOM   718  C CD  . PRO A 1 91  ? -13.224 8.629  -19.730 1.00 39.85 ? 97  PRO B CD  1 
ATOM   719  N N   . SER A 1 92  ? -17.408 10.846 -19.897 1.00 42.03 ? 98  SER B N   1 
ATOM   720  C CA  . SER A 1 92  ? -18.294 11.753 -19.188 1.00 42.92 ? 98  SER B CA  1 
ATOM   721  C C   . SER A 1 92  ? -18.636 11.180 -17.808 1.00 43.33 ? 98  SER B C   1 
ATOM   722  O O   . SER A 1 92  ? -18.640 9.959  -17.604 1.00 43.80 ? 98  SER B O   1 
ATOM   723  C CB  . SER A 1 92  ? -19.595 11.891 -19.974 1.00 43.31 ? 98  SER B CB  1 
ATOM   724  O OG  . SER A 1 92  ? -19.508 12.915 -20.931 1.00 43.42 ? 98  SER B OG  1 
ATOM   725  N N   . GLU A 1 93  ? -18.946 12.050 -16.858 1.00 43.69 ? 99  GLU B N   1 
ATOM   726  C CA  . GLU A 1 93  ? -19.485 11.584 -15.570 1.00 44.46 ? 99  GLU B CA  1 
ATOM   727  C C   . GLU A 1 93  ? -18.613 10.436 -15.001 1.00 43.18 ? 99  GLU B C   1 
ATOM   728  O O   . GLU A 1 93  ? -19.125 9.356  -14.652 1.00 42.89 ? 99  GLU B O   1 
ATOM   729  C CB  . GLU A 1 93  ? -20.954 11.131 -15.701 1.00 44.18 ? 99  GLU B CB  1 
ATOM   730  C CG  . GLU A 1 93  ? -21.827 11.908 -16.691 1.00 46.58 ? 99  GLU B CG  1 
ATOM   731  C CD  . GLU A 1 93  ? -23.247 11.315 -16.883 1.00 47.65 ? 99  GLU B CD  1 
ATOM   732  O OE1 . GLU A 1 93  ? -23.722 10.506 -16.033 1.00 51.74 ? 99  GLU B OE1 1 
ATOM   733  O OE2 . GLU A 1 93  ? -23.898 11.672 -17.900 1.00 51.05 ? 99  GLU B OE2 1 
ATOM   734  N N   . LEU A 1 94  ? -17.301 10.682 -14.927 1.00 41.48 ? 100 LEU B N   1 
ATOM   735  C CA  . LEU A 1 94  ? -16.357 9.727  -14.340 1.00 40.05 ? 100 LEU B CA  1 
ATOM   736  C C   . LEU A 1 94  ? -16.108 10.038 -12.874 1.00 38.71 ? 100 LEU B C   1 
ATOM   737  O O   . LEU A 1 94  ? -15.850 11.184 -12.516 1.00 38.98 ? 100 LEU B O   1 
ATOM   738  C CB  . LEU A 1 94  ? -15.024 9.725  -15.102 1.00 40.32 ? 100 LEU B CB  1 
ATOM   739  C CG  . LEU A 1 94  ? -13.833 8.989  -14.475 1.00 41.51 ? 100 LEU B CG  1 
ATOM   740  C CD1 . LEU A 1 94  ? -14.025 7.466  -14.509 1.00 40.80 ? 100 LEU B CD1 1 
ATOM   741  C CD2 . LEU A 1 94  ? -12.498 9.395  -15.119 1.00 40.20 ? 100 LEU B CD2 1 
ATOM   742  N N   . THR A 1 95  ? -16.194 9.015  -12.031 1.00 36.80 ? 101 THR B N   1 
ATOM   743  C CA  . THR A 1 95  ? -15.764 9.132  -10.650 1.00 35.27 ? 101 THR B CA  1 
ATOM   744  C C   . THR A 1 95  ? -14.673 8.089  -10.379 1.00 33.71 ? 101 THR B C   1 
ATOM   745  O O   . THR A 1 95  ? -14.835 6.905  -10.684 1.00 33.92 ? 101 THR B O   1 
ATOM   746  C CB  . THR A 1 95  ? -16.951 9.009  -9.651  1.00 35.33 ? 101 THR B CB  1 
ATOM   747  O OG1 . THR A 1 95  ? -18.092 9.680  -10.189 1.00 36.82 ? 101 THR B OG1 1 
ATOM   748  C CG2 . THR A 1 95  ? -16.631 9.687  -8.358  1.00 34.95 ? 101 THR B CG2 1 
ATOM   749  N N   . LEU A 1 96  ? -13.564 8.557  -9.817  1.00 32.16 ? 102 LEU B N   1 
ATOM   750  C CA  . LEU A 1 96  ? -12.366 7.750  -9.599  1.00 30.71 ? 102 LEU B CA  1 
ATOM   751  C C   . LEU A 1 96  ? -12.009 7.876  -8.124  1.00 30.32 ? 102 LEU B C   1 
ATOM   752  O O   . LEU A 1 96  ? -11.599 8.957  -7.670  1.00 30.44 ? 102 LEU B O   1 
ATOM   753  C CB  . LEU A 1 96  ? -11.218 8.293  -10.460 1.00 30.96 ? 102 LEU B CB  1 
ATOM   754  C CG  . LEU A 1 96  ? -10.184 7.407  -11.148 1.00 29.20 ? 102 LEU B CG  1 
ATOM   755  C CD1 . LEU A 1 96  ? -9.027  8.266  -11.613 1.00 27.39 ? 102 LEU B CD1 1 
ATOM   756  C CD2 . LEU A 1 96  ? -9.707  6.277  -10.305 1.00 25.86 ? 102 LEU B CD2 1 
ATOM   757  N N   . TRP A 1 97  ? -12.210 6.797  -7.370  1.00 28.90 ? 103 TRP B N   1 
ATOM   758  C CA  . TRP A 1 97  ? -11.867 6.794  -5.947  1.00 28.65 ? 103 TRP B CA  1 
ATOM   759  C C   . TRP A 1 97  ? -10.466 6.227  -5.819  1.00 28.44 ? 103 TRP B C   1 
ATOM   760  O O   . TRP A 1 97  ? -10.202 5.130  -6.293  1.00 27.74 ? 103 TRP B O   1 
ATOM   761  C CB  . TRP A 1 97  ? -12.870 5.959  -5.145  1.00 27.78 ? 103 TRP B CB  1 
ATOM   762  C CG  . TRP A 1 97  ? -14.216 6.544  -5.256  1.00 27.55 ? 103 TRP B CG  1 
ATOM   763  C CD1 . TRP A 1 97  ? -14.651 7.644  -4.610  1.00 28.57 ? 103 TRP B CD1 1 
ATOM   764  C CD2 . TRP A 1 97  ? -15.300 6.107  -6.080  1.00 26.77 ? 103 TRP B CD2 1 
ATOM   765  N NE1 . TRP A 1 97  ? -15.932 7.919  -4.948  1.00 29.21 ? 103 TRP B NE1 1 
ATOM   766  C CE2 . TRP A 1 97  ? -16.362 7.001  -5.866  1.00 28.24 ? 103 TRP B CE2 1 
ATOM   767  C CE3 . TRP A 1 97  ? -15.487 5.041  -6.960  1.00 28.14 ? 103 TRP B CE3 1 
ATOM   768  C CZ2 . TRP A 1 97  ? -17.604 6.886  -6.518  1.00 26.68 ? 103 TRP B CZ2 1 
ATOM   769  C CZ3 . TRP A 1 97  ? -16.738 4.916  -7.613  1.00 28.13 ? 103 TRP B CZ3 1 
ATOM   770  C CH2 . TRP A 1 97  ? -17.770 5.833  -7.383  1.00 27.17 ? 103 TRP B CH2 1 
ATOM   771  N N   . VAL A 1 98  ? -9.560  6.994  -5.210  1.00 28.82 ? 104 VAL B N   1 
ATOM   772  C CA  . VAL A 1 98  ? -8.176  6.537  -5.006  1.00 28.49 ? 104 VAL B CA  1 
ATOM   773  C C   . VAL A 1 98  ? -7.886  6.481  -3.514  1.00 28.59 ? 104 VAL B C   1 
ATOM   774  O O   . VAL A 1 98  ? -7.485  7.477  -2.933  1.00 27.62 ? 104 VAL B O   1 
ATOM   775  C CB  . VAL A 1 98  ? -7.164  7.452  -5.735  1.00 28.36 ? 104 VAL B CB  1 
ATOM   776  C CG1 . VAL A 1 98  ? -5.796  6.769  -5.853  1.00 28.75 ? 104 VAL B CG1 1 
ATOM   777  C CG2 . VAL A 1 98  ? -7.657  7.769  -7.140  1.00 29.43 ? 104 VAL B CG2 1 
ATOM   778  N N   . ASP A 1 99  ? -8.096  5.303  -2.908  1.00 29.49 ? 105 ASP B N   1 
ATOM   779  C CA  . ASP A 1 99  ? -7.975  5.089  -1.444  1.00 29.97 ? 105 ASP B CA  1 
ATOM   780  C C   . ASP A 1 99  ? -6.880  4.089  -1.124  1.00 29.84 ? 105 ASP B C   1 
ATOM   781  O O   . ASP A 1 99  ? -6.512  3.341  -1.993  1.00 29.77 ? 105 ASP B O   1 
ATOM   782  C CB  . ASP A 1 99  ? -9.298  4.547  -0.854  1.00 30.05 ? 105 ASP B CB  1 
ATOM   783  C CG  . ASP A 1 99  ? -10.513 5.321  -1.327  1.00 31.70 ? 105 ASP B CG  1 
ATOM   784  O OD1 . ASP A 1 99  ? -10.428 6.557  -1.422  1.00 34.39 ? 105 ASP B OD1 1 
ATOM   785  O OD2 . ASP A 1 99  ? -11.544 4.689  -1.626  1.00 32.84 ? 105 ASP B OD2 1 
ATOM   786  N N   . PRO A 1 100 ? -6.381  4.055  0.138   1.00 30.67 ? 106 PRO B N   1 
ATOM   787  C CA  . PRO A 1 100 ? -5.448  2.970  0.489   1.00 31.26 ? 106 PRO B CA  1 
ATOM   788  C C   . PRO A 1 100 ? -6.006  1.601  0.177   1.00 32.48 ? 106 PRO B C   1 
ATOM   789  O O   . PRO A 1 100 ? -7.135  1.291  0.556   1.00 32.25 ? 106 PRO B O   1 
ATOM   790  C CB  . PRO A 1 100 ? -5.221  3.149  2.010   1.00 31.28 ? 106 PRO B CB  1 
ATOM   791  C CG  . PRO A 1 100 ? -5.436  4.679  2.231   1.00 30.55 ? 106 PRO B CG  1 
ATOM   792  C CD  . PRO A 1 100 ? -6.592  5.000  1.270   1.00 30.53 ? 106 PRO B CD  1 
ATOM   793  N N   . TYR A 1 101 ? -5.203  0.800  -0.535  1.00 33.68 ? 107 TYR B N   1 
ATOM   794  C CA  . TYR A 1 101 ? -5.505  -0.615 -0.834  1.00 34.39 ? 107 TYR B CA  1 
ATOM   795  C C   . TYR A 1 101 ? -6.584  -0.859 -1.871  1.00 34.37 ? 107 TYR B C   1 
ATOM   796  O O   . TYR A 1 101 ? -6.794  -2.014 -2.256  1.00 35.50 ? 107 TYR B O   1 
ATOM   797  C CB  . TYR A 1 101 ? -5.843  -1.392 0.447   1.00 35.44 ? 107 TYR B CB  1 
ATOM   798  C CG  . TYR A 1 101 ? -4.780  -1.224 1.503   1.00 36.23 ? 107 TYR B CG  1 
ATOM   799  C CD1 . TYR A 1 101 ? -5.046  -0.531 2.688   1.00 37.16 ? 107 TYR B CD1 1 
ATOM   800  C CD2 . TYR A 1 101 ? -3.494  -1.731 1.301   1.00 36.58 ? 107 TYR B CD2 1 
ATOM   801  C CE1 . TYR A 1 101 ? -4.049  -0.365 3.665   1.00 37.63 ? 107 TYR B CE1 1 
ATOM   802  C CE2 . TYR A 1 101 ? -2.492  -1.563 2.256   1.00 37.17 ? 107 TYR B CE2 1 
ATOM   803  C CZ  . TYR A 1 101 ? -2.776  -0.881 3.438   1.00 36.69 ? 107 TYR B CZ  1 
ATOM   804  O OH  . TYR A 1 101 ? -1.783  -0.724 4.387   1.00 37.30 ? 107 TYR B OH  1 
ATOM   805  N N   . GLU A 1 102 ? -7.264  0.200  -2.318  1.00 32.85 ? 108 GLU B N   1 
ATOM   806  C CA  . GLU A 1 102 ? -8.301  0.045  -3.308  1.00 32.38 ? 108 GLU B CA  1 
ATOM   807  C C   . GLU A 1 102 ? -8.462  1.256  -4.225  1.00 31.53 ? 108 GLU B C   1 
ATOM   808  O O   . GLU A 1 102 ? -8.769  2.345  -3.751  1.00 30.79 ? 108 GLU B O   1 
ATOM   809  C CB  . GLU A 1 102 ? -9.634  -0.234 -2.623  1.00 32.76 ? 108 GLU B CB  1 
ATOM   810  C CG  . GLU A 1 102 ? -10.634 -0.936 -3.536  1.00 35.29 ? 108 GLU B CG  1 
ATOM   811  C CD  . GLU A 1 102 ? -12.077 -0.725 -3.126  1.00 37.69 ? 108 GLU B CD  1 
ATOM   812  O OE1 . GLU A 1 102 ? -12.462 0.406  -2.786  1.00 39.59 ? 108 GLU B OE1 1 
ATOM   813  O OE2 . GLU A 1 102 ? -12.839 -1.699 -3.165  1.00 40.89 ? 108 GLU B OE2 1 
ATOM   814  N N   . VAL A 1 103 ? -8.260  1.055  -5.531  1.00 30.56 ? 109 VAL B N   1 
ATOM   815  C CA  . VAL A 1 103 ? -8.646  2.055  -6.538  1.00 29.67 ? 109 VAL B CA  1 
ATOM   816  C C   . VAL A 1 103 ? -9.868  1.547  -7.307  1.00 30.17 ? 109 VAL B C   1 
ATOM   817  O O   . VAL A 1 103 ? -9.883  0.417  -7.808  1.00 29.14 ? 109 VAL B O   1 
ATOM   818  C CB  . VAL A 1 103 ? -7.515  2.371  -7.535  1.00 29.96 ? 109 VAL B CB  1 
ATOM   819  C CG1 . VAL A 1 103 ? -7.902  3.544  -8.435  1.00 28.89 ? 109 VAL B CG1 1 
ATOM   820  C CG2 . VAL A 1 103 ? -6.225  2.671  -6.817  1.00 27.75 ? 109 VAL B CG2 1 
ATOM   821  N N   . SER A 1 104 ? -10.902 2.382  -7.405  1.00 30.52 ? 110 SER B N   1 
ATOM   822  C CA  . SER A 1 104 ? -12.091 1.982  -8.130  1.00 31.12 ? 110 SER B CA  1 
ATOM   823  C C   . SER A 1 104 ? -12.646 3.158  -8.890  1.00 30.99 ? 110 SER B C   1 
ATOM   824  O O   . SER A 1 104 ? -12.242 4.296  -8.652  1.00 30.86 ? 110 SER B O   1 
ATOM   825  C CB  . SER A 1 104 ? -13.140 1.380  -7.167  1.00 31.31 ? 110 SER B CB  1 
ATOM   826  O OG  . SER A 1 104 ? -13.379 2.255  -6.063  1.00 34.37 ? 110 SER B OG  1 
ATOM   827  N N   . TYR A 1 105 ? -13.563 2.891  -9.816  1.00 30.97 ? 111 TYR B N   1 
ATOM   828  C CA  . TYR A 1 105 ? -14.160 3.969  -10.600 1.00 32.18 ? 111 TYR B CA  1 
ATOM   829  C C   . TYR A 1 105 ? -15.588 3.655  -11.074 1.00 31.90 ? 111 TYR B C   1 
ATOM   830  O O   . TYR A 1 105 ? -16.000 2.497  -11.122 1.00 31.52 ? 111 TYR B O   1 
ATOM   831  C CB  . TYR A 1 105 ? -13.281 4.306  -11.816 1.00 32.58 ? 111 TYR B CB  1 
ATOM   832  C CG  . TYR A 1 105 ? -13.264 3.244  -12.908 1.00 32.90 ? 111 TYR B CG  1 
ATOM   833  C CD1 . TYR A 1 105 ? -14.142 3.318  -13.990 1.00 33.41 ? 111 TYR B CD1 1 
ATOM   834  C CD2 . TYR A 1 105 ? -12.367 2.177  -12.860 1.00 34.91 ? 111 TYR B CD2 1 
ATOM   835  C CE1 . TYR A 1 105 ? -14.134 2.374  -15.008 1.00 32.90 ? 111 TYR B CE1 1 
ATOM   836  C CE2 . TYR A 1 105 ? -12.343 1.204  -13.877 1.00 35.61 ? 111 TYR B CE2 1 
ATOM   837  C CZ  . TYR A 1 105 ? -13.239 1.315  -14.952 1.00 35.78 ? 111 TYR B CZ  1 
ATOM   838  O OH  . TYR A 1 105 ? -13.234 0.368  -15.972 1.00 35.15 ? 111 TYR B OH  1 
ATOM   839  N N   . ARG A 1 106 ? -16.307 4.707  -11.441 1.00 31.92 ? 112 ARG B N   1 
ATOM   840  C CA  . ARG A 1 106 ? -17.593 4.578  -12.123 1.00 32.58 ? 112 ARG B CA  1 
ATOM   841  C C   . ARG A 1 106 ? -17.649 5.535  -13.323 1.00 33.13 ? 112 ARG B C   1 
ATOM   842  O O   . ARG A 1 106 ? -17.280 6.712  -13.217 1.00 32.85 ? 112 ARG B O   1 
ATOM   843  C CB  . ARG A 1 106 ? -18.743 4.855  -11.150 1.00 32.25 ? 112 ARG B CB  1 
ATOM   844  C CG  . ARG A 1 106 ? -20.139 4.741  -11.730 1.00 32.35 ? 112 ARG B CG  1 
ATOM   845  C CD  . ARG A 1 106 ? -21.184 5.151  -10.676 1.00 31.75 ? 112 ARG B CD  1 
ATOM   846  N NE  . ARG A 1 106 ? -20.962 6.503  -10.193 1.00 28.97 ? 112 ARG B NE  1 
ATOM   847  C CZ  . ARG A 1 106 ? -21.342 6.959  -8.993  1.00 30.64 ? 112 ARG B CZ  1 
ATOM   848  N NH1 . ARG A 1 106 ? -22.020 6.184  -8.145  1.00 28.14 ? 112 ARG B NH1 1 
ATOM   849  N NH2 . ARG A 1 106 ? -21.066 8.217  -8.647  1.00 29.53 ? 112 ARG B NH2 1 
ATOM   850  N N   . ILE A 1 107 ? -18.048 5.003  -14.477 1.00 34.32 ? 113 ILE B N   1 
ATOM   851  C CA  . ILE A 1 107 ? -18.407 5.839  -15.626 1.00 35.24 ? 113 ILE B CA  1 
ATOM   852  C C   . ILE A 1 107 ? -19.939 6.097  -15.598 1.00 35.49 ? 113 ILE B C   1 
ATOM   853  O O   . ILE A 1 107 ? -20.743 5.169  -15.651 1.00 35.88 ? 113 ILE B O   1 
ATOM   854  C CB  . ILE A 1 107 ? -17.948 5.209  -16.991 1.00 35.61 ? 113 ILE B CB  1 
ATOM   855  C CG1 . ILE A 1 107 ? -16.421 5.008  -17.014 1.00 35.38 ? 113 ILE B CG1 1 
ATOM   856  C CG2 . ILE A 1 107 ? -18.416 6.110  -18.186 1.00 35.99 ? 113 ILE B CG2 1 
ATOM   857  C CD1 . ILE A 1 107 ? -15.862 4.034  -18.090 1.00 35.19 ? 113 ILE B CD1 1 
ATOM   858  N N   . GLY A 1 108 ? -20.340 7.350  -15.484 1.00 35.69 ? 114 GLY B N   1 
ATOM   859  C CA  . GLY A 1 108 ? -21.758 7.675  -15.440 1.00 36.07 ? 114 GLY B CA  1 
ATOM   860  C C   . GLY A 1 108 ? -22.333 7.535  -14.041 1.00 35.77 ? 114 GLY B C   1 
ATOM   861  O O   . GLY A 1 108 ? -22.002 6.611  -13.315 1.00 34.84 ? 114 GLY B O   1 
ATOM   862  N N   . GLU A 1 109 ? -23.186 8.472  -13.668 1.00 36.41 ? 115 GLU B N   1 
ATOM   863  C CA  . GLU A 1 109 ? -23.984 8.368  -12.450 1.00 37.50 ? 115 GLU B CA  1 
ATOM   864  C C   . GLU A 1 109 ? -24.524 6.961  -12.145 1.00 37.89 ? 115 GLU B C   1 
ATOM   865  O O   . GLU A 1 109 ? -24.634 6.586  -10.979 1.00 38.33 ? 115 GLU B O   1 
ATOM   866  C CB  . GLU A 1 109 ? -25.170 9.285  -12.587 1.00 37.45 ? 115 GLU B CB  1 
ATOM   867  C CG  . GLU A 1 109 ? -24.846 10.718 -12.414 1.00 40.70 ? 115 GLU B CG  1 
ATOM   868  C CD  . GLU A 1 109 ? -26.100 11.548 -12.270 1.00 45.20 ? 115 GLU B CD  1 
ATOM   869  O OE1 . GLU A 1 109 ? -27.204 10.970 -12.472 1.00 44.23 ? 115 GLU B OE1 1 
ATOM   870  O OE2 . GLU A 1 109 ? -25.976 12.764 -11.950 1.00 47.53 ? 115 GLU B OE2 1 
ATOM   871  N N   . ASP A 1 110 ? -24.865 6.190  -13.178 1.00 37.88 ? 116 ASP B N   1 
ATOM   872  C CA  . ASP A 1 110 ? -25.500 4.885  -12.973 1.00 38.86 ? 116 ASP B CA  1 
ATOM   873  C C   . ASP A 1 110 ? -24.728 3.688  -13.561 1.00 38.44 ? 116 ASP B C   1 
ATOM   874  O O   . ASP A 1 110 ? -25.273 2.571  -13.687 1.00 37.67 ? 116 ASP B O   1 
ATOM   875  C CB  . ASP A 1 110 ? -26.928 4.901  -13.518 1.00 39.54 ? 116 ASP B CB  1 
ATOM   876  C CG  . ASP A 1 110 ? -27.858 5.786  -12.696 1.00 43.10 ? 116 ASP B CG  1 
ATOM   877  O OD1 . ASP A 1 110 ? -27.749 5.821  -11.433 1.00 46.34 ? 116 ASP B OD1 1 
ATOM   878  O OD2 . ASP A 1 110 ? -28.712 6.451  -13.329 1.00 47.90 ? 116 ASP B OD2 1 
ATOM   879  N N   . GLY A 1 111 ? -23.460 3.925  -13.912 1.00 37.75 ? 117 GLY B N   1 
ATOM   880  C CA  . GLY A 1 111 ? -22.586 2.865  -14.403 1.00 36.93 ? 117 GLY B CA  1 
ATOM   881  C C   . GLY A 1 111 ? -22.192 1.969  -13.251 1.00 36.64 ? 117 GLY B C   1 
ATOM   882  O O   . GLY A 1 111 ? -22.433 2.298  -12.081 1.00 36.72 ? 117 GLY B O   1 
ATOM   883  N N   . SER A 1 112 ? -21.621 0.820  -13.585 1.00 36.72 ? 118 SER B N   1 
ATOM   884  C CA  . SER A 1 112 ? -21.052 -0.084 -12.592 1.00 37.27 ? 118 SER B CA  1 
ATOM   885  C C   . SER A 1 112 ? -19.793 0.480  -11.916 1.00 37.68 ? 118 SER B C   1 
ATOM   886  O O   . SER A 1 112 ? -19.034 1.262  -12.518 1.00 36.97 ? 118 SER B O   1 
ATOM   887  C CB  . SER A 1 112 ? -20.737 -1.448 -13.221 1.00 37.35 ? 118 SER B CB  1 
ATOM   888  O OG  . SER A 1 112 ? -20.198 -1.315 -14.529 1.00 37.44 ? 118 SER B OG  1 
ATOM   889  N N   . ILE A 1 113 ? -19.619 0.088  -10.646 1.00 38.44 ? 119 ILE B N   1 
ATOM   890  C CA  . ILE A 1 113 ? -18.384 0.279  -9.893  1.00 38.60 ? 119 ILE B CA  1 
ATOM   891  C C   . ILE A 1 113 ? -17.369 -0.765 -10.373 1.00 39.08 ? 119 ILE B C   1 
ATOM   892  O O   . ILE A 1 113 ? -17.593 -1.955 -10.225 1.00 39.83 ? 119 ILE B O   1 
ATOM   893  C CB  . ILE A 1 113 ? -18.637 0.056  -8.375  1.00 38.40 ? 119 ILE B CB  1 
ATOM   894  C CG1 . ILE A 1 113 ? -19.887 0.802  -7.878  1.00 38.25 ? 119 ILE B CG1 1 
ATOM   895  C CG2 . ILE A 1 113 ? -17.393 0.368  -7.546  1.00 38.84 ? 119 ILE B CG2 1 
ATOM   896  C CD1 . ILE A 1 113 ? -19.873 2.300  -8.090  1.00 39.06 ? 119 ILE B CD1 1 
ATOM   897  N N   . CYS A 1 114 ? -16.259 -0.346 -10.971 1.00 39.81 ? 120 CYS B N   1 
ATOM   898  C CA  . CYS A 1 114 ? -15.201 -1.309 -11.291 1.00 39.83 ? 120 CYS B CA  1 
ATOM   899  C C   . CYS A 1 114 ? -14.029 -1.096 -10.357 1.00 39.02 ? 120 CYS B C   1 
ATOM   900  O O   . CYS A 1 114 ? -13.757 0.030  -9.963  1.00 39.18 ? 120 CYS B O   1 
ATOM   901  C CB  . CYS A 1 114 ? -14.761 -1.163 -12.734 1.00 40.03 ? 120 CYS B CB  1 
ATOM   902  S SG  . CYS A 1 114 ? -16.191 -0.908 -13.837 1.00 45.78 ? 120 CYS B SG  1 
ATOM   903  N N   . VAL A 1 115 ? -13.364 -2.177 -9.973  1.00 38.30 ? 121 VAL B N   1 
ATOM   904  C CA  . VAL A 1 115 ? -12.143 -2.107 -9.187  1.00 37.60 ? 121 VAL B CA  1 
ATOM   905  C C   . VAL A 1 115 ? -10.936 -2.138 -10.155 1.00 37.33 ? 121 VAL B C   1 
ATOM   906  O O   . VAL A 1 115 ? -10.833 -3.035 -10.989 1.00 37.21 ? 121 VAL B O   1 
ATOM   907  C CB  . VAL A 1 115 ? -12.057 -3.309 -8.201  1.00 38.27 ? 121 VAL B CB  1 
ATOM   908  C CG1 . VAL A 1 115 ? -10.681 -3.399 -7.556  1.00 36.47 ? 121 VAL B CG1 1 
ATOM   909  C CG2 . VAL A 1 115 ? -13.160 -3.224 -7.128  1.00 38.18 ? 121 VAL B CG2 1 
ATOM   910  N N   . LEU A 1 116 ? -10.045 -1.157 -10.064 1.00 36.42 ? 122 LEU B N   1 
ATOM   911  C CA  . LEU A 1 116 ? -8.800  -1.172 -10.837 1.00 35.76 ? 122 LEU B CA  1 
ATOM   912  C C   . LEU A 1 116 ? -7.706  -1.938 -10.109 1.00 35.36 ? 122 LEU B C   1 
ATOM   913  O O   . LEU A 1 116 ? -6.937  -2.684 -10.717 1.00 35.97 ? 122 LEU B O   1 
ATOM   914  C CB  . LEU A 1 116 ? -8.320  0.249  -11.089 1.00 35.13 ? 122 LEU B CB  1 
ATOM   915  C CG  . LEU A 1 116 ? -9.154  1.029  -12.089 1.00 35.80 ? 122 LEU B CG  1 
ATOM   916  C CD1 . LEU A 1 116 ? -8.809  2.494  -11.967 1.00 35.27 ? 122 LEU B CD1 1 
ATOM   917  C CD2 . LEU A 1 116 ? -8.827  0.504  -13.506 1.00 34.70 ? 122 LEU B CD2 1 
ATOM   918  N N   . TYR A 1 117 ? -7.667  -1.762 -8.799  1.00 34.47 ? 123 TYR B N   1 
ATOM   919  C CA  . TYR A 1 117 ? -6.548  -2.176 -7.983  1.00 35.03 ? 123 TYR B CA  1 
ATOM   920  C C   . TYR A 1 117 ? -7.120  -2.569 -6.642  1.00 36.13 ? 123 TYR B C   1 
ATOM   921  O O   . TYR A 1 117 ? -7.926  -1.854 -6.071  1.00 35.62 ? 123 TYR B O   1 
ATOM   922  C CB  . TYR A 1 117 ? -5.533  -1.001 -7.826  1.00 33.57 ? 123 TYR B CB  1 
ATOM   923  C CG  . TYR A 1 117 ? -4.382  -1.215 -6.845  1.00 32.31 ? 123 TYR B CG  1 
ATOM   924  C CD1 . TYR A 1 117 ? -3.120  -1.621 -7.284  1.00 29.09 ? 123 TYR B CD1 1 
ATOM   925  C CD2 . TYR A 1 117 ? -4.554  -0.971 -5.482  1.00 30.96 ? 123 TYR B CD2 1 
ATOM   926  C CE1 . TYR A 1 117 ? -2.079  -1.824 -6.383  1.00 29.62 ? 123 TYR B CE1 1 
ATOM   927  C CE2 . TYR A 1 117 ? -3.520  -1.161 -4.578  1.00 31.95 ? 123 TYR B CE2 1 
ATOM   928  C CZ  . TYR A 1 117 ? -2.276  -1.584 -5.030  1.00 31.18 ? 123 TYR B CZ  1 
ATOM   929  O OH  . TYR A 1 117 ? -1.253  -1.763 -4.103  1.00 32.19 ? 123 TYR B OH  1 
ATOM   930  N N   . GLU A 1 118 ? -6.716  -3.732 -6.167  1.00 38.49 ? 124 GLU B N   1 
ATOM   931  C CA  . GLU A 1 118 ? -6.891  -4.088 -4.793  1.00 41.21 ? 124 GLU B CA  1 
ATOM   932  C C   . GLU A 1 118 ? -5.679  -4.890 -4.332  1.00 41.90 ? 124 GLU B C   1 
ATOM   933  O O   . GLU A 1 118 ? -5.117  -5.697 -5.085  1.00 41.24 ? 124 GLU B O   1 
ATOM   934  C CB  . GLU A 1 118 ? -8.211  -4.814 -4.573  1.00 41.63 ? 124 GLU B CB  1 
ATOM   935  C CG  . GLU A 1 118 ? -8.295  -6.258 -5.044  1.00 43.40 ? 124 GLU B CG  1 
ATOM   936  C CD  . GLU A 1 118 ? -9.755  -6.741 -5.122  1.00 43.81 ? 124 GLU B CD  1 
ATOM   937  O OE1 . GLU A 1 118 ? -10.675 -5.956 -4.736  1.00 45.02 ? 124 GLU B OE1 1 
ATOM   938  O OE2 . GLU A 1 118 ? -9.970  -7.895 -5.585  1.00 45.89 ? 124 GLU B OE2 1 
ATOM   939  N N   . GLU A 1 119 ? -5.250  -4.594 -3.106  1.00 42.88 ? 125 GLU B N   1 
ATOM   940  C CA  . GLU A 1 119 ? -4.127  -5.276 -2.481  1.00 44.04 ? 125 GLU B CA  1 
ATOM   941  C C   . GLU A 1 119 ? -4.393  -5.355 -0.985  1.00 45.21 ? 125 GLU B C   1 
ATOM   942  O O   . GLU A 1 119 ? -5.051  -4.473 -0.422  1.00 46.12 ? 125 GLU B O   1 
ATOM   943  C CB  . GLU A 1 119 ? -2.807  -4.548 -2.762  1.00 43.71 ? 125 GLU B CB  1 
ATOM   944  C CG  . GLU A 1 119 ? -1.539  -5.349 -2.429  1.00 43.09 ? 125 GLU B CG  1 
ATOM   945  C CD  . GLU A 1 119 ? -1.579  -6.747 -3.006  1.00 43.51 ? 125 GLU B CD  1 
ATOM   946  O OE1 . GLU A 1 119 ? -2.299  -7.589 -2.437  1.00 45.00 ? 125 GLU B OE1 1 
ATOM   947  O OE2 . GLU A 1 119 ? -0.910  -7.002 -4.029  1.00 42.48 ? 125 GLU B OE2 1 
ATOM   948  N N   . ALA A 1 120 ? -3.904  -6.425 -0.362  1.00 46.42 ? 126 ALA B N   1 
ATOM   949  C CA  . ALA A 1 120 ? -4.026  -6.654 1.075   1.00 47.39 ? 126 ALA B CA  1 
ATOM   950  C C   . ALA A 1 120 ? -3.001  -5.824 1.877   1.00 47.88 ? 126 ALA B C   1 
ATOM   951  O O   . ALA A 1 120 ? -1.839  -5.686 1.457   1.00 48.02 ? 126 ALA B O   1 
ATOM   952  C CB  . ALA A 1 120 ? -3.852  -8.148 1.371   1.00 47.62 ? 126 ALA B CB  1 
ATOM   953  N N   . PRO A 1 121 ? -3.429  -5.256 3.029   1.00 48.50 ? 127 PRO B N   1 
ATOM   954  C CA  . PRO A 1 121 ? -2.531  -4.487 3.914   1.00 48.99 ? 127 PRO B CA  1 
ATOM   955  C C   . PRO A 1 121 ? -1.386  -5.306 4.521   1.00 49.83 ? 127 PRO B C   1 
ATOM   956  O O   . PRO A 1 121 ? -1.561  -6.492 4.845   1.00 50.34 ? 127 PRO B O   1 
ATOM   957  C CB  . PRO A 1 121 ? -3.470  -3.997 5.017   1.00 49.06 ? 127 PRO B CB  1 
ATOM   958  C CG  . PRO A 1 121 ? -4.849  -4.036 4.375   1.00 48.53 ? 127 PRO B CG  1 
ATOM   959  C CD  . PRO A 1 121 ? -4.815  -5.256 3.533   1.00 48.20 ? 127 PRO B CD  1 
HETATM 960  O O   . HOH B 2 .   ? -8.777  16.853 -7.396  1.00 35.40 ? 129 HOH B O   1 
HETATM 961  O O   . HOH B 2 .   ? 1.225   -6.237 5.176   1.00 43.06 ? 130 HOH B O   1 
HETATM 962  O O   . HOH B 2 .   ? -11.114 8.483  -3.317  1.00 28.29 ? 131 HOH B O   1 
HETATM 963  O O   . HOH B 2 .   ? -5.098  5.996  -30.830 1.00 54.37 ? 132 HOH B O   1 
HETATM 964  O O   . HOH B 2 .   ? -1.613  16.985 1.299   1.00 35.23 ? 133 HOH B O   1 
HETATM 965  O O   . HOH B 2 .   ? -18.445 14.709 -17.772 1.00 33.17 ? 134 HOH B O   1 
HETATM 966  O O   . HOH B 2 .   ? -12.420 16.248 -8.819  1.00 32.05 ? 135 HOH B O   1 
HETATM 967  O O   . HOH B 2 .   ? -11.398 22.649 -14.626 1.00 45.22 ? 136 HOH B O   1 
HETATM 968  O O   . HOH B 2 .   ? -1.448  1.913  1.250   1.00 42.34 ? 137 HOH B O   1 
HETATM 969  O O   . HOH B 2 .   ? -21.667 -2.095 -9.848  1.00 44.15 ? 138 HOH B O   1 
HETATM 970  O O   . HOH B 2 .   ? -6.371  20.893 -19.773 1.00 30.24 ? 139 HOH B O   1 
HETATM 971  O O   . HOH B 2 .   ? -9.334  17.383 -3.709  1.00 41.03 ? 140 HOH B O   1 
HETATM 972  O O   . HOH B 2 .   ? -7.323  7.030  4.086   1.00 36.40 ? 141 HOH B O   1 
HETATM 973  O O   . HOH B 2 .   ? -12.607 3.958  6.742   1.00 41.64 ? 142 HOH B O   1 
HETATM 974  O O   . HOH B 2 .   ? 1.013   5.205  -13.568 1.00 38.43 ? 143 HOH B O   1 
HETATM 975  O O   . HOH B 2 .   ? -0.496  23.418 -16.279 1.00 34.99 ? 144 HOH B O   1 
HETATM 976  O O   . HOH B 2 .   ? -10.987 26.585 -17.629 1.00 47.02 ? 145 HOH B O   1 
HETATM 977  O O   . HOH B 2 .   ? -1.895  11.960 5.890   1.00 32.44 ? 146 HOH B O   1 
HETATM 978  O O   . HOH B 2 .   ? -25.198 6.700  -16.129 1.00 34.65 ? 147 HOH B O   1 
HETATM 979  O O   . HOH B 2 .   ? -15.500 19.642 -25.180 1.00 40.51 ? 148 HOH B O   1 
HETATM 980  O O   . HOH B 2 .   ? -18.803 12.945 -11.650 1.00 38.57 ? 149 HOH B O   1 
HETATM 981  O O   . HOH B 2 .   ? -4.005  5.371  8.991   1.00 43.70 ? 150 HOH B O   1 
HETATM 982  O O   . HOH B 2 .   ? 8.445   11.557 -22.229 1.00 39.07 ? 151 HOH B O   1 
HETATM 983  O O   . HOH B 2 .   ? -11.650 2.234  -4.245  1.00 41.87 ? 152 HOH B O   1 
HETATM 984  O O   . HOH B 2 .   ? -12.835 14.283 2.166   1.00 41.95 ? 153 HOH B O   1 
HETATM 985  O O   . HOH B 2 .   ? -8.319  6.784  16.498  1.00 46.06 ? 154 HOH B O   1 
HETATM 986  O O   . HOH B 2 .   ? 6.685   14.233 -16.099 1.00 41.02 ? 155 HOH B O   1 
HETATM 987  O O   . HOH B 2 .   ? -15.289 15.332 -4.845  1.00 47.95 ? 156 HOH B O   1 
HETATM 988  O O   . HOH B 2 .   ? -23.821 4.313  -8.448  1.00 36.76 ? 157 HOH B O   1 
HETATM 989  O O   . HOH B 2 .   ? -14.869 13.764 -19.849 1.00 32.15 ? 158 HOH B O   1 
HETATM 990  O O   . HOH B 2 .   ? -10.195 20.115 -2.314  1.00 50.46 ? 159 HOH B O   1 
HETATM 991  O O   . HOH B 2 .   ? -3.096  20.999 -7.183  1.00 45.59 ? 160 HOH B O   1 
HETATM 992  O O   . HOH B 2 .   ? -18.682 21.963 -10.942 1.00 48.30 ? 161 HOH B O   1 
HETATM 993  O O   . HOH B 2 .   ? -4.936  22.685 -9.663  1.00 58.85 ? 162 HOH B O   1 
HETATM 994  O O   . HOH B 2 .   ? -12.037 15.585 -5.088  1.00 48.62 ? 163 HOH B O   1 
HETATM 995  O O   . HOH B 2 .   ? -9.133  24.235 -13.274 1.00 37.16 ? 164 HOH B O   1 
HETATM 996  O O   . HOH B 2 .   ? 2.814   -1.554 2.280   1.00 46.50 ? 165 HOH B O   1 
HETATM 997  O O   . HOH B 2 .   ? -6.695  23.454 -13.134 1.00 39.89 ? 166 HOH B O   1 
HETATM 998  O O   . HOH B 2 .   ? -8.610  15.062 -5.784  1.00 38.29 ? 167 HOH B O   1 
HETATM 999  O O   . HOH B 2 .   ? -8.889  14.426 3.967   1.00 37.81 ? 168 HOH B O   1 
HETATM 1000 O O   . HOH B 2 .   ? 1.967   19.623 -8.869  1.00 44.60 ? 169 HOH B O   1 
HETATM 1001 O O   . HOH B 2 .   ? -17.411 -3.378 -7.295  1.00 50.31 ? 170 HOH B O   1 
HETATM 1002 O O   . HOH B 2 .   ? -16.406 -2.005 -4.643  1.00 44.20 ? 171 HOH B O   1 
HETATM 1003 O O   . HOH B 2 .   ? -5.537  1.061  -15.462 1.00 50.13 ? 172 HOH B O   1 
HETATM 1004 O O   . HOH B 2 .   ? 2.807   6.141  -20.120 1.00 42.90 ? 173 HOH B O   1 
HETATM 1005 O O   . HOH B 2 .   ? -8.089  1.072  -29.374 1.00 39.25 ? 174 HOH B O   1 
HETATM 1006 O O   . HOH B 2 .   ? -14.459 -4.871 -12.146 1.00 43.36 ? 175 HOH B O   1 
HETATM 1007 O O   . HOH B 2 .   ? -16.662 15.477 -19.869 1.00 35.77 ? 176 HOH B O   1 
HETATM 1008 O O   . HOH B 2 .   ? -18.019 15.901 -22.142 1.00 45.46 ? 177 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   7   7   THR THR B . n 
A 1 2   ASP 2   8   8   ASP ASP B . n 
A 1 3   MET 3   9   9   MET MET B . n 
A 1 4   LEU 4   10  10  LEU LEU B . n 
A 1 5   PRO 5   11  11  PRO PRO B . n 
A 1 6   GLU 6   12  12  GLU GLU B . n 
A 1 7   ILE 7   13  13  ILE ILE B . n 
A 1 8   ALA 8   14  14  ALA ALA B . n 
A 1 9   ALA 9   15  15  ALA ALA B . n 
A 1 10  ALA 10  16  16  ALA ALA B . n 
A 1 11  VAL 11  17  17  VAL VAL B . n 
A 1 12  GLY 12  18  18  GLY GLY B . n 
A 1 13  PHE 13  19  19  PHE PHE B . n 
A 1 14  LEU 14  20  20  LEU LEU B . n 
A 1 15  SER 15  21  21  SER SER B . n 
A 1 16  SER 16  22  22  SER SER B . n 
A 1 17  LEU 17  23  23  LEU LEU B . n 
A 1 18  LEU 18  24  24  LEU LEU B . n 
A 1 19  ARG 19  25  25  ARG ARG B . n 
A 1 20  THR 20  26  26  THR THR B . n 
A 1 21  ARG 21  27  27  ARG ARG B . n 
A 1 22  GLY 22  28  28  GLY GLY B . n 
A 1 23  CYS 23  29  29  CYS CYS B . n 
A 1 24  VAL 24  30  30  VAL VAL B . n 
A 1 25  SER 25  31  31  SER SER B . n 
A 1 26  GLU 26  32  32  GLU GLU B . n 
A 1 27  GLN 27  33  33  GLN GLN B . n 
A 1 28  ARG 28  34  34  ARG ARG B . n 
A 1 29  LEU 29  35  35  LEU LEU B . n 
A 1 30  LYS 30  36  36  LYS LYS B . n 
A 1 31  VAL 31  37  37  VAL VAL B . n 
A 1 32  PHE 32  38  38  PHE PHE B . n 
A 1 33  SER 33  39  39  SER SER B . n 
A 1 34  GLY 34  40  40  GLY GLY B . n 
A 1 35  ALA 35  41  41  ALA ALA B . n 
A 1 36  LEU 36  42  42  LEU LEU B . n 
A 1 37  GLN 37  43  43  GLN GLN B . n 
A 1 38  GLU 38  44  44  GLU GLU B . n 
A 1 39  ALA 39  45  45  ALA ALA B . n 
A 1 40  LEU 40  46  46  LEU LEU B . n 
A 1 41  THR 41  47  47  THR THR B . n 
A 1 42  GLU 42  48  48  GLU GLU B . n 
A 1 43  HIS 43  49  49  HIS HIS B . n 
A 1 44  TYR 44  50  50  TYR TYR B . n 
A 1 45  LYS 45  51  51  LYS LYS B . n 
A 1 46  HIS 46  52  52  HIS HIS B . n 
A 1 47  HIS 47  53  53  HIS HIS B . n 
A 1 48  TRP 48  54  54  TRP TRP B . n 
A 1 49  PHE 49  55  55  PHE PHE B . n 
A 1 50  PRO 50  56  56  PRO PRO B . n 
A 1 51  GLU 51  57  57  GLU GLU B . n 
A 1 52  LYS 52  58  58  LYS LYS B . n 
A 1 53  PRO 53  59  59  PRO PRO B . n 
A 1 54  SER 54  60  60  SER SER B . n 
A 1 55  LYS 55  61  61  LYS LYS B . n 
A 1 56  GLY 56  62  62  GLY GLY B . n 
A 1 57  SER 57  63  63  SER SER B . n 
A 1 58  GLY 58  64  64  GLY GLY B . n 
A 1 59  TYR 59  65  65  TYR TYR B . n 
A 1 60  ARG 60  66  66  ARG ARG B . n 
A 1 61  CYS 61  67  67  CYS CYS B . n 
A 1 62  ILE 62  68  68  ILE ILE B . n 
A 1 63  ARG 63  69  69  ARG ARG B . n 
A 1 64  ILE 64  70  70  ILE ILE B . n 
A 1 65  ASN 65  71  71  ASN ASN B . n 
A 1 66  HIS 66  72  72  HIS HIS B . n 
A 1 67  LYS 67  73  73  LYS LYS B . n 
A 1 68  MET 68  74  74  MET MET B . n 
A 1 69  ASP 69  75  75  ASP ASP B . n 
A 1 70  PRO 70  76  76  PRO PRO B . n 
A 1 71  ILE 71  77  77  ILE ILE B . n 
A 1 72  ILE 72  78  78  ILE ILE B . n 
A 1 73  SER 73  79  79  SER SER B . n 
A 1 74  ARG 74  80  80  ARG ARG B . n 
A 1 75  VAL 75  81  81  VAL VAL B . n 
A 1 76  ALA 76  82  82  ALA ALA B . n 
A 1 77  SER 77  83  83  SER SER B . n 
A 1 78  GLN 78  84  84  GLN GLN B . n 
A 1 79  ILE 79  85  85  ILE ILE B . n 
A 1 80  GLY 80  86  86  GLY GLY B . n 
A 1 81  LEU 81  87  87  LEU LEU B . n 
A 1 82  SER 82  88  88  SER SER B . n 
A 1 83  GLN 83  89  89  GLN GLN B . n 
A 1 84  PRO 84  90  90  PRO PRO B . n 
A 1 85  GLN 85  91  91  GLN GLN B . n 
A 1 86  LEU 86  92  92  LEU LEU B . n 
A 1 87  HIS 87  93  93  HIS HIS B . n 
A 1 88  GLN 88  94  94  GLN GLN B . n 
A 1 89  LEU 89  95  95  LEU LEU B . n 
A 1 90  LEU 90  96  96  LEU LEU B . n 
A 1 91  PRO 91  97  97  PRO PRO B . n 
A 1 92  SER 92  98  98  SER SER B . n 
A 1 93  GLU 93  99  99  GLU GLU B . n 
A 1 94  LEU 94  100 100 LEU LEU B . n 
A 1 95  THR 95  101 101 THR THR B . n 
A 1 96  LEU 96  102 102 LEU LEU B . n 
A 1 97  TRP 97  103 103 TRP TRP B . n 
A 1 98  VAL 98  104 104 VAL VAL B . n 
A 1 99  ASP 99  105 105 ASP ASP B . n 
A 1 100 PRO 100 106 106 PRO PRO B . n 
A 1 101 TYR 101 107 107 TYR TYR B . n 
A 1 102 GLU 102 108 108 GLU GLU B . n 
A 1 103 VAL 103 109 109 VAL VAL B . n 
A 1 104 SER 104 110 110 SER SER B . n 
A 1 105 TYR 105 111 111 TYR TYR B . n 
A 1 106 ARG 106 112 112 ARG ARG B . n 
A 1 107 ILE 107 113 113 ILE ILE B . n 
A 1 108 GLY 108 114 114 GLY GLY B . n 
A 1 109 GLU 109 115 115 GLU GLU B . n 
A 1 110 ASP 110 116 116 ASP ASP B . n 
A 1 111 GLY 111 117 117 GLY GLY B . n 
A 1 112 SER 112 118 118 SER SER B . n 
A 1 113 ILE 113 119 119 ILE ILE B . n 
A 1 114 CYS 114 120 120 CYS CYS B . n 
A 1 115 VAL 115 121 121 VAL VAL B . n 
A 1 116 LEU 116 122 122 LEU LEU B . n 
A 1 117 TYR 117 123 123 TYR TYR B . n 
A 1 118 GLU 118 124 124 GLU GLU B . n 
A 1 119 GLU 119 125 125 GLU GLU B . n 
A 1 120 ALA 120 126 126 ALA ALA B . n 
A 1 121 PRO 121 127 127 PRO PRO B . n 
A 1 122 LEU 122 128 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  129 1  HOH HOH B . 
B 2 HOH 2  130 2  HOH HOH B . 
B 2 HOH 3  131 3  HOH HOH B . 
B 2 HOH 4  132 4  HOH HOH B . 
B 2 HOH 5  133 5  HOH HOH B . 
B 2 HOH 6  134 6  HOH HOH B . 
B 2 HOH 7  135 7  HOH HOH B . 
B 2 HOH 8  136 8  HOH HOH B . 
B 2 HOH 9  137 9  HOH HOH B . 
B 2 HOH 10 138 10 HOH HOH B . 
B 2 HOH 11 139 11 HOH HOH B . 
B 2 HOH 12 140 12 HOH HOH B . 
B 2 HOH 13 141 13 HOH HOH B . 
B 2 HOH 14 142 14 HOH HOH B . 
B 2 HOH 15 143 15 HOH HOH B . 
B 2 HOH 16 144 16 HOH HOH B . 
B 2 HOH 17 145 17 HOH HOH B . 
B 2 HOH 18 146 19 HOH HOH B . 
B 2 HOH 19 147 20 HOH HOH B . 
B 2 HOH 20 148 21 HOH HOH B . 
B 2 HOH 21 149 22 HOH HOH B . 
B 2 HOH 22 150 23 HOH HOH B . 
B 2 HOH 23 151 24 HOH HOH B . 
B 2 HOH 24 152 25 HOH HOH B . 
B 2 HOH 25 153 26 HOH HOH B . 
B 2 HOH 26 154 27 HOH HOH B . 
B 2 HOH 27 155 28 HOH HOH B . 
B 2 HOH 28 156 29 HOH HOH B . 
B 2 HOH 29 157 30 HOH HOH B . 
B 2 HOH 30 158 31 HOH HOH B . 
B 2 HOH 31 159 32 HOH HOH B . 
B 2 HOH 32 160 33 HOH HOH B . 
B 2 HOH 33 161 34 HOH HOH B . 
B 2 HOH 34 162 35 HOH HOH B . 
B 2 HOH 35 163 36 HOH HOH B . 
B 2 HOH 36 164 37 HOH HOH B . 
B 2 HOH 37 165 38 HOH HOH B . 
B 2 HOH 38 166 39 HOH HOH B . 
B 2 HOH 39 167 40 HOH HOH B . 
B 2 HOH 40 168 41 HOH HOH B . 
B 2 HOH 41 169 42 HOH HOH B . 
B 2 HOH 42 170 43 HOH HOH B . 
B 2 HOH 43 171 44 HOH HOH B . 
B 2 HOH 44 172 45 HOH HOH B . 
B 2 HOH 45 173 1  HOH HOH B . 
B 2 HOH 46 174 2  HOH HOH B . 
B 2 HOH 47 175 3  HOH HOH B . 
B 2 HOH 48 176 4  HOH HOH B . 
B 2 HOH 49 177 1  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-11-11 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
HKL-2000 'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
PHASER   phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN B 71  ? ? -120.80 -113.32 
2 1 TYR B 107 ? ? 73.56   -6.96   
3 1 GLU B 115 ? ? -38.99  -34.38  
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     LEU 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      128 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    LEU 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     122 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#