data_3E1J
# 
_entry.id   3E1J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3E1J         
RCSB  RCSB048757   
WWPDB D_1000048757 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3E1L . unspecified 
PDB 3E1M . unspecified 
PDB 3E1N . unspecified 
PDB 3E1O . unspecified 
PDB 3E1P . unspecified 
PDB 3E1Q . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3E1J 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Crow, A.'    1 
'Lawson, T.'  2 
'Lewin, A.'   3 
'Moore, G.R.' 4 
'Le Brun, N.' 5 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for iron mineralization by bacterioferritin' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            131 
_citation.page_first                6808 
_citation.page_last                 6813 
_citation.year                      2009 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19391621 
_citation.pdbx_database_id_DOI      10.1021/ja8093444 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Crow, A.'      1 
primary 'Lawson, T.L.'  2 
primary 'Lewin, A.'     3 
primary 'Moore, G.R.'   4 
primary 'Le Brun, N.E.' 5 
# 
_cell.entry_id           3E1J 
_cell.length_a           208.216 
_cell.length_b           208.216 
_cell.length_c           142.457 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              96 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3E1J 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Bacterioferritin                  18518.016 12  ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                     96.063    16  ? ? ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   6   ? ? ? ? 
4 water       nat water                             18.015    399 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BFR, Cytochrome b-1, Cytochrome b-557' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIG
EDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIG
EDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLY n 
1 4   ASP n 
1 5   THR n 
1 6   LYS n 
1 7   VAL n 
1 8   ILE n 
1 9   ASN n 
1 10  TYR n 
1 11  LEU n 
1 12  ASN n 
1 13  LYS n 
1 14  LEU n 
1 15  LEU n 
1 16  GLY n 
1 17  ASN n 
1 18  GLU n 
1 19  LEU n 
1 20  VAL n 
1 21  ALA n 
1 22  ILE n 
1 23  ASN n 
1 24  GLN n 
1 25  TYR n 
1 26  PHE n 
1 27  LEU n 
1 28  HIS n 
1 29  ALA n 
1 30  ARG n 
1 31  MET n 
1 32  PHE n 
1 33  LYS n 
1 34  ASN n 
1 35  TRP n 
1 36  GLY n 
1 37  LEU n 
1 38  LYS n 
1 39  ARG n 
1 40  LEU n 
1 41  ASN n 
1 42  ASP n 
1 43  VAL n 
1 44  GLU n 
1 45  TYR n 
1 46  HIS n 
1 47  GLU n 
1 48  SER n 
1 49  ILE n 
1 50  ASP n 
1 51  GLU n 
1 52  MET n 
1 53  LYS n 
1 54  HIS n 
1 55  ALA n 
1 56  ASP n 
1 57  ARG n 
1 58  TYR n 
1 59  ILE n 
1 60  GLU n 
1 61  ARG n 
1 62  ILE n 
1 63  LEU n 
1 64  PHE n 
1 65  LEU n 
1 66  GLU n 
1 67  GLY n 
1 68  LEU n 
1 69  PRO n 
1 70  ASN n 
1 71  LEU n 
1 72  GLN n 
1 73  ASP n 
1 74  LEU n 
1 75  GLY n 
1 76  LYS n 
1 77  LEU n 
1 78  ASN n 
1 79  ILE n 
1 80  GLY n 
1 81  GLU n 
1 82  ASP n 
1 83  VAL n 
1 84  GLU n 
1 85  GLU n 
1 86  MET n 
1 87  LEU n 
1 88  ARG n 
1 89  SER n 
1 90  ASP n 
1 91  LEU n 
1 92  ALA n 
1 93  LEU n 
1 94  GLU n 
1 95  LEU n 
1 96  ASP n 
1 97  GLY n 
1 98  ALA n 
1 99  LYS n 
1 100 ASN n 
1 101 LEU n 
1 102 ARG n 
1 103 GLU n 
1 104 ALA n 
1 105 ILE n 
1 106 GLY n 
1 107 TYR n 
1 108 ALA n 
1 109 ASP n 
1 110 SER n 
1 111 VAL n 
1 112 HIS n 
1 113 ASP n 
1 114 TYR n 
1 115 VAL n 
1 116 SER n 
1 117 ARG n 
1 118 ASP n 
1 119 MET n 
1 120 MET n 
1 121 ILE n 
1 122 GLU n 
1 123 ILE n 
1 124 LEU n 
1 125 ARG n 
1 126 ASP n 
1 127 GLU n 
1 128 GLU n 
1 129 GLY n 
1 130 HIS n 
1 131 ILE n 
1 132 ASP n 
1 133 TRP n 
1 134 LEU n 
1 135 GLU n 
1 136 THR n 
1 137 GLU n 
1 138 LEU n 
1 139 ASP n 
1 140 LEU n 
1 141 ILE n 
1 142 GLN n 
1 143 LYS n 
1 144 MET n 
1 145 GLY n 
1 146 LEU n 
1 147 GLN n 
1 148 ASN n 
1 149 TYR n 
1 150 LEU n 
1 151 GLN n 
1 152 ALA n 
1 153 GLN n 
1 154 ILE n 
1 155 ARG n 
1 156 GLU n 
1 157 GLU n 
1 158 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'bfr, b3336, JW3298' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K-12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli K12' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PALN1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BFR_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIG
EDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P0ABD3 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3E1J A 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
2  1 3E1J B 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
3  1 3E1J C 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
4  1 3E1J D 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
5  1 3E1J E 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
6  1 3E1J F 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
7  1 3E1J G 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
8  1 3E1J H 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
9  1 3E1J I 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
10 1 3E1J J 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
11 1 3E1J K 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
12 1 3E1J L 1 ? 158 ? P0ABD3 1 ? 158 ? 1 158 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                     ?    'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3E1J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.47 
_exptl_crystal.density_percent_sol   64.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.00 
_exptl_crystal_grow.pdbx_details    
;1.8 M AMMONIUM SULFATE, 0.1 M TRI- SODIUM CITRATE PH 5.0. CRYSTALS LATER SOAKED IN CRYOPROTECTANT AT PH 7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 289K, pH 5.00
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2006-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.072 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             1.072 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3E1J 
_reflns.observed_criterion_sigma_I   1.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   84897 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.101 
_reflns.pdbx_netI_over_sigmaI        14.5000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.500 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   93.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.202 
_reflns_shell.meanI_over_sigI_obs    5.000 
_reflns_shell.pdbx_redundancy        1.70 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3E1J 
_refine.ls_number_reflns_obs                     80604 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.11 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    98.7 
_refine.ls_R_factor_obs                          0.243 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.242 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  4239 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               6.29 
_refine.aniso_B[1][1]                            0.10000 
_refine.aniso_B[2][2]                            0.10000 
_refine.aniso_B[3][3]                            -0.20000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1BCF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.728 
_refine.pdbx_overall_ESU_R_Free                  0.330 
_refine.overall_SU_ML                            0.209 
_refine.overall_SU_B                             9.995 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15912 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         338 
_refine_hist.number_atoms_solvent             399 
_refine_hist.number_atoms_total               16649 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        35.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.021  ? 16552 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.817  2.021  ? 22392 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.689  5.000  ? 1956  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.763 24.805 ? 924   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       22.104 15.000 ? 3168  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.581 15.000 ? 132   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.170  0.200  ? 2328  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 12648 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.225  0.200  ? 8197  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.316  0.200  ? 11275 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.159  0.200  ? 628   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.226  0.200  ? 150   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.227  0.200  ? 35    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.757  1.500  ? 9863  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.138  2.000  ? 15240 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.070  3.000  ? 7627  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.354  4.500  ? 7128  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  A 1322 0.01 0.05 'tight positional' 1  1   'X-RAY DIFFRACTION' ? ? ? 
2  B 1322 0.01 0.05 'tight positional' 1  2   'X-RAY DIFFRACTION' ? ? ? 
3  C 1322 0.01 0.05 'tight positional' 1  3   'X-RAY DIFFRACTION' ? ? ? 
4  D 1322 0.01 0.05 'tight positional' 1  4   'X-RAY DIFFRACTION' ? ? ? 
5  E 1322 0.01 0.05 'tight positional' 1  5   'X-RAY DIFFRACTION' ? ? ? 
6  F 1322 0.01 0.05 'tight positional' 1  6   'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.05 'tight positional' 1  7   'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.05 'tight positional' 1  8   'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.05 'tight positional' 1  9   'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.01 0.05 'tight positional' 1  10  'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 1  11  'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 1  12  'X-RAY DIFFRACTION' ? ? ? 
1  B 1322 0.01 0.05 'tight positional' 2  13  'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 2  14  'X-RAY DIFFRACTION' ? ? ? 
3  C 1322 0.01 0.05 'tight positional' 2  15  'X-RAY DIFFRACTION' ? ? ? 
4  D 1322 0.01 0.05 'tight positional' 2  16  'X-RAY DIFFRACTION' ? ? ? 
5  E 1322 0.01 0.05 'tight positional' 2  17  'X-RAY DIFFRACTION' ? ? ? 
6  F 1322 0.01 0.05 'tight positional' 2  18  'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.05 'tight positional' 2  19  'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.05 'tight positional' 2  20  'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.05 'tight positional' 2  21  'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.01 0.05 'tight positional' 2  22  'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 2  23  'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 2  24  'X-RAY DIFFRACTION' ? ? ? 
1  C 1327 0.01 0.05 'tight positional' 3  25  'X-RAY DIFFRACTION' ? ? ? 
2  A 1327 0.01 0.05 'tight positional' 3  26  'X-RAY DIFFRACTION' ? ? ? 
3  B 1327 0.01 0.05 'tight positional' 3  27  'X-RAY DIFFRACTION' ? ? ? 
4  D 1327 0.01 0.05 'tight positional' 3  28  'X-RAY DIFFRACTION' ? ? ? 
5  E 1327 0.01 0.05 'tight positional' 3  29  'X-RAY DIFFRACTION' ? ? ? 
6  F 1327 0.01 0.05 'tight positional' 3  30  'X-RAY DIFFRACTION' ? ? ? 
7  G 1327 0.01 0.05 'tight positional' 3  31  'X-RAY DIFFRACTION' ? ? ? 
8  H 1327 0.01 0.05 'tight positional' 3  32  'X-RAY DIFFRACTION' ? ? ? 
9  I 1327 0.01 0.05 'tight positional' 3  33  'X-RAY DIFFRACTION' ? ? ? 
10 J 1327 0.01 0.05 'tight positional' 3  34  'X-RAY DIFFRACTION' ? ? ? 
11 K 1327 0.01 0.05 'tight positional' 3  35  'X-RAY DIFFRACTION' ? ? ? 
12 L 1327 0.01 0.05 'tight positional' 3  36  'X-RAY DIFFRACTION' ? ? ? 
1  D 1322 0.01 0.05 'tight positional' 4  37  'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 4  38  'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 4  39  'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 4  40  'X-RAY DIFFRACTION' ? ? ? 
5  E 1322 0.01 0.05 'tight positional' 4  41  'X-RAY DIFFRACTION' ? ? ? 
6  F 1322 0.01 0.05 'tight positional' 4  42  'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.05 'tight positional' 4  43  'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.05 'tight positional' 4  44  'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.05 'tight positional' 4  45  'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.01 0.05 'tight positional' 4  46  'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 4  47  'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 4  48  'X-RAY DIFFRACTION' ? ? ? 
1  E 1322 0.01 0.05 'tight positional' 5  49  'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 5  50  'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 5  51  'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 5  52  'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.05 'tight positional' 5  53  'X-RAY DIFFRACTION' ? ? ? 
6  F 1322 0.01 0.05 'tight positional' 5  54  'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.05 'tight positional' 5  55  'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.05 'tight positional' 5  56  'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.05 'tight positional' 5  57  'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.01 0.05 'tight positional' 5  58  'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 5  59  'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 5  60  'X-RAY DIFFRACTION' ? ? ? 
1  F 1322 0.01 0.05 'tight positional' 6  61  'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 6  62  'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 6  63  'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 6  64  'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.05 'tight positional' 6  65  'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.05 'tight positional' 6  66  'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.05 'tight positional' 6  67  'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.05 'tight positional' 6  68  'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.05 'tight positional' 6  69  'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.01 0.05 'tight positional' 6  70  'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 6  71  'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 6  72  'X-RAY DIFFRACTION' ? ? ? 
1  G 1322 0.01 0.05 'tight positional' 7  73  'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 7  74  'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 7  75  'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 7  76  'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.05 'tight positional' 7  77  'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.05 'tight positional' 7  78  'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.05 'tight positional' 7  79  'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.05 'tight positional' 7  80  'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.05 'tight positional' 7  81  'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.01 0.05 'tight positional' 7  82  'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 7  83  'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 7  84  'X-RAY DIFFRACTION' ? ? ? 
1  H 1322 0.01 0.05 'tight positional' 8  85  'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 8  86  'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 8  87  'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 8  88  'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.05 'tight positional' 8  89  'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.05 'tight positional' 8  90  'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.05 'tight positional' 8  91  'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.05 'tight positional' 8  92  'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.05 'tight positional' 8  93  'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.01 0.05 'tight positional' 8  94  'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 8  95  'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 8  96  'X-RAY DIFFRACTION' ? ? ? 
1  I 1322 0.01 0.05 'tight positional' 9  97  'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 9  98  'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 9  99  'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 9  100 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.05 'tight positional' 9  101 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.05 'tight positional' 9  102 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.05 'tight positional' 9  103 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.05 'tight positional' 9  104 'X-RAY DIFFRACTION' ? ? ? 
9  H 1322 0.01 0.05 'tight positional' 9  105 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.01 0.05 'tight positional' 9  106 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 9  107 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 9  108 'X-RAY DIFFRACTION' ? ? ? 
1  J 1322 0.01 0.05 'tight positional' 10 109 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 10 110 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 10 111 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 10 112 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.05 'tight positional' 10 113 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.05 'tight positional' 10 114 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.05 'tight positional' 10 115 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.05 'tight positional' 10 116 'X-RAY DIFFRACTION' ? ? ? 
9  H 1322 0.01 0.05 'tight positional' 10 117 'X-RAY DIFFRACTION' ? ? ? 
10 I 1322 0.01 0.05 'tight positional' 10 118 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.05 'tight positional' 10 119 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 10 120 'X-RAY DIFFRACTION' ? ? ? 
1  K 1322 0.01 0.05 'tight positional' 11 121 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 11 122 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 11 123 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 11 124 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.05 'tight positional' 11 125 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.05 'tight positional' 11 126 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.05 'tight positional' 11 127 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.05 'tight positional' 11 128 'X-RAY DIFFRACTION' ? ? ? 
9  H 1322 0.01 0.05 'tight positional' 11 129 'X-RAY DIFFRACTION' ? ? ? 
10 I 1322 0.01 0.05 'tight positional' 11 130 'X-RAY DIFFRACTION' ? ? ? 
1  K 1322 0.01 0.05 'tight positional' 11 131 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.05 'tight positional' 11 132 'X-RAY DIFFRACTION' ? ? ? 
1  L 1322 0.01 0.05 'tight positional' 12 133 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.05 'tight positional' 12 134 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.05 'tight positional' 12 135 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.05 'tight positional' 12 136 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.05 'tight positional' 12 137 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.05 'tight positional' 12 138 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.05 'tight positional' 12 139 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.05 'tight positional' 12 140 'X-RAY DIFFRACTION' ? ? ? 
9  H 1322 0.01 0.05 'tight positional' 12 141 'X-RAY DIFFRACTION' ? ? ? 
10 I 1322 0.01 0.05 'tight positional' 12 142 'X-RAY DIFFRACTION' ? ? ? 
11 J 1322 0.01 0.05 'tight positional' 12 143 'X-RAY DIFFRACTION' ? ? ? 
12 K 1322 0.01 0.05 'tight positional' 12 144 'X-RAY DIFFRACTION' ? ? ? 
1  B 43   0.00 0.05 'tight positional' 13 145 'X-RAY DIFFRACTION' ? ? ? 
13 D 43   0.00 0.05 'tight positional' 13 146 'X-RAY DIFFRACTION' ? ? ? 
3  F 43   0.00 0.05 'tight positional' 13 147 'X-RAY DIFFRACTION' ? ? ? 
4  H 43   0.00 0.05 'tight positional' 13 148 'X-RAY DIFFRACTION' ? ? ? 
5  J 43   0.00 0.05 'tight positional' 13 149 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.05 'tight positional' 13 150 'X-RAY DIFFRACTION' ? ? ? 
14 D 43   0.00 0.05 'tight positional' 14 151 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.05 'tight positional' 14 152 'X-RAY DIFFRACTION' ? ? ? 
3  F 43   0.00 0.05 'tight positional' 14 153 'X-RAY DIFFRACTION' ? ? ? 
4  H 43   0.00 0.05 'tight positional' 14 154 'X-RAY DIFFRACTION' ? ? ? 
5  J 43   0.00 0.05 'tight positional' 14 155 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.05 'tight positional' 14 156 'X-RAY DIFFRACTION' ? ? ? 
1  F 43   0.00 0.05 'tight positional' 15 157 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.05 'tight positional' 15 158 'X-RAY DIFFRACTION' ? ? ? 
15 D 43   0.00 0.05 'tight positional' 15 159 'X-RAY DIFFRACTION' ? ? ? 
4  H 43   0.00 0.05 'tight positional' 15 160 'X-RAY DIFFRACTION' ? ? ? 
5  J 43   0.00 0.05 'tight positional' 15 161 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.05 'tight positional' 15 162 'X-RAY DIFFRACTION' ? ? ? 
1  H 43   0.00 0.05 'tight positional' 16 163 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.05 'tight positional' 16 164 'X-RAY DIFFRACTION' ? ? ? 
16 D 43   0.00 0.05 'tight positional' 16 165 'X-RAY DIFFRACTION' ? ? ? 
4  F 43   0.00 0.05 'tight positional' 16 166 'X-RAY DIFFRACTION' ? ? ? 
5  J 43   0.00 0.05 'tight positional' 16 167 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.05 'tight positional' 16 168 'X-RAY DIFFRACTION' ? ? ? 
1  J 43   0.00 0.05 'tight positional' 17 169 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.05 'tight positional' 17 170 'X-RAY DIFFRACTION' ? ? ? 
17 D 43   0.00 0.05 'tight positional' 17 171 'X-RAY DIFFRACTION' ? ? ? 
4  F 43   0.00 0.05 'tight positional' 17 172 'X-RAY DIFFRACTION' ? ? ? 
5  H 43   0.00 0.05 'tight positional' 17 173 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.05 'tight positional' 17 174 'X-RAY DIFFRACTION' ? ? ? 
1  L 43   0.00 0.05 'tight positional' 18 175 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.05 'tight positional' 18 176 'X-RAY DIFFRACTION' ? ? ? 
18 D 43   0.00 0.05 'tight positional' 18 177 'X-RAY DIFFRACTION' ? ? ? 
4  F 43   0.00 0.05 'tight positional' 18 178 'X-RAY DIFFRACTION' ? ? ? 
5  H 43   0.00 0.05 'tight positional' 18 179 'X-RAY DIFFRACTION' ? ? ? 
6  J 43   0.00 0.05 'tight positional' 18 180 'X-RAY DIFFRACTION' ? ? ? 
1  A 1322 0.01 0.50 'tight thermal'    1  181 'X-RAY DIFFRACTION' ? ? ? 
2  B 1322 0.01 0.50 'tight thermal'    1  182 'X-RAY DIFFRACTION' ? ? ? 
3  C 1322 0.01 0.50 'tight thermal'    1  183 'X-RAY DIFFRACTION' ? ? ? 
4  D 1322 0.01 0.50 'tight thermal'    1  184 'X-RAY DIFFRACTION' ? ? ? 
5  E 1322 0.01 0.50 'tight thermal'    1  185 'X-RAY DIFFRACTION' ? ? ? 
6  F 1322 0.01 0.50 'tight thermal'    1  186 'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.50 'tight thermal'    1  187 'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.50 'tight thermal'    1  188 'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.50 'tight thermal'    1  189 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.02 0.50 'tight thermal'    1  190 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    1  191 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    1  192 'X-RAY DIFFRACTION' ? ? ? 
1  B 1322 0.01 0.50 'tight thermal'    2  193 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    2  194 'X-RAY DIFFRACTION' ? ? ? 
3  C 1322 0.01 0.50 'tight thermal'    2  195 'X-RAY DIFFRACTION' ? ? ? 
4  D 1322 0.01 0.50 'tight thermal'    2  196 'X-RAY DIFFRACTION' ? ? ? 
5  E 1322 0.01 0.50 'tight thermal'    2  197 'X-RAY DIFFRACTION' ? ? ? 
6  F 1322 0.01 0.50 'tight thermal'    2  198 'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.50 'tight thermal'    2  199 'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.50 'tight thermal'    2  200 'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.50 'tight thermal'    2  201 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.02 0.50 'tight thermal'    2  202 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    2  203 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    2  204 'X-RAY DIFFRACTION' ? ? ? 
1  C 1327 0.01 0.50 'tight thermal'    3  205 'X-RAY DIFFRACTION' ? ? ? 
2  A 1327 0.01 0.50 'tight thermal'    3  206 'X-RAY DIFFRACTION' ? ? ? 
3  B 1327 0.01 0.50 'tight thermal'    3  207 'X-RAY DIFFRACTION' ? ? ? 
4  D 1327 0.01 0.50 'tight thermal'    3  208 'X-RAY DIFFRACTION' ? ? ? 
5  E 1327 0.01 0.50 'tight thermal'    3  209 'X-RAY DIFFRACTION' ? ? ? 
6  F 1327 0.01 0.50 'tight thermal'    3  210 'X-RAY DIFFRACTION' ? ? ? 
7  G 1327 0.01 0.50 'tight thermal'    3  211 'X-RAY DIFFRACTION' ? ? ? 
8  H 1327 0.01 0.50 'tight thermal'    3  212 'X-RAY DIFFRACTION' ? ? ? 
9  I 1327 0.01 0.50 'tight thermal'    3  213 'X-RAY DIFFRACTION' ? ? ? 
10 J 1327 0.02 0.50 'tight thermal'    3  214 'X-RAY DIFFRACTION' ? ? ? 
11 K 1327 0.01 0.50 'tight thermal'    3  215 'X-RAY DIFFRACTION' ? ? ? 
12 L 1327 0.01 0.50 'tight thermal'    3  216 'X-RAY DIFFRACTION' ? ? ? 
1  D 1322 0.01 0.50 'tight thermal'    4  217 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    4  218 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    4  219 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    4  220 'X-RAY DIFFRACTION' ? ? ? 
5  E 1322 0.01 0.50 'tight thermal'    4  221 'X-RAY DIFFRACTION' ? ? ? 
6  F 1322 0.01 0.50 'tight thermal'    4  222 'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.50 'tight thermal'    4  223 'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.50 'tight thermal'    4  224 'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.50 'tight thermal'    4  225 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.02 0.50 'tight thermal'    4  226 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    4  227 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    4  228 'X-RAY DIFFRACTION' ? ? ? 
1  E 1322 0.01 0.50 'tight thermal'    5  229 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    5  230 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    5  231 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    5  232 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.50 'tight thermal'    5  233 'X-RAY DIFFRACTION' ? ? ? 
6  F 1322 0.01 0.50 'tight thermal'    5  234 'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.50 'tight thermal'    5  235 'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.50 'tight thermal'    5  236 'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.50 'tight thermal'    5  237 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.02 0.50 'tight thermal'    5  238 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    5  239 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    5  240 'X-RAY DIFFRACTION' ? ? ? 
1  F 1322 0.01 0.50 'tight thermal'    6  241 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    6  242 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    6  243 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    6  244 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.50 'tight thermal'    6  245 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.50 'tight thermal'    6  246 'X-RAY DIFFRACTION' ? ? ? 
7  G 1322 0.01 0.50 'tight thermal'    6  247 'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.50 'tight thermal'    6  248 'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.50 'tight thermal'    6  249 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.02 0.50 'tight thermal'    6  250 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    6  251 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    6  252 'X-RAY DIFFRACTION' ? ? ? 
1  G 1322 0.01 0.50 'tight thermal'    7  253 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    7  254 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    7  255 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    7  256 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.50 'tight thermal'    7  257 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.50 'tight thermal'    7  258 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.50 'tight thermal'    7  259 'X-RAY DIFFRACTION' ? ? ? 
8  H 1322 0.01 0.50 'tight thermal'    7  260 'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.50 'tight thermal'    7  261 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.02 0.50 'tight thermal'    7  262 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    7  263 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    7  264 'X-RAY DIFFRACTION' ? ? ? 
1  H 1322 0.01 0.50 'tight thermal'    8  265 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    8  266 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    8  267 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    8  268 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.50 'tight thermal'    8  269 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.50 'tight thermal'    8  270 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.50 'tight thermal'    8  271 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.50 'tight thermal'    8  272 'X-RAY DIFFRACTION' ? ? ? 
9  I 1322 0.01 0.50 'tight thermal'    8  273 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.02 0.50 'tight thermal'    8  274 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    8  275 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    8  276 'X-RAY DIFFRACTION' ? ? ? 
1  I 1322 0.01 0.50 'tight thermal'    9  277 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    9  278 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    9  279 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    9  280 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.50 'tight thermal'    9  281 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.50 'tight thermal'    9  282 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.50 'tight thermal'    9  283 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.50 'tight thermal'    9  284 'X-RAY DIFFRACTION' ? ? ? 
9  H 1322 0.01 0.50 'tight thermal'    9  285 'X-RAY DIFFRACTION' ? ? ? 
10 J 1322 0.02 0.50 'tight thermal'    9  286 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    9  287 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    9  288 'X-RAY DIFFRACTION' ? ? ? 
1  J 1322 0.02 0.50 'tight thermal'    10 289 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    10 290 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    10 291 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    10 292 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.50 'tight thermal'    10 293 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.50 'tight thermal'    10 294 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.50 'tight thermal'    10 295 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.50 'tight thermal'    10 296 'X-RAY DIFFRACTION' ? ? ? 
9  H 1322 0.01 0.50 'tight thermal'    10 297 'X-RAY DIFFRACTION' ? ? ? 
10 I 1322 0.01 0.50 'tight thermal'    10 298 'X-RAY DIFFRACTION' ? ? ? 
11 K 1322 0.01 0.50 'tight thermal'    10 299 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    10 300 'X-RAY DIFFRACTION' ? ? ? 
1  K 1322 0.01 0.50 'tight thermal'    11 301 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    11 302 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    11 303 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    11 304 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.50 'tight thermal'    11 305 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.50 'tight thermal'    11 306 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.50 'tight thermal'    11 307 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.50 'tight thermal'    11 308 'X-RAY DIFFRACTION' ? ? ? 
9  H 1322 0.01 0.50 'tight thermal'    11 309 'X-RAY DIFFRACTION' ? ? ? 
10 I 1322 0.01 0.50 'tight thermal'    11 310 'X-RAY DIFFRACTION' ? ? ? 
1  K 1322 0.01 0.50 'tight thermal'    11 311 'X-RAY DIFFRACTION' ? ? ? 
12 L 1322 0.01 0.50 'tight thermal'    11 312 'X-RAY DIFFRACTION' ? ? ? 
1  L 1322 0.01 0.50 'tight thermal'    12 313 'X-RAY DIFFRACTION' ? ? ? 
2  A 1322 0.01 0.50 'tight thermal'    12 314 'X-RAY DIFFRACTION' ? ? ? 
3  B 1322 0.01 0.50 'tight thermal'    12 315 'X-RAY DIFFRACTION' ? ? ? 
4  C 1322 0.01 0.50 'tight thermal'    12 316 'X-RAY DIFFRACTION' ? ? ? 
5  D 1322 0.01 0.50 'tight thermal'    12 317 'X-RAY DIFFRACTION' ? ? ? 
6  E 1322 0.01 0.50 'tight thermal'    12 318 'X-RAY DIFFRACTION' ? ? ? 
7  F 1322 0.01 0.50 'tight thermal'    12 319 'X-RAY DIFFRACTION' ? ? ? 
8  G 1322 0.01 0.50 'tight thermal'    12 320 'X-RAY DIFFRACTION' ? ? ? 
9  H 1322 0.01 0.50 'tight thermal'    12 321 'X-RAY DIFFRACTION' ? ? ? 
10 I 1322 0.01 0.50 'tight thermal'    12 322 'X-RAY DIFFRACTION' ? ? ? 
11 J 1322 0.02 0.50 'tight thermal'    12 323 'X-RAY DIFFRACTION' ? ? ? 
12 K 1322 0.01 0.50 'tight thermal'    12 324 'X-RAY DIFFRACTION' ? ? ? 
1  B 43   0.00 0.50 'tight thermal'    13 325 'X-RAY DIFFRACTION' ? ? ? 
13 D 43   0.00 0.50 'tight thermal'    13 326 'X-RAY DIFFRACTION' ? ? ? 
3  F 43   0.00 0.50 'tight thermal'    13 327 'X-RAY DIFFRACTION' ? ? ? 
4  H 43   0.00 0.50 'tight thermal'    13 328 'X-RAY DIFFRACTION' ? ? ? 
5  J 43   0.00 0.50 'tight thermal'    13 329 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.50 'tight thermal'    13 330 'X-RAY DIFFRACTION' ? ? ? 
14 D 43   0.00 0.50 'tight thermal'    14 331 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.50 'tight thermal'    14 332 'X-RAY DIFFRACTION' ? ? ? 
3  F 43   0.00 0.50 'tight thermal'    14 333 'X-RAY DIFFRACTION' ? ? ? 
4  H 43   0.00 0.50 'tight thermal'    14 334 'X-RAY DIFFRACTION' ? ? ? 
5  J 43   0.00 0.50 'tight thermal'    14 335 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.50 'tight thermal'    14 336 'X-RAY DIFFRACTION' ? ? ? 
1  F 43   0.00 0.50 'tight thermal'    15 337 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.50 'tight thermal'    15 338 'X-RAY DIFFRACTION' ? ? ? 
15 D 43   0.00 0.50 'tight thermal'    15 339 'X-RAY DIFFRACTION' ? ? ? 
4  H 43   0.00 0.50 'tight thermal'    15 340 'X-RAY DIFFRACTION' ? ? ? 
5  J 43   0.00 0.50 'tight thermal'    15 341 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.50 'tight thermal'    15 342 'X-RAY DIFFRACTION' ? ? ? 
1  H 43   0.00 0.50 'tight thermal'    16 343 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.50 'tight thermal'    16 344 'X-RAY DIFFRACTION' ? ? ? 
16 D 43   0.00 0.50 'tight thermal'    16 345 'X-RAY DIFFRACTION' ? ? ? 
4  F 43   0.00 0.50 'tight thermal'    16 346 'X-RAY DIFFRACTION' ? ? ? 
5  J 43   0.00 0.50 'tight thermal'    16 347 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.50 'tight thermal'    16 348 'X-RAY DIFFRACTION' ? ? ? 
1  J 43   0.00 0.50 'tight thermal'    17 349 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.50 'tight thermal'    17 350 'X-RAY DIFFRACTION' ? ? ? 
17 D 43   0.00 0.50 'tight thermal'    17 351 'X-RAY DIFFRACTION' ? ? ? 
4  F 43   0.00 0.50 'tight thermal'    17 352 'X-RAY DIFFRACTION' ? ? ? 
5  H 43   0.00 0.50 'tight thermal'    17 353 'X-RAY DIFFRACTION' ? ? ? 
6  L 43   0.00 0.50 'tight thermal'    17 354 'X-RAY DIFFRACTION' ? ? ? 
1  L 43   0.00 0.50 'tight thermal'    18 355 'X-RAY DIFFRACTION' ? ? ? 
2  B 43   0.00 0.50 'tight thermal'    18 356 'X-RAY DIFFRACTION' ? ? ? 
18 D 43   0.00 0.50 'tight thermal'    18 357 'X-RAY DIFFRACTION' ? ? ? 
4  F 43   0.00 0.50 'tight thermal'    18 358 'X-RAY DIFFRACTION' ? ? ? 
5  H 43   0.00 0.50 'tight thermal'    18 359 'X-RAY DIFFRACTION' ? ? ? 
6  J 43   0.00 0.50 'tight thermal'    18 360 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.77 
_refine_ls_shell.number_reflns_R_work             5357 
_refine_ls_shell.R_factor_R_work                  0.346 
_refine_ls_shell.percent_reflns_obs               90.11 
_refine_ls_shell.R_factor_R_free                  0.355 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             276 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1  1  A 
1  2  B 
1  3  C 
1  4  D 
1  5  E 
1  6  F 
1  7  G 
1  8  H 
1  9  I 
1  10 J 
1  11 K 
1  12 L 
1  13 A 
1  14 B 
1  15 C 
1  16 D 
1  17 E 
1  18 F 
1  19 G 
1  20 H 
1  21 I 
1  22 J 
1  23 K 
1  24 L 
1  25 A 
1  26 B 
1  27 C 
1  28 D 
1  29 E 
1  30 F 
1  31 G 
1  32 H 
1  33 I 
1  34 J 
1  35 K 
1  36 L 
2  1  B 
2  2  A 
2  3  C 
2  4  D 
2  5  E 
2  6  F 
2  7  G 
2  8  H 
2  9  I 
2  10 J 
2  11 K 
2  12 L 
2  13 B 
2  14 A 
2  15 C 
2  16 D 
2  17 E 
2  18 F 
2  19 G 
2  20 H 
2  21 I 
2  22 J 
2  23 K 
2  24 L 
2  25 B 
2  26 A 
2  27 C 
2  28 D 
2  29 E 
2  30 F 
2  31 G 
2  32 H 
2  33 I 
2  34 J 
2  35 K 
2  36 L 
3  1  C 
3  2  A 
3  3  B 
3  4  D 
3  5  E 
3  6  F 
3  7  G 
3  8  H 
3  9  I 
3  10 J 
3  11 K 
3  12 L 
3  13 C 
3  14 A 
3  15 B 
3  16 D 
3  17 E 
3  18 F 
3  19 G 
3  20 H 
3  21 I 
3  22 J 
3  23 K 
3  24 L 
3  25 C 
3  26 A 
3  27 B 
3  28 D 
3  29 E 
3  30 F 
3  31 G 
3  32 H 
3  33 I 
3  34 J 
3  35 K 
3  36 L 
4  1  D 
4  2  A 
4  3  B 
4  4  C 
4  5  E 
4  6  F 
4  7  G 
4  8  H 
4  9  I 
4  10 J 
4  11 K 
4  12 L 
4  13 D 
4  14 A 
4  15 B 
4  16 C 
4  17 E 
4  18 F 
4  19 G 
4  20 H 
4  21 I 
4  22 J 
4  23 K 
4  24 L 
4  25 D 
4  26 A 
4  27 B 
4  28 C 
4  29 E 
4  30 F 
4  31 G 
4  32 H 
4  33 I 
4  34 J 
4  35 K 
4  36 L 
5  1  E 
5  2  A 
5  3  B 
5  4  C 
5  5  D 
5  6  F 
5  7  G 
5  8  H 
5  9  I 
5  10 J 
5  11 K 
5  12 L 
5  13 E 
5  14 A 
5  15 B 
5  16 C 
5  17 D 
5  18 F 
5  19 G 
5  20 H 
5  21 I 
5  22 J 
5  23 K 
5  24 L 
5  25 E 
5  26 A 
5  27 B 
5  28 C 
5  29 D 
5  30 F 
5  31 G 
5  32 H 
5  33 I 
5  34 J 
5  35 K 
5  36 L 
6  1  F 
6  2  A 
6  3  B 
6  4  C 
6  5  D 
6  6  E 
6  7  G 
6  8  H 
6  9  I 
6  10 J 
6  11 K 
6  12 L 
6  13 F 
6  14 A 
6  15 B 
6  16 C 
6  17 D 
6  18 E 
6  19 G 
6  20 H 
6  21 I 
6  22 J 
6  23 K 
6  24 L 
6  25 F 
6  26 A 
6  27 B 
6  28 C 
6  29 D 
6  30 E 
6  31 G 
6  32 H 
6  33 I 
6  34 J 
6  35 K 
6  36 L 
7  1  G 
7  2  A 
7  3  B 
7  4  C 
7  5  D 
7  6  E 
7  7  F 
7  8  H 
7  9  I 
7  10 J 
7  11 K 
7  12 L 
7  13 G 
7  14 A 
7  15 B 
7  16 C 
7  17 D 
7  18 E 
7  19 F 
7  20 H 
7  21 I 
7  22 J 
7  23 K 
7  24 L 
7  25 G 
7  26 A 
7  27 B 
7  28 C 
7  29 D 
7  30 E 
7  31 F 
7  32 H 
7  33 I 
7  34 J 
7  35 K 
7  36 L 
8  1  H 
8  2  A 
8  3  B 
8  4  C 
8  5  D 
8  6  E 
8  7  F 
8  8  G 
8  9  I 
8  10 J 
8  11 K 
8  12 L 
8  13 H 
8  14 A 
8  15 B 
8  16 C 
8  17 D 
8  18 E 
8  19 F 
8  20 G 
8  21 I 
8  22 J 
8  23 K 
8  24 L 
8  25 H 
8  26 A 
8  27 B 
8  28 C 
8  29 D 
8  30 E 
8  31 F 
8  32 G 
8  33 I 
8  34 J 
8  35 K 
8  36 L 
9  1  I 
9  2  A 
9  3  B 
9  4  C 
9  5  D 
9  6  E 
9  7  F 
9  8  G 
9  9  H 
9  10 J 
9  11 K 
9  12 L 
9  13 I 
9  14 A 
9  15 B 
9  16 C 
9  17 D 
9  18 E 
9  19 F 
9  20 G 
9  21 H 
9  22 J 
9  23 K 
9  24 L 
9  25 I 
9  26 A 
9  27 B 
9  28 C 
9  29 D 
9  30 E 
9  31 F 
9  32 G 
9  33 H 
9  34 J 
9  35 K 
9  36 L 
10 1  J 
10 2  A 
10 3  B 
10 4  C 
10 5  D 
10 6  E 
10 7  F 
10 8  G 
10 9  H 
10 10 I 
10 11 K 
10 12 L 
10 13 J 
10 14 A 
10 15 B 
10 16 C 
10 17 D 
10 18 E 
10 19 F 
10 20 G 
10 21 H 
10 22 I 
10 23 K 
10 24 L 
10 25 J 
10 26 A 
10 27 B 
10 28 C 
10 29 D 
10 30 E 
10 31 F 
10 32 G 
10 33 H 
10 34 I 
10 35 K 
10 36 L 
11 1  K 
11 2  A 
11 3  B 
11 4  C 
11 5  D 
11 6  E 
11 7  F 
11 8  G 
11 9  H 
11 10 I 
11 11 K 
11 12 L 
11 13 K 
11 14 A 
11 15 B 
11 16 C 
11 17 D 
11 18 E 
11 19 F 
11 20 G 
11 21 H 
11 22 I 
11 23 K 
11 24 L 
11 25 K 
11 26 A 
11 27 B 
11 28 C 
11 29 D 
11 30 E 
11 31 F 
11 32 G 
11 33 H 
11 34 I 
11 35 K 
11 36 L 
12 1  L 
12 2  A 
12 3  B 
12 4  C 
12 5  D 
12 6  E 
12 7  F 
12 8  G 
12 9  H 
12 10 I 
12 11 J 
12 12 K 
12 13 L 
12 14 A 
12 15 B 
12 16 C 
12 17 D 
12 18 E 
12 19 F 
12 20 G 
12 21 H 
12 22 I 
12 23 J 
12 24 K 
12 25 L 
12 26 A 
12 27 B 
12 28 C 
12 29 D 
12 30 E 
12 31 F 
12 32 G 
12 33 H 
12 34 I 
12 35 J 
12 36 K 
13 1  B 
13 2  C 
13 3  F 
13 4  H 
13 5  J 
13 6  L 
14 1  C 
14 2  B 
14 3  F 
14 4  H 
14 5  J 
14 6  L 
15 1  F 
15 2  B 
15 3  C 
15 4  H 
15 5  J 
15 6  L 
16 1  H 
16 2  B 
16 3  C 
16 4  F 
16 5  J 
16 6  L 
17 1  J 
17 2  B 
17 3  C 
17 4  F 
17 5  H 
17 6  L 
18 1  L 
18 2  B 
18 3  C 
18 4  F 
18 5  H 
18 6  J 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 1  ? 
2  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 1  ? 
3  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 1  ? 
4  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 1  ? 
5  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 1  ? 
6  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 1  ? 
7  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 1  ? 
8  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 1  ? 
9  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 1  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 1  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 1  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 1  ? 
13 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 1  ? 
14 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 1  ? 
15 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 1  ? 
16 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 1  ? 
17 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 1  ? 
18 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 1  ? 
19 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 1  ? 
20 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 1  ? 
21 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 1  ? 
22 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 1  ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 1  ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 1  ? 
25 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 1  ? 
26 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 1  ? 
27 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 1  ? 
28 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 1  ? 
29 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 1  ? 
30 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 1  ? 
31 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 1  ? 
32 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 1  ? 
33 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 1  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 1  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 1  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 1  ? 
1  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 2  ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 2  ? 
3  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 2  ? 
4  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 2  ? 
5  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 2  ? 
6  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 2  ? 
7  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 2  ? 
8  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 2  ? 
9  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 2  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 2  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 2  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 2  ? 
13 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 2  ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 2  ? 
15 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 2  ? 
16 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 2  ? 
17 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 2  ? 
18 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 2  ? 
19 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 2  ? 
20 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 2  ? 
21 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 2  ? 
22 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 2  ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 2  ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 2  ? 
25 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 2  ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 2  ? 
27 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 2  ? 
28 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 2  ? 
29 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 2  ? 
30 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 2  ? 
31 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 2  ? 
32 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 2  ? 
33 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 2  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 2  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 2  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 2  ? 
1  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 3  ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 3  ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 3  ? 
4  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 3  ? 
5  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 3  ? 
6  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 3  ? 
7  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 3  ? 
8  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 3  ? 
9  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 3  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 3  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 3  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 3  ? 
13 C 104 C 250 2 1 C  ALA 104 ? Q  SO4 .   ? 3  ? 
14 A 104 A 250 2 1 A  ALA 104 ? M  SO4 .   ? 3  ? 
15 B 104 B 250 2 1 B  ALA 104 ? O  SO4 .   ? 3  ? 
16 D 104 D 250 2 1 D  ALA 104 ? R  SO4 .   ? 3  ? 
17 E 104 E 250 2 1 E  ALA 104 ? S  SO4 .   ? 3  ? 
18 F 104 F 250 2 1 F  ALA 104 ? T  SO4 .   ? 3  ? 
19 G 104 G 250 2 1 G  ALA 104 ? V  SO4 .   ? 3  ? 
20 H 104 H 250 2 1 H  ALA 104 ? X  SO4 .   ? 3  ? 
21 I 104 I 250 2 1 I  ALA 104 ? Y  SO4 .   ? 3  ? 
22 J 104 J 250 2 1 J  ALA 104 ? Z  SO4 .   ? 3  ? 
23 K 104 K 250 2 1 K  ALA 104 ? AA SO4 .   ? 3  ? 
24 L 104 L 250 2 1 L  ALA 104 ? BA SO4 .   ? 3  ? 
25 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 3  ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 3  ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 3  ? 
28 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 3  ? 
29 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 3  ? 
30 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 3  ? 
31 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 3  ? 
32 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 3  ? 
33 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 3  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 3  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 3  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 3  ? 
1  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 4  ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 4  ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 4  ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 4  ? 
5  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 4  ? 
6  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 4  ? 
7  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 4  ? 
8  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 4  ? 
9  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 4  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 4  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 4  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 4  ? 
13 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 4  ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 4  ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 4  ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 4  ? 
17 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 4  ? 
18 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 4  ? 
19 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 4  ? 
20 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 4  ? 
21 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 4  ? 
22 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 4  ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 4  ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 4  ? 
25 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 4  ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 4  ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 4  ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 4  ? 
29 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 4  ? 
30 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 4  ? 
31 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 4  ? 
32 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 4  ? 
33 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 4  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 4  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 4  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 4  ? 
1  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 5  ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 5  ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 5  ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 5  ? 
5  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 5  ? 
6  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 5  ? 
7  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 5  ? 
8  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 5  ? 
9  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 5  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 5  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 5  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 5  ? 
13 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 5  ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 5  ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 5  ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 5  ? 
17 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 5  ? 
18 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 5  ? 
19 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 5  ? 
20 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 5  ? 
21 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 5  ? 
22 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 5  ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 5  ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 5  ? 
25 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 5  ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 5  ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 5  ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 5  ? 
29 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 5  ? 
30 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 5  ? 
31 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 5  ? 
32 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 5  ? 
33 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 5  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 5  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 5  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 5  ? 
1  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 6  ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 6  ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 6  ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 6  ? 
5  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 6  ? 
6  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 6  ? 
7  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 6  ? 
8  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 6  ? 
9  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 6  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 6  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 6  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 6  ? 
13 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 6  ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 6  ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 6  ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 6  ? 
17 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 6  ? 
18 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 6  ? 
19 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 6  ? 
20 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 6  ? 
21 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 6  ? 
22 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 6  ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 6  ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 6  ? 
25 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 6  ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 6  ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 6  ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 6  ? 
29 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 6  ? 
30 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 6  ? 
31 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 6  ? 
32 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 6  ? 
33 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 6  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 6  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 6  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 6  ? 
1  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 7  ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 7  ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 7  ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 7  ? 
5  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 7  ? 
6  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 7  ? 
7  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 7  ? 
8  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 7  ? 
9  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 7  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 7  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 7  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 7  ? 
13 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 7  ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 7  ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 7  ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 7  ? 
17 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 7  ? 
18 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 7  ? 
19 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 7  ? 
20 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 7  ? 
21 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 7  ? 
22 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 7  ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 7  ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 7  ? 
25 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 7  ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 7  ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 7  ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 7  ? 
29 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 7  ? 
30 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 7  ? 
31 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 7  ? 
32 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 7  ? 
33 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 7  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 7  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 7  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 7  ? 
1  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 8  ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 8  ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 8  ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 8  ? 
5  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 8  ? 
6  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 8  ? 
7  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 8  ? 
8  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 8  ? 
9  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 8  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 8  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 8  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 8  ? 
13 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 8  ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 8  ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 8  ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 8  ? 
17 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 8  ? 
18 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 8  ? 
19 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 8  ? 
20 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 8  ? 
21 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 8  ? 
22 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 8  ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 8  ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 8  ? 
25 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 8  ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 8  ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 8  ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 8  ? 
29 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 8  ? 
30 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 8  ? 
31 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 8  ? 
32 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 8  ? 
33 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 8  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 8  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 8  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 8  ? 
1  I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 9  ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 9  ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 9  ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 9  ? 
5  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 9  ? 
6  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 9  ? 
7  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 9  ? 
8  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 9  ? 
9  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 9  ? 
10 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 9  ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 9  ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 9  ? 
13 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 9  ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 9  ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 9  ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 9  ? 
17 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 9  ? 
18 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 9  ? 
19 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 9  ? 
20 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 9  ? 
21 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 9  ? 
22 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 9  ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 9  ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 9  ? 
25 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 9  ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 9  ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 9  ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 9  ? 
29 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 9  ? 
30 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 9  ? 
31 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 9  ? 
32 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 9  ? 
33 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 9  ? 
34 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 9  ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 9  ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 9  ? 
1  J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 10 ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 10 ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 10 ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 10 ? 
5  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 10 ? 
6  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 10 ? 
7  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 10 ? 
8  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 10 ? 
9  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 10 ? 
10 I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 10 ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 10 ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 10 ? 
13 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 10 ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 10 ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 10 ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 10 ? 
17 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 10 ? 
18 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 10 ? 
19 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 10 ? 
20 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 10 ? 
21 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 10 ? 
22 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 10 ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 10 ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 10 ? 
25 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 10 ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 10 ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 10 ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 10 ? 
29 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 10 ? 
30 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 10 ? 
31 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 10 ? 
32 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 10 ? 
33 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 10 ? 
34 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 10 ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 10 ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 10 ? 
1  K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 11 ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 11 ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 11 ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 11 ? 
5  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 11 ? 
6  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 11 ? 
7  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 11 ? 
8  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 11 ? 
9  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 11 ? 
10 I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 11 ? 
11 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 11 ? 
12 L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 11 ? 
13 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 11 ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 11 ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 11 ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 11 ? 
17 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 11 ? 
18 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 11 ? 
19 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 11 ? 
20 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 11 ? 
21 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 11 ? 
22 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 11 ? 
23 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 11 ? 
24 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 11 ? 
25 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 11 ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 11 ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 11 ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 11 ? 
29 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 11 ? 
30 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 11 ? 
31 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 11 ? 
32 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 11 ? 
33 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 11 ? 
34 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 11 ? 
35 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 11 ? 
36 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 11 ? 
1  L 1   L 102 1 1 L  MET 1   ? L  ARG 102 ? 12 ? 
2  A 1   A 102 1 1 A  MET 1   ? A  ARG 102 ? 12 ? 
3  B 1   B 102 1 1 B  MET 1   ? B  ARG 102 ? 12 ? 
4  C 1   C 102 1 1 C  MET 1   ? C  ARG 102 ? 12 ? 
5  D 1   D 102 1 1 D  MET 1   ? D  ARG 102 ? 12 ? 
6  E 1   E 102 1 1 E  MET 1   ? E  ARG 102 ? 12 ? 
7  F 1   F 102 1 1 F  MET 1   ? F  ARG 102 ? 12 ? 
8  G 1   G 102 1 1 G  MET 1   ? G  ARG 102 ? 12 ? 
9  H 1   H 102 1 1 H  MET 1   ? H  ARG 102 ? 12 ? 
10 I 1   I 102 1 1 I  MET 1   ? I  ARG 102 ? 12 ? 
11 J 1   J 102 1 1 J  MET 1   ? J  ARG 102 ? 12 ? 
12 K 1   K 102 1 1 K  MET 1   ? K  ARG 102 ? 12 ? 
13 L 104 L 158 2 1 L  ALA 104 ? L  GLY 158 ? 12 ? 
14 A 104 A 158 2 1 A  ALA 104 ? A  GLY 158 ? 12 ? 
15 B 104 B 158 2 1 B  ALA 104 ? B  GLY 158 ? 12 ? 
16 C 104 C 158 2 1 C  ALA 104 ? C  GLY 158 ? 12 ? 
17 D 104 D 158 2 1 D  ALA 104 ? D  GLY 158 ? 12 ? 
18 E 104 E 158 2 1 E  ALA 104 ? E  GLY 158 ? 12 ? 
19 F 104 F 158 2 1 F  ALA 104 ? F  GLY 158 ? 12 ? 
20 G 104 G 158 2 1 G  ALA 104 ? G  GLY 158 ? 12 ? 
21 H 104 H 158 2 1 H  ALA 104 ? H  GLY 158 ? 12 ? 
22 I 104 I 158 2 1 I  ALA 104 ? I  GLY 158 ? 12 ? 
23 J 104 J 158 2 1 J  ALA 104 ? J  GLY 158 ? 12 ? 
24 K 104 K 158 2 1 K  ALA 104 ? K  GLY 158 ? 12 ? 
25 L 250 L 250 3 1 BA SO4 .   ? BA SO4 .   ? 12 ? 
26 A 250 A 250 3 1 M  SO4 .   ? M  SO4 .   ? 12 ? 
27 B 250 B 250 3 1 O  SO4 .   ? O  SO4 .   ? 12 ? 
28 C 250 C 250 3 1 Q  SO4 .   ? Q  SO4 .   ? 12 ? 
29 D 250 D 250 3 1 R  SO4 .   ? R  SO4 .   ? 12 ? 
30 E 250 E 250 3 1 S  SO4 .   ? S  SO4 .   ? 12 ? 
31 F 250 F 250 3 1 T  SO4 .   ? T  SO4 .   ? 12 ? 
32 G 250 G 250 3 1 V  SO4 .   ? V  SO4 .   ? 12 ? 
33 H 250 H 250 3 1 X  SO4 .   ? X  SO4 .   ? 12 ? 
34 I 250 I 250 3 1 Y  SO4 .   ? Y  SO4 .   ? 12 ? 
35 J 250 J 250 3 1 Z  SO4 .   ? Z  SO4 .   ? 12 ? 
36 K 250 K 250 3 1 AA SO4 .   ? AA SO4 .   ? 12 ? 
1  B 200 B 200 1 1 CA HEM .   ? CA HEM .   ? 13 ? 
2  C 200 C 200 1 1 DA HEM .   ? DA HEM .   ? 13 ? 
3  F 200 F 200 1 1 EA HEM .   ? EA HEM .   ? 13 ? 
4  H 200 H 200 1 1 FA HEM .   ? FA HEM .   ? 13 ? 
5  J 200 J 200 1 1 GA HEM .   ? GA HEM .   ? 13 ? 
6  L 200 L 200 1 1 HA HEM .   ? HA HEM .   ? 13 ? 
1  C 200 C 200 1 1 DA HEM .   ? DA HEM .   ? 14 ? 
2  B 200 B 200 1 1 CA HEM .   ? CA HEM .   ? 14 ? 
3  F 200 F 200 1 1 EA HEM .   ? EA HEM .   ? 14 ? 
4  H 200 H 200 1 1 FA HEM .   ? FA HEM .   ? 14 ? 
5  J 200 J 200 1 1 GA HEM .   ? GA HEM .   ? 14 ? 
6  L 200 L 200 1 1 HA HEM .   ? HA HEM .   ? 14 ? 
1  F 200 F 200 1 1 EA HEM .   ? EA HEM .   ? 15 ? 
2  B 200 B 200 1 1 CA HEM .   ? CA HEM .   ? 15 ? 
3  C 200 C 200 1 1 DA HEM .   ? DA HEM .   ? 15 ? 
4  H 200 H 200 1 1 FA HEM .   ? FA HEM .   ? 15 ? 
5  J 200 J 200 1 1 GA HEM .   ? GA HEM .   ? 15 ? 
6  L 200 L 200 1 1 HA HEM .   ? HA HEM .   ? 15 ? 
1  H 200 H 200 1 1 FA HEM .   ? FA HEM .   ? 16 ? 
2  B 200 B 200 1 1 CA HEM .   ? CA HEM .   ? 16 ? 
3  C 200 C 200 1 1 DA HEM .   ? DA HEM .   ? 16 ? 
4  F 200 F 200 1 1 EA HEM .   ? EA HEM .   ? 16 ? 
5  J 200 J 200 1 1 GA HEM .   ? GA HEM .   ? 16 ? 
6  L 200 L 200 1 1 HA HEM .   ? HA HEM .   ? 16 ? 
1  J 200 J 200 1 1 GA HEM .   ? GA HEM .   ? 17 ? 
2  B 200 B 200 1 1 CA HEM .   ? CA HEM .   ? 17 ? 
3  C 200 C 200 1 1 DA HEM .   ? DA HEM .   ? 17 ? 
4  F 200 F 200 1 1 EA HEM .   ? EA HEM .   ? 17 ? 
5  H 200 H 200 1 1 FA HEM .   ? FA HEM .   ? 17 ? 
6  L 200 L 200 1 1 HA HEM .   ? HA HEM .   ? 17 ? 
1  L 200 L 200 1 1 HA HEM .   ? HA HEM .   ? 18 ? 
2  B 200 B 200 1 1 CA HEM .   ? CA HEM .   ? 18 ? 
3  C 200 C 200 1 1 DA HEM .   ? DA HEM .   ? 18 ? 
4  F 200 F 200 1 1 EA HEM .   ? EA HEM .   ? 18 ? 
5  H 200 H 200 1 1 FA HEM .   ? FA HEM .   ? 18 ? 
6  J 200 J 200 1 1 GA HEM .   ? GA HEM .   ? 18 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
16 ? 
17 ? 
18 ? 
# 
_struct.entry_id                  3E1J 
_struct.title                     
'Crystal structure of E. coli Bacterioferritin (BFR) with an unoccupied ferroxidase centre (APO-BFR).' 
_struct.pdbx_descriptor           Bacterioferritin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3E1J 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
'RHOMBIC DODECAHEDRAL SUPERSTRUCTURE. APO-BFR., HEME, IRON, IRON STORAGE, METAL-BINDING, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 3 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 3 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? TRP A 35  ? ASP A 4   TRP A 35  1 ? 32 
HELX_P HELX_P2  2  LEU A 37  ? LEU A 65  ? LEU A 37  LEU A 65  1 ? 29 
HELX_P HELX_P3  3  ASP A 82  ? VAL A 111 ? ASP A 82  VAL A 111 1 ? 30 
HELX_P HELX_P4  4  ASP A 113 ? MET A 144 ? ASP A 113 MET A 144 1 ? 32 
HELX_P HELX_P5  5  LEU A 146 ? ALA A 152 ? LEU A 146 ALA A 152 1 ? 7  
HELX_P HELX_P6  6  ASP B 4   ? TRP B 35  ? ASP B 4   TRP B 35  1 ? 32 
HELX_P HELX_P7  7  LEU B 37  ? LEU B 65  ? LEU B 37  LEU B 65  1 ? 29 
HELX_P HELX_P8  8  ASP B 82  ? VAL B 111 ? ASP B 82  VAL B 111 1 ? 30 
HELX_P HELX_P9  9  ASP B 113 ? MET B 144 ? ASP B 113 MET B 144 1 ? 32 
HELX_P HELX_P10 10 LEU B 146 ? ALA B 152 ? LEU B 146 ALA B 152 1 ? 7  
HELX_P HELX_P11 11 ASP C 4   ? TRP C 35  ? ASP C 4   TRP C 35  1 ? 32 
HELX_P HELX_P12 12 LEU C 37  ? LEU C 65  ? LEU C 37  LEU C 65  1 ? 29 
HELX_P HELX_P13 13 ASP C 82  ? VAL C 111 ? ASP C 82  VAL C 111 1 ? 30 
HELX_P HELX_P14 14 ASP C 113 ? MET C 144 ? ASP C 113 MET C 144 1 ? 32 
HELX_P HELX_P15 15 LEU C 146 ? ALA C 152 ? LEU C 146 ALA C 152 1 ? 7  
HELX_P HELX_P16 16 ASP D 4   ? TRP D 35  ? ASP D 4   TRP D 35  1 ? 32 
HELX_P HELX_P17 17 LEU D 37  ? LEU D 65  ? LEU D 37  LEU D 65  1 ? 29 
HELX_P HELX_P18 18 ASP D 82  ? VAL D 111 ? ASP D 82  VAL D 111 1 ? 30 
HELX_P HELX_P19 19 ASP D 113 ? MET D 144 ? ASP D 113 MET D 144 1 ? 32 
HELX_P HELX_P20 20 LEU D 146 ? ALA D 152 ? LEU D 146 ALA D 152 1 ? 7  
HELX_P HELX_P21 21 ASP E 4   ? TRP E 35  ? ASP E 4   TRP E 35  1 ? 32 
HELX_P HELX_P22 22 LEU E 37  ? LEU E 65  ? LEU E 37  LEU E 65  1 ? 29 
HELX_P HELX_P23 23 ASP E 82  ? VAL E 111 ? ASP E 82  VAL E 111 1 ? 30 
HELX_P HELX_P24 24 ASP E 113 ? MET E 144 ? ASP E 113 MET E 144 1 ? 32 
HELX_P HELX_P25 25 LEU E 146 ? ALA E 152 ? LEU E 146 ALA E 152 1 ? 7  
HELX_P HELX_P26 26 ASP F 4   ? TRP F 35  ? ASP F 4   TRP F 35  1 ? 32 
HELX_P HELX_P27 27 LEU F 37  ? LEU F 65  ? LEU F 37  LEU F 65  1 ? 29 
HELX_P HELX_P28 28 ASP F 82  ? VAL F 111 ? ASP F 82  VAL F 111 1 ? 30 
HELX_P HELX_P29 29 ASP F 113 ? MET F 144 ? ASP F 113 MET F 144 1 ? 32 
HELX_P HELX_P30 30 LEU F 146 ? ALA F 152 ? LEU F 146 ALA F 152 1 ? 7  
HELX_P HELX_P31 31 ASP G 4   ? TRP G 35  ? ASP G 4   TRP G 35  1 ? 32 
HELX_P HELX_P32 32 LEU G 37  ? LEU G 65  ? LEU G 37  LEU G 65  1 ? 29 
HELX_P HELX_P33 33 ASP G 82  ? VAL G 111 ? ASP G 82  VAL G 111 1 ? 30 
HELX_P HELX_P34 34 ASP G 113 ? MET G 144 ? ASP G 113 MET G 144 1 ? 32 
HELX_P HELX_P35 35 LEU G 146 ? ALA G 152 ? LEU G 146 ALA G 152 1 ? 7  
HELX_P HELX_P36 36 ASP H 4   ? TRP H 35  ? ASP H 4   TRP H 35  1 ? 32 
HELX_P HELX_P37 37 LEU H 37  ? LEU H 65  ? LEU H 37  LEU H 65  1 ? 29 
HELX_P HELX_P38 38 ASP H 82  ? VAL H 111 ? ASP H 82  VAL H 111 1 ? 30 
HELX_P HELX_P39 39 ASP H 113 ? MET H 144 ? ASP H 113 MET H 144 1 ? 32 
HELX_P HELX_P40 40 LEU H 146 ? ALA H 152 ? LEU H 146 ALA H 152 1 ? 7  
HELX_P HELX_P41 41 ASP I 4   ? TRP I 35  ? ASP I 4   TRP I 35  1 ? 32 
HELX_P HELX_P42 42 LEU I 37  ? LEU I 65  ? LEU I 37  LEU I 65  1 ? 29 
HELX_P HELX_P43 43 ASP I 82  ? VAL I 111 ? ASP I 82  VAL I 111 1 ? 30 
HELX_P HELX_P44 44 ASP I 113 ? MET I 144 ? ASP I 113 MET I 144 1 ? 32 
HELX_P HELX_P45 45 LEU I 146 ? ALA I 152 ? LEU I 146 ALA I 152 1 ? 7  
HELX_P HELX_P46 46 ASP J 4   ? TRP J 35  ? ASP J 4   TRP J 35  1 ? 32 
HELX_P HELX_P47 47 LEU J 37  ? LEU J 65  ? LEU J 37  LEU J 65  1 ? 29 
HELX_P HELX_P48 48 ASP J 82  ? VAL J 111 ? ASP J 82  VAL J 111 1 ? 30 
HELX_P HELX_P49 49 ASP J 113 ? MET J 144 ? ASP J 113 MET J 144 1 ? 32 
HELX_P HELX_P50 50 LEU J 146 ? ALA J 152 ? LEU J 146 ALA J 152 1 ? 7  
HELX_P HELX_P51 51 ASP K 4   ? TRP K 35  ? ASP K 4   TRP K 35  1 ? 32 
HELX_P HELX_P52 52 LEU K 37  ? LEU K 65  ? LEU K 37  LEU K 65  1 ? 29 
HELX_P HELX_P53 53 ASP K 82  ? VAL K 111 ? ASP K 82  VAL K 111 1 ? 30 
HELX_P HELX_P54 54 ASP K 113 ? MET K 144 ? ASP K 113 MET K 144 1 ? 32 
HELX_P HELX_P55 55 LEU K 146 ? ALA K 152 ? LEU K 146 ALA K 152 1 ? 7  
HELX_P HELX_P56 56 ASP L 4   ? TRP L 35  ? ASP L 4   TRP L 35  1 ? 32 
HELX_P HELX_P57 57 LEU L 37  ? LEU L 65  ? LEU L 37  LEU L 65  1 ? 29 
HELX_P HELX_P58 58 ASP L 82  ? VAL L 111 ? ASP L 82  VAL L 111 1 ? 30 
HELX_P HELX_P59 59 ASP L 113 ? MET L 144 ? ASP L 113 MET L 144 1 ? 32 
HELX_P HELX_P60 60 LEU L 146 ? ALA L 152 ? LEU L 146 ALA L 152 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A MET 52 SD ? ? ? 1_555 Q  HEM . FE ? ? A MET 52 B HEM 200 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc2  metalc ? ? B MET 52 SD ? ? ? 1_555 Q  HEM . FE ? ? B MET 52 B HEM 200 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc3  metalc ? ? C MET 52 SD ? ? ? 1_555 S  HEM . FE ? ? C MET 52 C HEM 200 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc4  metalc ? ? D MET 52 SD ? ? ? 1_555 S  HEM . FE ? ? D MET 52 C HEM 200 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc5  metalc ? ? E MET 52 SD ? ? ? 1_555 X  HEM . FE ? ? E MET 52 F HEM 200 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc6  metalc ? ? F MET 52 SD ? ? ? 1_555 X  HEM . FE ? ? F MET 52 F HEM 200 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc7  metalc ? ? G MET 52 SD ? ? ? 1_555 BA HEM . FE ? ? G MET 52 H HEM 200 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc8  metalc ? ? H MET 52 SD ? ? ? 1_555 BA HEM . FE ? ? H MET 52 H HEM 200 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc9  metalc ? ? I MET 52 SD ? ? ? 1_555 EA HEM . FE ? ? I MET 52 J HEM 200 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc10 metalc ? ? J MET 52 SD ? ? ? 1_555 EA HEM . FE ? ? J MET 52 J HEM 200 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc11 metalc ? ? K MET 52 SD ? ? ? 1_555 HA HEM . FE ? ? K MET 52 L HEM 200 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc12 metalc ? ? L MET 52 SD ? ? ? 1_555 HA HEM . FE ? ? L MET 52 L HEM 200 1_555 ? ? ? ? ? ? ? 2.139 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 250' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 251' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 250' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 251' 
AC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEM B 200' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 250' 
AC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE HEM C 200' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 250' 
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 E 250' 
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 250' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 251' 
BC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEM F 200' 
BC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 G 250' 
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 G 251' 
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 H 250' 
BC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEM H 200' 
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 I 250' 
BC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 J 250' 
CC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE HEM J 200' 
CC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 K 250' 
CC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 L 250' 
CC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE HEM L 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  GLY A  145 ? GLY A 145 . ? 1_555 ? 
2   AC1 4  LEU A  146 ? LEU A 146 . ? 1_555 ? 
3   AC1 4  GLN A  147 ? GLN A 147 . ? 1_555 ? 
4   AC1 4  HOH IA .   ? HOH A 258 . ? 1_555 ? 
5   AC2 3  ARG A  117 ? ARG A 117 . ? 1_555 ? 
6   AC2 3  ARG D  117 ? ARG D 117 . ? 7_555 ? 
7   AC2 3  ARG J  117 ? ARG J 117 . ? 1_555 ? 
8   AC3 4  GLY B  145 ? GLY B 145 . ? 1_555 ? 
9   AC3 4  LEU B  146 ? LEU B 146 . ? 1_555 ? 
10  AC3 4  GLN B  147 ? GLN B 147 . ? 1_555 ? 
11  AC3 4  HOH JA .   ? HOH B 256 . ? 1_555 ? 
12  AC4 3  ARG B  117 ? ARG B 117 . ? 1_555 ? 
13  AC4 3  ARG C  117 ? ARG C 117 . ? 1_555 ? 
14  AC4 3  ARG H  117 ? ARG H 117 . ? 1_555 ? 
15  AC5 14 ILE A  22  ? ILE A 22  . ? 1_555 ? 
16  AC5 14 ASN A  23  ? ASN A 23  . ? 1_555 ? 
17  AC5 14 PHE A  26  ? PHE A 26  . ? 1_555 ? 
18  AC5 14 TYR A  45  ? TYR A 45  . ? 1_555 ? 
19  AC5 14 MET A  52  ? MET A 52  . ? 1_555 ? 
20  AC5 14 ALA A  55  ? ALA A 55  . ? 1_555 ? 
21  AC5 14 HOH IA .   ? HOH A 254 . ? 1_555 ? 
22  AC5 14 ILE B  22  ? ILE B 22  . ? 1_555 ? 
23  AC5 14 ASN B  23  ? ASN B 23  . ? 1_555 ? 
24  AC5 14 PHE B  26  ? PHE B 26  . ? 1_555 ? 
25  AC5 14 TYR B  45  ? TYR B 45  . ? 1_555 ? 
26  AC5 14 MET B  52  ? MET B 52  . ? 1_555 ? 
27  AC5 14 HOH JA .   ? HOH B 253 . ? 1_555 ? 
28  AC5 14 HOH JA .   ? HOH B 254 . ? 1_555 ? 
29  AC6 5  GLY C  145 ? GLY C 145 . ? 1_555 ? 
30  AC6 5  LEU C  146 ? LEU C 146 . ? 1_555 ? 
31  AC6 5  GLN C  147 ? GLN C 147 . ? 1_555 ? 
32  AC6 5  HOH KA .   ? HOH C 253 . ? 1_555 ? 
33  AC6 5  HOH KA .   ? HOH C 273 . ? 1_555 ? 
34  AC7 13 ILE C  22  ? ILE C 22  . ? 1_555 ? 
35  AC7 13 ASN C  23  ? ASN C 23  . ? 1_555 ? 
36  AC7 13 PHE C  26  ? PHE C 26  . ? 1_555 ? 
37  AC7 13 TYR C  45  ? TYR C 45  . ? 1_555 ? 
38  AC7 13 MET C  52  ? MET C 52  . ? 1_555 ? 
39  AC7 13 ALA C  55  ? ALA C 55  . ? 1_555 ? 
40  AC7 13 LEU D  19  ? LEU D 19  . ? 1_555 ? 
41  AC7 13 ASN D  23  ? ASN D 23  . ? 1_555 ? 
42  AC7 13 PHE D  26  ? PHE D 26  . ? 1_555 ? 
43  AC7 13 TYR D  45  ? TYR D 45  . ? 1_555 ? 
44  AC7 13 MET D  52  ? MET D 52  . ? 1_555 ? 
45  AC7 13 HOH LA .   ? HOH D 253 . ? 1_555 ? 
46  AC7 13 HOH LA .   ? HOH D 265 . ? 1_555 ? 
47  AC8 4  GLY D  145 ? GLY D 145 . ? 1_555 ? 
48  AC8 4  LEU D  146 ? LEU D 146 . ? 1_555 ? 
49  AC8 4  GLN D  147 ? GLN D 147 . ? 1_555 ? 
50  AC8 4  HOH LA .   ? HOH D 251 . ? 1_555 ? 
51  AC9 4  GLY E  145 ? GLY E 145 . ? 1_555 ? 
52  AC9 4  LEU E  146 ? LEU E 146 . ? 1_555 ? 
53  AC9 4  GLN E  147 ? GLN E 147 . ? 1_555 ? 
54  AC9 4  HOH MA .   ? HOH E 251 . ? 1_555 ? 
55  BC1 4  GLY F  145 ? GLY F 145 . ? 1_555 ? 
56  BC1 4  LEU F  146 ? LEU F 146 . ? 1_555 ? 
57  BC1 4  GLN F  147 ? GLN F 147 . ? 1_555 ? 
58  BC1 4  HOH NA .   ? HOH F 252 . ? 1_555 ? 
59  BC2 4  ARG F  117 ? ARG F 117 . ? 1_555 ? 
60  BC2 4  ARG I  117 ? ARG I 117 . ? 1_555 ? 
61  BC2 4  HOH QA .   ? HOH I 278 . ? 1_555 ? 
62  BC2 4  ARG K  117 ? ARG K 117 . ? 1_555 ? 
63  BC3 15 ILE E  22  ? ILE E 22  . ? 1_555 ? 
64  BC3 15 ASN E  23  ? ASN E 23  . ? 1_555 ? 
65  BC3 15 PHE E  26  ? PHE E 26  . ? 1_555 ? 
66  BC3 15 TYR E  45  ? TYR E 45  . ? 1_555 ? 
67  BC3 15 ILE E  49  ? ILE E 49  . ? 1_555 ? 
68  BC3 15 MET E  52  ? MET E 52  . ? 1_555 ? 
69  BC3 15 ALA E  55  ? ALA E 55  . ? 1_555 ? 
70  BC3 15 HOH MA .   ? HOH E 252 . ? 1_555 ? 
71  BC3 15 ILE F  22  ? ILE F 22  . ? 1_555 ? 
72  BC3 15 ASN F  23  ? ASN F 23  . ? 1_555 ? 
73  BC3 15 PHE F  26  ? PHE F 26  . ? 1_555 ? 
74  BC3 15 TYR F  45  ? TYR F 45  . ? 1_555 ? 
75  BC3 15 MET F  52  ? MET F 52  . ? 1_555 ? 
76  BC3 15 HOH NA .   ? HOH F 253 . ? 1_555 ? 
77  BC3 15 HOH NA .   ? HOH F 255 . ? 1_555 ? 
78  BC4 5  GLY G  145 ? GLY G 145 . ? 1_555 ? 
79  BC4 5  LEU G  146 ? LEU G 146 . ? 1_555 ? 
80  BC4 5  GLN G  147 ? GLN G 147 . ? 1_555 ? 
81  BC4 5  HOH OA .   ? HOH G 252 . ? 1_555 ? 
82  BC4 5  HOH OA .   ? HOH G 284 . ? 1_555 ? 
83  BC5 3  ARG E  117 ? ARG E 117 . ? 7_555 ? 
84  BC5 3  ARG G  117 ? ARG G 117 . ? 1_555 ? 
85  BC5 3  ARG L  117 ? ARG L 117 . ? 1_555 ? 
86  BC6 4  GLY H  145 ? GLY H 145 . ? 1_555 ? 
87  BC6 4  LEU H  146 ? LEU H 146 . ? 1_555 ? 
88  BC6 4  GLN H  147 ? GLN H 147 . ? 1_555 ? 
89  BC6 4  HOH PA .   ? HOH H 251 . ? 1_555 ? 
90  BC7 14 ILE G  22  ? ILE G 22  . ? 1_555 ? 
91  BC7 14 ASN G  23  ? ASN G 23  . ? 1_555 ? 
92  BC7 14 PHE G  26  ? PHE G 26  . ? 1_555 ? 
93  BC7 14 TYR G  45  ? TYR G 45  . ? 1_555 ? 
94  BC7 14 MET G  52  ? MET G 52  . ? 1_555 ? 
95  BC7 14 ALA G  55  ? ALA G 55  . ? 1_555 ? 
96  BC7 14 HOH OA .   ? HOH G 253 . ? 1_555 ? 
97  BC7 14 LEU H  19  ? LEU H 19  . ? 1_555 ? 
98  BC7 14 ASN H  23  ? ASN H 23  . ? 1_555 ? 
99  BC7 14 PHE H  26  ? PHE H 26  . ? 1_555 ? 
100 BC7 14 TYR H  45  ? TYR H 45  . ? 1_555 ? 
101 BC7 14 MET H  52  ? MET H 52  . ? 1_555 ? 
102 BC7 14 HOH PA .   ? HOH H 252 . ? 1_555 ? 
103 BC7 14 HOH PA .   ? HOH H 256 . ? 1_555 ? 
104 BC8 4  GLY I  145 ? GLY I 145 . ? 1_555 ? 
105 BC8 4  LEU I  146 ? LEU I 146 . ? 1_555 ? 
106 BC8 4  GLN I  147 ? GLN I 147 . ? 1_555 ? 
107 BC8 4  HOH QA .   ? HOH I 251 . ? 1_555 ? 
108 BC9 4  GLY J  145 ? GLY J 145 . ? 1_555 ? 
109 BC9 4  LEU J  146 ? LEU J 146 . ? 1_555 ? 
110 BC9 4  GLN J  147 ? GLN J 147 . ? 1_555 ? 
111 BC9 4  HOH RA .   ? HOH J 252 . ? 1_555 ? 
112 CC1 13 ILE I  22  ? ILE I 22  . ? 1_555 ? 
113 CC1 13 ASN I  23  ? ASN I 23  . ? 1_555 ? 
114 CC1 13 PHE I  26  ? PHE I 26  . ? 1_555 ? 
115 CC1 13 TYR I  45  ? TYR I 45  . ? 1_555 ? 
116 CC1 13 MET I  52  ? MET I 52  . ? 1_555 ? 
117 CC1 13 ALA I  55  ? ALA I 55  . ? 1_555 ? 
118 CC1 13 ILE J  22  ? ILE J 22  . ? 1_555 ? 
119 CC1 13 ASN J  23  ? ASN J 23  . ? 1_555 ? 
120 CC1 13 PHE J  26  ? PHE J 26  . ? 1_555 ? 
121 CC1 13 TYR J  45  ? TYR J 45  . ? 1_555 ? 
122 CC1 13 MET J  52  ? MET J 52  . ? 1_555 ? 
123 CC1 13 HOH RA .   ? HOH J 253 . ? 1_555 ? 
124 CC1 13 HOH RA .   ? HOH J 256 . ? 1_555 ? 
125 CC2 4  GLY K  145 ? GLY K 145 . ? 1_555 ? 
126 CC2 4  LEU K  146 ? LEU K 146 . ? 1_555 ? 
127 CC2 4  GLN K  147 ? GLN K 147 . ? 1_555 ? 
128 CC2 4  HOH SA .   ? HOH K 251 . ? 1_555 ? 
129 CC3 4  GLY L  145 ? GLY L 145 . ? 1_555 ? 
130 CC3 4  LEU L  146 ? LEU L 146 . ? 1_555 ? 
131 CC3 4  GLN L  147 ? GLN L 147 . ? 1_555 ? 
132 CC3 4  HOH TA .   ? HOH L 251 . ? 1_555 ? 
133 CC4 13 ILE K  22  ? ILE K 22  . ? 1_555 ? 
134 CC4 13 ASN K  23  ? ASN K 23  . ? 1_555 ? 
135 CC4 13 PHE K  26  ? PHE K 26  . ? 1_555 ? 
136 CC4 13 TYR K  45  ? TYR K 45  . ? 1_555 ? 
137 CC4 13 MET K  52  ? MET K 52  . ? 1_555 ? 
138 CC4 13 ALA K  55  ? ALA K 55  . ? 1_555 ? 
139 CC4 13 HOH SA .   ? HOH K 252 . ? 1_555 ? 
140 CC4 13 ILE L  22  ? ILE L 22  . ? 1_555 ? 
141 CC4 13 ASN L  23  ? ASN L 23  . ? 1_555 ? 
142 CC4 13 PHE L  26  ? PHE L 26  . ? 1_555 ? 
143 CC4 13 TYR L  45  ? TYR L 45  . ? 1_555 ? 
144 CC4 13 MET L  52  ? MET L 52  . ? 1_555 ? 
145 CC4 13 HOH TA .   ? HOH L 253 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3E1J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3E1J 
_atom_sites.fract_transf_matrix[1][1]   0.004803 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004803 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007020 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A  1 1   ? -97.209  -31.892  -18.550 1.00 7.47  ? 1   MET A N   1 
ATOM   2     C  CA  . MET A  1 1   ? -97.775  -32.011  -19.936 1.00 8.49  ? 1   MET A CA  1 
ATOM   3     C  C   . MET A  1 1   ? -99.140  -32.696  -19.831 1.00 8.24  ? 1   MET A C   1 
ATOM   4     O  O   . MET A  1 1   ? -99.222  -33.747  -19.232 1.00 8.26  ? 1   MET A O   1 
ATOM   5     C  CB  . MET A  1 1   ? -96.816  -32.868  -20.739 1.00 7.81  ? 1   MET A CB  1 
ATOM   6     C  CG  . MET A  1 1   ? -96.932  -32.780  -22.218 1.00 7.90  ? 1   MET A CG  1 
ATOM   7     S  SD  . MET A  1 1   ? -95.586  -33.878  -22.801 1.00 10.97 ? 1   MET A SD  1 
ATOM   8     C  CE  . MET A  1 1   ? -96.366  -35.507  -22.734 1.00 5.72  ? 1   MET A CE  1 
ATOM   9     N  N   . LYS A  1 2   ? -100.206 -32.109  -20.365 1.00 9.07  ? 2   LYS A N   1 
ATOM   10    C  CA  . LYS A  1 2   ? -101.558 -32.718  -20.197 1.00 10.63 ? 2   LYS A CA  1 
ATOM   11    C  C   . LYS A  1 2   ? -101.665 -33.996  -21.008 1.00 9.27  ? 2   LYS A C   1 
ATOM   12    O  O   . LYS A  1 2   ? -101.616 -33.947  -22.235 1.00 9.80  ? 2   LYS A O   1 
ATOM   13    C  CB  . LYS A  1 2   ? -102.670 -31.768  -20.662 1.00 10.61 ? 2   LYS A CB  1 
ATOM   14    C  CG  . LYS A  1 2   ? -103.755 -31.498  -19.594 1.00 14.40 ? 2   LYS A CG  1 
ATOM   15    C  CD  . LYS A  1 2   ? -105.184 -31.244  -20.205 1.00 15.09 ? 2   LYS A CD  1 
ATOM   16    C  CE  . LYS A  1 2   ? -105.856 -32.583  -20.647 1.00 19.15 ? 2   LYS A CE  1 
ATOM   17    N  NZ  . LYS A  1 2   ? -107.353 -32.494  -20.718 1.00 19.87 ? 2   LYS A NZ  1 
ATOM   18    N  N   . GLY A  1 3   ? -101.796 -35.137  -20.339 1.00 8.20  ? 3   GLY A N   1 
ATOM   19    C  CA  . GLY A  1 3   ? -101.875 -36.421  -21.034 1.00 6.90  ? 3   GLY A CA  1 
ATOM   20    C  C   . GLY A  1 3   ? -103.270 -36.775  -21.518 1.00 6.24  ? 3   GLY A C   1 
ATOM   21    O  O   . GLY A  1 3   ? -104.213 -36.069  -21.226 1.00 6.57  ? 3   GLY A O   1 
ATOM   22    N  N   . ASP A  1 4   ? -103.396 -37.881  -22.245 1.00 5.88  ? 4   ASP A N   1 
ATOM   23    C  CA  . ASP A  1 4   ? -104.693 -38.384  -22.658 1.00 5.70  ? 4   ASP A CA  1 
ATOM   24    C  C   . ASP A  1 4   ? -105.393 -38.936  -21.423 1.00 5.84  ? 4   ASP A C   1 
ATOM   25    O  O   . ASP A  1 4   ? -104.783 -39.674  -20.654 1.00 6.68  ? 4   ASP A O   1 
ATOM   26    C  CB  . ASP A  1 4   ? -104.515 -39.434  -23.745 1.00 5.44  ? 4   ASP A CB  1 
ATOM   27    C  CG  . ASP A  1 4   ? -105.785 -40.142  -24.095 1.00 6.93  ? 4   ASP A CG  1 
ATOM   28    O  OD1 . ASP A  1 4   ? -106.084 -41.188  -23.451 1.00 9.26  ? 4   ASP A OD1 1 
ATOM   29    O  OD2 . ASP A  1 4   ? -106.471 -39.684  -25.038 1.00 6.94  ? 4   ASP A OD2 1 
ATOM   30    N  N   . THR A  1 5   ? -106.648 -38.546  -21.210 1.00 5.73  ? 5   THR A N   1 
ATOM   31    C  CA  . THR A  1 5   ? -107.420 -38.965  -20.033 1.00 5.85  ? 5   THR A CA  1 
ATOM   32    C  C   . THR A  1 5   ? -107.526 -40.478  -19.869 1.00 5.63  ? 5   THR A C   1 
ATOM   33    O  O   . THR A  1 5   ? -107.397 -41.025  -18.754 1.00 5.76  ? 5   THR A O   1 
ATOM   34    C  CB  . THR A  1 5   ? -108.863 -38.379  -20.081 1.00 6.02  ? 5   THR A CB  1 
ATOM   35    O  OG1 . THR A  1 5   ? -108.766 -36.958  -20.065 1.00 7.11  ? 5   THR A OG1 1 
ATOM   36    C  CG2 . THR A  1 5   ? -109.715 -38.808  -18.861 1.00 5.34  ? 5   THR A CG2 1 
ATOM   37    N  N   . LYS A  1 6   ? -107.798 -41.156  -20.972 1.00 5.15  ? 6   LYS A N   1 
ATOM   38    C  CA  . LYS A  1 6   ? -108.018 -42.592  -20.930 1.00 4.74  ? 6   LYS A CA  1 
ATOM   39    C  C   . LYS A  1 6   ? -106.668 -43.284  -20.622 1.00 4.71  ? 6   LYS A C   1 
ATOM   40    O  O   . LYS A  1 6   ? -106.655 -44.310  -19.926 1.00 5.01  ? 6   LYS A O   1 
ATOM   41    C  CB  . LYS A  1 6   ? -108.676 -43.072  -22.228 1.00 4.14  ? 6   LYS A CB  1 
ATOM   42    C  CG  . LYS A  1 6   ? -108.872 -44.544  -22.277 1.00 6.53  ? 6   LYS A CG  1 
ATOM   43    C  CD  . LYS A  1 6   ? -110.126 -44.997  -23.025 1.00 9.47  ? 6   LYS A CD  1 
ATOM   44    C  CE  . LYS A  1 6   ? -110.930 -45.978  -22.095 1.00 13.25 ? 6   LYS A CE  1 
ATOM   45    N  NZ  . LYS A  1 6   ? -111.048 -47.381  -22.596 1.00 17.06 ? 6   LYS A NZ  1 
ATOM   46    N  N   . VAL A  1 7   ? -105.540 -42.731  -21.105 1.00 3.67  ? 7   VAL A N   1 
ATOM   47    C  CA  . VAL A  1 7   ? -104.234 -43.274  -20.719 1.00 3.13  ? 7   VAL A CA  1 
ATOM   48    C  C   . VAL A  1 7   ? -104.045 -43.202  -19.194 1.00 3.18  ? 7   VAL A C   1 
ATOM   49    O  O   . VAL A  1 7   ? -103.551 -44.153  -18.548 1.00 3.03  ? 7   VAL A O   1 
ATOM   50    C  CB  . VAL A  1 7   ? -103.045 -42.563  -21.412 1.00 3.02  ? 7   VAL A CB  1 
ATOM   51    C  CG1 . VAL A  1 7   ? -101.723 -42.982  -20.775 1.00 2.00  ? 7   VAL A CG1 1 
ATOM   52    C  CG2 . VAL A  1 7   ? -103.026 -42.911  -22.865 1.00 2.47  ? 7   VAL A CG2 1 
ATOM   53    N  N   . ILE A  1 8   ? -104.423 -42.061  -18.623 1.00 2.80  ? 8   ILE A N   1 
ATOM   54    C  CA  . ILE A  1 8   ? -104.339 -41.890  -17.199 1.00 2.58  ? 8   ILE A CA  1 
ATOM   55    C  C   . ILE A  1 8   ? -105.242 -42.904  -16.486 1.00 3.35  ? 8   ILE A C   1 
ATOM   56    O  O   . ILE A  1 8   ? -104.800 -43.478  -15.498 1.00 3.27  ? 8   ILE A O   1 
ATOM   57    C  CB  . ILE A  1 8   ? -104.650 -40.445  -16.784 1.00 2.71  ? 8   ILE A CB  1 
ATOM   58    C  CG1 . ILE A  1 8   ? -103.541 -39.507  -17.268 1.00 3.44  ? 8   ILE A CG1 1 
ATOM   59    C  CG2 . ILE A  1 8   ? -104.784 -40.325  -15.262 1.00 2.62  ? 8   ILE A CG2 1 
ATOM   60    C  CD1 . ILE A  1 8   ? -103.927 -38.048  -17.332 1.00 2.71  ? 8   ILE A CD1 1 
ATOM   61    N  N   . ASN A  1 9   ? -106.470 -43.141  -16.981 1.00 3.96  ? 9   ASN A N   1 
ATOM   62    C  CA  . ASN A  1 9   ? -107.337 -44.157  -16.385 1.00 4.76  ? 9   ASN A CA  1 
ATOM   63    C  C   . ASN A  1 9   ? -106.655 -45.523  -16.401 1.00 4.42  ? 9   ASN A C   1 
ATOM   64    O  O   . ASN A  1 9   ? -106.703 -46.264  -15.423 1.00 4.79  ? 9   ASN A O   1 
ATOM   65    C  CB  . ASN A  1 9   ? -108.715 -44.265  -17.073 1.00 5.78  ? 9   ASN A CB  1 
ATOM   66    C  CG  . ASN A  1 9   ? -109.636 -43.059  -16.793 1.00 10.58 ? 9   ASN A CG  1 
ATOM   67    O  OD1 . ASN A  1 9   ? -109.702 -42.564  -15.674 1.00 19.62 ? 9   ASN A OD1 1 
ATOM   68    N  ND2 . ASN A  1 9   ? -110.375 -42.600  -17.818 1.00 12.22 ? 9   ASN A ND2 1 
ATOM   69    N  N   . TYR A  1 10  ? -106.017 -45.855  -17.518 1.00 3.60  ? 10  TYR A N   1 
ATOM   70    C  CA  . TYR A  1 10  ? -105.321 -47.112  -17.625 1.00 3.21  ? 10  TYR A CA  1 
ATOM   71    C  C   . TYR A  1 10  ? -104.176 -47.172  -16.628 1.00 3.19  ? 10  TYR A C   1 
ATOM   72    O  O   . TYR A  1 10  ? -104.042 -48.154  -15.910 1.00 3.19  ? 10  TYR A O   1 
ATOM   73    C  CB  . TYR A  1 10  ? -104.777 -47.325  -19.027 1.00 3.19  ? 10  TYR A CB  1 
ATOM   74    C  CG  . TYR A  1 10  ? -105.704 -48.039  -19.959 1.00 3.10  ? 10  TYR A CG  1 
ATOM   75    C  CD1 . TYR A  1 10  ? -106.181 -49.304  -19.648 1.00 2.00  ? 10  TYR A CD1 1 
ATOM   76    C  CD2 . TYR A  1 10  ? -106.097 -47.441  -21.162 1.00 2.34  ? 10  TYR A CD2 1 
ATOM   77    C  CE1 . TYR A  1 10  ? -107.031 -49.964  -20.494 1.00 2.62  ? 10  TYR A CE1 1 
ATOM   78    C  CE2 . TYR A  1 10  ? -106.932 -48.087  -22.026 1.00 2.13  ? 10  TYR A CE2 1 
ATOM   79    C  CZ  . TYR A  1 10  ? -107.415 -49.347  -21.695 1.00 3.90  ? 10  TYR A CZ  1 
ATOM   80    O  OH  . TYR A  1 10  ? -108.263 -49.997  -22.560 1.00 4.42  ? 10  TYR A OH  1 
ATOM   81    N  N   . LEU A  1 11  ? -103.371 -46.110  -16.583 1.00 2.65  ? 11  LEU A N   1 
ATOM   82    C  CA  . LEU A  1 11  ? -102.275 -46.018  -15.634 1.00 2.11  ? 11  LEU A CA  1 
ATOM   83    C  C   . LEU A  1 11  ? -102.773 -46.243  -14.187 1.00 2.47  ? 11  LEU A C   1 
ATOM   84    O  O   . LEU A  1 11  ? -102.158 -47.011  -13.417 1.00 2.46  ? 11  LEU A O   1 
ATOM   85    C  CB  . LEU A  1 11  ? -101.536 -44.706  -15.795 1.00 2.00  ? 11  LEU A CB  1 
ATOM   86    C  CG  . LEU A  1 11  ? -100.266 -44.674  -16.644 1.00 2.48  ? 11  LEU A CG  1 
ATOM   87    C  CD1 . LEU A  1 11  ? -100.186 -45.771  -17.667 1.00 2.11  ? 11  LEU A CD1 1 
ATOM   88    C  CD2 . LEU A  1 11  ? -99.972  -43.301  -17.265 1.00 2.00  ? 11  LEU A CD2 1 
ATOM   89    N  N   . ASN A  1 12  ? -103.900 -45.632  -13.821 1.00 2.16  ? 12  ASN A N   1 
ATOM   90    C  CA  . ASN A  1 12  ? -104.449 -45.829  -12.476 1.00 2.05  ? 12  ASN A CA  1 
ATOM   91    C  C   . ASN A  1 12  ? -104.937 -47.260  -12.303 1.00 2.48  ? 12  ASN A C   1 
ATOM   92    O  O   . ASN A  1 12  ? -104.792 -47.843  -11.235 1.00 2.65  ? 12  ASN A O   1 
ATOM   93    C  CB  . ASN A  1 12  ? -105.572 -44.835  -12.160 1.00 2.04  ? 12  ASN A CB  1 
ATOM   94    C  CG  . ASN A  1 12  ? -105.078 -43.594  -11.438 1.00 2.47  ? 12  ASN A CG  1 
ATOM   95    O  OD1 . ASN A  1 12  ? -104.279 -43.682  -10.528 1.00 4.18  ? 12  ASN A OD1 1 
ATOM   96    N  ND2 . ASN A  1 12  ? -105.562 -42.435  -11.846 1.00 2.00  ? 12  ASN A ND2 1 
ATOM   97    N  N   . LYS A  1 13  ? -105.491 -47.849  -13.346 1.00 2.54  ? 13  LYS A N   1 
ATOM   98    C  CA  . LYS A  1 13  ? -105.947 -49.213  -13.220 1.00 3.19  ? 13  LYS A CA  1 
ATOM   99    C  C   . LYS A  1 13  ? -104.756 -50.169  -13.025 1.00 3.58  ? 13  LYS A C   1 
ATOM   100   O  O   . LYS A  1 13  ? -104.782 -51.051  -12.136 1.00 4.26  ? 13  LYS A O   1 
ATOM   101   C  CB  . LYS A  1 13  ? -106.785 -49.607  -14.436 1.00 3.16  ? 13  LYS A CB  1 
ATOM   102   C  CG  . LYS A  1 13  ? -107.135 -51.049  -14.520 1.00 2.85  ? 13  LYS A CG  1 
ATOM   103   C  CD  . LYS A  1 13  ? -108.379 -51.236  -15.328 1.00 5.52  ? 13  LYS A CD  1 
ATOM   104   C  CE  . LYS A  1 13  ? -108.478 -52.664  -15.801 1.00 8.11  ? 13  LYS A CE  1 
ATOM   105   N  NZ  . LYS A  1 13  ? -109.791 -53.227  -15.465 1.00 10.00 ? 13  LYS A NZ  1 
ATOM   106   N  N   . LEU A  1 14  ? -103.721 -49.983  -13.840 1.00 3.02  ? 14  LEU A N   1 
ATOM   107   C  CA  . LEU A  1 14  ? -102.506 -50.752  -13.689 1.00 2.94  ? 14  LEU A CA  1 
ATOM   108   C  C   . LEU A  1 14  ? -101.890 -50.530  -12.293 1.00 3.25  ? 14  LEU A C   1 
ATOM   109   O  O   . LEU A  1 14  ? -101.512 -51.507  -11.615 1.00 3.03  ? 14  LEU A O   1 
ATOM   110   C  CB  . LEU A  1 14  ? -101.511 -50.421  -14.795 1.00 2.48  ? 14  LEU A CB  1 
ATOM   111   C  CG  . LEU A  1 14  ? -102.043 -50.725  -16.196 1.00 2.72  ? 14  LEU A CG  1 
ATOM   112   C  CD1 . LEU A  1 14  ? -101.019 -50.338  -17.242 1.00 3.80  ? 14  LEU A CD1 1 
ATOM   113   C  CD2 . LEU A  1 14  ? -102.433 -52.149  -16.347 1.00 2.00  ? 14  LEU A CD2 1 
ATOM   114   N  N   . LEU A  1 15  ? -101.833 -49.266  -11.846 1.00 3.09  ? 15  LEU A N   1 
ATOM   115   C  CA  . LEU A  1 15  ? -101.366 -48.948  -10.499 1.00 2.26  ? 15  LEU A CA  1 
ATOM   116   C  C   . LEU A  1 15  ? -102.157 -49.738  -9.474  1.00 2.79  ? 15  LEU A C   1 
ATOM   117   O  O   . LEU A  1 15  ? -101.586 -50.266  -8.539  1.00 2.79  ? 15  LEU A O   1 
ATOM   118   C  CB  . LEU A  1 15  ? -101.496 -47.453  -10.231 1.00 2.02  ? 15  LEU A CB  1 
ATOM   119   C  CG  . LEU A  1 15  ? -101.228 -46.939  -8.819  1.00 2.00  ? 15  LEU A CG  1 
ATOM   120   C  CD1 . LEU A  1 15  ? -99.863  -47.306  -8.309  1.00 2.00  ? 15  LEU A CD1 1 
ATOM   121   C  CD2 . LEU A  1 15  ? -101.424 -45.467  -8.754  1.00 2.00  ? 15  LEU A CD2 1 
ATOM   122   N  N   . GLY A  1 16  ? -103.474 -49.831  -9.676  1.00 3.02  ? 16  GLY A N   1 
ATOM   123   C  CA  . GLY A  1 16  ? -104.334 -50.575  -8.794  1.00 3.47  ? 16  GLY A CA  1 
ATOM   124   C  C   . GLY A  1 16  ? -103.917 -52.041  -8.728  1.00 4.61  ? 16  GLY A C   1 
ATOM   125   O  O   . GLY A  1 16  ? -103.937 -52.650  -7.658  1.00 4.32  ? 16  GLY A O   1 
ATOM   126   N  N   . ASN A  1 17  ? -103.553 -52.610  -9.878  1.00 5.37  ? 17  ASN A N   1 
ATOM   127   C  CA  . ASN A  1 17  ? -103.131 -53.991  -9.946  1.00 6.08  ? 17  ASN A CA  1 
ATOM   128   C  C   . ASN A  1 17  ? -101.866 -54.181  -9.127  1.00 7.01  ? 17  ASN A C   1 
ATOM   129   O  O   . ASN A  1 17  ? -101.770 -55.168  -8.374  1.00 7.19  ? 17  ASN A O   1 
ATOM   130   C  CB  . ASN A  1 17  ? -102.839 -54.430  -11.379 1.00 6.04  ? 17  ASN A CB  1 
ATOM   131   C  CG  . ASN A  1 17  ? -104.082 -54.563  -12.231 1.00 6.58  ? 17  ASN A CG  1 
ATOM   132   O  OD1 . ASN A  1 17  ? -105.179 -54.676  -11.736 1.00 5.61  ? 17  ASN A OD1 1 
ATOM   133   N  ND2 . ASN A  1 17  ? -103.893 -54.572  -13.530 1.00 8.91  ? 17  ASN A ND2 1 
ATOM   134   N  N   . GLU A  1 18  ? -100.894 -53.254  -9.271  1.00 7.04  ? 18  GLU A N   1 
ATOM   135   C  CA  . GLU A  1 18  ? -99.613  -53.396  -8.597  1.00 7.59  ? 18  GLU A CA  1 
ATOM   136   C  C   . GLU A  1 18  ? -99.848  -53.228  -7.116  1.00 7.75  ? 18  GLU A C   1 
ATOM   137   O  O   . GLU A  1 18  ? -99.210  -53.881  -6.277  1.00 7.44  ? 18  GLU A O   1 
ATOM   138   C  CB  . GLU A  1 18  ? -98.579  -52.363  -9.053  1.00 7.67  ? 18  GLU A CB  1 
ATOM   139   C  CG  . GLU A  1 18  ? -98.211  -52.358  -10.510 1.00 9.76  ? 18  GLU A CG  1 
ATOM   140   C  CD  . GLU A  1 18  ? -97.391  -53.551  -10.993 1.00 13.56 ? 18  GLU A CD  1 
ATOM   141   O  OE1 . GLU A  1 18  ? -96.665  -54.220  -10.197 1.00 13.04 ? 18  GLU A OE1 1 
ATOM   142   O  OE2 . GLU A  1 18  ? -97.459  -53.799  -12.225 1.00 15.53 ? 18  GLU A OE2 1 
ATOM   143   N  N   . LEU A  1 19  ? -100.769 -52.350  -6.745  1.00 7.47  ? 19  LEU A N   1 
ATOM   144   C  CA  . LEU A  1 19  ? -100.907 -52.256  -5.335  1.00 7.23  ? 19  LEU A CA  1 
ATOM   145   C  C   . LEU A  1 19  ? -101.594 -53.380  -4.625  1.00 6.87  ? 19  LEU A C   1 
ATOM   146   O  O   . LEU A  1 19  ? -101.214 -53.685  -3.507  1.00 7.37  ? 19  LEU A O   1 
ATOM   147   C  CB  . LEU A  1 19  ? -101.019 -50.856  -4.755  1.00 7.64  ? 19  LEU A CB  1 
ATOM   148   C  CG  . LEU A  1 19  ? -101.854 -49.604  -4.781  1.00 8.52  ? 19  LEU A CG  1 
ATOM   149   C  CD1 . LEU A  1 19  ? -100.750 -48.622  -4.896  1.00 7.75  ? 19  LEU A CD1 1 
ATOM   150   C  CD2 . LEU A  1 19  ? -102.805 -49.383  -5.914  1.00 11.90 ? 19  LEU A CD2 1 
ATOM   151   N  N   . VAL A  1 20  ? -102.478 -54.123  -5.299  1.00 6.22  ? 20  VAL A N   1 
ATOM   152   C  CA  . VAL A  1 20  ? -102.863 -55.390  -4.694  1.00 4.55  ? 20  VAL A CA  1 
ATOM   153   C  C   . VAL A  1 20  ? -101.695 -56.393  -4.682  1.00 3.96  ? 20  VAL A C   1 
ATOM   154   O  O   . VAL A  1 20  ? -101.442 -57.026  -3.647  1.00 4.00  ? 20  VAL A O   1 
ATOM   155   C  CB  . VAL A  1 20  ? -104.293 -55.975  -5.074  1.00 4.12  ? 20  VAL A CB  1 
ATOM   156   C  CG1 . VAL A  1 20  ? -104.960 -55.234  -6.136  1.00 3.20  ? 20  VAL A CG1 1 
ATOM   157   C  CG2 . VAL A  1 20  ? -104.239 -57.452  -5.368  1.00 3.04  ? 20  VAL A CG2 1 
ATOM   158   N  N   . ALA A  1 21  ? -100.948 -56.492  -5.772  1.00 2.93  ? 21  ALA A N   1 
ATOM   159   C  CA  . ALA A  1 21  ? -99.811  -57.407  -5.822  1.00 2.39  ? 21  ALA A CA  1 
ATOM   160   C  C   . ALA A  1 21  ? -98.782  -57.140  -4.714  1.00 2.93  ? 21  ALA A C   1 
ATOM   161   O  O   . ALA A  1 21  ? -98.290  -58.091  -4.090  1.00 3.44  ? 21  ALA A O   1 
ATOM   162   C  CB  . ALA A  1 21  ? -99.149  -57.356  -7.131  1.00 2.00  ? 21  ALA A CB  1 
ATOM   163   N  N   . ILE A  1 22  ? -98.463  -55.862  -4.460  1.00 2.95  ? 22  ILE A N   1 
ATOM   164   C  CA  . ILE A  1 22  ? -97.532  -55.477  -3.412  1.00 3.05  ? 22  ILE A CA  1 
ATOM   165   C  C   . ILE A  1 22  ? -97.896  -56.111  -2.093  1.00 3.66  ? 22  ILE A C   1 
ATOM   166   O  O   . ILE A  1 22  ? -97.049  -56.773  -1.456  1.00 4.17  ? 22  ILE A O   1 
ATOM   167   C  CB  . ILE A  1 22  ? -97.454  -53.926  -3.247  1.00 3.81  ? 22  ILE A CB  1 
ATOM   168   C  CG1 . ILE A  1 22  ? -96.637  -53.301  -4.383  1.00 3.24  ? 22  ILE A CG1 1 
ATOM   169   C  CG2 . ILE A  1 22  ? -96.847  -53.521  -1.903  1.00 2.00  ? 22  ILE A CG2 1 
ATOM   170   C  CD1 . ILE A  1 22  ? -96.846  -51.863  -4.489  1.00 2.00  ? 22  ILE A CD1 1 
ATOM   171   N  N   . ASN A  1 23  ? -99.149  -55.922  -1.681  1.00 3.23  ? 23  ASN A N   1 
ATOM   172   C  CA  . ASN A  1 23  ? -99.631  -56.483  -0.432  1.00 3.21  ? 23  ASN A CA  1 
ATOM   173   C  C   . ASN A  1 23  ? -99.709  -58.006  -0.483  1.00 3.60  ? 23  ASN A C   1 
ATOM   174   O  O   . ASN A  1 23  ? -99.334  -58.700  0.467   1.00 4.00  ? 23  ASN A O   1 
ATOM   175   C  CB  . ASN A  1 23  ? -100.995 -55.905  -0.088  1.00 3.30  ? 23  ASN A CB  1 
ATOM   176   C  CG  . ASN A  1 23  ? -100.940 -54.429  0.265   1.00 4.13  ? 23  ASN A CG  1 
ATOM   177   O  OD1 . ASN A  1 23  ? -101.946 -53.866  0.654   1.00 5.89  ? 23  ASN A OD1 1 
ATOM   178   N  ND2 . ASN A  1 23  ? -99.775  -53.799  0.118   1.00 5.25  ? 23  ASN A ND2 1 
ATOM   179   N  N   . GLN A  1 24  ? -100.187 -58.553  -1.588  1.00 3.51  ? 24  GLN A N   1 
ATOM   180   C  CA  . GLN A  1 24  ? -100.392 -59.988  -1.575  1.00 3.67  ? 24  GLN A CA  1 
ATOM   181   C  C   . GLN A  1 24  ? -99.010  -60.668  -1.507  1.00 3.76  ? 24  GLN A C   1 
ATOM   182   O  O   . GLN A  1 24  ? -98.808  -61.607  -0.739  1.00 4.11  ? 24  GLN A O   1 
ATOM   183   C  CB  . GLN A  1 24  ? -101.247 -60.439  -2.763  1.00 3.63  ? 24  GLN A CB  1 
ATOM   184   C  CG  . GLN A  1 24  ? -101.487 -61.932  -2.816  1.00 4.33  ? 24  GLN A CG  1 
ATOM   185   C  CD  . GLN A  1 24  ? -102.548 -62.291  -3.802  1.00 7.13  ? 24  GLN A CD  1 
ATOM   186   O  OE1 . GLN A  1 24  ? -103.671 -61.765  -3.738  1.00 8.27  ? 24  GLN A OE1 1 
ATOM   187   N  NE2 . GLN A  1 24  ? -102.222 -63.193  -4.730  1.00 6.62  ? 24  GLN A NE2 1 
ATOM   188   N  N   . TYR A  1 25  ? -98.049  -60.159  -2.259  1.00 3.61  ? 25  TYR A N   1 
ATOM   189   C  CA  . TYR A  1 25  ? -96.720  -60.719  -2.218  1.00 4.26  ? 25  TYR A CA  1 
ATOM   190   C  C   . TYR A  1 25  ? -96.043  -60.586  -0.860  1.00 3.85  ? 25  TYR A C   1 
ATOM   191   O  O   . TYR A  1 25  ? -95.379  -61.507  -0.400  1.00 3.54  ? 25  TYR A O   1 
ATOM   192   C  CB  . TYR A  1 25  ? -95.837  -60.073  -3.277  1.00 5.22  ? 25  TYR A CB  1 
ATOM   193   C  CG  . TYR A  1 25  ? -95.932  -60.684  -4.652  1.00 7.10  ? 25  TYR A CG  1 
ATOM   194   C  CD1 . TYR A  1 25  ? -95.846  -62.078  -4.833  1.00 8.18  ? 25  TYR A CD1 1 
ATOM   195   C  CD2 . TYR A  1 25  ? -96.057  -59.869  -5.775  1.00 7.85  ? 25  TYR A CD2 1 
ATOM   196   C  CE1 . TYR A  1 25  ? -95.917  -62.636  -6.094  1.00 8.81  ? 25  TYR A CE1 1 
ATOM   197   C  CE2 . TYR A  1 25  ? -96.107  -60.420  -7.046  1.00 8.84  ? 25  TYR A CE2 1 
ATOM   198   C  CZ  . TYR A  1 25  ? -96.042  -61.798  -7.197  1.00 8.89  ? 25  TYR A CZ  1 
ATOM   199   O  OH  . TYR A  1 25  ? -96.087  -62.313  -8.457  1.00 8.68  ? 25  TYR A OH  1 
ATOM   200   N  N   . PHE A  1 26  ? -96.203  -59.440  -0.217  1.00 3.56  ? 26  PHE A N   1 
ATOM   201   C  CA  . PHE A  1 26  ? -95.605  -59.214  1.096   1.00 2.95  ? 26  PHE A CA  1 
ATOM   202   C  C   . PHE A  1 26  ? -96.169  -60.141  2.189   1.00 3.01  ? 26  PHE A C   1 
ATOM   203   O  O   . PHE A  1 26  ? -95.409  -60.723  2.968   1.00 2.39  ? 26  PHE A O   1 
ATOM   204   C  CB  . PHE A  1 26  ? -95.767  -57.763  1.518   1.00 2.63  ? 26  PHE A CB  1 
ATOM   205   C  CG  . PHE A  1 26  ? -94.742  -57.346  2.473   1.00 3.01  ? 26  PHE A CG  1 
ATOM   206   C  CD1 . PHE A  1 26  ? -93.532  -56.838  2.025   1.00 3.12  ? 26  PHE A CD1 1 
ATOM   207   C  CD2 . PHE A  1 26  ? -94.934  -57.532  3.840   1.00 3.54  ? 26  PHE A CD2 1 
ATOM   208   C  CE1 . PHE A  1 26  ? -92.521  -56.496  2.914   1.00 3.89  ? 26  PHE A CE1 1 
ATOM   209   C  CE2 . PHE A  1 26  ? -93.929  -57.188  4.758   1.00 4.14  ? 26  PHE A CE2 1 
ATOM   210   C  CZ  . PHE A  1 26  ? -92.715  -56.672  4.290   1.00 4.37  ? 26  PHE A CZ  1 
ATOM   211   N  N   . LEU A  1 27  ? -97.499  -60.254  2.266   1.00 2.82  ? 27  LEU A N   1 
ATOM   212   C  CA  . LEU A  1 27  ? -98.117  -61.163  3.203   1.00 2.53  ? 27  LEU A CA  1 
ATOM   213   C  C   . LEU A  1 27  ? -97.631  -62.587  2.895   1.00 2.49  ? 27  LEU A C   1 
ATOM   214   O  O   . LEU A  1 27  ? -97.210  -63.309  3.800   1.00 2.00  ? 27  LEU A O   1 
ATOM   215   C  CB  . LEU A  1 27  ? -99.634  -61.100  3.107   1.00 2.52  ? 27  LEU A CB  1 
ATOM   216   C  CG  . LEU A  1 27  ? -100.478 -61.287  4.369   1.00 2.48  ? 27  LEU A CG  1 
ATOM   217   C  CD1 . LEU A  1 27  ? -101.852 -61.747  4.040   1.00 2.00  ? 27  LEU A CD1 1 
ATOM   218   C  CD2 . LEU A  1 27  ? -99.838  -62.152  5.446   1.00 2.94  ? 27  LEU A CD2 1 
ATOM   219   N  N   . HIS A  1 28  ? -97.644  -62.978  1.615   1.00 2.17  ? 28  HIS A N   1 
ATOM   220   C  CA  . HIS A  1 28  ? -97.180  -64.327  1.279   1.00 2.41  ? 28  HIS A CA  1 
ATOM   221   C  C   . HIS A  1 28  ? -95.778  -64.549  1.775   1.00 2.55  ? 28  HIS A C   1 
ATOM   222   O  O   . HIS A  1 28  ? -95.516  -65.535  2.496   1.00 2.81  ? 28  HIS A O   1 
ATOM   223   C  CB  . HIS A  1 28  ? -97.294  -64.636  -0.200  1.00 2.55  ? 28  HIS A CB  1 
ATOM   224   C  CG  . HIS A  1 28  ? -98.693  -64.922  -0.649  1.00 2.58  ? 28  HIS A CG  1 
ATOM   225   N  ND1 . HIS A  1 28  ? -99.048  -64.958  -1.978  1.00 2.45  ? 28  HIS A ND1 1 
ATOM   226   C  CD2 . HIS A  1 28  ? -99.821  -65.155  0.052   1.00 2.00  ? 28  HIS A CD2 1 
ATOM   227   C  CE1 . HIS A  1 28  ? -100.335 -65.222  -2.077  1.00 3.17  ? 28  HIS A CE1 1 
ATOM   228   N  NE2 . HIS A  1 28  ? -100.824 -65.347  -0.858  1.00 3.28  ? 28  HIS A NE2 1 
ATOM   229   N  N   . ALA A  1 29  ? -94.907  -63.602  1.446   1.00 2.31  ? 29  ALA A N   1 
ATOM   230   C  CA  . ALA A  1 29  ? -93.527  -63.622  1.913   1.00 2.14  ? 29  ALA A CA  1 
ATOM   231   C  C   . ALA A  1 29  ? -93.397  -63.905  3.402   1.00 2.08  ? 29  ALA A C   1 
ATOM   232   O  O   . ALA A  1 29  ? -92.680  -64.823  3.787   1.00 2.19  ? 29  ALA A O   1 
ATOM   233   C  CB  . ALA A  1 29  ? -92.814  -62.351  1.550   1.00 2.00  ? 29  ALA A CB  1 
ATOM   234   N  N   . ARG A  1 30  ? -94.094  -63.146  4.232   1.00 2.08  ? 30  ARG A N   1 
ATOM   235   C  CA  . ARG A  1 30  ? -93.917  -63.270  5.669   1.00 2.43  ? 30  ARG A CA  1 
ATOM   236   C  C   . ARG A  1 30  ? -94.646  -64.497  6.249   1.00 2.71  ? 30  ARG A C   1 
ATOM   237   O  O   . ARG A  1 30  ? -94.288  -65.017  7.325   1.00 2.44  ? 30  ARG A O   1 
ATOM   238   C  CB  . ARG A  1 30  ? -94.311  -61.995  6.391   1.00 2.00  ? 30  ARG A CB  1 
ATOM   239   C  CG  . ARG A  1 30  ? -93.645  -60.794  5.854   1.00 2.00  ? 30  ARG A CG  1 
ATOM   240   C  CD  . ARG A  1 30  ? -92.384  -60.444  6.544   1.00 2.01  ? 30  ARG A CD  1 
ATOM   241   N  NE  . ARG A  1 30  ? -91.243  -60.645  5.663   1.00 4.30  ? 30  ARG A NE  1 
ATOM   242   C  CZ  . ARG A  1 30  ? -90.240  -59.784  5.460   1.00 2.88  ? 30  ARG A CZ  1 
ATOM   243   N  NH1 . ARG A  1 30  ? -90.158  -58.623  6.067   1.00 2.70  ? 30  ARG A NH1 1 
ATOM   244   N  NH2 . ARG A  1 30  ? -89.300  -60.105  4.616   1.00 4.04  ? 30  ARG A NH2 1 
ATOM   245   N  N   . MET A  1 31  ? -95.637  -64.984  5.509   1.00 2.93  ? 31  MET A N   1 
ATOM   246   C  CA  . MET A  1 31  ? -96.265  -66.277  5.833   1.00 2.86  ? 31  MET A CA  1 
ATOM   247   C  C   . MET A  1 31  ? -95.240  -67.404  5.614   1.00 2.78  ? 31  MET A C   1 
ATOM   248   O  O   . MET A  1 31  ? -94.960  -68.191  6.512   1.00 3.04  ? 31  MET A O   1 
ATOM   249   C  CB  . MET A  1 31  ? -97.516  -66.484  4.996   1.00 2.64  ? 31  MET A CB  1 
ATOM   250   C  CG  . MET A  1 31  ? -98.732  -65.757  5.500   1.00 2.00  ? 31  MET A CG  1 
ATOM   251   S  SD  . MET A  1 31  ? -100.139 -65.877  4.362   1.00 3.56  ? 31  MET A SD  1 
ATOM   252   C  CE  . MET A  1 31  ? -100.636 -67.605  4.520   1.00 2.00  ? 31  MET A CE  1 
ATOM   253   N  N   . PHE A  1 32  ? -94.640  -67.443  4.435   1.00 2.68  ? 32  PHE A N   1 
ATOM   254   C  CA  . PHE A  1 32  ? -93.541  -68.367  4.194   1.00 2.37  ? 32  PHE A CA  1 
ATOM   255   C  C   . PHE A  1 32  ? -92.442  -68.262  5.248   1.00 2.47  ? 32  PHE A C   1 
ATOM   256   O  O   . PHE A  1 32  ? -91.901  -69.275  5.711   1.00 2.56  ? 32  PHE A O   1 
ATOM   257   C  CB  . PHE A  1 32  ? -92.970  -68.120  2.801   1.00 2.42  ? 32  PHE A CB  1 
ATOM   258   C  CG  . PHE A  1 32  ? -93.920  -68.432  1.713   1.00 2.72  ? 32  PHE A CG  1 
ATOM   259   C  CD1 . PHE A  1 32  ? -94.052  -67.585  0.625   1.00 4.24  ? 32  PHE A CD1 1 
ATOM   260   C  CD2 . PHE A  1 32  ? -94.725  -69.554  1.787   1.00 2.42  ? 32  PHE A CD2 1 
ATOM   261   C  CE1 . PHE A  1 32  ? -94.951  -67.856  -0.402  1.00 4.24  ? 32  PHE A CE1 1 
ATOM   262   C  CE2 . PHE A  1 32  ? -95.623  -69.845  0.776   1.00 4.94  ? 32  PHE A CE2 1 
ATOM   263   C  CZ  . PHE A  1 32  ? -95.732  -68.980  -0.328  1.00 4.20  ? 32  PHE A CZ  1 
ATOM   264   N  N   . LYS A  1 33  ? -92.104  -67.033  5.623   1.00 2.61  ? 33  LYS A N   1 
ATOM   265   C  CA  . LYS A  1 33  ? -91.049  -66.800  6.607   1.00 3.00  ? 33  LYS A CA  1 
ATOM   266   C  C   . LYS A  1 33  ? -91.428  -67.400  7.953   1.00 3.09  ? 33  LYS A C   1 
ATOM   267   O  O   . LYS A  1 33  ? -90.632  -68.095  8.580   1.00 2.68  ? 33  LYS A O   1 
ATOM   268   C  CB  . LYS A  1 33  ? -90.812  -65.310  6.767   1.00 3.11  ? 33  LYS A CB  1 
ATOM   269   C  CG  . LYS A  1 33  ? -89.862  -64.947  7.861   1.00 4.06  ? 33  LYS A CG  1 
ATOM   270   C  CD  . LYS A  1 33  ? -89.101  -63.727  7.405   1.00 8.19  ? 33  LYS A CD  1 
ATOM   271   C  CE  . LYS A  1 33  ? -88.689  -62.849  8.568   1.00 10.43 ? 33  LYS A CE  1 
ATOM   272   N  NZ  . LYS A  1 33  ? -87.287  -63.150  8.998   1.00 10.83 ? 33  LYS A NZ  1 
ATOM   273   N  N   . ASN A  1 34  ? -92.662  -67.137  8.365   1.00 3.05  ? 34  ASN A N   1 
ATOM   274   C  CA  . ASN A  1 34  ? -93.145  -67.704  9.583   1.00 3.43  ? 34  ASN A CA  1 
ATOM   275   C  C   . ASN A  1 34  ? -93.063  -69.215  9.560   1.00 3.65  ? 34  ASN A C   1 
ATOM   276   O  O   . ASN A  1 34  ? -92.632  -69.799  10.538  1.00 4.78  ? 34  ASN A O   1 
ATOM   277   C  CB  . ASN A  1 34  ? -94.564  -67.256  9.895   1.00 3.26  ? 34  ASN A CB  1 
ATOM   278   C  CG  . ASN A  1 34  ? -95.025  -67.754  11.241  1.00 4.40  ? 34  ASN A CG  1 
ATOM   279   O  OD1 . ASN A  1 34  ? -95.819  -68.673  11.314  1.00 7.34  ? 34  ASN A OD1 1 
ATOM   280   N  ND2 . ASN A  1 34  ? -94.495  -67.179  12.321  1.00 6.82  ? 34  ASN A ND2 1 
ATOM   281   N  N   . TRP A  1 35  ? -93.477  -69.828  8.454   1.00 3.39  ? 35  TRP A N   1 
ATOM   282   C  CA  . TRP A  1 35  ? -93.399  -71.282  8.277   1.00 3.22  ? 35  TRP A CA  1 
ATOM   283   C  C   . TRP A  1 35  ? -91.958  -71.823  8.118   1.00 3.41  ? 35  TRP A C   1 
ATOM   284   O  O   . TRP A  1 35  ? -91.758  -73.042  8.057   1.00 3.46  ? 35  TRP A O   1 
ATOM   285   C  CB  . TRP A  1 35  ? -94.219  -71.727  7.075   1.00 2.81  ? 35  TRP A CB  1 
ATOM   286   C  CG  . TRP A  1 35  ? -95.644  -71.563  7.254   1.00 3.67  ? 35  TRP A CG  1 
ATOM   287   C  CD1 . TRP A  1 35  ? -96.333  -71.566  8.438   1.00 5.36  ? 35  TRP A CD1 1 
ATOM   288   C  CD2 . TRP A  1 35  ? -96.627  -71.410  6.227   1.00 4.19  ? 35  TRP A CD2 1 
ATOM   289   N  NE1 . TRP A  1 35  ? -97.675  -71.409  8.213   1.00 5.75  ? 35  TRP A NE1 1 
ATOM   290   C  CE2 . TRP A  1 35  ? -97.889  -71.313  6.865   1.00 4.66  ? 35  TRP A CE2 1 
ATOM   291   C  CE3 . TRP A  1 35  ? -96.571  -71.361  4.826   1.00 2.56  ? 35  TRP A CE3 1 
ATOM   292   C  CZ2 . TRP A  1 35  ? -99.083  -71.154  6.149   1.00 4.30  ? 35  TRP A CZ2 1 
ATOM   293   C  CZ3 . TRP A  1 35  ? -97.750  -71.189  4.117   1.00 3.83  ? 35  TRP A CZ3 1 
ATOM   294   C  CH2 . TRP A  1 35  ? -98.992  -71.094  4.770   1.00 4.14  ? 35  TRP A CH2 1 
ATOM   295   N  N   . GLY A  1 36  ? -90.966  -70.928  8.002   1.00 2.88  ? 36  GLY A N   1 
ATOM   296   C  CA  . GLY A  1 36  ? -89.599  -71.368  7.946   1.00 2.71  ? 36  GLY A CA  1 
ATOM   297   C  C   . GLY A  1 36  ? -89.156  -71.683  6.542   1.00 3.32  ? 36  GLY A C   1 
ATOM   298   O  O   . GLY A  1 36  ? -88.043  -72.160  6.321   1.00 3.94  ? 36  GLY A O   1 
ATOM   299   N  N   . LEU A  1 37  ? -90.018  -71.381  5.581   1.00 3.35  ? 37  LEU A N   1 
ATOM   300   C  CA  . LEU A  1 37  ? -89.751  -71.560  4.147   1.00 2.85  ? 37  LEU A CA  1 
ATOM   301   C  C   . LEU A  1 37  ? -88.921  -70.356  3.610   1.00 3.04  ? 37  LEU A C   1 
ATOM   302   O  O   . LEU A  1 37  ? -89.331  -69.597  2.741   1.00 3.20  ? 37  LEU A O   1 
ATOM   303   C  CB  . LEU A  1 37  ? -91.101  -71.722  3.421   1.00 2.62  ? 37  LEU A CB  1 
ATOM   304   C  CG  . LEU A  1 37  ? -91.719  -73.126  3.393   1.00 3.43  ? 37  LEU A CG  1 
ATOM   305   C  CD1 . LEU A  1 37  ? -91.237  -74.049  4.498   1.00 2.00  ? 37  LEU A CD1 1 
ATOM   306   C  CD2 . LEU A  1 37  ? -93.242  -73.118  3.274   1.00 2.00  ? 37  LEU A CD2 1 
ATOM   307   N  N   . LYS A  1 38  ? -87.736  -70.221  4.175   1.00 3.29  ? 38  LYS A N   1 
ATOM   308   C  CA  . LYS A  1 38  ? -86.841  -69.079  4.026   1.00 3.66  ? 38  LYS A CA  1 
ATOM   309   C  C   . LYS A  1 38  ? -86.709  -68.574  2.570   1.00 3.59  ? 38  LYS A C   1 
ATOM   310   O  O   . LYS A  1 38  ? -86.649  -67.388  2.295   1.00 3.43  ? 38  LYS A O   1 
ATOM   311   C  CB  . LYS A  1 38  ? -85.495  -69.545  4.584   1.00 3.94  ? 38  LYS A CB  1 
ATOM   312   C  CG  . LYS A  1 38  ? -84.689  -68.560  5.437   1.00 8.10  ? 38  LYS A CG  1 
ATOM   313   C  CD  . LYS A  1 38  ? -84.721  -68.798  6.966   1.00 10.93 ? 38  LYS A CD  1 
ATOM   314   C  CE  . LYS A  1 38  ? -84.194  -70.172  7.388   1.00 13.69 ? 38  LYS A CE  1 
ATOM   315   N  NZ  . LYS A  1 38  ? -82.752  -70.414  7.184   1.00 14.00 ? 38  LYS A NZ  1 
ATOM   316   N  N   . ARG A  1 39  ? -86.719  -69.504  1.630   1.00 4.36  ? 39  ARG A N   1 
ATOM   317   C  CA  . ARG A  1 39  ? -86.377  -69.250  0.239   1.00 4.49  ? 39  ARG A CA  1 
ATOM   318   C  C   . ARG A  1 39  ? -87.521  -68.616  -0.501  1.00 4.27  ? 39  ARG A C   1 
ATOM   319   O  O   . ARG A  1 39  ? -87.341  -67.780  -1.380  1.00 4.79  ? 39  ARG A O   1 
ATOM   320   C  CB  . ARG A  1 39  ? -86.070  -70.590  -0.392  1.00 5.21  ? 39  ARG A CB  1 
ATOM   321   C  CG  . ARG A  1 39  ? -85.085  -70.576  -1.494  1.00 7.86  ? 39  ARG A CG  1 
ATOM   322   C  CD  . ARG A  1 39  ? -85.830  -70.520  -2.819  1.00 14.23 ? 39  ARG A CD  1 
ATOM   323   N  NE  . ARG A  1 39  ? -85.434  -71.610  -3.733  1.00 18.69 ? 39  ARG A NE  1 
ATOM   324   C  CZ  . ARG A  1 39  ? -86.197  -72.053  -4.742  1.00 20.85 ? 39  ARG A CZ  1 
ATOM   325   N  NH1 . ARG A  1 39  ? -87.412  -71.506  -4.986  1.00 16.90 ? 39  ARG A NH1 1 
ATOM   326   N  NH2 . ARG A  1 39  ? -85.744  -73.063  -5.496  1.00 21.70 ? 39  ARG A NH2 1 
ATOM   327   N  N   . LEU A  1 40  ? -88.718  -69.055  -0.158  1.00 3.88  ? 40  LEU A N   1 
ATOM   328   C  CA  . LEU A  1 40  ? -89.930  -68.508  -0.719  1.00 3.22  ? 40  LEU A CA  1 
ATOM   329   C  C   . LEU A  1 40  ? -90.154  -67.110  -0.151  1.00 3.56  ? 40  LEU A C   1 
ATOM   330   O  O   . LEU A  1 40  ? -90.698  -66.255  -0.827  1.00 3.47  ? 40  LEU A O   1 
ATOM   331   C  CB  . LEU A  1 40  ? -91.074  -69.440  -0.349  1.00 3.41  ? 40  LEU A CB  1 
ATOM   332   C  CG  . LEU A  1 40  ? -91.690  -70.397  -1.371  1.00 2.42  ? 40  LEU A CG  1 
ATOM   333   C  CD1 . LEU A  1 40  ? -90.804  -70.746  -2.534  1.00 2.54  ? 40  LEU A CD1 1 
ATOM   334   C  CD2 . LEU A  1 40  ? -92.190  -71.592  -0.636  1.00 2.00  ? 40  LEU A CD2 1 
ATOM   335   N  N   . ASN A  1 41  ? -89.737  -66.880  1.102   1.00 3.63  ? 41  ASN A N   1 
ATOM   336   C  CA  . ASN A  1 41  ? -89.810  -65.556  1.689   1.00 2.94  ? 41  ASN A CA  1 
ATOM   337   C  C   . ASN A  1 41  ? -88.878  -64.630  0.952   1.00 3.18  ? 41  ASN A C   1 
ATOM   338   O  O   . ASN A  1 41  ? -89.261  -63.535  0.626   1.00 2.87  ? 41  ASN A O   1 
ATOM   339   C  CB  . ASN A  1 41  ? -89.457  -65.571  3.176   1.00 2.67  ? 41  ASN A CB  1 
ATOM   340   C  CG  . ASN A  1 41  ? -89.151  -64.166  3.710   1.00 3.36  ? 41  ASN A CG  1 
ATOM   341   O  OD1 . ASN A  1 41  ? -90.054  -63.363  3.927   1.00 3.54  ? 41  ASN A OD1 1 
ATOM   342   N  ND2 . ASN A  1 41  ? -87.869  -63.855  3.876   1.00 2.00  ? 41  ASN A ND2 1 
ATOM   343   N  N   . ASP A  1 42  ? -87.644  -65.058  0.694   1.00 3.84  ? 42  ASP A N   1 
ATOM   344   C  CA  . ASP A  1 42  ? -86.713  -64.219  -0.053  1.00 5.17  ? 42  ASP A CA  1 
ATOM   345   C  C   . ASP A  1 42  ? -87.280  -63.846  -1.431  1.00 5.45  ? 42  ASP A C   1 
ATOM   346   O  O   . ASP A  1 42  ? -87.303  -62.667  -1.794  1.00 5.95  ? 42  ASP A O   1 
ATOM   347   C  CB  . ASP A  1 42  ? -85.343  -64.870  -0.219  1.00 5.42  ? 42  ASP A CB  1 
ATOM   348   C  CG  . ASP A  1 42  ? -84.605  -65.042  1.095   1.00 9.94  ? 42  ASP A CG  1 
ATOM   349   O  OD1 . ASP A  1 42  ? -85.022  -64.481  2.141   1.00 12.98 ? 42  ASP A OD1 1 
ATOM   350   O  OD2 . ASP A  1 42  ? -83.582  -65.776  1.096   1.00 13.64 ? 42  ASP A OD2 1 
ATOM   351   N  N   . VAL A  1 43  ? -87.763  -64.824  -2.193  1.00 5.02  ? 43  VAL A N   1 
ATOM   352   C  CA  . VAL A  1 43  ? -88.199  -64.504  -3.541  1.00 4.91  ? 43  VAL A CA  1 
ATOM   353   C  C   . VAL A  1 43  ? -89.434  -63.600  -3.525  1.00 4.91  ? 43  VAL A C   1 
ATOM   354   O  O   . VAL A  1 43  ? -89.466  -62.557  -4.201  1.00 4.75  ? 43  VAL A O   1 
ATOM   355   C  CB  . VAL A  1 43  ? -88.402  -65.752  -4.425  1.00 4.88  ? 43  VAL A CB  1 
ATOM   356   C  CG1 . VAL A  1 43  ? -89.131  -65.378  -5.718  1.00 5.12  ? 43  VAL A CG1 1 
ATOM   357   C  CG2 . VAL A  1 43  ? -87.054  -66.385  -4.738  1.00 4.11  ? 43  VAL A CG2 1 
ATOM   358   N  N   . GLU A  1 44  ? -90.434  -63.964  -2.730  1.00 4.67  ? 44  GLU A N   1 
ATOM   359   C  CA  . GLU A  1 44  ? -91.687  -63.206  -2.738  1.00 4.90  ? 44  GLU A CA  1 
ATOM   360   C  C   . GLU A  1 44  ? -91.513  -61.826  -2.184  1.00 4.72  ? 44  GLU A C   1 
ATOM   361   O  O   . GLU A  1 44  ? -92.167  -60.881  -2.646  1.00 4.92  ? 44  GLU A O   1 
ATOM   362   C  CB  . GLU A  1 44  ? -92.798  -63.907  -1.998  1.00 4.26  ? 44  GLU A CB  1 
ATOM   363   C  CG  . GLU A  1 44  ? -93.138  -65.187  -2.662  1.00 7.82  ? 44  GLU A CG  1 
ATOM   364   C  CD  . GLU A  1 44  ? -94.499  -65.195  -3.326  1.00 11.33 ? 44  GLU A CD  1 
ATOM   365   O  OE1 . GLU A  1 44  ? -95.502  -64.720  -2.740  1.00 12.47 ? 44  GLU A OE1 1 
ATOM   366   O  OE2 . GLU A  1 44  ? -94.600  -65.726  -4.439  1.00 12.56 ? 44  GLU A OE2 1 
ATOM   367   N  N   . TYR A  1 45  ? -90.626  -61.684  -1.217  1.00 4.66  ? 45  TYR A N   1 
ATOM   368   C  CA  . TYR A  1 45  ? -90.300  -60.371  -0.748  1.00 4.79  ? 45  TYR A CA  1 
ATOM   369   C  C   . TYR A  1 45  ? -89.744  -59.547  -1.887  1.00 5.26  ? 45  TYR A C   1 
ATOM   370   O  O   . TYR A  1 45  ? -90.188  -58.425  -2.103  1.00 5.13  ? 45  TYR A O   1 
ATOM   371   C  CB  . TYR A  1 45  ? -89.298  -60.457  0.374   1.00 4.97  ? 45  TYR A CB  1 
ATOM   372   C  CG  . TYR A  1 45  ? -88.823  -59.129  0.843   1.00 5.00  ? 45  TYR A CG  1 
ATOM   373   C  CD1 . TYR A  1 45  ? -89.547  -58.397  1.767   1.00 5.38  ? 45  TYR A CD1 1 
ATOM   374   C  CD2 . TYR A  1 45  ? -87.631  -58.600  0.365   1.00 5.99  ? 45  TYR A CD2 1 
ATOM   375   C  CE1 . TYR A  1 45  ? -89.097  -57.169  2.207   1.00 6.97  ? 45  TYR A CE1 1 
ATOM   376   C  CE2 . TYR A  1 45  ? -87.158  -57.373  0.795   1.00 6.31  ? 45  TYR A CE2 1 
ATOM   377   C  CZ  . TYR A  1 45  ? -87.897  -56.655  1.715   1.00 7.80  ? 45  TYR A CZ  1 
ATOM   378   O  OH  . TYR A  1 45  ? -87.425  -55.431  2.141   1.00 8.40  ? 45  TYR A OH  1 
ATOM   379   N  N   A HIS A  1 46  ? -88.792  -60.106  -2.625  0.50 5.70  ? 46  HIS A N   1 
ATOM   380   N  N   B HIS A  1 46  ? -88.778  -60.102  -2.622  0.50 5.72  ? 46  HIS A N   1 
ATOM   381   C  CA  A HIS A  1 46  ? -88.200  -59.378  -3.742  0.50 6.24  ? 46  HIS A CA  1 
ATOM   382   C  CA  B HIS A  1 46  ? -88.192  -59.409  -3.780  0.50 6.32  ? 46  HIS A CA  1 
ATOM   383   C  C   A HIS A  1 46  ? -89.221  -59.063  -4.835  0.50 5.73  ? 46  HIS A C   1 
ATOM   384   C  C   B HIS A  1 46  ? -89.287  -58.997  -4.749  0.50 5.76  ? 46  HIS A C   1 
ATOM   385   O  O   A HIS A  1 46  ? -89.060  -58.098  -5.563  0.50 6.33  ? 46  HIS A O   1 
ATOM   386   O  O   B HIS A  1 46  ? -89.240  -57.911  -5.306  0.50 6.30  ? 46  HIS A O   1 
ATOM   387   C  CB  A HIS A  1 46  ? -86.946  -60.070  -4.279  0.50 6.46  ? 46  HIS A CB  1 
ATOM   388   C  CB  B HIS A  1 46  ? -87.133  -60.259  -4.493  0.50 6.56  ? 46  HIS A CB  1 
ATOM   389   C  CG  A HIS A  1 46  ? -85.800  -60.065  -3.309  0.50 9.87  ? 46  HIS A CG  1 
ATOM   390   C  CG  B HIS A  1 46  ? -86.485  -59.582  -5.672  0.50 10.54 ? 46  HIS A CG  1 
ATOM   391   N  ND1 A HIS A  1 46  ? -85.155  -58.912  -2.923  0.50 11.95 ? 46  HIS A ND1 1 
ATOM   392   N  ND1 B HIS A  1 46  ? -85.597  -58.532  -5.538  0.50 14.27 ? 46  HIS A ND1 1 
ATOM   393   C  CD2 A HIS A  1 46  ? -85.203  -61.075  -2.632  0.50 12.55 ? 46  HIS A CD2 1 
ATOM   394   C  CD2 B HIS A  1 46  ? -86.579  -59.823  -7.004  0.50 12.24 ? 46  HIS A CD2 1 
ATOM   395   C  CE1 A HIS A  1 46  ? -84.212  -59.211  -2.050  0.50 13.13 ? 46  HIS A CE1 1 
ATOM   396   C  CE1 B HIS A  1 46  ? -85.185  -58.149  -6.735  0.50 14.36 ? 46  HIS A CE1 1 
ATOM   397   N  NE2 A HIS A  1 46  ? -84.221  -60.517  -1.856  0.50 13.28 ? 46  HIS A NE2 1 
ATOM   398   N  NE2 B HIS A  1 46  ? -85.764  -58.918  -7.639  0.50 13.53 ? 46  HIS A NE2 1 
ATOM   399   N  N   . GLU A  1 47  ? -90.290  -59.840  -4.924  1.00 5.28  ? 47  GLU A N   1 
ATOM   400   C  CA  . GLU A  1 47  ? -91.327  -59.507  -5.844  1.00 5.21  ? 47  GLU A CA  1 
ATOM   401   C  C   . GLU A  1 47  ? -92.233  -58.413  -5.376  1.00 4.51  ? 47  GLU A C   1 
ATOM   402   O  O   . GLU A  1 47  ? -92.676  -57.622  -6.178  1.00 4.10  ? 47  GLU A O   1 
ATOM   403   C  CB  . GLU A  1 47  ? -92.089  -60.730  -6.264  1.00 6.20  ? 47  GLU A CB  1 
ATOM   404   C  CG  . GLU A  1 47  ? -91.394  -61.318  -7.446  1.00 8.86  ? 47  GLU A CG  1 
ATOM   405   C  CD  . GLU A  1 47  ? -91.703  -62.766  -7.655  1.00 15.05 ? 47  GLU A CD  1 
ATOM   406   O  OE1 . GLU A  1 47  ? -92.424  -63.407  -6.814  1.00 16.93 ? 47  GLU A OE1 1 
ATOM   407   O  OE2 . GLU A  1 47  ? -91.184  -63.258  -8.693  1.00 18.41 ? 47  GLU A OE2 1 
ATOM   408   N  N   . SER A  1 48  ? -92.491  -58.351  -4.077  1.00 4.52  ? 48  SER A N   1 
ATOM   409   C  CA  . SER A  1 48  ? -93.141  -57.199  -3.500  1.00 4.18  ? 48  SER A CA  1 
ATOM   410   C  C   . SER A  1 48  ? -92.390  -55.886  -3.792  1.00 4.46  ? 48  SER A C   1 
ATOM   411   O  O   . SER A  1 48  ? -93.021  -54.885  -4.193  1.00 3.78  ? 48  SER A O   1 
ATOM   412   C  CB  . SER A  1 48  ? -93.309  -57.392  -2.004  1.00 3.80  ? 48  SER A CB  1 
ATOM   413   O  OG  . SER A  1 48  ? -94.282  -56.465  -1.544  1.00 4.40  ? 48  SER A OG  1 
ATOM   414   N  N   . ILE A  1 49  ? -91.058  -55.883  -3.597  1.00 4.71  ? 49  ILE A N   1 
ATOM   415   C  CA  . ILE A  1 49  ? -90.234  -54.701  -3.910  1.00 5.03  ? 49  ILE A CA  1 
ATOM   416   C  C   . ILE A  1 49  ? -90.386  -54.374  -5.391  1.00 5.43  ? 49  ILE A C   1 
ATOM   417   O  O   . ILE A  1 49  ? -90.455  -53.220  -5.788  1.00 5.53  ? 49  ILE A O   1 
ATOM   418   C  CB  . ILE A  1 49  ? -88.721  -54.909  -3.601  1.00 4.94  ? 49  ILE A CB  1 
ATOM   419   C  CG1 . ILE A  1 49  ? -88.438  -55.083  -2.099  1.00 5.40  ? 49  ILE A CG1 1 
ATOM   420   C  CG2 . ILE A  1 49  ? -87.896  -53.765  -4.120  1.00 4.00  ? 49  ILE A CG2 1 
ATOM   421   C  CD1 . ILE A  1 49  ? -89.434  -54.421  -1.174  1.00 6.09  ? 49  ILE A CD1 1 
ATOM   422   N  N   . ASP A  1 50  ? -90.453  -55.403  -6.208  1.00 5.90  ? 50  ASP A N   1 
ATOM   423   C  CA  . ASP A  1 50  ? -90.601  -55.206  -7.614  1.00 7.07  ? 50  ASP A CA  1 
ATOM   424   C  C   . ASP A  1 50  ? -91.880  -54.450  -7.976  1.00 6.85  ? 50  ASP A C   1 
ATOM   425   O  O   . ASP A  1 50  ? -91.850  -53.473  -8.741  1.00 6.66  ? 50  ASP A O   1 
ATOM   426   C  CB  . ASP A  1 50  ? -90.559  -56.534  -8.341  1.00 7.89  ? 50  ASP A CB  1 
ATOM   427   C  CG  . ASP A  1 50  ? -89.710  -56.451  -9.559  1.00 11.70 ? 50  ASP A CG  1 
ATOM   428   O  OD1 . ASP A  1 50  ? -88.504  -56.189  -9.329  1.00 14.91 ? 50  ASP A OD1 1 
ATOM   429   O  OD2 . ASP A  1 50  ? -90.235  -56.588  -10.712 1.00 15.64 ? 50  ASP A OD2 1 
ATOM   430   N  N   . GLU A  1 51  ? -92.987  -54.893  -7.404  1.00 6.21  ? 51  GLU A N   1 
ATOM   431   C  CA  . GLU A  1 51  ? -94.249  -54.282  -7.700  1.00 6.43  ? 51  GLU A CA  1 
ATOM   432   C  C   . GLU A  1 51  ? -94.307  -52.860  -7.170  1.00 6.08  ? 51  GLU A C   1 
ATOM   433   O  O   . GLU A  1 51  ? -94.983  -52.021  -7.744  1.00 5.07  ? 51  GLU A O   1 
ATOM   434   C  CB  . GLU A  1 51  ? -95.414  -55.163  -7.199  1.00 7.13  ? 51  GLU A CB  1 
ATOM   435   C  CG  . GLU A  1 51  ? -95.445  -56.603  -7.771  1.00 8.48  ? 51  GLU A CG  1 
ATOM   436   C  CD  . GLU A  1 51  ? -95.318  -56.680  -9.298  1.00 12.35 ? 51  GLU A CD  1 
ATOM   437   O  OE1 . GLU A  1 51  ? -96.170  -57.299  -9.959  1.00 15.24 ? 51  GLU A OE1 1 
ATOM   438   O  OE2 . GLU A  1 51  ? -94.366  -56.124  -9.864  1.00 15.33 ? 51  GLU A OE2 1 
ATOM   439   N  N   . MET A  1 52  ? -93.569  -52.585  -6.091  1.00 6.18  ? 52  MET A N   1 
ATOM   440   C  CA  . MET A  1 52  ? -93.474  -51.223  -5.570  1.00 6.43  ? 52  MET A CA  1 
ATOM   441   C  C   . MET A  1 52  ? -92.801  -50.325  -6.570  1.00 6.13  ? 52  MET A C   1 
ATOM   442   O  O   . MET A  1 52  ? -93.254  -49.207  -6.778  1.00 6.43  ? 52  MET A O   1 
ATOM   443   C  CB  . MET A  1 52  ? -92.694  -51.156  -4.279  1.00 6.25  ? 52  MET A CB  1 
ATOM   444   C  CG  . MET A  1 52  ? -93.421  -51.653  -3.088  1.00 6.96  ? 52  MET A CG  1 
ATOM   445   S  SD  . MET A  1 52  ? -92.309  -51.776  -1.645  1.00 9.60  ? 52  MET A SD  1 
ATOM   446   C  CE  . MET A  1 52  ? -92.925  -53.356  -0.974  1.00 8.45  ? 52  MET A CE  1 
ATOM   447   N  N   . LYS A  1 53  ? -91.727  -50.805  -7.189  1.00 5.69  ? 53  LYS A N   1 
ATOM   448   C  CA  . LYS A  1 53  ? -91.039  -50.051  -8.206  1.00 5.73  ? 53  LYS A CA  1 
ATOM   449   C  C   . LYS A  1 53  ? -91.977  -49.701  -9.350  1.00 5.67  ? 53  LYS A C   1 
ATOM   450   O  O   . LYS A  1 53  ? -91.945  -48.598  -9.876  1.00 5.89  ? 53  LYS A O   1 
ATOM   451   C  CB  . LYS A  1 53  ? -89.826  -50.823  -8.727  1.00 6.08  ? 53  LYS A CB  1 
ATOM   452   C  CG  . LYS A  1 53  ? -88.749  -51.066  -7.684  1.00 7.85  ? 53  LYS A CG  1 
ATOM   453   C  CD  . LYS A  1 53  ? -87.400  -51.262  -8.351  1.00 12.55 ? 53  LYS A CD  1 
ATOM   454   C  CE  . LYS A  1 53  ? -86.511  -52.284  -7.611  1.00 16.01 ? 53  LYS A CE  1 
ATOM   455   N  NZ  . LYS A  1 53  ? -85.065  -52.193  -8.034  1.00 17.98 ? 53  LYS A NZ  1 
ATOM   456   N  N   . HIS A  1 54  ? -92.835  -50.645  -9.717  1.00 5.74  ? 54  HIS A N   1 
ATOM   457   C  CA  . HIS A  1 54  ? -93.783  -50.435  -10.763 1.00 5.46  ? 54  HIS A CA  1 
ATOM   458   C  C   . HIS A  1 54  ? -94.800  -49.368  -10.377 1.00 5.00  ? 54  HIS A C   1 
ATOM   459   O  O   . HIS A  1 54  ? -95.066  -48.445  -11.173 1.00 4.81  ? 54  HIS A O   1 
ATOM   460   C  CB  . HIS A  1 54  ? -94.446  -51.738  -11.132 1.00 5.90  ? 54  HIS A CB  1 
ATOM   461   C  CG  . HIS A  1 54  ? -93.509  -52.754  -11.705 1.00 7.49  ? 54  HIS A CG  1 
ATOM   462   N  ND1 . HIS A  1 54  ? -93.814  -54.103  -11.747 1.00 10.42 ? 54  HIS A ND1 1 
ATOM   463   C  CD2 . HIS A  1 54  ? -92.275  -52.626  -12.247 1.00 7.84  ? 54  HIS A CD2 1 
ATOM   464   C  CE1 . HIS A  1 54  ? -92.801  -54.754  -12.295 1.00 10.35 ? 54  HIS A CE1 1 
ATOM   465   N  NE2 . HIS A  1 54  ? -91.859  -53.880  -12.610 1.00 7.88  ? 54  HIS A NE2 1 
ATOM   466   N  N   . ALA A  1 55  ? -95.340  -49.470  -9.162  1.00 4.14  ? 55  ALA A N   1 
ATOM   467   C  CA  . ALA A  1 55  ? -96.317  -48.514  -8.670  1.00 3.84  ? 55  ALA A CA  1 
ATOM   468   C  C   . ALA A  1 55  ? -95.715  -47.101  -8.707  1.00 4.14  ? 55  ALA A C   1 
ATOM   469   O  O   . ALA A  1 55  ? -96.347  -46.131  -9.167  1.00 4.19  ? 55  ALA A O   1 
ATOM   470   C  CB  . ALA A  1 55  ? -96.758  -48.884  -7.278  1.00 2.92  ? 55  ALA A CB  1 
ATOM   471   N  N   . ASP A  1 56  ? -94.472  -46.993  -8.241  1.00 3.92  ? 56  ASP A N   1 
ATOM   472   C  CA  . ASP A  1 56  ? -93.746  -45.748  -8.250  1.00 4.00  ? 56  ASP A CA  1 
ATOM   473   C  C   . ASP A  1 56  ? -93.720  -45.183  -9.681  1.00 4.33  ? 56  ASP A C   1 
ATOM   474   O  O   . ASP A  1 56  ? -94.044  -44.009  -9.906  1.00 5.23  ? 56  ASP A O   1 
ATOM   475   C  CB  . ASP A  1 56  ? -92.352  -45.994  -7.707  1.00 3.82  ? 56  ASP A CB  1 
ATOM   476   C  CG  . ASP A  1 56  ? -91.573  -44.711  -7.445  1.00 4.33  ? 56  ASP A CG  1 
ATOM   477   O  OD1 . ASP A  1 56  ? -92.162  -43.607  -7.422  1.00 3.90  ? 56  ASP A OD1 1 
ATOM   478   O  OD2 . ASP A  1 56  ? -90.337  -44.794  -7.254  1.00 4.96  ? 56  ASP A OD2 1 
ATOM   479   N  N   . ARG A  1 57  ? -93.388  -46.013  -10.662 1.00 3.75  ? 57  ARG A N   1 
ATOM   480   C  CA  . ARG A  1 57  ? -93.302  -45.523  -12.028 1.00 3.65  ? 57  ARG A CA  1 
ATOM   481   C  C   . ARG A  1 57  ? -94.646  -45.022  -12.562 1.00 2.83  ? 57  ARG A C   1 
ATOM   482   O  O   . ARG A  1 57  ? -94.695  -43.975  -13.203 1.00 2.15  ? 57  ARG A O   1 
ATOM   483   C  CB  . ARG A  1 57  ? -92.626  -46.557  -12.933 1.00 3.57  ? 57  ARG A CB  1 
ATOM   484   C  CG  . ARG A  1 57  ? -91.136  -46.660  -12.664 1.00 4.89  ? 57  ARG A CG  1 
ATOM   485   C  CD  . ARG A  1 57  ? -90.435  -47.806  -13.425 1.00 7.34  ? 57  ARG A CD  1 
ATOM   486   N  NE  . ARG A  1 57  ? -90.230  -47.557  -14.863 1.00 12.01 ? 57  ARG A NE  1 
ATOM   487   C  CZ  . ARG A  1 57  ? -90.077  -48.539  -15.769 1.00 14.25 ? 57  ARG A CZ  1 
ATOM   488   N  NH1 . ARG A  1 57  ? -90.070  -49.837  -15.379 1.00 12.23 ? 57  ARG A NH1 1 
ATOM   489   N  NH2 . ARG A  1 57  ? -89.931  -48.228  -17.065 1.00 11.98 ? 57  ARG A NH2 1 
ATOM   490   N  N   . TYR A  1 58  ? -95.728  -45.754  -12.265 1.00 2.21  ? 58  TYR A N   1 
ATOM   491   C  CA  . TYR A  1 58  ? -97.067  -45.298  -12.616 1.00 2.00  ? 58  TYR A CA  1 
ATOM   492   C  C   . TYR A  1 58  ? -97.404  -43.954  -11.970 1.00 2.08  ? 58  TYR A C   1 
ATOM   493   O  O   . TYR A  1 58  ? -97.897  -43.025  -12.645 1.00 2.00  ? 58  TYR A O   1 
ATOM   494   C  CB  . TYR A  1 58  ? -98.122  -46.327  -12.243 1.00 2.00  ? 58  TYR A CB  1 
ATOM   495   C  CG  . TYR A  1 58  ? -98.084  -47.566  -13.086 1.00 2.13  ? 58  TYR A CG  1 
ATOM   496   C  CD1 . TYR A  1 58  ? -98.049  -47.483  -14.476 1.00 2.93  ? 58  TYR A CD1 1 
ATOM   497   C  CD2 . TYR A  1 58  ? -98.085  -48.828  -12.507 1.00 2.00  ? 58  TYR A CD2 1 
ATOM   498   C  CE1 . TYR A  1 58  ? -98.000  -48.602  -15.239 1.00 2.01  ? 58  TYR A CE1 1 
ATOM   499   C  CE2 . TYR A  1 58  ? -98.050  -49.937  -13.265 1.00 2.00  ? 58  TYR A CE2 1 
ATOM   500   C  CZ  . TYR A  1 58  ? -98.011  -49.822  -14.638 1.00 2.00  ? 58  TYR A CZ  1 
ATOM   501   O  OH  . TYR A  1 58  ? -97.973  -50.940  -15.439 1.00 2.02  ? 58  TYR A OH  1 
ATOM   502   N  N   . ILE A  1 59  ? -97.120  -43.856  -10.667 1.00 2.04  ? 59  ILE A N   1 
ATOM   503   C  CA  . ILE A  1 59  ? -97.479  -42.687  -9.890  1.00 2.19  ? 59  ILE A CA  1 
ATOM   504   C  C   . ILE A  1 59  ? -96.780  -41.492  -10.490 1.00 2.80  ? 59  ILE A C   1 
ATOM   505   O  O   . ILE A  1 59  ? -97.398  -40.469  -10.699 1.00 3.48  ? 59  ILE A O   1 
ATOM   506   C  CB  . ILE A  1 59  ? -97.135  -42.826  -8.401  1.00 2.00  ? 59  ILE A CB  1 
ATOM   507   C  CG1 . ILE A  1 59  ? -98.106  -43.774  -7.732  1.00 2.00  ? 59  ILE A CG1 1 
ATOM   508   C  CG2 . ILE A  1 59  ? -97.239  -41.514  -7.702  1.00 2.00  ? 59  ILE A CG2 1 
ATOM   509   C  CD1 . ILE A  1 59  ? -97.561  -44.416  -6.444  1.00 2.00  ? 59  ILE A CD1 1 
ATOM   510   N  N   . GLU A  1 60  ? -95.501  -41.633  -10.813 1.00 2.87  ? 60  GLU A N   1 
ATOM   511   C  CA  . GLU A  1 60  ? -94.752  -40.520  -11.343 1.00 2.86  ? 60  GLU A CA  1 
ATOM   512   C  C   . GLU A  1 60  ? -95.208  -40.122  -12.695 1.00 2.56  ? 60  GLU A C   1 
ATOM   513   O  O   . GLU A  1 60  ? -95.193  -38.965  -13.035 1.00 3.17  ? 60  GLU A O   1 
ATOM   514   C  CB  . GLU A  1 60  ? -93.265  -40.827  -11.346 1.00 2.88  ? 60  GLU A CB  1 
ATOM   515   C  CG  . GLU A  1 60  ? -92.720  -40.814  -9.922  1.00 5.19  ? 60  GLU A CG  1 
ATOM   516   C  CD  . GLU A  1 60  ? -91.260  -41.099  -9.855  1.00 7.96  ? 60  GLU A CD  1 
ATOM   517   O  OE1 . GLU A  1 60  ? -90.671  -41.013  -8.759  1.00 9.00  ? 60  GLU A OE1 1 
ATOM   518   O  OE2 . GLU A  1 60  ? -90.699  -41.422  -10.915 1.00 10.78 ? 60  GLU A OE2 1 
ATOM   519   N  N   . ARG A  1 61  ? -95.643  -41.095  -13.462 1.00 2.78  ? 61  ARG A N   1 
ATOM   520   C  CA  . ARG A  1 61  ? -96.066  -40.849  -14.823 1.00 2.60  ? 61  ARG A CA  1 
ATOM   521   C  C   . ARG A  1 61  ? -97.436  -40.180  -14.809 1.00 2.85  ? 61  ARG A C   1 
ATOM   522   O  O   . ARG A  1 61  ? -97.611  -39.187  -15.506 1.00 2.52  ? 61  ARG A O   1 
ATOM   523   C  CB  . ARG A  1 61  ? -96.061  -42.167  -15.621 1.00 2.62  ? 61  ARG A CB  1 
ATOM   524   C  CG  . ARG A  1 61  ? -96.390  -42.032  -17.080 1.00 2.08  ? 61  ARG A CG  1 
ATOM   525   C  CD  . ARG A  1 61  ? -95.265  -41.401  -17.890 1.00 2.35  ? 61  ARG A CD  1 
ATOM   526   N  NE  . ARG A  1 61  ? -95.748  -41.169  -19.237 1.00 3.05  ? 61  ARG A NE  1 
ATOM   527   C  CZ  . ARG A  1 61  ? -95.166  -40.385  -20.134 1.00 5.05  ? 61  ARG A CZ  1 
ATOM   528   N  NH1 . ARG A  1 61  ? -94.039  -39.752  -19.835 1.00 3.71  ? 61  ARG A NH1 1 
ATOM   529   N  NH2 . ARG A  1 61  ? -95.733  -40.244  -21.342 1.00 4.54  ? 61  ARG A NH2 1 
ATOM   530   N  N   . ILE A  1 62  ? -98.378  -40.708  -14.005 1.00 2.52  ? 62  ILE A N   1 
ATOM   531   C  CA  . ILE A  1 62  ? -99.690  -40.073  -13.852 1.00 2.42  ? 62  ILE A CA  1 
ATOM   532   C  C   . ILE A  1 62  ? -99.517  -38.591  -13.463 1.00 2.80  ? 62  ILE A C   1 
ATOM   533   O  O   . ILE A  1 62  ? -100.180 -37.684  -14.001 1.00 2.87  ? 62  ILE A O   1 
ATOM   534   C  CB  . ILE A  1 62  ? -100.581 -40.790  -12.824 1.00 2.14  ? 62  ILE A CB  1 
ATOM   535   C  CG1 . ILE A  1 62  ? -100.936 -42.194  -13.331 1.00 3.16  ? 62  ILE A CG1 1 
ATOM   536   C  CG2 . ILE A  1 62  ? -101.845 -40.045  -12.619 1.00 2.00  ? 62  ILE A CG2 1 
ATOM   537   C  CD1 . ILE A  1 62  ? -101.649 -43.053  -12.325 1.00 2.00  ? 62  ILE A CD1 1 
ATOM   538   N  N   . LEU A  1 63  ? -98.598  -38.345  -12.549 1.00 2.53  ? 63  LEU A N   1 
ATOM   539   C  CA  . LEU A  1 63  ? -98.378  -37.007  -12.045 1.00 2.79  ? 63  LEU A CA  1 
ATOM   540   C  C   . LEU A  1 63  ? -97.822  -36.147  -13.158 1.00 3.13  ? 63  LEU A C   1 
ATOM   541   O  O   . LEU A  1 63  ? -98.260  -35.013  -13.353 1.00 3.79  ? 63  LEU A O   1 
ATOM   542   C  CB  . LEU A  1 63  ? -97.436  -37.030  -10.847 1.00 2.67  ? 63  LEU A CB  1 
ATOM   543   C  CG  . LEU A  1 63  ? -97.904  -36.814  -9.405  1.00 2.03  ? 63  LEU A CG  1 
ATOM   544   C  CD1 . LEU A  1 63  ? -99.377  -36.737  -9.191  1.00 2.00  ? 63  LEU A CD1 1 
ATOM   545   C  CD2 . LEU A  1 63  ? -97.247  -37.818  -8.502  1.00 2.00  ? 63  LEU A CD2 1 
ATOM   546   N  N   . PHE A  1 64  ? -96.892  -36.698  -13.922 1.00 3.08  ? 64  PHE A N   1 
ATOM   547   C  CA  . PHE A  1 64  ? -96.286  -35.936  -15.008 1.00 3.09  ? 64  PHE A CA  1 
ATOM   548   C  C   . PHE A  1 64  ? -97.357  -35.562  -16.021 1.00 3.31  ? 64  PHE A C   1 
ATOM   549   O  O   . PHE A  1 64  ? -97.373  -34.419  -16.501 1.00 4.31  ? 64  PHE A O   1 
ATOM   550   C  CB  . PHE A  1 64  ? -95.158  -36.700  -15.702 1.00 2.44  ? 64  PHE A CB  1 
ATOM   551   C  CG  . PHE A  1 64  ? -94.721  -36.071  -16.983 1.00 2.05  ? 64  PHE A CG  1 
ATOM   552   C  CD1 . PHE A  1 64  ? -94.175  -34.790  -16.997 1.00 2.00  ? 64  PHE A CD1 1 
ATOM   553   C  CD2 . PHE A  1 64  ? -94.847  -36.745  -18.185 1.00 3.20  ? 64  PHE A CD2 1 
ATOM   554   C  CE1 . PHE A  1 64  ? -93.750  -34.205  -18.178 1.00 2.00  ? 64  PHE A CE1 1 
ATOM   555   C  CE2 . PHE A  1 64  ? -94.419  -36.156  -19.393 1.00 2.00  ? 64  PHE A CE2 1 
ATOM   556   C  CZ  . PHE A  1 64  ? -93.872  -34.897  -19.377 1.00 2.00  ? 64  PHE A CZ  1 
ATOM   557   N  N   . LEU A  1 65  ? -98.240  -36.519  -16.316 1.00 2.46  ? 65  LEU A N   1 
ATOM   558   C  CA  . LEU A  1 65  ? -99.306  -36.360  -17.287 1.00 2.23  ? 65  LEU A CA  1 
ATOM   559   C  C   . LEU A  1 65  ? -100.448 -35.534  -16.729 1.00 2.29  ? 65  LEU A C   1 
ATOM   560   O  O   . LEU A  1 65  ? -101.442 -35.354  -17.402 1.00 2.15  ? 65  LEU A O   1 
ATOM   561   C  CB  . LEU A  1 65  ? -99.837  -37.718  -17.736 1.00 2.23  ? 65  LEU A CB  1 
ATOM   562   C  CG  . LEU A  1 65  ? -98.844  -38.544  -18.558 1.00 2.32  ? 65  LEU A CG  1 
ATOM   563   C  CD1 . LEU A  1 65  ? -99.485  -39.840  -19.010 1.00 2.00  ? 65  LEU A CD1 1 
ATOM   564   C  CD2 . LEU A  1 65  ? -98.303  -37.711  -19.722 1.00 2.00  ? 65  LEU A CD2 1 
ATOM   565   N  N   . GLU A  1 66  ? -100.282 -35.048  -15.499 1.00 2.34  ? 66  GLU A N   1 
ATOM   566   C  CA  . GLU A  1 66  ? -101.238 -34.188  -14.802 1.00 3.37  ? 66  GLU A CA  1 
ATOM   567   C  C   . GLU A  1 66  ? -102.547 -34.848  -14.369 1.00 3.00  ? 66  GLU A C   1 
ATOM   568   O  O   . GLU A  1 66  ? -103.564 -34.185  -14.286 1.00 3.16  ? 66  GLU A O   1 
ATOM   569   C  CB  . GLU A  1 66  ? -101.482 -32.878  -15.559 1.00 2.96  ? 66  GLU A CB  1 
ATOM   570   C  CG  . GLU A  1 66  ? -100.166 -32.066  -15.758 1.00 6.18  ? 66  GLU A CG  1 
ATOM   571   C  CD  . GLU A  1 66  ? -100.296 -30.833  -16.652 1.00 5.85  ? 66  GLU A CD  1 
ATOM   572   O  OE1 . GLU A  1 66  ? -101.366 -30.185  -16.651 1.00 11.42 ? 66  GLU A OE1 1 
ATOM   573   O  OE2 . GLU A  1 66  ? -99.308  -30.496  -17.337 1.00 6.71  ? 66  GLU A OE2 1 
ATOM   574   N  N   . GLY A  1 67  ? -102.522 -36.139  -14.048 1.00 2.88  ? 67  GLY A N   1 
ATOM   575   C  CA  . GLY A  1 67  ? -103.672 -36.818  -13.471 1.00 3.01  ? 67  GLY A CA  1 
ATOM   576   C  C   . GLY A  1 67  ? -103.489 -37.053  -11.982 1.00 4.21  ? 67  GLY A C   1 
ATOM   577   O  O   . GLY A  1 67  ? -102.476 -36.676  -11.401 1.00 4.45  ? 67  GLY A O   1 
ATOM   578   N  N   . LEU A  1 68  ? -104.486 -37.674  -11.361 1.00 4.23  ? 68  LEU A N   1 
ATOM   579   C  CA  . LEU A  1 68  ? -104.510 -37.901  -9.928  1.00 4.20  ? 68  LEU A CA  1 
ATOM   580   C  C   . LEU A  1 68  ? -104.295 -39.388  -9.656  1.00 3.83  ? 68  LEU A C   1 
ATOM   581   O  O   . LEU A  1 68  ? -105.190 -40.188  -9.898  1.00 3.75  ? 68  LEU A O   1 
ATOM   582   C  CB  . LEU A  1 68  ? -105.875 -37.516  -9.399  1.00 4.20  ? 68  LEU A CB  1 
ATOM   583   C  CG  . LEU A  1 68  ? -106.237 -36.139  -8.844  1.00 6.82  ? 68  LEU A CG  1 
ATOM   584   C  CD1 . LEU A  1 68  ? -105.119 -35.068  -8.916  1.00 5.19  ? 68  LEU A CD1 1 
ATOM   585   C  CD2 . LEU A  1 68  ? -107.575 -35.657  -9.472  1.00 6.27  ? 68  LEU A CD2 1 
ATOM   586   N  N   . PRO A  1 69  ? -103.105 -39.769  -9.157  1.00 3.51  ? 69  PRO A N   1 
ATOM   587   C  CA  . PRO A  1 69  ? -102.901 -41.193  -8.854  1.00 3.07  ? 69  PRO A CA  1 
ATOM   588   C  C   . PRO A  1 69  ? -103.870 -41.631  -7.767  1.00 3.61  ? 69  PRO A C   1 
ATOM   589   O  O   . PRO A  1 69  ? -104.120 -40.895  -6.797  1.00 3.62  ? 69  PRO A O   1 
ATOM   590   C  CB  . PRO A  1 69  ? -101.468 -41.248  -8.325  1.00 2.07  ? 69  PRO A CB  1 
ATOM   591   C  CG  . PRO A  1 69  ? -100.839 -40.023  -8.769  1.00 2.01  ? 69  PRO A CG  1 
ATOM   592   C  CD  . PRO A  1 69  ? -101.908 -38.972  -8.857  1.00 2.81  ? 69  PRO A CD  1 
ATOM   593   N  N   . ASN A  1 70  ? -104.429 -42.817  -7.951  1.00 4.06  ? 70  ASN A N   1 
ATOM   594   C  CA  . ASN A  1 70  ? -105.425 -43.338  -7.053  1.00 4.41  ? 70  ASN A CA  1 
ATOM   595   C  C   . ASN A  1 70  ? -104.813 -44.446  -6.235  1.00 4.78  ? 70  ASN A C   1 
ATOM   596   O  O   . ASN A  1 70  ? -104.616 -45.537  -6.737  1.00 5.52  ? 70  ASN A O   1 
ATOM   597   C  CB  . ASN A  1 70  ? -106.583 -43.879  -7.857  1.00 4.02  ? 70  ASN A CB  1 
ATOM   598   C  CG  . ASN A  1 70  ? -107.723 -44.355  -6.983  1.00 5.27  ? 70  ASN A CG  1 
ATOM   599   O  OD1 . ASN A  1 70  ? -107.623 -44.404  -5.747  1.00 6.69  ? 70  ASN A OD1 1 
ATOM   600   N  ND2 . ASN A  1 70  ? -108.824 -44.722  -7.625  1.00 4.53  ? 70  ASN A ND2 1 
ATOM   601   N  N   . LEU A  1 71  ? -104.510 -44.156  -4.979  1.00 4.74  ? 71  LEU A N   1 
ATOM   602   C  CA  . LEU A  1 71  ? -104.025 -45.158  -4.042  1.00 4.87  ? 71  LEU A CA  1 
ATOM   603   C  C   . LEU A  1 71  ? -105.106 -45.499  -2.992  1.00 6.11  ? 71  LEU A C   1 
ATOM   604   O  O   . LEU A  1 71  ? -104.832 -46.176  -1.992  1.00 6.85  ? 71  LEU A O   1 
ATOM   605   C  CB  . LEU A  1 71  ? -102.767 -44.646  -3.354  1.00 4.07  ? 71  LEU A CB  1 
ATOM   606   C  CG  . LEU A  1 71  ? -101.485 -44.756  -4.185  1.00 4.61  ? 71  LEU A CG  1 
ATOM   607   C  CD1 . LEU A  1 71  ? -101.320 -43.586  -5.092  1.00 3.69  ? 71  LEU A CD1 1 
ATOM   608   C  CD2 . LEU A  1 71  ? -100.261 -44.907  -3.300  1.00 2.89  ? 71  LEU A CD2 1 
ATOM   609   N  N   . GLN A  1 72  ? -106.328 -45.023  -3.205  1.00 6.98  ? 72  GLN A N   1 
ATOM   610   C  CA  . GLN A  1 72  ? -107.350 -45.171  -2.207  1.00 7.65  ? 72  GLN A CA  1 
ATOM   611   C  C   . GLN A  1 72  ? -108.020 -46.508  -2.398  1.00 8.19  ? 72  GLN A C   1 
ATOM   612   O  O   . GLN A  1 72  ? -108.270 -47.196  -1.433  1.00 8.81  ? 72  GLN A O   1 
ATOM   613   C  CB  . GLN A  1 72  ? -108.369 -44.021  -2.295  1.00 7.95  ? 72  GLN A CB  1 
ATOM   614   C  CG  . GLN A  1 72  ? -109.592 -44.176  -1.375  1.00 9.04  ? 72  GLN A CG  1 
ATOM   615   C  CD  . GLN A  1 72  ? -109.213 -44.078  0.092   1.00 11.26 ? 72  GLN A CD  1 
ATOM   616   O  OE1 . GLN A  1 72  ? -109.041 -42.963  0.630   1.00 12.92 ? 72  GLN A OE1 1 
ATOM   617   N  NE2 . GLN A  1 72  ? -109.052 -45.242  0.752   1.00 7.90  ? 72  GLN A NE2 1 
ATOM   618   N  N   . ASP A  1 73  ? -108.305 -46.874  -3.644  1.00 8.84  ? 73  ASP A N   1 
ATOM   619   C  CA  . ASP A  1 73  ? -109.076 -48.101  -3.911  1.00 9.67  ? 73  ASP A CA  1 
ATOM   620   C  C   . ASP A  1 73  ? -108.146 -49.289  -4.016  1.00 10.11 ? 73  ASP A C   1 
ATOM   621   O  O   . ASP A  1 73  ? -107.109 -49.222  -4.723  1.00 12.25 ? 73  ASP A O   1 
ATOM   622   C  CB  . ASP A  1 73  ? -109.926 -47.947  -5.185  1.00 9.49  ? 73  ASP A CB  1 
ATOM   623   C  CG  . ASP A  1 73  ? -110.873 -46.732  -5.102  1.00 11.91 ? 73  ASP A CG  1 
ATOM   624   O  OD1 . ASP A  1 73  ? -111.424 -46.461  -3.984  1.00 13.94 ? 73  ASP A OD1 1 
ATOM   625   O  OD2 . ASP A  1 73  ? -111.037 -46.021  -6.129  1.00 12.37 ? 73  ASP A OD2 1 
ATOM   626   N  N   . LEU A  1 74  ? -108.478 -50.359  -3.296  1.00 9.55  ? 74  LEU A N   1 
ATOM   627   C  CA  . LEU A  1 74  ? -107.653 -51.562  -3.293  1.00 8.33  ? 74  LEU A CA  1 
ATOM   628   C  C   . LEU A  1 74  ? -108.510 -52.755  -3.685  1.00 8.41  ? 74  LEU A C   1 
ATOM   629   O  O   . LEU A  1 74  ? -109.493 -53.048  -3.002  1.00 8.70  ? 74  LEU A O   1 
ATOM   630   C  CB  . LEU A  1 74  ? -107.043 -51.764  -1.909  1.00 7.91  ? 74  LEU A CB  1 
ATOM   631   C  CG  . LEU A  1 74  ? -105.933 -52.817  -1.769  1.00 7.55  ? 74  LEU A CG  1 
ATOM   632   C  CD1 . LEU A  1 74  ? -104.713 -52.514  -2.601  1.00 4.10  ? 74  LEU A CD1 1 
ATOM   633   C  CD2 . LEU A  1 74  ? -105.523 -53.033  -0.307  1.00 7.43  ? 74  LEU A CD2 1 
ATOM   634   N  N   . GLY A  1 75  ? -108.147 -53.427  -4.781  1.00 8.29  ? 75  GLY A N   1 
ATOM   635   C  CA  . GLY A  1 75  ? -108.878 -54.603  -5.260  1.00 8.42  ? 75  GLY A CA  1 
ATOM   636   C  C   . GLY A  1 75  ? -108.817 -55.815  -4.352  1.00 9.35  ? 75  GLY A C   1 
ATOM   637   O  O   . GLY A  1 75  ? -108.175 -55.788  -3.300  1.00 9.26  ? 75  GLY A O   1 
ATOM   638   N  N   . LYS A  1 76  ? -109.507 -56.885  -4.748  1.00 10.22 ? 76  LYS A N   1 
ATOM   639   C  CA  . LYS A  1 76  ? -109.549 -58.102  -3.920  1.00 11.65 ? 76  LYS A CA  1 
ATOM   640   C  C   . LYS A  1 76  ? -108.198 -58.811  -3.842  1.00 10.49 ? 76  LYS A C   1 
ATOM   641   O  O   . LYS A  1 76  ? -107.620 -59.203  -4.859  1.00 10.76 ? 76  LYS A O   1 
ATOM   642   C  CB  . LYS A  1 76  ? -110.670 -59.086  -4.333  1.00 11.58 ? 76  LYS A CB  1 
ATOM   643   C  CG  . LYS A  1 76  ? -111.033 -60.028  -3.121  1.00 15.49 ? 76  LYS A CG  1 
ATOM   644   C  CD  . LYS A  1 76  ? -112.110 -61.131  -3.419  1.00 15.69 ? 76  LYS A CD  1 
ATOM   645   C  CE  . LYS A  1 76  ? -112.143 -62.240  -2.298  1.00 18.62 ? 76  LYS A CE  1 
ATOM   646   N  NZ  . LYS A  1 76  ? -113.099 -63.400  -2.683  1.00 20.33 ? 76  LYS A NZ  1 
ATOM   647   N  N   . LEU A  1 77  ? -107.699 -58.926  -2.615  1.00 9.99  ? 77  LEU A N   1 
ATOM   648   C  CA  . LEU A  1 77  ? -106.616 -59.854  -2.257  1.00 9.43  ? 77  LEU A CA  1 
ATOM   649   C  C   . LEU A  1 77  ? -107.194 -61.262  -2.156  1.00 9.37  ? 77  LEU A C   1 
ATOM   650   O  O   . LEU A  1 77  ? -108.316 -61.449  -1.699  1.00 9.85  ? 77  LEU A O   1 
ATOM   651   C  CB  . LEU A  1 77  ? -106.058 -59.478  -0.893  1.00 9.19  ? 77  LEU A CB  1 
ATOM   652   C  CG  . LEU A  1 77  ? -104.752 -58.714  -0.765  1.00 9.00  ? 77  LEU A CG  1 
ATOM   653   C  CD1 . LEU A  1 77  ? -104.758 -57.521  -1.681  1.00 7.33  ? 77  LEU A CD1 1 
ATOM   654   C  CD2 . LEU A  1 77  ? -104.637 -58.276  0.665   1.00 9.55  ? 77  LEU A CD2 1 
ATOM   655   N  N   . ASN A  1 78  ? -106.448 -62.258  -2.596  1.00 9.54  ? 78  ASN A N   1 
ATOM   656   C  CA  . ASN A  1 78  ? -106.839 -63.653  -2.352  1.00 9.48  ? 78  ASN A CA  1 
ATOM   657   C  C   . ASN A  1 78  ? -105.613 -64.335  -1.773  1.00 9.24  ? 78  ASN A C   1 
ATOM   658   O  O   . ASN A  1 78  ? -104.640 -64.536  -2.479  1.00 9.75  ? 78  ASN A O   1 
ATOM   659   C  CB  . ASN A  1 78  ? -107.366 -64.317  -3.631  1.00 9.39  ? 78  ASN A CB  1 
ATOM   660   C  CG  . ASN A  1 78  ? -107.669 -65.827  -3.448  1.00 12.26 ? 78  ASN A CG  1 
ATOM   661   O  OD1 . ASN A  1 78  ? -107.713 -66.354  -2.320  1.00 13.88 ? 78  ASN A OD1 1 
ATOM   662   N  ND2 . ASN A  1 78  ? -107.871 -66.526  -4.580  1.00 12.53 ? 78  ASN A ND2 1 
ATOM   663   N  N   . ILE A  1 79  ? -105.639 -64.603  -0.468  1.00 8.77  ? 79  ILE A N   1 
ATOM   664   C  CA  . ILE A  1 79  ? -104.431 -64.975  0.257   1.00 8.23  ? 79  ILE A CA  1 
ATOM   665   C  C   . ILE A  1 79  ? -104.148 -66.464  0.167   1.00 8.75  ? 79  ILE A C   1 
ATOM   666   O  O   . ILE A  1 79  ? -103.061 -66.843  -0.264  1.00 9.21  ? 79  ILE A O   1 
ATOM   667   C  CB  . ILE A  1 79  ? -104.446 -64.536  1.733   1.00 8.11  ? 79  ILE A CB  1 
ATOM   668   C  CG1 . ILE A  1 79  ? -104.687 -63.022  1.882   1.00 7.61  ? 79  ILE A CG1 1 
ATOM   669   C  CG2 . ILE A  1 79  ? -103.141 -64.932  2.401   1.00 7.79  ? 79  ILE A CG2 1 
ATOM   670   C  CD1 . ILE A  1 79  ? -103.729 -62.120  1.049   1.00 5.78  ? 79  ILE A CD1 1 
ATOM   671   N  N   . GLY A  1 80  ? -105.107 -67.312  0.547   1.00 8.40  ? 80  GLY A N   1 
ATOM   672   C  CA  . GLY A  1 80  ? -104.910 -68.752  0.453   1.00 8.51  ? 80  GLY A CA  1 
ATOM   673   C  C   . GLY A  1 80  ? -104.317 -69.249  1.749   1.00 9.07  ? 80  GLY A C   1 
ATOM   674   O  O   . GLY A  1 80  ? -103.800 -68.455  2.535   1.00 9.08  ? 80  GLY A O   1 
ATOM   675   N  N   . GLU A  1 81  ? -104.381 -70.553  2.001   1.00 9.31  ? 81  GLU A N   1 
ATOM   676   C  CA  . GLU A  1 81  ? -103.946 -71.049  3.300   1.00 10.14 ? 81  GLU A CA  1 
ATOM   677   C  C   . GLU A  1 81  ? -102.747 -71.983  3.233   1.00 9.38  ? 81  GLU A C   1 
ATOM   678   O  O   . GLU A  1 81  ? -102.138 -72.232  4.271   1.00 10.32 ? 81  GLU A O   1 
ATOM   679   C  CB  . GLU A  1 81  ? -105.108 -71.697  4.065   1.00 9.65  ? 81  GLU A CB  1 
ATOM   680   C  CG  . GLU A  1 81  ? -106.299 -70.742  4.405   1.00 12.24 ? 81  GLU A CG  1 
ATOM   681   C  CD  . GLU A  1 81  ? -107.643 -71.530  4.633   1.00 15.07 ? 81  GLU A CD  1 
ATOM   682   O  OE1 . GLU A  1 81  ? -108.032 -72.371  3.763   1.00 20.82 ? 81  GLU A OE1 1 
ATOM   683   O  OE2 . GLU A  1 81  ? -108.315 -71.320  5.679   1.00 19.48 ? 81  GLU A OE2 1 
ATOM   684   N  N   . ASP A  1 82  ? -102.413 -72.511  2.037   1.00 8.72  ? 82  ASP A N   1 
ATOM   685   C  CA  . ASP A  1 82  ? -101.198 -73.347  1.832   1.00 7.38  ? 82  ASP A CA  1 
ATOM   686   C  C   . ASP A  1 82  ? -100.363 -72.899  0.624   1.00 6.43  ? 82  ASP A C   1 
ATOM   687   O  O   . ASP A  1 82  ? -100.841 -72.144  -0.214  1.00 6.38  ? 82  ASP A O   1 
ATOM   688   C  CB  . ASP A  1 82  ? -101.540 -74.826  1.711   1.00 7.27  ? 82  ASP A CB  1 
ATOM   689   C  CG  . ASP A  1 82  ? -102.504 -75.114  0.590   1.00 10.33 ? 82  ASP A CG  1 
ATOM   690   O  OD1 . ASP A  1 82  ? -103.586 -75.669  0.883   1.00 16.58 ? 82  ASP A OD1 1 
ATOM   691   O  OD2 . ASP A  1 82  ? -102.218 -74.811  -0.587  1.00 12.05 ? 82  ASP A OD2 1 
ATOM   692   N  N   . VAL A  1 83  ? -99.130  -73.393  0.521   1.00 5.65  ? 83  VAL A N   1 
ATOM   693   C  CA  . VAL A  1 83  ? -98.169  -72.937  -0.487  1.00 4.94  ? 83  VAL A CA  1 
ATOM   694   C  C   . VAL A  1 83  ? -98.748  -72.903  -1.906  1.00 5.08  ? 83  VAL A C   1 
ATOM   695   O  O   . VAL A  1 83  ? -98.727  -71.843  -2.562  1.00 5.07  ? 83  VAL A O   1 
ATOM   696   C  CB  . VAL A  1 83  ? -96.890  -73.809  -0.466  1.00 4.69  ? 83  VAL A CB  1 
ATOM   697   C  CG1 . VAL A  1 83  ? -95.866  -73.322  -1.463  1.00 3.98  ? 83  VAL A CG1 1 
ATOM   698   C  CG2 . VAL A  1 83  ? -96.313  -73.771  0.906   1.00 4.70  ? 83  VAL A CG2 1 
ATOM   699   N  N   . GLU A  1 84  ? -99.249  -74.052  -2.375  1.00 4.70  ? 84  GLU A N   1 
ATOM   700   C  CA  . GLU A  1 84  ? -99.818  -74.152  -3.697  1.00 5.39  ? 84  GLU A CA  1 
ATOM   701   C  C   . GLU A  1 84  ? -100.906 -73.106  -3.907  1.00 5.71  ? 84  GLU A C   1 
ATOM   702   O  O   . GLU A  1 84  ? -100.854 -72.323  -4.858  1.00 5.75  ? 84  GLU A O   1 
ATOM   703   C  CB  . GLU A  1 84  ? -100.411 -75.535  -3.943  1.00 5.54  ? 84  GLU A CB  1 
ATOM   704   C  CG  . GLU A  1 84  ? -100.228 -75.983  -5.393  1.00 9.22  ? 84  GLU A CG  1 
ATOM   705   C  CD  . GLU A  1 84  ? -101.138 -77.128  -5.806  1.00 13.95 ? 84  GLU A CD  1 
ATOM   706   O  OE1 . GLU A  1 84  ? -101.240 -78.124  -5.041  1.00 16.29 ? 84  GLU A OE1 1 
ATOM   707   O  OE2 . GLU A  1 84  ? -101.743 -77.036  -6.905  1.00 13.50 ? 84  GLU A OE2 1 
ATOM   708   N  N   . GLU A  1 85  ? -101.886 -73.082  -3.011  1.00 5.76  ? 85  GLU A N   1 
ATOM   709   C  CA  . GLU A  1 85  ? -102.997 -72.152  -3.103  1.00 6.72  ? 85  GLU A CA  1 
ATOM   710   C  C   . GLU A  1 85  ? -102.428 -70.722  -3.189  1.00 5.76  ? 85  GLU A C   1 
ATOM   711   O  O   . GLU A  1 85  ? -102.890 -69.887  -3.987  1.00 5.33  ? 85  GLU A O   1 
ATOM   712   C  CB  . GLU A  1 85  ? -103.828 -72.333  -1.847  1.00 6.71  ? 85  GLU A CB  1 
ATOM   713   C  CG  . GLU A  1 85  ? -105.328 -72.190  -1.967  1.00 9.97  ? 85  GLU A CG  1 
ATOM   714   C  CD  . GLU A  1 85  ? -106.066 -72.797  -0.733  1.00 11.72 ? 85  GLU A CD  1 
ATOM   715   O  OE1 . GLU A  1 85  ? -105.753 -73.945  -0.334  1.00 15.05 ? 85  GLU A OE1 1 
ATOM   716   O  OE2 . GLU A  1 85  ? -106.951 -72.117  -0.166  1.00 16.80 ? 85  GLU A OE2 1 
ATOM   717   N  N   . MET A  1 86  ? -101.388 -70.437  -2.397  1.00 4.96  ? 86  MET A N   1 
ATOM   718   C  CA  . MET A  1 86  ? -100.932 -69.069  -2.406  1.00 5.02  ? 86  MET A CA  1 
ATOM   719   C  C   . MET A  1 86  ? -100.149 -68.739  -3.653  1.00 4.99  ? 86  MET A C   1 
ATOM   720   O  O   . MET A  1 86  ? -100.290 -67.635  -4.207  1.00 5.55  ? 86  MET A O   1 
ATOM   721   C  CB  . MET A  1 86  ? -100.297 -68.553  -1.077  1.00 4.77  ? 86  MET A CB  1 
ATOM   722   C  CG  . MET A  1 86  ? -99.442  -69.476  -0.328  1.00 6.72  ? 86  MET A CG  1 
ATOM   723   S  SD  . MET A  1 86  ? -99.460  -69.229  1.462   1.00 4.94  ? 86  MET A SD  1 
ATOM   724   C  CE  . MET A  1 86  ? -98.274  -67.932  1.700   1.00 3.18  ? 86  MET A CE  1 
ATOM   725   N  N   . LEU A  1 87  ? -99.365  -69.697  -4.134  1.00 4.78  ? 87  LEU A N   1 
ATOM   726   C  CA  . LEU A  1 87  ? -98.625  -69.470  -5.351  1.00 3.91  ? 87  LEU A CA  1 
ATOM   727   C  C   . LEU A  1 87  ? -99.588  -69.297  -6.519  1.00 4.02  ? 87  LEU A C   1 
ATOM   728   O  O   . LEU A  1 87  ? -99.424  -68.393  -7.339  1.00 4.35  ? 87  LEU A O   1 
ATOM   729   C  CB  . LEU A  1 87  ? -97.646  -70.606  -5.578  1.00 3.57  ? 87  LEU A CB  1 
ATOM   730   C  CG  . LEU A  1 87  ? -96.161  -70.366  -5.249  1.00 3.40  ? 87  LEU A CG  1 
ATOM   731   C  CD1 . LEU A  1 87  ? -95.859  -69.328  -4.173  1.00 2.57  ? 87  LEU A CD1 1 
ATOM   732   C  CD2 . LEU A  1 87  ? -95.543  -71.685  -4.872  1.00 4.18  ? 87  LEU A CD2 1 
ATOM   733   N  N   . ARG A  1 88  ? -100.609 -70.136  -6.559  1.00 3.99  ? 88  ARG A N   1 
ATOM   734   C  CA  . ARG A  1 88  ? -101.584 -70.153  -7.627  1.00 4.79  ? 88  ARG A CA  1 
ATOM   735   C  C   . ARG A  1 88  ? -102.304 -68.807  -7.633  1.00 4.69  ? 88  ARG A C   1 
ATOM   736   O  O   . ARG A  1 88  ? -102.645 -68.250  -8.682  1.00 5.44  ? 88  ARG A O   1 
ATOM   737   C  CB  . ARG A  1 88  ? -102.582 -71.297  -7.395  1.00 4.20  ? 88  ARG A CB  1 
ATOM   738   C  CG  . ARG A  1 88  ? -102.768 -72.216  -8.542  1.00 5.35  ? 88  ARG A CG  1 
ATOM   739   C  CD  . ARG A  1 88  ? -103.559 -73.483  -8.196  1.00 7.14  ? 88  ARG A CD  1 
ATOM   740   N  NE  . ARG A  1 88  ? -102.758 -74.714  -8.292  1.00 13.53 ? 88  ARG A NE  1 
ATOM   741   C  CZ  . ARG A  1 88  ? -102.125 -75.147  -9.403  1.00 14.66 ? 88  ARG A CZ  1 
ATOM   742   N  NH1 . ARG A  1 88  ? -102.144 -74.450  -10.551 1.00 13.83 ? 88  ARG A NH1 1 
ATOM   743   N  NH2 . ARG A  1 88  ? -101.426 -76.271  -9.368  1.00 13.11 ? 88  ARG A NH2 1 
ATOM   744   N  N   . SER A  1 89  ? -102.514 -68.254  -6.454  1.00 4.68  ? 89  SER A N   1 
ATOM   745   C  CA  . SER A  1 89  ? -103.246 -67.015  -6.369  1.00 4.20  ? 89  SER A CA  1 
ATOM   746   C  C   . SER A  1 89  ? -102.418 -65.841  -6.923  1.00 4.54  ? 89  SER A C   1 
ATOM   747   O  O   . SER A  1 89  ? -102.973 -64.959  -7.619  1.00 4.81  ? 89  SER A O   1 
ATOM   748   C  CB  . SER A  1 89  ? -103.682 -66.757  -4.933  1.00 4.06  ? 89  SER A CB  1 
ATOM   749   O  OG  . SER A  1 89  ? -104.303 -65.502  -4.841  1.00 3.45  ? 89  SER A OG  1 
ATOM   750   N  N   . ASP A  1 90  ? -101.112 -65.823  -6.624  1.00 3.86  ? 90  ASP A N   1 
ATOM   751   C  CA  . ASP A  1 90  ? -100.209 -64.833  -7.193  1.00 3.81  ? 90  ASP A CA  1 
ATOM   752   C  C   . ASP A  1 90  ? -100.171 -64.963  -8.704  1.00 3.87  ? 90  ASP A C   1 
ATOM   753   O  O   . ASP A  1 90  ? -100.203 -63.961  -9.399  1.00 4.20  ? 90  ASP A O   1 
ATOM   754   C  CB  . ASP A  1 90  ? -98.799  -64.965  -6.639  1.00 4.11  ? 90  ASP A CB  1 
ATOM   755   C  CG  . ASP A  1 90  ? -98.678  -64.582  -5.140  1.00 6.80  ? 90  ASP A CG  1 
ATOM   756   O  OD1 . ASP A  1 90  ? -97.825  -65.195  -4.411  1.00 9.11  ? 90  ASP A OD1 1 
ATOM   757   O  OD2 . ASP A  1 90  ? -99.404  -63.661  -4.683  1.00 9.71  ? 90  ASP A OD2 1 
ATOM   758   N  N   . LEU A  1 91  ? -100.122 -66.194  -9.215  1.00 3.63  ? 91  LEU A N   1 
ATOM   759   C  CA  . LEU A  1 91  ? -100.180 -66.437  -10.659 1.00 2.84  ? 91  LEU A CA  1 
ATOM   760   C  C   . LEU A  1 91  ? -101.472 -65.899  -11.299 1.00 3.13  ? 91  LEU A C   1 
ATOM   761   O  O   . LEU A  1 91  ? -101.407 -65.208  -12.315 1.00 3.74  ? 91  LEU A O   1 
ATOM   762   C  CB  . LEU A  1 91  ? -100.006 -67.930  -10.981 1.00 2.85  ? 91  LEU A CB  1 
ATOM   763   C  CG  . LEU A  1 91  ? -100.108 -68.395  -12.435 1.00 2.00  ? 91  LEU A CG  1 
ATOM   764   C  CD1 . LEU A  1 91  ? -99.082  -67.673  -13.276 1.00 2.67  ? 91  LEU A CD1 1 
ATOM   765   C  CD2 . LEU A  1 91  ? -99.949  -69.881  -12.537 1.00 2.00  ? 91  LEU A CD2 1 
ATOM   766   N  N   . ALA A  1 92  ? -102.636 -66.181  -10.719 1.00 3.23  ? 92  ALA A N   1 
ATOM   767   C  CA  . ALA A  1 92  ? -103.879 -65.651  -11.312 1.00 3.20  ? 92  ALA A CA  1 
ATOM   768   C  C   . ALA A  1 92  ? -103.827 -64.115  -11.381 1.00 3.63  ? 92  ALA A C   1 
ATOM   769   O  O   . ALA A  1 92  ? -104.290 -63.488  -12.350 1.00 4.25  ? 92  ALA A O   1 
ATOM   770   C  CB  . ALA A  1 92  ? -105.127 -66.140  -10.546 1.00 2.00  ? 92  ALA A CB  1 
ATOM   771   N  N   . LEU A  1 93  ? -103.237 -63.521  -10.350 1.00 3.86  ? 93  LEU A N   1 
ATOM   772   C  CA  . LEU A  1 93  ? -103.149 -62.071  -10.253 1.00 4.34  ? 93  LEU A CA  1 
ATOM   773   C  C   . LEU A  1 93  ? -102.265 -61.475  -11.330 1.00 4.78  ? 93  LEU A C   1 
ATOM   774   O  O   . LEU A  1 93  ? -102.644 -60.481  -11.937 1.00 5.10  ? 93  LEU A O   1 
ATOM   775   C  CB  . LEU A  1 93  ? -102.638 -61.685  -8.880  1.00 4.17  ? 93  LEU A CB  1 
ATOM   776   C  CG  . LEU A  1 93  ? -102.823 -60.226  -8.534  1.00 5.16  ? 93  LEU A CG  1 
ATOM   777   C  CD1 . LEU A  1 93  ? -104.305 -59.840  -8.542  1.00 5.04  ? 93  LEU A CD1 1 
ATOM   778   C  CD2 . LEU A  1 93  ? -102.210 -60.013  -7.158  1.00 4.54  ? 93  LEU A CD2 1 
ATOM   779   N  N   . GLU A  1 94  ? -101.103 -62.105  -11.574 1.00 4.94  ? 94  GLU A N   1 
ATOM   780   C  CA  . GLU A  1 94  ? -100.176 -61.684  -12.615 1.00 5.02  ? 94  GLU A CA  1 
ATOM   781   C  C   . GLU A  1 94  ? -100.841 -61.806  -13.981 1.00 4.85  ? 94  GLU A C   1 
ATOM   782   O  O   . GLU A  1 94  ? -100.739 -60.918  -14.818 1.00 4.42  ? 94  GLU A O   1 
ATOM   783   C  CB  . GLU A  1 94  ? -98.890  -62.491  -12.562 1.00 5.03  ? 94  GLU A CB  1 
ATOM   784   C  CG  . GLU A  1 94  ? -98.078  -62.290  -11.306 1.00 7.75  ? 94  GLU A CG  1 
ATOM   785   C  CD  . GLU A  1 94  ? -97.122  -61.098  -11.373 1.00 13.83 ? 94  GLU A CD  1 
ATOM   786   O  OE1 . GLU A  1 94  ? -97.159  -60.363  -12.395 1.00 15.08 ? 94  GLU A OE1 1 
ATOM   787   O  OE2 . GLU A  1 94  ? -96.337  -60.887  -10.404 1.00 14.47 ? 94  GLU A OE2 1 
ATOM   788   N  N   . LEU A  1 95  ? -101.548 -62.910  -14.188 1.00 4.98  ? 95  LEU A N   1 
ATOM   789   C  CA  . LEU A  1 95  ? -102.263 -63.138  -15.417 1.00 4.79  ? 95  LEU A CA  1 
ATOM   790   C  C   . LEU A  1 95  ? -103.311 -62.057  -15.679 1.00 5.53  ? 95  LEU A C   1 
ATOM   791   O  O   . LEU A  1 95  ? -103.406 -61.562  -16.814 1.00 5.96  ? 95  LEU A O   1 
ATOM   792   C  CB  . LEU A  1 95  ? -102.865 -64.528  -15.416 1.00 4.56  ? 95  LEU A CB  1 
ATOM   793   C  CG  . LEU A  1 95  ? -102.157 -65.628  -16.227 1.00 4.44  ? 95  LEU A CG  1 
ATOM   794   C  CD1 . LEU A  1 95  ? -100.735 -65.321  -16.563 1.00 2.63  ? 95  LEU A CD1 1 
ATOM   795   C  CD2 . LEU A  1 95  ? -102.256 -66.950  -15.527 1.00 3.34  ? 95  LEU A CD2 1 
ATOM   796   N  N   . ASP A  1 96  ? -104.080 -61.643  -14.668 1.00 5.54  ? 96  ASP A N   1 
ATOM   797   C  CA  . ASP A  1 96  ? -105.033 -60.574  -14.909 1.00 6.34  ? 96  ASP A CA  1 
ATOM   798   C  C   . ASP A  1 96  ? -104.372 -59.240  -15.173 1.00 5.90  ? 96  ASP A C   1 
ATOM   799   O  O   . ASP A  1 96  ? -104.875 -58.432  -15.936 1.00 5.85  ? 96  ASP A O   1 
ATOM   800   C  CB  . ASP A  1 96  ? -106.026 -60.438  -13.765 1.00 7.35  ? 96  ASP A CB  1 
ATOM   801   C  CG  . ASP A  1 96  ? -107.096 -61.508  -13.802 1.00 13.91 ? 96  ASP A CG  1 
ATOM   802   O  OD1 . ASP A  1 96  ? -107.442 -62.036  -14.928 1.00 19.38 ? 96  ASP A OD1 1 
ATOM   803   O  OD2 . ASP A  1 96  ? -107.596 -61.828  -12.694 1.00 19.46 ? 96  ASP A OD2 1 
ATOM   804   N  N   . GLY A  1 97  ? -103.264 -58.981  -14.509 1.00 5.50  ? 97  GLY A N   1 
ATOM   805   C  CA  . GLY A  1 97  ? -102.561 -57.747  -14.748 1.00 5.59  ? 97  GLY A CA  1 
ATOM   806   C  C   . GLY A  1 97  ? -101.907 -57.730  -16.120 1.00 5.91  ? 97  GLY A C   1 
ATOM   807   O  O   . GLY A  1 97  ? -101.826 -56.682  -16.755 1.00 5.93  ? 97  GLY A O   1 
ATOM   808   N  N   . ALA A  1 98  ? -101.412 -58.871  -16.580 1.00 6.52  ? 98  ALA A N   1 
ATOM   809   C  CA  . ALA A  1 98  ? -100.789 -58.915  -17.902 1.00 7.81  ? 98  ALA A CA  1 
ATOM   810   C  C   . ALA A  1 98  ? -101.838 -58.571  -18.965 1.00 9.23  ? 98  ALA A C   1 
ATOM   811   O  O   . ALA A  1 98  ? -101.550 -57.852  -19.906 1.00 8.85  ? 98  ALA A O   1 
ATOM   812   C  CB  . ALA A  1 98  ? -100.149 -60.274  -18.160 1.00 6.34  ? 98  ALA A CB  1 
ATOM   813   N  N   . LYS A  1 99  ? -103.055 -59.069  -18.763 1.00 11.32 ? 99  LYS A N   1 
ATOM   814   C  CA  . LYS A  1 99  ? -104.168 -58.832  -19.640 1.00 13.60 ? 99  LYS A CA  1 
ATOM   815   C  C   . LYS A  1 99  ? -104.421 -57.333  -19.714 1.00 11.97 ? 99  LYS A C   1 
ATOM   816   O  O   . LYS A  1 99  ? -104.430 -56.772  -20.813 1.00 12.43 ? 99  LYS A O   1 
ATOM   817   C  CB  . LYS A  1 99  ? -105.382 -59.599  -19.116 1.00 14.36 ? 99  LYS A CB  1 
ATOM   818   C  CG  . LYS A  1 99  ? -106.482 -59.965  -20.126 1.00 18.34 ? 99  LYS A CG  1 
ATOM   819   C  CD  . LYS A  1 99  ? -107.459 -61.041  -19.543 1.00 19.24 ? 99  LYS A CD  1 
ATOM   820   C  CE  . LYS A  1 99  ? -106.874 -62.533  -19.530 1.00 22.80 ? 99  LYS A CE  1 
ATOM   821   N  NZ  . LYS A  1 99  ? -107.197 -63.321  -18.233 1.00 22.16 ? 99  LYS A NZ  1 
ATOM   822   N  N   . ASN A  1 100 ? -104.579 -56.679  -18.558 1.00 9.86  ? 100 ASN A N   1 
ATOM   823   C  CA  . ASN A  1 100 ? -104.751 -55.218  -18.499 1.00 8.13  ? 100 ASN A CA  1 
ATOM   824   C  C   . ASN A  1 100 ? -103.602 -54.439  -19.181 1.00 7.38  ? 100 ASN A C   1 
ATOM   825   O  O   . ASN A  1 100 ? -103.825 -53.428  -19.873 1.00 6.43  ? 100 ASN A O   1 
ATOM   826   C  CB  . ASN A  1 100 ? -104.894 -54.726  -17.066 1.00 7.84  ? 100 ASN A CB  1 
ATOM   827   C  CG  . ASN A  1 100 ? -106.131 -55.300  -16.347 1.00 8.35  ? 100 ASN A CG  1 
ATOM   828   O  OD1 . ASN A  1 100 ? -106.145 -55.405  -15.122 1.00 9.73  ? 100 ASN A OD1 1 
ATOM   829   N  ND2 . ASN A  1 100 ? -107.167 -55.651  -17.094 1.00 6.55  ? 100 ASN A ND2 1 
ATOM   830   N  N   . LEU A  1 101 ? -102.370 -54.915  -18.978 1.00 5.82  ? 101 LEU A N   1 
ATOM   831   C  CA  . LEU A  1 101 ? -101.206 -54.282  -19.545 1.00 3.84  ? 101 LEU A CA  1 
ATOM   832   C  C   . LEU A  1 101 ? -101.230 -54.368  -21.049 1.00 3.45  ? 101 LEU A C   1 
ATOM   833   O  O   . LEU A  1 101 ? -100.927 -53.369  -21.720 1.00 3.01  ? 101 LEU A O   1 
ATOM   834   C  CB  . LEU A  1 101 ? -99.938  -54.924  -19.002 1.00 4.15  ? 101 LEU A CB  1 
ATOM   835   C  CG  . LEU A  1 101 ? -99.282  -54.278  -17.775 1.00 2.79  ? 101 LEU A CG  1 
ATOM   836   C  CD1 . LEU A  1 101 ? -98.352  -55.254  -17.085 1.00 3.14  ? 101 LEU A CD1 1 
ATOM   837   C  CD2 . LEU A  1 101 ? -98.515  -53.072  -18.194 1.00 2.00  ? 101 LEU A CD2 1 
ATOM   838   N  N   . ARG A  1 102 ? -101.614 -55.541  -21.589 1.00 3.03  ? 102 ARG A N   1 
ATOM   839   C  CA  A ARG A  1 102 ? -101.717 -55.726  -23.039 0.50 3.14  ? 102 ARG A CA  1 
ATOM   840   C  CA  B ARG A  1 102 ? -101.709 -55.729  -23.036 0.50 3.16  ? 102 ARG A CA  1 
ATOM   841   C  C   . ARG A  1 102 ? -102.699 -54.706  -23.623 1.00 3.52  ? 102 ARG A C   1 
ATOM   842   O  O   . ARG A  1 102 ? -102.429 -54.076  -24.628 1.00 3.76  ? 102 ARG A O   1 
ATOM   843   C  CB  A ARG A  1 102 ? -102.058 -57.177  -23.402 0.50 2.53  ? 102 ARG A CB  1 
ATOM   844   C  CB  B ARG A  1 102 ? -102.016 -57.195  -23.392 0.50 2.54  ? 102 ARG A CB  1 
ATOM   845   C  CG  A ARG A  1 102 ? -101.029 -58.164  -22.847 0.50 3.08  ? 102 ARG A CG  1 
ATOM   846   C  CG  B ARG A  1 102 ? -100.809 -58.142  -23.127 0.50 3.16  ? 102 ARG A CG  1 
ATOM   847   C  CD  A ARG A  1 102 ? -100.962 -59.548  -23.503 0.50 3.45  ? 102 ARG A CD  1 
ATOM   848   C  CD  B ARG A  1 102 ? -101.064 -59.677  -23.239 0.50 3.53  ? 102 ARG A CD  1 
ATOM   849   N  NE  A ARG A  1 102 ? -99.571  -60.000  -23.523 0.50 4.49  ? 102 ARG A NE  1 
ATOM   850   N  NE  B ARG A  1 102 ? -102.072 -60.151  -22.289 0.50 5.98  ? 102 ARG A NE  1 
ATOM   851   C  CZ  A ARG A  1 102 ? -99.003  -60.741  -22.591 0.50 5.97  ? 102 ARG A CZ  1 
ATOM   852   C  CZ  B ARG A  1 102 ? -102.636 -61.360  -22.280 0.50 7.20  ? 102 ARG A CZ  1 
ATOM   853   N  NH1 A ARG A  1 102 ? -99.697  -61.163  -21.557 0.50 9.10  ? 102 ARG A NH1 1 
ATOM   854   N  NH1 B ARG A  1 102 ? -102.300 -62.291  -23.164 0.50 10.62 ? 102 ARG A NH1 1 
ATOM   855   N  NH2 A ARG A  1 102 ? -97.734  -61.074  -22.703 0.50 7.38  ? 102 ARG A NH2 1 
ATOM   856   N  NH2 B ARG A  1 102 ? -103.556 -61.636  -21.382 0.50 7.28  ? 102 ARG A NH2 1 
ATOM   857   N  N   . GLU A  1 103 ? -103.801 -54.473  -22.934 1.00 4.02  ? 103 GLU A N   1 
ATOM   858   C  CA  . GLU A  1 103 ? -104.897 -53.580  -23.318 1.00 4.54  ? 103 GLU A CA  1 
ATOM   859   C  C   . GLU A  1 103 ? -104.415 -52.167  -23.350 1.00 3.10  ? 103 GLU A C   1 
ATOM   860   O  O   . GLU A  1 103 ? -104.617 -51.464  -24.319 1.00 2.49  ? 103 GLU A O   1 
ATOM   861   C  CB  . GLU A  1 103 ? -105.931 -53.650  -22.198 1.00 6.37  ? 103 GLU A CB  1 
ATOM   862   C  CG  . GLU A  1 103 ? -107.328 -54.054  -22.583 1.00 12.69 ? 103 GLU A CG  1 
ATOM   863   C  CD  . GLU A  1 103 ? -107.853 -55.215  -21.736 1.00 18.11 ? 103 GLU A CD  1 
ATOM   864   O  OE1 . GLU A  1 103 ? -108.231 -56.237  -22.348 1.00 21.65 ? 103 GLU A OE1 1 
ATOM   865   O  OE2 . GLU A  1 103 ? -107.873 -55.121  -20.482 1.00 20.37 ? 103 GLU A OE2 1 
ATOM   866   N  N   . ALA A  1 104 ? -103.805 -51.755  -22.245 1.00 2.82  ? 104 ALA A N   1 
ATOM   867   C  CA  . ALA A  1 104 ? -103.282 -50.403  -22.079 1.00 2.19  ? 104 ALA A CA  1 
ATOM   868   C  C   . ALA A  1 104 ? -102.201 -50.044  -23.091 1.00 2.23  ? 104 ALA A C   1 
ATOM   869   O  O   . ALA A  1 104 ? -102.184 -48.942  -23.620 1.00 2.00  ? 104 ALA A O   1 
ATOM   870   C  CB  . ALA A  1 104 ? -102.764 -50.211  -20.697 1.00 2.00  ? 104 ALA A CB  1 
ATOM   871   N  N   . ILE A  1 105 ? -101.300 -50.993  -23.359 1.00 2.42  ? 105 ILE A N   1 
ATOM   872   C  CA  . ILE A  1 105 ? -100.201 -50.810  -24.314 1.00 2.28  ? 105 ILE A CA  1 
ATOM   873   C  C   . ILE A  1 105 ? -100.717 -50.493  -25.716 1.00 2.25  ? 105 ILE A C   1 
ATOM   874   O  O   . ILE A  1 105 ? -100.224 -49.583  -26.387 1.00 2.00  ? 105 ILE A O   1 
ATOM   875   C  CB  . ILE A  1 105 ? -99.242  -52.026  -24.312 1.00 2.00  ? 105 ILE A CB  1 
ATOM   876   C  CG1 . ILE A  1 105 ? -98.421  -52.017  -23.027 1.00 2.01  ? 105 ILE A CG1 1 
ATOM   877   C  CG2 . ILE A  1 105 ? -98.270  -51.961  -25.462 1.00 2.54  ? 105 ILE A CG2 1 
ATOM   878   C  CD1 . ILE A  1 105 ? -97.813  -53.303  -22.690 1.00 2.00  ? 105 ILE A CD1 1 
ATOM   879   N  N   . GLY A  1 106 ? -101.719 -51.254  -26.142 1.00 2.21  ? 106 GLY A N   1 
ATOM   880   C  CA  . GLY A  1 106 ? -102.299 -51.087  -27.462 1.00 2.05  ? 106 GLY A CA  1 
ATOM   881   C  C   . GLY A  1 106 ? -102.948 -49.734  -27.575 1.00 2.40  ? 106 GLY A C   1 
ATOM   882   O  O   . GLY A  1 106 ? -102.837 -49.075  -28.624 1.00 3.03  ? 106 GLY A O   1 
ATOM   883   N  N   . TYR A  1 107 ? -103.604 -49.300  -26.493 1.00 2.00  ? 107 TYR A N   1 
ATOM   884   C  CA  . TYR A  1 107 ? -104.301 -48.041  -26.526 1.00 2.00  ? 107 TYR A CA  1 
ATOM   885   C  C   . TYR A  1 107 ? -103.341 -46.836  -26.510 1.00 2.68  ? 107 TYR A C   1 
ATOM   886   O  O   . TYR A  1 107 ? -103.535 -45.854  -27.250 1.00 2.66  ? 107 TYR A O   1 
ATOM   887   C  CB  . TYR A  1 107 ? -105.335 -47.946  -25.399 1.00 2.25  ? 107 TYR A CB  1 
ATOM   888   C  CG  . TYR A  1 107 ? -105.975 -46.579  -25.379 1.00 2.11  ? 107 TYR A CG  1 
ATOM   889   C  CD1 . TYR A  1 107 ? -106.996 -46.254  -26.260 1.00 2.00  ? 107 TYR A CD1 1 
ATOM   890   C  CD2 . TYR A  1 107 ? -105.472 -45.598  -24.570 1.00 2.00  ? 107 TYR A CD2 1 
ATOM   891   C  CE1 . TYR A  1 107 ? -107.528 -45.001  -26.292 1.00 2.14  ? 107 TYR A CE1 1 
ATOM   892   C  CE2 . TYR A  1 107 ? -105.993 -44.332  -24.583 1.00 3.55  ? 107 TYR A CE2 1 
ATOM   893   C  CZ  . TYR A  1 107 ? -107.025 -44.030  -25.446 1.00 3.73  ? 107 TYR A CZ  1 
ATOM   894   O  OH  . TYR A  1 107 ? -107.522 -42.757  -25.420 1.00 4.40  ? 107 TYR A OH  1 
ATOM   895   N  N   . ALA A  1 108 ? -102.301 -46.914  -25.680 1.00 2.82  ? 108 ALA A N   1 
ATOM   896   C  CA  . ALA A  1 108 ? -101.260 -45.878  -25.643 1.00 2.70  ? 108 ALA A CA  1 
ATOM   897   C  C   . ALA A  1 108 ? -100.638 -45.636  -27.029 1.00 2.92  ? 108 ALA A C   1 
ATOM   898   O  O   . ALA A  1 108 ? -100.389 -44.476  -27.414 1.00 2.70  ? 108 ALA A O   1 
ATOM   899   C  CB  . ALA A  1 108 ? -100.200 -46.209  -24.597 1.00 2.02  ? 108 ALA A CB  1 
ATOM   900   N  N   . ASP A  1 109 ? -100.432 -46.725  -27.776 1.00 2.96  ? 109 ASP A N   1 
ATOM   901   C  CA  . ASP A  1 109 ? -99.917  -46.645  -29.138 1.00 3.27  ? 109 ASP A CA  1 
ATOM   902   C  C   . ASP A  1 109 ? -100.889 -45.897  -30.015 1.00 3.33  ? 109 ASP A C   1 
ATOM   903   O  O   . ASP A  1 109 ? -100.494 -45.123  -30.875 1.00 2.68  ? 109 ASP A O   1 
ATOM   904   C  CB  . ASP A  1 109 ? -99.690  -48.026  -29.710 1.00 3.43  ? 109 ASP A CB  1 
ATOM   905   C  CG  . ASP A  1 109 ? -98.912  -48.001  -30.983 1.00 5.62  ? 109 ASP A CG  1 
ATOM   906   O  OD1 . ASP A  1 109 ? -99.543  -48.001  -32.069 1.00 8.71  ? 109 ASP A OD1 1 
ATOM   907   O  OD2 . ASP A  1 109 ? -97.650  -47.982  -30.919 1.00 8.53  ? 109 ASP A OD2 1 
ATOM   908   N  N   . SER A  1 110 ? -102.172 -46.110  -29.806 1.00 3.72  ? 110 SER A N   1 
ATOM   909   C  CA  . SER A  1 110 ? -103.090 -45.540  -30.763 1.00 4.46  ? 110 SER A CA  1 
ATOM   910   C  C   . SER A  1 110 ? -103.343 -44.068  -30.531 1.00 3.82  ? 110 SER A C   1 
ATOM   911   O  O   . SER A  1 110 ? -103.682 -43.360  -31.477 1.00 4.02  ? 110 SER A O   1 
ATOM   912   C  CB  . SER A  1 110 ? -104.365 -46.357  -30.873 1.00 4.70  ? 110 SER A CB  1 
ATOM   913   O  OG  . SER A  1 110 ? -105.003 -46.370  -29.616 1.00 10.39 ? 110 SER A OG  1 
ATOM   914   N  N   . VAL A  1 111 ? -103.112 -43.595  -29.311 1.00 3.47  ? 111 VAL A N   1 
ATOM   915   C  CA  . VAL A  1 111 ? -103.110 -42.124  -29.046 1.00 2.89  ? 111 VAL A CA  1 
ATOM   916   C  C   . VAL A  1 111 ? -101.707 -41.525  -29.043 1.00 2.81  ? 111 VAL A C   1 
ATOM   917   O  O   . VAL A  1 111 ? -101.533 -40.379  -28.645 1.00 2.01  ? 111 VAL A O   1 
ATOM   918   C  CB  . VAL A  1 111 ? -103.810 -41.720  -27.727 1.00 2.91  ? 111 VAL A CB  1 
ATOM   919   C  CG1 . VAL A  1 111 ? -105.277 -41.965  -27.800 1.00 3.07  ? 111 VAL A CG1 1 
ATOM   920   C  CG2 . VAL A  1 111 ? -103.201 -42.474  -26.537 1.00 3.50  ? 111 VAL A CG2 1 
ATOM   921   N  N   . HIS A  1 112 ? -100.707 -42.299  -29.477 1.00 3.26  ? 112 HIS A N   1 
ATOM   922   C  CA  . HIS A  1 112 ? -99.338  -41.764  -29.638 1.00 3.80  ? 112 HIS A CA  1 
ATOM   923   C  C   . HIS A  1 112 ? -98.586  -41.465  -28.336 1.00 3.48  ? 112 HIS A C   1 
ATOM   924   O  O   . HIS A  1 112 ? -97.604  -40.747  -28.373 1.00 4.05  ? 112 HIS A O   1 
ATOM   925   C  CB  . HIS A  1 112 ? -99.326  -40.540  -30.581 1.00 3.87  ? 112 HIS A CB  1 
ATOM   926   C  CG  . HIS A  1 112 ? -99.828  -40.854  -31.959 1.00 8.24  ? 112 HIS A CG  1 
ATOM   927   N  ND1 . HIS A  1 112 ? -101.154 -40.708  -32.327 1.00 12.07 ? 112 HIS A ND1 1 
ATOM   928   C  CD2 . HIS A  1 112 ? -99.191  -41.372  -33.042 1.00 11.31 ? 112 HIS A CD2 1 
ATOM   929   C  CE1 . HIS A  1 112 ? -101.309 -41.114  -33.576 1.00 12.93 ? 112 HIS A CE1 1 
ATOM   930   N  NE2 . HIS A  1 112 ? -100.133 -41.516  -34.036 1.00 12.53 ? 112 HIS A NE2 1 
ATOM   931   N  N   . ASP A  1 113 ? -99.029  -42.021  -27.205 1.00 3.03  ? 113 ASP A N   1 
ATOM   932   C  CA  . ASP A  1 113 ? -98.296  -41.892  -25.943 1.00 2.50  ? 113 ASP A CA  1 
ATOM   933   C  C   . ASP A  1 113 ? -97.226  -42.984  -25.886 1.00 2.14  ? 113 ASP A C   1 
ATOM   934   O  O   . ASP A  1 113 ? -97.293  -43.925  -25.109 1.00 2.03  ? 113 ASP A O   1 
ATOM   935   C  CB  . ASP A  1 113 ? -99.218  -41.941  -24.725 1.00 2.56  ? 113 ASP A CB  1 
ATOM   936   C  CG  . ASP A  1 113 ? -98.503  -41.550  -23.417 1.00 3.37  ? 113 ASP A CG  1 
ATOM   937   O  OD1 . ASP A  1 113 ? -97.256  -41.387  -23.384 1.00 3.52  ? 113 ASP A OD1 1 
ATOM   938   O  OD2 . ASP A  1 113 ? -99.199  -41.413  -22.391 1.00 3.82  ? 113 ASP A OD2 1 
ATOM   939   N  N   . TYR A  1 114 ? -96.222  -42.813  -26.728 1.00 2.00  ? 114 TYR A N   1 
ATOM   940   C  CA  . TYR A  1 114 ? -95.186  -43.768  -26.907 1.00 2.21  ? 114 TYR A CA  1 
ATOM   941   C  C   . TYR A  1 114 ? -94.310  -43.958  -25.672 1.00 2.56  ? 114 TYR A C   1 
ATOM   942   O  O   . TYR A  1 114 ? -93.813  -45.066  -25.432 1.00 2.01  ? 114 TYR A O   1 
ATOM   943   C  CB  . TYR A  1 114 ? -94.389  -43.413  -28.135 1.00 2.00  ? 114 TYR A CB  1 
ATOM   944   C  CG  . TYR A  1 114 ? -95.239  -43.504  -29.389 1.00 2.49  ? 114 TYR A CG  1 
ATOM   945   C  CD1 . TYR A  1 114 ? -95.850  -44.708  -29.767 1.00 2.00  ? 114 TYR A CD1 1 
ATOM   946   C  CD2 . TYR A  1 114 ? -95.439  -42.383  -30.202 1.00 2.17  ? 114 TYR A CD2 1 
ATOM   947   C  CE1 . TYR A  1 114 ? -96.608  -44.798  -30.900 1.00 2.00  ? 114 TYR A CE1 1 
ATOM   948   C  CE2 . TYR A  1 114 ? -96.220  -42.470  -31.357 1.00 2.06  ? 114 TYR A CE2 1 
ATOM   949   C  CZ  . TYR A  1 114 ? -96.793  -43.674  -31.701 1.00 2.00  ? 114 TYR A CZ  1 
ATOM   950   O  OH  . TYR A  1 114 ? -97.560  -43.738  -32.829 1.00 2.00  ? 114 TYR A OH  1 
ATOM   951   N  N   . VAL A  1 115 ? -94.136  -42.917  -24.853 1.00 2.64  ? 115 VAL A N   1 
ATOM   952   C  CA  . VAL A  1 115 ? -93.353  -43.159  -23.659 1.00 2.54  ? 115 VAL A CA  1 
ATOM   953   C  C   . VAL A  1 115 ? -94.084  -43.890  -22.559 1.00 2.91  ? 115 VAL A C   1 
ATOM   954   O  O   . VAL A  1 115 ? -93.520  -44.800  -21.961 1.00 3.43  ? 115 VAL A O   1 
ATOM   955   C  CB  . VAL A  1 115 ? -92.352  -42.053  -23.274 1.00 2.31  ? 115 VAL A CB  1 
ATOM   956   C  CG1 . VAL A  1 115 ? -92.417  -40.919  -24.216 1.00 2.92  ? 115 VAL A CG1 1 
ATOM   957   C  CG2 . VAL A  1 115 ? -92.400  -41.674  -21.807 1.00 2.00  ? 115 VAL A CG2 1 
ATOM   958   N  N   . SER A  1 116 ? -95.350  -43.575  -22.331 1.00 2.76  ? 116 SER A N   1 
ATOM   959   C  CA  . SER A  1 116 ? -96.156  -44.447  -21.488 1.00 2.46  ? 116 SER A CA  1 
ATOM   960   C  C   . SER A  1 116 ? -96.108  -45.885  -22.003 1.00 2.76  ? 116 SER A C   1 
ATOM   961   O  O   . SER A  1 116 ? -95.943  -46.807  -21.212 1.00 3.12  ? 116 SER A O   1 
ATOM   962   C  CB  . SER A  1 116 ? -97.581  -43.974  -21.365 1.00 2.01  ? 116 SER A CB  1 
ATOM   963   O  OG  . SER A  1 116 ? -97.629  -42.720  -20.721 1.00 2.03  ? 116 SER A OG  1 
ATOM   964   N  N   . ARG A  1 117 ? -96.215  -46.089  -23.318 1.00 2.54  ? 117 ARG A N   1 
ATOM   965   C  CA  . ARG A  1 117 ? -96.211  -47.426  -23.854 1.00 2.18  ? 117 ARG A CA  1 
ATOM   966   C  C   . ARG A  1 117 ? -94.922  -48.135  -23.492 1.00 3.11  ? 117 ARG A C   1 
ATOM   967   O  O   . ARG A  1 117 ? -94.922  -49.300  -23.015 1.00 3.06  ? 117 ARG A O   1 
ATOM   968   C  CB  . ARG A  1 117 ? -96.393  -47.409  -25.344 1.00 2.00  ? 117 ARG A CB  1 
ATOM   969   C  CG  . ARG A  1 117 ? -96.296  -48.776  -25.978 1.00 2.00  ? 117 ARG A CG  1 
ATOM   970   C  CD  . ARG A  1 117 ? -96.804  -48.740  -27.378 1.00 2.00  ? 117 ARG A CD  1 
ATOM   971   N  NE  . ARG A  1 117 ? -96.217  -49.788  -28.218 1.00 2.91  ? 117 ARG A NE  1 
ATOM   972   C  CZ  . ARG A  1 117 ? -96.915  -50.712  -28.878 1.00 2.72  ? 117 ARG A CZ  1 
ATOM   973   N  NH1 . ARG A  1 117 ? -98.256  -50.752  -28.825 1.00 2.00  ? 117 ARG A NH1 1 
ATOM   974   N  NH2 . ARG A  1 117 ? -96.257  -51.581  -29.626 1.00 2.00  ? 117 ARG A NH2 1 
ATOM   975   N  N   . ASP A  1 118 ? -93.814  -47.418  -23.688 1.00 3.54  ? 118 ASP A N   1 
ATOM   976   C  CA  . ASP A  1 118 ? -92.475  -47.942  -23.496 1.00 3.87  ? 118 ASP A CA  1 
ATOM   977   C  C   . ASP A  1 118 ? -92.303  -48.338  -22.040 1.00 3.99  ? 118 ASP A C   1 
ATOM   978   O  O   . ASP A  1 118 ? -91.839  -49.427  -21.744 1.00 5.13  ? 118 ASP A O   1 
ATOM   979   C  CB  . ASP A  1 118 ? -91.473  -46.872  -23.906 1.00 4.80  ? 118 ASP A CB  1 
ATOM   980   C  CG  . ASP A  1 118 ? -90.016  -47.375  -23.915 1.00 7.82  ? 118 ASP A CG  1 
ATOM   981   O  OD1 . ASP A  1 118 ? -89.716  -48.320  -24.687 1.00 11.69 ? 118 ASP A OD1 1 
ATOM   982   O  OD2 . ASP A  1 118 ? -89.157  -46.808  -23.184 1.00 11.13 ? 118 ASP A OD2 1 
ATOM   983   N  N   . MET A  1 119 ? -92.722  -47.484  -21.118 1.00 4.00  ? 119 MET A N   1 
ATOM   984   C  CA  . MET A  1 119 ? -92.706  -47.844  -19.704 1.00 4.18  ? 119 MET A CA  1 
ATOM   985   C  C   . MET A  1 119 ? -93.549  -49.086  -19.419 1.00 3.85  ? 119 MET A C   1 
ATOM   986   O  O   . MET A  1 119 ? -93.119  -49.954  -18.675 1.00 4.56  ? 119 MET A O   1 
ATOM   987   C  CB  . MET A  1 119 ? -93.182  -46.680  -18.850 1.00 4.08  ? 119 MET A CB  1 
ATOM   988   C  CG  . MET A  1 119 ? -93.560  -47.052  -17.431 1.00 4.22  ? 119 MET A CG  1 
ATOM   989   S  SD  . MET A  1 119 ? -94.691  -45.821  -16.745 1.00 5.91  ? 119 MET A SD  1 
ATOM   990   C  CE  . MET A  1 119 ? -93.518  -44.502  -16.510 1.00 9.20  ? 119 MET A CE  1 
ATOM   991   N  N   . MET A  1 120 ? -94.729  -49.186  -20.022 1.00 3.13  ? 120 MET A N   1 
ATOM   992   C  CA  . MET A  1 120 ? -95.582  -50.344  -19.788 1.00 3.24  ? 120 MET A CA  1 
ATOM   993   C  C   . MET A  1 120 ? -95.003  -51.636  -20.326 1.00 3.20  ? 120 MET A C   1 
ATOM   994   O  O   . MET A  1 120 ? -95.186  -52.667  -19.716 1.00 2.73  ? 120 MET A O   1 
ATOM   995   C  CB  . MET A  1 120 ? -96.987  -50.110  -20.338 1.00 2.58  ? 120 MET A CB  1 
ATOM   996   C  CG  . MET A  1 120 ? -97.690  -49.029  -19.598 1.00 2.71  ? 120 MET A CG  1 
ATOM   997   S  SD  . MET A  1 120 ? -99.382  -48.811  -20.068 1.00 5.71  ? 120 MET A SD  1 
ATOM   998   C  CE  . MET A  1 120 ? -99.266  -48.159  -21.722 1.00 2.37  ? 120 MET A CE  1 
ATOM   999   N  N   . ILE A  1 121 ? -94.305  -51.579  -21.471 1.00 3.58  ? 121 ILE A N   1 
ATOM   1000  C  CA  . ILE A  1 121 ? -93.729  -52.787  -22.044 1.00 3.29  ? 121 ILE A CA  1 
ATOM   1001  C  C   . ILE A  1 121 ? -92.634  -53.327  -21.133 1.00 4.01  ? 121 ILE A C   1 
ATOM   1002  O  O   . ILE A  1 121 ? -92.552  -54.536  -20.941 1.00 3.53  ? 121 ILE A O   1 
ATOM   1003  C  CB  . ILE A  1 121 ? -93.190  -52.577  -23.451 1.00 3.15  ? 121 ILE A CB  1 
ATOM   1004  C  CG1 . ILE A  1 121 ? -94.332  -52.468  -24.440 1.00 2.68  ? 121 ILE A CG1 1 
ATOM   1005  C  CG2 . ILE A  1 121 ? -92.373  -53.763  -23.884 1.00 2.00  ? 121 ILE A CG2 1 
ATOM   1006  C  CD1 . ILE A  1 121 ? -93.925  -51.753  -25.744 1.00 2.82  ? 121 ILE A CD1 1 
ATOM   1007  N  N   . GLU A  1 122 ? -91.808  -52.442  -20.557 1.00 4.72  ? 122 GLU A N   1 
ATOM   1008  C  CA  . GLU A  1 122 ? -90.798  -52.910  -19.611 1.00 5.53  ? 122 GLU A CA  1 
ATOM   1009  C  C   . GLU A  1 122 ? -91.446  -53.569  -18.395 1.00 5.39  ? 122 GLU A C   1 
ATOM   1010  O  O   . GLU A  1 122 ? -90.991  -54.632  -17.949 1.00 6.41  ? 122 GLU A O   1 
ATOM   1011  C  CB  . GLU A  1 122 ? -89.786  -51.828  -19.228 1.00 5.84  ? 122 GLU A CB  1 
ATOM   1012  C  CG  . GLU A  1 122 ? -88.814  -51.372  -20.405 1.00 11.59 ? 122 GLU A CG  1 
ATOM   1013  C  CD  . GLU A  1 122 ? -88.141  -52.576  -21.280 1.00 19.43 ? 122 GLU A CD  1 
ATOM   1014  O  OE1 . GLU A  1 122 ? -87.136  -53.239  -20.779 1.00 20.92 ? 122 GLU A OE1 1 
ATOM   1015  O  OE2 . GLU A  1 122 ? -88.605  -52.822  -22.463 1.00 18.96 ? 122 GLU A OE2 1 
ATOM   1016  N  N   . ILE A  1 123 ? -92.529  -52.988  -17.880 1.00 4.52  ? 123 ILE A N   1 
ATOM   1017  C  CA  . ILE A  1 123 ? -93.209  -53.556  -16.728 1.00 3.57  ? 123 ILE A CA  1 
ATOM   1018  C  C   . ILE A  1 123 ? -93.754  -54.955  -17.079 1.00 4.08  ? 123 ILE A C   1 
ATOM   1019  O  O   . ILE A  1 123 ? -93.553  -55.927  -16.310 1.00 3.90  ? 123 ILE A O   1 
ATOM   1020  C  CB  . ILE A  1 123 ? -94.272  -52.589  -16.189 1.00 3.54  ? 123 ILE A CB  1 
ATOM   1021  C  CG1 . ILE A  1 123 ? -93.582  -51.418  -15.495 1.00 2.43  ? 123 ILE A CG1 1 
ATOM   1022  C  CG2 . ILE A  1 123 ? -95.294  -53.300  -15.240 1.00 2.49  ? 123 ILE A CG2 1 
ATOM   1023  C  CD1 . ILE A  1 123 ? -94.456  -50.247  -15.256 1.00 2.00  ? 123 ILE A CD1 1 
ATOM   1024  N  N   . LEU A  1 124 ? -94.386  -55.073  -18.254 1.00 3.95  ? 124 LEU A N   1 
ATOM   1025  C  CA  . LEU A  1 124 ? -94.966  -56.340  -18.709 1.00 3.96  ? 124 LEU A CA  1 
ATOM   1026  C  C   . LEU A  1 124 ? -93.884  -57.421  -18.788 1.00 4.55  ? 124 LEU A C   1 
ATOM   1027  O  O   . LEU A  1 124 ? -94.123  -58.575  -18.428 1.00 4.89  ? 124 LEU A O   1 
ATOM   1028  C  CB  . LEU A  1 124 ? -95.671  -56.174  -20.053 1.00 3.41  ? 124 LEU A CB  1 
ATOM   1029  C  CG  . LEU A  1 124 ? -96.288  -57.414  -20.701 1.00 2.97  ? 124 LEU A CG  1 
ATOM   1030  C  CD1 . LEU A  1 124 ? -97.407  -58.087  -19.886 1.00 2.00  ? 124 LEU A CD1 1 
ATOM   1031  C  CD2 . LEU A  1 124 ? -96.774  -57.019  -22.070 1.00 2.00  ? 124 LEU A CD2 1 
ATOM   1032  N  N   . ARG A  1 125 ? -92.697  -57.027  -19.241 1.00 4.97  ? 125 ARG A N   1 
ATOM   1033  C  CA  . ARG A  1 125 ? -91.554  -57.922  -19.279 1.00 5.52  ? 125 ARG A CA  1 
ATOM   1034  C  C   . ARG A  1 125 ? -91.173  -58.402  -17.866 1.00 5.79  ? 125 ARG A C   1 
ATOM   1035  O  O   . ARG A  1 125 ? -90.847  -59.569  -17.697 1.00 5.59  ? 125 ARG A O   1 
ATOM   1036  C  CB  . ARG A  1 125 ? -90.381  -57.227  -19.953 1.00 5.59  ? 125 ARG A CB  1 
ATOM   1037  C  CG  . ARG A  1 125 ? -89.173  -58.087  -20.095 1.00 7.89  ? 125 ARG A CG  1 
ATOM   1038  C  CD  . ARG A  1 125 ? -88.105  -57.426  -20.948 1.00 12.91 ? 125 ARG A CD  1 
ATOM   1039  N  NE  . ARG A  1 125 ? -86.852  -58.210  -20.880 1.00 19.05 ? 125 ARG A NE  1 
ATOM   1040  C  CZ  . ARG A  1 125 ? -85.644  -57.770  -21.285 1.00 22.48 ? 125 ARG A CZ  1 
ATOM   1041  N  NH1 . ARG A  1 125 ? -85.483  -56.527  -21.802 1.00 21.47 ? 125 ARG A NH1 1 
ATOM   1042  N  NH2 . ARG A  1 125 ? -84.587  -58.580  -21.182 1.00 19.90 ? 125 ARG A NH2 1 
ATOM   1043  N  N   . ASP A  1 126 ? -91.243  -57.522  -16.855 1.00 6.04  ? 126 ASP A N   1 
ATOM   1044  C  CA  . ASP A  1 126 ? -90.981  -57.975  -15.488 1.00 6.53  ? 126 ASP A CA  1 
ATOM   1045  C  C   . ASP A  1 126 ? -92.088  -58.930  -15.024 1.00 6.74  ? 126 ASP A C   1 
ATOM   1046  O  O   . ASP A  1 126 ? -91.813  -59.863  -14.288 1.00 7.36  ? 126 ASP A O   1 
ATOM   1047  C  CB  . ASP A  1 126 ? -90.797  -56.828  -14.471 1.00 6.62  ? 126 ASP A CB  1 
ATOM   1048  C  CG  . ASP A  1 126 ? -89.672  -55.864  -14.840 1.00 9.53  ? 126 ASP A CG  1 
ATOM   1049  O  OD1 . ASP A  1 126 ? -89.685  -54.681  -14.370 1.00 10.12 ? 126 ASP A OD1 1 
ATOM   1050  O  OD2 . ASP A  1 126 ? -88.754  -56.269  -15.599 1.00 13.15 ? 126 ASP A OD2 1 
ATOM   1051  N  N   . GLU A  1 127 ? -93.328  -58.699  -15.460 1.00 6.84  ? 127 GLU A N   1 
ATOM   1052  C  CA  . GLU A  1 127 ? -94.452  -59.505  -14.985 1.00 6.89  ? 127 GLU A CA  1 
ATOM   1053  C  C   . GLU A  1 127 ? -94.373  -60.874  -15.565 1.00 6.00  ? 127 GLU A C   1 
ATOM   1054  O  O   . GLU A  1 127 ? -94.552  -61.861  -14.873 1.00 5.39  ? 127 GLU A O   1 
ATOM   1055  C  CB  . GLU A  1 127 ? -95.808  -58.883  -15.337 1.00 6.97  ? 127 GLU A CB  1 
ATOM   1056  C  CG  . GLU A  1 127 ? -95.987  -57.435  -14.806 1.00 11.06 ? 127 GLU A CG  1 
ATOM   1057  C  CD  . GLU A  1 127 ? -95.980  -57.280  -13.264 1.00 12.28 ? 127 GLU A CD  1 
ATOM   1058  O  OE1 . GLU A  1 127 ? -96.262  -56.167  -12.803 1.00 14.05 ? 127 GLU A OE1 1 
ATOM   1059  O  OE2 . GLU A  1 127 ? -95.726  -58.239  -12.510 1.00 12.85 ? 127 GLU A OE2 1 
ATOM   1060  N  N   . GLU A  1 128 ? -94.110  -60.902  -16.859 1.00 6.05  ? 128 GLU A N   1 
ATOM   1061  C  CA  . GLU A  1 128 ? -93.922  -62.100  -17.619 1.00 5.49  ? 128 GLU A CA  1 
ATOM   1062  C  C   . GLU A  1 128 ? -92.809  -62.944  -16.896 1.00 5.40  ? 128 GLU A C   1 
ATOM   1063  O  O   . GLU A  1 128 ? -92.922  -64.155  -16.754 1.00 5.34  ? 128 GLU A O   1 
ATOM   1064  C  CB  . GLU A  1 128 ? -93.555  -61.642  -19.012 1.00 5.53  ? 128 GLU A CB  1 
ATOM   1065  C  CG  . GLU A  1 128 ? -93.920  -62.530  -20.146 1.00 6.78  ? 128 GLU A CG  1 
ATOM   1066  C  CD  . GLU A  1 128 ? -94.822  -61.866  -21.173 1.00 7.26  ? 128 GLU A CD  1 
ATOM   1067  O  OE1 . GLU A  1 128 ? -95.811  -61.236  -20.782 1.00 9.76  ? 128 GLU A OE1 1 
ATOM   1068  O  OE2 . GLU A  1 128 ? -94.563  -62.011  -22.379 1.00 7.49  ? 128 GLU A OE2 1 
ATOM   1069  N  N   . GLY A  1 129 ? -91.774  -62.286  -16.373 1.00 4.79  ? 129 GLY A N   1 
ATOM   1070  C  CA  . GLY A  1 129 ? -90.761  -62.930  -15.550 1.00 4.12  ? 129 GLY A CA  1 
ATOM   1071  C  C   . GLY A  1 129 ? -91.315  -63.562  -14.278 1.00 5.05  ? 129 GLY A C   1 
ATOM   1072  O  O   . GLY A  1 129 ? -90.977  -64.698  -13.959 1.00 5.10  ? 129 GLY A O   1 
ATOM   1073  N  N   . HIS A  1 130 ? -92.152  -62.841  -13.528 1.00 5.22  ? 130 HIS A N   1 
ATOM   1074  C  CA  . HIS A  1 130 ? -92.799  -63.405  -12.364 1.00 5.80  ? 130 HIS A CA  1 
ATOM   1075  C  C   . HIS A  1 130 ? -93.688  -64.585  -12.741 1.00 5.55  ? 130 HIS A C   1 
ATOM   1076  O  O   . HIS A  1 130 ? -93.679  -65.615  -12.063 1.00 5.63  ? 130 HIS A O   1 
ATOM   1077  C  CB  . HIS A  1 130 ? -93.636  -62.361  -11.646 1.00 6.69  ? 130 HIS A CB  1 
ATOM   1078  C  CG  . HIS A  1 130 ? -92.860  -61.165  -11.171 1.00 10.74 ? 130 HIS A CG  1 
ATOM   1079  N  ND1 . HIS A  1 130 ? -93.469  -59.966  -10.860 1.00 14.41 ? 130 HIS A ND1 1 
ATOM   1080  C  CD2 . HIS A  1 130 ? -91.535  -60.976  -10.960 1.00 11.84 ? 130 HIS A CD2 1 
ATOM   1081  C  CE1 . HIS A  1 130 ? -92.553  -59.097  -10.477 1.00 14.21 ? 130 HIS A CE1 1 
ATOM   1082  N  NE2 . HIS A  1 130 ? -91.375  -59.685  -10.526 1.00 12.89 ? 130 HIS A NE2 1 
ATOM   1083  N  N   . ILE A  1 131 ? -94.454  -64.442  -13.819 1.00 4.98  ? 131 ILE A N   1 
ATOM   1084  C  CA  . ILE A  1 131 ? -95.267  -65.530  -14.330 1.00 4.09  ? 131 ILE A CA  1 
ATOM   1085  C  C   . ILE A  1 131 ? -94.375  -66.775  -14.572 1.00 4.68  ? 131 ILE A C   1 
ATOM   1086  O  O   . ILE A  1 131 ? -94.703  -67.885  -14.149 1.00 4.72  ? 131 ILE A O   1 
ATOM   1087  C  CB  . ILE A  1 131 ? -96.057  -65.105  -15.596 1.00 3.96  ? 131 ILE A CB  1 
ATOM   1088  C  CG1 . ILE A  1 131 ? -97.086  -64.026  -15.222 1.00 3.92  ? 131 ILE A CG1 1 
ATOM   1089  C  CG2 . ILE A  1 131 ? -96.725  -66.298  -16.239 1.00 2.66  ? 131 ILE A CG2 1 
ATOM   1090  C  CD1 . ILE A  1 131 ? -97.767  -63.292  -16.394 1.00 2.04  ? 131 ILE A CD1 1 
ATOM   1091  N  N   . ASP A  1 132 ? -93.233  -66.581  -15.200 1.00 4.28  ? 132 ASP A N   1 
ATOM   1092  C  CA  . ASP A  1 132 ? -92.329  -67.697  -15.426 1.00 4.29  ? 132 ASP A CA  1 
ATOM   1093  C  C   . ASP A  1 132 ? -91.969  -68.390  -14.106 1.00 4.08  ? 132 ASP A C   1 
ATOM   1094  O  O   . ASP A  1 132 ? -92.067  -69.600  -13.969 1.00 4.02  ? 132 ASP A O   1 
ATOM   1095  C  CB  . ASP A  1 132 ? -91.078  -67.191  -16.138 1.00 4.65  ? 132 ASP A CB  1 
ATOM   1096  C  CG  . ASP A  1 132 ? -90.194  -68.303  -16.652 1.00 6.31  ? 132 ASP A CG  1 
ATOM   1097  O  OD1 . ASP A  1 132 ? -90.541  -69.481  -16.525 1.00 4.71  ? 132 ASP A OD1 1 
ATOM   1098  O  OD2 . ASP A  1 132 ? -89.140  -67.974  -17.220 1.00 10.46 ? 132 ASP A OD2 1 
ATOM   1099  N  N   . TRP A  1 133 ? -91.592  -67.603  -13.113 1.00 3.87  ? 133 TRP A N   1 
ATOM   1100  C  CA  . TRP A  1 133 ? -91.145  -68.159  -11.861 1.00 3.77  ? 133 TRP A CA  1 
ATOM   1101  C  C   . TRP A  1 133 ? -92.268  -68.920  -11.162 1.00 3.77  ? 133 TRP A C   1 
ATOM   1102  O  O   . TRP A  1 133 ? -92.059  -70.057  -10.735 1.00 3.99  ? 133 TRP A O   1 
ATOM   1103  C  CB  . TRP A  1 133 ? -90.528  -67.086  -10.955 1.00 3.76  ? 133 TRP A CB  1 
ATOM   1104  C  CG  . TRP A  1 133 ? -90.006  -67.678  -9.697  1.00 4.09  ? 133 TRP A CG  1 
ATOM   1105  C  CD1 . TRP A  1 133 ? -88.792  -68.297  -9.509  1.00 4.07  ? 133 TRP A CD1 1 
ATOM   1106  C  CD2 . TRP A  1 133 ? -90.689  -67.753  -8.449  1.00 4.37  ? 133 TRP A CD2 1 
ATOM   1107  N  NE1 . TRP A  1 133 ? -88.678  -68.731  -8.214  1.00 3.68  ? 133 TRP A NE1 1 
ATOM   1108  C  CE2 . TRP A  1 133 ? -89.824  -68.420  -7.540  1.00 3.87  ? 133 TRP A CE2 1 
ATOM   1109  C  CE3 . TRP A  1 133 ? -91.933  -67.304  -7.998  1.00 4.08  ? 133 TRP A CE3 1 
ATOM   1110  C  CZ2 . TRP A  1 133 ? -90.174  -68.665  -6.216  1.00 4.27  ? 133 TRP A CZ2 1 
ATOM   1111  C  CZ3 . TRP A  1 133 ? -92.286  -67.551  -6.663  1.00 3.85  ? 133 TRP A CZ3 1 
ATOM   1112  C  CH2 . TRP A  1 133 ? -91.413  -68.219  -5.794  1.00 4.47  ? 133 TRP A CH2 1 
ATOM   1113  N  N   . LEU A  1 134 ? -93.447  -68.309  -11.044 1.00 3.39  ? 134 LEU A N   1 
ATOM   1114  C  CA  . LEU A  1 134 ? -94.581  -68.950  -10.391 1.00 2.59  ? 134 LEU A CA  1 
ATOM   1115  C  C   . LEU A  1 134 ? -94.953  -70.260  -11.087 1.00 2.55  ? 134 LEU A C   1 
ATOM   1116  O  O   . LEU A  1 134 ? -95.199  -71.263  -10.425 1.00 2.39  ? 134 LEU A O   1 
ATOM   1117  C  CB  . LEU A  1 134 ? -95.798  -68.048  -10.403 1.00 2.47  ? 134 LEU A CB  1 
ATOM   1118  C  CG  . LEU A  1 134 ? -96.173  -67.027  -9.346  1.00 2.36  ? 134 LEU A CG  1 
ATOM   1119  C  CD1 . LEU A  1 134 ? -95.430  -67.148  -8.073  1.00 2.00  ? 134 LEU A CD1 1 
ATOM   1120  C  CD2 . LEU A  1 134 ? -96.142  -65.605  -9.889  1.00 2.00  ? 134 LEU A CD2 1 
ATOM   1121  N  N   . GLU A  1 135 ? -95.023  -70.253  -12.421 1.00 2.83  ? 135 GLU A N   1 
ATOM   1122  C  CA  . GLU A  1 135 ? -95.380  -71.473  -13.158 1.00 3.39  ? 135 GLU A CA  1 
ATOM   1123  C  C   . GLU A  1 135 ? -94.374  -72.597  -12.852 1.00 3.60  ? 135 GLU A C   1 
ATOM   1124  O  O   . GLU A  1 135 ? -94.745  -73.767  -12.607 1.00 3.96  ? 135 GLU A O   1 
ATOM   1125  C  CB  . GLU A  1 135 ? -95.428  -71.223  -14.656 1.00 2.42  ? 135 GLU A CB  1 
ATOM   1126  C  CG  . GLU A  1 135 ? -96.648  -70.428  -15.093 1.00 3.74  ? 135 GLU A CG  1 
ATOM   1127  C  CD  . GLU A  1 135 ? -96.626  -70.035  -16.595 1.00 5.12  ? 135 GLU A CD  1 
ATOM   1128  O  OE1 . GLU A  1 135 ? -95.554  -70.102  -17.267 1.00 4.31  ? 135 GLU A OE1 1 
ATOM   1129  O  OE2 . GLU A  1 135 ? -97.701  -69.663  -17.102 1.00 6.60  ? 135 GLU A OE2 1 
ATOM   1130  N  N   . THR A  1 136 ? -93.103  -72.233  -12.833 1.00 2.92  ? 136 THR A N   1 
ATOM   1131  C  CA  . THR A  1 136 ? -92.080  -73.208  -12.605 1.00 2.75  ? 136 THR A CA  1 
ATOM   1132  C  C   . THR A  1 136 ? -92.189  -73.803  -11.208 1.00 2.78  ? 136 THR A C   1 
ATOM   1133  O  O   . THR A  1 136 ? -92.122  -75.033  -11.061 1.00 3.16  ? 136 THR A O   1 
ATOM   1134  C  CB  . THR A  1 136 ? -90.720  -72.589  -12.850 1.00 2.96  ? 136 THR A CB  1 
ATOM   1135  O  OG1 . THR A  1 136 ? -90.768  -71.922  -14.105 1.00 2.62  ? 136 THR A OG1 1 
ATOM   1136  C  CG2 . THR A  1 136 ? -89.639  -73.638  -12.884 1.00 2.30  ? 136 THR A CG2 1 
ATOM   1137  N  N   . GLU A  1 137 ? -92.360  -72.949  -10.196 1.00 2.19  ? 137 GLU A N   1 
ATOM   1138  C  CA  . GLU A  1 137 ? -92.548  -73.436  -8.829  1.00 2.39  ? 137 GLU A CA  1 
ATOM   1139  C  C   . GLU A  1 137 ? -93.753  -74.388  -8.759  1.00 2.43  ? 137 GLU A C   1 
ATOM   1140  O  O   . GLU A  1 137 ? -93.646  -75.475  -8.234  1.00 3.15  ? 137 GLU A O   1 
ATOM   1141  C  CB  . GLU A  1 137 ? -92.747  -72.291  -7.856  1.00 2.43  ? 137 GLU A CB  1 
ATOM   1142  C  CG  . GLU A  1 137 ? -91.536  -71.396  -7.639  1.00 4.78  ? 137 GLU A CG  1 
ATOM   1143  C  CD  . GLU A  1 137 ? -90.251  -72.174  -7.314  1.00 8.02  ? 137 GLU A CD  1 
ATOM   1144  O  OE1 . GLU A  1 137 ? -89.296  -72.158  -8.161  1.00 8.96  ? 137 GLU A OE1 1 
ATOM   1145  O  OE2 . GLU A  1 137 ? -90.198  -72.804  -6.224  1.00 9.39  ? 137 GLU A OE2 1 
ATOM   1146  N  N   . LEU A  1 138 ? -94.894  -73.993  -9.297  1.00 2.30  ? 138 LEU A N   1 
ATOM   1147  C  CA  . LEU A  1 138 ? -96.042  -74.855  -9.252  1.00 2.82  ? 138 LEU A CA  1 
ATOM   1148  C  C   . LEU A  1 138 ? -95.800  -76.206  -9.909  1.00 3.76  ? 138 LEU A C   1 
ATOM   1149  O  O   . LEU A  1 138 ? -96.289  -77.217  -9.417  1.00 4.44  ? 138 LEU A O   1 
ATOM   1150  C  CB  . LEU A  1 138 ? -97.246  -74.171  -9.875  1.00 2.56  ? 138 LEU A CB  1 
ATOM   1151  C  CG  . LEU A  1 138 ? -97.798  -73.005  -9.061  1.00 3.01  ? 138 LEU A CG  1 
ATOM   1152  C  CD1 . LEU A  1 138 ? -98.808  -72.306  -9.899  1.00 3.70  ? 138 LEU A CD1 1 
ATOM   1153  C  CD2 . LEU A  1 138 ? -98.437  -73.476  -7.756  1.00 2.81  ? 138 LEU A CD2 1 
ATOM   1154  N  N   . ASP A  1 139 ? -95.055  -76.233  -11.007 1.00 3.97  ? 139 ASP A N   1 
ATOM   1155  C  CA  . ASP A  1 139 ? -94.750  -77.500  -11.656 1.00 4.63  ? 139 ASP A CA  1 
ATOM   1156  C  C   . ASP A  1 139 ? -93.751  -78.309  -10.827 1.00 4.42  ? 139 ASP A C   1 
ATOM   1157  O  O   . ASP A  1 139 ? -93.814  -79.536  -10.781 1.00 4.52  ? 139 ASP A O   1 
ATOM   1158  C  CB  . ASP A  1 139 ? -94.199  -77.315  -13.077 1.00 5.23  ? 139 ASP A CB  1 
ATOM   1159  C  CG  . ASP A  1 139 ? -95.260  -76.859  -14.098 1.00 8.74  ? 139 ASP A CG  1 
ATOM   1160  O  OD1 . ASP A  1 139 ? -96.499  -76.850  -13.826 1.00 10.90 ? 139 ASP A OD1 1 
ATOM   1161  O  OD2 . ASP A  1 139 ? -94.828  -76.508  -15.226 1.00 11.24 ? 139 ASP A OD2 1 
ATOM   1162  N  N   . LEU A  1 140 ? -92.820  -77.641  -10.171 1.00 3.86  ? 140 LEU A N   1 
ATOM   1163  C  CA  . LEU A  1 140 ? -91.875  -78.364  -9.335  1.00 4.26  ? 140 LEU A CA  1 
ATOM   1164  C  C   . LEU A  1 140 ? -92.596  -79.072  -8.222  1.00 4.78  ? 140 LEU A C   1 
ATOM   1165  O  O   . LEU A  1 140 ? -92.231  -80.201  -7.896  1.00 5.78  ? 140 LEU A O   1 
ATOM   1166  C  CB  . LEU A  1 140 ? -90.785  -77.459  -8.741  1.00 3.90  ? 140 LEU A CB  1 
ATOM   1167  C  CG  . LEU A  1 140 ? -89.688  -77.014  -9.728  1.00 3.79  ? 140 LEU A CG  1 
ATOM   1168  C  CD1 . LEU A  1 140 ? -88.832  -75.899  -9.106  1.00 2.01  ? 140 LEU A CD1 1 
ATOM   1169  C  CD2 . LEU A  1 140 ? -88.847  -78.194  -10.194 1.00 2.00  ? 140 LEU A CD2 1 
ATOM   1170  N  N   . ILE A  1 141 ? -93.614  -78.435  -7.644  1.00 4.71  ? 141 ILE A N   1 
ATOM   1171  C  CA  . ILE A  1 141 ? -94.363  -79.046  -6.561  1.00 4.69  ? 141 ILE A CA  1 
ATOM   1172  C  C   . ILE A  1 141 ? -94.960  -80.378  -7.013  1.00 6.36  ? 141 ILE A C   1 
ATOM   1173  O  O   . ILE A  1 141 ? -94.911  -81.359  -6.256  1.00 7.35  ? 141 ILE A O   1 
ATOM   1174  C  CB  . ILE A  1 141 ? -95.480  -78.132  -6.036  1.00 4.84  ? 141 ILE A CB  1 
ATOM   1175  C  CG1 . ILE A  1 141 ? -94.910  -76.863  -5.364  1.00 4.07  ? 141 ILE A CG1 1 
ATOM   1176  C  CG2 . ILE A  1 141 ? -96.392  -78.898  -5.080  1.00 3.52  ? 141 ILE A CG2 1 
ATOM   1177  C  CD1 . ILE A  1 141 ? -96.014  -75.869  -4.932  1.00 3.34  ? 141 ILE A CD1 1 
ATOM   1178  N  N   . GLN A  1 142 ? -95.522  -80.435  -8.232  1.00 7.40  ? 142 GLN A N   1 
ATOM   1179  C  CA  . GLN A  1 142 ? -96.088  -81.690  -8.739  1.00 8.52  ? 142 GLN A CA  1 
ATOM   1180  C  C   . GLN A  1 142 ? -94.987  -82.691  -9.060  1.00 8.12  ? 142 GLN A C   1 
ATOM   1181  O  O   . GLN A  1 142 ? -95.153  -83.884  -8.806  1.00 8.41  ? 142 GLN A O   1 
ATOM   1182  C  CB  . GLN A  1 142 ? -97.000  -81.496  -9.968  1.00 9.09  ? 142 GLN A CB  1 
ATOM   1183  C  CG  . GLN A  1 142 ? -98.217  -80.574  -9.719  1.00 13.48 ? 142 GLN A CG  1 
ATOM   1184  C  CD  . GLN A  1 142 ? -99.201  -81.094  -8.614  1.00 19.50 ? 142 GLN A CD  1 
ATOM   1185  O  OE1 . GLN A  1 142 ? -99.955  -82.099  -8.821  1.00 19.85 ? 142 GLN A OE1 1 
ATOM   1186  N  NE2 . GLN A  1 142 ? -99.209  -80.388  -7.445  1.00 18.90 ? 142 GLN A NE2 1 
ATOM   1187  N  N   . LYS A  1 143 ? -93.870  -82.221  -9.608  1.00 7.64  ? 143 LYS A N   1 
ATOM   1188  C  CA  . LYS A  1 143 ? -92.864  -83.165  -10.120 1.00 7.75  ? 143 LYS A CA  1 
ATOM   1189  C  C   . LYS A  1 143 ? -92.095  -83.826  -8.989  1.00 7.71  ? 143 LYS A C   1 
ATOM   1190  O  O   . LYS A  1 143 ? -91.837  -85.023  -9.042  1.00 8.43  ? 143 LYS A O   1 
ATOM   1191  C  CB  . LYS A  1 143 ? -91.899  -82.514  -11.102 1.00 7.64  ? 143 LYS A CB  1 
ATOM   1192  C  CG  . LYS A  1 143 ? -92.543  -82.036  -12.391 1.00 9.65  ? 143 LYS A CG  1 
ATOM   1193  C  CD  . LYS A  1 143 ? -91.484  -81.776  -13.488 1.00 13.34 ? 143 LYS A CD  1 
ATOM   1194  C  CE  . LYS A  1 143 ? -92.011  -80.937  -14.666 1.00 13.02 ? 143 LYS A CE  1 
ATOM   1195  N  NZ  . LYS A  1 143 ? -91.340  -79.636  -14.433 1.00 16.84 ? 143 LYS A NZ  1 
ATOM   1196  N  N   . MET A  1 144 ? -91.761  -83.064  -7.950  1.00 7.12  ? 144 MET A N   1 
ATOM   1197  C  CA  . MET A  1 144 ? -90.964  -83.619  -6.847  1.00 6.79  ? 144 MET A CA  1 
ATOM   1198  C  C   . MET A  1 144 ? -91.780  -83.982  -5.610  1.00 5.69  ? 144 MET A C   1 
ATOM   1199  O  O   . MET A  1 144 ? -91.245  -84.647  -4.695  1.00 5.43  ? 144 MET A O   1 
ATOM   1200  C  CB  . MET A  1 144 ? -89.778  -82.724  -6.493  1.00 6.23  ? 144 MET A CB  1 
ATOM   1201  C  CG  . MET A  1 144 ? -90.123  -81.539  -5.658  1.00 6.63  ? 144 MET A CG  1 
ATOM   1202  S  SD  . MET A  1 144 ? -88.704  -80.485  -5.325  1.00 10.11 ? 144 MET A SD  1 
ATOM   1203  C  CE  . MET A  1 144 ? -88.312  -79.980  -6.992  1.00 10.37 ? 144 MET A CE  1 
ATOM   1204  N  N   . GLY A  1 145 ? -93.069  -83.577  -5.610  1.00 4.51  ? 145 GLY A N   1 
ATOM   1205  C  CA  . GLY A  1 145 ? -93.987  -83.805  -4.484  1.00 3.25  ? 145 GLY A CA  1 
ATOM   1206  C  C   . GLY A  1 145 ? -93.898  -82.709  -3.445  1.00 3.26  ? 145 GLY A C   1 
ATOM   1207  O  O   . GLY A  1 145 ? -92.871  -82.023  -3.336  1.00 3.31  ? 145 GLY A O   1 
ATOM   1208  N  N   . LEU A  1 146 ? -94.959  -82.522  -2.663  1.00 3.10  ? 146 LEU A N   1 
ATOM   1209  C  CA  . LEU A  1 146 ? -94.999  -81.400  -1.730  1.00 2.61  ? 146 LEU A CA  1 
ATOM   1210  C  C   . LEU A  1 146 ? -93.921  -81.461  -0.614  1.00 2.78  ? 146 LEU A C   1 
ATOM   1211  O  O   . LEU A  1 146 ? -93.226  -80.477  -0.360  1.00 3.05  ? 146 LEU A O   1 
ATOM   1212  C  CB  . LEU A  1 146 ? -96.402  -81.237  -1.165  1.00 3.01  ? 146 LEU A CB  1 
ATOM   1213  C  CG  . LEU A  1 146 ? -96.643  -80.059  -0.208  1.00 3.67  ? 146 LEU A CG  1 
ATOM   1214  C  CD1 . LEU A  1 146 ? -96.232  -78.709  -0.843  1.00 2.04  ? 146 LEU A CD1 1 
ATOM   1215  C  CD2 . LEU A  1 146 ? -98.075  -80.055  0.337   1.00 2.00  ? 146 LEU A CD2 1 
ATOM   1216  N  N   . GLN A  1 147 ? -93.763  -82.612  0.031   1.00 2.76  ? 147 GLN A N   1 
ATOM   1217  C  CA  . GLN A  1 147 ? -92.762  -82.772  1.071   1.00 2.48  ? 147 GLN A CA  1 
ATOM   1218  C  C   . GLN A  1 147 ? -91.361  -82.403  0.605   1.00 2.82  ? 147 GLN A C   1 
ATOM   1219  O  O   . GLN A  1 147 ? -90.717  -81.592  1.245   1.00 3.32  ? 147 GLN A O   1 
ATOM   1220  C  CB  . GLN A  1 147 ? -92.789  -84.185  1.645   1.00 2.29  ? 147 GLN A CB  1 
ATOM   1221  C  CG  . GLN A  1 147 ? -94.108  -84.510  2.336   1.00 2.02  ? 147 GLN A CG  1 
ATOM   1222  C  CD  . GLN A  1 147 ? -94.067  -85.800  3.126   1.00 2.80  ? 147 GLN A CD  1 
ATOM   1223  O  OE1 . GLN A  1 147 ? -93.513  -86.791  2.689   1.00 3.58  ? 147 GLN A OE1 1 
ATOM   1224  N  NE2 . GLN A  1 147 ? -94.649  -85.779  4.312   1.00 2.25  ? 147 GLN A NE2 1 
ATOM   1225  N  N   . ASN A  1 148 ? -90.884  -82.973  -0.504  1.00 3.18  ? 148 ASN A N   1 
ATOM   1226  C  CA  . ASN A  1 148 ? -89.592  -82.587  -1.065  1.00 3.73  ? 148 ASN A CA  1 
ATOM   1227  C  C   . ASN A  1 148 ? -89.528  -81.101  -1.464  1.00 4.44  ? 148 ASN A C   1 
ATOM   1228  O  O   . ASN A  1 148 ? -88.505  -80.444  -1.335  1.00 5.31  ? 148 ASN A O   1 
ATOM   1229  C  CB  . ASN A  1 148 ? -89.256  -83.420  -2.282  1.00 3.87  ? 148 ASN A CB  1 
ATOM   1230  C  CG  . ASN A  1 148 ? -88.644  -84.758  -1.950  1.00 3.63  ? 148 ASN A CG  1 
ATOM   1231  O  OD1 . ASN A  1 148 ? -88.410  -85.548  -2.836  1.00 5.71  ? 148 ASN A OD1 1 
ATOM   1232  N  ND2 . ASN A  1 148 ? -88.390  -85.021  -0.693  1.00 3.52  ? 148 ASN A ND2 1 
ATOM   1233  N  N   . TYR A  1 149 ? -90.620  -80.559  -1.946  1.00 4.22  ? 149 TYR A N   1 
ATOM   1234  C  CA  . TYR A  1 149 ? -90.583  -79.189  -2.332  1.00 4.70  ? 149 TYR A CA  1 
ATOM   1235  C  C   . TYR A  1 149 ? -90.368  -78.291  -1.133  1.00 4.81  ? 149 TYR A C   1 
ATOM   1236  O  O   . TYR A  1 149 ? -89.583  -77.333  -1.190  1.00 4.41  ? 149 TYR A O   1 
ATOM   1237  C  CB  . TYR A  1 149 ? -91.878  -78.801  -3.034  1.00 5.02  ? 149 TYR A CB  1 
ATOM   1238  C  CG  . TYR A  1 149 ? -91.911  -77.362  -3.441  1.00 5.16  ? 149 TYR A CG  1 
ATOM   1239  C  CD1 . TYR A  1 149 ? -91.280  -76.942  -4.606  1.00 4.34  ? 149 TYR A CD1 1 
ATOM   1240  C  CD2 . TYR A  1 149 ? -92.558  -76.411  -2.649  1.00 5.91  ? 149 TYR A CD2 1 
ATOM   1241  C  CE1 . TYR A  1 149 ? -91.305  -75.586  -4.990  1.00 6.73  ? 149 TYR A CE1 1 
ATOM   1242  C  CE2 . TYR A  1 149 ? -92.604  -75.053  -3.023  1.00 5.67  ? 149 TYR A CE2 1 
ATOM   1243  C  CZ  . TYR A  1 149 ? -91.974  -74.648  -4.196  1.00 5.97  ? 149 TYR A CZ  1 
ATOM   1244  O  OH  . TYR A  1 149 ? -92.007  -73.323  -4.579  1.00 5.20  ? 149 TYR A OH  1 
ATOM   1245  N  N   . LEU A  1 150 ? -91.093  -78.578  -0.059  1.00 5.15  ? 150 LEU A N   1 
ATOM   1246  C  CA  . LEU A  1 150 ? -90.956  -77.799  1.171   1.00 4.78  ? 150 LEU A CA  1 
ATOM   1247  C  C   . LEU A  1 150 ? -89.552  -77.913  1.703   1.00 5.07  ? 150 LEU A C   1 
ATOM   1248  O  O   . LEU A  1 150 ? -88.968  -76.891  2.044   1.00 6.04  ? 150 LEU A O   1 
ATOM   1249  C  CB  . LEU A  1 150 ? -91.942  -78.244  2.219   1.00 4.39  ? 150 LEU A CB  1 
ATOM   1250  C  CG  . LEU A  1 150 ? -93.289  -77.575  2.421   1.00 4.63  ? 150 LEU A CG  1 
ATOM   1251  C  CD1 . LEU A  1 150 ? -93.738  -76.605  1.341   1.00 5.73  ? 150 LEU A CD1 1 
ATOM   1252  C  CD2 . LEU A  1 150 ? -94.318  -78.645  2.673   1.00 4.15  ? 150 LEU A CD2 1 
ATOM   1253  N  N   . GLN A  1 151 ? -88.975  -79.120  1.746   1.00 4.95  ? 151 GLN A N   1 
ATOM   1254  C  CA  . GLN A  1 151 ? -87.609  -79.251  2.295   1.00 4.75  ? 151 GLN A CA  1 
ATOM   1255  C  C   . GLN A  1 151 ? -86.643  -78.362  1.517   1.00 4.74  ? 151 GLN A C   1 
ATOM   1256  O  O   . GLN A  1 151 ? -85.716  -77.788  2.059   1.00 5.05  ? 151 GLN A O   1 
ATOM   1257  C  CB  . GLN A  1 151 ? -87.161  -80.702  2.281   1.00 4.42  ? 151 GLN A CB  1 
ATOM   1258  C  CG  . GLN A  1 151 ? -85.714  -80.920  2.670   1.00 4.14  ? 151 GLN A CG  1 
ATOM   1259  C  CD  . GLN A  1 151 ? -85.215  -82.262  2.198   1.00 4.84  ? 151 GLN A CD  1 
ATOM   1260  O  OE1 . GLN A  1 151 ? -85.873  -82.930  1.434   1.00 8.40  ? 151 GLN A OE1 1 
ATOM   1261  N  NE2 . GLN A  1 151 ? -84.063  -82.658  2.645   1.00 7.26  ? 151 GLN A NE2 1 
ATOM   1262  N  N   . ALA A  1 152 ? -86.892  -78.212  0.237   1.00 4.79  ? 152 ALA A N   1 
ATOM   1263  C  CA  . ALA A  1 152 ? -86.020  -77.433  -0.608  1.00 4.78  ? 152 ALA A CA  1 
ATOM   1264  C  C   . ALA A  1 152 ? -86.153  -75.928  -0.378  1.00 5.30  ? 152 ALA A C   1 
ATOM   1265  O  O   . ALA A  1 152 ? -85.375  -75.171  -0.956  1.00 6.01  ? 152 ALA A O   1 
ATOM   1266  C  CB  . ALA A  1 152 ? -86.301  -77.760  -2.038  1.00 4.78  ? 152 ALA A CB  1 
ATOM   1267  N  N   . GLN A  1 153 ? -87.113  -75.487  0.449   1.00 5.05  ? 153 GLN A N   1 
ATOM   1268  C  CA  . GLN A  1 153 ? -87.307  -74.049  0.716   1.00 5.36  ? 153 GLN A CA  1 
ATOM   1269  C  C   . GLN A  1 153 ? -86.727  -73.590  2.045   1.00 5.81  ? 153 GLN A C   1 
ATOM   1270  O  O   . GLN A  1 153 ? -86.783  -72.424  2.376   1.00 5.73  ? 153 GLN A O   1 
ATOM   1271  C  CB  . GLN A  1 153 ? -88.801  -73.650  0.698   1.00 5.13  ? 153 GLN A CB  1 
ATOM   1272  C  CG  . GLN A  1 153 ? -89.590  -74.120  -0.477  1.00 5.25  ? 153 GLN A CG  1 
ATOM   1273  C  CD  . GLN A  1 153 ? -88.893  -73.897  -1.803  1.00 6.70  ? 153 GLN A CD  1 
ATOM   1274  O  OE1 . GLN A  1 153 ? -88.255  -72.859  -2.052  1.00 6.51  ? 153 GLN A OE1 1 
ATOM   1275  N  NE2 . GLN A  1 153 ? -89.020  -74.899  -2.683  1.00 7.61  ? 153 GLN A NE2 1 
ATOM   1276  N  N   . ILE A  1 154 ? -86.211  -74.522  2.811   1.00 6.72  ? 154 ILE A N   1 
ATOM   1277  C  CA  . ILE A  1 154 ? -85.810  -74.274  4.176   1.00 8.53  ? 154 ILE A CA  1 
ATOM   1278  C  C   . ILE A  1 154 ? -84.571  -73.383  4.274   1.00 9.68  ? 154 ILE A C   1 
ATOM   1279  O  O   . ILE A  1 154 ? -84.431  -72.627  5.224   1.00 10.62 ? 154 ILE A O   1 
ATOM   1280  C  CB  . ILE A  1 154 ? -85.485  -75.590  4.864   1.00 8.66  ? 154 ILE A CB  1 
ATOM   1281  C  CG1 . ILE A  1 154 ? -86.717  -76.215  5.445   1.00 9.48  ? 154 ILE A CG1 1 
ATOM   1282  C  CG2 . ILE A  1 154 ? -84.501  -75.411  6.005   1.00 9.45  ? 154 ILE A CG2 1 
ATOM   1283  C  CD1 . ILE A  1 154 ? -86.299  -77.560  6.124   1.00 11.55 ? 154 ILE A CD1 1 
ATOM   1284  N  N   A ARG A  1 155 ? -83.678  -73.487  3.298   0.70 10.40 ? 155 ARG A N   1 
ATOM   1285  N  N   B ARG A  1 155 ? -83.649  -73.482  3.333   0.30 10.34 ? 155 ARG A N   1 
ATOM   1286  C  CA  A ARG A  1 155 ? -82.434  -72.711  3.290   0.70 11.67 ? 155 ARG A CA  1 
ATOM   1287  C  CA  B ARG A  1 155 ? -82.507  -72.578  3.390   0.30 11.34 ? 155 ARG A CA  1 
ATOM   1288  C  C   A ARG A  1 155 ? -82.451  -71.657  2.177   0.70 12.69 ? 155 ARG A C   1 
ATOM   1289  C  C   B ARG A  1 155 ? -82.454  -71.651  2.203   0.30 12.34 ? 155 ARG A C   1 
ATOM   1290  O  O   A ARG A  1 155 ? -82.969  -71.914  1.078   0.70 13.32 ? 155 ARG A O   1 
ATOM   1291  O  O   B ARG A  1 155 ? -82.879  -72.004  1.094   0.30 12.66 ? 155 ARG A O   1 
ATOM   1292  C  CB  A ARG A  1 155 ? -81.250  -73.658  3.132   0.70 11.20 ? 155 ARG A CB  1 
ATOM   1293  C  CB  B ARG A  1 155 ? -81.189  -73.317  3.562   0.30 11.13 ? 155 ARG A CB  1 
ATOM   1294  C  CG  A ARG A  1 155 ? -81.150  -74.724  4.273   0.70 11.76 ? 155 ARG A CG  1 
ATOM   1295  C  CG  B ARG A  1 155 ? -81.127  -74.665  2.890   0.30 11.36 ? 155 ARG A CG  1 
ATOM   1296  C  CD  A ARG A  1 155 ? -80.138  -75.826  3.905   0.70 12.71 ? 155 ARG A CD  1 
ATOM   1297  C  CD  B ARG A  1 155 ? -79.711  -75.206  2.945   0.30 12.15 ? 155 ARG A CD  1 
ATOM   1298  N  NE  A ARG A  1 155 ? -79.787  -76.745  5.002   0.70 14.27 ? 155 ARG A NE  1 
ATOM   1299  N  NE  B ARG A  1 155 ? -78.873  -74.597  1.918   0.30 13.24 ? 155 ARG A NE  1 
ATOM   1300  C  CZ  A ARG A  1 155 ? -78.672  -76.655  5.746   0.70 14.74 ? 155 ARG A CZ  1 
ATOM   1301  C  CZ  B ARG A  1 155 ? -77.553  -74.721  1.846   0.30 13.42 ? 155 ARG A CZ  1 
ATOM   1302  N  NH1 A ARG A  1 155 ? -77.783  -75.672  5.562   0.70 13.78 ? 155 ARG A NH1 1 
ATOM   1303  N  NH1 B ARG A  1 155 ? -76.890  -75.439  2.746   0.30 13.11 ? 155 ARG A NH1 1 
ATOM   1304  N  NH2 A ARG A  1 155 ? -78.449  -77.554  6.700   0.70 13.92 ? 155 ARG A NH2 1 
ATOM   1305  N  NH2 B ARG A  1 155 ? -76.894  -74.128  0.863   0.30 12.58 ? 155 ARG A NH2 1 
ATOM   1306  N  N   . GLU A  1 156 ? -81.935  -70.453  2.444   1.00 13.51 ? 156 GLU A N   1 
ATOM   1307  C  CA  . GLU A  1 156 ? -81.965  -69.413  1.419   1.00 14.98 ? 156 GLU A CA  1 
ATOM   1308  C  C   . GLU A  1 156 ? -80.931  -69.699  0.344   1.00 16.90 ? 156 GLU A C   1 
ATOM   1309  O  O   . GLU A  1 156 ? -79.870  -70.299  0.632   1.00 17.54 ? 156 GLU A O   1 
ATOM   1310  C  CB  . GLU A  1 156 ? -81.786  -68.033  1.995   1.00 14.58 ? 156 GLU A CB  1 
ATOM   1311  C  CG  . GLU A  1 156 ? -80.801  -67.914  3.100   1.00 16.06 ? 156 GLU A CG  1 
ATOM   1312  C  CD  . GLU A  1 156 ? -81.122  -66.671  3.950   1.00 21.04 ? 156 GLU A CD  1 
ATOM   1313  O  OE1 . GLU A  1 156 ? -82.224  -66.079  3.718   1.00 20.98 ? 156 GLU A OE1 1 
ATOM   1314  O  OE2 . GLU A  1 156 ? -80.296  -66.300  4.838   1.00 23.03 ? 156 GLU A OE2 1 
ATOM   1315  N  N   . GLU A  1 157 ? -81.245  -69.315  -0.899  1.00 18.94 ? 157 GLU A N   1 
ATOM   1316  C  CA  . GLU A  1 157 ? -80.295  -69.570  -2.006  1.00 20.32 ? 157 GLU A CA  1 
ATOM   1317  C  C   . GLU A  1 157 ? -79.224  -68.462  -2.052  1.00 20.72 ? 157 GLU A C   1 
ATOM   1318  O  O   . GLU A  1 157 ? -79.575  -67.268  -2.118  1.00 20.43 ? 157 GLU A O   1 
ATOM   1319  C  CB  . GLU A  1 157 ? -80.975  -69.809  -3.393  1.00 19.89 ? 157 GLU A CB  1 
ATOM   1320  C  CG  . GLU A  1 157 ? -80.114  -70.801  -4.289  1.00 20.89 ? 157 GLU A CG  1 
ATOM   1321  C  CD  . GLU A  1 157 ? -80.409  -70.731  -5.809  1.00 21.11 ? 157 GLU A CD  1 
ATOM   1322  O  OE1 . GLU A  1 157 ? -81.594  -70.413  -6.178  1.00 20.45 ? 157 GLU A OE1 1 
ATOM   1323  O  OE2 . GLU A  1 157 ? -79.442  -71.010  -6.604  1.00 20.10 ? 157 GLU A OE2 1 
ATOM   1324  N  N   . GLY A  1 158 ? -77.943  -68.878  -1.957  1.00 21.43 ? 158 GLY A N   1 
ATOM   1325  C  CA  . GLY A  1 158 ? -76.783  -67.947  -2.015  1.00 21.83 ? 158 GLY A CA  1 
ATOM   1326  C  C   . GLY A  1 158 ? -76.588  -67.327  -3.413  1.00 21.64 ? 158 GLY A C   1 
ATOM   1327  N  N   . MET B  1 1   ? -97.240  -69.154  18.720  1.00 7.48  ? 1   MET B N   1 
ATOM   1328  C  CA  . MET B  1 1   ? -97.796  -69.036  20.096  1.00 8.48  ? 1   MET B CA  1 
ATOM   1329  C  C   . MET B  1 1   ? -99.158  -68.353  19.988  1.00 8.25  ? 1   MET B C   1 
ATOM   1330  O  O   . MET B  1 1   ? -99.236  -67.305  19.376  1.00 8.27  ? 1   MET B O   1 
ATOM   1331  C  CB  . MET B  1 1   ? -96.830  -68.190  20.897  1.00 7.81  ? 1   MET B CB  1 
ATOM   1332  C  CG  . MET B  1 1   ? -96.943  -68.274  22.378  1.00 7.90  ? 1   MET B CG  1 
ATOM   1333  S  SD  . MET B  1 1   ? -95.607  -67.179  22.966  1.00 10.90 ? 1   MET B SD  1 
ATOM   1334  C  CE  . MET B  1 1   ? -96.384  -65.552  22.893  1.00 5.71  ? 1   MET B CE  1 
ATOM   1335  N  N   . LYS B  1 2   ? -100.229 -68.935  20.534  1.00 9.09  ? 2   LYS B N   1 
ATOM   1336  C  CA  . LYS B  1 2   ? -101.585 -68.330  20.361  1.00 10.64 ? 2   LYS B CA  1 
ATOM   1337  C  C   . LYS B  1 2   ? -101.683 -67.047  21.173  1.00 9.29  ? 2   LYS B C   1 
ATOM   1338  O  O   . LYS B  1 2   ? -101.631 -67.106  22.403  1.00 9.83  ? 2   LYS B O   1 
ATOM   1339  C  CB  . LYS B  1 2   ? -102.699 -69.277  20.832  1.00 10.60 ? 2   LYS B CB  1 
ATOM   1340  C  CG  . LYS B  1 2   ? -103.777 -69.541  19.778  1.00 14.40 ? 2   LYS B CG  1 
ATOM   1341  C  CD  . LYS B  1 2   ? -105.210 -69.792  20.380  1.00 15.10 ? 2   LYS B CD  1 
ATOM   1342  C  CE  . LYS B  1 2   ? -105.884 -68.454  20.814  1.00 19.14 ? 2   LYS B CE  1 
ATOM   1343  N  NZ  . LYS B  1 2   ? -107.373 -68.542  20.885  1.00 19.85 ? 2   LYS B NZ  1 
ATOM   1344  N  N   . GLY B  1 3   ? -101.811 -65.897  20.506  1.00 8.20  ? 3   GLY B N   1 
ATOM   1345  C  CA  . GLY B  1 3   ? -101.891 -64.617  21.204  1.00 6.86  ? 3   GLY B CA  1 
ATOM   1346  C  C   . GLY B  1 3   ? -103.279 -64.270  21.690  1.00 6.23  ? 3   GLY B C   1 
ATOM   1347  O  O   . GLY B  1 3   ? -104.229 -64.970  21.390  1.00 6.57  ? 3   GLY B O   1 
ATOM   1348  N  N   . ASP B  1 4   ? -103.407 -63.168  22.419  1.00 5.87  ? 4   ASP B N   1 
ATOM   1349  C  CA  . ASP B  1 4   ? -104.701 -62.656  22.822  1.00 5.69  ? 4   ASP B CA  1 
ATOM   1350  C  C   . ASP B  1 4   ? -105.402 -62.099  21.581  1.00 5.83  ? 4   ASP B C   1 
ATOM   1351  O  O   . ASP B  1 4   ? -104.801 -61.360  20.814  1.00 6.66  ? 4   ASP B O   1 
ATOM   1352  C  CB  . ASP B  1 4   ? -104.521 -61.611  23.908  1.00 5.45  ? 4   ASP B CB  1 
ATOM   1353  C  CG  . ASP B  1 4   ? -105.807 -60.892  24.261  1.00 6.93  ? 4   ASP B CG  1 
ATOM   1354  O  OD1 . ASP B  1 4   ? -106.098 -59.843  23.618  1.00 9.25  ? 4   ASP B OD1 1 
ATOM   1355  O  OD2 . ASP B  1 4   ? -106.490 -61.343  25.197  1.00 6.88  ? 4   ASP B OD2 1 
ATOM   1356  N  N   . THR B  1 5   ? -106.659 -62.482  21.369  1.00 5.76  ? 5   THR B N   1 
ATOM   1357  C  CA  . THR B  1 5   ? -107.432 -62.068  20.198  1.00 5.85  ? 5   THR B CA  1 
ATOM   1358  C  C   . THR B  1 5   ? -107.536 -60.558  20.039  1.00 5.63  ? 5   THR B C   1 
ATOM   1359  O  O   . THR B  1 5   ? -107.414 -60.014  18.918  1.00 5.78  ? 5   THR B O   1 
ATOM   1360  C  CB  . THR B  1 5   ? -108.870 -62.655  20.257  1.00 6.03  ? 5   THR B CB  1 
ATOM   1361  O  OG1 . THR B  1 5   ? -108.773 -64.075  20.248  1.00 7.12  ? 5   THR B OG1 1 
ATOM   1362  C  CG2 . THR B  1 5   ? -109.731 -62.230  19.028  1.00 5.36  ? 5   THR B CG2 1 
ATOM   1363  N  N   . LYS B  1 6   ? -107.800 -59.876  21.147  1.00 5.14  ? 6   LYS B N   1 
ATOM   1364  C  CA  . LYS B  1 6   ? -108.021 -58.444  21.101  1.00 4.74  ? 6   LYS B CA  1 
ATOM   1365  C  C   . LYS B  1 6   ? -106.672 -57.754  20.782  1.00 4.70  ? 6   LYS B C   1 
ATOM   1366  O  O   . LYS B  1 6   ? -106.653 -56.742  20.070  1.00 4.96  ? 6   LYS B O   1 
ATOM   1367  C  CB  . LYS B  1 6   ? -108.684 -57.961  22.384  1.00 4.13  ? 6   LYS B CB  1 
ATOM   1368  C  CG  . LYS B  1 6   ? -108.867 -56.490  22.448  1.00 6.52  ? 6   LYS B CG  1 
ATOM   1369  C  CD  . LYS B  1 6   ? -110.135 -56.044  23.197  1.00 9.50  ? 6   LYS B CD  1 
ATOM   1370  C  CE  . LYS B  1 6   ? -110.949 -55.055  22.270  1.00 13.26 ? 6   LYS B CE  1 
ATOM   1371  N  NZ  . LYS B  1 6   ? -111.054 -53.647  22.775  1.00 17.04 ? 6   LYS B NZ  1 
ATOM   1372  N  N   . VAL B  1 7   ? -105.553 -58.305  21.269  1.00 3.67  ? 7   VAL B N   1 
ATOM   1373  C  CA  . VAL B  1 7   ? -104.240 -57.754  20.876  1.00 3.12  ? 7   VAL B CA  1 
ATOM   1374  C  C   . VAL B  1 7   ? -104.055 -57.841  19.360  1.00 3.18  ? 7   VAL B C   1 
ATOM   1375  O  O   . VAL B  1 7   ? -103.548 -56.893  18.716  1.00 3.08  ? 7   VAL B O   1 
ATOM   1376  C  CB  . VAL B  1 7   ? -103.053 -58.460  21.568  1.00 3.06  ? 7   VAL B CB  1 
ATOM   1377  C  CG1 . VAL B  1 7   ? -101.736 -58.052  20.925  1.00 2.01  ? 7   VAL B CG1 1 
ATOM   1378  C  CG2 . VAL B  1 7   ? -103.007 -58.121  23.030  1.00 2.47  ? 7   VAL B CG2 1 
ATOM   1379  N  N   . ILE B  1 8   ? -104.440 -58.977  18.783  1.00 2.81  ? 8   ILE B N   1 
ATOM   1380  C  CA  . ILE B  1 8   ? -104.343 -59.151  17.356  1.00 2.55  ? 8   ILE B CA  1 
ATOM   1381  C  C   . ILE B  1 8   ? -105.249 -58.136  16.659  1.00 3.35  ? 8   ILE B C   1 
ATOM   1382  O  O   . ILE B  1 8   ? -104.820 -57.570  15.663  1.00 3.30  ? 8   ILE B O   1 
ATOM   1383  C  CB  . ILE B  1 8   ? -104.652 -60.588  16.942  1.00 2.70  ? 8   ILE B CB  1 
ATOM   1384  C  CG1 . ILE B  1 8   ? -103.551 -61.529  17.419  1.00 3.44  ? 8   ILE B CG1 1 
ATOM   1385  C  CG2 . ILE B  1 8   ? -104.783 -60.708  15.431  1.00 2.63  ? 8   ILE B CG2 1 
ATOM   1386  C  CD1 . ILE B  1 8   ? -103.941 -62.999  17.509  1.00 2.71  ? 8   ILE B CD1 1 
ATOM   1387  N  N   . ASN B  1 9   ? -106.472 -57.896  17.156  1.00 3.95  ? 9   ASN B N   1 
ATOM   1388  C  CA  . ASN B  1 9   ? -107.342 -56.885  16.546  1.00 4.74  ? 9   ASN B CA  1 
ATOM   1389  C  C   . ASN B  1 9   ? -106.656 -55.521  16.556  1.00 4.43  ? 9   ASN B C   1 
ATOM   1390  O  O   . ASN B  1 9   ? -106.701 -54.784  15.565  1.00 4.82  ? 9   ASN B O   1 
ATOM   1391  C  CB  . ASN B  1 9   ? -108.720 -56.769  17.242  1.00 5.79  ? 9   ASN B CB  1 
ATOM   1392  C  CG  . ASN B  1 9   ? -109.654 -57.977  16.965  1.00 10.57 ? 9   ASN B CG  1 
ATOM   1393  O  OD1 . ASN B  1 9   ? -109.724 -58.475  15.853  1.00 19.60 ? 9   ASN B OD1 1 
ATOM   1394  N  ND2 . ASN B  1 9   ? -110.385 -58.427  17.986  1.00 12.20 ? 9   ASN B ND2 1 
ATOM   1395  N  N   . TYR B  1 10  ? -106.021 -55.183  17.676  1.00 3.60  ? 10  TYR B N   1 
ATOM   1396  C  CA  . TYR B  1 10  ? -105.322 -53.934  17.786  1.00 3.20  ? 10  TYR B CA  1 
ATOM   1397  C  C   . TYR B  1 10  ? -104.178 -53.875  16.781  1.00 3.21  ? 10  TYR B C   1 
ATOM   1398  O  O   . TYR B  1 10  ? -104.035 -52.889  16.063  1.00 3.21  ? 10  TYR B O   1 
ATOM   1399  C  CB  . TYR B  1 10  ? -104.774 -53.722  19.190  1.00 3.16  ? 10  TYR B CB  1 
ATOM   1400  C  CG  . TYR B  1 10  ? -105.707 -53.008  20.120  1.00 3.09  ? 10  TYR B CG  1 
ATOM   1401  C  CD1 . TYR B  1 10  ? -106.196 -51.746  19.807  1.00 2.00  ? 10  TYR B CD1 1 
ATOM   1402  C  CD2 . TYR B  1 10  ? -106.091 -53.595  21.324  1.00 2.34  ? 10  TYR B CD2 1 
ATOM   1403  C  CE1 . TYR B  1 10  ? -107.049 -51.086  20.658  1.00 2.62  ? 10  TYR B CE1 1 
ATOM   1404  C  CE2 . TYR B  1 10  ? -106.936 -52.940  22.187  1.00 2.12  ? 10  TYR B CE2 1 
ATOM   1405  C  CZ  . TYR B  1 10  ? -107.414 -51.688  21.854  1.00 3.87  ? 10  TYR B CZ  1 
ATOM   1406  O  OH  . TYR B  1 10  ? -108.250 -51.046  22.712  1.00 4.40  ? 10  TYR B OH  1 
ATOM   1407  N  N   . LEU B  1 11  ? -103.368 -54.935  16.734  1.00 2.67  ? 11  LEU B N   1 
ATOM   1408  C  CA  . LEU B  1 11  ? -102.279 -55.029  15.790  1.00 2.07  ? 11  LEU B CA  1 
ATOM   1409  C  C   . LEU B  1 11  ? -102.781 -54.810  14.359  1.00 2.47  ? 11  LEU B C   1 
ATOM   1410  O  O   . LEU B  1 11  ? -102.166 -54.033  13.592  1.00 2.50  ? 11  LEU B O   1 
ATOM   1411  C  CB  . LEU B  1 11  ? -101.561 -56.344  15.955  1.00 2.00  ? 11  LEU B CB  1 
ATOM   1412  C  CG  . LEU B  1 11  ? -100.282 -56.376  16.798  1.00 2.48  ? 11  LEU B CG  1 
ATOM   1413  C  CD1 . LEU B  1 11  ? -100.180 -55.279  17.823  1.00 2.13  ? 11  LEU B CD1 1 
ATOM   1414  C  CD2 . LEU B  1 11  ? -99.996  -57.740  17.418  1.00 2.00  ? 11  LEU B CD2 1 
ATOM   1415  N  N   . ASN B  1 12  ? -103.911 -55.426  13.984  1.00 2.15  ? 12  ASN B N   1 
ATOM   1416  C  CA  . ASN B  1 12  ? -104.461 -55.222  12.639  1.00 2.02  ? 12  ASN B CA  1 
ATOM   1417  C  C   . ASN B  1 12  ? -104.938 -53.786  12.465  1.00 2.47  ? 12  ASN B C   1 
ATOM   1418  O  O   . ASN B  1 12  ? -104.782 -53.192  11.406  1.00 2.65  ? 12  ASN B O   1 
ATOM   1419  C  CB  . ASN B  1 12  ? -105.580 -56.203  12.328  1.00 2.02  ? 12  ASN B CB  1 
ATOM   1420  C  CG  . ASN B  1 12  ? -105.089 -57.455  11.601  1.00 2.49  ? 12  ASN B CG  1 
ATOM   1421  O  OD1 . ASN B  1 12  ? -104.286 -57.362  10.679  1.00 4.19  ? 12  ASN B OD1 1 
ATOM   1422  N  ND2 . ASN B  1 12  ? -105.574 -58.628  12.009  1.00 2.00  ? 12  ASN B ND2 1 
ATOM   1423  N  N   . LYS B  1 13  ? -105.488 -53.199  13.510  1.00 2.56  ? 13  LYS B N   1 
ATOM   1424  C  CA  . LYS B  1 13  ? -105.948 -51.829  13.389  1.00 3.22  ? 13  LYS B CA  1 
ATOM   1425  C  C   . LYS B  1 13  ? -104.757 -50.880  13.184  1.00 3.59  ? 13  LYS B C   1 
ATOM   1426  O  O   . LYS B  1 13  ? -104.798 -49.999  12.288  1.00 4.29  ? 13  LYS B O   1 
ATOM   1427  C  CB  . LYS B  1 13  ? -106.780 -51.433  14.604  1.00 3.14  ? 13  LYS B CB  1 
ATOM   1428  C  CG  . LYS B  1 13  ? -107.139 -49.993  14.672  1.00 2.86  ? 13  LYS B CG  1 
ATOM   1429  C  CD  . LYS B  1 13  ? -108.389 -49.792  15.496  1.00 5.49  ? 13  LYS B CD  1 
ATOM   1430  C  CE  . LYS B  1 13  ? -108.478 -48.385  15.975  1.00 8.05  ? 13  LYS B CE  1 
ATOM   1431  N  NZ  . LYS B  1 13  ? -109.784 -47.815  15.623  1.00 9.99  ? 13  LYS B NZ  1 
ATOM   1432  N  N   . LEU B  1 14  ? -103.719 -51.069  13.990  1.00 2.99  ? 14  LEU B N   1 
ATOM   1433  C  CA  . LEU B  1 14  ? -102.512 -50.293  13.841  1.00 2.93  ? 14  LEU B CA  1 
ATOM   1434  C  C   . LEU B  1 14  ? -101.899 -50.509  12.439  1.00 3.26  ? 14  LEU B C   1 
ATOM   1435  O  O   . LEU B  1 14  ? -101.521 -49.538  11.768  1.00 2.98  ? 14  LEU B O   1 
ATOM   1436  C  CB  . LEU B  1 14  ? -101.506 -50.623  14.953  1.00 2.48  ? 14  LEU B CB  1 
ATOM   1437  C  CG  . LEU B  1 14  ? -102.039 -50.319  16.350  1.00 2.70  ? 14  LEU B CG  1 
ATOM   1438  C  CD1 . LEU B  1 14  ? -101.034 -50.698  17.391  1.00 3.82  ? 14  LEU B CD1 1 
ATOM   1439  C  CD2 . LEU B  1 14  ? -102.410 -48.893  16.505  1.00 2.00  ? 14  LEU B CD2 1 
ATOM   1440  N  N   . LEU B  1 15  ? -101.847 -51.777  11.990  1.00 3.12  ? 15  LEU B N   1 
ATOM   1441  C  CA  . LEU B  1 15  ? -101.376 -52.102  10.652  1.00 2.27  ? 15  LEU B CA  1 
ATOM   1442  C  C   . LEU B  1 15  ? -102.164 -51.315  9.629   1.00 2.78  ? 15  LEU B C   1 
ATOM   1443  O  O   . LEU B  1 15  ? -101.597 -50.801  8.690   1.00 2.78  ? 15  LEU B O   1 
ATOM   1444  C  CB  . LEU B  1 15  ? -101.515 -53.593  10.392  1.00 2.02  ? 15  LEU B CB  1 
ATOM   1445  C  CG  . LEU B  1 15  ? -101.237 -54.101  8.969   1.00 2.00  ? 15  LEU B CG  1 
ATOM   1446  C  CD1 . LEU B  1 15  ? -99.872  -53.737  8.450   1.00 2.00  ? 15  LEU B CD1 1 
ATOM   1447  C  CD2 . LEU B  1 15  ? -101.434 -55.589  8.897   1.00 2.00  ? 15  LEU B CD2 1 
ATOM   1448  N  N   . GLY B  1 16  ? -103.477 -51.215  9.831   1.00 3.03  ? 16  GLY B N   1 
ATOM   1449  C  CA  . GLY B  1 16  ? -104.340 -50.467  8.956   1.00 3.46  ? 16  GLY B CA  1 
ATOM   1450  C  C   . GLY B  1 16  ? -103.921 -49.005  8.890   1.00 4.59  ? 16  GLY B C   1 
ATOM   1451  O  O   . GLY B  1 16  ? -103.938 -48.396  7.830   1.00 4.34  ? 16  GLY B O   1 
ATOM   1452  N  N   . ASN B  1 17  ? -103.558 -48.436  10.035  1.00 5.37  ? 17  ASN B N   1 
ATOM   1453  C  CA  . ASN B  1 17  ? -103.135 -47.055  10.100  1.00 6.07  ? 17  ASN B CA  1 
ATOM   1454  C  C   . ASN B  1 17  ? -101.873 -46.865  9.274   1.00 7.00  ? 17  ASN B C   1 
ATOM   1455  O  O   . ASN B  1 17  ? -101.788 -45.886  8.515   1.00 7.17  ? 17  ASN B O   1 
ATOM   1456  C  CB  . ASN B  1 17  ? -102.839 -46.616  11.534  1.00 6.02  ? 17  ASN B CB  1 
ATOM   1457  C  CG  . ASN B  1 17  ? -104.075 -46.477  12.391  1.00 6.60  ? 17  ASN B CG  1 
ATOM   1458  O  OD1 . ASN B  1 17  ? -105.187 -46.356  11.898  1.00 5.66  ? 17  ASN B OD1 1 
ATOM   1459  N  ND2 . ASN B  1 17  ? -103.881 -46.472  13.703  1.00 8.91  ? 17  ASN B ND2 1 
ATOM   1460  N  N   . GLU B  1 18  ? -100.893 -47.786  9.426   1.00 7.05  ? 18  GLU B N   1 
ATOM   1461  C  CA  . GLU B  1 18  ? -99.610  -47.657  8.752   1.00 7.60  ? 18  GLU B CA  1 
ATOM   1462  C  C   . GLU B  1 18  ? -99.854  -47.821  7.264   1.00 7.77  ? 18  GLU B C   1 
ATOM   1463  O  O   . GLU B  1 18  ? -99.219  -47.153  6.427   1.00 7.45  ? 18  GLU B O   1 
ATOM   1464  C  CB  . GLU B  1 18  ? -98.584  -48.696  9.206   1.00 7.65  ? 18  GLU B CB  1 
ATOM   1465  C  CG  . GLU B  1 18  ? -98.229  -48.691  10.655  1.00 9.76  ? 18  GLU B CG  1 
ATOM   1466  C  CD  . GLU B  1 18  ? -97.391  -47.494  11.138  1.00 13.55 ? 18  GLU B CD  1 
ATOM   1467  O  OE1 . GLU B  1 18  ? -96.673  -46.826  10.354  1.00 13.00 ? 18  GLU B OE1 1 
ATOM   1468  O  OE2 . GLU B  1 18  ? -97.444  -47.243  12.367  1.00 15.54 ? 18  GLU B OE2 1 
ATOM   1469  N  N   . LEU B  1 19  ? -100.775 -48.707  6.894   1.00 7.46  ? 19  LEU B N   1 
ATOM   1470  C  CA  . LEU B  1 19  ? -100.919 -48.811  5.490   1.00 7.24  ? 19  LEU B CA  1 
ATOM   1471  C  C   . LEU B  1 19  ? -101.601 -47.663  4.772   1.00 6.87  ? 19  LEU B C   1 
ATOM   1472  O  O   . LEU B  1 19  ? -101.229 -47.361  3.643   1.00 7.34  ? 19  LEU B O   1 
ATOM   1473  C  CB  . LEU B  1 19  ? -101.032 -50.208  4.910   1.00 7.64  ? 19  LEU B CB  1 
ATOM   1474  C  CG  . LEU B  1 19  ? -101.866 -51.455  4.936   1.00 8.49  ? 19  LEU B CG  1 
ATOM   1475  C  CD1 . LEU B  1 19  ? -100.764 -52.436  5.044   1.00 7.73  ? 19  LEU B CD1 1 
ATOM   1476  C  CD2 . LEU B  1 19  ? -102.815 -51.672  6.064   1.00 11.88 ? 19  LEU B CD2 1 
ATOM   1477  N  N   . VAL B  1 20  ? -102.489 -46.936  5.444   1.00 6.24  ? 20  VAL B N   1 
ATOM   1478  C  CA  . VAL B  1 20  ? -102.877 -45.662  4.833   1.00 4.56  ? 20  VAL B CA  1 
ATOM   1479  C  C   . VAL B  1 20  ? -101.708 -44.658  4.819   1.00 3.97  ? 20  VAL B C   1 
ATOM   1480  O  O   . VAL B  1 20  ? -101.472 -44.040  3.787   1.00 3.97  ? 20  VAL B O   1 
ATOM   1481  C  CB  . VAL B  1 20  ? -104.303 -45.078  5.218   1.00 4.11  ? 20  VAL B CB  1 
ATOM   1482  C  CG1 . VAL B  1 20  ? -104.967 -45.813  6.279   1.00 3.19  ? 20  VAL B CG1 1 
ATOM   1483  C  CG2 . VAL B  1 20  ? -104.231 -43.593  5.516   1.00 3.05  ? 20  VAL B CG2 1 
ATOM   1484  N  N   . ALA B  1 21  ? -100.946 -44.560  5.910   1.00 2.98  ? 21  ALA B N   1 
ATOM   1485  C  CA  . ALA B  1 21  ? -99.798  -43.641  5.963   1.00 2.40  ? 21  ALA B CA  1 
ATOM   1486  C  C   . ALA B  1 21  ? -98.778  -43.908  4.869   1.00 2.89  ? 21  ALA B C   1 
ATOM   1487  O  O   . ALA B  1 21  ? -98.293  -42.965  4.257   1.00 3.38  ? 21  ALA B O   1 
ATOM   1488  C  CB  . ALA B  1 21  ? -99.147  -43.695  7.287   1.00 2.00  ? 21  ALA B CB  1 
ATOM   1489  N  N   . ILE B  1 22  ? -98.467  -45.189  4.620   1.00 2.93  ? 22  ILE B N   1 
ATOM   1490  C  CA  . ILE B  1 22  ? -97.533  -45.583  3.569   1.00 3.07  ? 22  ILE B CA  1 
ATOM   1491  C  C   . ILE B  1 22  ? -97.906  -44.951  2.234   1.00 3.68  ? 22  ILE B C   1 
ATOM   1492  O  O   . ILE B  1 22  ? -97.067  -44.275  1.601   1.00 4.22  ? 22  ILE B O   1 
ATOM   1493  C  CB  . ILE B  1 22  ? -97.453  -47.131  3.399   1.00 3.80  ? 22  ILE B CB  1 
ATOM   1494  C  CG1 . ILE B  1 22  ? -96.644  -47.753  4.538   1.00 3.23  ? 22  ILE B CG1 1 
ATOM   1495  C  CG2 . ILE B  1 22  ? -96.850  -47.521  2.045   1.00 2.00  ? 22  ILE B CG2 1 
ATOM   1496  C  CD1 . ILE B  1 22  ? -96.872  -49.194  4.642   1.00 2.01  ? 22  ILE B CD1 1 
ATOM   1497  N  N   . ASN B  1 23  ? -99.154  -45.150  1.816   1.00 3.21  ? 23  ASN B N   1 
ATOM   1498  C  CA  . ASN B  1 23  ? -99.631  -44.576  0.578   1.00 3.21  ? 23  ASN B CA  1 
ATOM   1499  C  C   . ASN B  1 23  ? -99.708  -43.049  0.625   1.00 3.59  ? 23  ASN B C   1 
ATOM   1500  O  O   . ASN B  1 23  ? -99.335  -42.366  -0.323  1.00 3.99  ? 23  ASN B O   1 
ATOM   1501  C  CB  . ASN B  1 23  ? -100.998 -45.149  0.231   1.00 3.29  ? 23  ASN B CB  1 
ATOM   1502  C  CG  . ASN B  1 23  ? -100.944 -46.635  -0.112  1.00 4.12  ? 23  ASN B CG  1 
ATOM   1503  O  OD1 . ASN B  1 23  ? -101.952 -47.199  -0.496  1.00 5.88  ? 23  ASN B OD1 1 
ATOM   1504  N  ND2 . ASN B  1 23  ? -99.784  -47.266  0.032   1.00 5.21  ? 23  ASN B ND2 1 
ATOM   1505  N  N   . GLN B  1 24  ? -100.179 -42.494  1.724   1.00 3.49  ? 24  GLN B N   1 
ATOM   1506  C  CA  . GLN B  1 24  ? -100.385 -41.066  1.723   1.00 3.65  ? 24  GLN B CA  1 
ATOM   1507  C  C   . GLN B  1 24  ? -99.010  -40.397  1.652   1.00 3.75  ? 24  GLN B C   1 
ATOM   1508  O  O   . GLN B  1 24  ? -98.803  -39.458  0.879   1.00 4.10  ? 24  GLN B O   1 
ATOM   1509  C  CB  . GLN B  1 24  ? -101.237 -40.608  2.915   1.00 3.61  ? 24  GLN B CB  1 
ATOM   1510  C  CG  . GLN B  1 24  ? -101.468 -39.125  2.965   1.00 4.32  ? 24  GLN B CG  1 
ATOM   1511  C  CD  . GLN B  1 24  ? -102.547 -38.760  3.942   1.00 7.15  ? 24  GLN B CD  1 
ATOM   1512  O  OE1 . GLN B  1 24  ? -103.671 -39.291  3.875   1.00 8.25  ? 24  GLN B OE1 1 
ATOM   1513  N  NE2 . GLN B  1 24  ? -102.227 -37.851  4.867   1.00 6.65  ? 24  GLN B NE2 1 
ATOM   1514  N  N   . TYR B  1 25  ? -98.049  -40.910  2.403   1.00 3.62  ? 25  TYR B N   1 
ATOM   1515  C  CA  . TYR B  1 25  ? -96.708  -40.340  2.365   1.00 4.25  ? 25  TYR B CA  1 
ATOM   1516  C  C   . TYR B  1 25  ? -96.030  -40.476  1.001   1.00 3.87  ? 25  TYR B C   1 
ATOM   1517  O  O   . TYR B  1 25  ? -95.376  -39.551  0.536   1.00 3.51  ? 25  TYR B O   1 
ATOM   1518  C  CB  . TYR B  1 25  ? -95.821  -40.985  3.417   1.00 5.19  ? 25  TYR B CB  1 
ATOM   1519  C  CG  . TYR B  1 25  ? -95.920  -40.374  4.794   1.00 7.10  ? 25  TYR B CG  1 
ATOM   1520  C  CD1 . TYR B  1 25  ? -95.836  -38.978  4.973   1.00 8.18  ? 25  TYR B CD1 1 
ATOM   1521  C  CD2 . TYR B  1 25  ? -96.045  -41.190  5.925   1.00 7.84  ? 25  TYR B CD2 1 
ATOM   1522  C  CE1 . TYR B  1 25  ? -95.903  -38.424  6.230   1.00 8.83  ? 25  TYR B CE1 1 
ATOM   1523  C  CE2 . TYR B  1 25  ? -96.099  -40.643  7.193   1.00 8.81  ? 25  TYR B CE2 1 
ATOM   1524  C  CZ  . TYR B  1 25  ? -96.028  -39.270  7.343   1.00 8.91  ? 25  TYR B CZ  1 
ATOM   1525  O  OH  . TYR B  1 25  ? -96.075  -38.754  8.615   1.00 8.69  ? 25  TYR B OH  1 
ATOM   1526  N  N   . PHE B  1 26  ? -96.190  -41.629  0.356   1.00 3.55  ? 26  PHE B N   1 
ATOM   1527  C  CA  . PHE B  1 26  ? -95.604  -41.851  -0.949  1.00 2.93  ? 26  PHE B CA  1 
ATOM   1528  C  C   . PHE B  1 26  ? -96.170  -40.925  -2.046  1.00 3.00  ? 26  PHE B C   1 
ATOM   1529  O  O   . PHE B  1 26  ? -95.418  -40.350  -2.832  1.00 2.40  ? 26  PHE B O   1 
ATOM   1530  C  CB  . PHE B  1 26  ? -95.763  -43.297  -1.368  1.00 2.66  ? 26  PHE B CB  1 
ATOM   1531  C  CG  . PHE B  1 26  ? -94.738  -43.716  -2.323  1.00 3.01  ? 26  PHE B CG  1 
ATOM   1532  C  CD1 . PHE B  1 26  ? -93.542  -44.222  -1.875  1.00 3.10  ? 26  PHE B CD1 1 
ATOM   1533  C  CD2 . PHE B  1 26  ? -94.929  -43.532  -3.694  1.00 3.56  ? 26  PHE B CD2 1 
ATOM   1534  C  CE1 . PHE B  1 26  ? -92.533  -44.565  -2.769  1.00 3.91  ? 26  PHE B CE1 1 
ATOM   1535  C  CE2 . PHE B  1 26  ? -93.932  -43.873  -4.620  1.00 4.09  ? 26  PHE B CE2 1 
ATOM   1536  C  CZ  . PHE B  1 26  ? -92.729  -44.381  -4.150  1.00 4.38  ? 26  PHE B CZ  1 
ATOM   1537  N  N   . LEU B  1 27  ? -97.497  -40.795  -2.108  1.00 2.83  ? 27  LEU B N   1 
ATOM   1538  C  CA  . LEU B  1 27  ? -98.120  -39.896  -3.053  1.00 2.52  ? 27  LEU B CA  1 
ATOM   1539  C  C   . LEU B  1 27  ? -97.634  -38.478  -2.747  1.00 2.51  ? 27  LEU B C   1 
ATOM   1540  O  O   . LEU B  1 27  ? -97.211  -37.755  -3.664  1.00 2.04  ? 27  LEU B O   1 
ATOM   1541  C  CB  . LEU B  1 27  ? -99.633  -39.962  -2.958  1.00 2.52  ? 27  LEU B CB  1 
ATOM   1542  C  CG  . LEU B  1 27  ? -100.473 -39.777  -4.226  1.00 2.49  ? 27  LEU B CG  1 
ATOM   1543  C  CD1 . LEU B  1 27  ? -101.853 -39.306  -3.900  1.00 2.00  ? 27  LEU B CD1 1 
ATOM   1544  C  CD2 . LEU B  1 27  ? -99.838  -38.908  -5.293  1.00 2.93  ? 27  LEU B CD2 1 
ATOM   1545  N  N   . HIS B  1 28  ? -97.650  -38.082  -1.471  1.00 2.17  ? 28  HIS B N   1 
ATOM   1546  C  CA  . HIS B  1 28  ? -97.180  -36.735  -1.142  1.00 2.40  ? 28  HIS B CA  1 
ATOM   1547  C  C   . HIS B  1 28  ? -95.774  -36.521  -1.636  1.00 2.53  ? 28  HIS B C   1 
ATOM   1548  O  O   . HIS B  1 28  ? -95.501  -35.545  -2.349  1.00 2.82  ? 28  HIS B O   1 
ATOM   1549  C  CB  . HIS B  1 28  ? -97.289  -36.413  0.346   1.00 2.55  ? 28  HIS B CB  1 
ATOM   1550  C  CG  . HIS B  1 28  ? -98.678  -36.120  0.800   1.00 2.58  ? 28  HIS B CG  1 
ATOM   1551  N  ND1 . HIS B  1 28  ? -99.032  -36.091  2.128   1.00 2.43  ? 28  HIS B ND1 1 
ATOM   1552  C  CD2 . HIS B  1 28  ? -99.814  -35.887  0.097   1.00 2.05  ? 28  HIS B CD2 1 
ATOM   1553  C  CE1 . HIS B  1 28  ? -100.326 -35.836  2.226   1.00 3.19  ? 28  HIS B CE1 1 
ATOM   1554  N  NE2 . HIS B  1 28  ? -100.823 -35.703  1.009   1.00 3.29  ? 28  HIS B NE2 1 
ATOM   1555  N  N   . ALA B  1 29  ? -94.907  -37.468  -1.306  1.00 2.31  ? 29  ALA B N   1 
ATOM   1556  C  CA  . ALA B  1 29  ? -93.521  -37.440  -1.772  1.00 2.14  ? 29  ALA B CA  1 
ATOM   1557  C  C   . ALA B  1 29  ? -93.396  -37.160  -3.260  1.00 2.07  ? 29  ALA B C   1 
ATOM   1558  O  O   . ALA B  1 29  ? -92.680  -36.242  -3.645  1.00 2.20  ? 29  ALA B O   1 
ATOM   1559  C  CB  . ALA B  1 29  ? -92.812  -38.712  -1.412  1.00 2.00  ? 29  ALA B CB  1 
ATOM   1560  N  N   . ARG B  1 30  ? -94.088  -37.927  -4.090  1.00 2.09  ? 30  ARG B N   1 
ATOM   1561  C  CA  . ARG B  1 30  ? -93.915  -37.803  -5.536  1.00 2.45  ? 30  ARG B CA  1 
ATOM   1562  C  C   . ARG B  1 30  ? -94.643  -36.567  -6.116  1.00 2.71  ? 30  ARG B C   1 
ATOM   1563  O  O   . ARG B  1 30  ? -94.286  -36.059  -7.187  1.00 2.39  ? 30  ARG B O   1 
ATOM   1564  C  CB  . ARG B  1 30  ? -94.321  -39.073  -6.251  1.00 2.00  ? 30  ARG B CB  1 
ATOM   1565  C  CG  . ARG B  1 30  ? -93.645  -40.264  -5.701  1.00 2.00  ? 30  ARG B CG  1 
ATOM   1566  C  CD  . ARG B  1 30  ? -92.385  -40.619  -6.397  1.00 2.02  ? 30  ARG B CD  1 
ATOM   1567  N  NE  . ARG B  1 30  ? -91.256  -40.419  -5.516  1.00 4.29  ? 30  ARG B NE  1 
ATOM   1568  C  CZ  . ARG B  1 30  ? -90.250  -41.286  -5.317  1.00 2.91  ? 30  ARG B CZ  1 
ATOM   1569  N  NH1 . ARG B  1 30  ? -90.169  -42.450  -5.944  1.00 2.71  ? 30  ARG B NH1 1 
ATOM   1570  N  NH2 . ARG B  1 30  ? -89.305  -40.969  -4.458  1.00 4.04  ? 30  ARG B NH2 1 
ATOM   1571  N  N   . MET B  1 31  ? -95.636  -36.076  -5.373  1.00 2.90  ? 31  MET B N   1 
ATOM   1572  C  CA  . MET B  1 31  ? -96.256  -34.795  -5.691  1.00 2.84  ? 31  MET B CA  1 
ATOM   1573  C  C   . MET B  1 31  ? -95.244  -33.669  -5.477  1.00 2.77  ? 31  MET B C   1 
ATOM   1574  O  O   . MET B  1 31  ? -94.973  -32.881  -6.385  1.00 3.02  ? 31  MET B O   1 
ATOM   1575  C  CB  . MET B  1 31  ? -97.504  -34.585  -4.853  1.00 2.64  ? 31  MET B CB  1 
ATOM   1576  C  CG  . MET B  1 31  ? -98.727  -35.315  -5.361  1.00 2.01  ? 31  MET B CG  1 
ATOM   1577  S  SD  . MET B  1 31  ? -100.146 -35.184  -4.228  1.00 3.53  ? 31  MET B SD  1 
ATOM   1578  C  CE  . MET B  1 31  ? -100.629 -33.459  -4.386  1.00 2.00  ? 31  MET B CE  1 
ATOM   1579  N  N   . PHE B  1 32  ? -94.639  -33.629  -4.294  1.00 2.68  ? 32  PHE B N   1 
ATOM   1580  C  CA  . PHE B  1 32  ? -93.532  -32.718  -4.051  1.00 2.38  ? 32  PHE B CA  1 
ATOM   1581  C  C   . PHE B  1 32  ? -92.425  -32.810  -5.110  1.00 2.47  ? 32  PHE B C   1 
ATOM   1582  O  O   . PHE B  1 32  ? -91.890  -31.793  -5.576  1.00 2.52  ? 32  PHE B O   1 
ATOM   1583  C  CB  . PHE B  1 32  ? -92.964  -32.965  -2.668  1.00 2.42  ? 32  PHE B CB  1 
ATOM   1584  C  CG  . PHE B  1 32  ? -93.912  -32.641  -1.582  1.00 2.73  ? 32  PHE B CG  1 
ATOM   1585  C  CD1 . PHE B  1 32  ? -94.037  -33.486  -0.483  1.00 4.25  ? 32  PHE B CD1 1 
ATOM   1586  C  CD2 . PHE B  1 32  ? -94.710  -31.516  -1.656  1.00 2.40  ? 32  PHE B CD2 1 
ATOM   1587  C  CE1 . PHE B  1 32  ? -94.942  -33.207  0.547   1.00 4.26  ? 32  PHE B CE1 1 
ATOM   1588  C  CE2 . PHE B  1 32  ? -95.605  -31.227  -0.636  1.00 4.97  ? 32  PHE B CE2 1 
ATOM   1589  C  CZ  . PHE B  1 32  ? -95.724  -32.091  0.476   1.00 4.19  ? 32  PHE B CZ  1 
ATOM   1590  N  N   . LYS B  1 33  ? -92.082  -34.038  -5.480  1.00 2.63  ? 33  LYS B N   1 
ATOM   1591  C  CA  . LYS B  1 33  ? -91.036  -34.275  -6.476  1.00 3.00  ? 33  LYS B CA  1 
ATOM   1592  C  C   . LYS B  1 33  ? -91.422  -33.677  -7.818  1.00 3.07  ? 33  LYS B C   1 
ATOM   1593  O  O   . LYS B  1 33  ? -90.635  -32.981  -8.448  1.00 2.67  ? 33  LYS B O   1 
ATOM   1594  C  CB  . LYS B  1 33  ? -90.800  -35.762  -6.633  1.00 3.09  ? 33  LYS B CB  1 
ATOM   1595  C  CG  . LYS B  1 33  ? -89.862  -36.125  -7.723  1.00 4.02  ? 33  LYS B CG  1 
ATOM   1596  C  CD  . LYS B  1 33  ? -89.105  -37.347  -7.271  1.00 8.19  ? 33  LYS B CD  1 
ATOM   1597  C  CE  . LYS B  1 33  ? -88.689  -38.225  -8.432  1.00 10.44 ? 33  LYS B CE  1 
ATOM   1598  N  NZ  . LYS B  1 33  ? -87.286  -37.927  -8.868  1.00 10.80 ? 33  LYS B NZ  1 
ATOM   1599  N  N   . ASN B  1 34  ? -92.654  -33.939  -8.232  1.00 3.05  ? 34  ASN B N   1 
ATOM   1600  C  CA  . ASN B  1 34  ? -93.142  -33.369  -9.446  1.00 3.43  ? 34  ASN B CA  1 
ATOM   1601  C  C   . ASN B  1 34  ? -93.053  -31.857  -9.423  1.00 3.68  ? 34  ASN B C   1 
ATOM   1602  O  O   . ASN B  1 34  ? -92.614  -31.270  -10.412 1.00 4.81  ? 34  ASN B O   1 
ATOM   1603  C  CB  . ASN B  1 34  ? -94.565  -33.811  -9.753  1.00 3.25  ? 34  ASN B CB  1 
ATOM   1604  C  CG  . ASN B  1 34  ? -95.020  -33.321  -11.099 1.00 4.38  ? 34  ASN B CG  1 
ATOM   1605  O  OD1 . ASN B  1 34  ? -95.812  -32.404  -11.179 1.00 7.34  ? 34  ASN B OD1 1 
ATOM   1606  N  ND2 . ASN B  1 34  ? -94.487  -33.900  -12.170 1.00 6.82  ? 34  ASN B ND2 1 
ATOM   1607  N  N   . TRP B  1 35  ? -93.473  -31.238  -8.317  1.00 3.39  ? 35  TRP B N   1 
ATOM   1608  C  CA  . TRP B  1 35  ? -93.389  -29.790  -8.148  1.00 3.19  ? 35  TRP B CA  1 
ATOM   1609  C  C   . TRP B  1 35  ? -91.952  -29.256  -7.990  1.00 3.41  ? 35  TRP B C   1 
ATOM   1610  O  O   . TRP B  1 35  ? -91.755  -28.034  -7.925  1.00 3.50  ? 35  TRP B O   1 
ATOM   1611  C  CB  . TRP B  1 35  ? -94.203  -29.331  -6.947  1.00 2.83  ? 35  TRP B CB  1 
ATOM   1612  C  CG  . TRP B  1 35  ? -95.642  -29.493  -7.123  1.00 3.67  ? 35  TRP B CG  1 
ATOM   1613  C  CD1 . TRP B  1 35  ? -96.325  -29.500  -8.297  1.00 5.34  ? 35  TRP B CD1 1 
ATOM   1614  C  CD2 . TRP B  1 35  ? -96.620  -29.656  -6.091  1.00 4.19  ? 35  TRP B CD2 1 
ATOM   1615  N  NE1 . TRP B  1 35  ? -97.662  -29.657  -8.071  1.00 5.74  ? 35  TRP B NE1 1 
ATOM   1616  C  CE2 . TRP B  1 35  ? -97.878  -29.751  -6.725  1.00 4.66  ? 35  TRP B CE2 1 
ATOM   1617  C  CE3 . TRP B  1 35  ? -96.563  -29.703  -4.685  1.00 2.55  ? 35  TRP B CE3 1 
ATOM   1618  C  CZ2 . TRP B  1 35  ? -99.071  -29.905  -6.006  1.00 4.30  ? 35  TRP B CZ2 1 
ATOM   1619  C  CZ3 . TRP B  1 35  ? -97.737  -29.868  -3.978  1.00 3.80  ? 35  TRP B CZ3 1 
ATOM   1620  C  CH2 . TRP B  1 35  ? -98.974  -29.970  -4.631  1.00 4.13  ? 35  TRP B CH2 1 
ATOM   1621  N  N   . GLY B  1 36  ? -90.957  -30.144  -7.892  1.00 2.87  ? 36  GLY B N   1 
ATOM   1622  C  CA  . GLY B  1 36  ? -89.591  -29.698  -7.827  1.00 2.72  ? 36  GLY B CA  1 
ATOM   1623  C  C   . GLY B  1 36  ? -89.137  -29.386  -6.412  1.00 3.32  ? 36  GLY B C   1 
ATOM   1624  O  O   . GLY B  1 36  ? -88.030  -28.909  -6.202  1.00 3.93  ? 36  GLY B O   1 
ATOM   1625  N  N   . LEU B  1 37  ? -89.991  -29.694  -5.445  1.00 3.38  ? 37  LEU B N   1 
ATOM   1626  C  CA  . LEU B  1 37  ? -89.731  -29.513  -4.009  1.00 2.86  ? 37  LEU B CA  1 
ATOM   1627  C  C   . LEU B  1 37  ? -88.907  -30.714  -3.474  1.00 3.05  ? 37  LEU B C   1 
ATOM   1628  O  O   . LEU B  1 37  ? -89.319  -31.475  -2.598  1.00 3.22  ? 37  LEU B O   1 
ATOM   1629  C  CB  . LEU B  1 37  ? -91.085  -29.352  -3.283  1.00 2.62  ? 37  LEU B CB  1 
ATOM   1630  C  CG  . LEU B  1 37  ? -91.697  -27.939  -3.263  1.00 3.42  ? 37  LEU B CG  1 
ATOM   1631  C  CD1 . LEU B  1 37  ? -91.215  -27.017  -4.354  1.00 2.00  ? 37  LEU B CD1 1 
ATOM   1632  C  CD2 . LEU B  1 37  ? -93.228  -27.954  -3.146  1.00 2.00  ? 37  LEU B CD2 1 
ATOM   1633  N  N   . LYS B  1 38  ? -87.727  -30.853  -4.047  1.00 3.30  ? 38  LYS B N   1 
ATOM   1634  C  CA  . LYS B  1 38  ? -86.827  -32.000  -3.891  1.00 3.68  ? 38  LYS B CA  1 
ATOM   1635  C  C   . LYS B  1 38  ? -86.700  -32.508  -2.431  1.00 3.57  ? 38  LYS B C   1 
ATOM   1636  O  O   . LYS B  1 38  ? -86.647  -33.697  -2.154  1.00 3.39  ? 38  LYS B O   1 
ATOM   1637  C  CB  . LYS B  1 38  ? -85.482  -31.544  -4.456  1.00 3.93  ? 38  LYS B CB  1 
ATOM   1638  C  CG  . LYS B  1 38  ? -84.694  -32.529  -5.305  1.00 8.09  ? 38  LYS B CG  1 
ATOM   1639  C  CD  . LYS B  1 38  ? -84.719  -32.286  -6.835  1.00 10.93 ? 38  LYS B CD  1 
ATOM   1640  C  CE  . LYS B  1 38  ? -84.188  -30.914  -7.264  1.00 13.70 ? 38  LYS B CE  1 
ATOM   1641  N  NZ  . LYS B  1 38  ? -82.736  -30.673  -7.062  1.00 14.01 ? 38  LYS B NZ  1 
ATOM   1642  N  N   . ARG B  1 39  ? -86.710  -31.577  -1.497  1.00 4.33  ? 39  ARG B N   1 
ATOM   1643  C  CA  . ARG B  1 39  ? -86.362  -31.828  -0.109  1.00 4.47  ? 39  ARG B CA  1 
ATOM   1644  C  C   . ARG B  1 39  ? -87.509  -32.466  0.630   1.00 4.26  ? 39  ARG B C   1 
ATOM   1645  O  O   . ARG B  1 39  ? -87.337  -33.308  1.500   1.00 4.81  ? 39  ARG B O   1 
ATOM   1646  C  CB  . ARG B  1 39  ? -86.057  -30.491  0.519   1.00 5.21  ? 39  ARG B CB  1 
ATOM   1647  C  CG  . ARG B  1 39  ? -85.073  -30.504  1.624   1.00 7.86  ? 39  ARG B CG  1 
ATOM   1648  C  CD  . ARG B  1 39  ? -85.815  -30.552  2.943   1.00 14.23 ? 39  ARG B CD  1 
ATOM   1649  N  NE  . ARG B  1 39  ? -85.416  -29.459  3.857   1.00 18.69 ? 39  ARG B NE  1 
ATOM   1650  C  CZ  . ARG B  1 39  ? -86.169  -29.022  4.873   1.00 20.86 ? 39  ARG B CZ  1 
ATOM   1651  N  NH1 . ARG B  1 39  ? -87.386  -29.568  5.129   1.00 16.92 ? 39  ARG B NH1 1 
ATOM   1652  N  NH2 . ARG B  1 39  ? -85.708  -28.015  5.620   1.00 21.71 ? 39  ARG B NH2 1 
ATOM   1653  N  N   . LEU B  1 40  ? -88.704  -32.024  0.304   1.00 3.88  ? 40  LEU B N   1 
ATOM   1654  C  CA  . LEU B  1 40  ? -89.910  -32.564  0.864   1.00 3.21  ? 40  LEU B CA  1 
ATOM   1655  C  C   . LEU B  1 40  ? -90.140  -33.965  0.281   1.00 3.56  ? 40  LEU B C   1 
ATOM   1656  O  O   . LEU B  1 40  ? -90.692  -34.829  0.949   1.00 3.49  ? 40  LEU B O   1 
ATOM   1657  C  CB  . LEU B  1 40  ? -91.063  -31.626  0.488   1.00 3.40  ? 40  LEU B CB  1 
ATOM   1658  C  CG  . LEU B  1 40  ? -91.673  -30.671  1.500   1.00 2.42  ? 40  LEU B CG  1 
ATOM   1659  C  CD1 . LEU B  1 40  ? -90.791  -30.306  2.661   1.00 2.57  ? 40  LEU B CD1 1 
ATOM   1660  C  CD2 . LEU B  1 40  ? -92.161  -29.473  0.769   1.00 2.01  ? 40  LEU B CD2 1 
ATOM   1661  N  N   . ASN B  1 41  ? -89.736  -34.187  -0.973  1.00 3.60  ? 41  ASN B N   1 
ATOM   1662  C  CA  . ASN B  1 41  ? -89.807  -35.511  -1.553  1.00 2.96  ? 41  ASN B CA  1 
ATOM   1663  C  C   . ASN B  1 41  ? -88.871  -36.439  -0.809  1.00 3.19  ? 41  ASN B C   1 
ATOM   1664  O  O   . ASN B  1 41  ? -89.268  -37.543  -0.472  1.00 2.88  ? 41  ASN B O   1 
ATOM   1665  C  CB  . ASN B  1 41  ? -89.453  -35.508  -3.046  1.00 2.69  ? 41  ASN B CB  1 
ATOM   1666  C  CG  . ASN B  1 41  ? -89.146  -36.911  -3.573  1.00 3.35  ? 41  ASN B CG  1 
ATOM   1667  O  OD1 . ASN B  1 41  ? -90.046  -37.713  -3.788  1.00 3.53  ? 41  ASN B OD1 1 
ATOM   1668  N  ND2 . ASN B  1 41  ? -87.869  -37.220  -3.740  1.00 2.00  ? 41  ASN B ND2 1 
ATOM   1669  N  N   . ASP B  1 42  ? -87.630  -36.011  -0.562  1.00 3.83  ? 42  ASP B N   1 
ATOM   1670  C  CA  . ASP B  1 42  ? -86.701  -36.852  0.190   1.00 5.17  ? 42  ASP B CA  1 
ATOM   1671  C  C   . ASP B  1 42  ? -87.269  -37.225  1.561   1.00 5.46  ? 42  ASP B C   1 
ATOM   1672  O  O   . ASP B  1 42  ? -87.303  -38.411  1.927   1.00 5.94  ? 42  ASP B O   1 
ATOM   1673  C  CB  . ASP B  1 42  ? -85.336  -36.212  0.360   1.00 5.40  ? 42  ASP B CB  1 
ATOM   1674  C  CG  . ASP B  1 42  ? -84.594  -36.040  -0.957  1.00 9.95  ? 42  ASP B CG  1 
ATOM   1675  O  OD1 . ASP B  1 42  ? -85.021  -36.597  -2.014  1.00 13.02 ? 42  ASP B OD1 1 
ATOM   1676  O  OD2 . ASP B  1 42  ? -83.559  -35.310  -0.958  1.00 13.63 ? 42  ASP B OD2 1 
ATOM   1677  N  N   . VAL B  1 43  ? -87.747  -36.243  2.321   1.00 5.03  ? 43  VAL B N   1 
ATOM   1678  C  CA  . VAL B  1 43  ? -88.185  -36.571  3.676   1.00 4.92  ? 43  VAL B CA  1 
ATOM   1679  C  C   . VAL B  1 43  ? -89.426  -37.469  3.664   1.00 4.90  ? 43  VAL B C   1 
ATOM   1680  O  O   . VAL B  1 43  ? -89.455  -38.504  4.342   1.00 4.74  ? 43  VAL B O   1 
ATOM   1681  C  CB  . VAL B  1 43  ? -88.379  -35.325  4.558   1.00 4.89  ? 43  VAL B CB  1 
ATOM   1682  C  CG1 . VAL B  1 43  ? -89.108  -35.693  5.865   1.00 5.16  ? 43  VAL B CG1 1 
ATOM   1683  C  CG2 . VAL B  1 43  ? -87.033  -34.689  4.872   1.00 4.12  ? 43  VAL B CG2 1 
ATOM   1684  N  N   . GLU B  1 44  ? -90.430  -37.102  2.873   1.00 4.66  ? 44  GLU B N   1 
ATOM   1685  C  CA  . GLU B  1 44  ? -91.678  -37.861  2.871   1.00 4.90  ? 44  GLU B CA  1 
ATOM   1686  C  C   . GLU B  1 44  ? -91.508  -39.244  2.315   1.00 4.69  ? 44  GLU B C   1 
ATOM   1687  O  O   . GLU B  1 44  ? -92.156  -40.181  2.778   1.00 4.91  ? 44  GLU B O   1 
ATOM   1688  C  CB  . GLU B  1 44  ? -92.786  -37.152  2.133   1.00 4.28  ? 44  GLU B CB  1 
ATOM   1689  C  CG  . GLU B  1 44  ? -93.133  -35.874  2.793   1.00 7.81  ? 44  GLU B CG  1 
ATOM   1690  C  CD  . GLU B  1 44  ? -94.482  -35.875  3.462   1.00 11.31 ? 44  GLU B CD  1 
ATOM   1691  O  OE1 . GLU B  1 44  ? -95.471  -36.355  2.883   1.00 12.45 ? 44  GLU B OE1 1 
ATOM   1692  O  OE2 . GLU B  1 44  ? -94.582  -35.346  4.581   1.00 12.56 ? 44  GLU B OE2 1 
ATOM   1693  N  N   . TYR B  1 45  ? -90.626  -39.392  1.349   1.00 4.64  ? 45  TYR B N   1 
ATOM   1694  C  CA  . TYR B  1 45  ? -90.303  -40.700  0.884   1.00 4.77  ? 45  TYR B CA  1 
ATOM   1695  C  C   . TYR B  1 45  ? -89.745  -41.528  2.023   1.00 5.28  ? 45  TYR B C   1 
ATOM   1696  O  O   . TYR B  1 45  ? -90.197  -42.656  2.243   1.00 5.15  ? 45  TYR B O   1 
ATOM   1697  C  CB  . TYR B  1 45  ? -89.298  -40.616  -0.236  1.00 4.97  ? 45  TYR B CB  1 
ATOM   1698  C  CG  . TYR B  1 45  ? -88.822  -41.946  -0.705  1.00 4.98  ? 45  TYR B CG  1 
ATOM   1699  C  CD1 . TYR B  1 45  ? -89.544  -42.674  -1.627  1.00 5.39  ? 45  TYR B CD1 1 
ATOM   1700  C  CD2 . TYR B  1 45  ? -87.637  -42.478  -0.226  1.00 5.99  ? 45  TYR B CD2 1 
ATOM   1701  C  CE1 . TYR B  1 45  ? -89.101  -43.905  -2.065  1.00 6.98  ? 45  TYR B CE1 1 
ATOM   1702  C  CE2 . TYR B  1 45  ? -87.168  -43.709  -0.648  1.00 6.31  ? 45  TYR B CE2 1 
ATOM   1703  C  CZ  . TYR B  1 45  ? -87.906  -44.422  -1.567  1.00 7.81  ? 45  TYR B CZ  1 
ATOM   1704  O  OH  . TYR B  1 45  ? -87.432  -45.650  -1.999  1.00 8.42  ? 45  TYR B OH  1 
ATOM   1705  N  N   A HIS B  1 46  ? -88.786  -40.974  2.759   0.50 5.71  ? 46  HIS B N   1 
ATOM   1706  N  N   B HIS B  1 46  ? -88.772  -40.977  2.756   0.50 5.73  ? 46  HIS B N   1 
ATOM   1707  C  CA  A HIS B  1 46  ? -88.195  -41.699  3.879   0.50 6.24  ? 46  HIS B CA  1 
ATOM   1708  C  CA  B HIS B  1 46  ? -88.187  -41.667  3.916   0.50 6.32  ? 46  HIS B CA  1 
ATOM   1709  C  C   A HIS B  1 46  ? -89.216  -42.007  4.972   0.50 5.73  ? 46  HIS B C   1 
ATOM   1710  C  C   B HIS B  1 46  ? -89.282  -42.075  4.886   0.50 5.76  ? 46  HIS B C   1 
ATOM   1711  O  O   A HIS B  1 46  ? -89.051  -42.973  5.700   0.50 6.33  ? 46  HIS B O   1 
ATOM   1712  O  O   B HIS B  1 46  ? -89.233  -43.162  5.442   0.50 6.30  ? 46  HIS B O   1 
ATOM   1713  C  CB  A HIS B  1 46  ? -86.943  -41.003  4.417   0.50 6.45  ? 46  HIS B CB  1 
ATOM   1714  C  CB  B HIS B  1 46  ? -87.128  -40.814  4.629   0.50 6.55  ? 46  HIS B CB  1 
ATOM   1715  C  CG  A HIS B  1 46  ? -85.797  -41.011  3.447   0.50 9.87  ? 46  HIS B CG  1 
ATOM   1716  C  CG  B HIS B  1 46  ? -86.480  -41.491  5.807   0.50 10.54 ? 46  HIS B CG  1 
ATOM   1717  N  ND1 A HIS B  1 46  ? -85.151  -42.167  3.062   0.50 11.96 ? 46  HIS B ND1 1 
ATOM   1718  N  ND1 B HIS B  1 46  ? -85.594  -42.544  5.673   0.50 14.27 ? 46  HIS B ND1 1 
ATOM   1719  C  CD2 A HIS B  1 46  ? -85.201  -40.003  2.764   0.50 12.56 ? 46  HIS B CD2 1 
ATOM   1720  C  CD2 B HIS B  1 46  ? -86.573  -41.248  7.140   0.50 12.25 ? 46  HIS B CD2 1 
ATOM   1721  C  CE1 A HIS B  1 46  ? -84.210  -41.870  2.184   0.50 13.13 ? 46  HIS B CE1 1 
ATOM   1722  C  CE1 B HIS B  1 46  ? -85.183  -42.927  6.870   0.50 14.36 ? 46  HIS B CE1 1 
ATOM   1723  N  NE2 A HIS B  1 46  ? -84.220  -40.564  1.984   0.50 13.28 ? 46  HIS B NE2 1 
ATOM   1724  N  NE2 B HIS B  1 46  ? -85.759  -42.154  7.775   0.50 13.53 ? 46  HIS B NE2 1 
ATOM   1725  N  N   . GLU B  1 47  ? -90.287  -41.233  5.058   1.00 5.27  ? 47  GLU B N   1 
ATOM   1726  C  CA  . GLU B  1 47  ? -91.330  -41.559  5.983   1.00 5.22  ? 47  GLU B CA  1 
ATOM   1727  C  C   . GLU B  1 47  ? -92.232  -42.645  5.523   1.00 4.51  ? 47  GLU B C   1 
ATOM   1728  O  O   . GLU B  1 47  ? -92.658  -43.435  6.332   1.00 4.08  ? 47  GLU B O   1 
ATOM   1729  C  CB  . GLU B  1 47  ? -92.089  -40.335  6.414   1.00 6.17  ? 47  GLU B CB  1 
ATOM   1730  C  CG  . GLU B  1 47  ? -91.395  -39.757  7.591   1.00 8.85  ? 47  GLU B CG  1 
ATOM   1731  C  CD  . GLU B  1 47  ? -91.698  -38.305  7.799   1.00 15.08 ? 47  GLU B CD  1 
ATOM   1732  O  OE1 . GLU B  1 47  ? -92.417  -37.670  6.953   1.00 16.97 ? 47  GLU B OE1 1 
ATOM   1733  O  OE2 . GLU B  1 47  ? -91.181  -37.801  8.841   1.00 18.43 ? 47  GLU B OE2 1 
ATOM   1734  N  N   . SER B  1 48  ? -92.491  -42.704  4.221   1.00 4.52  ? 48  SER B N   1 
ATOM   1735  C  CA  . SER B  1 48  ? -93.139  -43.871  3.637   1.00 4.20  ? 48  SER B CA  1 
ATOM   1736  C  C   . SER B  1 48  ? -92.391  -45.192  3.933   1.00 4.46  ? 48  SER B C   1 
ATOM   1737  O  O   . SER B  1 48  ? -93.014  -46.186  4.334   1.00 3.75  ? 48  SER B O   1 
ATOM   1738  C  CB  . SER B  1 48  ? -93.304  -43.682  2.145   1.00 3.79  ? 48  SER B CB  1 
ATOM   1739  O  OG  . SER B  1 48  ? -94.278  -44.599  1.680   1.00 4.39  ? 48  SER B OG  1 
ATOM   1740  N  N   . ILE B  1 49  ? -91.057  -45.188  3.742   1.00 4.73  ? 49  ILE B N   1 
ATOM   1741  C  CA  . ILE B  1 49  ? -90.234  -46.367  4.056   1.00 5.03  ? 49  ILE B CA  1 
ATOM   1742  C  C   . ILE B  1 49  ? -90.390  -46.693  5.531   1.00 5.43  ? 49  ILE B C   1 
ATOM   1743  O  O   . ILE B  1 49  ? -90.460  -47.849  5.929   1.00 5.53  ? 49  ILE B O   1 
ATOM   1744  C  CB  . ILE B  1 49  ? -88.729  -46.170  3.740   1.00 4.93  ? 49  ILE B CB  1 
ATOM   1745  C  CG1 . ILE B  1 49  ? -88.450  -46.000  2.236   1.00 5.40  ? 49  ILE B CG1 1 
ATOM   1746  C  CG2 . ILE B  1 49  ? -87.904  -47.315  4.257   1.00 3.98  ? 49  ILE B CG2 1 
ATOM   1747  C  CD1 . ILE B  1 49  ? -89.445  -46.658  1.317   1.00 6.06  ? 49  ILE B CD1 1 
ATOM   1748  N  N   . ASP B  1 50  ? -90.463  -45.660  6.347   1.00 5.91  ? 50  ASP B N   1 
ATOM   1749  C  CA  . ASP B  1 50  ? -90.599  -45.865  7.759   1.00 7.06  ? 50  ASP B CA  1 
ATOM   1750  C  C   . ASP B  1 50  ? -91.878  -46.618  8.122   1.00 6.84  ? 50  ASP B C   1 
ATOM   1751  O  O   . ASP B  1 50  ? -91.847  -47.589  8.887   1.00 6.68  ? 50  ASP B O   1 
ATOM   1752  C  CB  . ASP B  1 50  ? -90.558  -44.536  8.481   1.00 7.90  ? 50  ASP B CB  1 
ATOM   1753  C  CG  . ASP B  1 50  ? -89.708  -44.616  9.700   1.00 11.70 ? 50  ASP B CG  1 
ATOM   1754  O  OD1 . ASP B  1 50  ? -88.500  -44.886  9.471   1.00 14.92 ? 50  ASP B OD1 1 
ATOM   1755  O  OD2 . ASP B  1 50  ? -90.238  -44.471  10.851  1.00 15.63 ? 50  ASP B OD2 1 
ATOM   1756  N  N   . GLU B  1 51  ? -92.986  -46.179  7.555   1.00 6.21  ? 51  GLU B N   1 
ATOM   1757  C  CA  . GLU B  1 51  ? -94.250  -46.777  7.849   1.00 6.43  ? 51  GLU B CA  1 
ATOM   1758  C  C   . GLU B  1 51  ? -94.312  -48.197  7.314   1.00 6.09  ? 51  GLU B C   1 
ATOM   1759  O  O   . GLU B  1 51  ? -94.996  -49.046  7.900   1.00 5.10  ? 51  GLU B O   1 
ATOM   1760  C  CB  . GLU B  1 51  ? -95.423  -45.892  7.348   1.00 7.12  ? 51  GLU B CB  1 
ATOM   1761  C  CG  . GLU B  1 51  ? -95.462  -44.467  7.915   1.00 8.44  ? 51  GLU B CG  1 
ATOM   1762  C  CD  . GLU B  1 51  ? -95.320  -44.386  9.436   1.00 12.34 ? 51  GLU B CD  1 
ATOM   1763  O  OE1 . GLU B  1 51  ? -96.170  -43.762  10.109  1.00 15.24 ? 51  GLU B OE1 1 
ATOM   1764  O  OE2 . GLU B  1 51  ? -94.359  -44.939  9.988   1.00 15.32 ? 51  GLU B OE2 1 
ATOM   1765  N  N   . MET B  1 52  ? -93.566  -48.474  6.232   1.00 6.18  ? 52  MET B N   1 
ATOM   1766  C  CA  . MET B  1 52  ? -93.470  -49.834  5.715   1.00 6.42  ? 52  MET B CA  1 
ATOM   1767  C  C   . MET B  1 52  ? -92.807  -50.745  6.717   1.00 6.11  ? 52  MET B C   1 
ATOM   1768  O  O   . MET B  1 52  ? -93.262  -51.861  6.934   1.00 6.41  ? 52  MET B O   1 
ATOM   1769  C  CB  . MET B  1 52  ? -92.693  -49.890  4.425   1.00 6.23  ? 52  MET B CB  1 
ATOM   1770  C  CG  . MET B  1 52  ? -93.426  -49.395  3.239   1.00 6.95  ? 52  MET B CG  1 
ATOM   1771  S  SD  . MET B  1 52  ? -92.330  -49.282  1.788   1.00 9.64  ? 52  MET B SD  1 
ATOM   1772  C  CE  . MET B  1 52  ? -92.928  -47.705  1.124   1.00 8.43  ? 52  MET B CE  1 
ATOM   1773  N  N   . LYS B  1 53  ? -91.731  -50.268  7.329   1.00 5.71  ? 53  LYS B N   1 
ATOM   1774  C  CA  . LYS B  1 53  ? -91.039  -51.020  8.348   1.00 5.74  ? 53  LYS B CA  1 
ATOM   1775  C  C   . LYS B  1 53  ? -91.981  -51.366  9.498   1.00 5.69  ? 53  LYS B C   1 
ATOM   1776  O  O   . LYS B  1 53  ? -91.953  -52.469  10.028  1.00 5.90  ? 53  LYS B O   1 
ATOM   1777  C  CB  . LYS B  1 53  ? -89.828  -50.250  8.865   1.00 6.06  ? 53  LYS B CB  1 
ATOM   1778  C  CG  . LYS B  1 53  ? -88.764  -50.004  7.829   1.00 7.84  ? 53  LYS B CG  1 
ATOM   1779  C  CD  . LYS B  1 53  ? -87.406  -49.812  8.495   1.00 12.55 ? 53  LYS B CD  1 
ATOM   1780  C  CE  . LYS B  1 53  ? -86.515  -48.784  7.747   1.00 16.00 ? 53  LYS B CE  1 
ATOM   1781  N  NZ  . LYS B  1 53  ? -85.073  -48.879  8.167   1.00 18.00 ? 53  LYS B NZ  1 
ATOM   1782  N  N   . HIS B  1 54  ? -92.832  -50.416  9.866   1.00 5.76  ? 54  HIS B N   1 
ATOM   1783  C  CA  . HIS B  1 54  ? -93.790  -50.632  10.913  1.00 5.51  ? 54  HIS B CA  1 
ATOM   1784  C  C   . HIS B  1 54  ? -94.811  -51.691  10.526  1.00 4.99  ? 54  HIS B C   1 
ATOM   1785  O  O   . HIS B  1 54  ? -95.071  -52.611  11.311  1.00 4.80  ? 54  HIS B O   1 
ATOM   1786  C  CB  . HIS B  1 54  ? -94.455  -49.315  11.283  1.00 5.92  ? 54  HIS B CB  1 
ATOM   1787  C  CG  . HIS B  1 54  ? -93.508  -48.299  11.846  1.00 7.49  ? 54  HIS B CG  1 
ATOM   1788  N  ND1 . HIS B  1 54  ? -93.804  -46.954  11.887  1.00 10.41 ? 54  HIS B ND1 1 
ATOM   1789  C  CD2 . HIS B  1 54  ? -92.275  -48.430  12.383  1.00 7.86  ? 54  HIS B CD2 1 
ATOM   1790  C  CE1 . HIS B  1 54  ? -92.797  -46.303  12.436  1.00 10.34 ? 54  HIS B CE1 1 
ATOM   1791  N  NE2 . HIS B  1 54  ? -91.863  -47.177  12.757  1.00 7.88  ? 54  HIS B NE2 1 
ATOM   1792  N  N   . ALA B  1 55  ? -95.351  -51.581  9.316   1.00 4.13  ? 55  ALA B N   1 
ATOM   1793  C  CA  . ALA B  1 55  ? -96.315  -52.542  8.824   1.00 3.85  ? 55  ALA B CA  1 
ATOM   1794  C  C   . ALA B  1 55  ? -95.727  -53.956  8.864   1.00 4.11  ? 55  ALA B C   1 
ATOM   1795  O  O   . ALA B  1 55  ? -96.361  -54.908  9.330   1.00 4.18  ? 55  ALA B O   1 
ATOM   1796  C  CB  . ALA B  1 55  ? -96.739  -52.164  7.418   1.00 2.93  ? 55  ALA B CB  1 
ATOM   1797  N  N   . ASP B  1 56  ? -94.497  -54.073  8.381   1.00 3.92  ? 56  ASP B N   1 
ATOM   1798  C  CA  . ASP B  1 56  ? -93.767  -55.315  8.403   1.00 4.02  ? 56  ASP B CA  1 
ATOM   1799  C  C   . ASP B  1 56  ? -93.742  -55.882  9.843   1.00 4.32  ? 56  ASP B C   1 
ATOM   1800  O  O   . ASP B  1 56  ? -94.070  -57.044  10.066  1.00 5.23  ? 56  ASP B O   1 
ATOM   1801  C  CB  . ASP B  1 56  ? -92.358  -55.071  7.865   1.00 3.83  ? 56  ASP B CB  1 
ATOM   1802  C  CG  . ASP B  1 56  ? -91.589  -56.358  7.591   1.00 4.31  ? 56  ASP B CG  1 
ATOM   1803  O  OD1 . ASP B  1 56  ? -92.182  -57.451  7.556   1.00 3.87  ? 56  ASP B OD1 1 
ATOM   1804  O  OD2 . ASP B  1 56  ? -90.358  -56.276  7.405   1.00 4.95  ? 56  ASP B OD2 1 
ATOM   1805  N  N   . ARG B  1 57  ? -93.406  -55.057  10.820  1.00 3.72  ? 57  ARG B N   1 
ATOM   1806  C  CA  . ARG B  1 57  ? -93.308  -55.540  12.172  1.00 3.65  ? 57  ARG B CA  1 
ATOM   1807  C  C   . ARG B  1 57  ? -94.661  -56.043  12.705  1.00 2.86  ? 57  ARG B C   1 
ATOM   1808  O  O   . ARG B  1 57  ? -94.710  -57.097  13.349  1.00 2.16  ? 57  ARG B O   1 
ATOM   1809  C  CB  . ARG B  1 57  ? -92.631  -54.498  13.078  1.00 3.56  ? 57  ARG B CB  1 
ATOM   1810  C  CG  . ARG B  1 57  ? -91.152  -54.391  12.815  1.00 4.88  ? 57  ARG B CG  1 
ATOM   1811  C  CD  . ARG B  1 57  ? -90.440  -53.259  13.571  1.00 7.32  ? 57  ARG B CD  1 
ATOM   1812  N  NE  . ARG B  1 57  ? -90.234  -53.507  15.002  1.00 12.00 ? 57  ARG B NE  1 
ATOM   1813  C  CZ  . ARG B  1 57  ? -90.078  -52.523  15.909  1.00 14.26 ? 57  ARG B CZ  1 
ATOM   1814  N  NH1 . ARG B  1 57  ? -90.070  -51.218  15.519  1.00 12.22 ? 57  ARG B NH1 1 
ATOM   1815  N  NH2 . ARG B  1 57  ? -89.939  -52.836  17.213  1.00 12.01 ? 57  ARG B NH2 1 
ATOM   1816  N  N   . TYR B  1 58  ? -95.746  -55.315  12.411  1.00 2.22  ? 58  TYR B N   1 
ATOM   1817  C  CA  . TYR B  1 58  ? -97.075  -55.760  12.774  1.00 2.00  ? 58  TYR B CA  1 
ATOM   1818  C  C   . TYR B  1 58  ? -97.421  -57.098  12.124  1.00 2.08  ? 58  TYR B C   1 
ATOM   1819  O  O   . TYR B  1 58  ? -97.939  -58.023  12.787  1.00 2.00  ? 58  TYR B O   1 
ATOM   1820  C  CB  . TYR B  1 58  ? -98.125  -54.725  12.402  1.00 2.00  ? 58  TYR B CB  1 
ATOM   1821  C  CG  . TYR B  1 58  ? -98.079  -53.494  13.242  1.00 2.11  ? 58  TYR B CG  1 
ATOM   1822  C  CD1 . TYR B  1 58  ? -98.050  -53.578  14.626  1.00 2.93  ? 58  TYR B CD1 1 
ATOM   1823  C  CD2 . TYR B  1 58  ? -98.087  -52.231  12.660  1.00 2.00  ? 58  TYR B CD2 1 
ATOM   1824  C  CE1 . TYR B  1 58  ? -98.003  -52.450  15.402  1.00 2.02  ? 58  TYR B CE1 1 
ATOM   1825  C  CE2 . TYR B  1 58  ? -98.052  -51.115  13.419  1.00 2.00  ? 58  TYR B CE2 1 
ATOM   1826  C  CZ  . TYR B  1 58  ? -98.011  -51.227  14.796  1.00 2.00  ? 58  TYR B CZ  1 
ATOM   1827  O  OH  . TYR B  1 58  ? -97.968  -50.115  15.596  1.00 2.03  ? 58  TYR B OH  1 
ATOM   1828  N  N   . ILE B  1 59  ? -97.134  -57.194  10.828  1.00 2.03  ? 59  ILE B N   1 
ATOM   1829  C  CA  . ILE B  1 59  ? -97.487  -58.367  10.053  1.00 2.22  ? 59  ILE B CA  1 
ATOM   1830  C  C   . ILE B  1 59  ? -96.794  -59.561  10.656  1.00 2.81  ? 59  ILE B C   1 
ATOM   1831  O  O   . ILE B  1 59  ? -97.420  -60.586  10.885  1.00 3.49  ? 59  ILE B O   1 
ATOM   1832  C  CB  . ILE B  1 59  ? -97.144  -58.234  8.547   1.00 2.01  ? 59  ILE B CB  1 
ATOM   1833  C  CG1 . ILE B  1 59  ? -98.123  -57.284  7.872   1.00 2.00  ? 59  ILE B CG1 1 
ATOM   1834  C  CG2 . ILE B  1 59  ? -97.257  -59.543  7.854   1.00 2.00  ? 59  ILE B CG2 1 
ATOM   1835  C  CD1 . ILE B  1 59  ? -97.581  -56.651  6.598   1.00 2.00  ? 59  ILE B CD1 1 
ATOM   1836  N  N   . GLU B  1 60  ? -95.513  -59.413  10.969  1.00 2.85  ? 60  GLU B N   1 
ATOM   1837  C  CA  . GLU B  1 60  ? -94.768  -60.529  11.501  1.00 2.87  ? 60  GLU B CA  1 
ATOM   1838  C  C   . GLU B  1 60  ? -95.233  -60.943  12.849  1.00 2.57  ? 60  GLU B C   1 
ATOM   1839  O  O   . GLU B  1 60  ? -95.203  -62.111  13.188  1.00 3.14  ? 60  GLU B O   1 
ATOM   1840  C  CB  . GLU B  1 60  ? -93.275  -60.234  11.503  1.00 2.86  ? 60  GLU B CB  1 
ATOM   1841  C  CG  . GLU B  1 60  ? -92.742  -60.236  10.083  1.00 5.18  ? 60  GLU B CG  1 
ATOM   1842  C  CD  . GLU B  1 60  ? -91.284  -59.958  10.009  1.00 7.95  ? 60  GLU B CD  1 
ATOM   1843  O  OE1 . GLU B  1 60  ? -90.688  -60.039  8.919   1.00 9.00  ? 60  GLU B OE1 1 
ATOM   1844  O  OE2 . GLU B  1 60  ? -90.725  -59.652  11.063  1.00 10.80 ? 60  GLU B OE2 1 
ATOM   1845  N  N   . ARG B  1 61  ? -95.656  -59.966  13.623  1.00 2.79  ? 61  ARG B N   1 
ATOM   1846  C  CA  . ARG B  1 61  ? -96.072  -60.210  14.987  1.00 2.57  ? 61  ARG B CA  1 
ATOM   1847  C  C   . ARG B  1 61  ? -97.457  -60.873  14.975  1.00 2.86  ? 61  ARG B C   1 
ATOM   1848  O  O   . ARG B  1 61  ? -97.643  -61.868  15.665  1.00 2.54  ? 61  ARG B O   1 
ATOM   1849  C  CB  . ARG B  1 61  ? -96.063  -58.895  15.774  1.00 2.62  ? 61  ARG B CB  1 
ATOM   1850  C  CG  . ARG B  1 61  ? -96.400  -59.021  17.245  1.00 2.09  ? 61  ARG B CG  1 
ATOM   1851  C  CD  . ARG B  1 61  ? -95.286  -59.663  18.050  1.00 2.36  ? 61  ARG B CD  1 
ATOM   1852  N  NE  . ARG B  1 61  ? -95.771  -59.893  19.395  1.00 3.05  ? 61  ARG B NE  1 
ATOM   1853  C  CZ  . ARG B  1 61  ? -95.186  -60.671  20.294  1.00 5.04  ? 61  ARG B CZ  1 
ATOM   1854  N  NH1 . ARG B  1 61  ? -94.055  -61.310  20.003  1.00 3.74  ? 61  ARG B NH1 1 
ATOM   1855  N  NH2 . ARG B  1 61  ? -95.748  -60.808  21.487  1.00 4.51  ? 61  ARG B NH2 1 
ATOM   1856  N  N   . ILE B  1 62  ? -98.404  -60.342  14.176  1.00 2.56  ? 62  ILE B N   1 
ATOM   1857  C  CA  . ILE B  1 62  ? -99.712  -60.982  14.020  1.00 2.42  ? 62  ILE B CA  1 
ATOM   1858  C  C   . ILE B  1 62  ? -99.533  -62.457  13.630  1.00 2.81  ? 62  ILE B C   1 
ATOM   1859  O  O   . ILE B  1 62  ? -100.219 -63.351  14.160  1.00 2.89  ? 62  ILE B O   1 
ATOM   1860  C  CB  . ILE B  1 62  ? -100.612 -60.257  12.993  1.00 2.13  ? 62  ILE B CB  1 
ATOM   1861  C  CG1 . ILE B  1 62  ? -100.962 -58.853  13.489  1.00 3.15  ? 62  ILE B CG1 1 
ATOM   1862  C  CG2 . ILE B  1 62  ? -101.873 -60.997  12.791  1.00 2.00  ? 62  ILE B CG2 1 
ATOM   1863  C  CD1 . ILE B  1 62  ? -101.662 -57.993  12.497  1.00 2.00  ? 62  ILE B CD1 1 
ATOM   1864  N  N   . LEU B  1 63  ? -98.598  -62.710  12.720  1.00 2.50  ? 63  LEU B N   1 
ATOM   1865  C  CA  . LEU B  1 63  ? -98.398  -64.045  12.208  1.00 2.77  ? 63  LEU B CA  1 
ATOM   1866  C  C   . LEU B  1 63  ? -97.849  -64.908  13.317  1.00 3.13  ? 63  LEU B C   1 
ATOM   1867  O  O   . LEU B  1 63  ? -98.294  -66.038  13.517  1.00 3.77  ? 63  LEU B O   1 
ATOM   1868  C  CB  . LEU B  1 63  ? -97.461  -64.028  11.003  1.00 2.66  ? 63  LEU B CB  1 
ATOM   1869  C  CG  . LEU B  1 63  ? -97.924  -64.238  9.565   1.00 2.01  ? 63  LEU B CG  1 
ATOM   1870  C  CD1 . LEU B  1 63  ? -99.403  -64.316  9.344   1.00 2.00  ? 63  LEU B CD1 1 
ATOM   1871  C  CD2 . LEU B  1 63  ? -97.267  -63.245  8.666   1.00 2.00  ? 63  LEU B CD2 1 
ATOM   1872  N  N   . PHE B  1 64  ? -96.918  -64.357  14.085  1.00 3.09  ? 64  PHE B N   1 
ATOM   1873  C  CA  . PHE B  1 64  ? -96.310  -65.119  15.171  1.00 3.09  ? 64  PHE B CA  1 
ATOM   1874  C  C   . PHE B  1 64  ? -97.370  -65.486  16.185  1.00 3.33  ? 64  PHE B C   1 
ATOM   1875  O  O   . PHE B  1 64  ? -97.385  -66.634  16.660  1.00 4.33  ? 64  PHE B O   1 
ATOM   1876  C  CB  . PHE B  1 64  ? -95.188  -64.358  15.863  1.00 2.45  ? 64  PHE B CB  1 
ATOM   1877  C  CG  . PHE B  1 64  ? -94.748  -64.991  17.138  1.00 2.06  ? 64  PHE B CG  1 
ATOM   1878  C  CD1 . PHE B  1 64  ? -94.204  -66.266  17.151  1.00 2.00  ? 64  PHE B CD1 1 
ATOM   1879  C  CD2 . PHE B  1 64  ? -94.861  -64.311  18.344  1.00 3.23  ? 64  PHE B CD2 1 
ATOM   1880  C  CE1 . PHE B  1 64  ? -93.776  -66.853  18.339  1.00 2.00  ? 64  PHE B CE1 1 
ATOM   1881  C  CE2 . PHE B  1 64  ? -94.429  -64.897  19.548  1.00 2.00  ? 64  PHE B CE2 1 
ATOM   1882  C  CZ  . PHE B  1 64  ? -93.891  -66.163  19.538  1.00 2.00  ? 64  PHE B CZ  1 
ATOM   1883  N  N   . LEU B  1 65  ? -98.253  -64.521  16.487  1.00 2.46  ? 65  LEU B N   1 
ATOM   1884  C  CA  . LEU B  1 65  ? -99.321  -64.686  17.446  1.00 2.21  ? 65  LEU B CA  1 
ATOM   1885  C  C   . LEU B  1 65  ? -100.460 -65.519  16.895  1.00 2.27  ? 65  LEU B C   1 
ATOM   1886  O  O   . LEU B  1 65  ? -101.458 -65.703  17.571  1.00 2.13  ? 65  LEU B O   1 
ATOM   1887  C  CB  . LEU B  1 65  ? -99.849  -63.324  17.889  1.00 2.23  ? 65  LEU B CB  1 
ATOM   1888  C  CG  . LEU B  1 65  ? -98.862  -62.504  18.715  1.00 2.32  ? 65  LEU B CG  1 
ATOM   1889  C  CD1 . LEU B  1 65  ? -99.503  -61.203  19.166  1.00 2.00  ? 65  LEU B CD1 1 
ATOM   1890  C  CD2 . LEU B  1 65  ? -98.316  -63.352  19.889  1.00 2.00  ? 65  LEU B CD2 1 
ATOM   1891  N  N   . GLU B  1 66  ? -100.295 -65.999  15.663  1.00 2.34  ? 66  GLU B N   1 
ATOM   1892  C  CA  . GLU B  1 66  ? -101.261 -66.867  14.961  1.00 3.39  ? 66  GLU B CA  1 
ATOM   1893  C  C   . GLU B  1 66  ? -102.568 -66.197  14.529  1.00 3.00  ? 66  GLU B C   1 
ATOM   1894  O  O   . GLU B  1 66  ? -103.577 -66.855  14.455  1.00 3.16  ? 66  GLU B O   1 
ATOM   1895  C  CB  . GLU B  1 66  ? -101.512 -68.177  15.718  1.00 2.94  ? 66  GLU B CB  1 
ATOM   1896  C  CG  . GLU B  1 66  ? -100.203 -68.989  15.922  1.00 6.18  ? 66  GLU B CG  1 
ATOM   1897  C  CD  . GLU B  1 66  ? -100.329 -70.216  16.821  1.00 5.83  ? 66  GLU B CD  1 
ATOM   1898  O  OE1 . GLU B  1 66  ? -101.384 -70.873  16.823  1.00 11.36 ? 66  GLU B OE1 1 
ATOM   1899  O  OE2 . GLU B  1 66  ? -99.339  -70.538  17.504  1.00 6.71  ? 66  GLU B OE2 1 
ATOM   1900  N  N   . GLY B  1 67  ? -102.542 -64.903  14.214  1.00 2.87  ? 67  GLY B N   1 
ATOM   1901  C  CA  . GLY B  1 67  ? -103.700 -64.230  13.638  1.00 3.03  ? 67  GLY B CA  1 
ATOM   1902  C  C   . GLY B  1 67  ? -103.518 -63.987  12.141  1.00 4.23  ? 67  GLY B C   1 
ATOM   1903  O  O   . GLY B  1 67  ? -102.487 -64.359  11.559  1.00 4.47  ? 67  GLY B O   1 
ATOM   1904  N  N   . LEU B  1 68  ? -104.520 -63.374  11.521  1.00 4.19  ? 68  LEU B N   1 
ATOM   1905  C  CA  . LEU B  1 68  ? -104.533 -63.148  10.094  1.00 4.18  ? 68  LEU B CA  1 
ATOM   1906  C  C   . LEU B  1 68  ? -104.317 -61.658  9.814   1.00 3.84  ? 68  LEU B C   1 
ATOM   1907  O  O   . LEU B  1 68  ? -105.204 -60.845  10.075  1.00 3.76  ? 68  LEU B O   1 
ATOM   1908  C  CB  . LEU B  1 68  ? -105.893 -63.529  9.560   1.00 4.21  ? 68  LEU B CB  1 
ATOM   1909  C  CG  . LEU B  1 68  ? -106.262 -64.904  9.003   1.00 6.82  ? 68  LEU B CG  1 
ATOM   1910  C  CD1 . LEU B  1 68  ? -105.146 -65.976  9.081   1.00 5.19  ? 68  LEU B CD1 1 
ATOM   1911  C  CD2 . LEU B  1 68  ? -107.604 -65.389  9.641   1.00 6.27  ? 68  LEU B CD2 1 
ATOM   1912  N  N   . PRO B  1 69  ? -103.126 -61.279  9.308   1.00 3.49  ? 69  PRO B N   1 
ATOM   1913  C  CA  . PRO B  1 69  ? -102.918 -59.858  9.019   1.00 3.08  ? 69  PRO B CA  1 
ATOM   1914  C  C   . PRO B  1 69  ? -103.894 -59.416  7.933   1.00 3.62  ? 69  PRO B C   1 
ATOM   1915  O  O   . PRO B  1 69  ? -104.147 -60.155  6.964   1.00 3.62  ? 69  PRO B O   1 
ATOM   1916  C  CB  . PRO B  1 69  ? -101.483 -59.801  8.497   1.00 2.08  ? 69  PRO B CB  1 
ATOM   1917  C  CG  . PRO B  1 69  ? -100.858 -61.023  8.948   1.00 2.00  ? 69  PRO B CG  1 
ATOM   1918  C  CD  . PRO B  1 69  ? -101.929 -62.071  9.015   1.00 2.80  ? 69  PRO B CD  1 
ATOM   1919  N  N   . ASN B  1 70  ? -104.440 -58.217  8.116   1.00 4.04  ? 70  ASN B N   1 
ATOM   1920  C  CA  . ASN B  1 70  ? -105.446 -57.703  7.219   1.00 4.41  ? 70  ASN B CA  1 
ATOM   1921  C  C   . ASN B  1 70  ? -104.835 -56.598  6.394   1.00 4.81  ? 70  ASN B C   1 
ATOM   1922  O  O   . ASN B  1 70  ? -104.630 -55.499  6.898   1.00 5.55  ? 70  ASN B O   1 
ATOM   1923  C  CB  . ASN B  1 70  ? -106.604 -57.159  8.019   1.00 4.02  ? 70  ASN B CB  1 
ATOM   1924  C  CG  . ASN B  1 70  ? -107.736 -56.685  7.151   1.00 5.28  ? 70  ASN B CG  1 
ATOM   1925  O  OD1 . ASN B  1 70  ? -107.631 -56.644  5.921   1.00 6.72  ? 70  ASN B OD1 1 
ATOM   1926  N  ND2 . ASN B  1 70  ? -108.845 -56.311  7.785   1.00 4.53  ? 70  ASN B ND2 1 
ATOM   1927  N  N   . LEU B  1 71  ? -104.531 -56.893  5.133   1.00 4.75  ? 71  LEU B N   1 
ATOM   1928  C  CA  . LEU B  1 71  ? -104.047 -55.896  4.194   1.00 4.85  ? 71  LEU B CA  1 
ATOM   1929  C  C   . LEU B  1 71  ? -105.123 -55.545  3.144   1.00 6.08  ? 71  LEU B C   1 
ATOM   1930  O  O   . LEU B  1 71  ? -104.853 -54.871  2.158   1.00 6.80  ? 71  LEU B O   1 
ATOM   1931  C  CB  . LEU B  1 71  ? -102.789 -56.426  3.516   1.00 4.08  ? 71  LEU B CB  1 
ATOM   1932  C  CG  . LEU B  1 71  ? -101.493 -56.316  4.346   1.00 4.61  ? 71  LEU B CG  1 
ATOM   1933  C  CD1 . LEU B  1 71  ? -101.336 -57.463  5.239   1.00 3.68  ? 71  LEU B CD1 1 
ATOM   1934  C  CD2 . LEU B  1 71  ? -100.272 -56.167  3.455   1.00 2.87  ? 71  LEU B CD2 1 
ATOM   1935  N  N   . GLN B  1 72  ? -106.345 -56.014  3.356   1.00 7.01  ? 72  GLN B N   1 
ATOM   1936  C  CA  . GLN B  1 72  ? -107.375 -55.870  2.369   1.00 7.64  ? 72  GLN B CA  1 
ATOM   1937  C  C   . GLN B  1 72  ? -108.047 -54.540  2.565   1.00 8.18  ? 72  GLN B C   1 
ATOM   1938  O  O   . GLN B  1 72  ? -108.295 -53.848  1.601   1.00 8.80  ? 72  GLN B O   1 
ATOM   1939  C  CB  . GLN B  1 72  ? -108.393 -57.014  2.466   1.00 7.94  ? 72  GLN B CB  1 
ATOM   1940  C  CG  . GLN B  1 72  ? -109.619 -56.861  1.540   1.00 9.03  ? 72  GLN B CG  1 
ATOM   1941  C  CD  . GLN B  1 72  ? -109.243 -56.965  0.082   1.00 11.25 ? 72  GLN B CD  1 
ATOM   1942  O  OE1 . GLN B  1 72  ? -109.064 -58.084  -0.457  1.00 12.94 ? 72  GLN B OE1 1 
ATOM   1943  N  NE2 . GLN B  1 72  ? -109.086 -55.804  -0.574  1.00 7.91  ? 72  GLN B NE2 1 
ATOM   1944  N  N   . ASP B  1 73  ? -108.327 -54.170  3.811   1.00 8.81  ? 73  ASP B N   1 
ATOM   1945  C  CA  . ASP B  1 73  ? -109.089 -52.944  4.074   1.00 9.64  ? 73  ASP B CA  1 
ATOM   1946  C  C   . ASP B  1 73  ? -108.160 -51.761  4.176   1.00 10.09 ? 73  ASP B C   1 
ATOM   1947  O  O   . ASP B  1 73  ? -107.123 -51.832  4.872   1.00 12.25 ? 73  ASP B O   1 
ATOM   1948  C  CB  . ASP B  1 73  ? -109.936 -53.091  5.342   1.00 9.48  ? 73  ASP B CB  1 
ATOM   1949  C  CG  . ASP B  1 73  ? -110.887 -54.305  5.264   1.00 11.91 ? 73  ASP B CG  1 
ATOM   1950  O  OD1 . ASP B  1 73  ? -111.446 -54.577  4.148   1.00 13.92 ? 73  ASP B OD1 1 
ATOM   1951  O  OD2 . ASP B  1 73  ? -111.041 -55.022  6.291   1.00 12.38 ? 73  ASP B OD2 1 
ATOM   1952  N  N   . LEU B  1 74  ? -108.491 -50.689  3.465   1.00 9.55  ? 74  LEU B N   1 
ATOM   1953  C  CA  . LEU B  1 74  ? -107.663 -49.480  3.453   1.00 8.34  ? 74  LEU B CA  1 
ATOM   1954  C  C   . LEU B  1 74  ? -108.520 -48.288  3.845   1.00 8.41  ? 74  LEU B C   1 
ATOM   1955  O  O   . LEU B  1 74  ? -109.513 -47.996  3.171   1.00 8.67  ? 74  LEU B O   1 
ATOM   1956  C  CB  . LEU B  1 74  ? -107.051 -49.276  2.065   1.00 7.91  ? 74  LEU B CB  1 
ATOM   1957  C  CG  . LEU B  1 74  ? -105.948 -48.218  1.919   1.00 7.53  ? 74  LEU B CG  1 
ATOM   1958  C  CD1 . LEU B  1 74  ? -104.724 -48.524  2.744   1.00 4.12  ? 74  LEU B CD1 1 
ATOM   1959  C  CD2 . LEU B  1 74  ? -105.529 -48.010  0.460   1.00 7.42  ? 74  LEU B CD2 1 
ATOM   1960  N  N   . GLY B  1 75  ? -108.144 -47.615  4.937   1.00 8.30  ? 75  GLY B N   1 
ATOM   1961  C  CA  . GLY B  1 75  ? -108.869 -46.433  5.429   1.00 8.42  ? 75  GLY B CA  1 
ATOM   1962  C  C   . GLY B  1 75  ? -108.820 -45.218  4.517   1.00 9.36  ? 75  GLY B C   1 
ATOM   1963  O  O   . GLY B  1 75  ? -108.180 -45.250  3.447   1.00 9.32  ? 75  GLY B O   1 
ATOM   1964  N  N   . LYS B  1 76  ? -109.509 -44.149  4.913   1.00 10.18 ? 76  LYS B N   1 
ATOM   1965  C  CA  . LYS B  1 76  ? -109.552 -42.945  4.085   1.00 11.65 ? 76  LYS B CA  1 
ATOM   1966  C  C   . LYS B  1 76  ? -108.193 -42.234  4.003   1.00 10.50 ? 76  LYS B C   1 
ATOM   1967  O  O   . LYS B  1 76  ? -107.620 -41.842  5.026   1.00 10.76 ? 76  LYS B O   1 
ATOM   1968  C  CB  . LYS B  1 76  ? -110.676 -41.952  4.490   1.00 11.56 ? 76  LYS B CB  1 
ATOM   1969  C  CG  . LYS B  1 76  ? -111.032 -41.005  3.281   1.00 15.47 ? 76  LYS B CG  1 
ATOM   1970  C  CD  . LYS B  1 76  ? -112.102 -39.915  3.569   1.00 15.69 ? 76  LYS B CD  1 
ATOM   1971  C  CE  . LYS B  1 76  ? -112.135 -38.802  2.453   1.00 18.62 ? 76  LYS B CE  1 
ATOM   1972  N  NZ  . LYS B  1 76  ? -113.088 -37.633  2.837   1.00 20.33 ? 76  LYS B NZ  1 
ATOM   1973  N  N   . LEU B  1 77  ? -107.691 -42.110  2.772   1.00 9.98  ? 77  LEU B N   1 
ATOM   1974  C  CA  . LEU B  1 77  ? -106.615 -41.191  2.417   1.00 9.41  ? 77  LEU B CA  1 
ATOM   1975  C  C   . LEU B  1 77  ? -107.185 -39.789  2.318   1.00 9.36  ? 77  LEU B C   1 
ATOM   1976  O  O   . LEU B  1 77  ? -108.299 -39.599  1.859   1.00 9.89  ? 77  LEU B O   1 
ATOM   1977  C  CB  . LEU B  1 77  ? -106.060 -41.575  1.048   1.00 9.20  ? 77  LEU B CB  1 
ATOM   1978  C  CG  . LEU B  1 77  ? -104.754 -42.337  0.912   1.00 8.99  ? 77  LEU B CG  1 
ATOM   1979  C  CD1 . LEU B  1 77  ? -104.768 -43.525  1.833   1.00 7.33  ? 77  LEU B CD1 1 
ATOM   1980  C  CD2 . LEU B  1 77  ? -104.644 -42.772  -0.515  1.00 9.53  ? 77  LEU B CD2 1 
ATOM   1981  N  N   . ASN B  1 78  ? -106.442 -38.794  2.750   1.00 9.53  ? 78  ASN B N   1 
ATOM   1982  C  CA  . ASN B  1 78  ? -106.836 -37.401  2.503   1.00 9.48  ? 78  ASN B CA  1 
ATOM   1983  C  C   . ASN B  1 78  ? -105.602 -36.715  1.920   1.00 9.25  ? 78  ASN B C   1 
ATOM   1984  O  O   . ASN B  1 78  ? -104.611 -36.516  2.625   1.00 9.76  ? 78  ASN B O   1 
ATOM   1985  C  CB  . ASN B  1 78  ? -107.352 -36.732  3.786   1.00 9.40  ? 78  ASN B CB  1 
ATOM   1986  C  CG  . ASN B  1 78  ? -107.663 -35.218  3.600   1.00 12.27 ? 78  ASN B CG  1 
ATOM   1987  O  OD1 . ASN B  1 78  ? -107.721 -34.694  2.458   1.00 13.91 ? 78  ASN B OD1 1 
ATOM   1988  N  ND2 . ASN B  1 78  ? -107.857 -34.515  4.729   1.00 12.51 ? 78  ASN B ND2 1 
ATOM   1989  N  N   . ILE B  1 79  ? -105.639 -36.445  0.615   1.00 8.78  ? 79  ILE B N   1 
ATOM   1990  C  CA  . ILE B  1 79  ? -104.430 -36.079  -0.112  1.00 8.27  ? 79  ILE B CA  1 
ATOM   1991  C  C   . ILE B  1 79  ? -104.144 -34.585  -0.014  1.00 8.77  ? 79  ILE B C   1 
ATOM   1992  O  O   . ILE B  1 79  ? -103.050 -34.207  0.435   1.00 9.24  ? 79  ILE B O   1 
ATOM   1993  C  CB  . ILE B  1 79  ? -104.440 -36.524  -1.591  1.00 8.11  ? 79  ILE B CB  1 
ATOM   1994  C  CG1 . ILE B  1 79  ? -104.679 -38.029  -1.729  1.00 7.58  ? 79  ILE B CG1 1 
ATOM   1995  C  CG2 . ILE B  1 79  ? -103.137 -36.126  -2.255  1.00 7.78  ? 79  ILE B CG2 1 
ATOM   1996  C  CD1 . ILE B  1 79  ? -103.735 -38.930  -0.891  1.00 5.77  ? 79  ILE B CD1 1 
ATOM   1997  N  N   . GLY B  1 80  ? -105.107 -33.742  -0.395  1.00 8.40  ? 80  GLY B N   1 
ATOM   1998  C  CA  . GLY B  1 80  ? -104.904 -32.303  -0.308  1.00 8.54  ? 80  GLY B CA  1 
ATOM   1999  C  C   . GLY B  1 80  ? -104.298 -31.805  -1.604  1.00 9.08  ? 80  GLY B C   1 
ATOM   2000  O  O   . GLY B  1 80  ? -103.779 -32.602  -2.383  1.00 9.09  ? 80  GLY B O   1 
ATOM   2001  N  N   . GLU B  1 81  ? -104.361 -30.500  -1.860  1.00 9.32  ? 81  GLU B N   1 
ATOM   2002  C  CA  . GLU B  1 81  ? -103.932 -30.002  -3.156  1.00 10.14 ? 81  GLU B CA  1 
ATOM   2003  C  C   . GLU B  1 81  ? -102.735 -29.062  -3.093  1.00 9.36  ? 81  GLU B C   1 
ATOM   2004  O  O   . GLU B  1 81  ? -102.136 -28.804  -4.123  1.00 10.29 ? 81  GLU B O   1 
ATOM   2005  C  CB  . GLU B  1 81  ? -105.095 -29.355  -3.917  1.00 9.66  ? 81  GLU B CB  1 
ATOM   2006  C  CG  . GLU B  1 81  ? -106.285 -30.304  -4.252  1.00 12.25 ? 81  GLU B CG  1 
ATOM   2007  C  CD  . GLU B  1 81  ? -107.631 -29.516  -4.483  1.00 15.06 ? 81  GLU B CD  1 
ATOM   2008  O  OE1 . GLU B  1 81  ? -108.022 -28.683  -3.612  1.00 20.79 ? 81  GLU B OE1 1 
ATOM   2009  O  OE2 . GLU B  1 81  ? -108.302 -29.731  -5.534  1.00 19.48 ? 81  GLU B OE2 1 
ATOM   2010  N  N   . ASP B  1 82  ? -102.399 -28.537  -1.904  1.00 8.71  ? 82  ASP B N   1 
ATOM   2011  C  CA  . ASP B  1 82  ? -101.183 -27.711  -1.696  1.00 7.38  ? 82  ASP B CA  1 
ATOM   2012  C  C   . ASP B  1 82  ? -100.349 -28.158  -0.483  1.00 6.42  ? 82  ASP B C   1 
ATOM   2013  O  O   . ASP B  1 82  ? -100.825 -28.901  0.355   1.00 6.36  ? 82  ASP B O   1 
ATOM   2014  C  CB  . ASP B  1 82  ? -101.526 -26.227  -1.572  1.00 7.28  ? 82  ASP B CB  1 
ATOM   2015  C  CG  . ASP B  1 82  ? -102.475 -25.931  -0.446  1.00 10.30 ? 82  ASP B CG  1 
ATOM   2016  O  OD1 . ASP B  1 82  ? -103.553 -25.381  -0.735  1.00 16.59 ? 82  ASP B OD1 1 
ATOM   2017  O  OD2 . ASP B  1 82  ? -102.193 -26.223  0.725   1.00 12.02 ? 82  ASP B OD2 1 
ATOM   2018  N  N   . VAL B  1 83  ? -99.110  -27.668  -0.383  1.00 5.67  ? 83  VAL B N   1 
ATOM   2019  C  CA  . VAL B  1 83  ? -98.142  -28.114  0.628   1.00 4.94  ? 83  VAL B CA  1 
ATOM   2020  C  C   . VAL B  1 83  ? -98.726  -28.147  2.045   1.00 5.06  ? 83  VAL B C   1 
ATOM   2021  O  O   . VAL B  1 83  ? -98.705  -29.201  2.708   1.00 5.09  ? 83  VAL B O   1 
ATOM   2022  C  CB  . VAL B  1 83  ? -96.874  -27.254  0.600   1.00 4.66  ? 83  VAL B CB  1 
ATOM   2023  C  CG1 . VAL B  1 83  ? -95.851  -27.747  1.596   1.00 3.99  ? 83  VAL B CG1 1 
ATOM   2024  C  CG2 . VAL B  1 83  ? -96.301  -27.302  -0.759  1.00 4.69  ? 83  VAL B CG2 1 
ATOM   2025  N  N   . GLU B  1 84  ? -99.224  -27.004  2.509   1.00 4.69  ? 84  GLU B N   1 
ATOM   2026  C  CA  . GLU B  1 84  ? -99.794  -26.906  3.832   1.00 5.40  ? 84  GLU B CA  1 
ATOM   2027  C  C   . GLU B  1 84  ? -100.884 -27.957  4.047   1.00 5.71  ? 84  GLU B C   1 
ATOM   2028  O  O   . GLU B  1 84  ? -100.831 -28.745  4.999   1.00 5.74  ? 84  GLU B O   1 
ATOM   2029  C  CB  . GLU B  1 84  ? -100.379 -25.514  4.080   1.00 5.54  ? 84  GLU B CB  1 
ATOM   2030  C  CG  . GLU B  1 84  ? -100.204 -25.067  5.528   1.00 9.22  ? 84  GLU B CG  1 
ATOM   2031  C  CD  . GLU B  1 84  ? -101.115 -23.924  5.943   1.00 13.94 ? 84  GLU B CD  1 
ATOM   2032  O  OE1 . GLU B  1 84  ? -101.221 -22.931  5.184   1.00 16.29 ? 84  GLU B OE1 1 
ATOM   2033  O  OE2 . GLU B  1 84  ? -101.722 -24.013  7.038   1.00 13.51 ? 84  GLU B OE2 1 
ATOM   2034  N  N   . GLU B  1 85  ? -101.866 -27.973  3.155   1.00 5.75  ? 85  GLU B N   1 
ATOM   2035  C  CA  . GLU B  1 85  ? -102.975 -28.896  3.244   1.00 6.72  ? 85  GLU B CA  1 
ATOM   2036  C  C   . GLU B  1 85  ? -102.407 -30.327  3.330   1.00 5.76  ? 85  GLU B C   1 
ATOM   2037  O  O   . GLU B  1 85  ? -102.877 -31.157  4.129   1.00 5.37  ? 85  GLU B O   1 
ATOM   2038  C  CB  . GLU B  1 85  ? -103.813 -28.712  1.993   1.00 6.71  ? 85  GLU B CB  1 
ATOM   2039  C  CG  . GLU B  1 85  ? -105.310 -28.843  2.117   1.00 9.97  ? 85  GLU B CG  1 
ATOM   2040  C  CD  . GLU B  1 85  ? -106.046 -28.250  0.878   1.00 11.72 ? 85  GLU B CD  1 
ATOM   2041  O  OE1 . GLU B  1 85  ? -105.741 -27.098  0.484   1.00 15.05 ? 85  GLU B OE1 1 
ATOM   2042  O  OE2 . GLU B  1 85  ? -106.934 -28.940  0.306   1.00 16.79 ? 85  GLU B OE2 1 
ATOM   2043  N  N   . MET B  1 86  ? -101.369 -30.618  2.547   1.00 4.96  ? 86  MET B N   1 
ATOM   2044  C  CA  . MET B  1 86  ? -100.910 -31.985  2.555   1.00 5.01  ? 86  MET B CA  1 
ATOM   2045  C  C   . MET B  1 86  ? -100.129 -32.319  3.789   1.00 4.95  ? 86  MET B C   1 
ATOM   2046  O  O   . MET B  1 86  ? -100.262 -33.416  4.345   1.00 5.52  ? 86  MET B O   1 
ATOM   2047  C  CB  . MET B  1 86  ? -100.280 -32.499  1.222   1.00 4.80  ? 86  MET B CB  1 
ATOM   2048  C  CG  . MET B  1 86  ? -99.427  -31.571  0.467   1.00 6.69  ? 86  MET B CG  1 
ATOM   2049  S  SD  . MET B  1 86  ? -99.462  -31.822  -1.301  1.00 4.90  ? 86  MET B SD  1 
ATOM   2050  C  CE  . MET B  1 86  ? -98.272  -33.123  -1.544  1.00 3.20  ? 86  MET B CE  1 
ATOM   2051  N  N   . LEU B  1 87  ? -99.359  -31.363  4.265   1.00 4.78  ? 87  LEU B N   1 
ATOM   2052  C  CA  . LEU B  1 87  ? -98.609  -31.589  5.489   1.00 3.96  ? 87  LEU B CA  1 
ATOM   2053  C  C   . LEU B  1 87  ? -99.569  -31.761  6.662   1.00 4.00  ? 87  LEU B C   1 
ATOM   2054  O  O   . LEU B  1 87  ? -99.398  -32.662  7.473   1.00 4.33  ? 87  LEU B O   1 
ATOM   2055  C  CB  . LEU B  1 87  ? -97.614  -30.450  5.709   1.00 3.58  ? 87  LEU B CB  1 
ATOM   2056  C  CG  . LEU B  1 87  ? -96.135  -30.697  5.384   1.00 3.38  ? 87  LEU B CG  1 
ATOM   2057  C  CD1 . LEU B  1 87  ? -95.846  -31.731  4.313   1.00 2.56  ? 87  LEU B CD1 1 
ATOM   2058  C  CD2 . LEU B  1 87  ? -95.516  -29.383  5.013   1.00 4.18  ? 87  LEU B CD2 1 
ATOM   2059  N  N   . ARG B  1 88  ? -100.591 -30.921  6.696   1.00 3.97  ? 88  ARG B N   1 
ATOM   2060  C  CA  . ARG B  1 88  ? -101.564 -30.904  7.766   1.00 4.81  ? 88  ARG B CA  1 
ATOM   2061  C  C   . ARG B  1 88  ? -102.292 -32.238  7.780   1.00 4.68  ? 88  ARG B C   1 
ATOM   2062  O  O   . ARG B  1 88  ? -102.627 -32.782  8.818   1.00 5.45  ? 88  ARG B O   1 
ATOM   2063  C  CB  . ARG B  1 88  ? -102.556 -29.755  7.538   1.00 4.23  ? 88  ARG B CB  1 
ATOM   2064  C  CG  . ARG B  1 88  ? -102.739 -28.830  8.694   1.00 5.34  ? 88  ARG B CG  1 
ATOM   2065  C  CD  . ARG B  1 88  ? -103.540 -27.565  8.341   1.00 7.14  ? 88  ARG B CD  1 
ATOM   2066  N  NE  . ARG B  1 88  ? -102.730 -26.336  8.433   1.00 13.56 ? 88  ARG B NE  1 
ATOM   2067  C  CZ  . ARG B  1 88  ? -102.085 -25.903  9.547   1.00 14.67 ? 88  ARG B CZ  1 
ATOM   2068  N  NH1 . ARG B  1 88  ? -102.100 -26.600  10.697  1.00 13.81 ? 88  ARG B NH1 1 
ATOM   2069  N  NH2 . ARG B  1 88  ? -101.384 -24.782  9.510   1.00 13.09 ? 88  ARG B NH2 1 
ATOM   2070  N  N   . SER B  1 89  ? -102.512 -32.793  6.608   1.00 4.70  ? 89  SER B N   1 
ATOM   2071  C  CA  . SER B  1 89  ? -103.236 -34.041  6.525   1.00 4.18  ? 89  SER B CA  1 
ATOM   2072  C  C   . SER B  1 89  ? -102.407 -35.209  7.072   1.00 4.51  ? 89  SER B C   1 
ATOM   2073  O  O   . SER B  1 89  ? -102.955 -36.080  7.744   1.00 4.80  ? 89  SER B O   1 
ATOM   2074  C  CB  . SER B  1 89  ? -103.672 -34.297  5.085   1.00 4.06  ? 89  SER B CB  1 
ATOM   2075  O  OG  . SER B  1 89  ? -104.305 -35.551  4.992   1.00 3.45  ? 89  SER B OG  1 
ATOM   2076  N  N   . ASP B  1 90  ? -101.099 -35.236  6.772   1.00 3.88  ? 90  ASP B N   1 
ATOM   2077  C  CA  . ASP B  1 90  ? -100.202 -36.226  7.339   1.00 3.81  ? 90  ASP B CA  1 
ATOM   2078  C  C   . ASP B  1 90  ? -100.161 -36.085  8.851   1.00 3.88  ? 90  ASP B C   1 
ATOM   2079  O  O   . ASP B  1 90  ? -100.200 -37.080  9.557   1.00 4.23  ? 90  ASP B O   1 
ATOM   2080  C  CB  . ASP B  1 90  ? -98.787  -36.096  6.786   1.00 4.12  ? 90  ASP B CB  1 
ATOM   2081  C  CG  . ASP B  1 90  ? -98.674  -36.472  5.279   1.00 6.82  ? 90  ASP B CG  1 
ATOM   2082  O  OD1 . ASP B  1 90  ? -97.815  -35.858  4.553   1.00 9.12  ? 90  ASP B OD1 1 
ATOM   2083  O  OD2 . ASP B  1 90  ? -99.409  -37.386  4.813   1.00 9.69  ? 90  ASP B OD2 1 
ATOM   2084  N  N   . LEU B  1 91  ? -100.106 -34.858  9.359   1.00 3.64  ? 91  LEU B N   1 
ATOM   2085  C  CA  . LEU B  1 91  ? -100.170 -34.614  10.801  1.00 2.84  ? 91  LEU B CA  1 
ATOM   2086  C  C   . LEU B  1 91  ? -101.449 -35.153  11.436  1.00 3.09  ? 91  LEU B C   1 
ATOM   2087  O  O   . LEU B  1 91  ? -101.374 -35.833  12.448  1.00 3.74  ? 91  LEU B O   1 
ATOM   2088  C  CB  . LEU B  1 91  ? -99.988  -33.118  11.117  1.00 2.83  ? 91  LEU B CB  1 
ATOM   2089  C  CG  . LEU B  1 91  ? -100.089 -32.650  12.570  1.00 2.01  ? 91  LEU B CG  1 
ATOM   2090  C  CD1 . LEU B  1 91  ? -99.057  -33.384  13.424  1.00 2.71  ? 91  LEU B CD1 1 
ATOM   2091  C  CD2 . LEU B  1 91  ? -99.920  -31.154  12.677  1.00 2.00  ? 91  LEU B CD2 1 
ATOM   2092  N  N   . ALA B  1 92  ? -102.617 -34.873  10.860  1.00 3.20  ? 92  ALA B N   1 
ATOM   2093  C  CA  . ALA B  1 92  ? -103.864 -35.391  11.455  1.00 3.20  ? 92  ALA B CA  1 
ATOM   2094  C  C   . ALA B  1 92  ? -103.813 -36.932  11.534  1.00 3.63  ? 92  ALA B C   1 
ATOM   2095  O  O   . ALA B  1 92  ? -104.262 -37.548  12.515  1.00 4.22  ? 92  ALA B O   1 
ATOM   2096  C  CB  . ALA B  1 92  ? -105.103 -34.900  10.698  1.00 2.00  ? 92  ALA B CB  1 
ATOM   2097  N  N   . LEU B  1 93  ? -103.234 -37.538  10.503  1.00 3.85  ? 93  LEU B N   1 
ATOM   2098  C  CA  . LEU B  1 93  ? -103.147 -38.977  10.403  1.00 4.31  ? 93  LEU B CA  1 
ATOM   2099  C  C   . LEU B  1 93  ? -102.248 -39.576  11.480  1.00 4.79  ? 93  LEU B C   1 
ATOM   2100  O  O   . LEU B  1 93  ? -102.614 -40.584  12.083  1.00 5.08  ? 93  LEU B O   1 
ATOM   2101  C  CB  . LEU B  1 93  ? -102.640 -39.360  9.026   1.00 4.19  ? 93  LEU B CB  1 
ATOM   2102  C  CG  . LEU B  1 93  ? -102.812 -40.825  8.673   1.00 5.16  ? 93  LEU B CG  1 
ATOM   2103  C  CD1 . LEU B  1 93  ? -104.292 -41.199  8.685   1.00 5.05  ? 93  LEU B CD1 1 
ATOM   2104  C  CD2 . LEU B  1 93  ? -102.196 -41.041  7.313   1.00 4.52  ? 93  LEU B CD2 1 
ATOM   2105  N  N   . GLU B  1 94  ? -101.085 -38.944  11.719  1.00 4.92  ? 94  GLU B N   1 
ATOM   2106  C  CA  . GLU B  1 94  ? -100.162 -39.365  12.756  1.00 5.01  ? 94  GLU B CA  1 
ATOM   2107  C  C   . GLU B  1 94  ? -100.824 -39.236  14.125  1.00 4.86  ? 94  GLU B C   1 
ATOM   2108  O  O   . GLU B  1 94  ? -100.716 -40.127  14.977  1.00 4.49  ? 94  GLU B O   1 
ATOM   2109  C  CB  . GLU B  1 94  ? -98.880  -38.570  12.702  1.00 5.03  ? 94  GLU B CB  1 
ATOM   2110  C  CG  . GLU B  1 94  ? -98.071  -38.767  11.448  1.00 7.76  ? 94  GLU B CG  1 
ATOM   2111  C  CD  . GLU B  1 94  ? -97.111  -39.951  11.518  1.00 13.84 ? 94  GLU B CD  1 
ATOM   2112  O  OE1 . GLU B  1 94  ? -97.147  -40.684  12.543  1.00 15.09 ? 94  GLU B OE1 1 
ATOM   2113  O  OE2 . GLU B  1 94  ? -96.322  -40.163  10.539  1.00 14.50 ? 94  GLU B OE2 1 
ATOM   2114  N  N   . LEU B  1 95  ? -101.529 -38.131  14.333  1.00 4.97  ? 95  LEU B N   1 
ATOM   2115  C  CA  . LEU B  1 95  ? -102.244 -37.908  15.564  1.00 4.80  ? 95  LEU B CA  1 
ATOM   2116  C  C   . LEU B  1 95  ? -103.296 -38.983  15.832  1.00 5.52  ? 95  LEU B C   1 
ATOM   2117  O  O   . LEU B  1 95  ? -103.392 -39.464  16.960  1.00 5.95  ? 95  LEU B O   1 
ATOM   2118  C  CB  . LEU B  1 95  ? -102.842 -36.517  15.571  1.00 4.57  ? 95  LEU B CB  1 
ATOM   2119  C  CG  . LEU B  1 95  ? -102.139 -35.413  16.372  1.00 4.44  ? 95  LEU B CG  1 
ATOM   2120  C  CD1 . LEU B  1 95  ? -100.706 -35.730  16.705  1.00 2.67  ? 95  LEU B CD1 1 
ATOM   2121  C  CD2 . LEU B  1 95  ? -102.233 -34.101  15.670  1.00 3.34  ? 95  LEU B CD2 1 
ATOM   2122  N  N   . ASP B  1 96  ? -104.060 -39.401  14.823  1.00 5.55  ? 96  ASP B N   1 
ATOM   2123  C  CA  . ASP B  1 96  ? -105.023 -40.470  15.060  1.00 6.34  ? 96  ASP B CA  1 
ATOM   2124  C  C   . ASP B  1 96  ? -104.364 -41.807  15.322  1.00 5.91  ? 96  ASP B C   1 
ATOM   2125  O  O   . ASP B  1 96  ? -104.880 -42.614  16.083  1.00 5.85  ? 96  ASP B O   1 
ATOM   2126  C  CB  . ASP B  1 96  ? -106.022 -40.606  13.925  1.00 7.35  ? 96  ASP B CB  1 
ATOM   2127  C  CG  . ASP B  1 96  ? -107.087 -39.531  13.959  1.00 13.90 ? 96  ASP B CG  1 
ATOM   2128  O  OD1 . ASP B  1 96  ? -107.441 -39.012  15.073  1.00 19.36 ? 96  ASP B OD1 1 
ATOM   2129  O  OD2 . ASP B  1 96  ? -107.586 -39.202  12.851  1.00 19.45 ? 96  ASP B OD2 1 
ATOM   2130  N  N   . GLY B  1 97  ? -103.244 -42.063  14.671  1.00 5.49  ? 97  GLY B N   1 
ATOM   2131  C  CA  . GLY B  1 97  ? -102.553 -43.296  14.901  1.00 5.58  ? 97  GLY B CA  1 
ATOM   2132  C  C   . GLY B  1 97  ? -101.897 -43.309  16.262  1.00 5.91  ? 97  GLY B C   1 
ATOM   2133  O  O   . GLY B  1 97  ? -101.826 -44.367  16.899  1.00 5.95  ? 97  GLY B O   1 
ATOM   2134  N  N   . ALA B  1 98  ? -101.395 -42.166  16.719  1.00 6.49  ? 98  ALA B N   1 
ATOM   2135  C  CA  . ALA B  1 98  ? -100.778 -42.124  18.047  1.00 7.80  ? 98  ALA B CA  1 
ATOM   2136  C  C   . ALA B  1 98  ? -101.820 -42.470  19.122  1.00 9.22  ? 98  ALA B C   1 
ATOM   2137  O  O   . ALA B  1 98  ? -101.530 -43.177  20.065  1.00 8.84  ? 98  ALA B O   1 
ATOM   2138  C  CB  . ALA B  1 98  ? -100.144 -40.777  18.300  1.00 6.35  ? 98  ALA B CB  1 
ATOM   2139  N  N   . LYS B  1 99  ? -103.040 -41.982  18.917  1.00 11.32 ? 99  LYS B N   1 
ATOM   2140  C  CA  . LYS B  1 99  ? -104.154 -42.212  19.793  1.00 13.60 ? 99  LYS B CA  1 
ATOM   2141  C  C   . LYS B  1 99  ? -104.412 -43.707  19.868  1.00 11.96 ? 99  LYS B C   1 
ATOM   2142  O  O   . LYS B  1 99  ? -104.420 -44.264  20.964  1.00 12.43 ? 99  LYS B O   1 
ATOM   2143  C  CB  . LYS B  1 99  ? -105.366 -41.432  19.268  1.00 14.38 ? 99  LYS B CB  1 
ATOM   2144  C  CG  . LYS B  1 99  ? -106.465 -41.065  20.280  1.00 18.32 ? 99  LYS B CG  1 
ATOM   2145  C  CD  . LYS B  1 99  ? -107.431 -39.996  19.691  1.00 19.24 ? 99  LYS B CD  1 
ATOM   2146  C  CE  . LYS B  1 99  ? -106.853 -38.503  19.679  1.00 22.80 ? 99  LYS B CE  1 
ATOM   2147  N  NZ  . LYS B  1 99  ? -107.174 -37.719  18.386  1.00 22.13 ? 99  LYS B NZ  1 
ATOM   2148  N  N   . ASN B  1 100 ? -104.569 -44.362  18.715  1.00 9.86  ? 100 ASN B N   1 
ATOM   2149  C  CA  . ASN B  1 100 ? -104.736 -45.816  18.654  1.00 8.12  ? 100 ASN B CA  1 
ATOM   2150  C  C   . ASN B  1 100 ? -103.590 -46.599  19.331  1.00 7.36  ? 100 ASN B C   1 
ATOM   2151  O  O   . ASN B  1 100 ? -103.810 -47.615  20.011  1.00 6.44  ? 100 ASN B O   1 
ATOM   2152  C  CB  . ASN B  1 100 ? -104.884 -46.304  17.214  1.00 7.85  ? 100 ASN B CB  1 
ATOM   2153  C  CG  . ASN B  1 100 ? -106.125 -45.742  16.499  1.00 8.34  ? 100 ASN B CG  1 
ATOM   2154  O  OD1 . ASN B  1 100 ? -106.126 -45.645  15.279  1.00 9.74  ? 100 ASN B OD1 1 
ATOM   2155  N  ND2 . ASN B  1 100 ? -107.160 -45.376  17.237  1.00 6.52  ? 100 ASN B ND2 1 
ATOM   2156  N  N   . LEU B  1 101 ? -102.366 -46.121  19.132  1.00 5.82  ? 101 LEU B N   1 
ATOM   2157  C  CA  . LEU B  1 101 ? -101.199 -46.756  19.696  1.00 3.86  ? 101 LEU B CA  1 
ATOM   2158  C  C   . LEU B  1 101 ? -101.224 -46.671  21.209  1.00 3.44  ? 101 LEU B C   1 
ATOM   2159  O  O   . LEU B  1 101 ? -100.926 -47.665  21.890  1.00 3.00  ? 101 LEU B O   1 
ATOM   2160  C  CB  . LEU B  1 101 ? -99.931  -46.124  19.147  1.00 4.13  ? 101 LEU B CB  1 
ATOM   2161  C  CG  . LEU B  1 101 ? -99.279  -46.769  17.930  1.00 2.77  ? 101 LEU B CG  1 
ATOM   2162  C  CD1 . LEU B  1 101 ? -98.341  -45.795  17.242  1.00 3.13  ? 101 LEU B CD1 1 
ATOM   2163  C  CD2 . LEU B  1 101 ? -98.509  -47.974  18.353  1.00 2.00  ? 101 LEU B CD2 1 
ATOM   2164  N  N   . ARG B  1 102 ? -101.608 -45.506  21.738  1.00 3.01  ? 102 ARG B N   1 
ATOM   2165  C  CA  A ARG B  1 102 ? -101.699 -45.316  23.189  0.50 3.16  ? 102 ARG B CA  1 
ATOM   2166  C  CA  B ARG B  1 102 ? -101.691 -45.314  23.185  0.50 3.18  ? 102 ARG B CA  1 
ATOM   2167  C  C   . ARG B  1 102 ? -102.703 -46.315  23.766  1.00 3.61  ? 102 ARG B C   1 
ATOM   2168  O  O   . ARG B  1 102 ? -102.429 -46.969  24.787  1.00 3.81  ? 102 ARG B O   1 
ATOM   2169  C  CB  A ARG B  1 102 ? -102.040 -43.862  23.551  0.50 2.54  ? 102 ARG B CB  1 
ATOM   2170  C  CB  B ARG B  1 102 ? -101.998 -43.844  23.541  0.50 2.55  ? 102 ARG B CB  1 
ATOM   2171  C  CG  A ARG B  1 102 ? -101.013 -42.874  22.991  0.50 3.08  ? 102 ARG B CG  1 
ATOM   2172  C  CG  B ARG B  1 102 ? -100.792 -42.897  23.271  0.50 3.16  ? 102 ARG B CG  1 
ATOM   2173  C  CD  A ARG B  1 102 ? -100.941 -41.495  23.657  0.50 3.45  ? 102 ARG B CD  1 
ATOM   2174  C  CD  B ARG B  1 102 ? -101.044 -41.368  23.389  0.50 3.53  ? 102 ARG B CD  1 
ATOM   2175  N  NE  A ARG B  1 102 ? -99.552  -41.041  23.675  0.50 4.47  ? 102 ARG B NE  1 
ATOM   2176  N  NE  B ARG B  1 102 ? -102.057 -40.895  22.436  0.50 5.97  ? 102 ARG B NE  1 
ATOM   2177  C  CZ  A ARG B  1 102 ? -98.983  -40.303  22.739  0.50 5.97  ? 102 ARG B CZ  1 
ATOM   2178  C  CZ  B ARG B  1 102 ? -102.616 -39.682  22.423  0.50 7.19  ? 102 ARG B CZ  1 
ATOM   2179  N  NH1 A ARG B  1 102 ? -99.671  -39.879  21.703  0.50 9.11  ? 102 ARG B NH1 1 
ATOM   2180  N  NH1 B ARG B  1 102 ? -102.272 -38.744  23.298  0.50 10.63 ? 102 ARG B NH1 1 
ATOM   2181  N  NH2 A ARG B  1 102 ? -97.712  -39.972  22.846  0.50 7.38  ? 102 ARG B NH2 1 
ATOM   2182  N  NH2 B ARG B  1 102 ? -103.531 -39.408  21.529  0.50 7.27  ? 102 ARG B NH2 1 
ATOM   2183  N  N   . GLU B  1 103 ? -103.854 -46.466  23.076  1.00 5.07  ? 103 GLU B N   1 
ATOM   2184  C  CA  . GLU B  1 103 ? -104.919 -47.378  23.492  1.00 6.39  ? 103 GLU B CA  1 
ATOM   2185  C  C   . GLU B  1 103 ? -104.426 -48.837  23.498  1.00 4.18  ? 103 GLU B C   1 
ATOM   2186  O  O   . GLU B  1 103 ? -104.568 -49.521  24.507  1.00 3.97  ? 103 GLU B O   1 
ATOM   2187  C  CB  . GLU B  1 103 ? -106.166 -47.162  22.622  1.00 5.90  ? 103 GLU B CB  1 
ATOM   2188  C  CG  . GLU B  1 103 ? -107.448 -47.977  23.007  1.00 10.48 ? 103 GLU B CG  1 
ATOM   2189  C  CD  . GLU B  1 103 ? -108.628 -47.823  21.935  1.00 13.89 ? 103 GLU B CD  1 
ATOM   2190  O  OE1 . GLU B  1 103 ? -108.579 -46.809  21.130  1.00 21.67 ? 103 GLU B OE1 1 
ATOM   2191  O  OE2 . GLU B  1 103 ? -109.552 -48.732  21.889  1.00 16.59 ? 103 GLU B OE2 1 
ATOM   2192  N  N   . ALA B  1 104 ? -103.802 -49.270  22.404  1.00 2.86  ? 104 ALA B N   1 
ATOM   2193  C  CA  . ALA B  1 104 ? -103.278 -50.627  22.240  1.00 2.22  ? 104 ALA B CA  1 
ATOM   2194  C  C   . ALA B  1 104 ? -102.198 -50.991  23.251  1.00 2.24  ? 104 ALA B C   1 
ATOM   2195  O  O   . ALA B  1 104 ? -102.193 -52.107  23.783  1.00 2.00  ? 104 ALA B O   1 
ATOM   2196  C  CB  . ALA B  1 104 ? -102.760 -50.825  20.853  1.00 2.00  ? 104 ALA B CB  1 
ATOM   2197  N  N   . ILE B  1 105 ? -101.298 -50.042  23.515  1.00 2.39  ? 105 ILE B N   1 
ATOM   2198  C  CA  . ILE B  1 105 ? -100.194 -50.239  24.465  1.00 2.27  ? 105 ILE B CA  1 
ATOM   2199  C  C   . ILE B  1 105 ? -100.699 -50.554  25.868  1.00 2.25  ? 105 ILE B C   1 
ATOM   2200  O  O   . ILE B  1 105 ? -100.194 -51.462  26.526  1.00 2.00  ? 105 ILE B O   1 
ATOM   2201  C  CB  . ILE B  1 105 ? -99.231  -49.021  24.462  1.00 2.00  ? 105 ILE B CB  1 
ATOM   2202  C  CG1 . ILE B  1 105 ? -98.416  -49.025  23.172  1.00 2.01  ? 105 ILE B CG1 1 
ATOM   2203  C  CG2 . ILE B  1 105 ? -98.266  -49.078  25.618  1.00 2.55  ? 105 ILE B CG2 1 
ATOM   2204  C  CD1 . ILE B  1 105 ? -97.806  -47.736  22.834  1.00 2.00  ? 105 ILE B CD1 1 
ATOM   2205  N  N   . GLY B  1 106 ? -101.711 -49.792  26.303  1.00 2.22  ? 106 GLY B N   1 
ATOM   2206  C  CA  . GLY B  1 106 ? -102.291 -49.947  27.626  1.00 2.01  ? 106 GLY B CA  1 
ATOM   2207  C  C   . GLY B  1 106 ? -102.939 -51.294  27.739  1.00 2.39  ? 106 GLY B C   1 
ATOM   2208  O  O   . GLY B  1 106 ? -102.820 -51.949  28.775  1.00 3.06  ? 106 GLY B O   1 
ATOM   2209  N  N   . TYR B  1 107 ? -103.603 -51.735  26.663  1.00 2.02  ? 107 TYR B N   1 
ATOM   2210  C  CA  . TYR B  1 107 ? -104.302 -52.996  26.693  1.00 2.00  ? 107 TYR B CA  1 
ATOM   2211  C  C   . TYR B  1 107 ? -103.329 -54.202  26.676  1.00 2.68  ? 107 TYR B C   1 
ATOM   2212  O  O   . TYR B  1 107 ? -103.518 -55.182  27.414  1.00 2.62  ? 107 TYR B O   1 
ATOM   2213  C  CB  . TYR B  1 107 ? -105.335 -53.086  25.575  1.00 2.23  ? 107 TYR B CB  1 
ATOM   2214  C  CG  . TYR B  1 107 ? -105.967 -54.457  25.561  1.00 2.11  ? 107 TYR B CG  1 
ATOM   2215  C  CD1 . TYR B  1 107 ? -106.995 -54.780  26.436  1.00 2.00  ? 107 TYR B CD1 1 
ATOM   2216  C  CD2 . TYR B  1 107 ? -105.463 -55.448  24.741  1.00 2.00  ? 107 TYR B CD2 1 
ATOM   2217  C  CE1 . TYR B  1 107 ? -107.536 -56.024  26.456  1.00 2.12  ? 107 TYR B CE1 1 
ATOM   2218  C  CE2 . TYR B  1 107 ? -105.992 -56.705  24.753  1.00 3.52  ? 107 TYR B CE2 1 
ATOM   2219  C  CZ  . TYR B  1 107 ? -107.033 -56.992  25.607  1.00 3.71  ? 107 TYR B CZ  1 
ATOM   2220  O  OH  . TYR B  1 107 ? -107.531 -58.268  25.593  1.00 4.42  ? 107 TYR B OH  1 
ATOM   2221  N  N   . ALA B  1 108 ? -102.290 -54.120  25.842  1.00 2.80  ? 108 ALA B N   1 
ATOM   2222  C  CA  . ALA B  1 108 ? -101.261 -55.159  25.799  1.00 2.70  ? 108 ALA B CA  1 
ATOM   2223  C  C   . ALA B  1 108 ? -100.633 -55.400  27.185  1.00 2.95  ? 108 ALA B C   1 
ATOM   2224  O  O   . ALA B  1 108 ? -100.385 -56.564  27.563  1.00 2.72  ? 108 ALA B O   1 
ATOM   2225  C  CB  . ALA B  1 108 ? -100.190 -54.832  24.754  1.00 2.00  ? 108 ALA B CB  1 
ATOM   2226  N  N   . ASP B  1 109 ? -100.409 -54.308  27.932  1.00 2.94  ? 109 ASP B N   1 
ATOM   2227  C  CA  . ASP B  1 109 ? -99.911  -54.400  29.281  1.00 3.26  ? 109 ASP B CA  1 
ATOM   2228  C  C   . ASP B  1 109 ? -100.881 -55.146  30.174  1.00 3.30  ? 109 ASP B C   1 
ATOM   2229  O  O   . ASP B  1 109 ? -100.489 -55.914  31.017  1.00 2.63  ? 109 ASP B O   1 
ATOM   2230  C  CB  . ASP B  1 109 ? -99.679  -53.008  29.852  1.00 3.46  ? 109 ASP B CB  1 
ATOM   2231  C  CG  . ASP B  1 109 ? -98.892  -53.030  31.145  1.00 5.60  ? 109 ASP B CG  1 
ATOM   2232  O  OD1 . ASP B  1 109 ? -99.528  -53.037  32.226  1.00 8.70  ? 109 ASP B OD1 1 
ATOM   2233  O  OD2 . ASP B  1 109 ? -97.646  -53.058  31.088  1.00 8.46  ? 109 ASP B OD2 1 
ATOM   2234  N  N   . SER B  1 110 ? -102.163 -54.919  29.989  1.00 3.73  ? 110 SER B N   1 
ATOM   2235  C  CA  . SER B  1 110 ? -103.083 -55.492  30.933  1.00 4.45  ? 110 SER B CA  1 
ATOM   2236  C  C   . SER B  1 110 ? -103.328 -56.962  30.694  1.00 3.80  ? 110 SER B C   1 
ATOM   2237  O  O   . SER B  1 110 ? -103.659 -57.654  31.638  1.00 4.02  ? 110 SER B O   1 
ATOM   2238  C  CB  . SER B  1 110 ? -104.357 -54.661  31.047  1.00 4.67  ? 110 SER B CB  1 
ATOM   2239  O  OG  . SER B  1 110 ? -104.994 -54.629  29.788  1.00 10.42 ? 110 SER B OG  1 
ATOM   2240  N  N   . VAL B  1 111 ? -103.105 -57.446  29.470  1.00 3.43  ? 111 VAL B N   1 
ATOM   2241  C  CA  . VAL B  1 111 ? -103.101 -58.903  29.207  1.00 2.88  ? 111 VAL B CA  1 
ATOM   2242  C  C   . VAL B  1 111 ? -101.706 -59.516  29.207  1.00 2.79  ? 111 VAL B C   1 
ATOM   2243  O  O   . VAL B  1 111 ? -101.539 -60.661  28.813  1.00 2.01  ? 111 VAL B O   1 
ATOM   2244  C  CB  . VAL B  1 111 ? -103.811 -59.300  27.880  1.00 2.94  ? 111 VAL B CB  1 
ATOM   2245  C  CG1 . VAL B  1 111 ? -105.279 -59.049  27.968  1.00 3.08  ? 111 VAL B CG1 1 
ATOM   2246  C  CG2 . VAL B  1 111 ? -103.219 -58.552  26.696  1.00 3.47  ? 111 VAL B CG2 1 
ATOM   2247  N  N   . HIS B  1 112 ? -100.702 -58.754  29.632  1.00 3.26  ? 112 HIS B N   1 
ATOM   2248  C  CA  . HIS B  1 112 ? -99.339  -59.279  29.801  1.00 3.77  ? 112 HIS B CA  1 
ATOM   2249  C  C   . HIS B  1 112 ? -98.592  -59.579  28.489  1.00 3.49  ? 112 HIS B C   1 
ATOM   2250  O  O   . HIS B  1 112 ? -97.605  -60.302  28.502  1.00 4.09  ? 112 HIS B O   1 
ATOM   2251  C  CB  . HIS B  1 112 ? -99.336  -60.491  30.738  1.00 3.84  ? 112 HIS B CB  1 
ATOM   2252  C  CG  . HIS B  1 112 ? -99.834  -60.170  32.110  1.00 8.24  ? 112 HIS B CG  1 
ATOM   2253  N  ND1 . HIS B  1 112 ? -101.152 -60.310  32.479  1.00 12.06 ? 112 HIS B ND1 1 
ATOM   2254  C  CD2 . HIS B  1 112 ? -99.195  -59.657  33.192  1.00 11.33 ? 112 HIS B CD2 1 
ATOM   2255  C  CE1 . HIS B  1 112 ? -101.307 -59.906  33.725  1.00 12.93 ? 112 HIS B CE1 1 
ATOM   2256  N  NE2 . HIS B  1 112 ? -100.134 -59.508  34.184  1.00 12.52 ? 112 HIS B NE2 1 
ATOM   2257  N  N   . ASP B  1 113 ? -99.039  -59.027  27.361  1.00 3.05  ? 113 ASP B N   1 
ATOM   2258  C  CA  . ASP B  1 113 ? -98.296  -59.153  26.105  1.00 2.51  ? 113 ASP B CA  1 
ATOM   2259  C  C   . ASP B  1 113 ? -97.226  -58.065  26.045  1.00 2.14  ? 113 ASP B C   1 
ATOM   2260  O  O   . ASP B  1 113 ? -97.290  -57.116  25.268  1.00 2.03  ? 113 ASP B O   1 
ATOM   2261  C  CB  . ASP B  1 113 ? -99.222  -59.104  24.886  1.00 2.57  ? 113 ASP B CB  1 
ATOM   2262  C  CG  . ASP B  1 113 ? -98.510  -59.497  23.573  1.00 3.36  ? 113 ASP B CG  1 
ATOM   2263  O  OD1 . ASP B  1 113 ? -97.267  -59.665  23.546  1.00 3.53  ? 113 ASP B OD1 1 
ATOM   2264  O  OD2 . ASP B  1 113 ? -99.208  -59.622  22.545  1.00 3.82  ? 113 ASP B OD2 1 
ATOM   2265  N  N   . TYR B  1 114 ? -96.237  -58.237  26.884  1.00 2.00  ? 114 TYR B N   1 
ATOM   2266  C  CA  . TYR B  1 114 ? -95.190  -57.275  27.056  1.00 2.23  ? 114 TYR B CA  1 
ATOM   2267  C  C   . TYR B  1 114 ? -94.312  -57.085  25.825  1.00 2.54  ? 114 TYR B C   1 
ATOM   2268  O  O   . TYR B  1 114 ? -93.820  -55.980  25.586  1.00 2.00  ? 114 TYR B O   1 
ATOM   2269  C  CB  . TYR B  1 114 ? -94.375  -57.626  28.296  1.00 2.00  ? 114 TYR B CB  1 
ATOM   2270  C  CG  . TYR B  1 114 ? -95.232  -57.542  29.543  1.00 2.50  ? 114 TYR B CG  1 
ATOM   2271  C  CD1 . TYR B  1 114 ? -95.848  -56.328  29.913  1.00 2.00  ? 114 TYR B CD1 1 
ATOM   2272  C  CD2 . TYR B  1 114 ? -95.442  -58.677  30.357  1.00 2.14  ? 114 TYR B CD2 1 
ATOM   2273  C  CE1 . TYR B  1 114 ? -96.604  -56.234  31.058  1.00 2.00  ? 114 TYR B CE1 1 
ATOM   2274  C  CE2 . TYR B  1 114 ? -96.219  -58.589  31.513  1.00 2.03  ? 114 TYR B CE2 1 
ATOM   2275  C  CZ  . TYR B  1 114 ? -96.789  -57.369  31.862  1.00 2.00  ? 114 TYR B CZ  1 
ATOM   2276  O  OH  . TYR B  1 114 ? -97.563  -57.282  32.985  1.00 2.00  ? 114 TYR B OH  1 
ATOM   2277  N  N   . VAL B  1 115 ? -94.139  -58.134  25.012  1.00 2.66  ? 115 VAL B N   1 
ATOM   2278  C  CA  . VAL B  1 115 ? -93.356  -57.910  23.811  1.00 2.57  ? 115 VAL B CA  1 
ATOM   2279  C  C   . VAL B  1 115 ? -94.093  -57.154  22.707  1.00 2.93  ? 115 VAL B C   1 
ATOM   2280  O  O   . VAL B  1 115 ? -93.520  -56.237  22.119  1.00 3.42  ? 115 VAL B O   1 
ATOM   2281  C  CB  . VAL B  1 115 ? -92.359  -59.015  23.424  1.00 2.30  ? 115 VAL B CB  1 
ATOM   2282  C  CG1 . VAL B  1 115 ? -92.431  -60.142  24.358  1.00 2.92  ? 115 VAL B CG1 1 
ATOM   2283  C  CG2 . VAL B  1 115 ? -92.413  -59.389  21.958  1.00 2.00  ? 115 VAL B CG2 1 
ATOM   2284  N  N   . SER B  1 116 ? -95.354  -57.486  22.468  1.00 2.72  ? 116 SER B N   1 
ATOM   2285  C  CA  . SER B  1 116 ? -96.159  -56.611  21.632  1.00 2.48  ? 116 SER B CA  1 
ATOM   2286  C  C   . SER B  1 116 ? -96.123  -55.159  22.151  1.00 2.78  ? 116 SER B C   1 
ATOM   2287  O  O   . SER B  1 116 ? -95.963  -54.236  21.362  1.00 3.12  ? 116 SER B O   1 
ATOM   2288  C  CB  . SER B  1 116 ? -97.590  -57.078  21.523  1.00 2.02  ? 116 SER B CB  1 
ATOM   2289  O  OG  . SER B  1 116 ? -97.639  -58.330  20.880  1.00 2.06  ? 116 SER B OG  1 
ATOM   2290  N  N   . ARG B  1 117 ? -96.225  -54.957  23.463  1.00 2.55  ? 117 ARG B N   1 
ATOM   2291  C  CA  . ARG B  1 117 ? -96.204  -53.621  24.006  1.00 2.22  ? 117 ARG B CA  1 
ATOM   2292  C  C   . ARG B  1 117 ? -94.912  -52.921  23.649  1.00 3.10  ? 117 ARG B C   1 
ATOM   2293  O  O   . ARG B  1 117 ? -94.912  -51.765  23.182  1.00 3.08  ? 117 ARG B O   1 
ATOM   2294  C  CB  . ARG B  1 117 ? -96.390  -53.634  25.505  1.00 2.01  ? 117 ARG B CB  1 
ATOM   2295  C  CG  . ARG B  1 117 ? -96.292  -52.272  26.120  1.00 2.00  ? 117 ARG B CG  1 
ATOM   2296  C  CD  . ARG B  1 117 ? -96.805  -52.310  27.535  1.00 2.00  ? 117 ARG B CD  1 
ATOM   2297  N  NE  . ARG B  1 117 ? -96.214  -51.260  28.366  1.00 2.91  ? 117 ARG B NE  1 
ATOM   2298  C  CZ  . ARG B  1 117 ? -96.904  -50.331  29.020  1.00 2.72  ? 117 ARG B CZ  1 
ATOM   2299  N  NH1 . ARG B  1 117 ? -98.236  -50.297  28.972  1.00 2.00  ? 117 ARG B NH1 1 
ATOM   2300  N  NH2 . ARG B  1 117 ? -96.243  -49.456  29.763  1.00 2.02  ? 117 ARG B NH2 1 
ATOM   2301  N  N   . ASP B  1 118 ? -93.814  -53.643  23.835  1.00 3.52  ? 118 ASP B N   1 
ATOM   2302  C  CA  . ASP B  1 118 ? -92.478  -53.112  23.643  1.00 3.88  ? 118 ASP B CA  1 
ATOM   2303  C  C   . ASP B  1 118 ? -92.312  -52.716  22.181  1.00 3.98  ? 118 ASP B C   1 
ATOM   2304  O  O   . ASP B  1 118 ? -91.843  -51.644  21.887  1.00 5.12  ? 118 ASP B O   1 
ATOM   2305  C  CB  . ASP B  1 118 ? -91.470  -54.184  24.054  1.00 4.81  ? 118 ASP B CB  1 
ATOM   2306  C  CG  . ASP B  1 118 ? -90.019  -53.681  24.054  1.00 7.83  ? 118 ASP B CG  1 
ATOM   2307  O  OD1 . ASP B  1 118 ? -89.717  -52.726  24.830  1.00 11.69 ? 118 ASP B OD1 1 
ATOM   2308  O  OD2 . ASP B  1 118 ? -89.174  -54.263  23.306  1.00 11.12 ? 118 ASP B OD2 1 
ATOM   2309  N  N   . MET B  1 119 ? -92.733  -53.567  21.260  1.00 3.98  ? 119 MET B N   1 
ATOM   2310  C  CA  . MET B  1 119 ? -92.699  -53.216  19.860  1.00 4.19  ? 119 MET B CA  1 
ATOM   2311  C  C   . MET B  1 119 ? -93.553  -51.964  19.570  1.00 3.89  ? 119 MET B C   1 
ATOM   2312  O  O   . MET B  1 119 ? -93.123  -51.094  18.819  1.00 4.57  ? 119 MET B O   1 
ATOM   2313  C  CB  . MET B  1 119 ? -93.179  -54.377  19.002  1.00 4.10  ? 119 MET B CB  1 
ATOM   2314  C  CG  . MET B  1 119 ? -93.565  -53.995  17.579  1.00 4.22  ? 119 MET B CG  1 
ATOM   2315  S  SD  . MET B  1 119 ? -94.716  -55.238  16.889  1.00 5.93  ? 119 MET B SD  1 
ATOM   2316  C  CE  . MET B  1 119 ? -93.533  -56.562  16.664  1.00 9.19  ? 119 MET B CE  1 
ATOM   2317  N  N   . MET B  1 120 ? -94.737  -51.865  20.168  1.00 3.11  ? 120 MET B N   1 
ATOM   2318  C  CA  . MET B  1 120 ? -95.579  -50.714  19.932  1.00 3.21  ? 120 MET B CA  1 
ATOM   2319  C  C   . MET B  1 120 ? -94.997  -49.423  20.469  1.00 3.21  ? 120 MET B C   1 
ATOM   2320  O  O   . MET B  1 120 ? -95.178  -48.389  19.847  1.00 2.74  ? 120 MET B O   1 
ATOM   2321  C  CB  . MET B  1 120 ? -96.976  -50.937  20.491  1.00 2.56  ? 120 MET B CB  1 
ATOM   2322  C  CG  . MET B  1 120 ? -97.691  -52.017  19.755  1.00 2.70  ? 120 MET B CG  1 
ATOM   2323  S  SD  . MET B  1 120 ? -99.404  -52.223  20.207  1.00 5.72  ? 120 MET B SD  1 
ATOM   2324  C  CE  . MET B  1 120 ? -99.277  -52.881  21.874  1.00 2.39  ? 120 MET B CE  1 
ATOM   2325  N  N   . ILE B  1 121 ? -94.296  -49.473  21.616  1.00 3.55  ? 121 ILE B N   1 
ATOM   2326  C  CA  . ILE B  1 121 ? -93.719  -48.271  22.192  1.00 3.26  ? 121 ILE B CA  1 
ATOM   2327  C  C   . ILE B  1 121 ? -92.621  -47.739  21.284  1.00 4.02  ? 121 ILE B C   1 
ATOM   2328  O  O   . ILE B  1 121 ? -92.540  -46.523  21.081  1.00 3.58  ? 121 ILE B O   1 
ATOM   2329  C  CB  . ILE B  1 121 ? -93.185  -48.480  23.596  1.00 3.14  ? 121 ILE B CB  1 
ATOM   2330  C  CG1 . ILE B  1 121 ? -94.320  -48.576  24.595  1.00 2.66  ? 121 ILE B CG1 1 
ATOM   2331  C  CG2 . ILE B  1 121 ? -92.358  -47.298  24.031  1.00 2.02  ? 121 ILE B CG2 1 
ATOM   2332  C  CD1 . ILE B  1 121 ? -93.913  -49.296  25.886  1.00 2.81  ? 121 ILE B CD1 1 
ATOM   2333  N  N   . GLU B  1 122 ? -91.800  -48.624  20.704  1.00 4.71  ? 122 GLU B N   1 
ATOM   2334  C  CA  . GLU B  1 122 ? -90.791  -48.156  19.754  1.00 5.53  ? 122 GLU B CA  1 
ATOM   2335  C  C   . GLU B  1 122 ? -91.430  -47.493  18.532  1.00 5.38  ? 122 GLU B C   1 
ATOM   2336  O  O   . GLU B  1 122 ? -90.974  -46.437  18.089  1.00 6.39  ? 122 GLU B O   1 
ATOM   2337  C  CB  . GLU B  1 122 ? -89.778  -49.232  19.375  1.00 5.83  ? 122 GLU B CB  1 
ATOM   2338  C  CG  . GLU B  1 122 ? -88.817  -49.689  20.552  1.00 11.57 ? 122 GLU B CG  1 
ATOM   2339  C  CD  . GLU B  1 122 ? -88.134  -48.486  21.418  1.00 19.42 ? 122 GLU B CD  1 
ATOM   2340  O  OE1 . GLU B  1 122 ? -87.130  -47.823  20.907  1.00 20.92 ? 122 GLU B OE1 1 
ATOM   2341  O  OE2 . GLU B  1 122 ? -88.581  -48.238  22.604  1.00 18.97 ? 122 GLU B OE2 1 
ATOM   2342  N  N   . ILE B  1 123 ? -92.519  -48.071  18.023  1.00 4.53  ? 123 ILE B N   1 
ATOM   2343  C  CA  . ILE B  1 123 ? -93.212  -47.501  16.873  1.00 3.59  ? 123 ILE B CA  1 
ATOM   2344  C  C   . ILE B  1 123 ? -93.757  -46.097  17.225  1.00 4.07  ? 123 ILE B C   1 
ATOM   2345  O  O   . ILE B  1 123 ? -93.554  -45.130  16.465  1.00 3.88  ? 123 ILE B O   1 
ATOM   2346  C  CB  . ILE B  1 123 ? -94.271  -48.462  16.327  1.00 3.54  ? 123 ILE B CB  1 
ATOM   2347  C  CG1 . ILE B  1 123 ? -93.577  -49.637  15.635  1.00 2.43  ? 123 ILE B CG1 1 
ATOM   2348  C  CG2 . ILE B  1 123 ? -95.285  -47.749  15.385  1.00 2.47  ? 123 ILE B CG2 1 
ATOM   2349  C  CD1 . ILE B  1 123 ? -94.453  -50.814  15.403  1.00 2.00  ? 123 ILE B CD1 1 
ATOM   2350  N  N   . LEU B  1 124 ? -94.379  -45.979  18.400  1.00 3.93  ? 124 LEU B N   1 
ATOM   2351  C  CA  . LEU B  1 124 ? -94.956  -44.716  18.850  1.00 3.94  ? 124 LEU B CA  1 
ATOM   2352  C  C   . LEU B  1 124 ? -93.868  -43.638  18.931  1.00 4.54  ? 124 LEU B C   1 
ATOM   2353  O  O   . LEU B  1 124 ? -94.098  -42.482  18.577  1.00 4.90  ? 124 LEU B O   1 
ATOM   2354  C  CB  . LEU B  1 124 ? -95.651  -44.876  20.196  1.00 3.42  ? 124 LEU B CB  1 
ATOM   2355  C  CG  . LEU B  1 124 ? -96.279  -43.635  20.848  1.00 2.98  ? 124 LEU B CG  1 
ATOM   2356  C  CD1 . LEU B  1 124 ? -97.405  -42.956  20.037  1.00 2.00  ? 124 LEU B CD1 1 
ATOM   2357  C  CD2 . LEU B  1 124 ? -96.759  -44.023  22.221  1.00 2.00  ? 124 LEU B CD2 1 
ATOM   2358  N  N   . ARG B  1 125 ? -92.687  -44.030  19.387  1.00 4.98  ? 125 ARG B N   1 
ATOM   2359  C  CA  . ARG B  1 125 ? -91.540  -43.144  19.417  1.00 5.52  ? 125 ARG B CA  1 
ATOM   2360  C  C   . ARG B  1 125 ? -91.164  -42.668  18.000  1.00 5.79  ? 125 ARG B C   1 
ATOM   2361  O  O   . ARG B  1 125 ? -90.825  -41.502  17.827  1.00 5.63  ? 125 ARG B O   1 
ATOM   2362  C  CB  . ARG B  1 125 ? -90.364  -43.841  20.086  1.00 5.58  ? 125 ARG B CB  1 
ATOM   2363  C  CG  . ARG B  1 125 ? -89.154  -42.983  20.231  1.00 7.90  ? 125 ARG B CG  1 
ATOM   2364  C  CD  . ARG B  1 125 ? -88.086  -43.648  21.081  1.00 12.88 ? 125 ARG B CD  1 
ATOM   2365  N  NE  . ARG B  1 125 ? -86.842  -42.863  21.008  1.00 19.03 ? 125 ARG B NE  1 
ATOM   2366  C  CZ  . ARG B  1 125 ? -85.629  -43.301  21.410  1.00 22.49 ? 125 ARG B CZ  1 
ATOM   2367  N  NH1 . ARG B  1 125 ? -85.462  -44.548  21.928  1.00 21.49 ? 125 ARG B NH1 1 
ATOM   2368  N  NH2 . ARG B  1 125 ? -84.563  -42.492  21.311  1.00 19.90 ? 125 ARG B NH2 1 
ATOM   2369  N  N   . ASP B  1 126 ? -91.257  -43.542  16.990  1.00 6.01  ? 126 ASP B N   1 
ATOM   2370  C  CA  . ASP B  1 126 ? -90.984  -43.094  15.632  1.00 6.52  ? 126 ASP B CA  1 
ATOM   2371  C  C   . ASP B  1 126 ? -92.079  -42.132  15.168  1.00 6.75  ? 126 ASP B C   1 
ATOM   2372  O  O   . ASP B  1 126 ? -91.801  -41.197  14.434  1.00 7.41  ? 126 ASP B O   1 
ATOM   2373  C  CB  . ASP B  1 126 ? -90.803  -44.239  14.616  1.00 6.62  ? 126 ASP B CB  1 
ATOM   2374  C  CG  . ASP B  1 126 ? -89.662  -45.198  14.976  1.00 9.55  ? 126 ASP B CG  1 
ATOM   2375  O  OD1 . ASP B  1 126 ? -89.674  -46.373  14.495  1.00 10.15 ? 126 ASP B OD1 1 
ATOM   2376  O  OD2 . ASP B  1 126 ? -88.734  -44.801  15.736  1.00 13.13 ? 126 ASP B OD2 1 
ATOM   2377  N  N   . GLU B  1 127 ? -93.313  -42.350  15.597  1.00 6.85  ? 127 GLU B N   1 
ATOM   2378  C  CA  . GLU B  1 127 ? -94.440  -41.549  15.113  1.00 6.87  ? 127 GLU B CA  1 
ATOM   2379  C  C   . GLU B  1 127 ? -94.353  -40.186  15.691  1.00 6.01  ? 127 GLU B C   1 
ATOM   2380  O  O   . GLU B  1 127 ? -94.533  -39.203  14.995  1.00 5.34  ? 127 GLU B O   1 
ATOM   2381  C  CB  . GLU B  1 127 ? -95.807  -42.169  15.475  1.00 6.96  ? 127 GLU B CB  1 
ATOM   2382  C  CG  . GLU B  1 127 ? -95.987  -43.616  14.952  1.00 11.05 ? 127 GLU B CG  1 
ATOM   2383  C  CD  . GLU B  1 127 ? -95.976  -43.778  13.416  1.00 12.30 ? 127 GLU B CD  1 
ATOM   2384  O  OE1 . GLU B  1 127 ? -96.261  -44.897  12.954  1.00 14.05 ? 127 GLU B OE1 1 
ATOM   2385  O  OE2 . GLU B  1 127 ? -95.713  -42.810  12.662  1.00 12.88 ? 127 GLU B OE2 1 
ATOM   2386  N  N   . GLU B  1 128 ? -94.088  -40.163  16.995  1.00 6.07  ? 128 GLU B N   1 
ATOM   2387  C  CA  . GLU B  1 128 ? -93.900  -38.962  17.767  1.00 5.50  ? 128 GLU B CA  1 
ATOM   2388  C  C   . GLU B  1 128 ? -92.792  -38.116  17.040  1.00 5.42  ? 128 GLU B C   1 
ATOM   2389  O  O   . GLU B  1 128 ? -92.915  -36.896  16.910  1.00 5.31  ? 128 GLU B O   1 
ATOM   2390  C  CB  . GLU B  1 128 ? -93.520  -39.423  19.155  1.00 5.51  ? 128 GLU B CB  1 
ATOM   2391  C  CG  . GLU B  1 128 ? -93.887  -38.536  20.301  1.00 6.80  ? 128 GLU B CG  1 
ATOM   2392  C  CD  . GLU B  1 128 ? -94.798  -39.194  21.329  1.00 7.26  ? 128 GLU B CD  1 
ATOM   2393  O  OE1 . GLU B  1 128 ? -95.796  -39.823  20.949  1.00 9.80  ? 128 GLU B OE1 1 
ATOM   2394  O  OE2 . GLU B  1 128 ? -94.551  -39.050  22.532  1.00 7.50  ? 128 GLU B OE2 1 
ATOM   2395  N  N   . GLY B  1 129 ? -91.750  -38.783  16.509  1.00 4.79  ? 129 GLY B N   1 
ATOM   2396  C  CA  . GLY B  1 129 ? -90.738  -38.138  15.692  1.00 4.11  ? 129 GLY B CA  1 
ATOM   2397  C  C   . GLY B  1 129 ? -91.300  -37.505  14.411  1.00 5.05  ? 129 GLY B C   1 
ATOM   2398  O  O   . GLY B  1 129 ? -90.962  -36.369  14.082  1.00 5.08  ? 129 GLY B O   1 
ATOM   2399  N  N   . HIS B  1 130 ? -92.139  -38.227  13.666  1.00 5.20  ? 130 HIS B N   1 
ATOM   2400  C  CA  . HIS B  1 130 ? -92.781  -37.657  12.496  1.00 5.81  ? 130 HIS B CA  1 
ATOM   2401  C  C   . HIS B  1 130 ? -93.676  -36.465  12.878  1.00 5.56  ? 130 HIS B C   1 
ATOM   2402  O  O   . HIS B  1 130 ? -93.675  -35.435  12.209  1.00 5.60  ? 130 HIS B O   1 
ATOM   2403  C  CB  . HIS B  1 130 ? -93.619  -38.694  11.776  1.00 6.67  ? 130 HIS B CB  1 
ATOM   2404  C  CG  . HIS B  1 130 ? -92.848  -39.888  11.307  1.00 10.71 ? 130 HIS B CG  1 
ATOM   2405  N  ND1 . HIS B  1 130 ? -93.461  -41.085  10.996  1.00 14.39 ? 130 HIS B ND1 1 
ATOM   2406  C  CD2 . HIS B  1 130 ? -91.525  -40.081  11.107  1.00 11.83 ? 130 HIS B CD2 1 
ATOM   2407  C  CE1 . HIS B  1 130 ? -92.547  -41.957  10.618  1.00 14.21 ? 130 HIS B CE1 1 
ATOM   2408  N  NE2 . HIS B  1 130 ? -91.367  -41.371  10.672  1.00 12.90 ? 130 HIS B NE2 1 
ATOM   2409  N  N   . ILE B  1 131 ? -94.439  -36.607  13.959  1.00 4.99  ? 131 ILE B N   1 
ATOM   2410  C  CA  . ILE B  1 131 ? -95.245  -35.531  14.466  1.00 4.06  ? 131 ILE B CA  1 
ATOM   2411  C  C   . ILE B  1 131 ? -94.348  -34.294  14.698  1.00 4.71  ? 131 ILE B C   1 
ATOM   2412  O  O   . ILE B  1 131 ? -94.670  -33.182  14.259  1.00 4.80  ? 131 ILE B O   1 
ATOM   2413  C  CB  . ILE B  1 131 ? -96.028  -35.952  15.731  1.00 3.98  ? 131 ILE B CB  1 
ATOM   2414  C  CG1 . ILE B  1 131 ? -97.061  -37.040  15.365  1.00 3.93  ? 131 ILE B CG1 1 
ATOM   2415  C  CG2 . ILE B  1 131 ? -96.698  -34.743  16.387  1.00 2.68  ? 131 ILE B CG2 1 
ATOM   2416  C  CD1 . ILE B  1 131 ? -97.740  -37.762  16.540  1.00 2.03  ? 131 ILE B CD1 1 
ATOM   2417  N  N   . ASP B  1 132 ? -93.208  -34.476  15.342  1.00 4.30  ? 132 ASP B N   1 
ATOM   2418  C  CA  . ASP B  1 132 ? -92.309  -33.362  15.568  1.00 4.27  ? 132 ASP B CA  1 
ATOM   2419  C  C   . ASP B  1 132 ? -91.944  -32.674  14.250  1.00 4.09  ? 132 ASP B C   1 
ATOM   2420  O  O   . ASP B  1 132 ? -92.048  -31.459  14.126  1.00 4.03  ? 132 ASP B O   1 
ATOM   2421  C  CB  . ASP B  1 132 ? -91.064  -33.875  16.273  1.00 4.66  ? 132 ASP B CB  1 
ATOM   2422  C  CG  . ASP B  1 132 ? -90.161  -32.753  16.789  1.00 6.37  ? 132 ASP B CG  1 
ATOM   2423  O  OD1 . ASP B  1 132 ? -90.502  -31.554  16.657  1.00 4.72  ? 132 ASP B OD1 1 
ATOM   2424  O  OD2 . ASP B  1 132 ? -89.096  -33.095  17.358  1.00 10.49 ? 132 ASP B OD2 1 
ATOM   2425  N  N   . TRP B  1 133 ? -91.554  -33.466  13.253  1.00 3.87  ? 133 TRP B N   1 
ATOM   2426  C  CA  . TRP B  1 133 ? -91.116  -32.908  11.994  1.00 3.77  ? 133 TRP B CA  1 
ATOM   2427  C  C   . TRP B  1 133 ? -92.238  -32.137  11.289  1.00 3.77  ? 133 TRP B C   1 
ATOM   2428  O  O   . TRP B  1 133 ? -92.034  -30.998  10.880  1.00 3.95  ? 133 TRP B O   1 
ATOM   2429  C  CB  . TRP B  1 133 ? -90.506  -33.973  11.091  1.00 3.77  ? 133 TRP B CB  1 
ATOM   2430  C  CG  . TRP B  1 133 ? -89.986  -33.384  9.835   1.00 4.09  ? 133 TRP B CG  1 
ATOM   2431  C  CD1 . TRP B  1 133 ? -88.777  -32.759  9.649   1.00 4.05  ? 133 TRP B CD1 1 
ATOM   2432  C  CD2 . TRP B  1 133 ? -90.671  -33.314  8.582   1.00 4.39  ? 133 TRP B CD2 1 
ATOM   2433  N  NE1 . TRP B  1 133 ? -88.666  -32.324  8.349   1.00 3.72  ? 133 TRP B NE1 1 
ATOM   2434  C  CE2 . TRP B  1 133 ? -89.808  -32.647  7.668   1.00 3.86  ? 133 TRP B CE2 1 
ATOM   2435  C  CE3 . TRP B  1 133 ? -91.917  -33.763  8.136   1.00 4.10  ? 133 TRP B CE3 1 
ATOM   2436  C  CZ2 . TRP B  1 133 ? -90.155  -32.407  6.352   1.00 4.24  ? 133 TRP B CZ2 1 
ATOM   2437  C  CZ3 . TRP B  1 133 ? -92.266  -33.518  6.795   1.00 3.87  ? 133 TRP B CZ3 1 
ATOM   2438  C  CH2 . TRP B  1 133 ? -91.385  -32.849  5.927   1.00 4.46  ? 133 TRP B CH2 1 
ATOM   2439  N  N   . LEU B  1 134 ? -93.420  -32.746  11.170  1.00 3.45  ? 134 LEU B N   1 
ATOM   2440  C  CA  . LEU B  1 134 ? -94.563  -32.097  10.521  1.00 2.59  ? 134 LEU B CA  1 
ATOM   2441  C  C   . LEU B  1 134 ? -94.934  -30.801  11.216  1.00 2.53  ? 134 LEU B C   1 
ATOM   2442  O  O   . LEU B  1 134 ? -95.176  -29.811  10.558  1.00 2.38  ? 134 LEU B O   1 
ATOM   2443  C  CB  . LEU B  1 134 ? -95.778  -33.001  10.540  1.00 2.49  ? 134 LEU B CB  1 
ATOM   2444  C  CG  . LEU B  1 134 ? -96.153  -34.028  9.484   1.00 2.36  ? 134 LEU B CG  1 
ATOM   2445  C  CD1 . LEU B  1 134 ? -95.398  -33.902  8.227   1.00 2.00  ? 134 LEU B CD1 1 
ATOM   2446  C  CD2 . LEU B  1 134 ? -96.117  -35.457  10.036  1.00 2.00  ? 134 LEU B CD2 1 
ATOM   2447  N  N   . GLU B  1 135 ? -95.011  -30.806  12.550  1.00 2.85  ? 135 GLU B N   1 
ATOM   2448  C  CA  . GLU B  1 135 ? -95.360  -29.584  13.293  1.00 3.39  ? 135 GLU B CA  1 
ATOM   2449  C  C   . GLU B  1 135 ? -94.349  -28.459  12.986  1.00 3.61  ? 135 GLU B C   1 
ATOM   2450  O  O   . GLU B  1 135 ? -94.715  -27.297  12.735  1.00 3.97  ? 135 GLU B O   1 
ATOM   2451  C  CB  . GLU B  1 135 ? -95.404  -29.844  14.784  1.00 2.42  ? 135 GLU B CB  1 
ATOM   2452  C  CG  . GLU B  1 135 ? -96.621  -30.623  15.225  1.00 3.74  ? 135 GLU B CG  1 
ATOM   2453  C  CD  . GLU B  1 135 ? -96.593  -31.015  16.742  1.00 5.14  ? 135 GLU B CD  1 
ATOM   2454  O  OE1 . GLU B  1 135 ? -95.514  -30.959  17.406  1.00 4.27  ? 135 GLU B OE1 1 
ATOM   2455  O  OE2 . GLU B  1 135 ? -97.681  -31.374  17.260  1.00 6.62  ? 135 GLU B OE2 1 
ATOM   2456  N  N   . THR B  1 136 ? -93.077  -28.821  12.983  1.00 2.94  ? 136 THR B N   1 
ATOM   2457  C  CA  . THR B  1 136 ? -92.052  -27.849  12.743  1.00 2.77  ? 136 THR B CA  1 
ATOM   2458  C  C   . THR B  1 136 ? -92.170  -27.260  11.340  1.00 2.78  ? 136 THR B C   1 
ATOM   2459  O  O   . THR B  1 136 ? -92.093  -26.031  11.196  1.00 3.20  ? 136 THR B O   1 
ATOM   2460  C  CB  . THR B  1 136 ? -90.691  -28.476  12.985  1.00 2.96  ? 136 THR B CB  1 
ATOM   2461  O  OG1 . THR B  1 136 ? -90.745  -29.135  14.243  1.00 2.61  ? 136 THR B OG1 1 
ATOM   2462  C  CG2 . THR B  1 136 ? -89.613  -27.420  13.021  1.00 2.31  ? 136 THR B CG2 1 
ATOM   2463  N  N   . GLU B  1 137 ? -92.349  -28.112  10.328  1.00 2.18  ? 137 GLU B N   1 
ATOM   2464  C  CA  . GLU B  1 137 ? -92.525  -27.627  8.968   1.00 2.40  ? 137 GLU B CA  1 
ATOM   2465  C  C   . GLU B  1 137 ? -93.721  -26.672  8.892   1.00 2.43  ? 137 GLU B C   1 
ATOM   2466  O  O   . GLU B  1 137 ? -93.615  -25.588  8.366   1.00 3.16  ? 137 GLU B O   1 
ATOM   2467  C  CB  . GLU B  1 137 ? -92.723  -28.777  7.991   1.00 2.43  ? 137 GLU B CB  1 
ATOM   2468  C  CG  . GLU B  1 137 ? -91.508  -29.668  7.777   1.00 4.76  ? 137 GLU B CG  1 
ATOM   2469  C  CD  . GLU B  1 137 ? -90.232  -28.901  7.448   1.00 8.00  ? 137 GLU B CD  1 
ATOM   2470  O  OE1 . GLU B  1 137 ? -89.282  -28.917  8.289   1.00 8.93  ? 137 GLU B OE1 1 
ATOM   2471  O  OE2 . GLU B  1 137 ? -90.171  -28.279  6.343   1.00 9.39  ? 137 GLU B OE2 1 
ATOM   2472  N  N   . LEU B  1 138 ? -94.858  -27.056  9.437   1.00 2.33  ? 138 LEU B N   1 
ATOM   2473  C  CA  . LEU B  1 138 ? -96.017  -26.196  9.384   1.00 2.81  ? 138 LEU B CA  1 
ATOM   2474  C  C   . LEU B  1 138 ? -95.770  -24.852  10.032  1.00 3.76  ? 138 LEU B C   1 
ATOM   2475  O  O   . LEU B  1 138 ? -96.240  -23.843  9.529   1.00 4.45  ? 138 LEU B O   1 
ATOM   2476  C  CB  . LEU B  1 138 ? -97.222  -26.879  10.007  1.00 2.53  ? 138 LEU B CB  1 
ATOM   2477  C  CG  . LEU B  1 138 ? -97.770  -28.049  9.203   1.00 2.98  ? 138 LEU B CG  1 
ATOM   2478  C  CD1 . LEU B  1 138 ? -98.771  -28.742  10.037  1.00 3.71  ? 138 LEU B CD1 1 
ATOM   2479  C  CD2 . LEU B  1 138 ? -98.418  -27.583  7.900   1.00 2.81  ? 138 LEU B CD2 1 
ATOM   2480  N  N   . ASP B  1 139 ? -95.035  -24.822  11.143  1.00 4.00  ? 139 ASP B N   1 
ATOM   2481  C  CA  . ASP B  1 139 ? -94.719  -23.557  11.791  1.00 4.63  ? 139 ASP B CA  1 
ATOM   2482  C  C   . ASP B  1 139 ? -93.719  -22.756  10.958  1.00 4.42  ? 139 ASP B C   1 
ATOM   2483  O  O   . ASP B  1 139 ? -93.795  -21.526  10.920  1.00 4.50  ? 139 ASP B O   1 
ATOM   2484  C  CB  . ASP B  1 139 ? -94.164  -23.751  13.204  1.00 5.25  ? 139 ASP B CB  1 
ATOM   2485  C  CG  . ASP B  1 139 ? -95.227  -24.198  14.229  1.00 8.76  ? 139 ASP B CG  1 
ATOM   2486  O  OD1 . ASP B  1 139 ? -96.467  -24.201  13.944  1.00 10.90 ? 139 ASP B OD1 1 
ATOM   2487  O  OD2 . ASP B  1 139 ? -94.791  -24.554  15.364  1.00 11.25 ? 139 ASP B OD2 1 
ATOM   2488  N  N   . LEU B  1 140 ? -92.785  -23.430  10.298  1.00 3.83  ? 140 LEU B N   1 
ATOM   2489  C  CA  . LEU B  1 140 ? -91.838  -22.705  9.466   1.00 4.23  ? 140 LEU B CA  1 
ATOM   2490  C  C   . LEU B  1 140 ? -92.551  -21.994  8.350   1.00 4.77  ? 140 LEU B C   1 
ATOM   2491  O  O   . LEU B  1 140 ? -92.176  -20.877  8.016   1.00 5.76  ? 140 LEU B O   1 
ATOM   2492  C  CB  . LEU B  1 140 ? -90.760  -23.613  8.882   1.00 3.92  ? 140 LEU B CB  1 
ATOM   2493  C  CG  . LEU B  1 140 ? -89.662  -24.056  9.861   1.00 3.81  ? 140 LEU B CG  1 
ATOM   2494  C  CD1 . LEU B  1 140 ? -88.802  -25.164  9.230   1.00 2.02  ? 140 LEU B CD1 1 
ATOM   2495  C  CD2 . LEU B  1 140 ? -88.809  -22.866  10.334  1.00 2.00  ? 140 LEU B CD2 1 
ATOM   2496  N  N   . ILE B  1 141 ? -93.584  -22.627  7.780   1.00 4.74  ? 141 ILE B N   1 
ATOM   2497  C  CA  . ILE B  1 141 ? -94.330  -22.015  6.694   1.00 4.71  ? 141 ILE B CA  1 
ATOM   2498  C  C   . ILE B  1 141 ? -94.922  -20.682  7.144   1.00 6.36  ? 141 ILE B C   1 
ATOM   2499  O  O   . ILE B  1 141 ? -94.860  -19.709  6.393   1.00 7.34  ? 141 ILE B O   1 
ATOM   2500  C  CB  . ILE B  1 141 ? -95.440  -22.926  6.165   1.00 4.86  ? 141 ILE B CB  1 
ATOM   2501  C  CG1 . ILE B  1 141 ? -94.866  -24.195  5.499   1.00 4.06  ? 141 ILE B CG1 1 
ATOM   2502  C  CG2 . ILE B  1 141 ? -96.363  -22.154  5.203   1.00 3.51  ? 141 ILE B CG2 1 
ATOM   2503  C  CD1 . ILE B  1 141 ? -95.988  -25.197  5.073   1.00 3.35  ? 141 ILE B CD1 1 
ATOM   2504  N  N   . GLN B  1 142 ? -95.493  -20.626  8.355   1.00 7.39  ? 142 GLN B N   1 
ATOM   2505  C  CA  . GLN B  1 142 ? -96.049  -19.367  8.863   1.00 8.52  ? 142 GLN B CA  1 
ATOM   2506  C  C   . GLN B  1 142 ? -94.943  -18.370  9.188   1.00 8.11  ? 142 GLN B C   1 
ATOM   2507  O  O   . GLN B  1 142 ? -95.102  -17.174  8.943   1.00 8.40  ? 142 GLN B O   1 
ATOM   2508  C  CB  . GLN B  1 142 ? -96.970  -19.552  10.096  1.00 9.10  ? 142 GLN B CB  1 
ATOM   2509  C  CG  . GLN B  1 142 ? -98.185  -20.473  9.855   1.00 13.49 ? 142 GLN B CG  1 
ATOM   2510  C  CD  . GLN B  1 142 ? -99.167  -19.960  8.747   1.00 19.50 ? 142 GLN B CD  1 
ATOM   2511  O  OE1 . GLN B  1 142 ? -99.918  -18.961  8.950   1.00 19.85 ? 142 GLN B OE1 1 
ATOM   2512  N  NE2 . GLN B  1 142 ? -99.177  -20.666  7.587   1.00 18.91 ? 142 GLN B NE2 1 
ATOM   2513  N  N   . LYS B  1 143 ? -93.834  -18.843  9.740   1.00 7.61  ? 143 LYS B N   1 
ATOM   2514  C  CA  . LYS B  1 143 ? -92.826  -17.903  10.245  1.00 7.75  ? 143 LYS B CA  1 
ATOM   2515  C  C   . LYS B  1 143 ? -92.057  -17.244  9.108   1.00 7.73  ? 143 LYS B C   1 
ATOM   2516  O  O   . LYS B  1 143 ? -91.791  -16.042  9.170   1.00 8.49  ? 143 LYS B O   1 
ATOM   2517  C  CB  . LYS B  1 143 ? -91.855  -18.546  11.233  1.00 7.64  ? 143 LYS B CB  1 
ATOM   2518  C  CG  . LYS B  1 143 ? -92.498  -19.019  12.526  1.00 9.65  ? 143 LYS B CG  1 
ATOM   2519  C  CD  . LYS B  1 143 ? -91.443  -19.289  13.613  1.00 13.35 ? 143 LYS B CD  1 
ATOM   2520  C  CE  . LYS B  1 143 ? -91.976  -20.128  14.793  1.00 13.02 ? 143 LYS B CE  1 
ATOM   2521  N  NZ  . LYS B  1 143 ? -91.308  -21.425  14.557  1.00 16.84 ? 143 LYS B NZ  1 
ATOM   2522  N  N   . MET B  1 144 ? -91.728  -18.002  8.067   1.00 7.09  ? 144 MET B N   1 
ATOM   2523  C  CA  . MET B  1 144 ? -90.929  -17.449  6.978   1.00 6.81  ? 144 MET B CA  1 
ATOM   2524  C  C   . MET B  1 144 ? -91.747  -17.079  5.742   1.00 5.71  ? 144 MET B C   1 
ATOM   2525  O  O   . MET B  1 144 ? -91.211  -16.410  4.822   1.00 5.46  ? 144 MET B O   1 
ATOM   2526  C  CB  . MET B  1 144 ? -89.736  -18.347  6.621   1.00 6.25  ? 144 MET B CB  1 
ATOM   2527  C  CG  . MET B  1 144 ? -90.082  -19.532  5.794   1.00 6.64  ? 144 MET B CG  1 
ATOM   2528  S  SD  . MET B  1 144 ? -88.653  -20.577  5.484   1.00 10.12 ? 144 MET B SD  1 
ATOM   2529  C  CE  . MET B  1 144 ? -88.275  -21.081  7.125   1.00 10.35 ? 144 MET B CE  1 
ATOM   2530  N  N   . GLY B  1 145 ? -93.027  -17.485  5.743   1.00 4.51  ? 145 GLY B N   1 
ATOM   2531  C  CA  . GLY B  1 145 ? -93.940  -17.258  4.607   1.00 3.26  ? 145 GLY B CA  1 
ATOM   2532  C  C   . GLY B  1 145 ? -93.863  -18.354  3.571   1.00 3.25  ? 145 GLY B C   1 
ATOM   2533  O  O   . GLY B  1 145 ? -92.842  -19.037  3.466   1.00 3.32  ? 145 GLY B O   1 
ATOM   2534  N  N   . LEU B  1 146 ? -94.925  -18.544  2.794   1.00 3.09  ? 146 LEU B N   1 
ATOM   2535  C  CA  . LEU B  1 146 ? -94.968  -19.669  1.862   1.00 2.60  ? 146 LEU B CA  1 
ATOM   2536  C  C   . LEU B  1 146 ? -93.899  -19.613  0.738   1.00 2.77  ? 146 LEU B C   1 
ATOM   2537  O  O   . LEU B  1 146 ? -93.221  -20.604  0.478   1.00 3.05  ? 146 LEU B O   1 
ATOM   2538  C  CB  . LEU B  1 146 ? -96.362  -19.826  1.302   1.00 3.02  ? 146 LEU B CB  1 
ATOM   2539  C  CG  . LEU B  1 146 ? -96.603  -21.006  0.341   1.00 3.68  ? 146 LEU B CG  1 
ATOM   2540  C  CD1 . LEU B  1 146 ? -96.193  -22.356  0.983   1.00 2.03  ? 146 LEU B CD1 1 
ATOM   2541  C  CD2 . LEU B  1 146 ? -98.041  -21.005  -0.218  1.00 2.00  ? 146 LEU B CD2 1 
ATOM   2542  N  N   . GLN B  1 147 ? -93.724  -18.456  0.103   1.00 2.76  ? 147 GLN B N   1 
ATOM   2543  C  CA  . GLN B  1 147 ? -92.724  -18.297  -0.940  1.00 2.48  ? 147 GLN B CA  1 
ATOM   2544  C  C   . GLN B  1 147 ? -91.332  -18.665  -0.485  1.00 2.78  ? 147 GLN B C   1 
ATOM   2545  O  O   . GLN B  1 147 ? -90.696  -19.469  -1.123  1.00 3.28  ? 147 GLN B O   1 
ATOM   2546  C  CB  . GLN B  1 147 ? -92.761  -16.884  -1.510  1.00 2.30  ? 147 GLN B CB  1 
ATOM   2547  C  CG  . GLN B  1 147 ? -94.087  -16.555  -2.199  1.00 2.00  ? 147 GLN B CG  1 
ATOM   2548  C  CD  . GLN B  1 147 ? -94.037  -15.270  -2.995  1.00 2.81  ? 147 GLN B CD  1 
ATOM   2549  O  OE1 . GLN B  1 147 ? -93.473  -14.272  -2.555  1.00 3.58  ? 147 GLN B OE1 1 
ATOM   2550  N  NE2 . GLN B  1 147 ? -94.623  -15.291  -4.180  1.00 2.23  ? 147 GLN B NE2 1 
ATOM   2551  N  N   . ASN B  1 148 ? -90.863  -18.106  0.626   1.00 3.18  ? 148 ASN B N   1 
ATOM   2552  C  CA  . ASN B  1 148 ? -89.557  -18.489  1.188   1.00 3.75  ? 148 ASN B CA  1 
ATOM   2553  C  C   . ASN B  1 148 ? -89.496  -19.970  1.591   1.00 4.45  ? 148 ASN B C   1 
ATOM   2554  O  O   . ASN B  1 148 ? -88.466  -20.628  1.462   1.00 5.29  ? 148 ASN B O   1 
ATOM   2555  C  CB  . ASN B  1 148 ? -89.217  -17.651  2.412   1.00 3.90  ? 148 ASN B CB  1 
ATOM   2556  C  CG  . ASN B  1 148 ? -88.608  -16.317  2.076   1.00 3.64  ? 148 ASN B CG  1 
ATOM   2557  O  OD1 . ASN B  1 148 ? -88.362  -15.530  2.966   1.00 5.71  ? 148 ASN B OD1 1 
ATOM   2558  N  ND2 . ASN B  1 148 ? -88.357  -16.055  0.810   1.00 3.49  ? 148 ASN B ND2 1 
ATOM   2559  N  N   . TYR B  1 149 ? -90.600  -20.508  2.082   1.00 4.22  ? 149 TYR B N   1 
ATOM   2560  C  CA  . TYR B  1 149 ? -90.564  -21.882  2.470   1.00 4.69  ? 149 TYR B CA  1 
ATOM   2561  C  C   . TYR B  1 149 ? -90.338  -22.787  1.259   1.00 4.82  ? 149 TYR B C   1 
ATOM   2562  O  O   . TYR B  1 149 ? -89.554  -23.750  1.316   1.00 4.37  ? 149 TYR B O   1 
ATOM   2563  C  CB  . TYR B  1 149 ? -91.850  -22.259  3.164   1.00 4.98  ? 149 TYR B CB  1 
ATOM   2564  C  CG  . TYR B  1 149 ? -91.889  -23.697  3.580   1.00 5.17  ? 149 TYR B CG  1 
ATOM   2565  C  CD1 . TYR B  1 149 ? -91.256  -24.118  4.747   1.00 4.34  ? 149 TYR B CD1 1 
ATOM   2566  C  CD2 . TYR B  1 149 ? -92.545  -24.655  2.791   1.00 5.90  ? 149 TYR B CD2 1 
ATOM   2567  C  CE1 . TYR B  1 149 ? -91.280  -25.479  5.126   1.00 6.73  ? 149 TYR B CE1 1 
ATOM   2568  C  CE2 . TYR B  1 149 ? -92.584  -26.012  3.164   1.00 5.66  ? 149 TYR B CE2 1 
ATOM   2569  C  CZ  . TYR B  1 149 ? -91.952  -26.417  4.331   1.00 5.95  ? 149 TYR B CZ  1 
ATOM   2570  O  OH  . TYR B  1 149 ? -91.983  -27.743  4.708   1.00 5.19  ? 149 TYR B OH  1 
ATOM   2571  N  N   . LEU B  1 150 ? -91.064  -22.498  0.182   1.00 5.15  ? 150 LEU B N   1 
ATOM   2572  C  CA  . LEU B  1 150 ? -90.932  -23.271  -1.041  1.00 4.77  ? 150 LEU B CA  1 
ATOM   2573  C  C   . LEU B  1 150 ? -89.527  -23.154  -1.569  1.00 5.06  ? 150 LEU B C   1 
ATOM   2574  O  O   . LEU B  1 150 ? -88.934  -24.174  -1.892  1.00 6.04  ? 150 LEU B O   1 
ATOM   2575  C  CB  . LEU B  1 150 ? -91.920  -22.830  -2.082  1.00 4.38  ? 150 LEU B CB  1 
ATOM   2576  C  CG  . LEU B  1 150 ? -93.263  -23.502  -2.289  1.00 4.62  ? 150 LEU B CG  1 
ATOM   2577  C  CD1 . LEU B  1 150 ? -93.706  -24.455  -1.204  1.00 5.71  ? 150 LEU B CD1 1 
ATOM   2578  C  CD2 . LEU B  1 150 ? -94.290  -22.432  -2.554  1.00 4.17  ? 150 LEU B CD2 1 
ATOM   2579  N  N   . GLN B  1 151 ? -88.956  -21.950  -1.631  1.00 4.93  ? 151 GLN B N   1 
ATOM   2580  C  CA  . GLN B  1 151 ? -87.593  -21.821  -2.174  1.00 4.75  ? 151 GLN B CA  1 
ATOM   2581  C  C   . GLN B  1 151 ? -86.615  -22.722  -1.388  1.00 4.77  ? 151 GLN B C   1 
ATOM   2582  O  O   . GLN B  1 151 ? -85.675  -23.314  -1.936  1.00 5.05  ? 151 GLN B O   1 
ATOM   2583  C  CB  . GLN B  1 151 ? -87.139  -20.371  -2.163  1.00 4.41  ? 151 GLN B CB  1 
ATOM   2584  C  CG  . GLN B  1 151 ? -85.688  -20.160  -2.534  1.00 4.15  ? 151 GLN B CG  1 
ATOM   2585  C  CD  . GLN B  1 151 ? -85.180  -18.822  -2.069  1.00 4.82  ? 151 GLN B CD  1 
ATOM   2586  O  OE1 . GLN B  1 151 ? -85.825  -18.163  -1.311  1.00 8.39  ? 151 GLN B OE1 1 
ATOM   2587  N  NE2 . GLN B  1 151 ? -84.036  -18.421  -2.526  1.00 7.25  ? 151 GLN B NE2 1 
ATOM   2588  N  N   . ALA B  1 152 ? -86.862  -22.858  -0.105  1.00 4.77  ? 152 ALA B N   1 
ATOM   2589  C  CA  . ALA B  1 152 ? -85.995  -23.642  0.734   1.00 4.79  ? 152 ALA B CA  1 
ATOM   2590  C  C   . ALA B  1 152 ? -86.128  -25.151  0.510   1.00 5.28  ? 152 ALA B C   1 
ATOM   2591  O  O   . ALA B  1 152 ? -85.349  -25.906  1.091   1.00 5.97  ? 152 ALA B O   1 
ATOM   2592  C  CB  . ALA B  1 152 ? -86.266  -23.311  2.166   1.00 4.79  ? 152 ALA B CB  1 
ATOM   2593  N  N   . GLN B  1 153 ? -87.092  -25.588  -0.316  1.00 5.06  ? 153 GLN B N   1 
ATOM   2594  C  CA  . GLN B  1 153 ? -87.294  -27.032  -0.584  1.00 5.37  ? 153 GLN B CA  1 
ATOM   2595  C  C   . GLN B  1 153 ? -86.719  -27.493  -1.922  1.00 5.85  ? 153 GLN B C   1 
ATOM   2596  O  O   . GLN B  1 153 ? -86.772  -28.667  -2.248  1.00 5.75  ? 153 GLN B O   1 
ATOM   2597  C  CB  . GLN B  1 153 ? -88.779  -27.417  -0.575  1.00 5.12  ? 153 GLN B CB  1 
ATOM   2598  C  CG  . GLN B  1 153 ? -89.571  -26.944  0.613   1.00 5.25  ? 153 GLN B CG  1 
ATOM   2599  C  CD  . GLN B  1 153 ? -88.878  -27.170  1.929   1.00 6.70  ? 153 GLN B CD  1 
ATOM   2600  O  OE1 . GLN B  1 153 ? -88.239  -28.216  2.181   1.00 6.52  ? 153 GLN B OE1 1 
ATOM   2601  N  NE2 . GLN B  1 153 ? -89.000  -26.169  2.803   1.00 7.60  ? 153 GLN B NE2 1 
ATOM   2602  N  N   . ILE B  1 154 ? -86.200  -26.552  -2.696  1.00 6.74  ? 154 ILE B N   1 
ATOM   2603  C  CA  . ILE B  1 154 ? -85.797  -26.809  -4.048  1.00 8.54  ? 154 ILE B CA  1 
ATOM   2604  C  C   . ILE B  1 154 ? -84.555  -27.703  -4.146  1.00 9.67  ? 154 ILE B C   1 
ATOM   2605  O  O   . ILE B  1 154 ? -84.415  -28.461  -5.094  1.00 10.59 ? 154 ILE B O   1 
ATOM   2606  C  CB  . ILE B  1 154 ? -85.474  -25.491  -4.737  1.00 8.69  ? 154 ILE B CB  1 
ATOM   2607  C  CG1 . ILE B  1 154 ? -86.707  -24.863  -5.325  1.00 9.47  ? 154 ILE B CG1 1 
ATOM   2608  C  CG2 . ILE B  1 154 ? -84.478  -25.674  -5.887  1.00 9.46  ? 154 ILE B CG2 1 
ATOM   2609  C  CD1 . ILE B  1 154 ? -86.277  -23.520  -5.996  1.00 11.52 ? 154 ILE B CD1 1 
ATOM   2610  N  N   A ARG B  1 155 ? -83.664  -27.595  -3.171  0.70 10.38 ? 155 ARG B N   1 
ATOM   2611  N  N   B ARG B  1 155 ? -83.633  -27.601  -3.207  0.30 10.33 ? 155 ARG B N   1 
ATOM   2612  C  CA  A ARG B  1 155 ? -82.423  -28.371  -3.162  0.70 11.67 ? 155 ARG B CA  1 
ATOM   2613  C  CA  B ARG B  1 155 ? -82.494  -28.506  -3.263  0.30 11.35 ? 155 ARG B CA  1 
ATOM   2614  C  C   A ARG B  1 155 ? -82.438  -29.428  -2.051  0.70 12.69 ? 155 ARG B C   1 
ATOM   2615  C  C   B ARG B  1 155 ? -82.440  -29.433  -2.077  0.30 12.33 ? 155 ARG B C   1 
ATOM   2616  O  O   A ARG B  1 155 ? -82.949  -29.170  -0.952  0.70 13.33 ? 155 ARG B O   1 
ATOM   2617  O  O   B ARG B  1 155 ? -82.861  -29.080  -0.968  0.30 12.66 ? 155 ARG B O   1 
ATOM   2618  C  CB  A ARG B  1 155 ? -81.238  -27.425  -3.007  0.70 11.20 ? 155 ARG B CB  1 
ATOM   2619  C  CB  B ARG B  1 155 ? -81.174  -27.770  -3.438  0.30 11.14 ? 155 ARG B CB  1 
ATOM   2620  C  CG  A ARG B  1 155 ? -81.139  -26.359  -4.151  0.70 11.76 ? 155 ARG B CG  1 
ATOM   2621  C  CG  B ARG B  1 155 ? -81.110  -26.420  -2.768  0.30 11.36 ? 155 ARG B CG  1 
ATOM   2622  C  CD  A ARG B  1 155 ? -80.118  -25.262  -3.785  0.70 12.71 ? 155 ARG B CD  1 
ATOM   2623  C  CD  B ARG B  1 155 ? -79.692  -25.883  -2.825  0.30 12.15 ? 155 ARG B CD  1 
ATOM   2624  N  NE  A ARG B  1 155 ? -79.765  -24.342  -4.881  0.70 14.27 ? 155 ARG B NE  1 
ATOM   2625  N  NE  B ARG B  1 155 ? -78.853  -26.493  -1.797  0.30 13.24 ? 155 ARG B NE  1 
ATOM   2626  C  CZ  A ARG B  1 155 ? -78.654  -24.437  -5.629  0.70 14.73 ? 155 ARG B CZ  1 
ATOM   2627  C  CZ  B ARG B  1 155 ? -77.532  -26.371  -1.725  0.30 13.42 ? 155 ARG B CZ  1 
ATOM   2628  N  NH1 A ARG B  1 155 ? -77.771  -25.422  -5.447  0.70 13.79 ? 155 ARG B NH1 1 
ATOM   2629  N  NH1 B ARG B  1 155 ? -76.870  -25.654  -2.628  0.30 13.11 ? 155 ARG B NH1 1 
ATOM   2630  N  NH2 A ARG B  1 155 ? -78.428  -23.539  -6.584  0.70 13.92 ? 155 ARG B NH2 1 
ATOM   2631  N  NH2 B ARG B  1 155 ? -76.873  -26.966  -0.741  0.30 12.58 ? 155 ARG B NH2 1 
ATOM   2632  N  N   . GLU B  1 156 ? -81.925  -30.631  -2.320  1.00 13.52 ? 156 GLU B N   1 
ATOM   2633  C  CA  . GLU B  1 156 ? -81.952  -31.675  -1.290  1.00 14.99 ? 156 GLU B CA  1 
ATOM   2634  C  C   . GLU B  1 156 ? -80.914  -31.387  -0.218  1.00 16.89 ? 156 GLU B C   1 
ATOM   2635  O  O   . GLU B  1 156 ? -79.859  -30.784  -0.507  1.00 17.53 ? 156 GLU B O   1 
ATOM   2636  C  CB  . GLU B  1 156 ? -81.778  -33.059  -1.867  1.00 14.57 ? 156 GLU B CB  1 
ATOM   2637  C  CG  . GLU B  1 156 ? -80.797  -33.172  -2.980  1.00 16.05 ? 156 GLU B CG  1 
ATOM   2638  C  CD  . GLU B  1 156 ? -81.120  -34.406  -3.822  1.00 21.03 ? 156 GLU B CD  1 
ATOM   2639  O  OE1 . GLU B  1 156 ? -82.225  -34.991  -3.583  1.00 20.99 ? 156 GLU B OE1 1 
ATOM   2640  O  OE2 . GLU B  1 156 ? -80.291  -34.782  -4.710  1.00 23.05 ? 156 GLU B OE2 1 
ATOM   2641  N  N   . GLU B  1 157 ? -81.224  -31.766  1.022   1.00 18.94 ? 157 GLU B N   1 
ATOM   2642  C  CA  . GLU B  1 157 ? -80.274  -31.515  2.130   1.00 20.32 ? 157 GLU B CA  1 
ATOM   2643  C  C   . GLU B  1 157 ? -79.207  -32.628  2.174   1.00 20.72 ? 157 GLU B C   1 
ATOM   2644  O  O   . GLU B  1 157 ? -79.554  -33.822  2.243   1.00 20.42 ? 157 GLU B O   1 
ATOM   2645  C  CB  . GLU B  1 157 ? -80.952  -31.275  3.520   1.00 19.90 ? 157 GLU B CB  1 
ATOM   2646  C  CG  . GLU B  1 157 ? -80.096  -30.287  4.412   1.00 20.89 ? 157 GLU B CG  1 
ATOM   2647  C  CD  . GLU B  1 157 ? -80.392  -30.361  5.935   1.00 21.10 ? 157 GLU B CD  1 
ATOM   2648  O  OE1 . GLU B  1 157 ? -81.572  -30.670  6.312   1.00 20.42 ? 157 GLU B OE1 1 
ATOM   2649  O  OE2 . GLU B  1 157 ? -79.423  -30.082  6.724   1.00 20.12 ? 157 GLU B OE2 1 
ATOM   2650  N  N   . GLY B  1 158 ? -77.927  -32.216  2.076   1.00 21.43 ? 158 GLY B N   1 
ATOM   2651  C  CA  . GLY B  1 158 ? -76.768  -33.151  2.136   1.00 21.82 ? 158 GLY B CA  1 
ATOM   2652  C  C   . GLY B  1 158 ? -76.571  -33.763  3.535   1.00 21.63 ? 158 GLY B C   1 
ATOM   2653  N  N   . MET C  1 1   ? -77.724  -51.395  46.138  1.00 7.48  ? 1   MET C N   1 
ATOM   2654  C  CA  . MET C  1 1   ? -79.041  -50.764  46.444  1.00 8.46  ? 1   MET C CA  1 
ATOM   2655  C  C   . MET C  1 1   ? -79.980  -51.855  46.924  1.00 8.21  ? 1   MET C C   1 
ATOM   2656  O  O   . MET C  1 1   ? -80.106  -52.840  46.245  1.00 8.27  ? 1   MET C O   1 
ATOM   2657  C  CB  . MET C  1 1   ? -79.562  -50.150  45.160  1.00 7.82  ? 1   MET C CB  1 
ATOM   2658  C  CG  . MET C  1 1   ? -80.619  -49.110  45.294  1.00 7.88  ? 1   MET C CG  1 
ATOM   2659  S  SD  . MET C  1 1   ? -80.865  -48.557  43.591  1.00 10.93 ? 1   MET C SD  1 
ATOM   2660  C  CE  . MET C  1 1   ? -82.056  -49.829  42.968  1.00 5.74  ? 1   MET C CE  1 
ATOM   2661  N  N   . LYS C  1 2   ? -80.613  -51.719  48.086  1.00 9.05  ? 2   LYS C N   1 
ATOM   2662  C  CA  . LYS C  1 2   ? -81.469  -52.815  48.613  1.00 10.61 ? 2   LYS C CA  1 
ATOM   2663  C  C   . LYS C  1 2   ? -82.727  -52.939  47.784  1.00 9.26  ? 2   LYS C C   1 
ATOM   2664  O  O   . LYS C  1 2   ? -83.544  -52.018  47.780  1.00 9.82  ? 2   LYS C O   1 
ATOM   2665  C  CB  . LYS C  1 2   ? -81.877  -52.560  50.072  1.00 10.60 ? 2   LYS C CB  1 
ATOM   2666  C  CG  . LYS C  1 2   ? -81.531  -53.714  51.041  1.00 14.40 ? 2   LYS C CG  1 
ATOM   2667  C  CD  . LYS C  1 2   ? -82.550  -53.871  52.222  1.00 15.08 ? 2   LYS C CD  1 
ATOM   2668  C  CE  . LYS C  1 2   ? -83.876  -54.569  51.744  1.00 19.16 ? 2   LYS C CE  1 
ATOM   2669  N  NZ  . LYS C  1 2   ? -84.635  -55.222  52.869  1.00 19.86 ? 2   LYS C NZ  1 
ATOM   2670  N  N   . GLY C  1 3   ? -82.888  -54.046  47.069  1.00 8.16  ? 3   GLY C N   1 
ATOM   2671  C  CA  . GLY C  1 3   ? -84.064  -54.237  46.217  1.00 6.90  ? 3   GLY C CA  1 
ATOM   2672  C  C   . GLY C  1 3   ? -85.289  -54.771  46.954  1.00 6.24  ? 3   GLY C C   1 
ATOM   2673  O  O   . GLY C  1 3   ? -85.211  -55.089  48.125  1.00 6.57  ? 3   GLY C O   1 
ATOM   2674  N  N   . ASP C  1 4   ? -86.414  -54.883  46.257  1.00 5.88  ? 4   ASP C N   1 
ATOM   2675  C  CA  . ASP C  1 4   ? -87.599  -55.488  46.815  1.00 5.70  ? 4   ASP C CA  1 
ATOM   2676  C  C   . ASP C  1 4   ? -87.357  -56.972  46.927  1.00 5.80  ? 4   ASP C C   1 
ATOM   2677  O  O   . ASP C  1 4   ? -86.885  -57.572  45.987  1.00 6.67  ? 4   ASP C O   1 
ATOM   2678  C  CB  . ASP C  1 4   ? -88.803  -55.146  45.945  1.00 5.43  ? 4   ASP C CB  1 
ATOM   2679  C  CG  . ASP C  1 4   ? -90.047  -55.881  46.349  1.00 6.96  ? 4   ASP C CG  1 
ATOM   2680  O  OD1 . ASP C  1 4   ? -90.260  -57.034  45.833  1.00 9.31  ? 4   ASP C OD1 1 
ATOM   2681  O  OD2 . ASP C  1 4   ? -90.839  -55.311  47.152  1.00 6.94  ? 4   ASP C OD2 1 
ATOM   2682  N  N   . THR C  1 5   ? -87.634  -57.553  48.084  1.00 5.73  ? 5   THR C N   1 
ATOM   2683  C  CA  . THR C  1 5   ? -87.398  -58.984  48.342  1.00 5.86  ? 5   THR C CA  1 
ATOM   2684  C  C   . THR C  1 5   ? -88.096  -59.912  47.340  1.00 5.65  ? 5   THR C C   1 
ATOM   2685  O  O   . THR C  1 5   ? -87.507  -60.913  46.870  1.00 5.72  ? 5   THR C O   1 
ATOM   2686  C  CB  . THR C  1 5   ? -87.869  -59.379  49.779  1.00 6.00  ? 5   THR C CB  1 
ATOM   2687  O  OG1 . THR C  1 5   ? -87.087  -58.640  50.711  1.00 7.11  ? 5   THR C OG1 1 
ATOM   2688  C  CG2 . THR C  1 5   ? -87.649  -60.872  50.081  1.00 5.33  ? 5   THR C CG2 1 
ATOM   2689  N  N   . LYS C  1 6   ? -89.360  -59.593  47.040  1.00 5.13  ? 6   LYS C N   1 
ATOM   2690  C  CA  . LYS C  1 6   ? -90.149  -60.454  46.195  1.00 4.74  ? 6   LYS C CA  1 
ATOM   2691  C  C   . LYS C  1 6   ? -89.609  -60.362  44.764  1.00 4.70  ? 6   LYS C C   1 
ATOM   2692  O  O   . LYS C  1 6   ? -89.614  -61.367  44.048  1.00 4.99  ? 6   LYS C O   1 
ATOM   2693  C  CB  . LYS C  1 6   ? -91.629  -60.112  46.316  1.00 4.17  ? 6   LYS C CB  1 
ATOM   2694  C  CG  . LYS C  1 6   ? -92.505  -60.916  45.414  1.00 6.54  ? 6   LYS C CG  1 
ATOM   2695  C  CD  . LYS C  1 6   ? -93.892  -61.241  45.989  1.00 9.49  ? 6   LYS C CD  1 
ATOM   2696  C  CE  . LYS C  1 6   ? -94.124  -62.798  45.858  1.00 13.23 ? 6   LYS C CE  1 
ATOM   2697  N  NZ  . LYS C  1 6   ? -95.228  -63.203  44.950  1.00 17.00 ? 6   LYS C NZ  1 
ATOM   2698  N  N   . VAL C  1 7   ? -89.119  -59.189  44.347  1.00 3.68  ? 7   VAL C N   1 
ATOM   2699  C  CA  . VAL C  1 7   ? -88.449  -59.087  43.043  1.00 3.13  ? 7   VAL C CA  1 
ATOM   2700  C  C   . VAL C  1 7   ? -87.229  -60.020  42.965  1.00 3.16  ? 7   VAL C C   1 
ATOM   2701  O  O   . VAL C  1 7   ? -86.989  -60.694  41.948  1.00 3.04  ? 7   VAL C O   1 
ATOM   2702  C  CB  . VAL C  1 7   ? -87.992  -57.633  42.700  1.00 3.07  ? 7   VAL C CB  1 
ATOM   2703  C  CG1 . VAL C  1 7   ? -87.062  -57.635  41.472  1.00 2.00  ? 7   VAL C CG1 1 
ATOM   2704  C  CG2 . VAL C  1 7   ? -89.184  -56.758  42.432  1.00 2.45  ? 7   VAL C CG2 1 
ATOM   2705  N  N   . ILE C  1 8   ? -86.449  -60.031  44.030  1.00 2.77  ? 8   ILE C N   1 
ATOM   2706  C  CA  . ILE C  1 8   ? -85.322  -60.912  44.099  1.00 2.58  ? 8   ILE C CA  1 
ATOM   2707  C  C   . ILE C  1 8   ? -85.779  -62.378  44.022  1.00 3.37  ? 8   ILE C C   1 
ATOM   2708  O  O   . ILE C  1 8   ? -85.142  -63.150  43.309  1.00 3.31  ? 8   ILE C O   1 
ATOM   2709  C  CB  . ILE C  1 8   ? -84.462  -60.645  45.350  1.00 2.68  ? 8   ILE C CB  1 
ATOM   2710  C  CG1 . ILE C  1 8   ? -83.785  -59.282  45.217  1.00 3.42  ? 8   ILE C CG1 1 
ATOM   2711  C  CG2 . ILE C  1 8   ? -83.407  -61.724  45.533  1.00 2.61  ? 8   ILE C CG2 1 
ATOM   2712  C  CD1 . ILE C  1 8   ? -83.291  -58.689  46.535  1.00 2.71  ? 8   ILE C CD1 1 
ATOM   2713  N  N   . ASN C  1 9   ? -86.860  -62.764  44.728  1.00 3.98  ? 9   ASN C N   1 
ATOM   2714  C  CA  . ASN C  1 9   ? -87.378  -64.128  44.630  1.00 4.75  ? 9   ASN C CA  1 
ATOM   2715  C  C   . ASN C  1 9   ? -87.726  -64.466  43.173  1.00 4.44  ? 9   ASN C C   1 
ATOM   2716  O  O   . ASN C  1 9   ? -87.419  -65.571  42.677  1.00 4.77  ? 9   ASN C O   1 
ATOM   2717  C  CB  . ASN C  1 9   ? -88.609  -64.376  45.522  1.00 5.77  ? 9   ASN C CB  1 
ATOM   2718  C  CG  . ASN C  1 9   ? -88.272  -64.432  47.024  1.00 10.55 ? 9   ASN C CG  1 
ATOM   2719  O  OD1 . ASN C  1 9   ? -87.271  -65.007  47.418  1.00 19.62 ? 9   ASN C OD1 1 
ATOM   2720  N  ND2 . ASN C  1 9   ? -89.126  -63.851  47.868  1.00 12.21 ? 9   ASN C ND2 1 
ATOM   2721  N  N   . TYR C  1 10  ? -88.366  -63.517  42.488  1.00 3.60  ? 10  TYR C N   1 
ATOM   2722  C  CA  . TYR C  1 10  ? -88.721  -63.721  41.111  1.00 3.20  ? 10  TYR C CA  1 
ATOM   2723  C  C   . TYR C  1 10  ? -87.468  -63.889  40.264  1.00 3.20  ? 10  TYR C C   1 
ATOM   2724  O  O   . TYR C  1 10  ? -87.395  -64.817  39.468  1.00 3.23  ? 10  TYR C O   1 
ATOM   2725  C  CB  . TYR C  1 10  ? -89.544  -62.577  40.581  1.00 3.18  ? 10  TYR C CB  1 
ATOM   2726  C  CG  . TYR C  1 10  ? -91.019  -62.743  40.733  1.00 3.09  ? 10  TYR C CG  1 
ATOM   2727  C  CD1 . TYR C  1 10  ? -91.670  -63.831  40.179  1.00 2.00  ? 10  TYR C CD1 1 
ATOM   2728  C  CD2 . TYR C  1 10  ? -91.772  -61.778  41.415  1.00 2.36  ? 10  TYR C CD2 1 
ATOM   2729  C  CE1 . TYR C  1 10  ? -93.040  -63.979  40.298  1.00 2.62  ? 10  TYR C CE1 1 
ATOM   2730  C  CE2 . TYR C  1 10  ? -93.129  -61.902  41.538  1.00 2.15  ? 10  TYR C CE2 1 
ATOM   2731  C  CZ  . TYR C  1 10  ? -93.765  -63.019  40.980  1.00 3.89  ? 10  TYR C CZ  1 
ATOM   2732  O  OH  . TYR C  1 10  ? -95.113  -63.164  41.105  1.00 4.42  ? 10  TYR C OH  1 
ATOM   2733  N  N   . LEU C  1 11  ? -86.495  -63.002  40.455  1.00 2.64  ? 11  LEU C N   1 
ATOM   2734  C  CA  . LEU C  1 11  ? -85.245  -63.073  39.733  1.00 2.12  ? 11  LEU C CA  1 
ATOM   2735  C  C   . LEU C  1 11  ? -84.587  -64.451  39.931  1.00 2.43  ? 11  LEU C C   1 
ATOM   2736  O  O   . LEU C  1 11  ? -84.114  -65.064  38.968  1.00 2.46  ? 11  LEU C O   1 
ATOM   2737  C  CB  . LEU C  1 11  ? -84.329  -61.926  40.137  1.00 2.01  ? 11  LEU C CB  1 
ATOM   2738  C  CG  . LEU C  1 11  ? -84.268  -60.683  39.250  1.00 2.48  ? 11  LEU C CG  1 
ATOM   2739  C  CD1 . LEU C  1 11  ? -85.498  -60.466  38.419  1.00 2.13  ? 11  LEU C CD1 1 
ATOM   2740  C  CD2 . LEU C  1 11  ? -83.882  -59.413  40.012  1.00 2.00  ? 11  LEU C CD2 1 
ATOM   2741  N  N   . ASN C  1 12  ? -84.586  -64.959  41.156  1.00 2.14  ? 12  ASN C N   1 
ATOM   2742  C  CA  . ASN C  1 12  ? -84.001  -66.287  41.413  1.00 2.06  ? 12  ASN C CA  1 
ATOM   2743  C  C   . ASN C  1 12  ? -84.836  -67.379  40.739  1.00 2.49  ? 12  ASN C C   1 
ATOM   2744  O  O   . ASN C  1 12  ? -84.297  -68.349  40.208  1.00 2.61  ? 12  ASN C O   1 
ATOM   2745  C  CB  . ASN C  1 12  ? -83.851  -66.569  42.910  1.00 2.04  ? 12  ASN C CB  1 
ATOM   2746  C  CG  . ASN C  1 12  ? -82.475  -66.214  43.437  1.00 2.51  ? 12  ASN C CG  1 
ATOM   2747  O  OD1 . ASN C  1 12  ? -81.464  -66.515  42.798  1.00 4.22  ? 12  ASN C OD1 1 
ATOM   2748  N  ND2 . ASN C  1 12  ? -82.426  -65.579  44.603  1.00 2.00  ? 12  ASN C ND2 1 
ATOM   2749  N  N   . LYS C  1 13  ? -86.151  -67.208  40.718  1.00 2.55  ? 13  LYS C N   1 
ATOM   2750  C  CA  . LYS C  1 13  ? -86.969  -68.205  40.066  1.00 3.19  ? 13  LYS C CA  1 
ATOM   2751  C  C   . LYS C  1 13  ? -86.710  -68.226  38.558  1.00 3.56  ? 13  LYS C C   1 
ATOM   2752  O  O   . LYS C  1 13  ? -86.542  -69.295  37.956  1.00 4.28  ? 13  LYS C O   1 
ATOM   2753  C  CB  . LYS C  1 13  ? -88.441  -67.966  40.380  1.00 3.16  ? 13  LYS C CB  1 
ATOM   2754  C  CG  . LYS C  1 13  ? -89.394  -68.805  39.614  1.00 2.85  ? 13  LYS C CG  1 
ATOM   2755  C  CD  . LYS C  1 13  ? -90.689  -68.927  40.360  1.00 5.51  ? 13  LYS C CD  1 
ATOM   2756  C  CE  . LYS C  1 13  ? -91.787  -69.362  39.418  1.00 8.10  ? 13  LYS C CE  1 
ATOM   2757  N  NZ  . LYS C  1 13  ? -92.492  -70.555  39.952  1.00 9.97  ? 13  LYS C NZ  1 
ATOM   2758  N  N   . LEU C  1 14  ? -86.668  -67.047  37.954  1.00 3.01  ? 14  LEU C N   1 
ATOM   2759  C  CA  . LEU C  1 14  ? -86.336  -66.933  36.553  1.00 2.92  ? 14  LEU C CA  1 
ATOM   2760  C  C   . LEU C  1 14  ? -84.937  -67.510  36.269  1.00 3.23  ? 14  LEU C C   1 
ATOM   2761  O  O   . LEU C  1 14  ? -84.755  -68.289  35.321  1.00 2.96  ? 14  LEU C O   1 
ATOM   2762  C  CB  . LEU C  1 14  ? -86.454  -65.493  36.087  1.00 2.47  ? 14  LEU C CB  1 
ATOM   2763  C  CG  . LEU C  1 14  ? -87.874  -64.919  36.226  1.00 2.71  ? 14  LEU C CG  1 
ATOM   2764  C  CD1 . LEU C  1 14  ? -87.915  -63.476  35.785  1.00 3.79  ? 14  LEU C CD1 1 
ATOM   2765  C  CD2 . LEU C  1 14  ? -88.873  -65.714  35.490  1.00 2.00  ? 14  LEU C CD2 1 
ATOM   2766  N  N   . LEU C  1 15  ? -83.966  -67.168  37.125  1.00 3.13  ? 15  LEU C N   1 
ATOM   2767  C  CA  . LEU C  1 15  ? -82.615  -67.716  37.027  1.00 2.28  ? 15  LEU C CA  1 
ATOM   2768  C  C   . LEU C  1 15  ? -82.681  -69.238  37.023  1.00 2.80  ? 15  LEU C C   1 
ATOM   2769  O  O   . LEU C  1 15  ? -82.010  -69.879  36.251  1.00 2.75  ? 15  LEU C O   1 
ATOM   2770  C  CB  . LEU C  1 15  ? -81.752  -67.212  38.172  1.00 2.01  ? 15  LEU C CB  1 
ATOM   2771  C  CG  . LEU C  1 15  ? -80.354  -67.839  38.341  1.00 2.00  ? 15  LEU C CG  1 
ATOM   2772  C  CD1 . LEU C  1 15  ? -79.493  -67.708  37.117  1.00 2.00  ? 15  LEU C CD1 1 
ATOM   2773  C  CD2 . LEU C  1 15  ? -79.656  -67.228  39.545  1.00 2.00  ? 15  LEU C CD2 1 
ATOM   2774  N  N   . GLY C  1 16  ? -83.525  -69.798  37.891  1.00 3.06  ? 16  GLY C N   1 
ATOM   2775  C  CA  . GLY C  1 16  ? -83.706  -71.218  37.981  1.00 3.47  ? 16  GLY C CA  1 
ATOM   2776  C  C   . GLY C  1 16  ? -84.179  -71.789  36.653  1.00 4.63  ? 16  GLY C C   1 
ATOM   2777  O  O   . GLY C  1 16  ? -83.731  -72.867  36.241  1.00 4.36  ? 16  GLY C O   1 
ATOM   2778  N  N   . ASN C  1 17  ? -85.103  -71.086  35.995  1.00 5.40  ? 17  ASN C N   1 
ATOM   2779  C  CA  . ASN C  1 17  ? -85.630  -71.519  34.714  1.00 6.10  ? 17  ASN C CA  1 
ATOM   2780  C  C   . ASN C  1 17  ? -84.505  -71.553  33.686  1.00 6.99  ? 17  ASN C C   1 
ATOM   2781  O  O   . ASN C  1 17  ? -84.409  -72.529  32.932  1.00 7.20  ? 17  ASN C O   1 
ATOM   2782  C  CB  . ASN C  1 17  ? -86.720  -70.575  34.193  1.00 6.04  ? 17  ASN C CB  1 
ATOM   2783  C  CG  . ASN C  1 17  ? -88.000  -70.655  34.967  1.00 6.59  ? 17  ASN C CG  1 
ATOM   2784  O  OD1 . ASN C  1 17  ? -88.267  -71.621  35.674  1.00 5.67  ? 17  ASN C OD1 1 
ATOM   2785  N  ND2 . ASN C  1 17  ? -88.819  -69.638  34.823  1.00 8.90  ? 17  ASN C ND2 1 
ATOM   2786  N  N   . GLU C  1 18  ? -83.674  -70.500  33.647  1.00 7.02  ? 18  GLU C N   1 
ATOM   2787  C  CA  . GLU C  1 18  ? -82.619  -70.411  32.648  1.00 7.64  ? 18  GLU C CA  1 
ATOM   2788  C  C   . GLU C  1 18  ? -81.588  -71.503  32.942  1.00 7.77  ? 18  GLU C C   1 
ATOM   2789  O  O   . GLU C  1 18  ? -80.992  -72.101  32.031  1.00 7.45  ? 18  GLU C O   1 
ATOM   2790  C  CB  . GLU C  1 18  ? -81.897  -69.054  32.640  1.00 7.68  ? 18  GLU C CB  1 
ATOM   2791  C  CG  . GLU C  1 18  ? -82.744  -67.842  32.381  1.00 9.75  ? 18  GLU C CG  1 
ATOM   2792  C  CD  . GLU C  1 18  ? -83.264  -67.691  30.957  1.00 13.54 ? 18  GLU C CD  1 
ATOM   2793  O  OE1 . GLU C  1 18  ? -82.684  -68.230  29.983  1.00 13.04 ? 18  GLU C OE1 1 
ATOM   2794  O  OE2 . GLU C  1 18  ? -84.280  -66.984  30.819  1.00 15.53 ? 18  GLU C OE2 1 
ATOM   2795  N  N   . LEU C  1 19  ? -81.364  -71.790  34.212  1.00 7.46  ? 19  LEU C N   1 
ATOM   2796  C  CA  . LEU C  1 19  ? -80.385  -72.799  34.384  1.00 7.24  ? 19  LEU C CA  1 
ATOM   2797  C  C   . LEU C  1 19  ? -80.785  -74.206  34.070  1.00 6.88  ? 19  LEU C C   1 
ATOM   2798  O  O   . LEU C  1 19  ? -79.948  -74.964  33.599  1.00 7.37  ? 19  LEU C O   1 
ATOM   2799  C  CB  . LEU C  1 19  ? -79.333  -72.570  35.456  1.00 7.64  ? 19  LEU C CB  1 
ATOM   2800  C  CG  . LEU C  1 19  ? -79.148  -72.332  36.928  1.00 8.51  ? 19  LEU C CG  1 
ATOM   2801  C  CD1 . LEU C  1 19  ? -78.184  -71.205  36.836  1.00 7.74  ? 19  LEU C CD1 1 
ATOM   2802  C  CD2 . LEU C  1 19  ? -80.310  -71.902  37.748  1.00 11.90 ? 19  LEU C CD2 1 
ATOM   2803  N  N   . VAL C  1 20  ? -82.074  -74.543  34.175  1.00 6.25  ? 20  VAL C N   1 
ATOM   2804  C  CA  . VAL C  1 20  ? -82.474  -75.806  33.546  1.00 4.55  ? 20  VAL C CA  1 
ATOM   2805  C  C   . VAL C  1 20  ? -82.377  -75.735  32.010  1.00 3.95  ? 20  VAL C C   1 
ATOM   2806  O  O   . VAL C  1 20  ? -81.833  -76.640  31.401  1.00 3.96  ? 20  VAL C O   1 
ATOM   2807  C  CB  . VAL C  1 20  ? -83.752  -76.535  34.136  1.00 4.12  ? 20  VAL C CB  1 
ATOM   2808  C  CG1 . VAL C  1 20  ? -84.470  -75.736  35.130  1.00 3.20  ? 20  VAL C CG1 1 
ATOM   2809  C  CG2 . VAL C  1 20  ? -84.656  -77.043  33.052  1.00 3.02  ? 20  VAL C CG2 1 
ATOM   2810  N  N   . ALA C  1 21  ? -82.820  -74.640  31.404  1.00 2.97  ? 21  ALA C N   1 
ATOM   2811  C  CA  . ALA C  1 21  ? -82.746  -74.486  29.956  1.00 2.40  ? 21  ALA C CA  1 
ATOM   2812  C  C   . ALA C  1 21  ? -81.325  -74.623  29.427  1.00 2.93  ? 21  ALA C C   1 
ATOM   2813  O  O   . ALA C  1 21  ? -81.115  -75.301  28.410  1.00 3.47  ? 21  ALA C O   1 
ATOM   2814  C  CB  . ALA C  1 21  ? -83.317  -73.194  29.535  1.00 2.00  ? 21  ALA C CB  1 
ATOM   2815  N  N   . ILE C  1 22  ? -80.347  -74.000  30.100  1.00 2.94  ? 22  ILE C N   1 
ATOM   2816  C  CA  . ILE C  1 22  ? -78.939  -74.094  29.721  1.00 3.07  ? 22  ILE C CA  1 
ATOM   2817  C  C   . ILE C  1 22  ? -78.495  -75.523  29.538  1.00 3.63  ? 22  ILE C C   1 
ATOM   2818  O  O   . ILE C  1 22  ? -77.943  -75.881  28.491  1.00 4.17  ? 22  ILE C O   1 
ATOM   2819  C  CB  . ILE C  1 22  ? -78.001  -73.388  30.769  1.00 3.79  ? 22  ILE C CB  1 
ATOM   2820  C  CG1 . ILE C  1 22  ? -78.085  -71.864  30.624  1.00 3.25  ? 22  ILE C CG1 1 
ATOM   2821  C  CG2 . ILE C  1 22  ? -76.558  -73.820  30.615  1.00 2.00  ? 22  ILE C CG2 1 
ATOM   2822  C  CD1 . ILE C  1 22  ? -77.551  -71.171  31.785  1.00 2.01  ? 22  ILE C CD1 1 
ATOM   2823  N  N   . ASN C  1 23  ? -78.742  -76.343  30.554  1.00 3.21  ? 23  ASN C N   1 
ATOM   2824  C  CA  . ASN C  1 23  ? -78.384  -77.747  30.503  1.00 3.19  ? 23  ASN C CA  1 
ATOM   2825  C  C   . ASN C  1 23  ? -79.216  -78.515  29.478  1.00 3.61  ? 23  ASN C C   1 
ATOM   2826  O  O   . ASN C  1 23  ? -78.697  -79.345  28.724  1.00 4.01  ? 23  ASN C O   1 
ATOM   2827  C  CB  . ASN C  1 23  ? -78.534  -78.379  31.869  1.00 3.27  ? 23  ASN C CB  1 
ATOM   2828  C  CG  . ASN C  1 23  ? -77.523  -77.863  32.876  1.00 4.11  ? 23  ASN C CG  1 
ATOM   2829  O  OD1 . ASN C  1 23  ? -77.469  -78.359  33.985  1.00 5.88  ? 23  ASN C OD1 1 
ATOM   2830  N  ND2 . ASN C  1 23  ? -76.735  -76.867  32.510  1.00 5.23  ? 23  ASN C ND2 1 
ATOM   2831  N  N   . GLN C  1 24  ? -80.512  -78.247  29.419  1.00 3.52  ? 24  GLN C N   1 
ATOM   2832  C  CA  . GLN C  1 24  ? -81.324  -79.070  28.560  1.00 3.68  ? 24  GLN C CA  1 
ATOM   2833  C  C   . GLN C  1 24  ? -80.922  -78.766  27.109  1.00 3.76  ? 24  GLN C C   1 
ATOM   2834  O  O   . GLN C  1 24  ? -80.752  -79.696  26.294  1.00 4.12  ? 24  GLN C O   1 
ATOM   2835  C  CB  . GLN C  1 24  ? -82.822  -78.897  28.847  1.00 3.63  ? 24  GLN C CB  1 
ATOM   2836  C  CG  . GLN C  1 24  ? -83.718  -79.718  27.953  1.00 4.33  ? 24  GLN C CG  1 
ATOM   2837  C  CD  . GLN C  1 24  ? -85.133  -79.722  28.454  1.00 7.16  ? 24  GLN C CD  1 
ATOM   2838  O  OE1 . GLN C  1 24  ? -85.389  -80.053  29.625  1.00 8.26  ? 24  GLN C OE1 1 
ATOM   2839  N  NE2 . GLN C  1 24  ? -86.083  -79.372  27.571  1.00 6.64  ? 24  GLN C NE2 1 
ATOM   2840  N  N   . TYR C  1 25  ? -80.711  -77.500  26.799  1.00 3.56  ? 25  TYR C N   1 
ATOM   2841  C  CA  . TYR C  1 25  ? -80.299  -77.148  25.442  1.00 4.26  ? 25  TYR C CA  1 
ATOM   2842  C  C   . TYR C  1 25  ? -78.938  -77.711  25.054  1.00 3.85  ? 25  TYR C C   1 
ATOM   2843  O  O   . TYR C  1 25  ? -78.757  -78.180  23.928  1.00 3.48  ? 25  TYR C O   1 
ATOM   2844  C  CB  . TYR C  1 25  ? -80.283  -75.641  25.261  1.00 5.21  ? 25  TYR C CB  1 
ATOM   2845  C  CG  . TYR C  1 25  ? -81.620  -75.021  24.897  1.00 7.10  ? 25  TYR C CG  1 
ATOM   2846  C  CD1 . TYR C  1 25  ? -82.401  -75.549  23.851  1.00 8.17  ? 25  TYR C CD1 1 
ATOM   2847  C  CD2 . TYR C  1 25  ? -82.073  -73.876  25.562  1.00 7.84  ? 25  TYR C CD2 1 
ATOM   2848  C  CE1 . TYR C  1 25  ? -83.599  -74.975  23.498  1.00 8.80  ? 25  TYR C CE1 1 
ATOM   2849  C  CE2 . TYR C  1 25  ? -83.260  -73.281  25.213  1.00 8.83  ? 25  TYR C CE2 1 
ATOM   2850  C  CZ  . TYR C  1 25  ? -84.022  -73.837  24.186  1.00 8.92  ? 25  TYR C CZ  1 
ATOM   2851  O  OH  . TYR C  1 25  ? -85.197  -73.221  23.853  1.00 8.71  ? 25  TYR C OH  1 
ATOM   2852  N  N   . PHE C  1 26  ? -77.988  -77.675  25.992  1.00 3.53  ? 26  PHE C N   1 
ATOM   2853  C  CA  . PHE C  1 26  ? -76.656  -78.187  25.735  1.00 2.94  ? 26  PHE C CA  1 
ATOM   2854  C  C   . PHE C  1 26  ? -76.616  -79.711  25.477  1.00 3.00  ? 26  PHE C C   1 
ATOM   2855  O  O   . PHE C  1 26  ? -75.990  -80.172  24.523  1.00 2.35  ? 26  PHE C O   1 
ATOM   2856  C  CB  . PHE C  1 26  ? -75.719  -77.834  26.864  1.00 2.66  ? 26  PHE C CB  1 
ATOM   2857  C  CG  . PHE C  1 26  ? -74.316  -77.798  26.433  1.00 3.03  ? 26  PHE C CG  1 
ATOM   2858  C  CD1 . PHE C  1 26  ? -73.772  -76.618  25.929  1.00 3.12  ? 26  PHE C CD1 1 
ATOM   2859  C  CD2 . PHE C  1 26  ? -73.542  -78.957  26.437  1.00 3.53  ? 26  PHE C CD2 1 
ATOM   2860  C  CE1 . PHE C  1 26  ? -72.464  -76.571  25.459  1.00 3.87  ? 26  PHE C CE1 1 
ATOM   2861  C  CE2 . PHE C  1 26  ? -72.223  -78.933  25.967  1.00 4.13  ? 26  PHE C CE2 1 
ATOM   2862  C  CZ  . PHE C  1 26  ? -71.682  -77.728  25.475  1.00 4.37  ? 26  PHE C CZ  1 
ATOM   2863  N  N   . LEU C  1 27  ? -77.276  -80.479  26.340  1.00 2.81  ? 27  LEU C N   1 
ATOM   2864  C  CA  . LEU C  1 27  ? -77.390  -81.910  26.129  1.00 2.53  ? 27  LEU C CA  1 
ATOM   2865  C  C   . LEU C  1 27  ? -78.083  -82.160  24.770  1.00 2.49  ? 27  LEU C C   1 
ATOM   2866  O  O   . LEU C  1 27  ? -77.598  -82.945  23.971  1.00 2.01  ? 27  LEU C O   1 
ATOM   2867  C  CB  . LEU C  1 27  ? -78.186  -82.571  27.252  1.00 2.52  ? 27  LEU C CB  1 
ATOM   2868  C  CG  . LEU C  1 27  ? -77.805  -83.971  27.714  1.00 2.45  ? 27  LEU C CG  1 
ATOM   2869  C  CD1 . LEU C  1 27  ? -78.953  -84.663  28.361  1.00 2.00  ? 27  LEU C CD1 1 
ATOM   2870  C  CD2 . LEU C  1 27  ? -77.168  -84.845  26.647  1.00 2.91  ? 27  LEU C CD2 1 
ATOM   2871  N  N   . HIS C  1 28  ? -79.188  -81.464  24.495  1.00 2.14  ? 28  HIS C N   1 
ATOM   2872  C  CA  . HIS C  1 28  ? -79.858  -81.675  23.229  1.00 2.37  ? 28  HIS C CA  1 
ATOM   2873  C  C   . HIS C  1 28  ? -78.909  -81.431  22.085  1.00 2.53  ? 28  HIS C C   1 
ATOM   2874  O  O   . HIS C  1 28  ? -78.760  -82.276  21.193  1.00 2.81  ? 28  HIS C O   1 
ATOM   2875  C  CB  . HIS C  1 28  ? -81.126  -80.837  23.083  1.00 2.54  ? 28  HIS C CB  1 
ATOM   2876  C  CG  . HIS C  1 28  ? -82.286  -81.354  23.865  1.00 2.57  ? 28  HIS C CG  1 
ATOM   2877  N  ND1 . HIS C  1 28  ? -83.417  -80.611  24.088  1.00 2.44  ? 28  HIS C ND1 1 
ATOM   2878  C  CD2 . HIS C  1 28  ? -82.477  -82.533  24.498  1.00 2.02  ? 28  HIS C CD2 1 
ATOM   2879  C  CE1 . HIS C  1 28  ? -84.267  -81.316  24.811  1.00 3.18  ? 28  HIS C CE1 1 
ATOM   2880  N  NE2 . HIS C  1 28  ? -83.716  -82.486  25.076  1.00 3.28  ? 28  HIS C NE2 1 
ATOM   2881  N  N   . ALA C  1 29  ? -78.240  -80.285  22.132  1.00 2.33  ? 29  ALA C N   1 
ATOM   2882  C  CA  . ALA C  1 29  ? -77.239  -79.937  21.136  1.00 2.14  ? 29  ALA C CA  1 
ATOM   2883  C  C   . ALA C  1 29  ? -76.256  -81.073  20.848  1.00 2.08  ? 29  ALA C C   1 
ATOM   2884  O  O   . ALA C  1 29  ? -76.080  -81.452  19.691  1.00 2.20  ? 29  ALA C O   1 
ATOM   2885  C  CB  . ALA C  1 29  ? -76.505  -78.684  21.532  1.00 2.00  ? 29  ALA C CB  1 
ATOM   2886  N  N   . ARG C  1 30  ? -75.632  -81.624  21.882  1.00 2.08  ? 30  ARG C N   1 
ATOM   2887  C  CA  . ARG C  1 30  ? -74.591  -82.615  21.676  1.00 2.41  ? 30  ARG C CA  1 
ATOM   2888  C  C   . ARG C  1 30  ? -75.162  -84.007  21.330  1.00 2.71  ? 30  ARG C C   1 
ATOM   2889  O  O   . ARG C  1 30  ? -74.473  -84.855  20.717  1.00 2.44  ? 30  ARG C O   1 
ATOM   2890  C  CB  . ARG C  1 30  ? -73.649  -82.690  22.855  1.00 2.00  ? 30  ARG C CB  1 
ATOM   2891  C  CG  . ARG C  1 30  ? -73.090  -81.377  23.234  1.00 2.00  ? 30  ARG C CG  1 
ATOM   2892  C  CD  . ARG C  1 30  ? -71.797  -81.050  22.579  1.00 2.01  ? 30  ARG C CD  1 
ATOM   2893  N  NE  . ARG C  1 30  ? -71.956  -79.962  21.634  1.00 4.25  ? 30  ARG C NE  1 
ATOM   2894  C  CZ  . ARG C  1 30  ? -71.174  -78.886  21.545  1.00 2.89  ? 30  ARG C CZ  1 
ATOM   2895  N  NH1 . ARG C  1 30  ? -70.119  -78.687  22.317  1.00 2.70  ? 30  ARG C NH1 1 
ATOM   2896  N  NH2 . ARG C  1 30  ? -71.462  -77.986  20.642  1.00 4.07  ? 30  ARG C NH2 1 
ATOM   2897  N  N   . MET C  1 31  ? -76.428  -84.225  21.674  1.00 2.90  ? 31  MET C N   1 
ATOM   2898  C  CA  . MET C  1 31  ? -77.156  -85.404  21.207  1.00 2.84  ? 31  MET C CA  1 
ATOM   2899  C  C   . MET C  1 31  ? -77.359  -85.309  19.691  1.00 2.78  ? 31  MET C C   1 
ATOM   2900  O  O   . MET C  1 31  ? -76.979  -86.208  18.933  1.00 3.04  ? 31  MET C O   1 
ATOM   2901  C  CB  . MET C  1 31  ? -78.484  -85.537  21.944  1.00 2.62  ? 31  MET C CB  1 
ATOM   2902  C  CG  . MET C  1 31  ? -78.374  -86.136  23.317  1.00 2.00  ? 31  MET C CG  1 
ATOM   2903  S  SD  . MET C  1 31  ? -79.929  -86.110  24.229  1.00 3.54  ? 31  MET C SD  1 
ATOM   2904  C  CE  . MET C  1 31  ? -80.949  -87.319  23.368  1.00 2.00  ? 31  MET C CE  1 
ATOM   2905  N  N   . PHE C  1 32  ? -77.906  -84.195  19.235  1.00 2.70  ? 32  PHE C N   1 
ATOM   2906  C  CA  . PHE C  1 32  ? -77.987  -83.934  17.807  1.00 2.38  ? 32  PHE C CA  1 
ATOM   2907  C  C   . PHE C  1 32  ? -76.645  -84.081  17.107  1.00 2.47  ? 32  PHE C C   1 
ATOM   2908  O  O   . PHE C  1 32  ? -76.550  -84.652  16.017  1.00 2.57  ? 32  PHE C O   1 
ATOM   2909  C  CB  . PHE C  1 32  ? -78.564  -82.549  17.577  1.00 2.43  ? 32  PHE C CB  1 
ATOM   2910  C  CG  . PHE C  1 32  ? -79.965  -82.415  18.035  1.00 2.72  ? 32  PHE C CG  1 
ATOM   2911  C  CD1 . PHE C  1 32  ? -80.377  -81.274  18.720  1.00 4.25  ? 32  PHE C CD1 1 
ATOM   2912  C  CD2 . PHE C  1 32  ? -80.881  -83.426  17.792  1.00 2.41  ? 32  PHE C CD2 1 
ATOM   2913  C  CE1 . PHE C  1 32  ? -81.696  -81.133  19.159  1.00 4.25  ? 32  PHE C CE1 1 
ATOM   2914  C  CE2 . PHE C  1 32  ? -82.198  -83.302  18.215  1.00 4.94  ? 32  PHE C CE2 1 
ATOM   2915  C  CZ  . PHE C  1 32  ? -82.601  -82.143  18.915  1.00 4.20  ? 32  PHE C CZ  1 
ATOM   2916  N  N   . LYS C  1 33  ? -75.605  -83.552  17.728  1.00 2.61  ? 33  LYS C N   1 
ATOM   2917  C  CA  . LYS C  1 33  ? -74.255  -83.619  17.145  1.00 3.00  ? 33  LYS C CA  1 
ATOM   2918  C  C   . LYS C  1 33  ? -73.796  -85.058  17.001  1.00 3.06  ? 33  LYS C C   1 
ATOM   2919  O  O   . LYS C  1 33  ? -73.293  -85.453  15.958  1.00 2.64  ? 33  LYS C O   1 
ATOM   2920  C  CB  . LYS C  1 33  ? -73.279  -82.878  18.032  1.00 3.12  ? 33  LYS C CB  1 
ATOM   2921  C  CG  . LYS C  1 33  ? -71.845  -82.990  17.626  1.00 4.05  ? 33  LYS C CG  1 
ATOM   2922  C  CD  . LYS C  1 33  ? -71.177  -81.673  17.947  1.00 8.19  ? 33  LYS C CD  1 
ATOM   2923  C  CE  . LYS C  1 33  ? -69.720  -81.850  18.284  1.00 10.43 ? 33  LYS C CE  1 
ATOM   2924  N  NZ  . LYS C  1 33  ? -68.863  -81.610  17.072  1.00 10.83 ? 33  LYS C NZ  1 
ATOM   2925  N  N   . ASN C  1 34  ? -73.994  -85.830  18.060  1.00 3.02  ? 34  ASN C N   1 
ATOM   2926  C  CA  . ASN C  1 34  ? -73.658  -87.216  18.007  1.00 3.45  ? 34  ASN C CA  1 
ATOM   2927  C  C   . ASN C  1 34  ? -74.389  -87.922  16.883  1.00 3.69  ? 34  ASN C C   1 
ATOM   2928  O  O   . ASN C  1 34  ? -73.771  -88.693  16.169  1.00 4.83  ? 34  ASN C O   1 
ATOM   2929  C  CB  . ASN C  1 34  ? -73.934  -87.922  19.318  1.00 3.28  ? 34  ASN C CB  1 
ATOM   2930  C  CG  . ASN C  1 34  ? -73.457  -89.342  19.292  1.00 4.40  ? 34  ASN C CG  1 
ATOM   2931  O  OD1 . ASN C  1 34  ? -74.265  -90.245  19.210  1.00 7.34  ? 34  ASN C OD1 1 
ATOM   2932  N  ND2 . ASN C  1 34  ? -72.126  -89.548  19.327  1.00 6.82  ? 34  ASN C ND2 1 
ATOM   2933  N  N   . TRP C  1 35  ? -75.685  -87.644  16.731  1.00 3.42  ? 35  TRP C N   1 
ATOM   2934  C  CA  . TRP C  1 35  ? -76.488  -88.209  15.643  1.00 3.22  ? 35  TRP C CA  1 
ATOM   2935  C  C   . TRP C  1 35  ? -76.154  -87.663  14.250  1.00 3.37  ? 35  TRP C C   1 
ATOM   2936  O  O   . TRP C  1 35  ? -76.706  -88.121  13.265  1.00 3.45  ? 35  TRP C O   1 
ATOM   2937  C  CB  . TRP C  1 35  ? -77.972  -87.996  15.897  1.00 2.84  ? 35  TRP C CB  1 
ATOM   2938  C  CG  . TRP C  1 35  ? -78.495  -88.767  17.033  1.00 3.69  ? 35  TRP C CG  1 
ATOM   2939  C  CD1 . TRP C  1 35  ? -77.993  -89.941  17.523  1.00 5.36  ? 35  TRP C CD1 1 
ATOM   2940  C  CD2 . TRP C  1 35  ? -79.635  -88.448  17.836  1.00 4.16  ? 35  TRP C CD2 1 
ATOM   2941  N  NE1 . TRP C  1 35  ? -78.742  -90.357  18.589  1.00 5.76  ? 35  TRP C NE1 1 
ATOM   2942  C  CE2 . TRP C  1 35  ? -79.759  -89.468  18.798  1.00 4.64  ? 35  TRP C CE2 1 
ATOM   2943  C  CE3 . TRP C  1 35  ? -80.565  -87.397  17.832  1.00 2.54  ? 35  TRP C CE3 1 
ATOM   2944  C  CZ2 . TRP C  1 35  ? -80.780  -89.479  19.757  1.00 4.30  ? 35  TRP C CZ2 1 
ATOM   2945  C  CZ3 . TRP C  1 35  ? -81.568  -87.391  18.776  1.00 3.80  ? 35  TRP C CZ3 1 
ATOM   2946  C  CH2 . TRP C  1 35  ? -81.676  -88.425  19.736  1.00 4.15  ? 35  TRP C CH2 1 
ATOM   2947  N  N   . GLY C  1 36  ? -75.283  -86.659  14.170  1.00 2.91  ? 36  GLY C N   1 
ATOM   2948  C  CA  . GLY C  1 36  ? -74.867  -86.144  12.887  1.00 2.73  ? 36  GLY C CA  1 
ATOM   2949  C  C   . GLY C  1 36  ? -75.797  -85.077  12.360  1.00 3.31  ? 36  GLY C C   1 
ATOM   2950  O  O   . GLY C  1 36  ? -75.641  -84.624  11.238  1.00 3.97  ? 36  GLY C O   1 
ATOM   2951  N  N   . LEU C  1 37  ? -76.747  -84.664  13.184  1.00 3.33  ? 37  LEU C N   1 
ATOM   2952  C  CA  . LEU C  1 37  ? -77.722  -83.618  12.871  1.00 2.84  ? 37  LEU C CA  1 
ATOM   2953  C  C   . LEU C  1 37  ? -77.086  -82.222  13.125  1.00 3.09  ? 37  LEU C C   1 
ATOM   2954  O  O   . LEU C  1 37  ? -77.541  -81.417  13.969  1.00 3.23  ? 37  LEU C O   1 
ATOM   2955  C  CB  . LEU C  1 37  ? -78.990  -83.855  13.715  1.00 2.57  ? 37  LEU C CB  1 
ATOM   2956  C  CG  . LEU C  1 37  ? -80.017  -84.846  13.157  1.00 3.43  ? 37  LEU C CG  1 
ATOM   2957  C  CD1 . LEU C  1 37  ? -79.468  -85.844  12.146  1.00 2.00  ? 37  LEU C CD1 1 
ATOM   2958  C  CD2 . LEU C  1 37  ? -80.856  -85.533  14.236  1.00 2.00  ? 37  LEU C CD2 1 
ATOM   2959  N  N   . LYS C  1 38  ? -76.019  -81.960  12.379  1.00 3.29  ? 38  LYS C N   1 
ATOM   2960  C  CA  . LYS C  1 38  ? -75.103  -80.840  12.558  1.00 3.63  ? 38  LYS C CA  1 
ATOM   2961  C  C   . LYS C  1 38  ? -75.820  -79.486  12.814  1.00 3.61  ? 38  LYS C C   1 
ATOM   2962  O  O   . LYS C  1 38  ? -75.389  -78.648  13.611  1.00 3.45  ? 38  LYS C O   1 
ATOM   2963  C  CB  . LYS C  1 38  ? -74.264  -80.798  11.286  1.00 3.92  ? 38  LYS C CB  1 
ATOM   2964  C  CG  . LYS C  1 38  ? -72.783  -80.504  11.410  1.00 8.08  ? 38  LYS C CG  1 
ATOM   2965  C  CD  . LYS C  1 38  ? -71.837  -81.722  11.269  1.00 10.94 ? 38  LYS C CD  1 
ATOM   2966  C  CE  . LYS C  1 38  ? -71.953  -82.444  9.924   1.00 13.70 ? 38  LYS C CE  1 
ATOM   2967  N  NZ  . LYS C  1 38  ? -71.486  -81.698  8.730   1.00 13.99 ? 38  LYS C NZ  1 
ATOM   2968  N  N   . ARG C  1 39  ? -76.952  -79.291  12.156  1.00 4.35  ? 39  ARG C N   1 
ATOM   2969  C  CA  . ARG C  1 39  ? -77.635  -78.006  12.102  1.00 4.47  ? 39  ARG C CA  1 
ATOM   2970  C  C   . ARG C  1 39  ? -78.410  -77.739  13.367  1.00 4.28  ? 39  ARG C C   1 
ATOM   2971  O  O   . ARG C  1 39  ? -78.526  -76.604  13.827  1.00 4.81  ? 39  ARG C O   1 
ATOM   2972  C  CB  . ARG C  1 39  ? -78.605  -78.073  10.944  1.00 5.23  ? 39  ARG C CB  1 
ATOM   2973  C  CG  . ARG C  1 39  ? -78.886  -76.798  10.241  1.00 7.83  ? 39  ARG C CG  1 
ATOM   2974  C  CD  . ARG C  1 39  ? -80.162  -76.222  10.798  1.00 14.23 ? 39  ARG C CD  1 
ATOM   2975  N  NE  . ARG C  1 39  ? -81.151  -75.925  9.749   1.00 18.67 ? 39  ARG C NE  1 
ATOM   2976  C  CZ  . ARG C  1 39  ? -82.464  -75.807  9.975   1.00 20.86 ? 39  ARG C CZ  1 
ATOM   2977  N  NH1 . ARG C  1 39  ? -82.977  -75.969  11.222  1.00 16.92 ? 39  ARG C NH1 1 
ATOM   2978  N  NH2 . ARG C  1 39  ? -83.273  -75.545  8.934   1.00 21.72 ? 39  ARG C NH2 1 
ATOM   2979  N  N   . LEU C  1 40  ? -78.993  -78.797  13.911  1.00 3.89  ? 40  LEU C N   1 
ATOM   2980  C  CA  . LEU C  1 40  ? -79.733  -78.731  15.136  1.00 3.21  ? 40  LEU C CA  1 
ATOM   2981  C  C   . LEU C  1 40  ? -78.748  -78.553  16.286  1.00 3.55  ? 40  LEU C C   1 
ATOM   2982  O  O   . LEU C  1 40  ? -79.071  -77.930  17.286  1.00 3.45  ? 40  LEU C O   1 
ATOM   2983  C  CB  . LEU C  1 40  ? -80.506  -80.032  15.293  1.00 3.40  ? 40  LEU C CB  1 
ATOM   2984  C  CG  . LEU C  1 40  ? -82.008  -80.105  15.050  1.00 2.44  ? 40  LEU C CG  1 
ATOM   2985  C  CD1 . LEU C  1 40  ? -82.562  -79.006  14.154  1.00 2.59  ? 40  LEU C CD1 1 
ATOM   2986  C  CD2 . LEU C  1 40  ? -82.348  -81.471  14.544  1.00 2.00  ? 40  LEU C CD2 1 
ATOM   2987  N  N   . ASN C  1 41  ? -77.543  -79.118  16.149  1.00 3.65  ? 41  ASN C N   1 
ATOM   2988  C  CA  . ASN C  1 41  ? -76.493  -78.904  17.145  1.00 2.97  ? 41  ASN C CA  1 
ATOM   2989  C  C   . ASN C  1 41  ? -76.079  -77.435  17.142  1.00 3.18  ? 41  ASN C C   1 
ATOM   2990  O  O   . ASN C  1 41  ? -75.971  -76.837  18.185  1.00 2.82  ? 41  ASN C O   1 
ATOM   2991  C  CB  . ASN C  1 41  ? -75.277  -79.784  16.894  1.00 2.67  ? 41  ASN C CB  1 
ATOM   2992  C  CG  . ASN C  1 41  ? -74.040  -79.299  17.667  1.00 3.37  ? 41  ASN C CG  1 
ATOM   2993  O  OD1 . ASN C  1 41  ? -73.925  -79.499  18.878  1.00 3.55  ? 41  ASN C OD1 1 
ATOM   2994  N  ND2 . ASN C  1 41  ? -73.132  -78.630  16.972  1.00 2.01  ? 41  ASN C ND2 1 
ATOM   2995  N  N   . ASP C  1 42  ? -75.852  -76.860  15.967  1.00 3.84  ? 42  ASP C N   1 
ATOM   2996  C  CA  . ASP C  1 42  ? -75.505  -75.449  15.896  1.00 5.17  ? 42  ASP C CA  1 
ATOM   2997  C  C   . ASP C  1 42  ? -76.576  -74.575  16.546  1.00 5.47  ? 42  ASP C C   1 
ATOM   2998  O  O   . ASP C  1 42  ? -76.261  -73.733  17.403  1.00 5.99  ? 42  ASP C O   1 
ATOM   2999  C  CB  . ASP C  1 42  ? -75.260  -74.970  14.465  1.00 5.43  ? 42  ASP C CB  1 
ATOM   3000  C  CG  . ASP C  1 42  ? -74.049  -75.619  13.822  1.00 9.94  ? 42  ASP C CG  1 
ATOM   3001  O  OD1 . ASP C  1 42  ? -73.239  -76.294  14.518  1.00 13.00 ? 42  ASP C OD1 1 
ATOM   3002  O  OD2 . ASP C  1 42  ? -73.905  -75.474  12.582  1.00 13.64 ? 42  ASP C OD2 1 
ATOM   3003  N  N   . VAL C  1 43  ? -77.843  -74.766  16.188  1.00 5.05  ? 43  VAL C N   1 
ATOM   3004  C  CA  . VAL C  1 43  ? -78.860  -73.865  16.736  1.00 4.94  ? 43  VAL C CA  1 
ATOM   3005  C  C   . VAL C  1 43  ? -79.013  -74.037  18.251  1.00 4.90  ? 43  VAL C C   1 
ATOM   3006  O  O   . VAL C  1 43  ? -78.982  -73.060  19.003  1.00 4.71  ? 43  VAL C O   1 
ATOM   3007  C  CB  . VAL C  1 43  ? -80.221  -73.969  15.994  1.00 4.87  ? 43  VAL C CB  1 
ATOM   3008  C  CG1 . VAL C  1 43  ? -81.310  -73.230  16.757  1.00 5.11  ? 43  VAL C CG1 1 
ATOM   3009  C  CG2 . VAL C  1 43  ? -80.080  -73.400  14.600  1.00 4.15  ? 43  VAL C CG2 1 
ATOM   3010  N  N   . GLU C  1 44  ? -79.144  -75.282  18.699  1.00 4.68  ? 44  GLU C N   1 
ATOM   3011  C  CA  . GLU C  1 44  ? -79.399  -75.522  20.128  1.00 4.91  ? 44  GLU C CA  1 
ATOM   3012  C  C   . GLU C  1 44  ? -78.224  -75.146  20.990  1.00 4.71  ? 44  GLU C C   1 
ATOM   3013  O  O   . GLU C  1 44  ? -78.398  -74.684  22.112  1.00 4.86  ? 44  GLU C O   1 
ATOM   3014  C  CB  . GLU C  1 44  ? -79.778  -76.947  20.410  1.00 4.30  ? 44  GLU C CB  1 
ATOM   3015  C  CG  . GLU C  1 44  ? -81.063  -77.296  19.748  1.00 7.83  ? 44  GLU C CG  1 
ATOM   3016  C  CD  . GLU C  1 44  ? -82.205  -77.512  20.702  1.00 11.31 ? 44  GLU C CD  1 
ATOM   3017  O  OE1 . GLU C  1 44  ? -82.052  -78.194  21.735  1.00 12.44 ? 44  GLU C OE1 1 
ATOM   3018  O  OE2 . GLU C  1 44  ? -83.297  -77.033  20.402  1.00 12.55 ? 44  GLU C OE2 1 
ATOM   3019  N  N   . TYR C  1 45  ? -77.028  -75.309  20.457  1.00 4.69  ? 45  TYR C N   1 
ATOM   3020  C  CA  . TYR C  1 45  ? -75.871  -74.813  21.148  1.00 4.80  ? 45  TYR C CA  1 
ATOM   3021  C  C   . TYR C  1 45  ? -75.990  -73.318  21.344  1.00 5.25  ? 45  TYR C C   1 
ATOM   3022  O  O   . TYR C  1 45  ? -75.803  -72.828  22.443  1.00 5.09  ? 45  TYR C O   1 
ATOM   3023  C  CB  . TYR C  1 45  ? -74.618  -75.159  20.380  1.00 4.93  ? 45  TYR C CB  1 
ATOM   3024  C  CG  . TYR C  1 45  ? -73.392  -74.591  20.980  1.00 5.00  ? 45  TYR C CG  1 
ATOM   3025  C  CD1 . TYR C  1 45  ? -72.736  -75.237  22.019  1.00 5.39  ? 45  TYR C CD1 1 
ATOM   3026  C  CD2 . TYR C  1 45  ? -72.867  -73.385  20.513  1.00 6.00  ? 45  TYR C CD2 1 
ATOM   3027  C  CE1 . TYR C  1 45  ? -71.581  -74.704  22.572  1.00 6.96  ? 45  TYR C CE1 1 
ATOM   3028  C  CE2 . TYR C  1 45  ? -71.719  -72.837  21.052  1.00 6.31  ? 45  TYR C CE2 1 
ATOM   3029  C  CZ  . TYR C  1 45  ? -71.077  -73.500  22.085  1.00 7.80  ? 45  TYR C CZ  1 
ATOM   3030  O  OH  . TYR C  1 45  ? -69.928  -72.943  22.617  1.00 8.41  ? 45  TYR C OH  1 
ATOM   3031  N  N   A HIS C  1 46  ? -76.317  -72.605  20.275  0.50 5.71  ? 46  HIS C N   1 
ATOM   3032  N  N   B HIS C  1 46  ? -76.307  -72.598  20.268  0.50 5.73  ? 46  HIS C N   1 
ATOM   3033  C  CA  A HIS C  1 46  ? -76.442  -71.155  20.363  0.50 6.25  ? 46  HIS C CA  1 
ATOM   3034  C  CA  B HIS C  1 46  ? -76.481  -71.141  20.336  0.50 6.32  ? 46  HIS C CA  1 
ATOM   3035  C  C   A HIS C  1 46  ? -77.568  -70.738  21.303  0.50 5.73  ? 46  HIS C C   1 
ATOM   3036  C  C   B HIS C  1 46  ? -77.507  -70.798  21.399  0.50 5.75  ? 46  HIS C C   1 
ATOM   3037  O  O   A HIS C  1 46  ? -77.520  -69.660  21.870  0.50 6.34  ? 46  HIS C O   1 
ATOM   3038  O  O   B HIS C  1 46  ? -77.336  -69.837  22.132  0.50 6.30  ? 46  HIS C O   1 
ATOM   3039  C  CB  A HIS C  1 46  ? -76.541  -70.495  18.980  0.50 6.45  ? 46  HIS C CB  1 
ATOM   3040  C  CB  B HIS C  1 46  ? -76.878  -70.533  18.979  0.50 6.56  ? 46  HIS C CB  1 
ATOM   3041  C  CG  A HIS C  1 46  ? -75.280  -70.609  18.174  0.50 9.87  ? 46  HIS C CG  1 
ATOM   3042  C  CG  B HIS C  1 46  ? -77.049  -69.040  18.997  0.50 10.54 ? 46  HIS C CG  1 
ATOM   3043  N  ND1 A HIS C  1 46  ? -74.107  -69.983  18.535  0.50 11.97 ? 46  HIS C ND1 1 
ATOM   3044  N  ND1 B HIS C  1 46  ? -75.984  -68.165  19.112  0.50 14.26 ? 46  HIS C ND1 1 
ATOM   3045  C  CD2 A HIS C  1 46  ? -75.004  -71.301  17.043  0.50 12.54 ? 46  HIS C CD2 1 
ATOM   3046  C  CD2 B HIS C  1 46  ? -78.160  -68.266  18.893  0.50 12.25 ? 46  HIS C CD2 1 
ATOM   3047  C  CE1 A HIS C  1 46  ? -73.165  -70.281  17.658  0.50 13.13 ? 46  HIS C CE1 1 
ATOM   3048  C  CE1 B HIS C  1 46  ? -76.433  -66.922  19.089  0.50 14.36 ? 46  HIS C CE1 1 
ATOM   3049  N  NE2 A HIS C  1 46  ? -73.685  -71.082  16.745  0.50 13.28 ? 46  HIS C NE2 1 
ATOM   3050  N  NE2 B HIS C  1 46  ? -77.749  -66.955  18.955  0.50 13.54 ? 46  HIS C NE2 1 
ATOM   3051  N  N   . GLU C  1 47  ? -78.545  -71.603  21.519  1.00 5.28  ? 47  GLU C N   1 
ATOM   3052  C  CA  . GLU C  1 47  ? -79.564  -71.303  22.481  1.00 5.21  ? 47  GLU C CA  1 
ATOM   3053  C  C   . GLU C  1 47  ? -79.142  -71.527  23.887  1.00 4.50  ? 47  GLU C C   1 
ATOM   3054  O  O   . GLU C  1 47  ? -79.531  -70.780  24.752  1.00 4.09  ? 47  GLU C O   1 
ATOM   3055  C  CB  . GLU C  1 47  ? -80.857  -71.999  22.155  1.00 6.17  ? 47  GLU C CB  1 
ATOM   3056  C  CG  . GLU C  1 47  ? -81.633  -71.105  21.235  1.00 8.86  ? 47  GLU C CG  1 
ATOM   3057  C  CD  . GLU C  1 47  ? -82.660  -71.830  20.436  1.00 15.05 ? 47  GLU C CD  1 
ATOM   3058  O  OE1 . GLU C  1 47  ? -82.744  -73.101  20.501  1.00 16.96 ? 47  GLU C OE1 1 
ATOM   3059  O  OE2 . GLU C  1 47  ? -83.380  -71.088  19.724  1.00 18.40 ? 47  GLU C OE2 1 
ATOM   3060  N  N   . SER C  1 48  ? -78.324  -72.544  24.117  1.00 4.53  ? 48  SER C N   1 
ATOM   3061  C  CA  . SER C  1 48  ? -77.658  -72.702  25.398  1.00 4.21  ? 48  SER C CA  1 
ATOM   3062  C  C   . SER C  1 48  ? -76.827  -71.454  25.793  1.00 4.46  ? 48  SER C C   1 
ATOM   3063  O  O   . SER C  1 48  ? -76.924  -70.973  26.933  1.00 3.78  ? 48  SER C O   1 
ATOM   3064  C  CB  . SER C  1 48  ? -76.779  -73.937  25.383  1.00 3.79  ? 48  SER C CB  1 
ATOM   3065  O  OG  . SER C  1 48  ? -76.476  -74.294  26.715  1.00 4.38  ? 48  SER C OG  1 
ATOM   3066  N  N   . ILE C  1 49  ? -76.022  -70.935  24.858  1.00 4.71  ? 49  ILE C N   1 
ATOM   3067  C  CA  . ILE C  1 49  ? -75.248  -69.710  25.104  1.00 5.03  ? 49  ILE C CA  1 
ATOM   3068  C  C   . ILE C  1 49  ? -76.207  -68.578  25.437  1.00 5.44  ? 49  ILE C C   1 
ATOM   3069  O  O   . ILE C  1 49  ? -75.932  -67.750  26.300  1.00 5.53  ? 49  ILE C O   1 
ATOM   3070  C  CB  . ILE C  1 49  ? -74.374  -69.277  23.883  1.00 4.93  ? 49  ILE C CB  1 
ATOM   3071  C  CG1 . ILE C  1 49  ? -73.258  -70.282  23.570  1.00 5.39  ? 49  ILE C CG1 1 
ATOM   3072  C  CG2 . ILE C  1 49  ? -73.750  -67.922  24.105  1.00 4.00  ? 49  ILE C CG2 1 
ATOM   3073  C  CD1 . ILE C  1 49  ? -72.769  -71.103  24.735  1.00 6.07  ? 49  ILE C CD1 1 
ATOM   3074  N  N   . ASP C  1 50  ? -77.338  -68.548  24.747  1.00 5.90  ? 50  ASP C N   1 
ATOM   3075  C  CA  . ASP C  1 50  ? -78.303  -67.521  24.991  1.00 7.05  ? 50  ASP C CA  1 
ATOM   3076  C  C   . ASP C  1 50  ? -78.821  -67.522  26.437  1.00 6.85  ? 50  ASP C C   1 
ATOM   3077  O  O   . ASP C  1 50  ? -78.851  -66.479  27.103  1.00 6.66  ? 50  ASP C O   1 
ATOM   3078  C  CB  . ASP C  1 50  ? -79.454  -67.655  24.029  1.00 7.89  ? 50  ASP C CB  1 
ATOM   3079  C  CG  . ASP C  1 50  ? -79.853  -66.331  23.487  1.00 11.72 ? 50  ASP C CG  1 
ATOM   3080  O  OD1 . ASP C  1 50  ? -78.942  -65.755  22.816  1.00 14.95 ? 50  ASP C OD1 1 
ATOM   3081  O  OD2 . ASP C  1 50  ? -81.011  -65.846  23.760  1.00 15.65 ? 50  ASP C OD2 1 
ATOM   3082  N  N   . GLU C  1 51  ? -79.193  -68.700  26.916  1.00 6.23  ? 51  GLU C N   1 
ATOM   3083  C  CA  . GLU C  1 51  ? -79.735  -68.818  28.231  1.00 6.43  ? 51  GLU C CA  1 
ATOM   3084  C  C   . GLU C  1 51  ? -78.666  -68.517  29.277  1.00 6.08  ? 51  GLU C C   1 
ATOM   3085  O  O   . GLU C  1 51  ? -78.983  -68.026  30.349  1.00 5.10  ? 51  GLU C O   1 
ATOM   3086  C  CB  . GLU C  1 51  ? -80.399  -70.197  28.433  1.00 7.11  ? 51  GLU C CB  1 
ATOM   3087  C  CG  . GLU C  1 51  ? -81.538  -70.526  27.438  1.00 8.48  ? 51  GLU C CG  1 
ATOM   3088  C  CD  . GLU C  1 51  ? -82.588  -69.425  27.291  1.00 12.35 ? 51  GLU C CD  1 
ATOM   3089  O  OE1 . GLU C  1 51  ? -83.796  -69.686  27.457  1.00 15.24 ? 51  GLU C OE1 1 
ATOM   3090  O  OE2 . GLU C  1 51  ? -82.223  -68.273  27.000  1.00 15.34 ? 51  GLU C OE2 1 
ATOM   3091  N  N   . MET C  1 52  ? -77.400  -68.777  28.954  1.00 6.14  ? 52  MET C N   1 
ATOM   3092  C  CA  . MET C  1 52  ? -76.312  -68.411  29.843  1.00 6.42  ? 52  MET C CA  1 
ATOM   3093  C  C   . MET C  1 52  ? -76.225  -66.915  30.010  1.00 6.15  ? 52  MET C C   1 
ATOM   3094  O  O   . MET C  1 52  ? -76.044  -66.429  31.130  1.00 6.42  ? 52  MET C O   1 
ATOM   3095  C  CB  . MET C  1 52  ? -74.979  -68.893  29.335  1.00 6.25  ? 52  MET C CB  1 
ATOM   3096  C  CG  . MET C  1 52  ? -74.748  -70.353  29.502  1.00 6.98  ? 52  MET C CG  1 
ATOM   3097  S  SD  . MET C  1 52  ? -73.225  -70.868  28.644  1.00 9.63  ? 52  MET C SD  1 
ATOM   3098  C  CE  . MET C  1 52  ? -73.855  -72.456  27.962  1.00 8.43  ? 52  MET C CE  1 
ATOM   3099  N  N   . LYS C  1 53  ? -76.359  -66.183  28.903  1.00 5.73  ? 53  LYS C N   1 
ATOM   3100  C  CA  . LYS C  1 53  ? -76.369  -64.737  28.946  1.00 5.76  ? 53  LYS C CA  1 
ATOM   3101  C  C   . LYS C  1 53  ? -77.481  -64.218  29.857  1.00 5.70  ? 53  LYS C C   1 
ATOM   3102  O  O   . LYS C  1 53  ? -77.286  -63.273  30.619  1.00 5.91  ? 53  LYS C O   1 
ATOM   3103  C  CB  . LYS C  1 53  ? -76.520  -64.150  27.542  1.00 6.09  ? 53  LYS C CB  1 
ATOM   3104  C  CG  . LYS C  1 53  ? -75.363  -64.474  26.609  1.00 7.87  ? 53  LYS C CG  1 
ATOM   3105  C  CD  . LYS C  1 53  ? -75.252  -63.423  25.519  1.00 12.54 ? 53  LYS C CD  1 
ATOM   3106  C  CE  . LYS C  1 53  ? -74.792  -64.020  24.170  1.00 16.02 ? 53  LYS C CE  1 
ATOM   3107  N  NZ  . LYS C  1 53  ? -74.327  -62.953  23.213  1.00 17.99 ? 53  LYS C NZ  1 
ATOM   3108  N  N   . HIS C  1 54  ? -78.640  -64.858  29.792  1.00 5.73  ? 54  HIS C N   1 
ATOM   3109  C  CA  . HIS C  1 54  ? -79.748  -64.488  30.614  1.00 5.46  ? 54  HIS C CA  1 
ATOM   3110  C  C   . HIS C  1 54  ? -79.462  -64.741  32.089  1.00 4.99  ? 54  HIS C C   1 
ATOM   3111  O  O   . HIS C  1 54  ? -79.706  -63.856  32.930  1.00 4.78  ? 54  HIS C O   1 
ATOM   3112  C  CB  . HIS C  1 54  ? -80.987  -65.218  30.155  1.00 5.90  ? 54  HIS C CB  1 
ATOM   3113  C  CG  . HIS C  1 54  ? -81.424  -64.859  28.770  1.00 7.49  ? 54  HIS C CG  1 
ATOM   3114  N  ND1 . HIS C  1 54  ? -82.272  -65.652  28.030  1.00 10.43 ? 54  HIS C ND1 1 
ATOM   3115  C  CD2 . HIS C  1 54  ? -81.129  -63.800  27.987  1.00 7.86  ? 54  HIS C CD2 1 
ATOM   3116  C  CE1 . HIS C  1 54  ? -82.486  -65.088  26.855  1.00 10.33 ? 54  HIS C CE1 1 
ATOM   3117  N  NE2 . HIS C  1 54  ? -81.805  -63.963  26.805  1.00 7.84  ? 54  HIS C NE2 1 
ATOM   3118  N  N   . ALA C  1 55  ? -78.911  -65.917  32.399  1.00 4.13  ? 55  ALA C N   1 
ATOM   3119  C  CA  . ALA C  1 55  ? -78.565  -66.273  33.768  1.00 3.83  ? 55  ALA C CA  1 
ATOM   3120  C  C   . ALA C  1 55  ? -77.596  -65.244  34.344  1.00 4.10  ? 55  ALA C C   1 
ATOM   3121  O  O   . ALA C  1 55  ? -77.772  -64.761  35.464  1.00 4.14  ? 55  ALA C O   1 
ATOM   3122  C  CB  . ALA C  1 55  ? -77.980  -67.653  33.815  1.00 2.89  ? 55  ALA C CB  1 
ATOM   3123  N  N   . ASP C  1 56  ? -76.588  -64.896  33.546  1.00 3.88  ? 56  ASP C N   1 
ATOM   3124  C  CA  . ASP C  1 56  ? -75.615  -63.902  33.906  1.00 3.99  ? 56  ASP C CA  1 
ATOM   3125  C  C   . ASP C  1 56  ? -76.318  -62.585  34.282  1.00 4.34  ? 56  ASP C C   1 
ATOM   3126  O  O   . ASP C  1 56  ? -76.044  -62.003  35.344  1.00 5.22  ? 56  ASP C O   1 
ATOM   3127  C  CB  . ASP C  1 56  ? -74.656  -63.710  32.746  1.00 3.85  ? 56  ASP C CB  1 
ATOM   3128  C  CG  . ASP C  1 56  ? -73.434  -62.868  33.107  1.00 4.34  ? 56  ASP C CG  1 
ATOM   3129  O  OD1 . ASP C  1 56  ? -73.164  -62.643  34.308  1.00 3.88  ? 56  ASP C OD1 1 
ATOM   3130  O  OD2 . ASP C  1 56  ? -72.728  -62.414  32.170  1.00 4.95  ? 56  ASP C OD2 1 
ATOM   3131  N  N   . ARG C  1 57  ? -77.261  -62.139  33.456  1.00 3.76  ? 57  ARG C N   1 
ATOM   3132  C  CA  . ARG C  1 57  ? -77.946  -60.895  33.738  1.00 3.65  ? 57  ARG C CA  1 
ATOM   3133  C  C   . ARG C  1 57  ? -78.748  -60.937  35.038  1.00 2.84  ? 57  ARG C C   1 
ATOM   3134  O  O   . ARG C  1 57  ? -78.711  -59.965  35.812  1.00 2.17  ? 57  ARG C O   1 
ATOM   3135  C  CB  . ARG C  1 57  ? -78.768  -60.446  32.529  1.00 3.57  ? 57  ARG C CB  1 
ATOM   3136  C  CG  . ARG C  1 57  ? -77.875  -59.938  31.400  1.00 4.89  ? 57  ARG C CG  1 
ATOM   3137  C  CD  . ARG C  1 57  ? -78.634  -59.625  30.092  1.00 7.31  ? 57  ARG C CD  1 
ATOM   3138  N  NE  . ARG C  1 57  ? -79.427  -58.382  30.126  1.00 12.00 ? 57  ARG C NE  1 
ATOM   3139  C  CZ  . ARG C  1 57  ? -80.482  -58.156  29.325  1.00 14.25 ? 57  ARG C CZ  1 
ATOM   3140  N  NH1 . ARG C  1 57  ? -80.852  -59.081  28.398  1.00 12.24 ? 57  ARG C NH1 1 
ATOM   3141  N  NH2 . ARG C  1 57  ? -81.170  -57.014  29.444  1.00 11.97 ? 57  ARG C NH2 1 
ATOM   3142  N  N   . TYR C  1 58  ? -79.442  -62.052  35.287  1.00 2.20  ? 58  TYR C N   1 
ATOM   3143  C  CA  . TYR C  1 58  ? -80.140  -62.234  36.566  1.00 2.00  ? 58  TYR C CA  1 
ATOM   3144  C  C   . TYR C  1 58  ? -79.180  -62.198  37.748  1.00 2.08  ? 58  TYR C C   1 
ATOM   3145  O  O   . TYR C  1 58  ? -79.442  -61.521  38.755  1.00 2.04  ? 58  TYR C O   1 
ATOM   3146  C  CB  . TYR C  1 58  ? -80.926  -63.542  36.591  1.00 2.01  ? 58  TYR C CB  1 
ATOM   3147  C  CG  . TYR C  1 58  ? -82.113  -63.555  35.673  1.00 2.13  ? 58  TYR C CG  1 
ATOM   3148  C  CD1 . TYR C  1 58  ? -83.025  -62.507  35.699  1.00 2.93  ? 58  TYR C CD1 1 
ATOM   3149  C  CD2 . TYR C  1 58  ? -82.330  -64.601  34.791  1.00 2.00  ? 58  TYR C CD2 1 
ATOM   3150  C  CE1 . TYR C  1 58  ? -84.108  -62.501  34.880  1.00 2.04  ? 58  TYR C CE1 1 
ATOM   3151  C  CE2 . TYR C  1 58  ? -83.398  -64.605  33.985  1.00 2.00  ? 58  TYR C CE2 1 
ATOM   3152  C  CZ  . TYR C  1 58  ? -84.300  -63.552  34.024  1.00 2.02  ? 58  TYR C CZ  1 
ATOM   3153  O  OH  . TYR C  1 58  ? -85.413  -63.516  33.201  1.00 2.00  ? 58  TYR C OH  1 
ATOM   3154  N  N   . ILE C  1 59  ? -78.059  -62.916  37.617  1.00 2.04  ? 59  ILE C N   1 
ATOM   3155  C  CA  . ILE C  1 59  ? -77.108  -63.065  38.707  1.00 2.19  ? 59  ILE C CA  1 
ATOM   3156  C  C   . ILE C  1 59  ? -76.590  -61.697  39.058  1.00 2.78  ? 59  ILE C C   1 
ATOM   3157  O  O   . ILE C  1 59  ? -76.545  -61.334  40.228  1.00 3.43  ? 59  ILE C O   1 
ATOM   3158  C  CB  . ILE C  1 59  ? -75.957  -64.020  38.378  1.00 2.01  ? 59  ILE C CB  1 
ATOM   3159  C  CG1 . ILE C  1 59  ? -76.441  -65.461  38.391  1.00 2.00  ? 59  ILE C CG1 1 
ATOM   3160  C  CG2 . ILE C  1 59  ? -74.855  -63.906  39.382  1.00 2.00  ? 59  ILE C CG2 1 
ATOM   3161  C  CD1 . ILE C  1 59  ? -75.585  -66.422  37.552  1.00 2.00  ? 59  ILE C CD1 1 
ATOM   3162  N  N   . GLU C  1 60  ? -76.250  -60.910  38.043  1.00 2.88  ? 60  GLU C N   1 
ATOM   3163  C  CA  . GLU C  1 60  ? -75.691  -59.588  38.289  1.00 2.87  ? 60  GLU C CA  1 
ATOM   3164  C  C   . GLU C  1 60  ? -76.684  -58.655  38.897  1.00 2.59  ? 60  GLU C C   1 
ATOM   3165  O  O   . GLU C  1 60  ? -76.331  -57.814  39.713  1.00 3.18  ? 60  GLU C O   1 
ATOM   3166  C  CB  . GLU C  1 60  ? -75.099  -58.997  37.039  1.00 2.84  ? 60  GLU C CB  1 
ATOM   3167  C  CG  . GLU C  1 60  ? -73.823  -59.726  36.667  1.00 5.19  ? 60  GLU C CG  1 
ATOM   3168  C  CD  . GLU C  1 60  ? -73.180  -59.189  35.427  1.00 7.96  ? 60  GLU C CD  1 
ATOM   3169  O  OE1 . GLU C  1 60  ? -72.070  -59.635  35.070  1.00 9.01  ? 60  GLU C OE1 1 
ATOM   3170  O  OE2 . GLU C  1 60  ? -73.802  -58.331  34.796  1.00 10.76 ? 60  GLU C OE2 1 
ATOM   3171  N  N   . ARG C  1 61  ? -77.935  -58.827  38.526  1.00 2.75  ? 61  ARG C N   1 
ATOM   3172  C  CA  . ARG C  1 61  ? -78.970  -57.954  38.995  1.00 2.56  ? 61  ARG C CA  1 
ATOM   3173  C  C   . ARG C  1 61  ? -79.315  -58.307  40.440  1.00 2.84  ? 61  ARG C C   1 
ATOM   3174  O  O   . ARG C  1 61  ? -79.400  -57.411  41.266  1.00 2.51  ? 61  ARG C O   1 
ATOM   3175  C  CB  . ARG C  1 61  ? -80.188  -58.057  38.060  1.00 2.64  ? 61  ARG C CB  1 
ATOM   3176  C  CG  . ARG C  1 61  ? -81.330  -57.104  38.392  1.00 2.11  ? 61  ARG C CG  1 
ATOM   3177  C  CD  . ARG C  1 61  ? -81.022  -55.657  38.047  1.00 2.31  ? 61  ARG C CD  1 
ATOM   3178  N  NE  . ARG C  1 61  ? -82.096  -54.842  38.541  1.00 3.01  ? 61  ARG C NE  1 
ATOM   3179  C  CZ  . ARG C  1 61  ? -82.049  -53.525  38.677  1.00 5.06  ? 61  ARG C CZ  1 
ATOM   3180  N  NH1 . ARG C  1 61  ? -80.954  -52.849  38.328  1.00 3.77  ? 61  ARG C NH1 1 
ATOM   3181  N  NH2 . ARG C  1 61  ? -83.111  -52.879  39.161  1.00 4.54  ? 61  ARG C NH2 1 
ATOM   3182  N  N   . ILE C  1 62  ? -79.486  -59.609  40.742  1.00 2.55  ? 62  ILE C N   1 
ATOM   3183  C  CA  . ILE C  1 62  ? -79.727  -60.051  42.112  1.00 2.42  ? 62  ILE C CA  1 
ATOM   3184  C  C   . ILE C  1 62  ? -78.617  -59.512  43.031  1.00 2.81  ? 62  ILE C C   1 
ATOM   3185  O  O   . ILE C  1 62  ? -78.878  -59.023  44.152  1.00 2.89  ? 62  ILE C O   1 
ATOM   3186  C  CB  . ILE C  1 62  ? -79.802  -61.586  42.233  1.00 2.17  ? 62  ILE C CB  1 
ATOM   3187  C  CG1 . ILE C  1 62  ? -81.033  -62.118  41.493  1.00 3.15  ? 62  ILE C CG1 1 
ATOM   3188  C  CG2 . ILE C  1 62  ? -79.909  -61.993  43.672  1.00 2.00  ? 62  ILE C CG2 1 
ATOM   3189  C  CD1 . ILE C  1 62  ? -81.097  -63.600  41.400  1.00 2.00  ? 62  ILE C CD1 1 
ATOM   3190  N  N   . LEU C  1 63  ? -77.379  -59.574  42.542  1.00 2.52  ? 63  LEU C N   1 
ATOM   3191  C  CA  . LEU C  1 63  ? -76.243  -59.151  43.339  1.00 2.80  ? 63  LEU C CA  1 
ATOM   3192  C  C   . LEU C  1 63  ? -76.320  -57.646  43.553  1.00 3.17  ? 63  LEU C C   1 
ATOM   3193  O  O   . LEU C  1 63  ? -76.104  -57.152  44.684  1.00 3.83  ? 63  LEU C O   1 
ATOM   3194  C  CB  . LEU C  1 63  ? -74.945  -59.542  42.668  1.00 2.66  ? 63  LEU C CB  1 
ATOM   3195  C  CG  . LEU C  1 63  ? -74.057  -60.678  43.167  1.00 2.03  ? 63  LEU C CG  1 
ATOM   3196  C  CD1 . LEU C  1 63  ? -74.600  -61.521  44.260  1.00 2.00  ? 63  LEU C CD1 1 
ATOM   3197  C  CD2 . LEU C  1 63  ? -73.595  -61.503  41.987  1.00 2.00  ? 63  LEU C CD2 1 
ATOM   3198  N  N   . PHE C  1 64  ? -76.678  -56.924  42.505  1.00 3.05  ? 64  PHE C N   1 
ATOM   3199  C  CA  . PHE C  1 64  ? -76.766  -55.479  42.628  1.00 3.12  ? 64  PHE C CA  1 
ATOM   3200  C  C   . PHE C  1 64  ? -77.830  -55.107  43.641  1.00 3.29  ? 64  PHE C C   1 
ATOM   3201  O  O   . PHE C  1 64  ? -77.610  -54.192  44.445  1.00 4.30  ? 64  PHE C O   1 
ATOM   3202  C  CB  . PHE C  1 64  ? -77.079  -54.796  41.274  1.00 2.48  ? 64  PHE C CB  1 
ATOM   3203  C  CG  . PHE C  1 64  ? -77.437  -53.359  41.407  1.00 2.06  ? 64  PHE C CG  1 
ATOM   3204  C  CD1 . PHE C  1 64  ? -76.534  -52.440  41.928  1.00 2.00  ? 64  PHE C CD1 1 
ATOM   3205  C  CD2 . PHE C  1 64  ? -78.691  -52.908  41.008  1.00 3.24  ? 64  PHE C CD2 1 
ATOM   3206  C  CE1 . PHE C  1 64  ? -76.875  -51.102  42.037  1.00 2.00  ? 64  PHE C CE1 1 
ATOM   3207  C  CE2 . PHE C  1 64  ? -79.039  -51.542  41.128  1.00 2.00  ? 64  PHE C CE2 1 
ATOM   3208  C  CZ  . PHE C  1 64  ? -78.125  -50.655  41.634  1.00 2.00  ? 64  PHE C CZ  1 
ATOM   3209  N  N   . LEU C  1 65  ? -78.950  -55.827  43.590  1.00 2.43  ? 65  LEU C N   1 
ATOM   3210  C  CA  . LEU C  1 65  ? -80.097  -55.575  44.448  1.00 2.23  ? 65  LEU C CA  1 
ATOM   3211  C  C   . LEU C  1 65  ? -79.857  -56.121  45.843  1.00 2.29  ? 65  LEU C C   1 
ATOM   3212  O  O   . LEU C  1 65  ? -80.742  -56.051  46.677  1.00 2.15  ? 65  LEU C O   1 
ATOM   3213  C  CB  . LEU C  1 65  ? -81.369  -56.199  43.865  1.00 2.20  ? 65  LEU C CB  1 
ATOM   3214  C  CG  . LEU C  1 65  ? -81.858  -55.548  42.587  1.00 2.30  ? 65  LEU C CG  1 
ATOM   3215  C  CD1 . LEU C  1 65  ? -83.136  -56.198  42.123  1.00 2.00  ? 65  LEU C CD1 1 
ATOM   3216  C  CD2 . LEU C  1 65  ? -81.982  -54.026  42.791  1.00 2.00  ? 65  LEU C CD2 1 
ATOM   3217  N  N   . GLU C  1 66  ? -78.666  -56.675  46.063  1.00 2.32  ? 66  GLU C N   1 
ATOM   3218  C  CA  . GLU C  1 66  ? -78.220  -57.212  47.360  1.00 3.39  ? 66  GLU C CA  1 
ATOM   3219  C  C   . GLU C  1 66  ? -78.908  -58.495  47.823  1.00 2.99  ? 66  GLU C C   1 
ATOM   3220  O  O   . GLU C  1 66  ? -79.023  -58.725  49.001  1.00 3.12  ? 66  GLU C O   1 
ATOM   3221  C  CB  . GLU C  1 66  ? -78.222  -56.132  48.466  1.00 2.97  ? 66  GLU C CB  1 
ATOM   3222  C  CG  . GLU C  1 66  ? -77.311  -54.930  48.108  1.00 6.18  ? 66  GLU C CG  1 
ATOM   3223  C  CD  . GLU C  1 66  ? -77.390  -53.755  49.060  1.00 5.85  ? 66  GLU C CD  1 
ATOM   3224  O  OE1 . GLU C  1 66  ? -77.599  -53.974  50.272  1.00 11.42 ? 66  GLU C OE1 1 
ATOM   3225  O  OE2 . GLU C  1 66  ? -77.206  -52.605  48.595  1.00 6.71  ? 66  GLU C OE2 1 
ATOM   3226  N  N   . GLY C  1 67  ? -79.326  -59.345  46.892  1.00 2.90  ? 67  GLY C N   1 
ATOM   3227  C  CA  . GLY C  1 67  ? -79.828  -60.679  47.227  1.00 3.06  ? 67  GLY C CA  1 
ATOM   3228  C  C   . GLY C  1 67  ? -78.789  -61.765  46.940  1.00 4.23  ? 67  GLY C C   1 
ATOM   3229  O  O   . GLY C  1 67  ? -77.672  -61.467  46.500  1.00 4.46  ? 67  GLY C O   1 
ATOM   3230  N  N   . LEU C  1 68  ? -79.164  -63.015  47.197  1.00 4.20  ? 68  LEU C N   1 
ATOM   3231  C  CA  . LEU C  1 68  ? -78.288  -64.146  47.057  1.00 4.19  ? 68  LEU C CA  1 
ATOM   3232  C  C   . LEU C  1 68  ? -78.716  -64.971  45.860  1.00 3.82  ? 68  LEU C C   1 
ATOM   3233  O  O   . LEU C  1 68  ? -79.737  -65.644  45.930  1.00 3.77  ? 68  LEU C O   1 
ATOM   3234  C  CB  . LEU C  1 68  ? -78.413  -65.013  48.301  1.00 4.20  ? 68  LEU C CB  1 
ATOM   3235  C  CG  . LEU C  1 68  ? -77.497  -64.892  49.536  1.00 6.84  ? 68  LEU C CG  1 
ATOM   3236  C  CD1 . LEU C  1 68  ? -76.447  -63.745  49.505  1.00 5.17  ? 68  LEU C CD1 1 
ATOM   3237  C  CD2 . LEU C  1 68  ? -78.366  -64.870  50.826  1.00 6.28  ? 68  LEU C CD2 1 
ATOM   3238  N  N   . PRO C  1 69  ? -77.954  -64.928  44.752  1.00 3.50  ? 69  PRO C N   1 
ATOM   3239  C  CA  . PRO C  1 69  ? -78.347  -65.757  43.596  1.00 3.05  ? 69  PRO C CA  1 
ATOM   3240  C  C   . PRO C  1 69  ? -78.294  -67.216  43.974  1.00 3.60  ? 69  PRO C C   1 
ATOM   3241  O  O   . PRO C  1 69  ? -77.367  -67.650  44.685  1.00 3.63  ? 69  PRO C O   1 
ATOM   3242  C  CB  . PRO C  1 69  ? -77.283  -65.442  42.546  1.00 2.05  ? 69  PRO C CB  1 
ATOM   3243  C  CG  . PRO C  1 69  ? -76.675  -64.194  42.959  1.00 2.00  ? 69  PRO C CG  1 
ATOM   3244  C  CD  . PRO C  1 69  ? -76.746  -64.135  44.469  1.00 2.81  ? 69  PRO C CD  1 
ATOM   3245  N  N   . ASN C  1 70  ? -79.301  -67.960  43.532  1.00 4.03  ? 70  ASN C N   1 
ATOM   3246  C  CA  . ASN C  1 70  ? -79.419  -69.354  43.876  1.00 4.41  ? 70  ASN C CA  1 
ATOM   3247  C  C   . ASN C  1 70  ? -79.081  -70.195  42.658  1.00 4.81  ? 70  ASN C C   1 
ATOM   3248  O  O   . ASN C  1 70  ? -79.902  -70.293  41.741  1.00 5.55  ? 70  ASN C O   1 
ATOM   3249  C  CB  . ASN C  1 70  ? -80.840  -69.640  44.305  1.00 4.03  ? 70  ASN C CB  1 
ATOM   3250  C  CG  . ASN C  1 70  ? -81.030  -71.067  44.778  1.00 5.27  ? 70  ASN C CG  1 
ATOM   3251  O  OD1 . ASN C  1 70  ? -80.127  -71.912  44.682  1.00 6.70  ? 70  ASN C OD1 1 
ATOM   3252  N  ND2 . ASN C  1 70  ? -82.212  -71.345  45.293  1.00 4.51  ? 70  ASN C ND2 1 
ATOM   3253  N  N   . LEU C  1 71  ? -77.890  -70.788  42.645  1.00 4.74  ? 71  LEU C N   1 
ATOM   3254  C  CA  . LEU C  1 71  ? -77.487  -71.703  41.597  1.00 4.84  ? 71  LEU C CA  1 
ATOM   3255  C  C   . LEU C  1 71  ? -77.457  -73.163  42.130  1.00 6.12  ? 71  LEU C C   1 
ATOM   3256  O  O   . LEU C  1 71  ? -76.953  -74.085  41.460  1.00 6.83  ? 71  LEU C O   1 
ATOM   3257  C  CB  . LEU C  1 71  ? -76.119  -71.307  41.080  1.00 4.04  ? 71  LEU C CB  1 
ATOM   3258  C  CG  . LEU C  1 71  ? -76.125  -70.146  40.091  1.00 4.62  ? 71  LEU C CG  1 
ATOM   3259  C  CD1 . LEU C  1 71  ? -76.110  -68.825  40.801  1.00 3.72  ? 71  LEU C CD1 1 
ATOM   3260  C  CD2 . LEU C  1 71  ? -74.957  -70.236  39.117  1.00 2.88  ? 71  LEU C CD2 1 
ATOM   3261  N  N   . GLN C  1 72  ? -77.984  -73.384  43.331  1.00 7.00  ? 72  GLN C N   1 
ATOM   3262  C  CA  . GLN C  1 72  ? -77.871  -74.672  43.950  1.00 7.62  ? 72  GLN C CA  1 
ATOM   3263  C  C   . GLN C  1 72  ? -79.007  -75.535  43.479  1.00 8.16  ? 72  GLN C C   1 
ATOM   3264  O  O   . GLN C  1 72  ? -78.809  -76.686  43.166  1.00 8.81  ? 72  GLN C O   1 
ATOM   3265  C  CB  . GLN C  1 72  ? -77.873  -74.537  45.476  1.00 7.95  ? 72  GLN C CB  1 
ATOM   3266  C  CG  . GLN C  1 72  ? -77.908  -75.881  46.239  1.00 9.05  ? 72  GLN C CG  1 
ATOM   3267  C  CD  . GLN C  1 72  ? -76.631  -76.681  46.039  1.00 11.26 ? 72  GLN C CD  1 
ATOM   3268  O  OE1 . GLN C  1 72  ? -75.593  -76.409  46.699  1.00 12.94 ? 72  GLN C OE1 1 
ATOM   3269  N  NE2 . GLN C  1 72  ? -76.671  -77.640  45.115  1.00 7.87  ? 72  GLN C NE2 1 
ATOM   3270  N  N   . ASP C  1 73  ? -80.207  -74.981  43.421  1.00 8.83  ? 73  ASP C N   1 
ATOM   3271  C  CA  . ASP C  1 73  ? -81.392  -75.793  43.102  1.00 9.66  ? 73  ASP C CA  1 
ATOM   3272  C  C   . ASP C  1 73  ? -81.594  -75.849  41.602  1.00 10.10 ? 73  ASP C C   1 
ATOM   3273  O  O   . ASP C  1 73  ? -81.531  -74.800  40.918  1.00 12.24 ? 73  ASP C O   1 
ATOM   3274  C  CB  . ASP C  1 73  ? -82.644  -75.243  43.805  1.00 9.50  ? 73  ASP C CB  1 
ATOM   3275  C  CG  . ASP C  1 73  ? -82.463  -75.165  45.330  1.00 11.91 ? 73  ASP C CG  1 
ATOM   3276  O  OD1 . ASP C  1 73  ? -81.827  -76.098  45.915  1.00 13.94 ? 73  ASP C OD1 1 
ATOM   3277  O  OD2 . ASP C  1 73  ? -82.921  -74.166  45.939  1.00 12.37 ? 73  ASP C OD2 1 
ATOM   3278  N  N   . LEU C  1 74  ? -81.800  -77.062  41.083  1.00 9.56  ? 74  LEU C N   1 
ATOM   3279  C  CA  . LEU C  1 74  ? -81.975  -77.263  39.650  1.00 8.35  ? 74  LEU C CA  1 
ATOM   3280  C  C   . LEU C  1 74  ? -83.279  -78.005  39.417  1.00 8.42  ? 74  LEU C C   1 
ATOM   3281  O  O   . LEU C  1 74  ? -83.435  -79.121  39.907  1.00 8.70  ? 74  LEU C O   1 
ATOM   3282  C  CB  . LEU C  1 74  ? -80.789  -78.041  39.075  1.00 7.90  ? 74  LEU C CB  1 
ATOM   3283  C  CG  . LEU C  1 74  ? -80.669  -78.113  37.545  1.00 7.54  ? 74  LEU C CG  1 
ATOM   3284  C  CD1 . LEU C  1 74  ? -80.497  -76.761  36.890  1.00 4.12  ? 74  LEU C CD1 1 
ATOM   3285  C  CD2 . LEU C  1 74  ? -79.526  -79.038  37.100  1.00 7.44  ? 74  LEU C CD2 1 
ATOM   3286  N  N   . GLY C  1 75  ? -84.201  -77.385  38.673  1.00 8.31  ? 75  GLY C N   1 
ATOM   3287  C  CA  . GLY C  1 75  ? -85.498  -77.993  38.349  1.00 8.44  ? 75  GLY C CA  1 
ATOM   3288  C  C   . GLY C  1 75  ? -85.428  -79.222  37.457  1.00 9.37  ? 75  GLY C C   1 
ATOM   3289  O  O   . GLY C  1 75  ? -84.336  -79.633  37.024  1.00 9.29  ? 75  GLY C O   1 
ATOM   3290  N  N   . LYS C  1 76  ? -86.591  -79.827  37.191  1.00 10.21 ? 76  LYS C N   1 
ATOM   3291  C  CA  . LYS C  1 76  ? -86.632  -81.036  36.367  1.00 11.64 ? 76  LYS C CA  1 
ATOM   3292  C  C   . LYS C  1 76  ? -86.251  -80.777  34.910  1.00 10.51 ? 76  LYS C C   1 
ATOM   3293  O  O   . LYS C  1 76  ? -86.881  -79.963  34.213  1.00 10.80 ? 76  LYS C O   1 
ATOM   3294  C  CB  . LYS C  1 76  ? -87.977  -81.800  36.462  1.00 11.59 ? 76  LYS C CB  1 
ATOM   3295  C  CG  . LYS C  1 76  ? -87.776  -83.306  36.053  1.00 15.49 ? 76  LYS C CG  1 
ATOM   3296  C  CD  . LYS C  1 76  ? -89.072  -84.183  36.038  1.00 15.69 ? 76  LYS C CD  1 
ATOM   3297  C  CE  . LYS C  1 76  ? -88.851  -85.548  35.271  1.00 18.64 ? 76  LYS C CE  1 
ATOM   3298  N  NZ  . LYS C  1 76  ? -90.186  -86.335  35.125  1.00 20.33 ? 76  LYS C NZ  1 
ATOM   3299  N  N   . LEU C  1 77  ? -85.186  -81.454  34.481  1.00 9.99  ? 77  LEU C N   1 
ATOM   3300  C  CA  . LEU C  1 77  ? -84.858  -81.627  33.054  1.00 9.45  ? 77  LEU C CA  1 
ATOM   3301  C  C   . LEU C  1 77  ? -85.775  -82.698  32.461  1.00 9.38  ? 77  LEU C C   1 
ATOM   3302  O  O   . LEU C  1 77  ? -86.100  -83.682  33.127  1.00 9.86  ? 77  LEU C O   1 
ATOM   3303  C  CB  . LEU C  1 77  ? -83.418  -82.132  32.923  1.00 9.19  ? 77  LEU C CB  1 
ATOM   3304  C  CG  . LEU C  1 77  ? -82.302  -81.189  32.532  1.00 8.98  ? 77  LEU C CG  1 
ATOM   3305  C  CD1 . LEU C  1 77  ? -82.360  -79.937  33.378  1.00 7.33  ? 77  LEU C CD1 1 
ATOM   3306  C  CD2 . LEU C  1 77  ? -81.022  -81.916  32.769  1.00 9.55  ? 77  LEU C CD2 1 
ATOM   3307  N  N   . ASN C  1 78  ? -86.210  -82.512  31.224  1.00 9.53  ? 78  ASN C N   1 
ATOM   3308  C  CA  . ASN C  1 78  ? -86.933  -83.578  30.533  1.00 9.46  ? 78  ASN C CA  1 
ATOM   3309  C  C   . ASN C  1 78  ? -86.239  -83.709  29.184  1.00 9.27  ? 78  ASN C C   1 
ATOM   3310  O  O   . ASN C  1 78  ? -86.352  -82.821  28.350  1.00 9.78  ? 78  ASN C O   1 
ATOM   3311  C  CB  . ASN C  1 78  ? -88.431  -83.264  30.426  1.00 9.37  ? 78  ASN C CB  1 
ATOM   3312  C  CG  . ASN C  1 78  ? -89.217  -84.307  29.581  1.00 12.27 ? 78  ASN C CG  1 
ATOM   3313  O  OD1 . ASN C  1 78  ? -88.707  -85.394  29.248  1.00 13.93 ? 78  ASN C OD1 1 
ATOM   3314  N  ND2 . ASN C  1 78  ? -90.465  -83.964  29.224  1.00 12.52 ? 78  ASN C ND2 1 
ATOM   3315  N  N   . ILE C  1 79  ? -85.463  -84.782  29.008  1.00 8.78  ? 79  ILE C N   1 
ATOM   3316  C  CA  . ILE C  1 79  ? -84.537  -84.883  27.893  1.00 8.24  ? 79  ILE C CA  1 
ATOM   3317  C  C   . ILE C  1 79  ? -85.204  -85.423  26.639  1.00 8.76  ? 79  ILE C C   1 
ATOM   3318  O  O   . ILE C  1 79  ? -85.154  -84.770  25.591  1.00 9.20  ? 79  ILE C O   1 
ATOM   3319  C  CB  . ILE C  1 79  ? -83.285  -85.716  28.218  1.00 8.10  ? 79  ILE C CB  1 
ATOM   3320  C  CG1 . ILE C  1 79  ? -82.547  -85.177  29.459  1.00 7.59  ? 79  ILE C CG1 1 
ATOM   3321  C  CG2 . ILE C  1 79  ? -82.357  -85.741  27.021  1.00 7.79  ? 79  ILE C CG2 1 
ATOM   3322  C  CD1 . ILE C  1 79  ? -82.196  -83.673  29.421  1.00 5.77  ? 79  ILE C CD1 1 
ATOM   3323  N  N   . GLY C  1 80  ? -85.835  -86.593  26.726  1.00 8.42  ? 80  GLY C N   1 
ATOM   3324  C  CA  . GLY C  1 80  ? -86.519  -87.140  25.556  1.00 8.54  ? 80  GLY C CA  1 
ATOM   3325  C  C   . GLY C  1 80  ? -85.553  -88.017  24.791  1.00 9.09  ? 80  GLY C C   1 
ATOM   3326  O  O   . GLY C  1 80  ? -84.336  -87.921  24.995  1.00 9.07  ? 80  GLY C O   1 
ATOM   3327  N  N   . GLU C  1 81  ? -86.066  -88.889  23.914  1.00 9.34  ? 81  GLU C N   1 
ATOM   3328  C  CA  . GLU C  1 81  ? -85.175  -89.842  23.260  1.00 10.13 ? 81  GLU C CA  1 
ATOM   3329  C  C   . GLU C  1 81  ? -85.085  -89.664  21.751  1.00 9.36  ? 81  GLU C C   1 
ATOM   3330  O  O   . GLU C  1 81  ? -84.172  -90.224  21.152  1.00 10.29 ? 81  GLU C O   1 
ATOM   3331  C  CB  . GLU C  1 81  ? -85.549  -91.282  23.630  1.00 9.65  ? 81  GLU C CB  1 
ATOM   3332  C  CG  . GLU C  1 81  ? -85.419  -91.641  25.149  1.00 12.25 ? 81  GLU C CG  1 
ATOM   3333  C  CD  . GLU C  1 81  ? -86.325  -92.866  25.540  1.00 15.08 ? 81  GLU C CD  1 
ATOM   3334  O  OE1 . GLU C  1 81  ? -87.559  -92.860  25.216  1.00 20.83 ? 81  GLU C OE1 1 
ATOM   3335  O  OE2 . GLU C  1 81  ? -85.819  -93.834  26.163  1.00 19.48 ? 81  GLU C OE2 1 
ATOM   3336  N  N   . ASP C  1 82  ? -86.029  -88.920  21.137  1.00 8.72  ? 82  ASP C N   1 
ATOM   3337  C  CA  . ASP C  1 82  ? -85.989  -88.588  19.686  1.00 7.38  ? 82  ASP C CA  1 
ATOM   3338  C  C   . ASP C  1 82  ? -86.205  -87.096  19.412  1.00 6.44  ? 82  ASP C C   1 
ATOM   3339  O  O   . ASP C  1 82  ? -86.657  -86.376  20.286  1.00 6.42  ? 82  ASP C O   1 
ATOM   3340  C  CB  . ASP C  1 82  ? -86.981  -89.414  18.887  1.00 7.26  ? 82  ASP C CB  1 
ATOM   3341  C  CG  . ASP C  1 82  ? -88.400  -89.239  19.362  1.00 10.33 ? 82  ASP C CG  1 
ATOM   3342  O  OD1 . ASP C  1 82  ? -89.023  -90.254  19.738  1.00 16.60 ? 82  ASP C OD1 1 
ATOM   3343  O  OD2 . ASP C  1 82  ? -88.935  -88.113  19.371  1.00 12.03 ? 82  ASP C OD2 1 
ATOM   3344  N  N   . VAL C  1 83  ? -85.911  -86.646  18.192  1.00 5.65  ? 83  VAL C N   1 
ATOM   3345  C  CA  . VAL C  1 83  ? -85.912  -85.227  17.833  1.00 4.91  ? 83  VAL C CA  1 
ATOM   3346  C  C   . VAL C  1 83  ? -87.176  -84.495  18.255  1.00 5.05  ? 83  VAL C C   1 
ATOM   3347  O  O   . VAL C  1 83  ? -87.100  -83.486  18.979  1.00 5.06  ? 83  VAL C O   1 
ATOM   3348  C  CB  . VAL C  1 83  ? -85.686  -85.041  16.317  1.00 4.69  ? 83  VAL C CB  1 
ATOM   3349  C  CG1 . VAL C  1 83  ? -85.635  -83.582  15.944  1.00 4.02  ? 83  VAL C CG1 1 
ATOM   3350  C  CG2 . VAL C  1 83  ? -84.401  -85.694  15.929  1.00 4.70  ? 83  VAL C CG2 1 
ATOM   3351  N  N   . GLU C  1 84  ? -88.328  -84.994  17.804  1.00 4.70  ? 84  GLU C N   1 
ATOM   3352  C  CA  . GLU C  1 84  ? -89.604  -84.393  18.137  1.00 5.40  ? 84  GLU C CA  1 
ATOM   3353  C  C   . GLU C  1 84  ? -89.774  -84.259  19.655  1.00 5.72  ? 84  GLU C C   1 
ATOM   3354  O  O   . GLU C  1 84  ? -90.028  -83.164  20.167  1.00 5.76  ? 84  GLU C O   1 
ATOM   3355  C  CB  . GLU C  1 84  ? -90.771  -85.207  17.574  1.00 5.54  ? 84  GLU C CB  1 
ATOM   3356  C  CG  . GLU C  1 84  ? -91.925  -84.316  17.130  1.00 9.23  ? 84  GLU C CG  1 
ATOM   3357  C  CD  . GLU C  1 84  ? -93.245  -85.050  16.973  1.00 13.96 ? 84  GLU C CD  1 
ATOM   3358  O  OE1 . GLU C  1 84  ? -93.252  -86.143  16.339  1.00 16.30 ? 84  GLU C OE1 1 
ATOM   3359  O  OE2 . GLU C  1 84  ? -94.284  -84.527  17.473  1.00 13.49 ? 84  GLU C OE2 1 
ATOM   3360  N  N   . GLU C  1 85  ? -89.620  -85.364  20.370  1.00 5.72  ? 85  GLU C N   1 
ATOM   3361  C  CA  . GLU C  1 85  ? -89.772  -85.385  21.788  1.00 6.69  ? 85  GLU C CA  1 
ATOM   3362  C  C   . GLU C  1 85  ? -88.841  -84.333  22.393  1.00 5.72  ? 85  GLU C C   1 
ATOM   3363  O  O   . GLU C  1 85  ? -89.215  -83.590  23.317  1.00 5.39  ? 85  GLU C O   1 
ATOM   3364  C  CB  . GLU C  1 85  ? -89.390  -86.772  22.255  1.00 6.72  ? 85  GLU C CB  1 
ATOM   3365  C  CG  . GLU C  1 85  ? -90.172  -87.379  23.425  1.00 9.98  ? 85  GLU C CG  1 
ATOM   3366  C  CD  . GLU C  1 85  ? -89.969  -88.923  23.520  1.00 11.72 ? 85  GLU C CD  1 
ATOM   3367  O  OE1 . GLU C  1 85  ? -90.113  -89.636  22.477  1.00 15.04 ? 85  GLU C OE1 1 
ATOM   3368  O  OE2 . GLU C  1 85  ? -89.664  -89.414  24.636  1.00 16.79 ? 85  GLU C OE2 1 
ATOM   3369  N  N   . MET C  1 86  ? -87.628  -84.221  21.866  1.00 4.94  ? 86  MET C N   1 
ATOM   3370  C  CA  . MET C  1 86  ? -86.718  -83.304  22.513  1.00 5.00  ? 86  MET C CA  1 
ATOM   3371  C  C   . MET C  1 86  ? -87.028  -81.867  22.193  1.00 4.99  ? 86  MET C C   1 
ATOM   3372  O  O   . MET C  1 86  ? -86.935  -80.988  23.065  1.00 5.53  ? 86  MET C O   1 
ATOM   3373  C  CB  . MET C  1 86  ? -85.210  -83.675  22.436  1.00 4.79  ? 86  MET C CB  1 
ATOM   3374  C  CG  . MET C  1 86  ? -84.711  -84.252  21.178  1.00 6.71  ? 86  MET C CG  1 
ATOM   3375  S  SD  . MET C  1 86  ? -83.340  -85.374  21.345  1.00 4.94  ? 86  MET C SD  1 
ATOM   3376  C  CE  . MET C  1 86  ? -81.917  -84.312  21.452  1.00 3.17  ? 86  MET C CE  1 
ATOM   3377  N  N   . LEU C  1 87  ? -87.457  -81.615  20.962  1.00 4.81  ? 87  LEU C N   1 
ATOM   3378  C  CA  . LEU C  1 87  ? -87.837  -80.279  20.594  1.00 3.91  ? 87  LEU C CA  1 
ATOM   3379  C  C   . LEU C  1 87  ? -89.061  -79.849  21.400  1.00 4.03  ? 87  LEU C C   1 
ATOM   3380  O  O   . LEU C  1 87  ? -89.121  -78.726  21.918  1.00 4.37  ? 87  LEU C O   1 
ATOM   3381  C  CB  . LEU C  1 87  ? -88.073  -80.212  19.098  1.00 3.55  ? 87  LEU C CB  1 
ATOM   3382  C  CG  . LEU C  1 87  ? -86.987  -79.583  18.220  1.00 3.41  ? 87  LEU C CG  1 
ATOM   3383  C  CD1 . LEU C  1 87  ? -85.548  -79.661  18.749  1.00 2.58  ? 87  LEU C CD1 1 
ATOM   3384  C  CD2 . LEU C  1 87  ? -87.074  -80.188  16.854  1.00 4.17  ? 87  LEU C CD2 1 
ATOM   3385  N  N   . ARG C  1 88  ? -90.019  -80.754  21.526  1.00 4.00  ? 88  ARG C N   1 
ATOM   3386  C  CA  . ARG C  1 88  ? -91.277  -80.490  22.201  1.00 4.81  ? 88  ARG C CA  1 
ATOM   3387  C  C   . ARG C  1 88  ? -90.968  -80.173  23.657  1.00 4.70  ? 88  ARG C C   1 
ATOM   3388  O  O   . ARG C  1 88  ? -91.606  -79.315  24.279  1.00 5.44  ? 88  ARG C O   1 
ATOM   3389  C  CB  . ARG C  1 88  ? -92.189  -81.720  22.106  1.00 4.19  ? 88  ARG C CB  1 
ATOM   3390  C  CG  . ARG C  1 88  ? -93.545  -81.449  21.589  1.00 5.32  ? 88  ARG C CG  1 
ATOM   3391  C  CD  . ARG C  1 88  ? -94.329  -82.739  21.250  1.00 7.16  ? 88  ARG C CD  1 
ATOM   3392  N  NE  . ARG C  1 88  ? -94.614  -82.892  19.807  1.00 13.56 ? 88  ARG C NE  1 
ATOM   3393  C  CZ  . ARG C  1 88  ? -95.287  -81.999  19.046  1.00 14.68 ? 88  ARG C CZ  1 
ATOM   3394  N  NH1 . ARG C  1 88  ? -95.751  -80.840  19.547  1.00 13.84 ? 88  ARG C NH1 1 
ATOM   3395  N  NH2 . ARG C  1 88  ? -95.469  -82.247  17.754  1.00 13.13 ? 88  ARG C NH2 1 
ATOM   3396  N  N   . SER C  1 89  ? -89.960  -80.847  24.204  1.00 4.66  ? 89  SER C N   1 
ATOM   3397  C  CA  . SER C  1 89  ? -89.641  -80.639  25.595  1.00 4.19  ? 89  SER C CA  1 
ATOM   3398  C  C   . SER C  1 89  ? -89.030  -79.240  25.854  1.00 4.53  ? 89  SER C C   1 
ATOM   3399  O  O   . SER C  1 89  ? -89.370  -78.597  26.861  1.00 4.75  ? 89  SER C O   1 
ATOM   3400  C  CB  . SER C  1 89  ? -88.729  -81.739  26.080  1.00 4.05  ? 89  SER C CB  1 
ATOM   3401  O  OG  . SER C  1 89  ? -88.362  -81.497  27.421  1.00 3.48  ? 89  SER C OG  1 
ATOM   3402  N  N   . ASP C  1 90  ? -88.159  -78.781  24.943  1.00 3.86  ? 90  ASP C N   1 
ATOM   3403  C  CA  . ASP C  1 90  ? -87.622  -77.441  24.999  1.00 3.79  ? 90  ASP C CA  1 
ATOM   3404  C  C   . ASP C  1 90  ? -88.740  -76.422  24.877  1.00 3.87  ? 90  ASP C C   1 
ATOM   3405  O  O   . ASP C  1 90  ? -88.742  -75.435  25.602  1.00 4.18  ? 90  ASP C O   1 
ATOM   3406  C  CB  . ASP C  1 90  ? -86.591  -77.196  23.908  1.00 4.11  ? 90  ASP C CB  1 
ATOM   3407  C  CG  . ASP C  1 90  ? -85.282  -78.004  24.094  1.00 6.79  ? 90  ASP C CG  1 
ATOM   3408  O  OD1 . ASP C  1 90  ? -84.651  -78.417  23.061  1.00 9.09  ? 90  ASP C OD1 1 
ATOM   3409  O  OD2 . ASP C  1 90  ? -84.862  -78.211  25.263  1.00 9.69  ? 90  ASP C OD2 1 
ATOM   3410  N  N   . LEU C  1 91  ? -89.698  -76.660  23.973  1.00 3.67  ? 91  LEU C N   1 
ATOM   3411  C  CA  . LEU C  1 91  ? -90.872  -75.780  23.827  1.00 2.84  ? 91  LEU C CA  1 
ATOM   3412  C  C   . LEU C  1 91  ? -91.699  -75.701  25.117  1.00 3.12  ? 91  LEU C C   1 
ATOM   3413  O  O   . LEU C  1 91  ? -92.041  -74.612  25.560  1.00 3.74  ? 91  LEU C O   1 
ATOM   3414  C  CB  . LEU C  1 91  ? -91.745  -76.204  22.655  1.00 2.84  ? 91  LEU C CB  1 
ATOM   3415  C  CG  . LEU C  1 91  ? -93.049  -75.466  22.383  1.00 2.00  ? 91  LEU C CG  1 
ATOM   3416  C  CD1 . LEU C  1 91  ? -92.781  -74.000  22.171  1.00 2.68  ? 91  LEU C CD1 1 
ATOM   3417  C  CD2 . LEU C  1 91  ? -93.783  -76.063  21.209  1.00 2.00  ? 91  LEU C CD2 1 
ATOM   3418  N  N   . ALA C  1 92  ? -92.001  -76.829  25.751  1.00 3.25  ? 92  ALA C N   1 
ATOM   3419  C  CA  . ALA C  1 92  ? -92.781  -76.770  27.002  1.00 3.20  ? 92  ALA C CA  1 
ATOM   3420  C  C   . ALA C  1 92  ? -92.034  -75.921  28.044  1.00 3.62  ? 92  ALA C C   1 
ATOM   3421  O  O   . ALA C  1 92  ? -92.631  -75.134  28.809  1.00 4.25  ? 92  ALA C O   1 
ATOM   3422  C  CB  . ALA C  1 92  ? -93.105  -78.168  27.533  1.00 2.00  ? 92  ALA C CB  1 
ATOM   3423  N  N   . LEU C  1 93  ? -90.721  -76.068  28.055  1.00 3.83  ? 93  LEU C N   1 
ATOM   3424  C  CA  . LEU C  1 93  ? -89.882  -75.360  29.015  1.00 4.33  ? 93  LEU C CA  1 
ATOM   3425  C  C   . LEU C  1 93  ? -89.894  -73.852  28.807  1.00 4.81  ? 93  LEU C C   1 
ATOM   3426  O  O   . LEU C  1 93  ? -90.000  -73.103  29.776  1.00 5.12  ? 93  LEU C O   1 
ATOM   3427  C  CB  . LEU C  1 93  ? -88.460  -75.867  28.928  1.00 4.19  ? 93  LEU C CB  1 
ATOM   3428  C  CG  . LEU C  1 93  ? -87.578  -75.475  30.092  1.00 5.16  ? 93  LEU C CG  1 
ATOM   3429  C  CD1 . LEU C  1 93  ? -88.137  -76.024  31.415  1.00 5.02  ? 93  LEU C CD1 1 
ATOM   3430  C  CD2 . LEU C  1 93  ? -86.197  -76.026  29.809  1.00 4.53  ? 93  LEU C CD2 1 
ATOM   3431  N  N   . GLU C  1 94  ? -89.805  -73.418  27.538  1.00 4.96  ? 94  GLU C N   1 
ATOM   3432  C  CA  . GLU C  1 94  ? -89.867  -72.011  27.180  1.00 5.03  ? 94  GLU C CA  1 
ATOM   3433  C  C   . GLU C  1 94  ? -91.230  -71.439  27.554  1.00 4.87  ? 94  GLU C C   1 
ATOM   3434  O  O   . GLU C  1 94  ? -91.341  -70.342  28.104  1.00 4.46  ? 94  GLU C O   1 
ATOM   3435  C  CB  . GLU C  1 94  ? -89.588  -71.817  25.700  1.00 5.05  ? 94  GLU C CB  1 
ATOM   3436  C  CG  . GLU C  1 94  ? -88.194  -72.201  25.264  1.00 7.75  ? 94  GLU C CG  1 
ATOM   3437  C  CD  . GLU C  1 94  ? -87.164  -71.075  25.421  1.00 13.84 ? 94  GLU C CD  1 
ATOM   3438  O  OE1 . GLU C  1 94  ? -87.538  -69.992  25.973  1.00 15.14 ? 94  GLU C OE1 1 
ATOM   3439  O  OE2 . GLU C  1 94  ? -85.984  -71.265  25.010  1.00 14.45 ? 94  GLU C OE2 1 
ATOM   3440  N  N   . LEU C  1 95  ? -92.274  -72.207  27.274  1.00 4.99  ? 95  LEU C N   1 
ATOM   3441  C  CA  . LEU C  1 95  ? -93.623  -71.797  27.621  1.00 4.83  ? 95  LEU C CA  1 
ATOM   3442  C  C   . LEU C  1 95  ? -93.790  -71.593  29.136  1.00 5.52  ? 95  LEU C C   1 
ATOM   3443  O  O   . LEU C  1 95  ? -94.388  -70.598  29.549  1.00 5.95  ? 95  LEU C O   1 
ATOM   3444  C  CB  . LEU C  1 95  ? -94.633  -72.781  27.061  1.00 4.56  ? 95  LEU C CB  1 
ATOM   3445  C  CG  . LEU C  1 95  ? -95.391  -72.408  25.788  1.00 4.43  ? 95  LEU C CG  1 
ATOM   3446  C  CD1 . LEU C  1 95  ? -94.755  -71.317  25.001  1.00 2.64  ? 95  LEU C CD1 1 
ATOM   3447  C  CD2 . LEU C  1 95  ? -95.601  -73.627  24.927  1.00 3.36  ? 95  LEU C CD2 1 
ATOM   3448  N  N   . ASP C  1 96  ? -93.255  -72.482  29.966  1.00 5.50  ? 96  ASP C N   1 
ATOM   3449  C  CA  . ASP C  1 96  ? -93.372  -72.247  31.391  1.00 6.34  ? 96  ASP C CA  1 
ATOM   3450  C  C   . ASP C  1 96  ? -92.559  -71.064  31.874  1.00 5.91  ? 96  ASP C C   1 
ATOM   3451  O  O   . ASP C  1 96  ? -92.944  -70.366  32.815  1.00 5.82  ? 96  ASP C O   1 
ATOM   3452  C  CB  . ASP C  1 96  ? -92.988  -73.485  32.201  1.00 7.37  ? 96  ASP C CB  1 
ATOM   3453  C  CG  . ASP C  1 96  ? -94.094  -74.534  32.201  1.00 13.92 ? 96  ASP C CG  1 
ATOM   3454  O  OD1 . ASP C  1 96  ? -95.324  -74.169  32.068  1.00 19.35 ? 96  ASP C OD1 1 
ATOM   3455  O  OD2 . ASP C  1 96  ? -93.726  -75.734  32.327  1.00 19.45 ? 96  ASP C OD2 1 
ATOM   3456  N  N   . GLY C  1 97  ? -91.406  -70.851  31.267  1.00 5.50  ? 97  GLY C N   1 
ATOM   3457  C  CA  . GLY C  1 97  ? -90.607  -69.716  31.643  1.00 5.60  ? 97  GLY C CA  1 
ATOM   3458  C  C   . GLY C  1 97  ? -91.243  -68.405  31.191  1.00 5.92  ? 97  GLY C C   1 
ATOM   3459  O  O   . GLY C  1 97  ? -91.129  -67.387  31.872  1.00 5.91  ? 97  GLY C O   1 
ATOM   3460  N  N   . ALA C  1 98  ? -91.894  -68.407  30.033  1.00 6.51  ? 98  ALA C N   1 
ATOM   3461  C  CA  . ALA C  1 98  ? -92.533  -67.192  29.560  1.00 7.80  ? 98  ALA C CA  1 
ATOM   3462  C  C   . ALA C  1 98  ? -93.641  -66.789  30.542  1.00 9.22  ? 98  ALA C C   1 
ATOM   3463  O  O   . ALA C  1 98  ? -93.815  -65.617  30.850  1.00 8.86  ? 98  ALA C O   1 
ATOM   3464  C  CB  . ALA C  1 98  ? -93.062  -67.370  28.145  1.00 6.34  ? 98  ALA C CB  1 
ATOM   3465  N  N   . LYS C  1 99  ? -94.348  -67.787  31.051  1.00 11.31 ? 99  LYS C N   1 
ATOM   3466  C  CA  . LYS C  1 99  ? -95.413  -67.606  32.006  1.00 13.62 ? 99  LYS C CA  1 
ATOM   3467  C  C   . LYS C  1 99  ? -94.845  -66.932  33.239  1.00 11.97 ? 99  LYS C C   1 
ATOM   3468  O  O   . LYS C  1 99  ? -95.347  -65.885  33.643  1.00 12.45 ? 99  LYS C O   1 
ATOM   3469  C  CB  . LYS C  1 99  ? -96.037  -68.962  32.317  1.00 14.36 ? 99  LYS C CB  1 
ATOM   3470  C  CG  . LYS C  1 99  ? -97.483  -68.975  32.824  1.00 18.33 ? 99  LYS C CG  1 
ATOM   3471  C  CD  . LYS C  1 99  ? -98.102  -70.420  32.763  1.00 19.23 ? 99  LYS C CD  1 
ATOM   3472  C  CE  . LYS C  1 99  ? -98.534  -70.888  31.298  1.00 22.80 ? 99  LYS C CE  1 
ATOM   3473  N  NZ  . LYS C  1 99  ? -98.191  -72.347  30.972  1.00 22.14 ? 99  LYS C NZ  1 
ATOM   3474  N  N   . ASN C  1 100 ? -93.774  -67.492  33.804  1.00 9.86  ? 100 ASN C N   1 
ATOM   3475  C  CA  . ASN C  1 100 ? -93.094  -66.887  34.960  1.00 8.14  ? 100 ASN C CA  1 
ATOM   3476  C  C   . ASN C  1 100 ? -92.616  -65.445  34.705  1.00 7.37  ? 100 ASN C C   1 
ATOM   3477  O  O   . ASN C  1 100 ? -92.722  -64.568  35.589  1.00 6.40  ? 100 ASN C O   1 
ATOM   3478  C  CB  . ASN C  1 100 ? -91.906  -67.736  35.421  1.00 7.84  ? 100 ASN C CB  1 
ATOM   3479  C  CG  . ASN C  1 100 ? -92.307  -69.133  35.893  1.00 8.34  ? 100 ASN C CG  1 
ATOM   3480  O  OD1 . ASN C  1 100 ? -91.511  -70.059  35.808  1.00 9.75  ? 100 ASN C OD1 1 
ATOM   3481  N  ND2 . ASN C  1 100 ? -93.530  -69.293  36.383  1.00 6.54  ? 100 ASN C ND2 1 
ATOM   3482  N  N   . LEU C  1 101 ? -92.094  -65.214  33.490  1.00 5.79  ? 101 LEU C N   1 
ATOM   3483  C  CA  . LEU C  1 101 ? -91.594  -63.919  33.122  1.00 3.80  ? 101 LEU C CA  1 
ATOM   3484  C  C   . LEU C  1 101 ? -92.716  -62.912  33.074  1.00 3.44  ? 101 LEU C C   1 
ATOM   3485  O  O   . LEU C  1 101 ? -92.543  -61.785  33.561  1.00 3.03  ? 101 LEU C O   1 
ATOM   3486  C  CB  . LEU C  1 101 ? -90.893  -63.990  31.782  1.00 4.16  ? 101 LEU C CB  1 
ATOM   3487  C  CG  . LEU C  1 101 ? -89.371  -64.189  31.771  1.00 2.79  ? 101 LEU C CG  1 
ATOM   3488  C  CD1 . LEU C  1 101 ? -88.900  -64.708  30.412  1.00 3.14  ? 101 LEU C CD1 1 
ATOM   3489  C  CD2 . LEU C  1 101 ? -88.685  -62.926  32.086  1.00 2.00  ? 101 LEU C CD2 1 
ATOM   3490  N  N   . ARG C  1 102 ? -93.866  -63.305  32.511  1.00 3.00  ? 102 ARG C N   1 
ATOM   3491  C  CA  A ARG C  1 102 ? -95.035  -62.425  32.456  0.50 3.16  ? 102 ARG C CA  1 
ATOM   3492  C  CA  B ARG C  1 102 ? -95.030  -62.425  32.449  0.50 3.17  ? 102 ARG C CA  1 
ATOM   3493  C  C   . ARG C  1 102 ? -95.435  -62.000  33.878  1.00 3.57  ? 102 ARG C C   1 
ATOM   3494  O  O   . ARG C  1 102 ? -95.709  -60.818  34.123  1.00 3.76  ? 102 ARG C O   1 
ATOM   3495  C  CB  A ARG C  1 102 ? -96.195  -63.064  31.666  0.50 2.53  ? 102 ARG C CB  1 
ATOM   3496  C  CB  B ARG C  1 102 ? -96.176  -63.059  31.624  0.50 2.54  ? 102 ARG C CB  1 
ATOM   3497  C  CG  A ARG C  1 102 ? -95.777  -63.438  30.247  0.50 3.08  ? 102 ARG C CG  1 
ATOM   3498  C  CG  B ARG C  1 102 ? -95.854  -63.117  30.105  0.50 3.16  ? 102 ARG C CG  1 
ATOM   3499  C  CD  A ARG C  1 102 ? -96.895  -63.626  29.222  0.50 3.46  ? 102 ARG C CD  1 
ATOM   3500  C  CD  B ARG C  1 102 ? -96.823  -63.932  29.205  0.50 3.54  ? 102 ARG C CD  1 
ATOM   3501  N  NE  A ARG C  1 102 ? -96.441  -63.147  27.913  0.50 4.49  ? 102 ARG C NE  1 
ATOM   3502  N  NE  B ARG C  1 102 ? -96.895  -65.345  29.589  0.50 5.97  ? 102 ARG C NE  1 
ATOM   3503  C  CZ  A ARG C  1 102 ? -95.869  -63.898  26.987  0.50 5.97  ? 102 ARG C CZ  1 
ATOM   3504  C  CZ  B ARG C  1 102 ? -97.774  -66.241  29.128  0.50 7.20  ? 102 ARG C CZ  1 
ATOM   3505  N  NH1 A ARG C  1 102 ? -95.686  -65.178  27.182  0.50 9.10  ? 102 ARG C NH1 1 
ATOM   3506  N  NH1 B ARG C  1 102 ? -98.692  -65.917  28.222  0.50 10.62 ? 102 ARG C NH1 1 
ATOM   3507  N  NH2 A ARG C  1 102 ? -95.480  -63.354  25.852  0.50 7.38  ? 102 ARG C NH2 1 
ATOM   3508  N  NH2 B ARG C  1 102 ? -97.737  -67.468  29.587  0.50 7.27  ? 102 ARG C NH2 1 
ATOM   3509  N  N   . GLU C  1 103 ? -95.386  -62.925  34.863  1.00 4.19  ? 103 GLU C N   1 
ATOM   3510  C  CA  . GLU C  1 103 ? -95.811  -62.532  36.232  1.00 6.46  ? 103 GLU C CA  1 
ATOM   3511  C  C   . GLU C  1 103 ? -94.783  -61.613  36.794  1.00 4.96  ? 103 GLU C C   1 
ATOM   3512  O  O   . GLU C  1 103 ? -95.100  -60.573  37.321  1.00 6.60  ? 103 GLU C O   1 
ATOM   3513  C  CB  . GLU C  1 103 ? -95.878  -63.662  37.212  1.00 5.39  ? 103 GLU C CB  1 
ATOM   3514  C  CG  . GLU C  1 103 ? -96.844  -64.777  36.925  1.00 12.15 ? 103 GLU C CG  1 
ATOM   3515  C  CD  . GLU C  1 103 ? -96.645  -65.965  37.925  1.00 14.09 ? 103 GLU C CD  1 
ATOM   3516  O  OE1 . GLU C  1 103 ? -96.654  -67.129  37.422  1.00 20.93 ? 103 GLU C OE1 1 
ATOM   3517  O  OE2 . GLU C  1 103 ? -96.457  -65.712  39.195  1.00 22.70 ? 103 GLU C OE2 1 
ATOM   3518  N  N   . ALA C  1 104 ? -93.528  -62.020  36.723  1.00 2.89  ? 104 ALA C N   1 
ATOM   3519  C  CA  . ALA C  1 104 ? -92.484  -61.219  37.324  1.00 2.21  ? 104 ALA C CA  1 
ATOM   3520  C  C   . ALA C  1 104 ? -92.496  -59.779  36.818  1.00 2.28  ? 104 ALA C C   1 
ATOM   3521  O  O   . ALA C  1 104 ? -92.310  -58.845  37.606  1.00 2.00  ? 104 ALA C O   1 
ATOM   3522  C  CB  . ALA C  1 104 ? -91.156  -61.836  37.096  1.00 2.00  ? 104 ALA C CB  1 
ATOM   3523  N  N   . ILE C  1 105 ? -92.708  -59.615  35.506  1.00 2.42  ? 105 ILE C N   1 
ATOM   3524  C  CA  . ILE C  1 105 ? -92.715  -58.300  34.859  1.00 2.28  ? 105 ILE C CA  1 
ATOM   3525  C  C   . ILE C  1 105 ? -93.820  -57.407  35.439  1.00 2.29  ? 105 ILE C C   1 
ATOM   3526  O  O   . ILE C  1 105 ? -93.577  -56.214  35.714  1.00 2.00  ? 105 ILE C O   1 
ATOM   3527  C  CB  . ILE C  1 105 ? -92.841  -58.427  33.311  1.00 2.00  ? 105 ILE C CB  1 
ATOM   3528  C  CG1 . ILE C  1 105 ? -91.531  -58.929  32.747  1.00 2.00  ? 105 ILE C CG1 1 
ATOM   3529  C  CG2 . ILE C  1 105 ? -93.154  -57.100  32.666  1.00 2.52  ? 105 ILE C CG2 1 
ATOM   3530  C  CD1 . ILE C  1 105 ? -91.629  -59.493  31.420  1.00 2.00  ? 105 ILE C CD1 1 
ATOM   3531  N  N   . GLY C  1 106 ? -95.009  -57.990  35.620  1.00 2.15  ? 106 GLY C N   1 
ATOM   3532  C  CA  . GLY C  1 106 ? -96.134  -57.263  36.129  1.00 2.00  ? 106 GLY C CA  1 
ATOM   3533  C  C   . GLY C  1 106 ? -95.864  -56.829  37.552  1.00 2.39  ? 106 GLY C C   1 
ATOM   3534  O  O   . GLY C  1 106 ? -96.224  -55.694  37.958  1.00 3.05  ? 106 GLY C O   1 
ATOM   3535  N  N   . TYR C  1 107 ? -95.207  -57.697  38.319  1.00 2.00  ? 107 TYR C N   1 
ATOM   3536  C  CA  . TYR C  1 107 ? -94.956  -57.390  39.700  1.00 2.00  ? 107 TYR C CA  1 
ATOM   3537  C  C   . TYR C  1 107 ? -93.864  -56.320  39.880  1.00 2.68  ? 107 TYR C C   1 
ATOM   3538  O  O   . TYR C  1 107 ? -93.997  -55.397  40.706  1.00 2.70  ? 107 TYR C O   1 
ATOM   3539  C  CB  . TYR C  1 107 ? -94.648  -58.649  40.505  1.00 2.25  ? 107 TYR C CB  1 
ATOM   3540  C  CG  . TYR C  1 107 ? -94.270  -58.281  41.921  1.00 2.13  ? 107 TYR C CG  1 
ATOM   3541  C  CD1 . TYR C  1 107 ? -95.247  -58.010  42.875  1.00 2.00  ? 107 TYR C CD1 1 
ATOM   3542  C  CD2 . TYR C  1 107 ? -92.952  -58.105  42.259  1.00 2.00  ? 107 TYR C CD2 1 
ATOM   3543  C  CE1 . TYR C  1 107 ? -94.910  -57.634  44.140  1.00 2.11  ? 107 TYR C CE1 1 
ATOM   3544  C  CE2 . TYR C  1 107 ? -92.587  -57.729  43.526  1.00 3.55  ? 107 TYR C CE2 1 
ATOM   3545  C  CZ  . TYR C  1 107 ? -93.571  -57.488  44.473  1.00 3.75  ? 107 TYR C CZ  1 
ATOM   3546  O  OH  . TYR C  1 107 ? -93.169  -57.100  45.744  1.00 4.39  ? 107 TYR C OH  1 
ATOM   3547  N  N   . ALA C  1 108 ? -92.795  -56.421  39.095  1.00 2.82  ? 108 ALA C N   1 
ATOM   3548  C  CA  . ALA C  1 108 ? -91.735  -55.411  39.090  1.00 2.67  ? 108 ALA C CA  1 
ATOM   3549  C  C   . ALA C  1 108 ? -92.287  -54.001  38.813  1.00 2.95  ? 108 ALA C C   1 
ATOM   3550  O  O   . ALA C  1 108 ? -91.868  -53.024  39.459  1.00 2.72  ? 108 ALA C O   1 
ATOM   3551  C  CB  . ALA C  1 108 ? -90.645  -55.770  38.102  1.00 2.02  ? 108 ALA C CB  1 
ATOM   3552  N  N   . ASP C  1 109 ? -93.246  -53.903  37.887  1.00 2.96  ? 109 ASP C N   1 
ATOM   3553  C  CA  . ASP C  1 109 ? -93.917  -52.653  37.593  1.00 3.22  ? 109 ASP C CA  1 
ATOM   3554  C  C   . ASP C  1 109 ? -94.651  -52.147  38.792  1.00 3.31  ? 109 ASP C C   1 
ATOM   3555  O  O   . ASP C  1 109 ? -94.683  -50.958  39.052  1.00 2.71  ? 109 ASP C O   1 
ATOM   3556  C  CB  . ASP C  1 109 ? -94.901  -52.836  36.462  1.00 3.44  ? 109 ASP C CB  1 
ATOM   3557  C  CG  . ASP C  1 109 ? -95.396  -51.522  35.904  1.00 5.63  ? 109 ASP C CG  1 
ATOM   3558  O  OD1 . ASP C  1 109 ? -96.471  -51.071  36.345  1.00 8.74  ? 109 ASP C OD1 1 
ATOM   3559  O  OD2 . ASP C  1 109 ? -94.720  -50.915  35.024  1.00 8.49  ? 109 ASP C OD2 1 
ATOM   3560  N  N   . SER C  1 110 ? -95.249  -53.038  39.560  1.00 3.76  ? 110 SER C N   1 
ATOM   3561  C  CA  . SER C  1 110 ? -96.106  -52.534  40.610  1.00 4.46  ? 110 SER C CA  1 
ATOM   3562  C  C   . SER C  1 110 ? -95.333  -52.094  41.827  1.00 3.83  ? 110 SER C C   1 
ATOM   3563  O  O   . SER C  1 110 ? -95.825  -51.245  42.573  1.00 4.06  ? 110 SER C O   1 
ATOM   3564  C  CB  . SER C  1 110 ? -97.231  -53.501  40.932  1.00 4.71  ? 110 SER C CB  1 
ATOM   3565  O  OG  . SER C  1 110 ? -96.665  -54.721  41.371  1.00 10.38 ? 110 SER C OG  1 
ATOM   3566  N  N   . VAL C  1 111 ? -94.116  -52.606  42.006  1.00 3.46  ? 111 VAL C N   1 
ATOM   3567  C  CA  . VAL C  1 111 ? -93.203  -52.045  43.041  1.00 2.88  ? 111 VAL C CA  1 
ATOM   3568  C  C   . VAL C  1 111 ? -92.190  -51.045  42.476  1.00 2.82  ? 111 VAL C C   1 
ATOM   3569  O  O   . VAL C  1 111 ? -91.244  -50.670  43.165  1.00 2.00  ? 111 VAL C O   1 
ATOM   3570  C  CB  . VAL C  1 111 ? -92.414  -53.127  43.820  1.00 2.93  ? 111 VAL C CB  1 
ATOM   3571  C  CG1 . VAL C  1 111 ? -93.330  -53.930  44.686  1.00 3.09  ? 111 VAL C CG1 1 
ATOM   3572  C  CG2 . VAL C  1 111 ? -91.648  -54.033  42.865  1.00 3.51  ? 111 VAL C CG2 1 
ATOM   3573  N  N   . HIS C  1 112 ? -92.375  -50.624  41.216  1.00 3.28  ? 112 HIS C N   1 
ATOM   3574  C  CA  . HIS C  1 112 ? -91.542  -49.564  40.621  1.00 3.77  ? 112 HIS C CA  1 
ATOM   3575  C  C   . HIS C  1 112 ? -90.101  -49.963  40.308  1.00 3.47  ? 112 HIS C C   1 
ATOM   3576  O  O   . HIS C  1 112 ? -89.273  -49.092  40.092  1.00 4.04  ? 112 HIS C O   1 
ATOM   3577  C  CB  . HIS C  1 112 ? -91.595  -48.280  41.476  1.00 3.87  ? 112 HIS C CB  1 
ATOM   3578  C  CG  . HIS C  1 112 ? -92.973  -47.713  41.610  1.00 8.21  ? 112 HIS C CG  1 
ATOM   3579  N  ND1 . HIS C  1 112 ? -93.823  -48.043  42.649  1.00 12.06 ? 112 HIS C ND1 1 
ATOM   3580  C  CD2 . HIS C  1 112 ? -93.677  -46.890  40.794  1.00 11.31 ? 112 HIS C CD2 1 
ATOM   3581  C  CE1 . HIS C  1 112 ? -94.988  -47.439  42.469  1.00 12.96 ? 112 HIS C CE1 1 
ATOM   3582  N  NE2 . HIS C  1 112 ? -94.922  -46.720  41.358  1.00 12.53 ? 112 HIS C NE2 1 
ATOM   3583  N  N   . ASP C  1 113 ? -89.800  -51.263  40.249  1.00 3.02  ? 113 ASP C N   1 
ATOM   3584  C  CA  . ASP C  1 113 ? -88.483  -51.725  39.809  1.00 2.50  ? 113 ASP C CA  1 
ATOM   3585  C  C   . ASP C  1 113 ? -88.450  -51.782  38.283  1.00 2.13  ? 113 ASP C C   1 
ATOM   3586  O  O   . ASP C  1 113 ? -88.393  -52.828  37.680  1.00 2.03  ? 113 ASP C O   1 
ATOM   3587  C  CB  . ASP C  1 113 ? -88.108  -53.070  40.428  1.00 2.56  ? 113 ASP C CB  1 
ATOM   3588  C  CG  . ASP C  1 113 ? -86.623  -53.444  40.201  1.00 3.39  ? 113 ASP C CG  1 
ATOM   3589  O  OD1 . ASP C  1 113 ? -85.905  -52.763  39.427  1.00 3.55  ? 113 ASP C OD1 1 
ATOM   3590  O  OD2 . ASP C  1 113 ? -86.168  -54.441  40.795  1.00 3.83  ? 113 ASP C OD2 1 
ATOM   3591  N  N   . TYR C  1 114 ? -88.468  -50.607  37.689  1.00 2.00  ? 114 TYR C N   1 
ATOM   3592  C  CA  . TYR C  1 114 ? -88.546  -50.445  36.274  1.00 2.18  ? 114 TYR C CA  1 
ATOM   3593  C  C   . TYR C  1 114 ? -87.332  -50.970  35.532  1.00 2.55  ? 114 TYR C C   1 
ATOM   3594  O  O   . TYR C  1 114 ? -87.489  -51.434  34.398  1.00 2.01  ? 114 TYR C O   1 
ATOM   3595  C  CB  . TYR C  1 114 ? -88.834  -48.996  35.962  1.00 2.00  ? 114 TYR C CB  1 
ATOM   3596  C  CG  . TYR C  1 114 ? -90.184  -48.572  36.498  1.00 2.48  ? 114 TYR C CG  1 
ATOM   3597  C  CD1 . TYR C  1 114 ? -91.363  -49.217  36.069  1.00 2.00  ? 114 TYR C CD1 1 
ATOM   3598  C  CD2 . TYR C  1 114 ? -90.297  -47.536  37.432  1.00 2.15  ? 114 TYR C CD2 1 
ATOM   3599  C  CE1 . TYR C  1 114 ? -92.596  -48.842  36.542  1.00 2.00  ? 114 TYR C CE1 1 
ATOM   3600  C  CE2 . TYR C  1 114 ? -91.552  -47.137  37.913  1.00 2.06  ? 114 TYR C CE2 1 
ATOM   3601  C  CZ  . TYR C  1 114 ? -92.687  -47.793  37.466  1.00 2.01  ? 114 TYR C CZ  1 
ATOM   3602  O  OH  . TYR C  1 114 ? -93.904  -47.420  37.961  1.00 2.01  ? 114 TYR C OH  1 
ATOM   3603  N  N   . VAL C  1 115 ? -86.128  -50.938  36.145  1.00 2.63  ? 115 VAL C N   1 
ATOM   3604  C  CA  . VAL C  1 115 ? -85.015  -51.501  35.425  1.00 2.53  ? 115 VAL C CA  1 
ATOM   3605  C  C   . VAL C  1 115 ? -84.977  -53.018  35.424  1.00 2.93  ? 115 VAL C C   1 
ATOM   3606  O  O   . VAL C  1 115 ? -84.726  -53.611  34.368  1.00 3.43  ? 115 VAL C O   1 
ATOM   3607  C  CB  . VAL C  1 115 ? -83.692  -50.724  35.494  1.00 2.29  ? 115 VAL C CB  1 
ATOM   3608  C  CG1 . VAL C  1 115 ? -83.825  -49.536  36.334  1.00 2.95  ? 115 VAL C CG1 1 
ATOM   3609  C  CG2 . VAL C  1 115 ? -82.484  -51.603  35.811  1.00 2.00  ? 115 VAL C CG2 1 
ATOM   3610  N  N   . SER C  1 116 ? -85.291  -53.652  36.547  1.00 2.74  ? 116 SER C N   1 
ATOM   3611  C  CA  . SER C  1 116 ? -85.524  -55.089  36.500  1.00 2.48  ? 116 SER C CA  1 
ATOM   3612  C  C   . SER C  1 116 ? -86.594  -55.429  35.460  1.00 2.75  ? 116 SER C C   1 
ATOM   3613  O  O   . SER C  1 116 ? -86.427  -56.386  34.706  1.00 3.14  ? 116 SER C O   1 
ATOM   3614  C  CB  . SER C  1 116 ? -85.922  -55.657  37.851  1.00 2.01  ? 116 SER C CB  1 
ATOM   3615  O  OG  . SER C  1 116 ? -84.866  -55.519  38.765  1.00 2.02  ? 116 SER C OG  1 
ATOM   3616  N  N   . ARG C  1 117 ? -87.669  -54.649  35.389  1.00 2.51  ? 117 ARG C N   1 
ATOM   3617  C  CA  . ARG C  1 117 ? -88.713  -54.931  34.435  1.00 2.23  ? 117 ARG C CA  1 
ATOM   3618  C  C   . ARG C  1 117 ? -88.166  -54.903  33.008  1.00 3.13  ? 117 ARG C C   1 
ATOM   3619  O  O   . ARG C  1 117 ? -88.427  -55.828  32.197  1.00 3.08  ? 117 ARG C O   1 
ATOM   3620  C  CB  . ARG C  1 117 ? -89.862  -53.959  34.573  1.00 2.00  ? 117 ARG C CB  1 
ATOM   3621  C  CG  . ARG C  1 117 ? -90.923  -54.147  33.528  1.00 2.00  ? 117 ARG C CG  1 
ATOM   3622  C  CD  . ARG C  1 117 ? -92.161  -53.379  33.917  1.00 2.00  ? 117 ARG C CD  1 
ATOM   3623  N  NE  . ARG C  1 117 ? -92.991  -53.031  32.761  1.00 2.91  ? 117 ARG C NE  1 
ATOM   3624  C  CZ  . ARG C  1 117 ? -94.252  -53.382  32.595  1.00 2.70  ? 117 ARG C CZ  1 
ATOM   3625  N  NH1 . ARG C  1 117 ? -94.874  -54.113  33.515  1.00 2.00  ? 117 ARG C NH1 1 
ATOM   3626  N  NH2 . ARG C  1 117 ? -94.890  -52.959  31.513  1.00 2.00  ? 117 ARG C NH2 1 
ATOM   3627  N  N   . ASP C  1 118 ? -87.390  -53.854  32.730  1.00 3.52  ? 118 ASP C N   1 
ATOM   3628  C  CA  . ASP C  1 118 ? -86.851  -53.588  31.423  1.00 3.87  ? 118 ASP C CA  1 
ATOM   3629  C  C   . ASP C  1 118 ? -85.935  -54.734  31.036  1.00 4.00  ? 118 ASP C C   1 
ATOM   3630  O  O   . ASP C  1 118 ? -86.036  -55.247  29.936  1.00 5.18  ? 118 ASP C O   1 
ATOM   3631  C  CB  . ASP C  1 118 ? -86.098  -52.256  31.464  1.00 4.82  ? 118 ASP C CB  1 
ATOM   3632  C  CG  . ASP C  1 118 ? -85.623  -51.785  30.081  1.00 7.81  ? 118 ASP C CG  1 
ATOM   3633  O  OD1 . ASP C  1 118 ? -86.486  -51.562  29.193  1.00 11.70 ? 118 ASP C OD1 1 
ATOM   3634  O  OD2 . ASP C  1 118 ? -84.394  -51.600  29.890  1.00 11.12 ? 118 ASP C OD2 1 
ATOM   3635  N  N   . MET C  1 119 ? -85.070  -55.177  31.939  1.00 3.97  ? 119 MET C N   1 
ATOM   3636  C  CA  . MET C  1 119 ? -84.239  -56.329  31.663  1.00 4.15  ? 119 MET C CA  1 
ATOM   3637  C  C   . MET C  1 119 ? -85.079  -57.573  31.372  1.00 3.86  ? 119 MET C C   1 
ATOM   3638  O  O   . MET C  1 119 ? -84.766  -58.329  30.452  1.00 4.55  ? 119 MET C O   1 
ATOM   3639  C  CB  . MET C  1 119 ? -83.286  -56.585  32.812  1.00 4.08  ? 119 MET C CB  1 
ATOM   3640  C  CG  . MET C  1 119 ? -82.657  -57.967  32.835  1.00 4.22  ? 119 MET C CG  1 
ATOM   3641  S  SD  . MET C  1 119 ? -82.125  -58.368  34.514  1.00 5.82  ? 119 MET C SD  1 
ATOM   3642  C  CE  . MET C  1 119 ? -80.713  -57.317  34.610  1.00 9.20  ? 119 MET C CE  1 
ATOM   3643  N  N   . MET C  1 120 ? -86.145  -57.786  32.137  1.00 3.13  ? 120 MET C N   1 
ATOM   3644  C  CA  . MET C  1 120 ? -86.976  -58.963  31.933  1.00 3.22  ? 120 MET C CA  1 
ATOM   3645  C  C   . MET C  1 120 ? -87.708  -58.939  30.604  1.00 3.22  ? 120 MET C C   1 
ATOM   3646  O  O   . MET C  1 120 ? -87.888  -59.989  30.007  1.00 2.76  ? 120 MET C O   1 
ATOM   3647  C  CB  . MET C  1 120 ? -87.953  -59.154  33.087  1.00 2.55  ? 120 MET C CB  1 
ATOM   3648  C  CG  . MET C  1 120 ? -87.250  -59.482  34.348  1.00 2.70  ? 120 MET C CG  1 
ATOM   3649  S  SD  . MET C  1 120 ? -88.327  -59.905  35.703  1.00 5.67  ? 120 MET C SD  1 
ATOM   3650  C  CE  . MET C  1 120 ? -89.109  -58.344  36.093  1.00 2.39  ? 120 MET C CE  1 
ATOM   3651  N  N   . ILE C  1 121 ? -88.141  -57.753  30.141  1.00 3.56  ? 121 ILE C N   1 
ATOM   3652  C  CA  . ILE C  1 121 ? -88.862  -57.666  28.881  1.00 3.28  ? 121 ILE C CA  1 
ATOM   3653  C  C   . ILE C  1 121 ? -87.947  -58.031  27.733  1.00 4.01  ? 121 ILE C C   1 
ATOM   3654  O  O   . ILE C  1 121 ? -88.375  -58.735  26.825  1.00 3.54  ? 121 ILE C O   1 
ATOM   3655  C  CB  . ILE C  1 121 ? -89.481  -56.296  28.645  1.00 3.16  ? 121 ILE C CB  1 
ATOM   3656  C  CG1 . ILE C  1 121 ? -90.708  -56.104  29.536  1.00 2.71  ? 121 ILE C CG1 1 
ATOM   3657  C  CG2 . ILE C  1 121 ? -89.974  -56.180  27.230  1.00 2.00  ? 121 ILE C CG2 1 
ATOM   3658  C  CD1 . ILE C  1 121 ? -91.073  -54.632  29.749  1.00 2.80  ? 121 ILE C CD1 1 
ATOM   3659  N  N   . GLU C  1 122 ? -86.686  -57.579  27.770  1.00 4.73  ? 122 GLU C N   1 
ATOM   3660  C  CA  . GLU C  1 122 ? -85.744  -57.982  26.723  1.00 5.54  ? 122 GLU C CA  1 
ATOM   3661  C  C   . GLU C  1 122 ? -85.531  -59.500  26.725  1.00 5.39  ? 122 GLU C C   1 
ATOM   3662  O  O   . GLU C  1 122 ? -85.535  -60.125  25.658  1.00 6.42  ? 122 GLU C O   1 
ATOM   3663  C  CB  . GLU C  1 122 ? -84.431  -57.206  26.770  1.00 5.85  ? 122 GLU C CB  1 
ATOM   3664  C  CG  . GLU C  1 122 ? -84.546  -55.665  26.414  1.00 11.58 ? 122 GLU C CG  1 
ATOM   3665  C  CD  . GLU C  1 122 ? -85.418  -55.319  25.083  1.00 19.43 ? 122 GLU C CD  1 
ATOM   3666  O  OE1 . GLU C  1 122 ? -84.894  -55.511  23.907  1.00 20.92 ? 122 GLU C OE1 1 
ATOM   3667  O  OE2 . GLU C  1 122 ? -86.608  -54.826  25.228  1.00 18.99 ? 122 GLU C OE2 1 
ATOM   3668  N  N   . ILE C  1 123 ? -85.414  -60.109  27.903  1.00 4.52  ? 123 ILE C N   1 
ATOM   3669  C  CA  . ILE C  1 123 ? -85.235  -61.558  27.988  1.00 3.57  ? 123 ILE C CA  1 
ATOM   3670  C  C   . ILE C  1 123 ? -86.449  -62.286  27.389  1.00 4.07  ? 123 ILE C C   1 
ATOM   3671  O  O   . ILE C  1 123 ? -86.285  -63.200  26.561  1.00 3.90  ? 123 ILE C O   1 
ATOM   3672  C  CB  . ILE C  1 123 ? -84.900  -61.991  29.426  1.00 3.55  ? 123 ILE C CB  1 
ATOM   3673  C  CG1 . ILE C  1 123 ? -83.475  -61.545  29.768  1.00 2.46  ? 123 ILE C CG1 1 
ATOM   3674  C  CG2 . ILE C  1 123 ? -85.089  -63.518  29.653  1.00 2.47  ? 123 ILE C CG2 1 
ATOM   3675  C  CD1 . ILE C  1 123 ? -83.173  -61.552  31.225  1.00 2.00  ? 123 ILE C CD1 1 
ATOM   3676  N  N   . LEU C  1 124 ? -87.657  -61.842  27.751  1.00 3.96  ? 124 LEU C N   1 
ATOM   3677  C  CA  . LEU C  1 124 ? -88.901  -62.436  27.252  1.00 3.94  ? 124 LEU C CA  1 
ATOM   3678  C  C   . LEU C  1 124 ? -88.959  -62.373  25.721  1.00 4.52  ? 124 LEU C C   1 
ATOM   3679  O  O   . LEU C  1 124 ? -89.394  -63.305  25.074  1.00 4.86  ? 124 LEU C O   1 
ATOM   3680  C  CB  . LEU C  1 124 ? -90.121  -61.738  27.868  1.00 3.42  ? 124 LEU C CB  1 
ATOM   3681  C  CG  . LEU C  1 124 ? -91.519  -62.208  27.430  1.00 2.98  ? 124 LEU C CG  1 
ATOM   3682  C  CD1 . LEU C  1 124 ? -91.846  -63.675  27.734  1.00 2.00  ? 124 LEU C CD1 1 
ATOM   3683  C  CD2 . LEU C  1 124 ? -92.524  -61.290  28.043  1.00 2.00  ? 124 LEU C CD2 1 
ATOM   3684  N  N   . ARG C  1 125 ? -88.491  -61.272  25.156  1.00 4.97  ? 125 ARG C N   1 
ATOM   3685  C  CA  . ARG C  1 125 ? -88.385  -61.123  23.722  1.00 5.50  ? 125 ARG C CA  1 
ATOM   3686  C  C   . ARG C  1 125 ? -87.437  -62.170  23.127  1.00 5.77  ? 125 ARG C C   1 
ATOM   3687  O  O   . ARG C  1 125 ? -87.727  -62.715  22.072  1.00 5.59  ? 125 ARG C O   1 
ATOM   3688  C  CB  . ARG C  1 125 ? -87.926  -59.706  23.376  1.00 5.59  ? 125 ARG C CB  1 
ATOM   3689  C  CG  . ARG C  1 125 ? -87.841  -59.430  21.917  1.00 7.86  ? 125 ARG C CG  1 
ATOM   3690  C  CD  . ARG C  1 125 ? -87.572  -57.976  21.631  1.00 12.91 ? 125 ARG C CD  1 
ATOM   3691  N  NE  . ARG C  1 125 ? -87.295  -57.786  20.194  1.00 19.06 ? 125 ARG C NE  1 
ATOM   3692  C  CZ  . ARG C  1 125 ? -86.760  -56.674  19.645  1.00 22.48 ? 125 ARG C CZ  1 
ATOM   3693  N  NH1 . ARG C  1 125 ? -86.417  -55.605  20.405  1.00 21.49 ? 125 ARG C NH1 1 
ATOM   3694  N  NH2 . ARG C  1 125 ? -86.564  -56.622  18.323  1.00 19.89 ? 125 ARG C NH2 1 
ATOM   3695  N  N   . ASP C  1 126 ? -86.321  -62.477  23.800  1.00 6.03  ? 126 ASP C N   1 
ATOM   3696  C  CA  . ASP C  1 126 ? -85.448  -63.536  23.297  1.00 6.52  ? 126 ASP C CA  1 
ATOM   3697  C  C   . ASP C  1 126 ? -86.147  -64.892  23.399  1.00 6.73  ? 126 ASP C C   1 
ATOM   3698  O  O   . ASP C  1 126 ? -85.958  -65.737  22.546  1.00 7.39  ? 126 ASP C O   1 
ATOM   3699  C  CB  . ASP C  1 126 ? -84.063  -63.587  23.974  1.00 6.62  ? 126 ASP C CB  1 
ATOM   3700  C  CG  . ASP C  1 126 ? -83.277  -62.279  23.852  1.00 9.55  ? 126 ASP C CG  1 
ATOM   3701  O  OD1 . ASP C  1 126 ? -82.358  -62.024  24.702  1.00 10.17 ? 126 ASP C OD1 1 
ATOM   3702  O  OD2 . ASP C  1 126 ? -83.553  -61.484  22.918  1.00 13.11 ? 126 ASP C OD2 1 
ATOM   3703  N  N   . GLU C  1 127 ? -86.958  -65.091  24.431  1.00 6.83  ? 127 GLU C N   1 
ATOM   3704  C  CA  . GLU C  1 127 ? -87.584  -66.395  24.662  1.00 6.88  ? 127 GLU C CA  1 
ATOM   3705  C  C   . GLU C  1 127 ? -88.637  -66.632  23.644  1.00 6.01  ? 127 GLU C C   1 
ATOM   3706  O  O   . GLU C  1 127 ? -88.732  -67.713  23.086  1.00 5.37  ? 127 GLU C O   1 
ATOM   3707  C  CB  . GLU C  1 127 ? -88.203  -66.506  26.064  1.00 6.97  ? 127 GLU C CB  1 
ATOM   3708  C  CG  . GLU C  1 127 ? -87.197  -66.239  27.209  1.00 11.06 ? 127 GLU C CG  1 
ATOM   3709  C  CD  . GLU C  1 127 ? -86.019  -67.250  27.315  1.00 12.27 ? 127 GLU C CD  1 
ATOM   3710  O  OE1 . GLU C  1 127 ? -85.261  -67.162  28.291  1.00 14.04 ? 127 GLU C OE1 1 
ATOM   3711  O  OE2 . GLU C  1 127 ? -85.852  -68.137  26.469  1.00 12.83 ? 127 GLU C OE2 1 
ATOM   3712  N  N   . GLU C  1 128 ? -89.441  -65.596  23.435  1.00 6.07  ? 128 GLU C N   1 
ATOM   3713  C  CA  . GLU C  1 128 ? -90.492  -65.562  22.452  1.00 5.49  ? 128 GLU C CA  1 
ATOM   3714  C  C   . GLU C  1 128 ? -89.832  -65.932  21.072  1.00 5.42  ? 128 GLU C C   1 
ATOM   3715  O  O   . GLU C  1 128 ? -90.399  -66.706  20.289  1.00 5.37  ? 128 GLU C O   1 
ATOM   3716  C  CB  . GLU C  1 128 ? -91.056  -64.167  22.508  1.00 5.54  ? 128 GLU C CB  1 
ATOM   3717  C  CG  . GLU C  1 128 ? -92.490  -63.980  22.138  1.00 6.79  ? 128 GLU C CG  1 
ATOM   3718  C  CD  . GLU C  1 128 ? -93.336  -63.363  23.244  1.00 7.24  ? 128 GLU C CD  1 
ATOM   3719  O  OE1 . GLU C  1 128 ? -93.257  -63.809  24.389  1.00 9.80  ? 128 GLU C OE1 1 
ATOM   3720  O  OE2 . GLU C  1 128 ? -94.127  -62.475  22.964  1.00 7.47  ? 128 GLU C OE2 1 
ATOM   3721  N  N   . GLY C  1 129 ? -88.602  -65.460  20.816  1.00 4.77  ? 129 GLY C N   1 
ATOM   3722  C  CA  . GLY C  1 129 ? -87.845  -65.864  19.640  1.00 4.13  ? 129 GLY C CA  1 
ATOM   3723  C  C   . GLY C  1 129 ? -87.539  -67.360  19.582  1.00 5.05  ? 129 GLY C C   1 
ATOM   3724  O  O   . GLY C  1 129 ? -87.712  -67.989  18.543  1.00 5.08  ? 129 GLY C O   1 
ATOM   3725  N  N   . HIS C  1 130 ? -87.066  -67.943  20.684  1.00 5.21  ? 130 HIS C N   1 
ATOM   3726  C  CA  . HIS C  1 130 ? -86.853  -69.375  20.744  1.00 5.80  ? 130 HIS C CA  1 
ATOM   3727  C  C   . HIS C  1 130 ? -88.158  -70.149  20.543  1.00 5.54  ? 130 HIS C C   1 
ATOM   3728  O  O   . HIS C  1 130 ? -88.194  -71.148  19.825  1.00 5.60  ? 130 HIS C O   1 
ATOM   3729  C  CB  . HIS C  1 130 ? -86.240  -69.785  22.073  1.00 6.69  ? 130 HIS C CB  1 
ATOM   3730  C  CG  . HIS C  1 130 ? -84.919  -69.136  22.375  1.00 10.73 ? 130 HIS C CG  1 
ATOM   3731  N  ND1 . HIS C  1 130 ? -84.408  -69.058  23.655  1.00 14.38 ? 130 HIS C ND1 1 
ATOM   3732  C  CD2 . HIS C  1 130 ? -84.017  -68.523  21.573  1.00 11.85 ? 130 HIS C CD2 1 
ATOM   3733  C  CE1 . HIS C  1 130 ? -83.250  -68.429  23.626  1.00 14.21 ? 130 HIS C CE1 1 
ATOM   3734  N  NE2 . HIS C  1 130 ? -82.990  -68.096  22.376  1.00 12.92 ? 130 HIS C NE2 1 
ATOM   3735  N  N   . ILE C  1 131 ? -89.229  -69.689  21.177  1.00 4.97  ? 131 ILE C N   1 
ATOM   3736  C  CA  . ILE C  1 131 ? -90.539  -70.281  20.987  1.00 4.10  ? 131 ILE C CA  1 
ATOM   3737  C  C   . ILE C  1 131 ? -90.880  -70.288  19.469  1.00 4.72  ? 131 ILE C C   1 
ATOM   3738  O  O   . ILE C  1 131 ? -91.306  -71.307  18.914  1.00 4.75  ? 131 ILE C O   1 
ATOM   3739  C  CB  . ILE C  1 131 ? -91.627  -69.556  21.840  1.00 3.96  ? 131 ILE C CB  1 
ATOM   3740  C  CG1 . ILE C  1 131 ? -91.341  -69.789  23.323  1.00 3.94  ? 131 ILE C CG1 1 
ATOM   3741  C  CG2 . ILE C  1 131 ? -93.005  -70.024  21.466  1.00 2.64  ? 131 ILE C CG2 1 
ATOM   3742  C  CD1 . ILE C  1 131 ? -92.154  -68.950  24.312  1.00 2.06  ? 131 ILE C CD1 1 
ATOM   3743  N  N   . ASP C  1 132 ? -90.653  -69.172  18.793  1.00 4.29  ? 132 ASP C N   1 
ATOM   3744  C  CA  . ASP C  1 132 ? -90.927  -69.122  17.373  1.00 4.29  ? 132 ASP C CA  1 
ATOM   3745  C  C   . ASP C  1 132 ? -90.160  -70.225  16.632  1.00 4.10  ? 132 ASP C C   1 
ATOM   3746  O  O   . ASP C  1 132 ? -90.731  -70.988  15.852  1.00 4.04  ? 132 ASP C O   1 
ATOM   3747  C  CB  . ASP C  1 132 ? -90.547  -67.744  16.845  1.00 4.65  ? 132 ASP C CB  1 
ATOM   3748  C  CG  . ASP C  1 132 ? -91.026  -67.493  15.428  1.00 6.33  ? 132 ASP C CG  1 
ATOM   3749  O  OD1 . ASP C  1 132 ? -91.707  -68.338  14.835  1.00 4.73  ? 132 ASP C OD1 1 
ATOM   3750  O  OD2 . ASP C  1 132 ? -90.734  -66.398  14.911  1.00 10.48 ? 132 ASP C OD2 1 
ATOM   3751  N  N   . TRP C  1 133 ? -88.868  -70.337  16.914  1.00 3.87  ? 133 TRP C N   1 
ATOM   3752  C  CA  . TRP C  1 133 ? -88.039  -71.288  16.217  1.00 3.77  ? 133 TRP C CA  1 
ATOM   3753  C  C   . TRP C  1 133 ? -88.483  -72.725  16.469  1.00 3.76  ? 133 TRP C C   1 
ATOM   3754  O  O   . TRP C  1 133 ? -88.643  -73.485  15.521  1.00 3.97  ? 133 TRP C O   1 
ATOM   3755  C  CB  . TRP C  1 133 ? -86.555  -71.082  16.543  1.00 3.76  ? 133 TRP C CB  1 
ATOM   3756  C  CG  . TRP C  1 133 ? -85.700  -72.006  15.757  1.00 4.09  ? 133 TRP C CG  1 
ATOM   3757  C  CD1 . TRP C  1 133 ? -85.265  -71.843  14.457  1.00 4.05  ? 133 TRP C CD1 1 
ATOM   3758  C  CD2 . TRP C  1 133 ? -85.198  -73.270  16.189  1.00 4.38  ? 133 TRP C CD2 1 
ATOM   3759  N  NE1 . TRP C  1 133 ? -84.505  -72.917  14.073  1.00 3.68  ? 133 TRP C NE1 1 
ATOM   3760  C  CE2 . TRP C  1 133 ? -84.448  -73.814  15.108  1.00 3.87  ? 133 TRP C CE2 1 
ATOM   3761  C  CE3 . TRP C  1 133 ? -85.277  -73.983  17.386  1.00 4.08  ? 133 TRP C CE3 1 
ATOM   3762  C  CZ2 . TRP C  1 133 ? -83.806  -75.043  15.187  1.00 4.24  ? 133 TRP C CZ2 1 
ATOM   3763  C  CZ3 . TRP C  1 133 ? -84.629  -75.218  17.468  1.00 3.85  ? 133 TRP C CZ3 1 
ATOM   3764  C  CH2 . TRP C  1 133 ? -83.899  -75.730  16.374  1.00 4.48  ? 133 TRP C CH2 1 
ATOM   3765  N  N   . LEU C  1 134 ? -88.694  -73.088  17.735  1.00 3.42  ? 134 LEU C N   1 
ATOM   3766  C  CA  . LEU C  1 134 ? -89.136  -74.432  18.085  1.00 2.61  ? 134 LEU C CA  1 
ATOM   3767  C  C   . LEU C  1 134 ? -90.451  -74.785  17.425  1.00 2.51  ? 134 LEU C C   1 
ATOM   3768  O  O   . LEU C  1 134 ? -90.600  -75.866  16.894  1.00 2.38  ? 134 LEU C O   1 
ATOM   3769  C  CB  . LEU C  1 134 ? -89.300  -74.567  19.587  1.00 2.50  ? 134 LEU C CB  1 
ATOM   3770  C  CG  . LEU C  1 134 ? -88.208  -74.991  20.580  1.00 2.40  ? 134 LEU C CG  1 
ATOM   3771  C  CD1 . LEU C  1 134 ? -86.990  -75.584  19.978  1.00 2.00  ? 134 LEU C CD1 1 
ATOM   3772  C  CD2 . LEU C  1 134 ? -87.863  -73.889  21.558  1.00 2.00  ? 134 LEU C CD2 1 
ATOM   3773  N  N   . GLU C  1 135 ? -91.423  -73.881  17.473  1.00 2.83  ? 135 GLU C N   1 
ATOM   3774  C  CA  . GLU C  1 135 ? -92.736  -74.144  16.871  1.00 3.37  ? 135 GLU C CA  1 
ATOM   3775  C  C   . GLU C  1 135 ? -92.570  -74.424  15.365  1.00 3.60  ? 135 GLU C C   1 
ATOM   3776  O  O   . GLU C  1 135 ? -93.167  -75.378  14.807  1.00 3.96  ? 135 GLU C O   1 
ATOM   3777  C  CB  . GLU C  1 135 ? -93.698  -72.992  17.082  1.00 2.39  ? 135 GLU C CB  1 
ATOM   3778  C  CG  . GLU C  1 135 ? -94.206  -72.885  18.487  1.00 3.73  ? 135 GLU C CG  1 
ATOM   3779  C  CD  . GLU C  1 135 ? -95.068  -71.601  18.750  1.00 5.13  ? 135 GLU C CD  1 
ATOM   3780  O  OE1 . GLU C  1 135 ? -95.033  -70.625  17.934  1.00 4.24  ? 135 GLU C OE1 1 
ATOM   3781  O  OE2 . GLU C  1 135 ? -95.798  -71.604  19.778  1.00 6.58  ? 135 GLU C OE2 1 
ATOM   3782  N  N   . THR C  1 136 ? -91.744  -73.611  14.715  1.00 2.91  ? 136 THR C N   1 
ATOM   3783  C  CA  . THR C  1 136 ? -91.555  -73.755  13.309  1.00 2.74  ? 136 THR C CA  1 
ATOM   3784  C  C   . THR C  1 136 ? -90.922  -75.095  12.973  1.00 2.78  ? 136 THR C C   1 
ATOM   3785  O  O   . THR C  1 136 ? -91.410  -75.792  12.064  1.00 3.20  ? 136 THR C O   1 
ATOM   3786  C  CB  . THR C  1 136 ? -90.735  -72.601  12.786  1.00 2.97  ? 136 THR C CB  1 
ATOM   3787  O  OG1 . THR C  1 136 ? -91.316  -71.407  13.303  1.00 2.65  ? 136 THR C OG1 1 
ATOM   3788  C  CG2 . THR C  1 136 ? -90.734  -72.558  11.270  1.00 2.27  ? 136 THR C CG2 1 
ATOM   3789  N  N   . GLU C  1 137 ? -89.863  -75.467  13.695  1.00 2.19  ? 137 GLU C N   1 
ATOM   3790  C  CA  . GLU C  1 137 ? -89.239  -76.775  13.486  1.00 2.41  ? 137 GLU C CA  1 
ATOM   3791  C  C   . GLU C  1 137 ? -90.270  -77.901  13.658  1.00 2.44  ? 137 GLU C C   1 
ATOM   3792  O  O   . GLU C  1 137 ? -90.394  -78.755  12.803  1.00 3.16  ? 137 GLU C O   1 
ATOM   3793  C  CB  . GLU C  1 137 ? -88.075  -76.988  14.439  1.00 2.45  ? 137 GLU C CB  1 
ATOM   3794  C  CG  . GLU C  1 137 ? -86.866  -76.082  14.206  1.00 4.77  ? 137 GLU C CG  1 
ATOM   3795  C  CD  . GLU C  1 137 ? -86.382  -76.065  12.757  1.00 8.01  ? 137 GLU C CD  1 
ATOM   3796  O  OE1 . GLU C  1 137 ? -86.500  -74.999  12.090  1.00 8.94  ? 137 GLU C OE1 1 
ATOM   3797  O  OE2 . GLU C  1 137 ? -85.888  -77.119  12.272  1.00 9.40  ? 137 GLU C OE2 1 
ATOM   3798  N  N   . LEU C  1 138 ? -91.027  -77.888  14.740  1.00 2.28  ? 138 LEU C N   1 
ATOM   3799  C  CA  . LEU C  1 138 ? -91.990  -78.942  14.949  1.00 2.79  ? 138 LEU C CA  1 
ATOM   3800  C  C   . LEU C  1 138 ? -93.001  -79.029  13.833  1.00 3.78  ? 138 LEU C C   1 
ATOM   3801  O  O   . LEU C  1 138 ? -93.404  -80.140  13.473  1.00 4.46  ? 138 LEU C O   1 
ATOM   3802  C  CB  . LEU C  1 138 ? -92.688  -78.774  16.283  1.00 2.57  ? 138 LEU C CB  1 
ATOM   3803  C  CG  . LEU C  1 138 ? -91.807  -79.016  17.502  1.00 2.98  ? 138 LEU C CG  1 
ATOM   3804  C  CD1 . LEU C  1 138 ? -92.553  -78.564  18.697  1.00 3.70  ? 138 LEU C CD1 1 
ATOM   3805  C  CD2 . LEU C  1 138 ? -91.440  -80.479  17.618  1.00 2.78  ? 138 LEU C CD2 1 
ATOM   3806  N  N   . ASP C  1 139 ? -93.426  -77.881  13.276  1.00 4.00  ? 139 ASP C N   1 
ATOM   3807  C  CA  . ASP C  1 139 ? -94.368  -77.908  12.164  1.00 4.63  ? 139 ASP C CA  1 
ATOM   3808  C  C   . ASP C  1 139 ? -93.687  -78.406  10.895  1.00 4.43  ? 139 ASP C C   1 
ATOM   3809  O  O   . ASP C  1 139 ? -94.308  -79.092  10.080  1.00 4.49  ? 139 ASP C O   1 
ATOM   3810  C  CB  . ASP C  1 139 ? -94.989  -76.535  11.905  1.00 5.25  ? 139 ASP C CB  1 
ATOM   3811  C  CG  . ASP C  1 139 ? -96.030  -76.115  12.973  1.00 8.74  ? 139 ASP C CG  1 
ATOM   3812  O  OD1 . ASP C  1 139 ? -96.457  -76.933  13.846  1.00 10.92 ? 139 ASP C OD1 1 
ATOM   3813  O  OD2 . ASP C  1 139 ? -96.439  -74.932  12.916  1.00 11.20 ? 139 ASP C OD2 1 
ATOM   3814  N  N   . LEU C  1 140 ? -92.414  -78.072  10.719  1.00 3.88  ? 140 LEU C N   1 
ATOM   3815  C  CA  . LEU C  1 140 ? -91.705  -78.549  9.522   1.00 4.28  ? 140 LEU C CA  1 
ATOM   3816  C  C   . LEU C  1 140 ? -91.633  -80.053  9.539   1.00 4.80  ? 140 LEU C C   1 
ATOM   3817  O  O   . LEU C  1 140 ? -91.785  -80.669  8.480   1.00 5.79  ? 140 LEU C O   1 
ATOM   3818  C  CB  . LEU C  1 140 ? -90.296  -77.969  9.391   1.00 3.90  ? 140 LEU C CB  1 
ATOM   3819  C  CG  . LEU C  1 140 ? -90.221  -76.504  8.944   1.00 3.77  ? 140 LEU C CG  1 
ATOM   3820  C  CD1 . LEU C  1 140 ? -88.810  -75.953  9.122   1.00 2.00  ? 140 LEU C CD1 1 
ATOM   3821  C  CD2 . LEU C  1 140 ? -90.726  -76.345  7.509   1.00 2.01  ? 140 LEU C CD2 1 
ATOM   3822  N  N   . ILE C  1 141 ? -91.424  -80.649  10.722  1.00 4.72  ? 141 ILE C N   1 
ATOM   3823  C  CA  . ILE C  1 141 ? -91.343  -82.093  10.822  1.00 4.70  ? 141 ILE C CA  1 
ATOM   3824  C  C   . ILE C  1 141 ? -92.625  -82.746  10.296  1.00 6.36  ? 141 ILE C C   1 
ATOM   3825  O  O   . ILE C  1 141 ? -92.554  -83.739  9.562   1.00 7.36  ? 141 ILE C O   1 
ATOM   3826  C  CB  . ILE C  1 141 ? -91.072  -82.554  12.244  1.00 4.83  ? 141 ILE C CB  1 
ATOM   3827  C  CG1 . ILE C  1 141 ? -89.688  -82.111  12.740  1.00 4.04  ? 141 ILE C CG1 1 
ATOM   3828  C  CG2 . ILE C  1 141 ? -91.235  -84.085  12.354  1.00 3.53  ? 141 ILE C CG2 1 
ATOM   3829  C  CD1 . ILE C  1 141 ? -89.431  -82.458  14.219  1.00 3.34  ? 141 ILE C CD1 1 
ATOM   3830  N  N   . GLN C  1 142 ? -93.790  -82.196  10.646  1.00 7.40  ? 142 GLN C N   1 
ATOM   3831  C  CA  . GLN C  1 142 ? -95.060  -82.747  10.153  1.00 8.52  ? 142 GLN C CA  1 
ATOM   3832  C  C   . GLN C  1 142 ? -95.232  -82.468  8.663   1.00 8.11  ? 142 GLN C C   1 
ATOM   3833  O  O   . GLN C  1 142 ? -95.741  -83.327  7.932   1.00 8.40  ? 142 GLN C O   1 
ATOM   3834  C  CB  . GLN C  1 142 ? -96.300  -82.234  10.941  1.00 9.10  ? 142 GLN C CB  1 
ATOM   3835  C  CG  . GLN C  1 142 ? -96.276  -82.546  12.450  1.00 13.45 ? 142 GLN C CG  1 
ATOM   3836  C  CD  . GLN C  1 142 ? -96.240  -84.080  12.777  1.00 19.49 ? 142 GLN C CD  1 
ATOM   3837  O  OE1 . GLN C  1 142 ? -97.257  -84.813  12.601  1.00 19.84 ? 142 GLN C OE1 1 
ATOM   3838  N  NE2 . GLN C  1 142 ? -95.065  -84.561  13.274  1.00 18.93 ? 142 GLN C NE2 1 
ATOM   3839  N  N   . LYS C  1 143 ? -94.817  -81.287  8.207   1.00 7.61  ? 143 LYS C N   1 
ATOM   3840  C  CA  . LYS C  1 143 ? -95.150  -80.893  6.832   1.00 7.74  ? 143 LYS C CA  1 
ATOM   3841  C  C   . LYS C  1 143 ? -94.307  -81.642  5.824   1.00 7.72  ? 143 LYS C C   1 
ATOM   3842  O  O   . LYS C  1 143 ? -94.822  -82.073  4.800   1.00 8.47  ? 143 LYS C O   1 
ATOM   3843  C  CB  . LYS C  1 143 ? -95.044  -79.394  6.597   1.00 7.64  ? 143 LYS C CB  1 
ATOM   3844  C  CG  . LYS C  1 143 ? -96.049  -78.563  7.387   1.00 9.65  ? 143 LYS C CG  1 
ATOM   3845  C  CD  . LYS C  1 143 ? -96.164  -77.133  6.828   1.00 13.34 ? 143 LYS C CD  1 
ATOM   3846  C  CE  . LYS C  1 143 ? -96.846  -76.146  7.789   1.00 12.98 ? 143 LYS C CE  1 
ATOM   3847  N  NZ  . LYS C  1 143 ? -95.698  -75.321  8.230   1.00 16.86 ? 143 LYS C NZ  1 
ATOM   3848  N  N   . MET C  1 144 ? -93.026  -81.837  6.122   1.00 7.13  ? 144 MET C N   1 
ATOM   3849  C  CA  . MET C  1 144 ? -92.127  -82.494  5.169   1.00 6.79  ? 144 MET C CA  1 
ATOM   3850  C  C   . MET C  1 144 ? -91.846  -83.954  5.494   1.00 5.68  ? 144 MET C C   1 
ATOM   3851  O  O   . MET C  1 144 ? -91.263  -84.668  4.643   1.00 5.45  ? 144 MET C O   1 
ATOM   3852  C  CB  . MET C  1 144 ? -90.832  -81.696  4.965   1.00 6.24  ? 144 MET C CB  1 
ATOM   3853  C  CG  . MET C  1 144 ? -89.827  -81.864  6.048   1.00 6.62  ? 144 MET C CG  1 
ATOM   3854  S  SD  . MET C  1 144 ? -88.357  -80.859  5.791   1.00 10.16 ? 144 MET C SD  1 
ATOM   3855  C  CE  . MET C  1 144 ? -89.071  -79.230  5.871   1.00 10.36 ? 144 MET C CE  1 
ATOM   3856  N  N   . GLY C  1 145 ? -92.280  -84.392  6.690   1.00 4.50  ? 145 GLY C N   1 
ATOM   3857  C  CA  . GLY C  1 145 ? -92.055  -85.762  7.179   1.00 3.26  ? 145 GLY C CA  1 
ATOM   3858  C  C   . GLY C  1 145 ? -90.733  -85.900  7.906   1.00 3.25  ? 145 GLY C C   1 
ATOM   3859  O  O   . GLY C  1 145 ? -89.807  -85.132  7.685   1.00 3.32  ? 145 GLY C O   1 
ATOM   3860  N  N   . LEU C  1 146 ? -90.621  -86.879  8.783   1.00 3.10  ? 146 LEU C N   1 
ATOM   3861  C  CA  . LEU C  1 146 ? -89.418  -87.004  9.604   1.00 2.65  ? 146 LEU C CA  1 
ATOM   3862  C  C   . LEU C  1 146 ? -88.120  -87.298  8.813   1.00 2.77  ? 146 LEU C C   1 
ATOM   3863  O  O   . LEU C  1 146 ? -87.108  -86.643  9.027   1.00 3.07  ? 146 LEU C O   1 
ATOM   3864  C  CB  . LEU C  1 146 ? -89.644  -88.017  10.730  1.00 3.04  ? 146 LEU C CB  1 
ATOM   3865  C  CG  . LEU C  1 146 ? -88.490  -88.234  11.715  1.00 3.66  ? 146 LEU C CG  1 
ATOM   3866  C  CD1 . LEU C  1 146 ? -88.058  -86.907  12.371  1.00 2.08  ? 146 LEU C CD1 1 
ATOM   3867  C  CD2 . LEU C  1 146 ? -88.828  -89.327  12.741  1.00 2.00  ? 146 LEU C CD2 1 
ATOM   3868  N  N   . GLN C  1 147 ? -88.163  -88.245  7.883   1.00 2.78  ? 147 GLN C N   1 
ATOM   3869  C  CA  . GLN C  1 147 ? -87.001  -88.562  7.048   1.00 2.49  ? 147 GLN C CA  1 
ATOM   3870  C  C   . GLN C  1 147 ? -86.447  -87.353  6.322   1.00 2.78  ? 147 GLN C C   1 
ATOM   3871  O  O   . GLN C  1 147 ? -85.276  -87.069  6.458   1.00 3.30  ? 147 GLN C O   1 
ATOM   3872  C  CB  . GLN C  1 147 ? -87.315  -89.687  6.074   1.00 2.26  ? 147 GLN C CB  1 
ATOM   3873  C  CG  . GLN C  1 147 ? -87.640  -90.992  6.785   1.00 2.04  ? 147 GLN C CG  1 
ATOM   3874  C  CD  . GLN C  1 147 ? -87.700  -92.191  5.839   1.00 2.84  ? 147 GLN C CD  1 
ATOM   3875  O  OE1 . GLN C  1 147 ? -88.228  -92.109  4.731   1.00 3.61  ? 147 GLN C OE1 1 
ATOM   3876  N  NE2 . GLN C  1 147 ? -87.147  -93.313  6.279   1.00 2.22  ? 147 GLN C NE2 1 
ATOM   3877  N  N   . ASN C  1 148 ? -87.274  -86.622  5.585   1.00 3.15  ? 148 ASN C N   1 
ATOM   3878  C  CA  . ASN C  1 148 ? -86.834  -85.380  4.948   1.00 3.74  ? 148 ASN C CA  1 
ATOM   3879  C  C   . ASN C  1 148 ? -86.350  -84.309  5.939   1.00 4.43  ? 148 ASN C C   1 
ATOM   3880  O  O   . ASN C  1 148 ? -85.421  -83.562  5.668   1.00 5.28  ? 148 ASN C O   1 
ATOM   3881  C  CB  . ASN C  1 148 ? -87.945  -84.775  4.125   1.00 3.90  ? 148 ASN C CB  1 
ATOM   3882  C  CG  . ASN C  1 148 ? -88.061  -85.372  2.731   1.00 3.64  ? 148 ASN C CG  1 
ATOM   3883  O  OD1 . ASN C  1 148 ? -88.964  -85.020  1.993   1.00 5.74  ? 148 ASN C OD1 1 
ATOM   3884  N  ND2 . ASN C  1 148 ? -87.179  -86.256  2.374   1.00 3.49  ? 148 ASN C ND2 1 
ATOM   3885  N  N   . TYR C  1 149 ? -86.965  -84.236  7.095   1.00 4.21  ? 149 TYR C N   1 
ATOM   3886  C  CA  . TYR C  1 149 ? -86.530  -83.265  8.042   1.00 4.68  ? 149 TYR C CA  1 
ATOM   3887  C  C   . TYR C  1 149 ? -85.116  -83.558  8.531   1.00 4.80  ? 149 TYR C C   1 
ATOM   3888  O  O   . TYR C  1 149 ? -84.291  -82.645  8.667   1.00 4.36  ? 149 TYR C O   1 
ATOM   3889  C  CB  . TYR C  1 149 ? -87.481  -83.232  9.228   1.00 5.03  ? 149 TYR C CB  1 
ATOM   3890  C  CG  . TYR C  1 149 ? -87.065  -82.232  10.279  1.00 5.17  ? 149 TYR C CG  1 
ATOM   3891  C  CD1 . TYR C  1 149 ? -87.370  -80.891  10.134  1.00 4.34  ? 149 TYR C CD1 1 
ATOM   3892  C  CD2 . TYR C  1 149 ? -86.356  -82.637  11.410  1.00 5.88  ? 149 TYR C CD2 1 
ATOM   3893  C  CE1 . TYR C  1 149 ? -86.979  -79.954  11.108  1.00 6.71  ? 149 TYR C CE1 1 
ATOM   3894  C  CE2 . TYR C  1 149 ? -85.973  -81.721  12.394  1.00 5.65  ? 149 TYR C CE2 1 
ATOM   3895  C  CZ  . TYR C  1 149 ? -86.285  -80.377  12.231  1.00 5.96  ? 149 TYR C CZ  1 
ATOM   3896  O  OH  . TYR C  1 149 ? -85.893  -79.458  13.187  1.00 5.23  ? 149 TYR C OH  1 
ATOM   3897  N  N   . LEU C  1 150 ? -84.856  -84.830  8.832   1.00 5.13  ? 150 LEU C N   1 
ATOM   3898  C  CA  . LEU C  1 150 ? -83.546  -85.233  9.303   1.00 4.75  ? 150 LEU C CA  1 
ATOM   3899  C  C   . LEU C  1 150 ? -82.530  -84.962  8.228   1.00 5.07  ? 150 LEU C C   1 
ATOM   3900  O  O   . LEU C  1 150 ? -81.494  -84.398  8.532   1.00 6.06  ? 150 LEU C O   1 
ATOM   3901  C  CB  . LEU C  1 150 ? -83.527  -86.687  9.689   1.00 4.40  ? 150 LEU C CB  1 
ATOM   3902  C  CG  . LEU C  1 150 ? -83.709  -87.176  11.112  1.00 4.62  ? 150 LEU C CG  1 
ATOM   3903  C  CD1 . LEU C  1 150 ? -84.224  -86.145  12.097  1.00 5.74  ? 150 LEU C CD1 1 
ATOM   3904  C  CD2 . LEU C  1 150 ? -84.575  -88.398  11.096  1.00 4.16  ? 150 LEU C CD2 1 
ATOM   3905  N  N   . GLN C  1 151 ? -82.801  -85.326  6.971   1.00 4.96  ? 151 GLN C N   1 
ATOM   3906  C  CA  . GLN C  1 151 ? -81.798  -85.101  5.916   1.00 4.79  ? 151 GLN C CA  1 
ATOM   3907  C  C   . GLN C  1 151 ? -81.416  -83.612  5.856   1.00 4.77  ? 151 GLN C C   1 
ATOM   3908  O  O   . GLN C  1 151 ? -80.267  -83.246  5.601   1.00 5.05  ? 151 GLN C O   1 
ATOM   3909  C  CB  . GLN C  1 151 ? -82.314  -85.595  4.562   1.00 4.43  ? 151 GLN C CB  1 
ATOM   3910  C  CG  . GLN C  1 151 ? -81.420  -85.239  3.377   1.00 4.14  ? 151 GLN C CG  1 
ATOM   3911  C  CD  . GLN C  1 151 ? -82.166  -85.341  2.079   1.00 4.83  ? 151 GLN C CD  1 
ATOM   3912  O  OE1 . GLN C  1 151 ? -83.366  -85.468  2.072   1.00 8.38  ? 151 GLN C OE1 1 
ATOM   3913  N  NE2 . GLN C  1 151 ? -81.468  -85.291  0.983   1.00 7.23  ? 151 GLN C NE2 1 
ATOM   3914  N  N   . ALA C  1 152 ? -82.382  -82.757  6.130   1.00 4.78  ? 152 ALA C N   1 
ATOM   3915  C  CA  . ALA C  1 152 ? -82.156  -81.338  6.068   1.00 4.78  ? 152 ALA C CA  1 
ATOM   3916  C  C   . ALA C  1 152 ? -81.307  -80.810  7.228   1.00 5.30  ? 152 ALA C C   1 
ATOM   3917  O  O   . ALA C  1 152 ? -80.935  -79.623  7.206   1.00 6.01  ? 152 ALA C O   1 
ATOM   3918  C  CB  . ALA C  1 152 ? -83.464  -80.631  6.027   1.00 4.77  ? 152 ALA C CB  1 
ATOM   3919  N  N   . GLN C  1 153 ? -80.986  -81.654  8.219   1.00 5.04  ? 153 GLN C N   1 
ATOM   3920  C  CA  . GLN C  1 153 ? -80.174  -81.215  9.371   1.00 5.36  ? 153 GLN C CA  1 
ATOM   3921  C  C   . GLN C  1 153 ? -78.706  -81.639  9.284   1.00 5.87  ? 153 GLN C C   1 
ATOM   3922  O  O   . GLN C  1 153 ? -77.904  -81.309  10.160  1.00 5.77  ? 153 GLN C O   1 
ATOM   3923  C  CB  . GLN C  1 153 ? -80.728  -81.753  10.701  1.00 5.12  ? 153 GLN C CB  1 
ATOM   3924  C  CG  . GLN C  1 153 ? -82.192  -81.555  10.925  1.00 5.24  ? 153 GLN C CG  1 
ATOM   3925  C  CD  . GLN C  1 153 ? -82.676  -80.156  10.596  1.00 6.72  ? 153 GLN C CD  1 
ATOM   3926  O  OE1 . GLN C  1 153 ? -82.010  -79.130  10.889  1.00 6.56  ? 153 GLN C OE1 1 
ATOM   3927  N  NE2 . GLN C  1 153 ? -83.857  -80.099  9.974   1.00 7.60  ? 153 GLN C NE2 1 
ATOM   3928  N  N   . ILE C  1 154 ? -78.371  -82.392  8.253   1.00 6.72  ? 154 ILE C N   1 
ATOM   3929  C  CA  . ILE C  1 154 ? -77.080  -83.029  8.156   1.00 8.54  ? 154 ILE C CA  1 
ATOM   3930  C  C   . ILE C  1 154 ? -75.947  -82.038  7.911   1.00 9.68  ? 154 ILE C C   1 
ATOM   3931  O  O   . ILE C  1 154 ? -74.826  -82.270  8.344   1.00 10.61 ? 154 ILE C O   1 
ATOM   3932  C  CB  . ILE C  1 154 ? -77.082  -84.018  7.000   1.00 8.67  ? 154 ILE C CB  1 
ATOM   3933  C  CG1 . ILE C  1 154 ? -77.606  -85.363  7.429   1.00 9.47  ? 154 ILE C CG1 1 
ATOM   3934  C  CG2 . ILE C  1 154 ? -75.689  -84.236  6.441   1.00 9.43  ? 154 ILE C CG2 1 
ATOM   3935  C  CD1 . ILE C  1 154 ? -77.593  -86.305  6.185   1.00 11.53 ? 154 ILE C CD1 1 
ATOM   3936  N  N   A ARG C  1 155 ? -76.243  -80.952  7.207   0.70 10.39 ? 155 ARG C N   1 
ATOM   3937  N  N   B ARG C  1 155 ? -76.200  -80.961  7.188   0.30 10.33 ? 155 ARG C N   1 
ATOM   3938  C  CA  A ARG C  1 155 ? -75.238  -79.940  6.871   0.70 11.67 ? 155 ARG C CA  1 
ATOM   3939  C  CA  B ARG C  1 155 ? -75.137  -79.980  7.018   0.30 11.34 ? 155 ARG C CA  1 
ATOM   3940  C  C   A ARG C  1 155 ? -75.505  -78.633  7.622   0.70 12.69 ? 155 ARG C C   1 
ATOM   3941  C  C   B ARG C  1 155 ? -75.486  -78.650  7.631   0.30 12.34 ? 155 ARG C C   1 
ATOM   3942  O  O   A ARG C  1 155 ? -76.669  -78.243  7.796   0.70 13.33 ? 155 ARG C O   1 
ATOM   3943  O  O   B ARG C  1 155 ? -76.658  -78.254  7.677   0.30 12.66 ? 155 ARG C O   1 
ATOM   3944  C  CB  A ARG C  1 155 ? -75.233  -79.718  5.369   0.70 11.20 ? 155 ARG C CB  1 
ATOM   3945  C  CB  B ARG C  1 155 ? -74.724  -79.816  5.566   0.30 11.14 ? 155 ARG C CB  1 
ATOM   3946  C  CG  A ARG C  1 155 ? -74.904  -81.006  4.544   0.70 11.76 ? 155 ARG C CG  1 
ATOM   3947  C  CG  B ARG C  1 155 ? -75.841  -79.986  4.565   0.30 11.36 ? 155 ARG C CG  1 
ATOM   3948  C  CD  A ARG C  1 155 ? -75.207  -80.793  3.050   0.70 12.72 ? 155 ARG C CD  1 
ATOM   3949  C  CD  B ARG C  1 155 ? -75.360  -79.589  3.182   0.30 12.14 ? 155 ARG C CD  1 
ATOM   3950  N  NE  A ARG C  1 155 ? -74.715  -81.857  2.152   0.70 14.27 ? 155 ARG C NE  1 
ATOM   3951  N  NE  B ARG C  1 155 ? -75.362  -78.140  3.016   0.30 13.24 ? 155 ARG C NE  1 
ATOM   3952  C  CZ  A ARG C  1 155 ? -73.584  -81.780  1.431   0.70 14.74 ? 155 ARG C CZ  1 
ATOM   3953  C  CZ  B ARG C  1 155 ? -74.813  -77.491  1.997   0.30 13.42 ? 155 ARG C CZ  1 
ATOM   3954  N  NH1 A ARG C  1 155 ? -72.771  -80.708  1.498   0.70 13.79 ? 155 ARG C NH1 1 
ATOM   3955  N  NH1 B ARG C  1 155 ? -74.204  -78.159  1.023   0.30 13.11 ? 155 ARG C NH1 1 
ATOM   3956  N  NH2 A ARG C  1 155 ? -73.247  -82.794  0.641   0.70 13.91 ? 155 ARG C NH2 1 
ATOM   3957  N  NH2 B ARG C  1 155 ? -74.882  -76.169  1.949   0.30 12.58 ? 155 ARG C NH2 1 
ATOM   3958  N  N   . GLU C  1 156 ? -74.458  -77.963  8.111   1.00 13.52 ? 156 GLU C N   1 
ATOM   3959  C  CA  . GLU C  1 156 ? -74.679  -76.726  8.869   1.00 14.99 ? 156 GLU C CA  1 
ATOM   3960  C  C   . GLU C  1 156 ? -75.058  -75.595  7.932   1.00 16.89 ? 156 GLU C C   1 
ATOM   3961  O  O   . GLU C  1 156 ? -74.625  -75.577  6.763   1.00 17.52 ? 156 GLU C O   1 
ATOM   3962  C  CB  . GLU C  1 156 ? -73.493  -76.346  9.719   1.00 14.58 ? 156 GLU C CB  1 
ATOM   3963  C  CG  . GLU C  1 156 ? -72.155  -76.585  9.109   1.00 16.06 ? 156 GLU C CG  1 
ATOM   3964  C  CD  . GLU C  1 156 ? -71.098  -76.721  10.215  1.00 21.05 ? 156 GLU C CD  1 
ATOM   3965  O  OE1 . GLU C  1 156 ? -71.520  -76.807  11.415  1.00 20.99 ? 156 GLU C OE1 1 
ATOM   3966  O  OE2 . GLU C  1 156 ? -69.870  -76.748  9.895   1.00 23.05 ? 156 GLU C OE2 1 
ATOM   3967  N  N   . GLU C  1 157 ? -75.899  -74.679  8.423   1.00 18.94 ? 157 GLU C N   1 
ATOM   3968  C  CA  . GLU C  1 157 ? -76.340  -73.551  7.564   1.00 20.31 ? 157 GLU C CA  1 
ATOM   3969  C  C   . GLU C  1 157 ? -75.280  -72.427  7.593   1.00 20.73 ? 157 GLU C C   1 
ATOM   3970  O  O   . GLU C  1 157 ? -74.902  -71.956  8.681   1.00 20.42 ? 157 GLU C O   1 
ATOM   3971  C  CB  . GLU C  1 157 ? -77.780  -73.026  7.874   1.00 19.89 ? 157 GLU C CB  1 
ATOM   3972  C  CG  . GLU C  1 157 ? -78.482  -72.464  6.569   1.00 20.90 ? 157 GLU C CG  1 
ATOM   3973  C  CD  . GLU C  1 157 ? -79.669  -71.498  6.824   1.00 21.09 ? 157 GLU C CD  1 
ATOM   3974  O  OE1 . GLU C  1 157 ? -80.366  -71.667  7.871   1.00 20.42 ? 157 GLU C OE1 1 
ATOM   3975  O  OE2 . GLU C  1 157 ? -79.883  -70.595  5.949   1.00 20.09 ? 157 GLU C OE2 1 
ATOM   3976  N  N   . GLY C  1 158 ? -74.777  -72.066  6.393   1.00 21.43 ? 158 GLY C N   1 
ATOM   3977  C  CA  . GLY C  1 158 ? -73.775  -70.981  6.232   1.00 21.83 ? 158 GLY C CA  1 
ATOM   3978  C  C   . GLY C  1 158 ? -74.354  -69.585  6.519   1.00 21.64 ? 158 GLY C C   1 
ATOM   3979  N  N   . MET D  1 1   ? -69.954  -96.496  19.833  1.00 7.51  ? 1   MET D N   1 
ATOM   3980  C  CA  . MET D  1 1   ? -69.196  -97.695  20.321  1.00 8.48  ? 1   MET D CA  1 
ATOM   3981  C  C   . MET D  1 1   ? -69.606  -97.958  21.769  1.00 8.23  ? 1   MET D C   1 
ATOM   3982  O  O   . MET D  1 1   ? -69.545  -97.048  22.553  1.00 8.23  ? 1   MET D O   1 
ATOM   3983  C  CB  . MET D  1 1   ? -67.731  -97.359  20.234  1.00 7.82  ? 1   MET D CB  1 
ATOM   3984  C  CG  . MET D  1 1   ? -66.774  -98.505  20.258  1.00 7.89  ? 1   MET D CG  1 
ATOM   3985  S  SD  . MET D  1 1   ? -65.141  -97.701  20.059  1.00 10.86 ? 1   MET D SD  1 
ATOM   3986  C  CE  . MET D  1 1   ? -64.749  -97.205  21.759  1.00 5.73  ? 1   MET D CE  1 
ATOM   3987  N  N   . LYS D  1 2   ? -70.056  -99.166  22.116  1.00 9.07  ? 2   LYS D N   1 
ATOM   3988  C  CA  . LYS D  1 2   ? -70.544  -99.422  23.498  1.00 10.58 ? 2   LYS D CA  1 
ATOM   3989  C  C   . LYS D  1 2   ? -69.383  -99.400  24.473  1.00 9.28  ? 2   LYS D C   1 
ATOM   3990  O  O   . LYS D  1 2   ? -68.524  -100.270 24.400  1.00 9.85  ? 2   LYS D O   1 
ATOM   3991  C  CB  . LYS D  1 2   ? -71.234  -100.779 23.627  1.00 10.59 ? 2   LYS D CB  1 
ATOM   3992  C  CG  . LYS D  1 2   ? -72.660  -100.713 24.191  1.00 14.40 ? 2   LYS D CG  1 
ATOM   3993  C  CD  . LYS D  1 2   ? -73.067  -101.974 25.022  1.00 15.14 ? 2   LYS D CD  1 
ATOM   3994  C  CE  . LYS D  1 2   ? -72.412  -101.959 26.450  1.00 19.17 ? 2   LYS D CE  1 
ATOM   3995  N  NZ  . LYS D  1 2   ? -73.154  -102.796 27.452  1.00 19.85 ? 2   LYS D NZ  1 
ATOM   3996  N  N   . GLY D  1 3   ? -69.339  -98.419  25.373  1.00 8.18  ? 3   GLY D N   1 
ATOM   3997  C  CA  . GLY D  1 3   ? -68.241  -98.309  26.324  1.00 6.87  ? 3   GLY D CA  1 
ATOM   3998  C  C   . GLY D  1 3   ? -68.412  -99.168  27.563  1.00 6.23  ? 3   GLY D C   1 
ATOM   3999  O  O   . GLY D  1 3   ? -69.442  -99.795  27.743  1.00 6.57  ? 3   GLY D O   1 
ATOM   4000  N  N   . ASP D  1 4   ? -67.407  -99.180  28.433  1.00 5.87  ? 4   ASP D N   1 
ATOM   4001  C  CA  . ASP D  1 4   ? -67.508  -99.865  29.698  1.00 5.71  ? 4   ASP D CA  1 
ATOM   4002  C  C   . ASP D  1 4   ? -68.457  -99.060  30.593  1.00 5.84  ? 4   ASP D C   1 
ATOM   4003  O  O   . ASP D  1 4   ? -68.324  -97.848  30.688  1.00 6.65  ? 4   ASP D O   1 
ATOM   4004  C  CB  . ASP D  1 4   ? -66.121  -100.029 30.308  1.00 5.45  ? 4   ASP D CB  1 
ATOM   4005  C  CG  . ASP D  1 4   ? -66.165  -100.548 31.730  1.00 6.92  ? 4   ASP D CG  1 
ATOM   4006  O  OD1 . ASP D  1 4   ? -66.265  -99.722  32.670  1.00 9.25  ? 4   ASP D OD1 1 
ATOM   4007  O  OD2 . ASP D  1 4   ? -66.049  -101.773 31.908  1.00 6.93  ? 4   ASP D OD2 1 
ATOM   4008  N  N   . THR D  1 5   ? -69.422  -99.732  31.215  1.00 5.76  ? 5   THR D N   1 
ATOM   4009  C  CA  . THR D  1 5   ? -70.435  -99.083  32.061  1.00 5.86  ? 5   THR D CA  1 
ATOM   4010  C  C   . THR D  1 5   ? -69.843  -98.262  33.203  1.00 5.62  ? 5   THR D C   1 
ATOM   4011  O  O   . THR D  1 5   ? -70.294  -97.139  33.495  1.00 5.73  ? 5   THR D O   1 
ATOM   4012  C  CB  . THR D  1 5   ? -71.410  -100.141 32.667  1.00 6.01  ? 5   THR D CB  1 
ATOM   4013  O  OG1 . THR D  1 5   ? -72.090  -100.788 31.606  1.00 7.05  ? 5   THR D OG1 1 
ATOM   4014  C  CG2 . THR D  1 5   ? -72.469  -99.491  33.575  1.00 5.37  ? 5   THR D CG2 1 
ATOM   4015  N  N   . LYS D  1 6   ? -68.851  -98.840  33.871  1.00 5.13  ? 6   LYS D N   1 
ATOM   4016  C  CA  . LYS D  1 6   ? -68.269  -98.197  35.034  1.00 4.74  ? 6   LYS D CA  1 
ATOM   4017  C  C   . LYS D  1 6   ? -67.471  -96.956  34.572  1.00 4.69  ? 6   LYS D C   1 
ATOM   4018  O  O   . LYS D  1 6   ? -67.460  -95.947  35.275  1.00 4.97  ? 6   LYS D O   1 
ATOM   4019  C  CB  . LYS D  1 6   ? -67.453  -99.194  35.842  1.00 4.14  ? 6   LYS D CB  1 
ATOM   4020  C  CG  . LYS D  1 6   ? -66.765  -98.591  37.010  1.00 6.53  ? 6   LYS D CG  1 
ATOM   4021  C  CD  . LYS D  1 6   ? -66.637  -99.526  38.216  1.00 9.50  ? 6   LYS D CD  1 
ATOM   4022  C  CE  . LYS D  1 6   ? -67.207  -98.793  39.498  1.00 13.27 ? 6   LYS D CE  1 
ATOM   4023  N  NZ  . LYS D  1 6   ? -66.196  -98.494  40.581  1.00 17.04 ? 6   LYS D NZ  1 
ATOM   4024  N  N   . VAL D  1 7   ? -66.842  -97.008  33.393  1.00 3.68  ? 7   VAL D N   1 
ATOM   4025  C  CA  . VAL D  1 7   ? -66.203  -95.804  32.839  1.00 3.12  ? 7   VAL D CA  1 
ATOM   4026  C  C   . VAL D  1 7   ? -67.229  -94.682  32.643  1.00 3.18  ? 7   VAL D C   1 
ATOM   4027  O  O   . VAL D  1 7   ? -66.961  -93.504  32.952  1.00 3.09  ? 7   VAL D O   1 
ATOM   4028  C  CB  . VAL D  1 7   ? -65.481  -96.061  31.495  1.00 3.07  ? 7   VAL D CB  1 
ATOM   4029  C  CG1 . VAL D  1 7   ? -65.090  -94.729  30.835  1.00 2.00  ? 7   VAL D CG1 1 
ATOM   4030  C  CG2 . VAL D  1 7   ? -64.253  -96.909  31.702  1.00 2.44  ? 7   VAL D CG2 1 
ATOM   4031  N  N   . ILE D  1 8   ? -68.394  -95.037  32.115  1.00 2.80  ? 8   ILE D N   1 
ATOM   4032  C  CA  . ILE D  1 8   ? -69.448  -94.075  31.928  1.00 2.55  ? 8   ILE D CA  1 
ATOM   4033  C  C   . ILE D  1 8   ? -69.888  -93.520  33.280  1.00 3.35  ? 8   ILE D C   1 
ATOM   4034  O  O   . ILE D  1 8   ? -70.101  -92.311  33.370  1.00 3.29  ? 8   ILE D O   1 
ATOM   4035  C  CB  . ILE D  1 8   ? -70.619  -94.662  31.134  1.00 2.68  ? 8   ILE D CB  1 
ATOM   4036  C  CG1 . ILE D  1 8   ? -70.200  -94.917  29.688  1.00 3.44  ? 8   ILE D CG1 1 
ATOM   4037  C  CG2 . ILE D  1 8   ? -71.807  -93.720  31.145  1.00 2.63  ? 8   ILE D CG2 1 
ATOM   4038  C  CD1 . ILE D  1 8   ? -71.069  -95.901  28.921  1.00 2.69  ? 8   ILE D CD1 1 
ATOM   4039  N  N   . ASN D  1 9   ? -70.022  -94.365  34.320  1.00 3.96  ? 9   ASN D N   1 
ATOM   4040  C  CA  . ASN D  1 9   ? -70.387  -93.858  35.659  1.00 4.75  ? 9   ASN D CA  1 
ATOM   4041  C  C   . ASN D  1 9   ? -69.345  -92.836  36.126  1.00 4.43  ? 9   ASN D C   1 
ATOM   4042  O  O   . ASN D  1 9   ? -69.689  -91.783  36.663  1.00 4.83  ? 9   ASN D O   1 
ATOM   4043  C  CB  . ASN D  1 9   ? -70.519  -94.977  36.708  1.00 5.79  ? 9   ASN D CB  1 
ATOM   4044  C  CG  . ASN D  1 9   ? -71.775  -95.851  36.506  1.00 10.56 ? 9   ASN D CG  1 
ATOM   4045  O  OD1 . ASN D  1 9   ? -72.843  -95.350  36.203  1.00 19.60 ? 9   ASN D OD1 1 
ATOM   4046  N  ND2 . ASN D  1 9   ? -71.644  -97.165  36.709  1.00 12.21 ? 9   ASN D ND2 1 
ATOM   4047  N  N   . TYR D  1 10  ? -68.065  -93.143  35.913  1.00 3.62  ? 10  TYR D N   1 
ATOM   4048  C  CA  . TYR D  1 10  ? -67.014  -92.248  36.305  1.00 3.20  ? 10  TYR D CA  1 
ATOM   4049  C  C   . TYR D  1 10  ? -67.134  -90.938  35.538  1.00 3.22  ? 10  TYR D C   1 
ATOM   4050  O  O   . TYR D  1 10  ? -67.070  -89.873  36.150  1.00 3.21  ? 10  TYR D O   1 
ATOM   4051  C  CB  . TYR D  1 10  ? -65.649  -92.866  36.061  1.00 3.13  ? 10  TYR D CB  1 
ATOM   4052  C  CG  . TYR D  1 10  ? -65.100  -93.623  37.221  1.00 3.08  ? 10  TYR D CG  1 
ATOM   4053  C  CD1 . TYR D  1 10  ? -64.930  -93.010  38.467  1.00 2.00  ? 10  TYR D CD1 1 
ATOM   4054  C  CD2 . TYR D  1 10  ? -64.728  -94.955  37.078  1.00 2.36  ? 10  TYR D CD2 1 
ATOM   4055  C  CE1 . TYR D  1 10  ? -64.418  -93.691  39.528  1.00 2.62  ? 10  TYR D CE1 1 
ATOM   4056  C  CE2 . TYR D  1 10  ? -64.216  -95.663  38.134  1.00 2.15  ? 10  TYR D CE2 1 
ATOM   4057  C  CZ  . TYR D  1 10  ? -64.056  -95.035  39.363  1.00 3.90  ? 10  TYR D CZ  1 
ATOM   4058  O  OH  . TYR D  1 10  ? -63.531  -95.749  40.412  1.00 4.41  ? 10  TYR D OH  1 
ATOM   4059  N  N   . LEU D  1 11  ? -67.292  -91.024  34.209  1.00 2.65  ? 11  LEU D N   1 
ATOM   4060  C  CA  . LEU D  1 11  ? -67.453  -89.862  33.375  1.00 2.06  ? 11  LEU D CA  1 
ATOM   4061  C  C   . LEU D  1 11  ? -68.618  -88.994  33.889  1.00 2.49  ? 11  LEU D C   1 
ATOM   4062  O  O   . LEU D  1 11  ? -68.473  -87.757  33.999  1.00 2.50  ? 11  LEU D O   1 
ATOM   4063  C  CB  . LEU D  1 11  ? -67.646  -90.283  31.931  1.00 2.00  ? 11  LEU D CB  1 
ATOM   4064  C  CG  . LEU D  1 11  ? -66.431  -90.257  30.988  1.00 2.51  ? 11  LEU D CG  1 
ATOM   4065  C  CD1 . LEU D  1 11  ? -65.096  -90.393  31.703  1.00 2.15  ? 11  LEU D CD1 1 
ATOM   4066  C  CD2 . LEU D  1 11  ? -66.534  -91.226  29.831  1.00 2.00  ? 11  LEU D CD2 1 
ATOM   4067  N  N   . ASN D  1 12  ? -69.748  -89.609  34.267  1.00 2.15  ? 12  ASN D N   1 
ATOM   4068  C  CA  . ASN D  1 12  ? -70.870  -88.832  34.795  1.00 2.05  ? 12  ASN D CA  1 
ATOM   4069  C  C   . ASN D  1 12  ? -70.516  -88.219  36.137  1.00 2.48  ? 12  ASN D C   1 
ATOM   4070  O  O   . ASN D  1 12  ? -70.895  -87.084  36.442  1.00 2.63  ? 12  ASN D O   1 
ATOM   4071  C  CB  . ASN D  1 12  ? -72.156  -89.668  34.901  1.00 2.04  ? 12  ASN D CB  1 
ATOM   4072  C  CG  . ASN D  1 12  ? -73.061  -89.532  33.664  1.00 2.49  ? 12  ASN D CG  1 
ATOM   4073  O  OD1 . ASN D  1 12  ? -73.268  -88.438  33.160  1.00 4.19  ? 12  ASN D OD1 1 
ATOM   4074  N  ND2 . ASN D  1 12  ? -73.587  -90.635  33.186  1.00 2.00  ? 12  ASN D ND2 1 
ATOM   4075  N  N   . LYS D  1 13  ? -69.768  -88.943  36.949  1.00 2.57  ? 13  LYS D N   1 
ATOM   4076  C  CA  . LYS D  1 13  ? -69.393  -88.390  38.242  1.00 3.20  ? 13  LYS D CA  1 
ATOM   4077  C  C   . LYS D  1 13  ? -68.460  -87.179  38.067  1.00 3.57  ? 13  LYS D C   1 
ATOM   4078  O  O   . LYS D  1 13  ? -68.647  -86.139  38.707  1.00 4.29  ? 13  LYS D O   1 
ATOM   4079  C  CB  . LYS D  1 13  ? -68.752  -89.461  39.107  1.00 3.15  ? 13  LYS D CB  1 
ATOM   4080  C  CG  . LYS D  1 13  ? -68.141  -88.969  40.365  1.00 2.83  ? 13  LYS D CG  1 
ATOM   4081  C  CD  . LYS D  1 13  ? -68.091  -90.085  41.383  1.00 5.49  ? 13  LYS D CD  1 
ATOM   4082  C  CE  . LYS D  1 13  ? -67.089  -89.749  42.453  1.00 8.10  ? 13  LYS D CE  1 
ATOM   4083  N  NZ  . LYS D  1 13  ? -67.704  -89.881  43.787  1.00 10.01 ? 13  LYS D NZ  1 
ATOM   4084  N  N   . LEU D  1 14  ? -67.481  -87.313  37.188  1.00 3.01  ? 14  LEU D N   1 
ATOM   4085  C  CA  . LEU D  1 14  ? -66.593  -86.213  36.874  1.00 2.92  ? 14  LEU D CA  1 
ATOM   4086  C  C   . LEU D  1 14  ? -67.382  -85.045  36.295  1.00 3.22  ? 14  LEU D C   1 
ATOM   4087  O  O   . LEU D  1 14  ? -67.192  -83.906  36.716  1.00 2.98  ? 14  LEU D O   1 
ATOM   4088  C  CB  . LEU D  1 14  ? -65.466  -86.662  35.930  1.00 2.48  ? 14  LEU D CB  1 
ATOM   4089  C  CG  . LEU D  1 14  ? -64.580  -87.774  36.518  1.00 2.73  ? 14  LEU D CG  1 
ATOM   4090  C  CD1 . LEU D  1 14  ? -63.530  -88.211  35.538  1.00 3.77  ? 14  LEU D CD1 1 
ATOM   4091  C  CD2 . LEU D  1 14  ? -63.955  -87.357  37.807  1.00 2.00  ? 14  LEU D CD2 1 
ATOM   4092  N  N   . LEU D  1 15  ? -68.299  -85.339  35.364  1.00 3.11  ? 15  LEU D N   1 
ATOM   4093  C  CA  . LEU D  1 15  ? -69.182  -84.320  34.797  1.00 2.28  ? 15  LEU D CA  1 
ATOM   4094  C  C   . LEU D  1 15  ? -69.894  -83.593  35.923  1.00 2.78  ? 15  LEU D C   1 
ATOM   4095  O  O   . LEU D  1 15  ? -69.998  -82.376  35.881  1.00 2.79  ? 15  LEU D O   1 
ATOM   4096  C  CB  . LEU D  1 15  ? -70.182  -84.948  33.831  1.00 2.00  ? 15  LEU D CB  1 
ATOM   4097  C  CG  . LEU D  1 15  ? -71.307  -84.072  33.291  1.00 2.00  ? 15  LEU D CG  1 
ATOM   4098  C  CD1 . LEU D  1 15  ? -70.810  -82.836  32.589  1.00 2.00  ? 15  LEU D CD1 1 
ATOM   4099  C  CD2 . LEU D  1 15  ? -72.212  -84.872  32.383  1.00 2.00  ? 15  LEU D CD2 1 
ATOM   4100  N  N   . GLY D  1 16  ? -70.365  -84.345  36.924  1.00 3.01  ? 16  GLY D N   1 
ATOM   4101  C  CA  . GLY D  1 16  ? -71.048  -83.786  38.056  1.00 3.46  ? 16  GLY D CA  1 
ATOM   4102  C  C   . GLY D  1 16  ? -70.157  -82.797  38.797  1.00 4.61  ? 16  GLY D C   1 
ATOM   4103  O  O   . GLY D  1 16  ? -70.623  -81.753  39.235  1.00 4.34  ? 16  GLY D O   1 
ATOM   4104  N  N   . ASN D  1 17  ? -68.879  -83.130  38.937  1.00 5.37  ? 17  ASN D N   1 
ATOM   4105  C  CA  . ASN D  1 17  ? -67.933  -82.271  39.599  1.00 6.07  ? 17  ASN D CA  1 
ATOM   4106  C  C   . ASN D  1 17  ? -67.794  -80.967  38.838  1.00 6.97  ? 17  ASN D C   1 
ATOM   4107  O  O   . ASN D  1 17  ? -67.791  -79.900  39.459  1.00 7.14  ? 17  ASN D O   1 
ATOM   4108  C  CB  . ASN D  1 17  ? -66.546  -82.922  39.697  1.00 6.03  ? 17  ASN D CB  1 
ATOM   4109  C  CG  . ASN D  1 17  ? -66.481  -84.069  40.682  1.00 6.58  ? 17  ASN D CG  1 
ATOM   4110  O  OD1 . ASN D  1 17  ? -67.324  -84.221  41.551  1.00 5.60  ? 17  ASN D OD1 1 
ATOM   4111  N  ND2 . ASN D  1 17  ? -65.447  -84.879  40.551  1.00 8.90  ? 17  ASN D ND2 1 
ATOM   4112  N  N   . GLU D  1 18  ? -67.671  -81.050  37.502  1.00 7.03  ? 18  GLU D N   1 
ATOM   4113  C  CA  . GLU D  1 18  ? -67.434  -79.870  36.688  1.00 7.61  ? 18  GLU D CA  1 
ATOM   4114  C  C   . GLU D  1 18  ? -68.694  -79.024  36.738  1.00 7.78  ? 18  GLU D C   1 
ATOM   4115  O  O   . GLU D  1 18  ? -68.638  -77.769  36.754  1.00 7.48  ? 18  GLU D O   1 
ATOM   4116  C  CB  . GLU D  1 18  ? -67.109  -80.188  35.224  1.00 7.68  ? 18  GLU D CB  1 
ATOM   4117  C  CG  . GLU D  1 18  ? -65.898  -81.033  34.959  1.00 9.73  ? 18  GLU D CG  1 
ATOM   4118  C  CD  . GLU D  1 18  ? -64.557  -80.357  35.207  1.00 13.54 ? 18  GLU D CD  1 
ATOM   4119  O  OE1 . GLU D  1 18  ? -64.427  -79.103  35.177  1.00 13.02 ? 18  GLU D OE1 1 
ATOM   4120  O  OE2 . GLU D  1 18  ? -63.585  -81.124  35.412  1.00 15.56 ? 18  GLU D OE2 1 
ATOM   4121  N  N   . LEU D  1 19  ? -69.855  -79.667  36.771  1.00 7.45  ? 19  LEU D N   1 
ATOM   4122  C  CA  . LEU D  1 19  ? -70.969  -78.793  36.804  1.00 7.22  ? 19  LEU D CA  1 
ATOM   4123  C  C   . LEU D  1 19  ? -71.249  -78.060  38.090  1.00 6.86  ? 19  LEU D C   1 
ATOM   4124  O  O   . LEU D  1 19  ? -71.716  -76.936  38.044  1.00 7.37  ? 19  LEU D O   1 
ATOM   4125  C  CB  . LEU D  1 19  ? -72.128  -79.142  35.896  1.00 7.64  ? 19  LEU D CB  1 
ATOM   4126  C  CG  . LEU D  1 19  ? -73.156  -80.204  35.611  1.00 8.50  ? 19  LEU D CG  1 
ATOM   4127  C  CD1 . LEU D  1 19  ? -73.013  -80.226  34.145  1.00 7.74  ? 19  LEU D CD1 1 
ATOM   4128  C  CD2 . LEU D  1 19  ? -72.942  -81.573  36.131  1.00 11.90 ? 19  LEU D CD2 1 
ATOM   4129  N  N   . VAL D  1 20  ? -70.842  -78.601  39.233  1.00 6.21  ? 20  VAL D N   1 
ATOM   4130  C  CA  . VAL D  1 20  ? -70.823  -77.730  40.401  1.00 4.55  ? 20  VAL D CA  1 
ATOM   4131  C  C   . VAL D  1 20  ? -69.748  -76.628  40.280  1.00 3.97  ? 20  VAL D C   1 
ATOM   4132  O  O   . VAL D  1 20  ? -70.046  -75.467  40.542  1.00 3.97  ? 20  VAL D O   1 
ATOM   4133  C  CB  . VAL D  1 20  ? -70.959  -78.420  41.822  1.00 4.10  ? 20  VAL D CB  1 
ATOM   4134  C  CG1 . VAL D  1 20  ? -70.909  -79.859  41.781  1.00 3.18  ? 20  VAL D CG1 1 
ATOM   4135  C  CG2 . VAL D  1 20  ? -69.974  -77.861  42.805  1.00 3.07  ? 20  VAL D CG2 1 
ATOM   4136  N  N   . ALA D  1 21  ? -68.552  -76.968  39.804  1.00 2.97  ? 21  ALA D N   1 
ATOM   4137  C  CA  . ALA D  1 21  ? -67.487  -75.983  39.646  1.00 2.39  ? 21  ALA D CA  1 
ATOM   4138  C  C   . ALA D  1 21  ? -67.891  -74.830  38.740  1.00 2.89  ? 21  ALA D C   1 
ATOM   4139  O  O   . ALA D  1 21  ? -67.613  -73.678  39.058  1.00 3.39  ? 21  ALA D O   1 
ATOM   4140  C  CB  . ALA D  1 21  ? -66.258  -76.617  39.145  1.00 2.00  ? 21  ALA D CB  1 
ATOM   4141  N  N   . ILE D  1 22  ? -68.550  -75.139  37.620  1.00 2.96  ? 22  ILE D N   1 
ATOM   4142  C  CA  . ILE D  1 22  ? -69.044  -74.123  36.674  1.00 3.09  ? 22  ILE D CA  1 
ATOM   4143  C  C   . ILE D  1 22  ? -69.847  -73.052  37.390  1.00 3.66  ? 22  ILE D C   1 
ATOM   4144  O  O   . ILE D  1 22  ? -69.546  -71.849  37.262  1.00 4.23  ? 22  ILE D O   1 
ATOM   4145  C  CB  . ILE D  1 22  ? -69.899  -74.743  35.532  1.00 3.77  ? 22  ILE D CB  1 
ATOM   4146  C  CG1 . ILE D  1 22  ? -68.999  -75.458  34.515  1.00 3.23  ? 22  ILE D CG1 1 
ATOM   4147  C  CG2 . ILE D  1 22  ? -70.737  -73.683  34.830  1.00 2.00  ? 22  ILE D CG2 1 
ATOM   4148  C  CD1 . ILE D  1 22  ? -69.744  -76.347  33.644  1.00 2.00  ? 22  ILE D CD1 1 
ATOM   4149  N  N   . ASN D  1 23  ? -70.840  -73.476  38.160  1.00 3.19  ? 23  ASN D N   1 
ATOM   4150  C  CA  . ASN D  1 23  ? -71.679  -72.558  38.880  1.00 3.18  ? 23  ASN D CA  1 
ATOM   4151  C  C   . ASN D  1 23  ? -70.921  -71.868  39.996  1.00 3.60  ? 23  ASN D C   1 
ATOM   4152  O  O   . ASN D  1 23  ? -71.051  -70.656  40.202  1.00 4.01  ? 23  ASN D O   1 
ATOM   4153  C  CB  . ASN D  1 23  ? -72.899  -73.281  39.441  1.00 3.28  ? 23  ASN D CB  1 
ATOM   4154  C  CG  . ASN D  1 23  ? -73.861  -73.762  38.355  1.00 4.10  ? 23  ASN D CG  1 
ATOM   4155  O  OD1 . ASN D  1 23  ? -74.902  -74.280  38.663  1.00 5.86  ? 23  ASN D OD1 1 
ATOM   4156  N  ND2 . ASN D  1 23  ? -73.503  -73.595  37.092  1.00 5.22  ? 23  ASN D ND2 1 
ATOM   4157  N  N   . GLN D  1 24  ? -70.114  -72.606  40.736  1.00 3.50  ? 24  GLN D N   1 
ATOM   4158  C  CA  . GLN D  1 24  ? -69.493  -71.980  41.882  1.00 3.63  ? 24  GLN D CA  1 
ATOM   4159  C  C   . GLN D  1 24  ? -68.520  -70.914  41.387  1.00 3.74  ? 24  GLN D C   1 
ATOM   4160  O  O   . GLN D  1 24  ? -68.491  -69.794  41.909  1.00 4.10  ? 24  GLN D O   1 
ATOM   4161  C  CB  . GLN D  1 24  ? -68.848  -73.011  42.804  1.00 3.64  ? 24  GLN D CB  1 
ATOM   4162  C  CG  . GLN D  1 24  ? -68.192  -72.421  44.038  1.00 4.32  ? 24  GLN D CG  1 
ATOM   4163  C  CD  . GLN D  1 24  ? -67.843  -73.478  45.046  1.00 7.12  ? 24  GLN D CD  1 
ATOM   4164  O  OE1 . GLN D  1 24  ? -68.695  -74.243  45.465  1.00 8.23  ? 24  GLN D OE1 1 
ATOM   4165  N  NE2 . GLN D  1 24  ? -66.576  -73.524  45.452  1.00 6.64  ? 24  GLN D NE2 1 
ATOM   4166  N  N   . TYR D  1 25  ? -67.770  -71.223  40.340  1.00 3.61  ? 25  TYR D N   1 
ATOM   4167  C  CA  . TYR D  1 25  ? -66.846  -70.238  39.779  1.00 4.27  ? 25  TYR D CA  1 
ATOM   4168  C  C   . TYR D  1 25  ? -67.538  -69.003  39.213  1.00 3.86  ? 25  TYR D C   1 
ATOM   4169  O  O   . TYR D  1 25  ? -67.081  -67.890  39.412  1.00 3.48  ? 25  TYR D O   1 
ATOM   4170  C  CB  . TYR D  1 25  ? -65.982  -70.853  38.699  1.00 5.16  ? 25  TYR D CB  1 
ATOM   4171  C  CG  . TYR D  1 25  ? -64.749  -71.569  39.206  1.00 7.10  ? 25  TYR D CG  1 
ATOM   4172  C  CD1 . TYR D  1 25  ? -63.886  -70.956  40.128  1.00 8.20  ? 25  TYR D CD1 1 
ATOM   4173  C  CD2 . TYR D  1 25  ? -64.407  -72.848  38.716  1.00 7.85  ? 25  TYR D CD2 1 
ATOM   4174  C  CE1 . TYR D  1 25  ? -62.748  -71.604  40.571  1.00 8.83  ? 25  TYR D CE1 1 
ATOM   4175  C  CE2 . TYR D  1 25  ? -63.279  -73.493  39.138  1.00 8.79  ? 25  TYR D CE2 1 
ATOM   4176  C  CZ  . TYR D  1 25  ? -62.453  -72.876  40.067  1.00 8.92  ? 25  TYR D CZ  1 
ATOM   4177  O  OH  . TYR D  1 25  ? -61.317  -73.530  40.478  1.00 8.69  ? 25  TYR D OH  1 
ATOM   4178  N  N   . PHE D  1 26  ? -68.656  -69.210  38.523  1.00 3.56  ? 26  PHE D N   1 
ATOM   4179  C  CA  . PHE D  1 26  ? -69.408  -68.097  37.949  1.00 2.96  ? 26  PHE D CA  1 
ATOM   4180  C  C   . PHE D  1 26  ? -69.995  -67.137  39.000  1.00 2.99  ? 26  PHE D C   1 
ATOM   4181  O  O   . PHE D  1 26  ? -69.858  -65.927  38.879  1.00 2.37  ? 26  PHE D O   1 
ATOM   4182  C  CB  . PHE D  1 26  ? -70.507  -68.608  37.038  1.00 2.67  ? 26  PHE D CB  1 
ATOM   4183  C  CG  . PHE D  1 26  ? -70.876  -67.624  36.019  1.00 3.04  ? 26  PHE D CG  1 
ATOM   4184  C  CD1 . PHE D  1 26  ? -70.199  -67.589  34.804  1.00 3.11  ? 26  PHE D CD1 1 
ATOM   4185  C  CD2 . PHE D  1 26  ? -71.864  -66.670  36.279  1.00 3.54  ? 26  PHE D CD2 1 
ATOM   4186  C  CE1 . PHE D  1 26  ? -70.515  -66.642  33.844  1.00 3.90  ? 26  PHE D CE1 1 
ATOM   4187  C  CE2 . PHE D  1 26  ? -72.191  -65.690  35.327  1.00 4.10  ? 26  PHE D CE2 1 
ATOM   4188  C  CZ  . PHE D  1 26  ? -71.516  -65.668  34.110  1.00 4.36  ? 26  PHE D CZ  1 
ATOM   4189  N  N   . LEU D  1 27  ? -70.647  -67.686  40.027  1.00 2.83  ? 27  LEU D N   1 
ATOM   4190  C  CA  . LEU D  1 27  ? -71.157  -66.885  41.103  1.00 2.50  ? 27  LEU D CA  1 
ATOM   4191  C  C   . LEU D  1 27  ? -69.989  -66.157  41.748  1.00 2.49  ? 27  LEU D C   1 
ATOM   4192  O  O   . LEU D  1 27  ? -70.071  -64.936  41.958  1.00 2.04  ? 27  LEU D O   1 
ATOM   4193  C  CB  . LEU D  1 27  ? -71.876  -67.737  42.132  1.00 2.52  ? 27  LEU D CB  1 
ATOM   4194  C  CG  . LEU D  1 27  ? -73.106  -67.173  42.858  1.00 2.48  ? 27  LEU D CG  1 
ATOM   4195  C  CD1 . LEU D  1 27  ? -73.320  -67.855  44.180  1.00 2.00  ? 27  LEU D CD1 1 
ATOM   4196  C  CD2 . LEU D  1 27  ? -73.118  -65.670  43.024  1.00 2.93  ? 27  LEU D CD2 1 
ATOM   4197  N  N   . HIS D  1 28  ? -68.894  -66.864  42.039  1.00 2.12  ? 28  HIS D N   1 
ATOM   4198  C  CA  . HIS D  1 28  ? -67.763  -66.185  42.670  1.00 2.39  ? 28  HIS D CA  1 
ATOM   4199  C  C   . HIS D  1 28  ? -67.297  -65.020  41.819  1.00 2.55  ? 28  HIS D C   1 
ATOM   4200  O  O   . HIS D  1 28  ? -67.161  -63.889  42.303  1.00 2.85  ? 28  HIS D O   1 
ATOM   4201  C  CB  . HIS D  1 28  ? -66.601  -67.123  42.966  1.00 2.55  ? 28  HIS D CB  1 
ATOM   4202  C  CG  . HIS D  1 28  ? -66.825  -67.992  44.159  1.00 2.62  ? 28  HIS D CG  1 
ATOM   4203  N  ND1 . HIS D  1 28  ? -66.043  -69.099  44.432  1.00 2.47  ? 28  HIS D ND1 1 
ATOM   4204  C  CD2 . HIS D  1 28  ? -67.776  -67.948  45.130  1.00 2.03  ? 28  HIS D CD2 1 
ATOM   4205  C  CE1 . HIS D  1 28  ? -66.492  -69.685  45.534  1.00 3.18  ? 28  HIS D CE1 1 
ATOM   4206  N  NE2 . HIS D  1 28  ? -67.539  -69.003  45.980  1.00 3.28  ? 28  HIS D NE2 1 
ATOM   4207  N  N   . ALA D  1 29  ? -67.118  -65.286  40.535  1.00 2.33  ? 29  ALA D N   1 
ATOM   4208  C  CA  . ALA D  1 29  ? -66.733  -64.258  39.585  1.00 2.15  ? 29  ALA D CA  1 
ATOM   4209  C  C   . ALA D  1 29  ? -67.592  -62.996  39.703  1.00 2.08  ? 29  ALA D C   1 
ATOM   4210  O  O   . ALA D  1 29  ? -67.063  -61.907  39.844  1.00 2.15  ? 29  ALA D O   1 
ATOM   4211  C  CB  . ALA D  1 29  ? -66.747  -64.797  38.170  1.00 2.00  ? 29  ALA D CB  1 
ATOM   4212  N  N   . ARG D  1 30  ? -68.903  -63.143  39.645  1.00 2.09  ? 30  ARG D N   1 
ATOM   4213  C  CA  . ARG D  1 30  ? -69.776  -61.978  39.602  1.00 2.44  ? 30  ARG D CA  1 
ATOM   4214  C  C   . ARG D  1 30  ? -69.938  -61.324  40.991  1.00 2.73  ? 30  ARG D C   1 
ATOM   4215  O  O   . ARG D  1 30  ? -70.265  -60.128  41.095  1.00 2.43  ? 30  ARG D O   1 
ATOM   4216  C  CB  . ARG D  1 30  ? -71.126  -62.306  38.993  1.00 2.00  ? 30  ARG D CB  1 
ATOM   4217  C  CG  . ARG D  1 30  ? -71.008  -62.976  37.671  1.00 2.00  ? 30  ARG D CG  1 
ATOM   4218  C  CD  . ARG D  1 30  ? -71.051  -62.019  36.527  1.00 2.03  ? 30  ARG D CD  1 
ATOM   4219  N  NE  . ARG D  1 30  ? -69.751  -61.975  35.865  1.00 4.32  ? 30  ARG D NE  1 
ATOM   4220  C  CZ  . ARG D  1 30  ? -69.537  -62.056  34.547  1.00 2.91  ? 30  ARG D CZ  1 
ATOM   4221  N  NH1 . ARG D  1 30  ? -70.523  -62.161  33.666  1.00 2.76  ? 30  ARG D NH1 1 
ATOM   4222  N  NH2 . ARG D  1 30  ? -68.307  -62.021  34.111  1.00 4.03  ? 30  ARG D NH2 1 
ATOM   4223  N  N   . MET D  1 31  ? -69.660  -62.096  42.046  1.00 2.90  ? 31  MET D N   1 
ATOM   4224  C  CA  . MET D  1 31  ? -69.553  -61.535  43.384  1.00 2.81  ? 31  MET D CA  1 
ATOM   4225  C  C   . MET D  1 31  ? -68.325  -60.612  43.454  1.00 2.78  ? 31  MET D C   1 
ATOM   4226  O  O   . MET D  1 31  ? -68.434  -59.446  43.815  1.00 3.06  ? 31  MET D O   1 
ATOM   4227  C  CB  . MET D  1 31  ? -69.470  -62.645  44.419  1.00 2.62  ? 31  MET D CB  1 
ATOM   4228  C  CG  . MET D  1 31  ? -70.803  -63.258  44.770  1.00 2.02  ? 31  MET D CG  1 
ATOM   4229  S  SD  . MET D  1 31  ? -70.649  -64.702  45.868  1.00 3.58  ? 31  MET D SD  1 
ATOM   4230  C  CE  . MET D  1 31  ? -70.117  -63.978  47.417  1.00 2.00  ? 31  MET D CE  1 
ATOM   4231  N  N   . PHE D  1 32  ? -67.163  -61.120  43.066  1.00 2.67  ? 32  PHE D N   1 
ATOM   4232  C  CA  . PHE D  1 32  ? -65.998  -60.286  42.922  1.00 2.36  ? 32  PHE D CA  1 
ATOM   4233  C  C   . PHE D  1 32  ? -66.252  -59.043  42.071  1.00 2.49  ? 32  PHE D C   1 
ATOM   4234  O  O   . PHE D  1 32  ? -65.803  -57.925  42.412  1.00 2.61  ? 32  PHE D O   1 
ATOM   4235  C  CB  . PHE D  1 32  ? -64.850  -61.096  42.340  1.00 2.42  ? 32  PHE D CB  1 
ATOM   4236  C  CG  . PHE D  1 32  ? -64.394  -62.189  43.235  1.00 2.73  ? 32  PHE D CG  1 
ATOM   4237  C  CD1 . PHE D  1 32  ? -64.102  -63.440  42.725  1.00 4.22  ? 32  PHE D CD1 1 
ATOM   4238  C  CD2 . PHE D  1 32  ? -64.273  -61.969  44.605  1.00 2.42  ? 32  PHE D CD2 1 
ATOM   4239  C  CE1 . PHE D  1 32  ? -63.675  -64.469  43.556  1.00 4.29  ? 32  PHE D CE1 1 
ATOM   4240  C  CE2 . PHE D  1 32  ? -63.836  -62.975  45.442  1.00 4.96  ? 32  PHE D CE2 1 
ATOM   4241  C  CZ  . PHE D  1 32  ? -63.542  -64.249  44.915  1.00 4.21  ? 32  PHE D CZ  1 
ATOM   4242  N  N   . LYS D  1 33  ? -66.958  -59.222  40.963  1.00 2.62  ? 33  LYS D N   1 
ATOM   4243  C  CA  . LYS D  1 33  ? -67.246  -58.109  40.054  1.00 3.01  ? 33  LYS D CA  1 
ATOM   4244  C  C   . LYS D  1 33  ? -68.088  -57.061  40.751  1.00 3.06  ? 33  LYS D C   1 
ATOM   4245  O  O   . LYS D  1 33  ? -67.800  -55.876  40.679  1.00 2.64  ? 33  LYS D O   1 
ATOM   4246  C  CB  . LYS D  1 33  ? -67.979  -58.624  38.830  1.00 3.11  ? 33  LYS D CB  1 
ATOM   4247  C  CG  . LYS D  1 33  ? -68.466  -57.575  37.908  1.00 4.04  ? 33  LYS D CG  1 
ATOM   4248  C  CD  . LYS D  1 33  ? -68.390  -58.127  36.513  1.00 8.20  ? 33  LYS D CD  1 
ATOM   4249  C  CE  . LYS D  1 33  ? -69.455  -57.542  35.599  1.00 10.42 ? 33  LYS D CE  1 
ATOM   4250  N  NZ  . LYS D  1 33  ? -68.902  -56.391  34.820  1.00 10.84 ? 33  LYS D NZ  1 
ATOM   4251  N  N   . ASN D  1 34  ? -69.117  -57.526  41.442  1.00 3.03  ? 34  ASN D N   1 
ATOM   4252  C  CA  . ASN D  1 34  ? -69.943  -56.625  42.192  1.00 3.44  ? 34  ASN D CA  1 
ATOM   4253  C  C   . ASN D  1 34  ? -69.134  -55.830  43.193  1.00 3.68  ? 34  ASN D C   1 
ATOM   4254  O  O   . ASN D  1 34  ? -69.321  -54.611  43.284  1.00 4.80  ? 34  ASN D O   1 
ATOM   4255  C  CB  . ASN D  1 34  ? -71.093  -57.335  42.882  1.00 3.23  ? 34  ASN D CB  1 
ATOM   4256  C  CG  . ASN D  1 34  ? -72.024  -56.360  43.552  1.00 4.40  ? 34  ASN D CG  1 
ATOM   4257  O  OD1 . ASN D  1 34  ? -72.023  -56.241  44.764  1.00 7.33  ? 34  ASN D OD1 1 
ATOM   4258  N  ND2 . ASN D  1 34  ? -72.807  -55.613  42.761  1.00 6.84  ? 34  ASN D ND2 1 
ATOM   4259  N  N   . TRP D  1 35  ? -68.255  -56.507  43.932  1.00 3.38  ? 35  TRP D N   1 
ATOM   4260  C  CA  . TRP D  1 35  ? -67.365  -55.852  44.884  1.00 3.18  ? 35  TRP D CA  1 
ATOM   4261  C  C   . TRP D  1 35  ? -66.266  -54.981  44.248  1.00 3.40  ? 35  TRP D C   1 
ATOM   4262  O  O   . TRP D  1 35  ? -65.514  -54.333  44.975  1.00 3.49  ? 35  TRP D O   1 
ATOM   4263  C  CB  . TRP D  1 35  ? -66.695  -56.878  45.772  1.00 2.87  ? 35  TRP D CB  1 
ATOM   4264  C  CG  . TRP D  1 35  ? -67.605  -57.554  46.687  1.00 3.68  ? 35  TRP D CG  1 
ATOM   4265  C  CD1 . TRP D  1 35  ? -68.777  -57.064  47.167  1.00 5.36  ? 35  TRP D CD1 1 
ATOM   4266  C  CD2 . TRP D  1 35  ? -67.438  -58.856  47.269  1.00 4.17  ? 35  TRP D CD2 1 
ATOM   4267  N  NE1 . TRP D  1 35  ? -69.362  -57.983  48.011  1.00 5.77  ? 35  TRP D NE1 1 
ATOM   4268  C  CE2 . TRP D  1 35  ? -68.557  -59.089  48.093  1.00 4.65  ? 35  TRP D CE2 1 
ATOM   4269  C  CE3 . TRP D  1 35  ? -66.446  -59.839  47.188  1.00 2.56  ? 35  TRP D CE3 1 
ATOM   4270  C  CZ2 . TRP D  1 35  ? -68.719  -60.268  48.823  1.00 4.28  ? 35  TRP D CZ2 1 
ATOM   4271  C  CZ3 . TRP D  1 35  ? -66.617  -61.018  47.905  1.00 3.82  ? 35  TRP D CZ3 1 
ATOM   4272  C  CH2 . TRP D  1 35  ? -67.738  -61.223  48.710  1.00 4.10  ? 35  TRP D CH2 1 
ATOM   4273  N  N   . GLY D  1 36  ? -66.138  -54.994  42.912  1.00 2.92  ? 36  GLY D N   1 
ATOM   4274  C  CA  . GLY D  1 36  ? -65.185  -54.130  42.249  1.00 2.71  ? 36  GLY D CA  1 
ATOM   4275  C  C   . GLY D  1 36  ? -63.819  -54.751  42.156  1.00 3.33  ? 36  GLY D C   1 
ATOM   4276  O  O   . GLY D  1 36  ? -62.873  -54.104  41.708  1.00 3.98  ? 36  GLY D O   1 
ATOM   4277  N  N   . LEU D  1 37  ? -63.715  -56.023  42.540  1.00 3.36  ? 37  LEU D N   1 
ATOM   4278  C  CA  . LEU D  1 37  ? -62.474  -56.807  42.481  1.00 2.84  ? 37  LEU D CA  1 
ATOM   4279  C  C   . LEU D  1 37  ? -62.283  -57.373  41.048  1.00 3.08  ? 37  LEU D C   1 
ATOM   4280  O  O   . LEU D  1 37  ? -62.257  -58.591  40.799  1.00 3.26  ? 37  LEU D O   1 
ATOM   4281  C  CB  . LEU D  1 37  ? -62.558  -57.922  43.550  1.00 2.63  ? 37  LEU D CB  1 
ATOM   4282  C  CG  . LEU D  1 37  ? -62.140  -57.543  44.990  1.00 3.46  ? 37  LEU D CG  1 
ATOM   4283  C  CD1 . LEU D  1 37  ? -62.213  -56.042  45.298  1.00 2.00  ? 37  LEU D CD1 1 
ATOM   4284  C  CD2 . LEU D  1 37  ? -62.826  -58.374  46.057  1.00 2.00  ? 37  LEU D CD2 1 
ATOM   4285  N  N   . LYS D  1 38  ? -62.157  -56.452  40.112  1.00 3.32  ? 38  LYS D N   1 
ATOM   4286  C  CA  . LYS D  1 38  ? -62.184  -56.689  38.668  1.00 3.67  ? 38  LYS D CA  1 
ATOM   4287  C  C   . LYS D  1 38  ? -61.338  -57.903  38.221  1.00 3.60  ? 38  LYS D C   1 
ATOM   4288  O  O   . LYS D  1 38  ? -61.707  -58.670  37.337  1.00 3.47  ? 38  LYS D O   1 
ATOM   4289  C  CB  . LYS D  1 38  ? -61.682  -55.388  38.037  1.00 3.92  ? 38  LYS D CB  1 
ATOM   4290  C  CG  . LYS D  1 38  ? -62.391  -54.884  36.783  1.00 8.09  ? 38  LYS D CG  1 
ATOM   4291  C  CD  . LYS D  1 38  ? -63.366  -53.704  36.981  1.00 10.92 ? 38  LYS D CD  1 
ATOM   4292  C  CE  . LYS D  1 38  ? -62.719  -52.438  37.565  1.00 13.69 ? 38  LYS D CE  1 
ATOM   4293  N  NZ  . LYS D  1 38  ? -61.735  -51.740  36.701  1.00 14.00 ? 38  LYS D NZ  1 
ATOM   4294  N  N   . ARG D  1 39  ? -60.208  -58.097  38.879  1.00 4.35  ? 39  ARG D N   1 
ATOM   4295  C  CA  . ARG D  1 39  ? -59.189  -59.045  38.461  1.00 4.48  ? 39  ARG D CA  1 
ATOM   4296  C  C   . ARG D  1 39  ? -59.553  -60.454  38.825  1.00 4.26  ? 39  ARG D C   1 
ATOM   4297  O  O   . ARG D  1 39  ? -59.264  -61.401  38.098  1.00 4.82  ? 39  ARG D O   1 
ATOM   4298  C  CB  . ARG D  1 39  ? -57.921  -58.677  39.184  1.00 5.23  ? 39  ARG D CB  1 
ATOM   4299  C  CG  . ARG D  1 39  ? -56.650  -58.957  38.475  1.00 7.84  ? 39  ARG D CG  1 
ATOM   4300  C  CD  . ARG D  1 39  ? -56.111  -60.279  38.965  1.00 14.22 ? 39  ARG D CD  1 
ATOM   4301  N  NE  . ARG D  1 39  ? -54.722  -60.174  39.449  1.00 18.68 ? 39  ARG D NE  1 
ATOM   4302  C  CZ  . ARG D  1 39  ? -54.160  -61.048  40.299  1.00 20.86 ? 39  ARG D CZ  1 
ATOM   4303  N  NH1 . ARG D  1 39  ? -54.864  -62.112  40.785  1.00 16.91 ? 39  ARG D NH1 1 
ATOM   4304  N  NH2 . ARG D  1 39  ? -52.893  -60.842  40.680  1.00 21.70 ? 39  ARG D NH2 1 
ATOM   4305  N  N   . LEU D  1 40  ? -60.155  -60.601  39.986  1.00 3.86  ? 40  LEU D N   1 
ATOM   4306  C  CA  . LEU D  1 40  ? -60.631  -61.866  40.454  1.00 3.18  ? 40  LEU D CA  1 
ATOM   4307  C  C   . LEU D  1 40  ? -61.860  -62.278  39.638  1.00 3.54  ? 40  LEU D C   1 
ATOM   4308  O  O   . LEU D  1 40  ? -62.089  -63.462  39.418  1.00 3.46  ? 40  LEU D O   1 
ATOM   4309  C  CB  . LEU D  1 40  ? -60.992  -61.706  41.916  1.00 3.41  ? 40  LEU D CB  1 
ATOM   4310  C  CG  . LEU D  1 40  ? -60.104  -62.248  43.029  1.00 2.43  ? 40  LEU D CG  1 
ATOM   4311  C  CD1 . LEU D  1 40  ? -58.666  -62.441  42.651  1.00 2.57  ? 40  LEU D CD1 1 
ATOM   4312  C  CD2 . LEU D  1 40  ? -60.266  -61.373  44.231  1.00 2.01  ? 40  LEU D CD2 1 
ATOM   4313  N  N   . ASN D  1 41  ? -62.650  -61.302  39.183  1.00 3.61  ? 41  ASN D N   1 
ATOM   4314  C  CA  . ASN D  1 41  ? -63.762  -61.584  38.295  1.00 2.96  ? 41  ASN D CA  1 
ATOM   4315  C  C   . ASN D  1 41  ? -63.240  -62.104  36.982  1.00 3.19  ? 41  ASN D C   1 
ATOM   4316  O  O   . ASN D  1 41  ? -63.750  -63.101  36.489  1.00 2.90  ? 41  ASN D O   1 
ATOM   4317  C  CB  . ASN D  1 41  ? -64.641  -60.356  38.050  1.00 2.67  ? 41  ASN D CB  1 
ATOM   4318  C  CG  . ASN D  1 41  ? -65.572  -60.542  36.848  1.00 3.37  ? 41  ASN D CG  1 
ATOM   4319  O  OD1 . ASN D  1 41  ? -66.578  -61.259  36.915  1.00 3.53  ? 41  ASN D OD1 1 
ATOM   4320  N  ND2 . ASN D  1 41  ? -65.214  -59.933  35.731  1.00 2.02  ? 41  ASN D ND2 1 
ATOM   4321  N  N   . ASP D  1 42  ? -62.242  -61.447  36.408  1.00 3.80  ? 42  ASP D N   1 
ATOM   4322  C  CA  . ASP D  1 42  ? -61.670  -61.943  35.154  1.00 5.20  ? 42  ASP D CA  1 
ATOM   4323  C  C   . ASP D  1 42  ? -61.153  -63.388  35.288  1.00 5.48  ? 42  ASP D C   1 
ATOM   4324  O  O   . ASP D  1 42  ? -61.494  -64.258  34.459  1.00 5.95  ? 42  ASP D O   1 
ATOM   4325  C  CB  . ASP D  1 42  ? -60.543  -61.057  34.625  1.00 5.47  ? 42  ASP D CB  1 
ATOM   4326  C  CG  . ASP D  1 42  ? -61.021  -59.663  34.227  1.00 9.95  ? 42  ASP D CG  1 
ATOM   4327  O  OD1 . ASP D  1 42  ? -62.258  -59.417  34.133  1.00 13.00 ? 42  ASP D OD1 1 
ATOM   4328  O  OD2 . ASP D  1 42  ? -60.139  -58.788  34.029  1.00 13.61 ? 42  ASP D OD2 1 
ATOM   4329  N  N   . VAL D  1 43  ? -60.368  -63.668  36.325  1.00 5.02  ? 43  VAL D N   1 
ATOM   4330  C  CA  . VAL D  1 43  ? -59.789  -65.005  36.405  1.00 4.93  ? 43  VAL D CA  1 
ATOM   4331  C  C   . VAL D  1 43  ? -60.870  -66.069  36.643  1.00 4.93  ? 43  VAL D C   1 
ATOM   4332  O  O   . VAL D  1 43  ? -60.930  -67.091  35.927  1.00 4.74  ? 43  VAL D O   1 
ATOM   4333  C  CB  . VAL D  1 43  ? -58.637  -65.107  37.425  1.00 4.88  ? 43  VAL D CB  1 
ATOM   4334  C  CG1 . VAL D  1 43  ? -58.275  -66.565  37.682  1.00 5.14  ? 43  VAL D CG1 1 
ATOM   4335  C  CG2 . VAL D  1 43  ? -57.429  -64.339  36.919  1.00 4.13  ? 43  VAL D CG2 1 
ATOM   4336  N  N   . GLU D  1 44  ? -61.740  -65.820  37.614  1.00 4.69  ? 44  GLU D N   1 
ATOM   4337  C  CA  . GLU D  1 44  ? -62.741  -66.838  37.960  1.00 4.91  ? 44  GLU D CA  1 
ATOM   4338  C  C   . GLU D  1 44  ? -63.733  -67.055  36.873  1.00 4.66  ? 44  GLU D C   1 
ATOM   4339  O  O   . GLU D  1 44  ? -64.190  -68.162  36.678  1.00 4.87  ? 44  GLU D O   1 
ATOM   4340  C  CB  . GLU D  1 44  ? -63.457  -66.511  39.254  1.00 4.29  ? 44  GLU D CB  1 
ATOM   4341  C  CG  . GLU D  1 44  ? -62.514  -66.506  40.401  1.00 7.79  ? 44  GLU D CG  1 
ATOM   4342  C  CD  . GLU D  1 44  ? -62.726  -67.642  41.360  1.00 11.30 ? 44  GLU D CD  1 
ATOM   4343  O  OE1 . GLU D  1 44  ? -63.874  -67.959  41.743  1.00 12.44 ? 44  GLU D OE1 1 
ATOM   4344  O  OE2 . GLU D  1 44  ? -61.723  -68.213  41.797  1.00 12.58 ? 44  GLU D OE2 1 
ATOM   4345  N  N   . TYR D  1 45  ? -64.061  -66.004  36.153  1.00 4.66  ? 45  TYR D N   1 
ATOM   4346  C  CA  . TYR D  1 45  ? -64.896  -66.169  34.997  1.00 4.79  ? 45  TYR D CA  1 
ATOM   4347  C  C   . TYR D  1 45  ? -64.221  -67.106  34.011  1.00 5.27  ? 45  TYR D C   1 
ATOM   4348  O  O   . TYR D  1 45  ? -64.849  -68.044  33.534  1.00 5.10  ? 45  TYR D O   1 
ATOM   4349  C  CB  . TYR D  1 45  ? -65.144  -64.833  34.343  1.00 4.98  ? 45  TYR D CB  1 
ATOM   4350  C  CG  . TYR D  1 45  ? -65.905  -64.934  33.065  1.00 5.01  ? 45  TYR D CG  1 
ATOM   4351  C  CD1 . TYR D  1 45  ? -67.283  -65.022  33.063  1.00 5.36  ? 45  TYR D CD1 1 
ATOM   4352  C  CD2 . TYR D  1 45  ? -65.239  -64.928  31.843  1.00 5.98  ? 45  TYR D CD2 1 
ATOM   4353  C  CE1 . TYR D  1 45  ? -67.983  -65.097  31.881  1.00 6.96  ? 45  TYR D CE1 1 
ATOM   4354  C  CE2 . TYR D  1 45  ? -65.927  -65.015  30.650  1.00 6.28  ? 45  TYR D CE2 1 
ATOM   4355  C  CZ  . TYR D  1 45  ? -67.295  -65.102  30.672  1.00 7.79  ? 45  TYR D CZ  1 
ATOM   4356  O  OH  . TYR D  1 45  ? -67.979  -65.185  29.474  1.00 8.43  ? 45  TYR D OH  1 
ATOM   4357  N  N   A HIS D  1 46  ? -62.942  -66.865  33.725  0.50 5.71  ? 46  HIS D N   1 
ATOM   4358  N  N   B HIS D  1 46  ? -62.939  -66.857  33.713  0.50 5.73  ? 46  HIS D N   1 
ATOM   4359  C  CA  A HIS D  1 46  ? -62.218  -67.728  32.797  0.50 6.26  ? 46  HIS D CA  1 
ATOM   4360  C  CA  B HIS D  1 46  ? -62.171  -67.735  32.814  0.50 6.34  ? 46  HIS D CA  1 
ATOM   4361  C  C   A HIS D  1 46  ? -62.105  -69.167  33.299  0.50 5.72  ? 46  HIS D C   1 
ATOM   4362  C  C   B HIS D  1 46  ? -62.233  -69.174  33.299  0.50 5.75  ? 46  HIS D C   1 
ATOM   4363  O  O   A HIS D  1 46  ? -62.000  -70.082  32.503  0.50 6.32  ? 46  HIS D O   1 
ATOM   4364  O  O   B HIS D  1 46  ? -62.364  -70.087  32.500  0.50 6.29  ? 46  HIS D O   1 
ATOM   4365  C  CB  A HIS D  1 46  ? -60.864  -67.128  32.394  0.50 6.46  ? 46  HIS D CB  1 
ATOM   4366  C  CB  B HIS D  1 46  ? -60.712  -67.277  32.659  0.50 6.57  ? 46  HIS D CB  1 
ATOM   4367  C  CG  A HIS D  1 46  ? -60.987  -65.876  31.577  0.50 9.87  ? 46  HIS D CG  1 
ATOM   4368  C  CG  B HIS D  1 46  ? -59.893  -68.124  31.721  0.50 10.55 ? 46  HIS D CG  1 
ATOM   4369  N  ND1 A HIS D  1 46  ? -61.522  -65.861  30.307  0.50 11.96 ? 46  HIS D ND1 1 
ATOM   4370  N  ND1 B HIS D  1 46  ? -60.076  -68.114  30.351  0.50 14.27 ? 46  HIS D ND1 1 
ATOM   4371  C  CD2 A HIS D  1 46  ? -60.670  -64.590  31.866  0.50 12.55 ? 46  HIS D CD2 1 
ATOM   4372  C  CD2 B HIS D  1 46  ? -58.875  -68.993  31.957  0.50 12.25 ? 46  HIS D CD2 1 
ATOM   4373  C  CE1 A HIS D  1 46  ? -61.527  -64.622  29.848  0.50 13.13 ? 46  HIS D CE1 1 
ATOM   4374  C  CE1 B HIS D  1 46  ? -59.213  -68.946  29.788  0.50 14.37 ? 46  HIS D CE1 1 
ATOM   4375  N  NE2 A HIS D  1 46  ? -61.016  -63.832  30.776  0.50 13.28 ? 46  HIS D NE2 1 
ATOM   4376  N  NE2 B HIS D  1 46  ? -58.471  -69.487  30.740  0.50 13.54 ? 46  HIS D NE2 1 
ATOM   4377  N  N   . GLU D  1 47  ? -62.173  -69.372  34.603  1.00 5.27  ? 47  GLU D N   1 
ATOM   4378  C  CA  . GLU D  1 47  ? -62.207  -70.706  35.112  1.00 5.23  ? 47  GLU D CA  1 
ATOM   4379  C  C   . GLU D  1 47  ? -63.547  -71.383  34.985  1.00 4.53  ? 47  GLU D C   1 
ATOM   4380  O  O   . GLU D  1 47  ? -63.596  -72.571  34.747  1.00 4.11  ? 47  GLU D O   1 
ATOM   4381  C  CB  . GLU D  1 47  ? -61.672  -70.775  36.509  1.00 6.17  ? 47  GLU D CB  1 
ATOM   4382  C  CG  . GLU D  1 47  ? -60.203  -70.965  36.421  1.00 8.84  ? 47  GLU D CG  1 
ATOM   4383  C  CD  . GLU D  1 47  ? -59.478  -70.540  37.657  1.00 15.05 ? 47  GLU D CD  1 
ATOM   4384  O  OE1 . GLU D  1 47  ? -60.117  -69.990  38.625  1.00 16.97 ? 47  GLU D OE1 1 
ATOM   4385  O  OE2 . GLU D  1 47  ? -58.244  -70.763  37.636  1.00 18.37 ? 47  GLU D OE2 1 
ATOM   4386  N  N   . SER D  1 48  ? -64.627  -70.631  35.127  1.00 4.50  ? 48  SER D N   1 
ATOM   4387  C  CA  . SER D  1 48  ? -65.936  -71.129  34.769  1.00 4.17  ? 48  SER D CA  1 
ATOM   4388  C  C   . SER D  1 48  ? -66.016  -71.618  33.309  1.00 4.44  ? 48  SER D C   1 
ATOM   4389  O  O   . SER D  1 48  ? -66.533  -72.706  33.043  1.00 3.77  ? 48  SER D O   1 
ATOM   4390  C  CB  . SER D  1 48  ? -66.985  -70.056  35.023  1.00 3.80  ? 48  SER D CB  1 
ATOM   4391  O  OG  . SER D  1 48  ? -68.260  -70.654  35.081  1.00 4.39  ? 48  SER D OG  1 
ATOM   4392  N  N   . ILE D  1 49  ? -65.498  -70.822  32.362  1.00 4.74  ? 49  ILE D N   1 
ATOM   4393  C  CA  . ILE D  1 49  ? -65.451  -71.219  30.950  1.00 5.01  ? 49  ILE D CA  1 
ATOM   4394  C  C   . ILE D  1 49  ? -64.645  -72.492  30.829  1.00 5.42  ? 49  ILE D C   1 
ATOM   4395  O  O   . ILE D  1 49  ? -64.975  -73.389  30.058  1.00 5.54  ? 49  ILE D O   1 
ATOM   4396  C  CB  . ILE D  1 49  ? -64.814  -70.135  30.028  1.00 4.93  ? 49  ILE D CB  1 
ATOM   4397  C  CG1 . ILE D  1 49  ? -65.659  -68.848  29.953  1.00 5.40  ? 49  ILE D CG1 1 
ATOM   4398  C  CG2 . ILE D  1 49  ? -64.602  -70.665  28.629  1.00 4.00  ? 49  ILE D CG2 1 
ATOM   4399  C  CD1 . ILE D  1 49  ? -67.130  -69.016  30.180  1.00 6.07  ? 49  ILE D CD1 1 
ATOM   4400  N  N   . ASP D  1 50  ? -63.574  -72.580  31.604  1.00 5.92  ? 50  ASP D N   1 
ATOM   4401  C  CA  . ASP D  1 50  ? -62.747  -73.760  31.560  1.00 7.07  ? 50  ASP D CA  1 
ATOM   4402  C  C   . ASP D  1 50  ? -63.509  -75.033  31.939  1.00 6.83  ? 50  ASP D C   1 
ATOM   4403  O  O   . ASP D  1 50  ? -63.452  -76.043  31.233  1.00 6.69  ? 50  ASP D O   1 
ATOM   4404  C  CB  . ASP D  1 50  ? -61.550  -73.584  32.458  1.00 7.90  ? 50  ASP D CB  1 
ATOM   4405  C  CG  . ASP D  1 50  ? -60.312  -74.058  31.799  1.00 11.68 ? 50  ASP D CG  1 
ATOM   4406  O  OD1 . ASP D  1 50  ? -60.011  -73.431  30.761  1.00 14.90 ? 50  ASP D OD1 1 
ATOM   4407  O  OD2 . ASP D  1 50  ? -59.694  -75.061  32.264  1.00 15.62 ? 50  ASP D OD2 1 
ATOM   4408  N  N   . GLU D  1 51  ? -64.242  -74.965  33.035  1.00 6.21  ? 51  GLU D N   1 
ATOM   4409  C  CA  . GLU D  1 51  ? -64.964  -76.100  33.501  1.00 6.44  ? 51  GLU D CA  1 
ATOM   4410  C  C   . GLU D  1 51  ? -66.090  -76.471  32.545  1.00 6.09  ? 51  GLU D C   1 
ATOM   4411  O  O   . GLU D  1 51  ? -66.450  -77.655  32.438  1.00 5.07  ? 51  GLU D O   1 
ATOM   4412  C  CB  . GLU D  1 51  ? -65.452  -75.889  34.943  1.00 7.13  ? 51  GLU D CB  1 
ATOM   4413  C  CG  . GLU D  1 51  ? -64.351  -75.590  35.977  1.00 8.50  ? 51  GLU D CG  1 
ATOM   4414  C  CD  . GLU D  1 51  ? -63.165  -76.566  35.935  1.00 12.35 ? 51  GLU D CD  1 
ATOM   4415  O  OE1 . GLU D  1 51  ? -62.796  -77.146  36.980  1.00 15.24 ? 51  GLU D OE1 1 
ATOM   4416  O  OE2 . GLU D  1 51  ? -62.578  -76.752  34.866  1.00 15.31 ? 51  GLU D OE2 1 
ATOM   4417  N  N   . MET D  1 52  ? -66.627  -75.476  31.836  1.00 6.16  ? 52  MET D N   1 
ATOM   4418  C  CA  . MET D  1 52  ? -67.623  -75.747  30.805  1.00 6.43  ? 52  MET D CA  1 
ATOM   4419  C  C   . MET D  1 52  ? -67.036  -76.572  29.683  1.00 6.14  ? 52  MET D C   1 
ATOM   4420  O  O   . MET D  1 52  ? -67.680  -77.514  29.220  1.00 6.42  ? 52  MET D O   1 
ATOM   4421  C  CB  . MET D  1 52  ? -68.173  -74.473  30.208  1.00 6.27  ? 52  MET D CB  1 
ATOM   4422  C  CG  . MET D  1 52  ? -69.138  -73.747  31.078  1.00 6.98  ? 52  MET D CG  1 
ATOM   4423  S  SD  . MET D  1 52  ? -69.543  -72.139  30.377  1.00 9.62  ? 52  MET D SD  1 
ATOM   4424  C  CE  . MET D  1 52  ? -69.534  -71.171  31.916  1.00 8.41  ? 52  MET D CE  1 
ATOM   4425  N  N   . LYS D  1 53  ? -65.820  -76.225  29.253  1.00 5.71  ? 53  LYS D N   1 
ATOM   4426  C  CA  . LYS D  1 53  ? -65.133  -76.984  28.239  1.00 5.73  ? 53  LYS D CA  1 
ATOM   4427  C  C   . LYS D  1 53  ? -64.960  -78.436  28.670  1.00 5.68  ? 53  LYS D C   1 
ATOM   4428  O  O   . LYS D  1 53  ? -65.124  -79.357  27.883  1.00 5.91  ? 53  LYS D O   1 
ATOM   4429  C  CB  . LYS D  1 53  ? -63.782  -76.357  27.920  1.00 6.07  ? 53  LYS D CB  1 
ATOM   4430  C  CG  . LYS D  1 53  ? -63.861  -74.964  27.334  1.00 7.87  ? 53  LYS D CG  1 
ATOM   4431  C  CD  . LYS D  1 53  ? -62.614  -74.657  26.511  1.00 12.56 ? 53  LYS D CD  1 
ATOM   4432  C  CE  . LYS D  1 53  ? -62.194  -73.179  26.601  1.00 16.00 ? 53  LYS D CE  1 
ATOM   4433  N  NZ  . LYS D  1 53  ? -61.226  -72.811  25.508  1.00 18.00 ? 53  LYS D NZ  1 
ATOM   4434  N  N   . HIS D  1 54  ? -64.640  -78.636  29.937  1.00 5.71  ? 54  HIS D N   1 
ATOM   4435  C  CA  . HIS D  1 54  ? -64.492  -79.964  30.454  1.00 5.50  ? 54  HIS D CA  1 
ATOM   4436  C  C   . HIS D  1 54  ? -65.811  -80.740  30.433  1.00 4.99  ? 54  HIS D C   1 
ATOM   4437  O  O   . HIS D  1 54  ? -65.854  -81.884  29.979  1.00 4.82  ? 54  HIS D O   1 
ATOM   4438  C  CB  . HIS D  1 54  ? -63.902  -79.899  31.851  1.00 5.93  ? 54  HIS D CB  1 
ATOM   4439  C  CG  . HIS D  1 54  ? -62.528  -79.312  31.897  1.00 7.49  ? 54  HIS D CG  1 
ATOM   4440  N  ND1 . HIS D  1 54  ? -61.973  -78.820  33.058  1.00 10.41 ? 54  HIS D ND1 1 
ATOM   4441  C  CD2 . HIS D  1 54  ? -61.597  -79.147  30.932  1.00 7.86  ? 54  HIS D CD2 1 
ATOM   4442  C  CE1 . HIS D  1 54  ? -60.754  -78.386  32.803  1.00 10.35 ? 54  HIS D CE1 1 
ATOM   4443  N  NE2 . HIS D  1 54  ? -60.501  -78.583  31.521  1.00 7.89  ? 54  HIS D NE2 1 
ATOM   4444  N  N   . ALA D  1 55  ? -66.880  -80.106  30.899  1.00 4.14  ? 55  ALA D N   1 
ATOM   4445  C  CA  . ALA D  1 55  ? -68.193  -80.716  30.903  1.00 3.86  ? 55  ALA D CA  1 
ATOM   4446  C  C   . ALA D  1 55  ? -68.566  -81.162  29.488  1.00 4.14  ? 55  ALA D C   1 
ATOM   4447  O  O   . ALA D  1 55  ? -69.013  -82.301  29.269  1.00 4.20  ? 55  ALA D O   1 
ATOM   4448  C  CB  . ALA D  1 55  ? -69.217  -79.744  31.461  1.00 2.88  ? 55  ALA D CB  1 
ATOM   4449  N  N   . ASP D  1 56  ? -68.347  -80.267  28.527  1.00 3.90  ? 56  ASP D N   1 
ATOM   4450  C  CA  . ASP D  1 56  ? -68.601  -80.537  27.140  1.00 3.99  ? 56  ASP D CA  1 
ATOM   4451  C  C   . ASP D  1 56  ? -67.856  -81.814  26.719  1.00 4.33  ? 56  ASP D C   1 
ATOM   4452  O  O   . ASP D  1 56  ? -68.449  -82.719  26.122  1.00 5.27  ? 56  ASP D O   1 
ATOM   4453  C  CB  . ASP D  1 56  ? -68.165  -79.333  26.315  1.00 3.84  ? 56  ASP D CB  1 
ATOM   4454  C  CG  . ASP D  1 56  ? -68.623  -79.394  24.858  1.00 4.32  ? 56  ASP D CG  1 
ATOM   4455  O  OD1 . ASP D  1 56  ? -69.490  -80.217  24.498  1.00 3.87  ? 56  ASP D OD1 1 
ATOM   4456  O  OD2 . ASP D  1 56  ? -68.105  -78.598  24.045  1.00 4.96  ? 56  ASP D OD2 1 
ATOM   4457  N  N   . ARG D  1 57  ? -66.580  -81.923  27.056  1.00 3.74  ? 57  ARG D N   1 
ATOM   4458  C  CA  . ARG D  1 57  ? -65.813  -83.085  26.647  1.00 3.64  ? 57  ARG D CA  1 
ATOM   4459  C  C   . ARG D  1 57  ? -66.359  -84.387  27.262  1.00 2.87  ? 57  ARG D C   1 
ATOM   4460  O  O   . ARG D  1 57  ? -66.470  -85.396  26.557  1.00 2.21  ? 57  ARG D O   1 
ATOM   4461  C  CB  . ARG D  1 57  ? -64.320  -82.865  26.906  1.00 3.55  ? 57  ARG D CB  1 
ATOM   4462  C  CG  . ARG D  1 57  ? -63.720  -81.883  25.928  1.00 4.88  ? 57  ARG D CG  1 
ATOM   4463  C  CD  . ARG D  1 57  ? -62.269  -81.493  26.223  1.00 7.34  ? 57  ARG D CD  1 
ATOM   4464  N  NE  . ARG D  1 57  ? -61.265  -82.527  25.898  1.00 12.03 ? 57  ARG D NE  1 
ATOM   4465  C  CZ  . ARG D  1 57  ? -60.050  -82.597  26.491  1.00 14.26 ? 57  ARG D CZ  1 
ATOM   4466  N  NH1 . ARG D  1 57  ? -59.669  -81.679  27.414  1.00 12.22 ? 57  ARG D NH1 1 
ATOM   4467  N  NH2 . ARG D  1 57  ? -59.214  -83.596  26.171  1.00 12.01 ? 57  ARG D NH2 1 
ATOM   4468  N  N   . TYR D  1 58  ? -66.737  -84.355  28.546  1.00 2.23  ? 58  TYR D N   1 
ATOM   4469  C  CA  . TYR D  1 58  ? -67.375  -85.503  29.165  1.00 2.01  ? 58  TYR D CA  1 
ATOM   4470  C  C   . TYR D  1 58  ? -68.683  -85.887  28.459  1.00 2.07  ? 58  TYR D C   1 
ATOM   4471  O  O   . TYR D  1 58  ? -68.945  -87.063  28.179  1.00 2.00  ? 58  TYR D O   1 
ATOM   4472  C  CB  . TYR D  1 58  ? -67.648  -85.244  30.648  1.00 2.00  ? 58  TYR D CB  1 
ATOM   4473  C  CG  . TYR D  1 58  ? -66.412  -85.199  31.489  1.00 2.11  ? 58  TYR D CG  1 
ATOM   4474  C  CD1 . TYR D  1 58  ? -65.450  -86.207  31.404  1.00 2.91  ? 58  TYR D CD1 1 
ATOM   4475  C  CD2 . TYR D  1 58  ? -66.201  -84.158  32.380  1.00 2.00  ? 58  TYR D CD2 1 
ATOM   4476  C  CE1 . TYR D  1 58  ? -64.326  -86.172  32.163  1.00 2.00  ? 58  TYR D CE1 1 
ATOM   4477  C  CE2 . TYR D  1 58  ? -65.083  -84.115  33.139  1.00 2.00  ? 58  TYR D CE2 1 
ATOM   4478  C  CZ  . TYR D  1 58  ? -64.146  -85.136  33.032  1.00 2.00  ? 58  TYR D CZ  1 
ATOM   4479  O  OH  . TYR D  1 58  ? -63.005  -85.103  33.782  1.00 2.02  ? 58  TYR D OH  1 
ATOM   4480  N  N   . ILE D  1 59  ? -69.497  -84.875  28.188  1.00 2.04  ? 59  ILE D N   1 
ATOM   4481  C  CA  . ILE D  1 59  ? -70.820  -85.096  27.627  1.00 2.22  ? 59  ILE D CA  1 
ATOM   4482  C  C   . ILE D  1 59  ? -70.647  -85.780  26.288  1.00 2.81  ? 59  ILE D C   1 
ATOM   4483  O  O   . ILE D  1 59  ? -71.317  -86.752  26.008  1.00 3.47  ? 59  ILE D O   1 
ATOM   4484  C  CB  . ILE D  1 59  ? -71.644  -83.795  27.476  1.00 2.00  ? 59  ILE D CB  1 
ATOM   4485  C  CG1 . ILE D  1 59  ? -72.126  -83.332  28.839  1.00 2.00  ? 59  ILE D CG1 1 
ATOM   4486  C  CG2 . ILE D  1 59  ? -72.861  -84.017  26.623  1.00 2.00  ? 59  ILE D CG2 1 
ATOM   4487  C  CD1 . ILE D  1 59  ? -72.442  -81.840  28.914  1.00 2.00  ? 59  ILE D CD1 1 
ATOM   4488  N  N   . GLU D  1 60  ? -69.711  -85.298  25.481  1.00 2.88  ? 60  GLU D N   1 
ATOM   4489  C  CA  . GLU D  1 60  ? -69.524  -85.843  24.168  1.00 2.87  ? 60  GLU D CA  1 
ATOM   4490  C  C   . GLU D  1 60  ? -68.998  -87.230  24.212  1.00 2.58  ? 60  GLU D C   1 
ATOM   4491  O  O   . GLU D  1 60  ? -69.321  -88.054  23.356  1.00 3.16  ? 60  GLU D O   1 
ATOM   4492  C  CB  . GLU D  1 60  ? -68.626  -84.945  23.335  1.00 2.85  ? 60  GLU D CB  1 
ATOM   4493  C  CG  . GLU D  1 60  ? -69.377  -83.687  22.939  1.00 5.16  ? 60  GLU D CG  1 
ATOM   4494  C  CD  . GLU D  1 60  ? -68.555  -82.762  22.102  1.00 7.99  ? 60  GLU D CD  1 
ATOM   4495  O  OE1 . GLU D  1 60  ? -69.079  -81.726  21.625  1.00 9.04  ? 60  GLU D OE1 1 
ATOM   4496  O  OE2 . GLU D  1 60  ? -67.363  -83.065  21.918  1.00 10.79 ? 60  GLU D OE2 1 
ATOM   4497  N  N   . ARG D  1 61  ? -68.181  -87.495  25.214  1.00 2.76  ? 61  ARG D N   1 
ATOM   4498  C  CA  . ARG D  1 61  ? -67.550  -88.786  25.338  1.00 2.57  ? 61  ARG D CA  1 
ATOM   4499  C  C   . ARG D  1 61  ? -68.579  -89.806  25.831  1.00 2.85  ? 61  ARG D C   1 
ATOM   4500  O  O   . ARG D  1 61  ? -68.693  -90.896  25.242  1.00 2.55  ? 61  ARG D O   1 
ATOM   4501  C  CB  . ARG D  1 61  ? -66.320  -88.688  26.248  1.00 2.62  ? 61  ARG D CB  1 
ATOM   4502  C  CG  . ARG D  1 61  ? -65.520  -89.960  26.387  1.00 2.07  ? 61  ARG D CG  1 
ATOM   4503  C  CD  . ARG D  1 61  ? -64.712  -90.288  25.144  1.00 2.34  ? 61  ARG D CD  1 
ATOM   4504  N  NE  . ARG D  1 61  ? -64.118  -91.588  25.317  1.00 3.06  ? 61  ARG D NE  1 
ATOM   4505  C  CZ  . ARG D  1 61  ? -63.576  -92.317  24.359  1.00 5.06  ? 61  ARG D CZ  1 
ATOM   4506  N  NH1 . ARG D  1 61  ? -63.529  -91.866  23.111  1.00 3.74  ? 61  ARG D NH1 1 
ATOM   4507  N  NH2 . ARG D  1 61  ? -63.074  -93.515  24.673  1.00 4.57  ? 61  ARG D NH2 1 
ATOM   4508  N  N   . ILE D  1 62  ? -69.344  -89.453  26.875  1.00 2.54  ? 62  ILE D N   1 
ATOM   4509  C  CA  . ILE D  1 62  ? -70.426  -90.314  27.352  1.00 2.42  ? 62  ILE D CA  1 
ATOM   4510  C  C   . ILE D  1 62  ? -71.349  -90.691  26.196  1.00 2.79  ? 62  ILE D C   1 
ATOM   4511  O  O   . ILE D  1 62  ? -71.744  -91.864  26.049  1.00 2.88  ? 62  ILE D O   1 
ATOM   4512  C  CB  . ILE D  1 62  ? -71.235  -89.671  28.495  1.00 2.15  ? 62  ILE D CB  1 
ATOM   4513  C  CG1 . ILE D  1 62  ? -70.344  -89.500  29.730  1.00 3.15  ? 62  ILE D CG1 1 
ATOM   4514  C  CG2 . ILE D  1 62  ? -72.390  -90.526  28.876  1.00 2.00  ? 62  ILE D CG2 1 
ATOM   4515  C  CD1 . ILE D  1 62  ? -70.978  -88.732  30.851  1.00 2.03  ? 62  ILE D CD1 1 
ATOM   4516  N  N   . LEU D  1 63  ? -71.669  -89.709  25.367  1.00 2.49  ? 63  LEU D N   1 
ATOM   4517  C  CA  . LEU D  1 63  ? -72.591  -89.919  24.270  1.00 2.78  ? 63  LEU D CA  1 
ATOM   4518  C  C   . LEU D  1 63  ? -71.961  -90.862  23.267  1.00 3.14  ? 63  LEU D C   1 
ATOM   4519  O  O   . LEU D  1 63  ? -72.621  -91.789  22.778  1.00 3.75  ? 63  LEU D O   1 
ATOM   4520  C  CB  . LEU D  1 63  ? -72.965  -88.590  23.616  1.00 2.67  ? 63  LEU D CB  1 
ATOM   4521  C  CG  . LEU D  1 63  ? -74.329  -87.923  23.798  1.00 2.02  ? 63  LEU D CG  1 
ATOM   4522  C  CD1 . LEU D  1 63  ? -75.241  -88.540  24.778  1.00 2.00  ? 63  LEU D CD1 1 
ATOM   4523  C  CD2 . LEU D  1 63  ? -74.133  -86.459  24.059  1.00 2.01  ? 63  LEU D CD2 1 
ATOM   4524  N  N   . PHE D  1 64  ? -70.670  -90.661  23.000  1.00 3.09  ? 64  PHE D N   1 
ATOM   4525  C  CA  . PHE D  1 64  ? -69.988  -91.505  22.037  1.00 3.10  ? 64  PHE D CA  1 
ATOM   4526  C  C   . PHE D  1 64  ? -69.982  -92.938  22.530  1.00 3.30  ? 64  PHE D C   1 
ATOM   4527  O  O   . PHE D  1 64  ? -70.217  -93.866  21.735  1.00 4.30  ? 64  PHE D O   1 
ATOM   4528  C  CB  . PHE D  1 64  ? -68.552  -91.041  21.770  1.00 2.48  ? 64  PHE D CB  1 
ATOM   4529  C  CG  . PHE D  1 64  ? -67.739  -92.044  20.999  1.00 2.05  ? 64  PHE D CG  1 
ATOM   4530  C  CD1 . PHE D  1 64  ? -68.100  -92.422  19.715  1.00 2.00  ? 64  PHE D CD1 1 
ATOM   4531  C  CD2 . PHE D  1 64  ? -66.607  -92.614  21.565  1.00 3.21  ? 64  PHE D CD2 1 
ATOM   4532  C  CE1 . PHE D  1 64  ? -67.348  -93.342  19.000  1.00 2.00  ? 64  PHE D CE1 1 
ATOM   4533  C  CE2 . PHE D  1 64  ? -65.834  -93.534  20.849  1.00 2.00  ? 64  PHE D CE2 1 
ATOM   4534  C  CZ  . PHE D  1 64  ? -66.208  -93.896  19.558  1.00 2.00  ? 64  PHE D CZ  1 
ATOM   4535  N  N   . LEU D  1 65  ? -69.727  -93.093  23.832  1.00 2.41  ? 65  LEU D N   1 
ATOM   4536  C  CA  . LEU D  1 65  ? -69.656  -94.390  24.462  1.00 2.23  ? 65  LEU D CA  1 
ATOM   4537  C  C   . LEU D  1 65  ? -71.040  -94.997  24.690  1.00 2.28  ? 65  LEU D C   1 
ATOM   4538  O  O   . LEU D  1 65  ? -71.161  -96.064  25.288  1.00 2.14  ? 65  LEU D O   1 
ATOM   4539  C  CB  . LEU D  1 65  ? -68.915  -94.297  25.793  1.00 2.24  ? 65  LEU D CB  1 
ATOM   4540  C  CG  . LEU D  1 65  ? -67.443  -93.974  25.674  1.00 2.33  ? 65  LEU D CG  1 
ATOM   4541  C  CD1 . LEU D  1 65  ? -66.794  -93.955  27.044  1.00 2.01  ? 65  LEU D CD1 1 
ATOM   4542  C  CD2 . LEU D  1 65  ? -66.760  -94.960  24.694  1.00 2.00  ? 65  LEU D CD2 1 
ATOM   4543  N  N   . GLU D  1 66  ? -72.064  -94.292  24.229  1.00 2.35  ? 66  GLU D N   1 
ATOM   4544  C  CA  . GLU D  1 66  ? -73.473  -94.711  24.301  1.00 3.41  ? 66  GLU D CA  1 
ATOM   4545  C  C   . GLU D  1 66  ? -74.099  -94.719  25.701  1.00 2.98  ? 66  GLU D C   1 
ATOM   4546  O  O   . GLU D  1 66  ? -74.982  -95.500  25.949  1.00 3.12  ? 66  GLU D O   1 
ATOM   4547  C  CB  . GLU D  1 66  ? -73.708  -96.027  23.549  1.00 2.95  ? 66  GLU D CB  1 
ATOM   4548  C  CG  . GLU D  1 66  ? -73.321  -95.923  22.060  1.00 6.17  ? 66  GLU D CG  1 
ATOM   4549  C  CD  . GLU D  1 66  ? -73.367  -97.235  21.275  1.00 5.85  ? 66  GLU D CD  1 
ATOM   4550  O  OE1 . GLU D  1 66  ? -74.240  -98.084  21.568  1.00 11.40 ? 66  GLU D OE1 1 
ATOM   4551  O  OE2 . GLU D  1 66  ? -72.552  -97.393  20.336  1.00 6.68  ? 66  GLU D OE2 1 
ATOM   4552  N  N   . GLY D  1 67  ? -73.660  -93.831  26.588  1.00 2.84  ? 67  GLY D N   1 
ATOM   4553  C  CA  . GLY D  1 67  ? -74.298  -93.665  27.890  1.00 3.02  ? 67  GLY D CA  1 
ATOM   4554  C  C   . GLY D  1 67  ? -75.142  -92.403  27.933  1.00 4.24  ? 67  GLY D C   1 
ATOM   4555  O  O   . GLY D  1 67  ? -75.235  -91.660  26.938  1.00 4.50  ? 67  GLY D O   1 
ATOM   4556  N  N   . LEU D  1 68  ? -75.774  -92.159  29.078  1.00 4.23  ? 68  LEU D N   1 
ATOM   4557  C  CA  . LEU D  1 68  ? -76.686  -91.037  29.257  1.00 4.20  ? 68  LEU D CA  1 
ATOM   4558  C  C   . LEU D  1 68  ? -76.035  -89.986  30.145  1.00 3.80  ? 68  LEU D C   1 
ATOM   4559  O  O   . LEU D  1 68  ? -75.888  -90.196  31.332  1.00 3.74  ? 68  LEU D O   1 
ATOM   4560  C  CB  . LEU D  1 68  ? -77.932  -91.541  29.956  1.00 4.21  ? 68  LEU D CB  1 
ATOM   4561  C  CG  . LEU D  1 68  ? -79.204  -92.027  29.236  1.00 6.83  ? 68  LEU D CG  1 
ATOM   4562  C  CD1 . LEU D  1 68  ? -79.129  -92.056  27.691  1.00 5.19  ? 68  LEU D CD1 1 
ATOM   4563  C  CD2 . LEU D  1 68  ? -79.657  -93.388  29.843  1.00 6.26  ? 68  LEU D CD2 1 
ATOM   4564  N  N   . PRO D  1 69  ? -75.614  -88.854  29.567  1.00 3.50  ? 69  PRO D N   1 
ATOM   4565  C  CA  . PRO D  1 69  ? -75.012  -87.823  30.417  1.00 3.09  ? 69  PRO D CA  1 
ATOM   4566  C  C   . PRO D  1 69  ? -76.038  -87.329  31.423  1.00 3.61  ? 69  PRO D C   1 
ATOM   4567  O  O   . PRO D  1 69  ? -77.214  -87.145  31.089  1.00 3.62  ? 69  PRO D O   1 
ATOM   4568  C  CB  . PRO D  1 69  ? -74.639  -86.700  29.434  1.00 2.04  ? 69  PRO D CB  1 
ATOM   4569  C  CG  . PRO D  1 69  ? -74.624  -87.312  28.147  1.00 2.01  ? 69  PRO D CG  1 
ATOM   4570  C  CD  . PRO D  1 69  ? -75.628  -88.444  28.155  1.00 2.80  ? 69  PRO D CD  1 
ATOM   4571  N  N   . ASN D  1 70  ? -75.585  -87.139  32.657  1.00 4.06  ? 70  ASN D N   1 
ATOM   4572  C  CA  . ASN D  1 70  ? -76.458  -86.738  33.736  1.00 4.43  ? 70  ASN D CA  1 
ATOM   4573  C  C   . ASN D  1 70  ? -76.186  -85.288  34.088  1.00 4.77  ? 70  ASN D C   1 
ATOM   4574  O  O   . ASN D  1 70  ? -75.191  -84.992  34.728  1.00 5.53  ? 70  ASN D O   1 
ATOM   4575  C  CB  . ASN D  1 70  ? -76.193  -87.622  34.941  1.00 4.03  ? 70  ASN D CB  1 
ATOM   4576  C  CG  . ASN D  1 70  ? -77.123  -87.333  36.083  1.00 5.27  ? 70  ASN D CG  1 
ATOM   4577  O  OD1 . ASN D  1 70  ? -77.931  -86.398  36.041  1.00 6.71  ? 70  ASN D OD1 1 
ATOM   4578  N  ND2 . ASN D  1 70  ? -77.016  -88.135  37.126  1.00 4.50  ? 70  ASN D ND2 1 
ATOM   4579  N  N   . LEU D  1 71  ? -77.060  -84.397  33.655  1.00 4.71  ? 71  LEU D N   1 
ATOM   4580  C  CA  . LEU D  1 71  ? -76.985  -82.998  34.019  1.00 4.83  ? 71  LEU D CA  1 
ATOM   4581  C  C   . LEU D  1 71  ? -78.083  -82.613  35.031  1.00 6.09  ? 71  LEU D C   1 
ATOM   4582  O  O   . LEU D  1 71  ? -78.309  -81.444  35.313  1.00 6.80  ? 71  LEU D O   1 
ATOM   4583  C  CB  . LEU D  1 71  ? -77.108  -82.155  32.772  1.00 4.05  ? 71  LEU D CB  1 
ATOM   4584  C  CG  . LEU D  1 71  ? -75.825  -82.033  31.938  1.00 4.62  ? 71  LEU D CG  1 
ATOM   4585  C  CD1 . LEU D  1 71  ? -75.677  -83.177  30.996  1.00 3.72  ? 71  LEU D CD1 1 
ATOM   4586  C  CD2 . LEU D  1 71  ? -75.762  -80.705  31.169  1.00 2.87  ? 71  LEU D CD2 1 
ATOM   4587  N  N   . GLN D  1 72  ? -78.788  -83.607  35.563  1.00 7.05  ? 72  GLN D N   1 
ATOM   4588  C  CA  . GLN D  1 72  ? -79.933  -83.356  36.403  1.00 7.64  ? 72  GLN D CA  1 
ATOM   4589  C  C   . GLN D  1 72  ? -79.455  -83.164  37.813  1.00 8.19  ? 72  GLN D C   1 
ATOM   4590  O  O   . GLN D  1 72  ? -79.915  -82.257  38.483  1.00 8.83  ? 72  GLN D O   1 
ATOM   4591  C  CB  . GLN D  1 72  ? -80.941  -84.502  36.324  1.00 7.94  ? 72  GLN D CB  1 
ATOM   4592  C  CG  . GLN D  1 72  ? -82.121  -84.384  37.298  1.00 9.00  ? 72  GLN D CG  1 
ATOM   4593  C  CD  . GLN D  1 72  ? -83.022  -83.218  36.952  1.00 11.25 ? 72  GLN D CD  1 
ATOM   4594  O  OE1 . GLN D  1 72  ? -83.876  -83.303  36.030  1.00 12.92 ? 72  GLN D OE1 1 
ATOM   4595  N  NE2 . GLN D  1 72  ? -82.826  -82.097  37.658  1.00 7.90  ? 72  GLN D NE2 1 
ATOM   4596  N  N   . ASP D  1 73  ? -78.525  -83.996  38.269  1.00 8.82  ? 73  ASP D N   1 
ATOM   4597  C  CA  . ASP D  1 73  ? -78.109  -83.953  39.683  1.00 9.65  ? 73  ASP D CA  1 
ATOM   4598  C  C   . ASP D  1 73  ? -76.980  -82.956  39.847  1.00 10.10 ? 73  ASP D C   1 
ATOM   4599  O  O   . ASP D  1 73  ? -76.008  -82.959  39.055  1.00 12.23 ? 73  ASP D O   1 
ATOM   4600  C  CB  . ASP D  1 73  ? -77.704  -85.347  40.183  1.00 9.48  ? 73  ASP D CB  1 
ATOM   4601  C  CG  . ASP D  1 73  ? -78.833  -86.372  39.994  1.00 11.90 ? 73  ASP D CG  1 
ATOM   4602  O  OD1 . ASP D  1 73  ? -80.032  -85.999  40.196  1.00 13.93 ? 73  ASP D OD1 1 
ATOM   4603  O  OD2 . ASP D  1 73  ? -78.536  -87.529  39.606  1.00 12.37 ? 73  ASP D OD2 1 
ATOM   4604  N  N   . LEU D  1 74  ? -77.112  -82.082  40.845  1.00 9.56  ? 74  LEU D N   1 
ATOM   4605  C  CA  . LEU D  1 74  ? -76.111  -81.059  41.111  1.00 8.33  ? 74  LEU D CA  1 
ATOM   4606  C  C   . LEU D  1 74  ? -75.661  -81.173  42.565  1.00 8.41  ? 74  LEU D C   1 
ATOM   4607  O  O   . LEU D  1 74  ? -76.477  -81.032  43.468  1.00 8.69  ? 74  LEU D O   1 
ATOM   4608  C  CB  . LEU D  1 74  ? -76.694  -79.671  40.838  1.00 7.91  ? 74  LEU D CB  1 
ATOM   4609  C  CG  . LEU D  1 74  ? -75.706  -78.485  40.789  1.00 7.54  ? 74  LEU D CG  1 
ATOM   4610  C  CD1 . LEU D  1 74  ? -74.654  -78.626  39.704  1.00 4.11  ? 74  LEU D CD1 1 
ATOM   4611  C  CD2 . LEU D  1 74  ? -76.418  -77.137  40.635  1.00 7.42  ? 74  LEU D CD2 1 
ATOM   4612  N  N   . GLY D  1 75  ? -74.364  -81.413  42.781  1.00 8.32  ? 75  GLY D N   1 
ATOM   4613  C  CA  . GLY D  1 75  ? -73.783  -81.523  44.116  1.00 8.42  ? 75  GLY D CA  1 
ATOM   4614  C  C   . GLY D  1 75  ? -73.802  -80.248  44.934  1.00 9.35  ? 75  GLY D C   1 
ATOM   4615  O  O   . GLY D  1 75  ? -74.251  -79.202  44.465  1.00 9.29  ? 75  GLY D O   1 
ATOM   4616  N  N   . LYS D  1 76  ? -73.321  -80.333  46.176  1.00 10.20 ? 76  LYS D N   1 
ATOM   4617  C  CA  . LYS D  1 76  ? -73.323  -79.167  47.058  1.00 11.65 ? 76  LYS D CA  1 
ATOM   4618  C  C   . LYS D  1 76  ? -72.357  -78.076  46.589  1.00 10.51 ? 76  LYS D C   1 
ATOM   4619  O  O   . LYS D  1 76  ? -71.141  -78.310  46.453  1.00 10.81 ? 76  LYS D O   1 
ATOM   4620  C  CB  . LYS D  1 76  ? -73.089  -79.518  48.552  1.00 11.55 ? 76  LYS D CB  1 
ATOM   4621  C  CG  . LYS D  1 76  ? -73.649  -78.373  49.469  1.00 15.46 ? 76  LYS D CG  1 
ATOM   4622  C  CD  . LYS D  1 76  ? -73.429  -78.561  51.003  1.00 15.68 ? 76  LYS D CD  1 
ATOM   4623  C  CE  . LYS D  1 76  ? -73.688  -77.227  51.811  1.00 18.62 ? 76  LYS D CE  1 
ATOM   4624  N  NZ  . LYS D  1 76  ? -73.307  -77.387  53.315  1.00 20.34 ? 76  LYS D NZ  1 
ATOM   4625  N  N   . LEU D  1 77  ? -72.920  -76.902  46.325  1.00 9.97  ? 77  LEU D N   1 
ATOM   4626  C  CA  . LEU D  1 77  ? -72.159  -75.642  46.219  1.00 9.42  ? 77  LEU D CA  1 
ATOM   4627  C  C   . LEU D  1 77  ? -71.811  -75.149  47.599  1.00 9.34  ? 77  LEU D C   1 
ATOM   4628  O  O   . LEU D  1 77  ? -72.602  -75.284  48.521  1.00 9.90  ? 77  LEU D O   1 
ATOM   4629  C  CB  . LEU D  1 77  ? -73.040  -74.577  45.554  1.00 9.20  ? 77  LEU D CB  1 
ATOM   4630  C  CG  . LEU D  1 77  ? -72.868  -74.215  44.082  1.00 8.99  ? 77  LEU D CG  1 
ATOM   4631  C  CD1 . LEU D  1 77  ? -72.812  -75.472  43.239  1.00 7.32  ? 77  LEU D CD1 1 
ATOM   4632  C  CD2 . LEU D  1 77  ? -74.044  -73.381  43.699  1.00 9.55  ? 77  LEU D CD2 1 
ATOM   4633  N  N   . ASN D  1 78  ? -70.638  -74.581  47.770  1.00 9.49  ? 78  ASN D N   1 
ATOM   4634  C  CA  . ASN D  1 78  ? -70.312  -73.910  49.037  1.00 9.47  ? 78  ASN D CA  1 
ATOM   4635  C  C   . ASN D  1 78  ? -69.768  -72.551  48.641  1.00 9.25  ? 78  ASN D C   1 
ATOM   4636  O  O   . ASN D  1 78  ? -68.678  -72.463  48.081  1.00 9.74  ? 78  ASN D O   1 
ATOM   4637  C  CB  . ASN D  1 78  ? -69.329  -74.736  49.884  1.00 9.39  ? 78  ASN D CB  1 
ATOM   4638  C  CG  . ASN D  1 78  ? -68.858  -74.000  51.162  1.00 12.25 ? 78  ASN D CG  1 
ATOM   4639  O  OD1 . ASN D  1 78  ? -69.417  -72.966  51.568  1.00 13.90 ? 78  ASN D OD1 1 
ATOM   4640  N  ND2 . ASN D  1 78  ? -67.813  -74.549  51.802  1.00 12.55 ? 78  ASN D ND2 1 
ATOM   4641  N  N   . ILE D  1 79  ? -70.576  -71.508  48.854  1.00 8.80  ? 79  ILE D N   1 
ATOM   4642  C  CA  . ILE D  1 79  ? -70.301  -70.194  48.260  1.00 8.26  ? 79  ILE D CA  1 
ATOM   4643  C  C   . ILE D  1 79  ? -69.350  -69.366  49.108  1.00 8.75  ? 79  ILE D C   1 
ATOM   4644  O  O   . ILE D  1 79  ? -68.318  -68.932  48.596  1.00 9.21  ? 79  ILE D O   1 
ATOM   4645  C  CB  . ILE D  1 79  ? -71.576  -69.380  47.968  1.00 8.12  ? 79  ILE D CB  1 
ATOM   4646  C  CG1 . ILE D  1 79  ? -72.546  -70.173  47.072  1.00 7.62  ? 79  ILE D CG1 1 
ATOM   4647  C  CG2 . ILE D  1 79  ? -71.213  -68.061  47.343  1.00 7.77  ? 79  ILE D CG2 1 
ATOM   4648  C  CD1 . ILE D  1 79  ? -71.927  -70.740  45.753  1.00 5.74  ? 79  ILE D CD1 1 
ATOM   4649  N  N   . GLY D  1 80  ? -69.669  -69.170  50.389  1.00 8.39  ? 80  GLY D N   1 
ATOM   4650  C  CA  . GLY D  1 80  ? -68.781  -68.406  51.259  1.00 8.55  ? 80  GLY D CA  1 
ATOM   4651  C  C   . GLY D  1 80  ? -69.150  -66.932  51.187  1.00 9.10  ? 80  GLY D C   1 
ATOM   4652  O  O   . GLY D  1 80  ? -69.848  -66.516  50.258  1.00 9.08  ? 80  GLY D O   1 
ATOM   4653  N  N   . GLU D  1 81  ? -68.709  -66.133  52.158  1.00 9.32  ? 81  GLU D N   1 
ATOM   4654  C  CA  . GLU D  1 81  ? -69.172  -64.756  52.200  1.00 10.14 ? 81  GLU D CA  1 
ATOM   4655  C  C   . GLU D  1 81  ? -68.059  -63.732  52.002  1.00 9.38  ? 81  GLU D C   1 
ATOM   4656  O  O   . GLU D  1 81  ? -68.360  -62.572  51.765  1.00 10.32 ? 81  GLU D O   1 
ATOM   4657  C  CB  . GLU D  1 81  ? -69.966  -64.470  53.488  1.00 9.64  ? 81  GLU D CB  1 
ATOM   4658  C  CG  . GLU D  1 81  ? -71.274  -65.309  53.660  1.00 12.24 ? 81  GLU D CG  1 
ATOM   4659  C  CD  . GLU D  1 81  ? -71.713  -65.428  55.164  1.00 15.06 ? 81  GLU D CD  1 
ATOM   4660  O  OE1 . GLU D  1 81  ? -70.879  -65.819  56.036  1.00 20.82 ? 81  GLU D OE1 1 
ATOM   4661  O  OE2 . GLU D  1 81  ? -72.888  -65.130  55.494  1.00 19.49 ? 81  GLU D OE2 1 
ATOM   4662  N  N   . ASP D  1 82  ? -66.787  -64.142  52.126  1.00 8.73  ? 82  ASP D N   1 
ATOM   4663  C  CA  . ASP D  1 82  ? -65.622  -63.262  51.863  1.00 7.39  ? 82  ASP D CA  1 
ATOM   4664  C  C   . ASP D  1 82  ? -64.577  -63.929  50.956  1.00 6.42  ? 82  ASP D C   1 
ATOM   4665  O  O   . ASP D  1 82  ? -64.600  -65.131  50.772  1.00 6.36  ? 82  ASP D O   1 
ATOM   4666  C  CB  . ASP D  1 82  ? -64.967  -62.776  53.160  1.00 7.30  ? 82  ASP D CB  1 
ATOM   4667  C  CG  . ASP D  1 82  ? -64.491  -63.904  54.045  1.00 10.32 ? 82  ASP D CG  1 
ATOM   4668  O  OD1 . ASP D  1 82  ? -64.952  -63.963  55.195  1.00 16.59 ? 82  ASP D OD1 1 
ATOM   4669  O  OD2 . ASP D  1 82  ? -63.671  -64.736  53.634  1.00 12.02 ? 82  ASP D OD2 1 
ATOM   4670  N  N   . VAL D  1 83  ? -63.650  -63.137  50.421  1.00 5.65  ? 83  VAL D N   1 
ATOM   4671  C  CA  . VAL D  1 83  ? -62.670  -63.596  49.429  1.00 4.95  ? 83  VAL D CA  1 
ATOM   4672  C  C   . VAL D  1 83  ? -61.968  -64.886  49.813  1.00 5.05  ? 83  VAL D C   1 
ATOM   4673  O  O   . VAL D  1 83  ? -62.023  -65.875  49.053  1.00 5.08  ? 83  VAL D O   1 
ATOM   4674  C  CB  . VAL D  1 83  ? -61.617  -62.507  49.135  1.00 4.71  ? 83  VAL D CB  1 
ATOM   4675  C  CG1 . VAL D  1 83  ? -60.654  -62.952  48.062  1.00 4.01  ? 83  VAL D CG1 1 
ATOM   4676  C  CG2 . VAL D  1 83  ? -62.320  -61.253  48.695  1.00 4.70  ? 83  VAL D CG2 1 
ATOM   4677  N  N   . GLU D  1 84  ? -61.309  -64.880  50.970  1.00 4.69  ? 84  GLU D N   1 
ATOM   4678  C  CA  . GLU D  1 84  ? -60.609  -66.068  51.454  1.00 5.41  ? 84  GLU D CA  1 
ATOM   4679  C  C   . GLU D  1 84  ? -61.531  -67.293  51.484  1.00 5.71  ? 84  GLU D C   1 
ATOM   4680  O  O   . GLU D  1 84  ? -61.234  -68.333  50.888  1.00 5.75  ? 84  GLU D O   1 
ATOM   4681  C  CB  . GLU D  1 84  ? -60.023  -65.836  52.841  1.00 5.53  ? 84  GLU D CB  1 
ATOM   4682  C  CG  . GLU D  1 84  ? -58.693  -66.541  53.021  1.00 9.21  ? 84  GLU D CG  1 
ATOM   4683  C  CD  . GLU D  1 84  ? -58.287  -66.718  54.484  1.00 13.97 ? 84  GLU D CD  1 
ATOM   4684  O  OE1 . GLU D  1 84  ? -58.382  -65.719  55.258  1.00 16.29 ? 84  GLU D OE1 1 
ATOM   4685  O  OE2 . GLU D  1 84  ? -57.870  -67.862  54.854  1.00 13.51 ? 84  GLU D OE2 1 
ATOM   4686  N  N   . GLU D  1 85  ? -62.658  -67.160  52.159  1.00 5.73  ? 85  GLU D N   1 
ATOM   4687  C  CA  . GLU D  1 85  ? -63.607  -68.237  52.290  1.00 6.73  ? 85  GLU D CA  1 
ATOM   4688  C  C   . GLU D  1 85  ? -63.982  -68.729  50.884  1.00 5.74  ? 85  GLU D C   1 
ATOM   4689  O  O   . GLU D  1 85  ? -64.068  -69.948  50.620  1.00 5.39  ? 85  GLU D O   1 
ATOM   4690  C  CB  . GLU D  1 85  ? -64.821  -67.688  53.015  1.00 6.72  ? 85  GLU D CB  1 
ATOM   4691  C  CG  . GLU D  1 85  ? -65.541  -68.595  53.987  1.00 9.95  ? 85  GLU D CG  1 
ATOM   4692  C  CD  . GLU D  1 85  ? -66.487  -67.781  54.935  1.00 11.75 ? 85  GLU D CD  1 
ATOM   4693  O  OE1 . GLU D  1 85  ? -66.027  -66.755  55.532  1.00 15.07 ? 85  GLU D OE1 1 
ATOM   4694  O  OE2 . GLU D  1 85  ? -67.688  -68.169  55.079  1.00 16.81 ? 85  GLU D OE2 1 
ATOM   4695  N  N   . MET D  1 86  ? -64.169  -67.804  49.956  1.00 4.94  ? 86  MET D N   1 
ATOM   4696  C  CA  . MET D  1 86  ? -64.619  -68.263  48.661  1.00 5.01  ? 86  MET D CA  1 
ATOM   4697  C  C   . MET D  1 86  ? -63.513  -68.921  47.861  1.00 4.97  ? 86  MET D C   1 
ATOM   4698  O  O   . MET D  1 86  ? -63.726  -69.923  47.174  1.00 5.53  ? 86  MET D O   1 
ATOM   4699  C  CB  . MET D  1 86  ? -65.515  -67.277  47.852  1.00 4.77  ? 86  MET D CB  1 
ATOM   4700  C  CG  . MET D  1 86  ? -65.156  -65.855  47.904  1.00 6.71  ? 86  MET D CG  1 
ATOM   4701  S  SD  . MET D  1 86  ? -66.543  -64.720  47.742  1.00 4.95  ? 86  MET D SD  1 
ATOM   4702  C  CE  . MET D  1 86  ? -66.781  -64.620  45.978  1.00 3.21  ? 86  MET D CE  1 
ATOM   4703  N  N   . LEU D  1 87  ? -62.307  -68.393  47.991  1.00 4.80  ? 87  LEU D N   1 
ATOM   4704  C  CA  . LEU D  1 87  ? -61.190  -68.990  47.303  1.00 3.92  ? 87  LEU D CA  1 
ATOM   4705  C  C   . LEU D  1 87  ? -60.925  -70.378  47.866  1.00 4.03  ? 87  LEU D C   1 
ATOM   4706  O  O   . LEU D  1 87  ? -60.711  -71.337  47.112  1.00 4.40  ? 87  LEU D O   1 
ATOM   4707  C  CB  . LEU D  1 87  ? -59.993  -68.076  47.410  1.00 3.57  ? 87  LEU D CB  1 
ATOM   4708  C  CG  . LEU D  1 87  ? -59.594  -67.233  46.179  1.00 3.37  ? 87  LEU D CG  1 
ATOM   4709  C  CD1 . LEU D  1 87  ? -60.719  -66.857  45.242  1.00 2.57  ? 87  LEU D CD1 1 
ATOM   4710  C  CD2 . LEU D  1 87  ? -58.893  -66.006  46.664  1.00 4.16  ? 87  LEU D CD2 1 
ATOM   4711  N  N   . ARG D  1 88  ? -60.997  -70.493  49.186  1.00 4.01  ? 88  ARG D N   1 
ATOM   4712  C  CA  . ARG D  1 88  ? -60.709  -71.733  49.886  1.00 4.83  ? 88  ARG D CA  1 
ATOM   4713  C  C   . ARG D  1 88  ? -61.733  -72.768  49.452  1.00 4.68  ? 88  ARG D C   1 
ATOM   4714  O  O   . ARG D  1 88  ? -61.442  -73.945  49.303  1.00 5.46  ? 88  ARG D O   1 
ATOM   4715  C  CB  . ARG D  1 88  ? -60.791  -71.499  51.399  1.00 4.23  ? 88  ARG D CB  1 
ATOM   4716  C  CG  . ARG D  1 88  ? -59.605  -71.948  52.177  1.00 5.35  ? 88  ARG D CG  1 
ATOM   4717  C  CD  . ARG D  1 88  ? -59.611  -71.458  53.636  1.00 7.14  ? 88  ARG D CD  1 
ATOM   4718  N  NE  . ARG D  1 88  ? -58.531  -70.494  53.929  1.00 13.57 ? 88  ARG D NE  1 
ATOM   4719  C  CZ  . ARG D  1 88  ? -57.204  -70.741  53.771  1.00 14.70 ? 88  ARG D CZ  1 
ATOM   4720  N  NH1 . ARG D  1 88  ? -56.743  -71.916  53.291  1.00 13.83 ? 88  ARG D NH1 1 
ATOM   4721  N  NH2 . ARG D  1 88  ? -56.321  -69.797  54.062  1.00 13.12 ? 88  ARG D NH2 1 
ATOM   4722  N  N   . SER D  1 89  ? -62.945  -72.319  49.217  1.00 4.67  ? 89  SER D N   1 
ATOM   4723  C  CA  . SER D  1 89  ? -63.992  -73.262  48.855  1.00 4.21  ? 89  SER D CA  1 
ATOM   4724  C  C   . SER D  1 89  ? -63.790  -73.831  47.445  1.00 4.51  ? 89  SER D C   1 
ATOM   4725  O  O   . SER D  1 89  ? -64.013  -75.022  47.225  1.00 4.75  ? 89  SER D O   1 
ATOM   4726  C  CB  . SER D  1 89  ? -65.356  -72.587  48.985  1.00 4.09  ? 89  SER D CB  1 
ATOM   4727  O  OG  . SER D  1 89  ? -66.367  -73.459  48.547  1.00 3.50  ? 89  SER D OG  1 
ATOM   4728  N  N   . ASP D  1 90  ? -63.365  -72.975  46.502  1.00 3.90  ? 90  ASP D N   1 
ATOM   4729  C  CA  . ASP D  1 90  ? -62.998  -73.417  45.164  1.00 3.83  ? 90  ASP D CA  1 
ATOM   4730  C  C   . ASP D  1 90  ? -61.839  -74.408  45.236  1.00 3.88  ? 90  ASP D C   1 
ATOM   4731  O  O   . ASP D  1 90  ? -61.870  -75.422  44.558  1.00 4.19  ? 90  ASP D O   1 
ATOM   4732  C  CB  . ASP D  1 90  ? -62.619  -72.236  44.265  1.00 4.12  ? 90  ASP D CB  1 
ATOM   4733  C  CG  . ASP D  1 90  ? -63.816  -71.320  43.907  1.00 6.79  ? 90  ASP D CG  1 
ATOM   4734  O  OD1 . ASP D  1 90  ? -63.610  -70.085  43.728  1.00 9.08  ? 90  ASP D OD1 1 
ATOM   4735  O  OD2 . ASP D  1 90  ? -64.963  -71.822  43.778  1.00 9.69  ? 90  ASP D OD2 1 
ATOM   4736  N  N   . LEU D  1 91  ? -60.829  -74.117  46.066  1.00 3.65  ? 91  LEU D N   1 
ATOM   4737  C  CA  . LEU D  1 91  ? -59.721  -75.045  46.277  1.00 2.83  ? 91  LEU D CA  1 
ATOM   4738  C  C   . LEU D  1 91  ? -60.185  -76.404  46.805  1.00 3.07  ? 91  LEU D C   1 
ATOM   4739  O  O   . LEU D  1 91  ? -59.788  -77.418  46.282  1.00 3.74  ? 91  LEU D O   1 
ATOM   4740  C  CB  . LEU D  1 91  ? -58.662  -74.434  47.183  1.00 2.83  ? 91  LEU D CB  1 
ATOM   4741  C  CG  . LEU D  1 91  ? -57.447  -75.272  47.589  1.00 2.00  ? 91  LEU D CG  1 
ATOM   4742  C  CD1 . LEU D  1 91  ? -56.705  -75.709  46.352  1.00 2.67  ? 91  LEU D CD1 1 
ATOM   4743  C  CD2 . LEU D  1 91  ? -56.526  -74.513  48.537  1.00 2.00  ? 91  LEU D CD2 1 
ATOM   4744  N  N   . ALA D  1 92  ? -61.026  -76.446  47.823  1.00 3.18  ? 92  ALA D N   1 
ATOM   4745  C  CA  . ALA D  1 92  ? -61.480  -77.743  48.345  1.00 3.19  ? 92  ALA D CA  1 
ATOM   4746  C  C   . ALA D  1 92  ? -62.181  -78.543  47.222  1.00 3.64  ? 92  ALA D C   1 
ATOM   4747  O  O   . ALA D  1 92  ? -62.031  -79.767  47.092  1.00 4.24  ? 92  ALA D O   1 
ATOM   4748  C  CB  . ALA D  1 92  ? -62.387  -77.580  49.558  1.00 2.00  ? 92  ALA D CB  1 
ATOM   4749  N  N   . LEU D  1 93  ? -62.928  -77.827  46.390  1.00 3.88  ? 93  LEU D N   1 
ATOM   4750  C  CA  . LEU D  1 93  ? -63.676  -78.441  45.307  1.00 4.33  ? 93  LEU D CA  1 
ATOM   4751  C  C   . LEU D  1 93  ? -62.763  -79.048  44.252  1.00 4.79  ? 93  LEU D C   1 
ATOM   4752  O  O   . LEU D  1 93  ? -63.014  -80.165  43.806  1.00 5.13  ? 93  LEU D O   1 
ATOM   4753  C  CB  . LEU D  1 93  ? -64.583  -77.406  44.670  1.00 4.16  ? 93  LEU D CB  1 
ATOM   4754  C  CG  . LEU D  1 93  ? -65.644  -77.979  43.768  1.00 5.16  ? 93  LEU D CG  1 
ATOM   4755  C  CD1 . LEU D  1 93  ? -66.581  -78.918  44.561  1.00 5.06  ? 93  LEU D CD1 1 
ATOM   4756  C  CD2 . LEU D  1 93  ? -66.409  -76.822  43.173  1.00 4.54  ? 93  LEU D CD2 1 
ATOM   4757  N  N   . GLU D  1 94  ? -61.709  -78.319  43.864  1.00 4.91  ? 94  GLU D N   1 
ATOM   4758  C  CA  . GLU D  1 94  ? -60.716  -78.805  42.912  1.00 5.03  ? 94  GLU D CA  1 
ATOM   4759  C  C   . GLU D  1 94  ? -59.994  -80.036  43.470  1.00 4.87  ? 94  GLU D C   1 
ATOM   4760  O  O   . GLU D  1 94  ? -59.783  -81.018  42.769  1.00 4.46  ? 94  GLU D O   1 
ATOM   4761  C  CB  . GLU D  1 94  ? -59.711  -77.717  42.576  1.00 5.05  ? 94  GLU D CB  1 
ATOM   4762  C  CG  . GLU D  1 94  ? -60.288  -76.522  41.860  1.00 7.76  ? 94  GLU D CG  1 
ATOM   4763  C  CD  . GLU D  1 94  ? -60.353  -76.693  40.336  1.00 13.85 ? 94  GLU D CD  1 
ATOM   4764  O  OE1 . GLU D  1 94  ? -60.017  -77.796  39.835  1.00 15.08 ? 94  GLU D OE1 1 
ATOM   4765  O  OE2 . GLU D  1 94  ? -60.765  -75.719  39.626  1.00 14.52 ? 94  GLU D OE2 1 
ATOM   4766  N  N   . LEU D  1 95  ? -59.648  -79.984  44.752  1.00 4.98  ? 95  LEU D N   1 
ATOM   4767  C  CA  . LEU D  1 95  ? -59.031  -81.100  45.414  1.00 4.81  ? 95  LEU D CA  1 
ATOM   4768  C  C   . LEU D  1 95  ? -59.910  -82.348  45.404  1.00 5.50  ? 95  LEU D C   1 
ATOM   4769  O  O   . LEU D  1 95  ? -59.407  -83.443  45.137  1.00 5.93  ? 95  LEU D O   1 
ATOM   4770  C  CB  . LEU D  1 95  ? -58.627  -80.705  46.826  1.00 4.60  ? 95  LEU D CB  1 
ATOM   4771  C  CG  . LEU D  1 95  ? -57.153  -80.356  47.098  1.00 4.46  ? 95  LEU D CG  1 
ATOM   4772  C  CD1 . LEU D  1 95  ? -56.366  -80.029  45.867  1.00 2.65  ? 95  LEU D CD1 1 
ATOM   4773  C  CD2 . LEU D  1 95  ? -57.038  -79.250  48.095  1.00 3.34  ? 95  LEU D CD2 1 
ATOM   4774  N  N   . ASP D  1 96  ? -61.209  -82.216  45.643  1.00 5.51  ? 96  ASP D N   1 
ATOM   4775  C  CA  . ASP D  1 96  ? -62.056  -83.411  45.579  1.00 6.36  ? 96  ASP D CA  1 
ATOM   4776  C  C   . ASP D  1 96  ? -62.215  -83.943  44.173  1.00 5.92  ? 96  ASP D C   1 
ATOM   4777  O  O   . ASP D  1 96  ? -62.337  -85.142  43.961  1.00 5.83  ? 96  ASP D O   1 
ATOM   4778  C  CB  . ASP D  1 96  ? -63.424  -83.188  46.190  1.00 7.34  ? 96  ASP D CB  1 
ATOM   4779  C  CG  . ASP D  1 96  ? -63.387  -83.203  47.711  1.00 13.90 ? 96  ASP D CG  1 
ATOM   4780  O  OD1 . ASP D  1 96  ? -62.502  -83.900  48.321  1.00 19.34 ? 96  ASP D OD1 1 
ATOM   4781  O  OD2 . ASP D  1 96  ? -64.258  -82.506  48.304  1.00 19.46 ? 96  ASP D OD2 1 
ATOM   4782  N  N   . GLY D  1 97  ? -62.253  -83.047  43.207  1.00 5.51  ? 97  GLY D N   1 
ATOM   4783  C  CA  . GLY D  1 97  ? -62.357  -83.496  41.845  1.00 5.61  ? 97  GLY D CA  1 
ATOM   4784  C  C   . GLY D  1 97  ? -61.065  -84.142  41.367  1.00 5.90  ? 97  GLY D C   1 
ATOM   4785  O  O   . GLY D  1 97  ? -61.104  -85.076  40.570  1.00 5.90  ? 97  GLY D O   1 
ATOM   4786  N  N   . ALA D  1 98  ? -59.923  -83.634  41.807  1.00 6.48  ? 98  ALA D N   1 
ATOM   4787  C  CA  . ALA D  1 98  ? -58.653  -84.236  41.406  1.00 7.80  ? 98  ALA D CA  1 
ATOM   4788  C  C   . ALA D  1 98  ? -58.587  -85.675  41.901  1.00 9.22  ? 98  ALA D C   1 
ATOM   4789  O  O   . ALA D  1 98  ? -58.127  -86.550  41.185  1.00 8.86  ? 98  ALA D O   1 
ATOM   4790  C  CB  . ALA D  1 98  ? -57.474  -83.427  41.912  1.00 6.34  ? 98  ALA D CB  1 
ATOM   4791  N  N   . LYS D  1 99  ? -59.106  -85.894  43.114  1.00 11.33 ? 99  LYS D N   1 
ATOM   4792  C  CA  . LYS D  1 99  ? -59.150  -87.188  43.744  1.00 13.62 ? 99  LYS D CA  1 
ATOM   4793  C  C   . LYS D  1 99  ? -59.977  -88.124  42.864  1.00 11.97 ? 99  LYS D C   1 
ATOM   4794  O  O   . LYS D  1 99  ? -59.483  -89.189  42.468  1.00 12.45 ? 99  LYS D O   1 
ATOM   4795  C  CB  . LYS D  1 99  ? -59.733  -87.037  45.146  1.00 14.37 ? 99  LYS D CB  1 
ATOM   4796  C  CG  . LYS D  1 99  ? -59.378  -88.117  46.175  1.00 18.32 ? 99  LYS D CG  1 
ATOM   4797  C  CD  . LYS D  1 99  ? -59.736  -87.651  47.627  1.00 19.24 ? 99  LYS D CD  1 
ATOM   4798  C  CE  . LYS D  1 99  ? -58.707  -86.594  48.264  1.00 22.80 ? 99  LYS D CE  1 
ATOM   4799  N  NZ  . LYS D  1 99  ? -59.387  -85.453  49.047  1.00 22.13 ? 99  LYS D NZ  1 
ATOM   4800  N  N   . ASN D  1 100 ? -61.195  -87.719  42.514  1.00 9.83  ? 100 ASN D N   1 
ATOM   4801  C  CA  . ASN D  1 100 ? -62.044  -88.492  41.614  1.00 8.10  ? 100 ASN D CA  1 
ATOM   4802  C  C   . ASN D  1 100 ? -61.390  -88.788  40.250  1.00 7.37  ? 100 ASN D C   1 
ATOM   4803  O  O   . ASN D  1 100 ? -61.522  -89.898  39.689  1.00 6.46  ? 100 ASN D O   1 
ATOM   4804  C  CB  . ASN D  1 100 ? -63.386  -87.796  41.371  1.00 7.85  ? 100 ASN D CB  1 
ATOM   4805  C  CG  . ASN D  1 100 ? -64.222  -87.622  42.637  1.00 8.33  ? 100 ASN D CG  1 
ATOM   4806  O  OD1 . ASN D  1 100 ? -65.027  -86.709  42.716  1.00 9.72  ? 100 ASN D OD1 1 
ATOM   4807  N  ND2 . ASN D  1 100 ? -64.029  -88.483  43.623  1.00 6.56  ? 100 ASN D ND2 1 
ATOM   4808  N  N   . LEU D  1 101 ? -60.690  -87.786  39.715  1.00 5.83  ? 101 LEU D N   1 
ATOM   4809  C  CA  . LEU D  1 101 ? -60.012  -87.928  38.437  1.00 3.88  ? 101 LEU D CA  1 
ATOM   4810  C  C   . LEU D  1 101 ? -58.917  -88.972  38.518  1.00 3.45  ? 101 LEU D C   1 
ATOM   4811  O  O   . LEU D  1 101 ? -58.800  -89.799  37.607  1.00 3.00  ? 101 LEU D O   1 
ATOM   4812  C  CB  . LEU D  1 101 ? -59.448  -86.584  37.976  1.00 4.12  ? 101 LEU D CB  1 
ATOM   4813  C  CG  . LEU D  1 101 ? -60.321  -85.724  37.062  1.00 2.76  ? 101 LEU D CG  1 
ATOM   4814  C  CD1 . LEU D  1 101 ? -59.861  -84.294  37.086  1.00 3.13  ? 101 LEU D CD1 1 
ATOM   4815  C  CD2 . LEU D  1 101 ? -60.254  -86.245  35.680  1.00 2.00  ? 101 LEU D CD2 1 
ATOM   4816  N  N   . ARG D  1 102 ? -58.144  -88.951  39.613  1.00 2.97  ? 102 ARG D N   1 
ATOM   4817  C  CA  A ARG D  1 102 ? -57.074  -89.924  39.806  0.50 3.15  ? 102 ARG D CA  1 
ATOM   4818  C  CA  B ARG D  1 102 ? -57.071  -89.916  39.802  0.50 3.16  ? 102 ARG D CA  1 
ATOM   4819  C  C   . ARG D  1 102 ? -57.647  -91.334  39.822  1.00 3.54  ? 102 ARG D C   1 
ATOM   4820  O  O   . ARG D  1 102 ? -57.114  -92.233  39.166  1.00 3.77  ? 102 ARG D O   1 
ATOM   4821  C  CB  A ARG D  1 102 ? -56.255  -89.622  41.070  0.50 2.54  ? 102 ARG D CB  1 
ATOM   4822  C  CB  B ARG D  1 102 ? -56.232  -89.585  41.052  0.50 2.55  ? 102 ARG D CB  1 
ATOM   4823  C  CG  A ARG D  1 102 ? -55.640  -88.216  41.035  0.50 3.09  ? 102 ARG D CG  1 
ATOM   4824  C  CG  B ARG D  1 102 ? -55.344  -88.316  40.862  0.50 3.16  ? 102 ARG D CG  1 
ATOM   4825  C  CD  A ARG D  1 102 ? -54.451  -87.953  41.964  0.50 3.45  ? 102 ARG D CD  1 
ATOM   4826  C  CD  B ARG D  1 102 ? -54.627  -87.753  42.126  0.50 3.53  ? 102 ARG D CD  1 
ATOM   4827  N  NE  A ARG D  1 102 ? -53.519  -87.043  41.298  0.50 4.48  ? 102 ARG D NE  1 
ATOM   4828  N  NE  B ARG D  1 102 ? -55.569  -87.349  43.175  0.50 5.96  ? 102 ARG D NE  1 
ATOM   4829  C  CZ  A ARG D  1 102 ? -53.525  -85.729  41.417  0.50 5.97  ? 102 ARG D CZ  1 
ATOM   4830  C  CZ  B ARG D  1 102 ? -55.249  -87.014  44.427  0.50 7.20  ? 102 ARG D CZ  1 
ATOM   4831  N  NH1 A ARG D  1 102 ? -54.386  -85.132  42.205  0.50 9.11  ? 102 ARG D NH1 1 
ATOM   4832  N  NH1 B ARG D  1 102 ? -53.982  -86.990  44.845  0.50 10.63 ? 102 ARG D NH1 1 
ATOM   4833  N  NH2 A ARG D  1 102 ? -52.656  -85.005  40.747  0.50 7.37  ? 102 ARG D NH2 1 
ATOM   4834  N  NH2 B ARG D  1 102 ? -56.204  -86.705  45.270  0.50 7.27  ? 102 ARG D NH2 1 
ATOM   4835  N  N   . GLU D  1 103 ? -58.744  -91.531  40.571  1.00 4.07  ? 103 GLU D N   1 
ATOM   4836  C  CA  . GLU D  1 103 ? -59.414  -92.833  40.614  1.00 4.50  ? 103 GLU D CA  1 
ATOM   4837  C  C   . GLU D  1 103 ? -59.921  -93.269  39.188  1.00 2.90  ? 103 GLU D C   1 
ATOM   4838  O  O   . GLU D  1 103 ? -59.559  -94.333  38.694  1.00 2.45  ? 103 GLU D O   1 
ATOM   4839  C  CB  . GLU D  1 103 ? -60.484  -92.837  41.712  1.00 3.90  ? 103 GLU D CB  1 
ATOM   4840  C  CG  . GLU D  1 103 ? -61.311  -94.169  41.953  1.00 5.60  ? 103 GLU D CG  1 
ATOM   4841  C  CD  . GLU D  1 103 ? -62.582  -93.897  42.847  1.00 9.98  ? 103 GLU D CD  1 
ATOM   4842  O  OE1 . GLU D  1 103 ? -62.530  -92.888  43.658  1.00 17.26 ? 103 GLU D OE1 1 
ATOM   4843  O  OE2 . GLU D  1 103 ? -63.625  -94.643  42.748  1.00 11.52 ? 103 GLU D OE2 1 
ATOM   4844  N  N   . ALA D  1 104 ? -60.647  -92.403  38.504  1.00 2.83  ? 104 ALA D N   1 
ATOM   4845  C  CA  . ALA D  1 104 ? -61.181  -92.705  37.181  1.00 2.24  ? 104 ALA D CA  1 
ATOM   4846  C  C   . ALA D  1 104 ? -60.116  -93.059  36.158  1.00 2.25  ? 104 ALA D C   1 
ATOM   4847  O  O   . ALA D  1 104 ? -60.302  -93.990  35.362  1.00 2.00  ? 104 ALA D O   1 
ATOM   4848  C  CB  . ALA D  1 104 ? -62.011  -91.562  36.673  1.00 2.02  ? 104 ALA D CB  1 
ATOM   4849  N  N   . ILE D  1 105 ? -59.005  -92.328  36.195  1.00 2.38  ? 105 ILE D N   1 
ATOM   4850  C  CA  . ILE D  1 105 ? -57.887  -92.538  35.259  1.00 2.27  ? 105 ILE D CA  1 
ATOM   4851  C  C   . ILE D  1 105 ? -57.297  -93.945  35.401  1.00 2.26  ? 105 ILE D C   1 
ATOM   4852  O  O   . ILE D  1 105 ? -57.037  -94.621  34.421  1.00 2.00  ? 105 ILE D O   1 
ATOM   4853  C  CB  . ILE D  1 105 ? -56.801  -91.440  35.430  1.00 2.00  ? 105 ILE D CB  1 
ATOM   4854  C  CG1 . ILE D  1 105 ? -57.304  -90.130  34.854  1.00 2.00  ? 105 ILE D CG1 1 
ATOM   4855  C  CG2 . ILE D  1 105 ? -55.526  -91.796  34.713  1.00 2.56  ? 105 ILE D CG2 1 
ATOM   4856  C  CD1 . ILE D  1 105 ? -56.598  -88.936  35.339  1.00 2.00  ? 105 ILE D CD1 1 
ATOM   4857  N  N   . GLY D  1 106 ? -57.109  -94.369  36.643  1.00 2.22  ? 106 GLY D N   1 
ATOM   4858  C  CA  . GLY D  1 106 ? -56.534  -95.667  36.921  1.00 2.04  ? 106 GLY D CA  1 
ATOM   4859  C  C   . GLY D  1 106 ? -57.470  -96.748  36.443  1.00 2.39  ? 106 GLY D C   1 
ATOM   4860  O  O   . GLY D  1 106 ? -57.009  -97.759  35.892  1.00 3.06  ? 106 GLY D O   1 
ATOM   4861  N  N   . TYR D  1 107 ? -58.776  -96.546  36.631  1.00 2.00  ? 107 TYR D N   1 
ATOM   4862  C  CA  . TYR D  1 107 ? -59.731  -97.551  36.233  1.00 2.00  ? 107 TYR D CA  1 
ATOM   4863  C  C   . TYR D  1 107 ? -59.866  -97.661  34.694  1.00 2.70  ? 107 TYR D C   1 
ATOM   4864  O  O   . TYR D  1 107 ? -59.931  -98.763  34.144  1.00 2.66  ? 107 TYR D O   1 
ATOM   4865  C  CB  . TYR D  1 107 ? -61.087  -97.327  36.898  1.00 2.22  ? 107 TYR D CB  1 
ATOM   4866  C  CG  . TYR D  1 107 ? -62.087  -98.310  36.384  1.00 2.09  ? 107 TYR D CG  1 
ATOM   4867  C  CD1 . TYR D  1 107 ? -62.136  -99.607  36.882  1.00 2.00  ? 107 TYR D CD1 1 
ATOM   4868  C  CD2 . TYR D  1 107 ? -62.915  -97.983  35.333  1.00 2.00  ? 107 TYR D CD2 1 
ATOM   4869  C  CE1 . TYR D  1 107 ? -63.031  -100.532 36.381  1.00 2.12  ? 107 TYR D CE1 1 
ATOM   4870  C  CE2 . TYR D  1 107 ? -63.807  -98.900  34.807  1.00 3.52  ? 107 TYR D CE2 1 
ATOM   4871  C  CZ  . TYR D  1 107 ? -63.861  -100.161 35.339  1.00 3.69  ? 107 TYR D CZ  1 
ATOM   4872  O  OH  . TYR D  1 107 ? -64.740  -101.025 34.806  1.00 4.41  ? 107 TYR D OH  1 
ATOM   4873  N  N   . ALA D  1 108 ? -59.904  -96.514  34.007  1.00 2.83  ? 108 ALA D N   1 
ATOM   4874  C  CA  . ALA D  1 108 ? -59.942  -96.491  32.555  1.00 2.71  ? 108 ALA D CA  1 
ATOM   4875  C  C   . ALA D  1 108 ? -58.757  -97.287  31.933  1.00 2.95  ? 108 ALA D C   1 
ATOM   4876  O  O   . ALA D  1 108 ? -58.932  -98.006  30.939  1.00 2.69  ? 108 ALA D O   1 
ATOM   4877  C  CB  . ALA D  1 108 ? -59.971  -95.029  32.038  1.00 2.00  ? 108 ALA D CB  1 
ATOM   4878  N  N   . ASP D  1 109 ? -57.570  -97.146  32.537  1.00 2.94  ? 109 ASP D N   1 
ATOM   4879  C  CA  . ASP D  1 109 ? -56.414  -97.883  32.123  1.00 3.25  ? 109 ASP D CA  1 
ATOM   4880  C  C   . ASP D  1 109 ? -56.638  -99.375  32.294  1.00 3.34  ? 109 ASP D C   1 
ATOM   4881  O  O   . ASP D  1 109 ? -56.211  -100.164 31.466  1.00 2.67  ? 109 ASP D O   1 
ATOM   4882  C  CB  . ASP D  1 109 ? -55.205  -97.479  32.935  1.00 3.44  ? 109 ASP D CB  1 
ATOM   4883  C  CG  . ASP D  1 109 ? -53.916  -98.011  32.355  1.00 5.63  ? 109 ASP D CG  1 
ATOM   4884  O  OD1 . ASP D  1 109 ? -53.466  -99.109  32.793  1.00 8.74  ? 109 ASP D OD1 1 
ATOM   4885  O  OD2 . ASP D  1 109 ? -53.352  -97.349  31.455  1.00 8.48  ? 109 ASP D OD2 1 
ATOM   4886  N  N   . SER D  1 110 ? -57.304  -99.772  33.365  1.00 3.72  ? 110 SER D N   1 
ATOM   4887  C  CA  . SER D  1 110 ? -57.376  -101.185 33.608  1.00 4.44  ? 110 SER D CA  1 
ATOM   4888  C  C   . SER D  1 110 ? -58.408  -101.884 32.736  1.00 3.80  ? 110 SER D C   1 
ATOM   4889  O  O   . SER D  1 110 ? -58.260  -103.055 32.462  1.00 4.00  ? 110 SER D O   1 
ATOM   4890  C  CB  . SER D  1 110 ? -57.507  -101.494 35.096  1.00 4.64  ? 110 SER D CB  1 
ATOM   4891  O  OG  . SER D  1 110 ? -58.683  -100.903 35.567  1.00 10.43 ? 110 SER D OG  1 
ATOM   4892  N  N   . VAL D  1 111 ? -59.410  -101.156 32.253  1.00 3.43  ? 111 VAL D N   1 
ATOM   4893  C  CA  . VAL D  1 111 ? -60.316  -101.688 31.217  1.00 2.87  ? 111 VAL D CA  1 
ATOM   4894  C  C   . VAL D  1 111 ? -59.932  -101.289 29.785  1.00 2.77  ? 111 VAL D C   1 
ATOM   4895  O  O   . VAL D  1 111 ? -60.683  -101.510 28.868  1.00 2.00  ? 111 VAL D O   1 
ATOM   4896  C  CB  . VAL D  1 111 ? -61.791  -101.306 31.434  1.00 2.94  ? 111 VAL D CB  1 
ATOM   4897  C  CG1 . VAL D  1 111 ? -62.346  -101.988 32.662  1.00 3.09  ? 111 VAL D CG1 1 
ATOM   4898  C  CG2 . VAL D  1 111 ? -61.966  -99.800  31.527  1.00 3.47  ? 111 VAL D CG2 1 
ATOM   4899  N  N   . HIS D  1 112 ? -58.753  -100.700 29.609  1.00 3.25  ? 112 HIS D N   1 
ATOM   4900  C  CA  . HIS D  1 112 ? -58.220  -100.413 28.277  1.00 3.79  ? 112 HIS D CA  1 
ATOM   4901  C  C   . HIS D  1 112 ? -58.921  -99.264  27.539  1.00 3.49  ? 112 HIS D C   1 
ATOM   4902  O  O   . HIS D  1 112 ? -58.762  -99.142  26.329  1.00 4.06  ? 112 HIS D O   1 
ATOM   4903  C  CB  . HIS D  1 112 ? -58.149  -101.692 27.406  1.00 3.85  ? 112 HIS D CB  1 
ATOM   4904  C  CG  . HIS D  1 112 ? -57.261  -102.744 27.987  1.00 8.21  ? 112 HIS D CG  1 
ATOM   4905  N  ND1 . HIS D  1 112 ? -57.728  -103.729 28.833  1.00 12.09 ? 112 HIS D ND1 1 
ATOM   4906  C  CD2 . HIS D  1 112 ? -55.920  -102.929 27.901  1.00 11.29 ? 112 HIS D CD2 1 
ATOM   4907  C  CE1 . HIS D  1 112 ? -56.713  -104.482 29.233  1.00 12.97 ? 112 HIS D CE1 1 
ATOM   4908  N  NE2 . HIS D  1 112 ? -55.604  -104.019 28.676  1.00 12.50 ? 112 HIS D NE2 1 
ATOM   4909  N  N   . ASP D  1 113 ? -59.676  -98.416  28.244  1.00 3.01  ? 113 ASP D N   1 
ATOM   4910  C  CA  . ASP D  1 113 ? -60.248  -97.235  27.634  1.00 2.48  ? 113 ASP D CA  1 
ATOM   4911  C  C   . ASP D  1 113 ? -59.212  -96.108  27.648  1.00 2.14  ? 113 ASP D C   1 
ATOM   4912  O  O   . ASP D  1 113 ? -59.324  -95.111  28.347  1.00 2.02  ? 113 ASP D O   1 
ATOM   4913  C  CB  . ASP D  1 113 ? -61.535  -96.813  28.326  1.00 2.56  ? 113 ASP D CB  1 
ATOM   4914  C  CG  . ASP D  1 113 ? -62.316  -95.724  27.540  1.00 3.40  ? 113 ASP D CG  1 
ATOM   4915  O  OD1 . ASP D  1 113 ? -61.804  -95.163  26.531  1.00 3.53  ? 113 ASP D OD1 1 
ATOM   4916  O  OD2 . ASP D  1 113 ? -63.465  -95.420  27.949  1.00 3.87  ? 113 ASP D OD2 1 
ATOM   4917  N  N   . TYR D  1 114 ? -58.205  -96.290  26.828  1.00 2.00  ? 114 TYR D N   1 
ATOM   4918  C  CA  . TYR D  1 114 ? -57.084  -95.402  26.757  1.00 2.22  ? 114 TYR D CA  1 
ATOM   4919  C  C   . TYR D  1 114 ? -57.429  -94.005  26.263  1.00 2.52  ? 114 TYR D C   1 
ATOM   4920  O  O   . TYR D  1 114 ? -56.792  -93.051  26.693  1.00 2.00  ? 114 TYR D O   1 
ATOM   4921  C  CB  . TYR D  1 114 ? -55.983  -96.055  25.924  1.00 2.00  ? 114 TYR D CB  1 
ATOM   4922  C  CG  . TYR D  1 114 ? -55.474  -97.316  26.591  1.00 2.50  ? 114 TYR D CG  1 
ATOM   4923  C  CD1 . TYR D  1 114 ? -54.902  -97.272  27.877  1.00 2.00  ? 114 TYR D CD1 1 
ATOM   4924  C  CD2 . TYR D  1 114 ? -55.570  -98.562  25.950  1.00 2.16  ? 114 TYR D CD2 1 
ATOM   4925  C  CE1 . TYR D  1 114 ? -54.427  -98.418  28.484  1.00 2.00  ? 114 TYR D CE1 1 
ATOM   4926  C  CE2 . TYR D  1 114 ? -55.100  -99.719  26.562  1.00 2.01  ? 114 TYR D CE2 1 
ATOM   4927  C  CZ  . TYR D  1 114 ? -54.527  -99.639  27.819  1.00 2.00  ? 114 TYR D CZ  1 
ATOM   4928  O  OH  . TYR D  1 114 ? -54.058  -100.764 28.427  1.00 2.00  ? 114 TYR D OH  1 
ATOM   4929  N  N   . VAL D  1 115 ? -58.440  -93.863  25.401  1.00 2.59  ? 115 VAL D N   1 
ATOM   4930  C  CA  . VAL D  1 115 ? -58.778  -92.515  25.014  1.00 2.55  ? 115 VAL D CA  1 
ATOM   4931  C  C   . VAL D  1 115 ? -59.561  -91.729  26.053  1.00 2.94  ? 115 VAL D C   1 
ATOM   4932  O  O   . VAL D  1 115 ? -59.225  -90.558  26.293  1.00 3.46  ? 115 VAL D O   1 
ATOM   4933  C  CB  . VAL D  1 115 ? -59.114  -92.302  23.529  1.00 2.32  ? 115 VAL D CB  1 
ATOM   4934  C  CG1 . VAL D  1 115 ? -59.043  -93.560  22.777  1.00 2.92  ? 115 VAL D CG1 1 
ATOM   4935  C  CG2 . VAL D  1 115 ? -60.377  -91.478  23.304  1.00 2.00  ? 115 VAL D CG2 1 
ATOM   4936  N  N   . SER D  1 116 ? -60.522  -92.356  26.727  1.00 2.73  ? 116 SER D N   1 
ATOM   4937  C  CA  . SER D  1 116 ? -61.066  -91.736  27.911  1.00 2.46  ? 116 SER D CA  1 
ATOM   4938  C  C   . SER D  1 116 ? -59.959  -91.361  28.904  1.00 2.75  ? 116 SER D C   1 
ATOM   4939  O  O   . SER D  1 116 ? -59.986  -90.259  29.458  1.00 3.13  ? 116 SER D O   1 
ATOM   4940  C  CB  . SER D  1 116 ? -62.103  -92.599  28.591  1.00 2.02  ? 116 SER D CB  1 
ATOM   4941  O  OG  . SER D  1 116 ? -63.206  -92.802  27.740  1.00 2.00  ? 116 SER D OG  1 
ATOM   4942  N  N   . ARG D  1 117 ? -58.975  -92.235  29.108  1.00 2.50  ? 117 ARG D N   1 
ATOM   4943  C  CA  . ARG D  1 117 ? -57.915  -91.934  30.041  1.00 2.21  ? 117 ARG D CA  1 
ATOM   4944  C  C   . ARG D  1 117 ? -57.176  -90.674  29.634  1.00 3.12  ? 117 ARG D C   1 
ATOM   4945  O  O   . ARG D  1 117 ? -56.925  -89.758  30.459  1.00 3.07  ? 117 ARG D O   1 
ATOM   4946  C  CB  . ARG D  1 117 ? -56.955  -93.076  30.166  1.00 2.00  ? 117 ARG D CB  1 
ATOM   4947  C  CG  . ARG D  1 117 ? -55.782  -92.773  31.049  1.00 2.00  ? 117 ARG D CG  1 
ATOM   4948  C  CD  . ARG D  1 117 ? -55.057  -94.046  31.396  1.00 2.00  ? 117 ARG D CD  1 
ATOM   4949  N  NE  . ARG D  1 117 ? -53.652  -93.826  31.715  1.00 2.92  ? 117 ARG D NE  1 
ATOM   4950  C  CZ  . ARG D  1 117 ? -53.066  -94.163  32.858  1.00 2.72  ? 117 ARG D CZ  1 
ATOM   4951  N  NH1 . ARG D  1 117 ? -53.759  -94.752  33.821  1.00 2.00  ? 117 ARG D NH1 1 
ATOM   4952  N  NH2 . ARG D  1 117 ? -51.763  -93.918  33.010  1.00 2.00  ? 117 ARG D NH2 1 
ATOM   4953  N  N   . ASP D  1 118 ? -56.861  -90.613  28.343  1.00 3.53  ? 118 ASP D N   1 
ATOM   4954  C  CA  . ASP D  1 118 ? -56.063  -89.546  27.769  1.00 3.88  ? 118 ASP D CA  1 
ATOM   4955  C  C   . ASP D  1 118 ? -56.818  -88.236  27.934  1.00 3.99  ? 118 ASP D C   1 
ATOM   4956  O  O   . ASP D  1 118 ? -56.250  -87.259  28.364  1.00 5.12  ? 118 ASP D O   1 
ATOM   4957  C  CB  . ASP D  1 118 ? -55.800  -89.871  26.298  1.00 4.82  ? 118 ASP D CB  1 
ATOM   4958  C  CG  . ASP D  1 118 ? -54.831  -88.895  25.625  1.00 7.81  ? 118 ASP D CG  1 
ATOM   4959  O  OD1 . ASP D  1 118 ? -53.666  -88.805  26.079  1.00 11.66 ? 118 ASP D OD1 1 
ATOM   4960  O  OD2 . ASP D  1 118 ? -55.232  -88.237  24.622  1.00 11.12 ? 118 ASP D OD2 1 
ATOM   4961  N  N   . MET D  1 119 ? -58.111  -88.220  27.631  1.00 3.99  ? 119 MET D N   1 
ATOM   4962  C  CA  . MET D  1 119 ? -58.912  -87.040  27.861  1.00 4.16  ? 119 MET D CA  1 
ATOM   4963  C  C   . MET D  1 119 ? -58.908  -86.636  29.330  1.00 3.84  ? 119 MET D C   1 
ATOM   4964  O  O   . MET D  1 119 ? -58.781  -85.466  29.629  1.00 4.58  ? 119 MET D O   1 
ATOM   4965  C  CB  . MET D  1 119 ? -60.334  -87.262  27.370  1.00 4.10  ? 119 MET D CB  1 
ATOM   4966  C  CG  . MET D  1 119 ? -61.357  -86.256  27.913  1.00 4.22  ? 119 MET D CG  1 
ATOM   4967  S  SD  . MET D  1 119 ? -63.026  -86.970  27.861  1.00 5.80  ? 119 MET D SD  1 
ATOM   4968  C  CE  . MET D  1 119 ? -63.259  -86.887  26.090  1.00 9.20  ? 119 MET D CE  1 
ATOM   4969  N  N   . MET D  1 120 ? -59.025  -87.594  30.242  1.00 3.12  ? 120 MET D N   1 
ATOM   4970  C  CA  . MET D  1 120 ? -59.036  -87.278  31.661  1.00 3.23  ? 120 MET D CA  1 
ATOM   4971  C  C   . MET D  1 120 ? -57.718  -86.717  32.158  1.00 3.21  ? 120 MET D C   1 
ATOM   4972  O  O   . MET D  1 120 ? -57.733  -85.854  33.017  1.00 2.73  ? 120 MET D O   1 
ATOM   4973  C  CB  . MET D  1 120 ? -59.456  -88.477  32.492  1.00 2.57  ? 120 MET D CB  1 
ATOM   4974  C  CG  . MET D  1 120 ? -60.870  -88.836  32.242  1.00 2.69  ? 120 MET D CG  1 
ATOM   4975  S  SD  . MET D  1 120 ? -61.481  -90.125  33.313  1.00 5.73  ? 120 MET D SD  1 
ATOM   4976  C  CE  . MET D  1 120 ? -60.598  -91.581  32.743  1.00 2.40  ? 120 MET D CE  1 
ATOM   4977  N  N   . ILE D  1 121 ? -56.585  -87.195  31.622  1.00 3.56  ? 121 ILE D N   1 
ATOM   4978  C  CA  . ILE D  1 121 ? -55.284  -86.706  32.066  1.00 3.28  ? 121 ILE D CA  1 
ATOM   4979  C  C   . ILE D  1 121 ? -55.111  -85.258  31.665  1.00 4.01  ? 121 ILE D C   1 
ATOM   4980  O  O   . ILE D  1 121 ? -54.613  -84.481  32.464  1.00 3.56  ? 121 ILE D O   1 
ATOM   4981  C  CB  . ILE D  1 121 ? -54.129  -87.533  31.540  1.00 3.17  ? 121 ILE D CB  1 
ATOM   4982  C  CG1 . ILE D  1 121 ? -54.049  -88.866  32.271  1.00 2.69  ? 121 ILE D CG1 1 
ATOM   4983  C  CG2 . ILE D  1 121 ? -52.823  -86.841  31.780  1.00 2.00  ? 121 ILE D CG2 1 
ATOM   4984  C  CD1 . ILE D  1 121 ? -53.285  -89.933  31.473  1.00 2.82  ? 121 ILE D CD1 1 
ATOM   4985  N  N   . GLU D  1 122 ? -55.552  -84.881  30.461  1.00 4.71  ? 122 GLU D N   1 
ATOM   4986  C  CA  . GLU D  1 122 ? -55.490  -83.471  30.071  1.00 5.52  ? 122 GLU D CA  1 
ATOM   4987  C  C   . GLU D  1 122 ? -56.352  -82.602  30.995  1.00 5.40  ? 122 GLU D C   1 
ATOM   4988  O  O   . GLU D  1 122 ? -55.914  -81.515  31.422  1.00 6.41  ? 122 GLU D O   1 
ATOM   4989  C  CB  . GLU D  1 122 ? -55.794  -83.234  28.593  1.00 5.82  ? 122 GLU D CB  1 
ATOM   4990  C  CG  . GLU D  1 122 ? -54.718  -83.816  27.591  1.00 11.57 ? 122 GLU D CG  1 
ATOM   4991  C  CD  . GLU D  1 122 ? -53.167  -83.480  27.951  1.00 19.42 ? 122 GLU D CD  1 
ATOM   4992  O  OE1 . GLU D  1 122 ? -52.698  -82.286  27.716  1.00 20.91 ? 122 GLU D OE1 1 
ATOM   4993  O  OE2 . GLU D  1 122 ? -52.422  -84.423  28.432  1.00 18.99 ? 122 GLU D OE2 1 
ATOM   4994  N  N   . ILE D  1 123 ? -57.544  -83.083  31.356  1.00 4.51  ? 123 ILE D N   1 
ATOM   4995  C  CA  . ILE D  1 123 ? -58.414  -82.318  32.246  1.00 3.60  ? 123 ILE D CA  1 
ATOM   4996  C  C   . ILE D  1 123 ? -57.729  -82.128  33.617  1.00 4.07  ? 123 ILE D C   1 
ATOM   4997  O  O   . ILE D  1 123 ? -57.690  -81.006  34.142  1.00 3.89  ? 123 ILE D O   1 
ATOM   4998  C  CB  . ILE D  1 123 ? -59.815  -82.945  32.319  1.00 3.54  ? 123 ILE D CB  1 
ATOM   4999  C  CG1 . ILE D  1 123 ? -60.546  -82.710  31.006  1.00 2.45  ? 123 ILE D CG1 1 
ATOM   5000  C  CG2 . ILE D  1 123 ? -60.630  -82.419  33.541  1.00 2.48  ? 123 ILE D CG2 1 
ATOM   5001  C  CD1 . ILE D  1 123 ? -61.732  -83.585  30.807  1.00 2.00  ? 123 ILE D CD1 1 
ATOM   5002  N  N   . LEU D  1 124 ? -57.142  -83.208  34.150  1.00 3.94  ? 124 LEU D N   1 
ATOM   5003  C  CA  . LEU D  1 124 ? -56.487  -83.184  35.451  1.00 3.92  ? 124 LEU D CA  1 
ATOM   5004  C  C   . LEU D  1 124 ? -55.354  -82.160  35.443  1.00 4.52  ? 124 LEU D C   1 
ATOM   5005  O  O   . LEU D  1 124 ? -55.140  -81.458  36.419  1.00 4.86  ? 124 LEU D O   1 
ATOM   5006  C  CB  . LEU D  1 124 ? -55.969  -84.566  35.827  1.00 3.40  ? 124 LEU D CB  1 
ATOM   5007  C  CG  . LEU D  1 124 ? -55.199  -84.726  37.148  1.00 3.01  ? 124 LEU D CG  1 
ATOM   5008  C  CD1 . LEU D  1 124 ? -55.993  -84.377  38.425  1.00 2.00  ? 124 LEU D CD1 1 
ATOM   5009  C  CD2 . LEU D  1 124 ? -54.654  -86.123  37.210  1.00 2.01  ? 124 LEU D CD2 1 
ATOM   5010  N  N   . ARG D  1 125 ? -54.647  -82.073  34.324  1.00 4.98  ? 125 ARG D N   1 
ATOM   5011  C  CA  . ARG D  1 125 ? -53.601  -81.085  34.134  1.00 5.50  ? 125 ARG D CA  1 
ATOM   5012  C  C   . ARG D  1 125 ? -54.173  -79.658  34.205  1.00 5.78  ? 125 ARG D C   1 
ATOM   5013  O  O   . ARG D  1 125 ? -53.549  -78.785  34.788  1.00 5.60  ? 125 ARG D O   1 
ATOM   5014  C  CB  . ARG D  1 125 ? -52.888  -81.322  32.814  1.00 5.56  ? 125 ARG D CB  1 
ATOM   5015  C  CG  . ARG D  1 125 ? -51.757  -80.385  32.555  1.00 7.88  ? 125 ARG D CG  1 
ATOM   5016  C  CD  . ARG D  1 125 ? -50.960  -80.784  31.331  1.00 12.89 ? 125 ARG D CD  1 
ATOM   5017  N  NE  . ARG D  1 125 ? -49.992  -79.725  31.001  1.00 19.03 ? 125 ARG D NE  1 
ATOM   5018  C  CZ  . ARG D  1 125 ? -49.317  -79.630  29.836  1.00 22.48 ? 125 ARG D CZ  1 
ATOM   5019  N  NH1 . ARG D  1 125 ? -49.490  -80.533  28.840  1.00 21.48 ? 125 ARG D NH1 1 
ATOM   5020  N  NH2 . ARG D  1 125 ? -48.454  -78.629  29.656  1.00 19.89 ? 125 ARG D NH2 1 
ATOM   5021  N  N   . ASP D  1 126 ? -55.365  -79.426  33.655  1.00 6.02  ? 126 ASP D N   1 
ATOM   5022  C  CA  . ASP D  1 126 ? -55.970  -78.113  33.785  1.00 6.50  ? 126 ASP D CA  1 
ATOM   5023  C  C   . ASP D  1 126 ? -56.366  -77.860  35.228  1.00 6.74  ? 126 ASP D C   1 
ATOM   5024  O  O   . ASP D  1 126 ? -56.277  -76.731  35.687  1.00 7.44  ? 126 ASP D O   1 
ATOM   5025  C  CB  . ASP D  1 126 ? -57.181  -77.874  32.842  1.00 6.64  ? 126 ASP D CB  1 
ATOM   5026  C  CG  . ASP D  1 126 ? -56.843  -78.054  31.352  1.00 9.54  ? 126 ASP D CG  1 
ATOM   5027  O  OD1 . ASP D  1 126 ? -57.777  -78.318  30.541  1.00 10.14 ? 126 ASP D OD1 1 
ATOM   5028  O  OD2 . ASP D  1 126 ? -55.644  -77.931  30.969  1.00 13.14 ? 126 ASP D OD2 1 
ATOM   5029  N  N   . GLU D  1 127 ? -56.793  -78.892  35.949  1.00 6.84  ? 127 GLU D N   1 
ATOM   5030  C  CA  . GLU D  1 127 ? -57.286  -78.716  37.318  1.00 6.88  ? 127 GLU D CA  1 
ATOM   5031  C  C   . GLU D  1 127 ? -56.154  -78.394  38.222  1.00 6.00  ? 127 GLU D C   1 
ATOM   5032  O  O   . GLU D  1 127 ? -56.240  -77.498  39.049  1.00 5.38  ? 127 GLU D O   1 
ATOM   5033  C  CB  . GLU D  1 127 ? -58.017  -79.962  37.843  1.00 6.93  ? 127 GLU D CB  1 
ATOM   5034  C  CG  . GLU D  1 127 ? -59.202  -80.397  36.952  1.00 11.05 ? 127 GLU D CG  1 
ATOM   5035  C  CD  . GLU D  1 127 ? -60.374  -79.385  36.837  1.00 12.29 ? 127 GLU D CD  1 
ATOM   5036  O  OE1 . GLU D  1 127 ? -61.396  -79.756  36.242  1.00 14.06 ? 127 GLU D OE1 1 
ATOM   5037  O  OE2 . GLU D  1 127 ? -60.308  -78.248  37.345  1.00 12.87 ? 127 GLU D OE2 1 
ATOM   5038  N  N   . GLU D  1 128 ? -55.091  -79.169  38.056  1.00 6.06  ? 128 GLU D N   1 
ATOM   5039  C  CA  . GLU D  1 128 ? -53.852  -79.013  38.770  1.00 5.49  ? 128 GLU D CA  1 
ATOM   5040  C  C   . GLU D  1 128 ? -53.389  -77.520  38.575  1.00 5.43  ? 128 GLU D C   1 
ATOM   5041  O  O   . GLU D  1 128 ? -52.940  -76.878  39.534  1.00 5.32  ? 128 GLU D O   1 
ATOM   5042  C  CB  . GLU D  1 128 ? -52.915  -80.039  38.180  1.00 5.53  ? 128 GLU D CB  1 
ATOM   5043  C  CG  . GLU D  1 128 ? -51.838  -80.586  39.057  1.00 6.77  ? 128 GLU D CG  1 
ATOM   5044  C  CD  . GLU D  1 128 ? -51.897  -82.085  39.222  1.00 7.24  ? 128 GLU D CD  1 
ATOM   5045  O  OE1 . GLU D  1 128 ? -52.973  -82.635  39.469  1.00 9.76  ? 128 GLU D OE1 1 
ATOM   5046  O  OE2 . GLU D  1 128 ? -50.850  -82.739  39.144  1.00 7.52  ? 128 GLU D OE2 1 
ATOM   5047  N  N   . GLY D  1 129 ? -53.583  -76.960  37.364  1.00 4.79  ? 129 GLY D N   1 
ATOM   5048  C  CA  . GLY D  1 129 ? -53.341  -75.547  37.103  1.00 4.14  ? 129 GLY D CA  1 
ATOM   5049  C  C   . GLY D  1 129 ? -54.202  -74.609  37.954  1.00 5.05  ? 129 GLY D C   1 
ATOM   5050  O  O   . GLY D  1 129 ? -53.702  -73.636  38.517  1.00 5.06  ? 129 GLY D O   1 
ATOM   5051  N  N   . HIS D  1 130 ? -55.506  -74.873  38.042  1.00 5.22  ? 130 HIS D N   1 
ATOM   5052  C  CA  . HIS D  1 130 ? -56.370  -74.075  38.895  1.00 5.82  ? 130 HIS D CA  1 
ATOM   5053  C  C   . HIS D  1 130 ? -55.952  -74.187  40.351  1.00 5.54  ? 130 HIS D C   1 
ATOM   5054  O  O   . HIS D  1 130 ? -55.917  -73.192  41.058  1.00 5.58  ? 130 HIS D O   1 
ATOM   5055  C  CB  . HIS D  1 130 ? -57.816  -74.507  38.752  1.00 6.69  ? 130 HIS D CB  1 
ATOM   5056  C  CG  . HIS D  1 130 ? -58.365  -74.389  37.364  1.00 10.71 ? 130 HIS D CG  1 
ATOM   5057  N  ND1 . HIS D  1 130 ? -59.495  -75.071  36.959  1.00 14.39 ? 130 HIS D ND1 1 
ATOM   5058  C  CD2 . HIS D  1 130 ? -57.945  -73.686  36.289  1.00 11.83 ? 130 HIS D CD2 1 
ATOM   5059  C  CE1 . HIS D  1 130 ? -59.745  -74.786  35.695  1.00 14.21 ? 130 HIS D CE1 1 
ATOM   5060  N  NE2 . HIS D  1 130 ? -58.820  -73.949  35.267  1.00 12.91 ? 130 HIS D NE2 1 
ATOM   5061  N  N   . ILE D  1 131 ? -55.640  -75.411  40.793  1.00 5.00  ? 131 ILE D N   1 
ATOM   5062  C  CA  . ILE D  1 131 ? -55.136  -75.640  42.142  1.00 4.06  ? 131 ILE D CA  1 
ATOM   5063  C  C   . ILE D  1 131 ? -53.904  -74.729  42.376  1.00 4.70  ? 131 ILE D C   1 
ATOM   5064  O  O   . ILE D  1 131 ? -53.816  -74.028  43.384  1.00 4.77  ? 131 ILE D O   1 
ATOM   5065  C  CB  . ILE D  1 131 ? -54.842  -77.115  42.393  1.00 3.96  ? 131 ILE D CB  1 
ATOM   5066  C  CG1 . ILE D  1 131 ? -56.152  -77.917  42.350  1.00 3.91  ? 131 ILE D CG1 1 
ATOM   5067  C  CG2 . ILE D  1 131 ? -54.108  -77.303  43.715  1.00 2.67  ? 131 ILE D CG2 1 
ATOM   5068  C  CD1 . ILE D  1 131 ? -56.020  -79.457  42.324  1.00 2.04  ? 131 ILE D CD1 1 
ATOM   5069  N  N   . ASP D  1 132 ? -52.978  -74.689  41.426  1.00 4.32  ? 132 ASP D N   1 
ATOM   5070  C  CA  . ASP D  1 132 ? -51.812  -73.850  41.577  1.00 4.26  ? 132 ASP D CA  1 
ATOM   5071  C  C   . ASP D  1 132 ? -52.220  -72.392  41.813  1.00 4.08  ? 132 ASP D C   1 
ATOM   5072  O  O   . ASP D  1 132 ? -51.749  -71.746  42.736  1.00 4.03  ? 132 ASP D O   1 
ATOM   5073  C  CB  . ASP D  1 132 ? -50.947  -73.991  40.334  1.00 4.64  ? 132 ASP D CB  1 
ATOM   5074  C  CG  . ASP D  1 132 ? -49.571  -73.326  40.481  1.00 6.36  ? 132 ASP D CG  1 
ATOM   5075  O  OD1 . ASP D  1 132 ? -49.222  -72.804  41.560  1.00 4.74  ? 132 ASP D OD1 1 
ATOM   5076  O  OD2 . ASP D  1 132 ? -48.813  -73.358  39.496  1.00 10.47 ? 132 ASP D OD2 1 
ATOM   5077  N  N   . TRP D  1 133 ? -53.129  -71.889  40.989  1.00 3.88  ? 133 TRP D N   1 
ATOM   5078  C  CA  . TRP D  1 133 ? -53.516  -70.497  41.067  1.00 3.76  ? 133 TRP D CA  1 
ATOM   5079  C  C   . TRP D  1 133 ? -54.195  -70.185  42.401  1.00 3.76  ? 133 TRP D C   1 
ATOM   5080  O  O   . TRP D  1 133 ? -53.825  -69.225  43.060  1.00 3.97  ? 133 TRP D O   1 
ATOM   5081  C  CB  . TRP D  1 133 ? -54.385  -70.083  39.878  1.00 3.78  ? 133 TRP D CB  1 
ATOM   5082  C  CG  . TRP D  1 133 ? -54.729  -68.651  39.927  1.00 4.08  ? 133 TRP D CG  1 
ATOM   5083  C  CD1 . TRP D  1 133 ? -53.950  -67.595  39.501  1.00 4.06  ? 133 TRP D CD1 1 
ATOM   5084  C  CD2 . TRP D  1 133 ? -55.916  -68.078  40.455  1.00 4.37  ? 133 TRP D CD2 1 
ATOM   5085  N  NE1 . TRP D  1 133 ? -54.597  -66.407  39.721  1.00 3.67  ? 133 TRP D NE1 1 
ATOM   5086  C  CE2 . TRP D  1 133 ? -55.802  -66.662  40.309  1.00 3.85  ? 133 TRP D CE2 1 
ATOM   5087  C  CE3 . TRP D  1 133 ? -57.075  -68.609  41.023  1.00 4.10  ? 133 TRP D CE3 1 
ATOM   5088  C  CZ2 . TRP D  1 133 ? -56.790  -65.784  40.731  1.00 4.23  ? 133 TRP D CZ2 1 
ATOM   5089  C  CZ3 . TRP D  1 133 ? -58.077  -67.710  41.457  1.00 3.86  ? 133 TRP D CZ3 1 
ATOM   5090  C  CH2 . TRP D  1 133 ? -57.919  -66.319  41.300  1.00 4.45  ? 133 TRP D CH2 1 
ATOM   5091  N  N   . LEU D  1 134 ? -55.162  -71.003  42.814  1.00 3.41  ? 134 LEU D N   1 
ATOM   5092  C  CA  . LEU D  1 134 ? -55.864  -70.785  44.061  1.00 2.58  ? 134 LEU D CA  1 
ATOM   5093  C  C   . LEU D  1 134 ? -54.900  -70.803  45.233  1.00 2.57  ? 134 LEU D C   1 
ATOM   5094  O  O   . LEU D  1 134 ? -54.985  -69.937  46.114  1.00 2.44  ? 134 LEU D O   1 
ATOM   5095  C  CB  . LEU D  1 134 ? -56.902  -71.863  44.287  1.00 2.50  ? 134 LEU D CB  1 
ATOM   5096  C  CG  . LEU D  1 134 ? -58.368  -71.816  43.832  1.00 2.39  ? 134 LEU D CG  1 
ATOM   5097  C  CD1 . LEU D  1 134 ? -58.843  -70.490  43.380  1.00 2.00  ? 134 LEU D CD1 1 
ATOM   5098  C  CD2 . LEU D  1 134 ? -58.667  -72.906  42.803  1.00 2.00  ? 134 LEU D CD2 1 
ATOM   5099  N  N   . GLU D  1 135 ? -54.001  -71.793  45.287  1.00 2.82  ? 135 GLU D N   1 
ATOM   5100  C  CA  . GLU D  1 135 ? -53.049  -71.879  46.402  1.00 3.39  ? 135 GLU D CA  1 
ATOM   5101  C  C   . GLU D  1 135 ? -52.198  -70.580  46.479  1.00 3.63  ? 135 GLU D C   1 
ATOM   5102  O  O   . GLU D  1 135 ? -51.970  -70.001  47.567  1.00 3.99  ? 135 GLU D O   1 
ATOM   5103  C  CB  . GLU D  1 135 ? -52.143  -73.084  46.267  1.00 2.42  ? 135 GLU D CB  1 
ATOM   5104  C  CG  . GLU D  1 135 ? -52.815  -74.382  46.566  1.00 3.73  ? 135 GLU D CG  1 
ATOM   5105  C  CD  . GLU D  1 135 ? -51.928  -75.632  46.277  1.00 5.13  ? 135 GLU D CD  1 
ATOM   5106  O  OE1 . GLU D  1 135 ? -50.905  -75.537  45.540  1.00 4.24  ? 135 GLU D OE1 1 
ATOM   5107  O  OE2 . GLU D  1 135 ? -52.284  -76.726  46.808  1.00 6.62  ? 135 GLU D OE2 1 
ATOM   5108  N  N   . THR D  1 136 ? -51.749  -70.119  45.321  1.00 2.93  ? 136 THR D N   1 
ATOM   5109  C  CA  . THR D  1 136 ? -50.921  -68.956  45.281  1.00 2.73  ? 136 THR D CA  1 
ATOM   5110  C  C   . THR D  1 136 ? -51.667  -67.733  45.778  1.00 2.79  ? 136 THR D C   1 
ATOM   5111  O  O   . THR D  1 136 ? -51.131  -66.989  46.607  1.00 3.23  ? 136 THR D O   1 
ATOM   5112  C  CB  . THR D  1 136 ? -50.400  -68.762  43.887  1.00 2.95  ? 136 THR D CB  1 
ATOM   5113  O  OG1 . THR D  1 136 ? -49.869  -70.015  43.451  1.00 2.64  ? 136 THR D OG1 1 
ATOM   5114  C  CG2 . THR D  1 136 ? -49.300  -67.713  43.863  1.00 2.31  ? 136 THR D CG2 1 
ATOM   5115  N  N   . GLU D  1 137 ? -52.894  -67.520  45.301  1.00 2.23  ? 137 GLU D N   1 
ATOM   5116  C  CA  . GLU D  1 137 ? -53.714  -66.415  45.788  1.00 2.39  ? 137 GLU D CA  1 
ATOM   5117  C  C   . GLU D  1 137 ? -53.884  -66.489  47.301  1.00 2.42  ? 137 GLU D C   1 
ATOM   5118  O  O   . GLU D  1 137 ? -53.644  -65.527  47.989  1.00 3.17  ? 137 GLU D O   1 
ATOM   5119  C  CB  . GLU D  1 137 ? -55.089  -66.401  45.113  1.00 2.45  ? 137 GLU D CB  1 
ATOM   5120  C  CG  . GLU D  1 137 ? -55.087  -66.092  43.619  1.00 4.77  ? 137 GLU D CG  1 
ATOM   5121  C  CD  . GLU D  1 137 ? -54.288  -64.829  43.259  1.00 8.01  ? 137 GLU D CD  1 
ATOM   5122  O  OE1 . GLU D  1 137 ? -53.222  -64.960  42.577  1.00 8.93  ? 137 GLU D OE1 1 
ATOM   5123  O  OE2 . GLU D  1 137 ? -54.725  -63.709  43.660  1.00 9.35  ? 137 GLU D OE2 1 
ATOM   5124  N  N   . LEU D  1 138 ? -54.278  -67.630  47.829  1.00 2.31  ? 138 LEU D N   1 
ATOM   5125  C  CA  . LEU D  1 138 ? -54.449  -67.741  49.259  1.00 2.82  ? 138 LEU D CA  1 
ATOM   5126  C  C   . LEU D  1 138 ? -53.177  -67.408  50.040  1.00 3.76  ? 138 LEU D C   1 
ATOM   5127  O  O   . LEU D  1 138 ? -53.259  -66.794  51.096  1.00 4.47  ? 138 LEU D O   1 
ATOM   5128  C  CB  . LEU D  1 138 ? -54.951  -69.127  49.634  1.00 2.54  ? 138 LEU D CB  1 
ATOM   5129  C  CG  . LEU D  1 138 ? -56.371  -69.407  49.193  1.00 2.98  ? 138 LEU D CG  1 
ATOM   5130  C  CD1 . LEU D  1 138 ? -56.618  -70.860  49.412  1.00 3.73  ? 138 LEU D CD1 1 
ATOM   5131  C  CD2 . LEU D  1 138 ? -57.381  -68.568  49.972  1.00 2.80  ? 138 LEU D CD2 1 
ATOM   5132  N  N   . ASP D  1 139 ? -52.014  -67.806  49.540  1.00 3.95  ? 139 ASP D N   1 
ATOM   5133  C  CA  . ASP D  1 139 ? -50.777  -67.465  50.208  1.00 4.63  ? 139 ASP D CA  1 
ATOM   5134  C  C   . ASP D  1 139 ? -50.463  -65.970  50.068  1.00 4.43  ? 139 ASP D C   1 
ATOM   5135  O  O   . ASP D  1 139 ? -49.922  -65.352  50.988  1.00 4.46  ? 139 ASP D O   1 
ATOM   5136  C  CB  . ASP D  1 139 ? -49.592  -68.278  49.682  1.00 5.26  ? 139 ASP D CB  1 
ATOM   5137  C  CG  . ASP D  1 139 ? -49.619  -69.774  50.119  1.00 8.76  ? 139 ASP D CG  1 
ATOM   5138  O  OD1 . ASP D  1 139 ? -50.426  -70.210  50.997  1.00 10.90 ? 139 ASP D OD1 1 
ATOM   5139  O  OD2 . ASP D  1 139 ? -48.782  -70.527  49.559  1.00 11.24 ? 139 ASP D OD2 1 
ATOM   5140  N  N   . LEU D  1 140 ? -50.802  -65.382  48.929  1.00 3.86  ? 140 LEU D N   1 
ATOM   5141  C  CA  . LEU D  1 140 ? -50.561  -63.959  48.766  1.00 4.26  ? 140 LEU D CA  1 
ATOM   5142  C  C   . LEU D  1 140 ? -51.352  -63.169  49.779  1.00 4.78  ? 140 LEU D C   1 
ATOM   5143  O  O   . LEU D  1 140 ? -50.841  -62.185  50.307  1.00 5.75  ? 140 LEU D O   1 
ATOM   5144  C  CB  . LEU D  1 140 ? -50.893  -63.469  47.356  1.00 3.89  ? 140 LEU D CB  1 
ATOM   5145  C  CG  . LEU D  1 140 ? -49.873  -63.828  46.270  1.00 3.78  ? 140 LEU D CG  1 
ATOM   5146  C  CD1 . LEU D  1 140 ? -50.433  -63.511  44.876  1.00 2.00  ? 140 LEU D CD1 1 
ATOM   5147  C  CD2 . LEU D  1 140 ? -48.525  -63.147  46.510  1.00 2.00  ? 140 LEU D CD2 1 
ATOM   5148  N  N   . ILE D  1 141 ? -52.592  -63.588  50.057  1.00 4.73  ? 141 ILE D N   1 
ATOM   5149  C  CA  . ILE D  1 141 ? -53.422  -62.894  51.021  1.00 4.68  ? 141 ILE D CA  1 
ATOM   5150  C  C   . ILE D  1 141 ? -52.731  -62.848  52.384  1.00 6.34  ? 141 ILE D C   1 
ATOM   5151  O  O   . ILE D  1 141 ? -52.733  -61.801  53.029  1.00 7.33  ? 141 ILE D O   1 
ATOM   5152  C  CB  . ILE D  1 141 ? -54.802  -63.539  51.170  1.00 4.87  ? 141 ILE D CB  1 
ATOM   5153  C  CG1 . ILE D  1 141 ? -55.628  -63.434  49.869  1.00 4.08  ? 141 ILE D CG1 1 
ATOM   5154  C  CG2 . ILE D  1 141 ? -55.558  -62.932  52.366  1.00 3.51  ? 141 ILE D CG2 1 
ATOM   5155  C  CD1 . ILE D  1 141 ? -56.973  -64.182  49.953  1.00 3.33  ? 141 ILE D CD1 1 
ATOM   5156  N  N   . GLN D  1 142 ? -52.130  -63.959  52.826  1.00 7.39  ? 142 GLN D N   1 
ATOM   5157  C  CA  . GLN D  1 142 ? -51.405  -63.964  54.099  1.00 8.51  ? 142 GLN D CA  1 
ATOM   5158  C  C   . GLN D  1 142 ? -50.128  -63.139  54.021  1.00 8.11  ? 142 GLN D C   1 
ATOM   5159  O  O   . GLN D  1 142 ? -49.773  -62.449  54.979  1.00 8.42  ? 142 GLN D O   1 
ATOM   5160  C  CB  . GLN D  1 142 ? -51.081  -65.385  54.616  1.00 9.09  ? 142 GLN D CB  1 
ATOM   5161  C  CG  . GLN D  1 142 ? -52.325  -66.278  54.836  1.00 13.48 ? 142 GLN D CG  1 
ATOM   5162  C  CD  . GLN D  1 142 ? -53.340  -65.726  55.901  1.00 19.48 ? 142 GLN D CD  1 
ATOM   5163  O  OE1 . GLN D  1 142 ? -53.072  -65.742  57.132  1.00 19.84 ? 142 GLN D OE1 1 
ATOM   5164  N  NE2 . GLN D  1 142 ? -54.514  -65.263  55.419  1.00 18.92 ? 142 GLN D NE2 1 
ATOM   5165  N  N   . LYS D  1 143 ? -49.427  -63.201  52.898  1.00 7.62  ? 143 LYS D N   1 
ATOM   5166  C  CA  . LYS D  1 143 ? -48.093  -62.595  52.855  1.00 7.75  ? 143 LYS D CA  1 
ATOM   5167  C  C   . LYS D  1 143 ? -48.185  -61.076  52.782  1.00 7.75  ? 143 LYS D C   1 
ATOM   5168  O  O   . LYS D  1 143 ? -47.403  -60.378  53.439  1.00 8.49  ? 143 LYS D O   1 
ATOM   5169  C  CB  . LYS D  1 143 ? -47.232  -63.127  51.710  1.00 7.65  ? 143 LYS D CB  1 
ATOM   5170  C  CG  . LYS D  1 143 ? -46.880  -64.598  51.837  1.00 9.63  ? 143 LYS D CG  1 
ATOM   5171  C  CD  . LYS D  1 143 ? -45.720  -64.974  50.890  1.00 13.36 ? 143 LYS D CD  1 
ATOM   5172  C  CE  . LYS D  1 143 ? -45.553  -66.494  50.673  1.00 13.02 ? 143 LYS D CE  1 
ATOM   5173  N  NZ  . LYS D  1 143 ? -46.035  -66.650  49.280  1.00 16.83 ? 143 LYS D NZ  1 
ATOM   5174  N  N   . MET D  1 144 ? -49.145  -60.553  52.014  1.00 7.13  ? 144 MET D N   1 
ATOM   5175  C  CA  . MET D  1 144 ? -49.232  -59.101  51.835  1.00 6.81  ? 144 MET D CA  1 
ATOM   5176  C  C   . MET D  1 144 ? -50.338  -58.455  52.675  1.00 5.70  ? 144 MET D C   1 
ATOM   5177  O  O   . MET D  1 144 ? -50.392  -57.202  52.776  1.00 5.43  ? 144 MET D O   1 
ATOM   5178  C  CB  . MET D  1 144 ? -49.336  -58.710  50.350  1.00 6.25  ? 144 MET D CB  1 
ATOM   5179  C  CG  . MET D  1 144 ? -50.701  -58.900  49.760  1.00 6.65  ? 144 MET D CG  1 
ATOM   5180  S  SD  . MET D  1 144 ? -50.769  -58.477  47.987  1.00 10.16 ? 144 MET D SD  1 
ATOM   5181  C  CE  . MET D  1 144 ? -49.655  -59.730  47.374  1.00 10.32 ? 144 MET D CE  1 
ATOM   5182  N  N   . GLY D  1 145 ? -51.185  -59.300  53.282  1.00 4.51  ? 145 GLY D N   1 
ATOM   5183  C  CA  . GLY D  1 145 ? -52.322  -58.854  54.096  1.00 3.26  ? 145 GLY D CA  1 
ATOM   5184  C  C   . GLY D  1 145 ? -53.566  -58.625  53.268  1.00 3.25  ? 145 GLY D C   1 
ATOM   5185  O  O   . GLY D  1 145 ? -53.485  -58.391  52.068  1.00 3.31  ? 145 GLY D O   1 
ATOM   5186  N  N   . LEU D  1 146 ? -54.734  -58.691  53.887  1.00 3.12  ? 146 LEU D N   1 
ATOM   5187  C  CA  . LEU D  1 146 ? -55.978  -58.629  53.124  1.00 2.62  ? 146 LEU D CA  1 
ATOM   5188  C  C   . LEU D  1 146 ? -56.208  -57.276  52.414  1.00 2.76  ? 146 LEU D C   1 
ATOM   5189  O  O   . LEU D  1 146 ? -56.551  -57.251  51.244  1.00 3.06  ? 146 LEU D O   1 
ATOM   5190  C  CB  . LEU D  1 146 ? -57.157  -59.015  54.010  1.00 3.00  ? 146 LEU D CB  1 
ATOM   5191  C  CG  . LEU D  1 146 ? -58.547  -59.028  53.354  1.00 3.65  ? 146 LEU D CG  1 
ATOM   5192  C  CD1 . LEU D  1 146 ? -58.567  -59.961  52.115  1.00 2.08  ? 146 LEU D CD1 1 
ATOM   5193  C  CD2 . LEU D  1 146 ? -59.661  -59.361  54.359  1.00 2.00  ? 146 LEU D CD2 1 
ATOM   5194  N  N   . GLN D  1 147 ? -55.997  -56.162  53.108  1.00 2.75  ? 147 GLN D N   1 
ATOM   5195  C  CA  . GLN D  1 147 ? -56.156  -54.841  52.515  1.00 2.50  ? 147 GLN D CA  1 
ATOM   5196  C  C   . GLN D  1 147 ? -55.325  -54.647  51.252  1.00 2.79  ? 147 GLN D C   1 
ATOM   5197  O  O   . GLN D  1 147 ? -55.864  -54.290  50.227  1.00 3.25  ? 147 GLN D O   1 
ATOM   5198  C  CB  . GLN D  1 147 ? -55.874  -53.749  53.537  1.00 2.27  ? 147 GLN D CB  1 
ATOM   5199  C  CG  . GLN D  1 147 ? -56.853  -53.761  54.692  1.00 2.01  ? 147 GLN D CG  1 
ATOM   5200  C  CD  . GLN D  1 147 ? -56.755  -52.533  55.580  1.00 2.83  ? 147 GLN D CD  1 
ATOM   5201  O  OE1 . GLN D  1 147 ? -55.669  -52.075  55.896  1.00 3.63  ? 147 GLN D OE1 1 
ATOM   5202  N  NE2 . GLN D  1 147 ? -57.897  -51.991  55.977  1.00 2.22  ? 147 GLN D NE2 1 
ATOM   5203  N  N   . ASN D  1 148 ? -54.026  -54.916  51.316  1.00 3.17  ? 148 ASN D N   1 
ATOM   5204  C  CA  . ASN D  1 148 ? -53.177  -54.871  50.129  1.00 3.73  ? 148 ASN D CA  1 
ATOM   5205  C  C   . ASN D  1 148 ? -53.600  -55.852  49.039  1.00 4.44  ? 148 ASN D C   1 
ATOM   5206  O  O   . ASN D  1 148 ? -53.499  -55.575  47.840  1.00 5.30  ? 148 ASN D O   1 
ATOM   5207  C  CB  . ASN D  1 148 ? -51.729  -55.142  50.481  1.00 3.88  ? 148 ASN D CB  1 
ATOM   5208  C  CG  . ASN D  1 148 ? -50.987  -53.913  50.988  1.00 3.65  ? 148 ASN D CG  1 
ATOM   5209  O  OD1 . ASN D  1 148 ? -49.838  -54.018  51.372  1.00 5.74  ? 148 ASN D OD1 1 
ATOM   5210  N  ND2 . ASN D  1 148 ? -51.618  -52.772  50.990  1.00 3.48  ? 148 ASN D ND2 1 
ATOM   5211  N  N   . TYR D  1 149 ? -54.070  -57.016  49.432  1.00 4.23  ? 149 TYR D N   1 
ATOM   5212  C  CA  . TYR D  1 149 ? -54.471  -57.965  48.438  1.00 4.69  ? 149 TYR D CA  1 
ATOM   5213  C  C   . TYR D  1 149 ? -55.677  -57.466  47.646  1.00 4.79  ? 149 TYR D C   1 
ATOM   5214  O  O   . TYR D  1 149 ? -55.730  -57.594  46.424  1.00 4.35  ? 149 TYR D O   1 
ATOM   5215  C  CB  . TYR D  1 149 ? -54.810  -59.290  49.087  1.00 5.01  ? 149 TYR D CB  1 
ATOM   5216  C  CG  . TYR D  1 149 ? -55.258  -60.318  48.096  1.00 5.17  ? 149 TYR D CG  1 
ATOM   5217  C  CD1 . TYR D  1 149 ? -54.328  -61.046  47.361  1.00 4.34  ? 149 TYR D CD1 1 
ATOM   5218  C  CD2 . TYR D  1 149 ? -56.623  -60.560  47.877  1.00 5.90  ? 149 TYR D CD2 1 
ATOM   5219  C  CE1 . TYR D  1 149 ? -54.752  -62.020  46.425  1.00 6.74  ? 149 TYR D CE1 1 
ATOM   5220  C  CE2 . TYR D  1 149 ? -57.064  -61.536  46.952  1.00 5.64  ? 149 TYR D CE2 1 
ATOM   5221  C  CZ  . TYR D  1 149 ? -56.122  -62.262  46.238  1.00 5.96  ? 149 TYR D CZ  1 
ATOM   5222  O  OH  . TYR D  1 149 ? -56.517  -63.202  45.328  1.00 5.20  ? 149 TYR D OH  1 
ATOM   5223  N  N   . LEU D  1 150 ? -56.658  -56.928  48.357  1.00 5.13  ? 150 LEU D N   1 
ATOM   5224  C  CA  . LEU D  1 150 ? -57.838  -56.380  47.723  1.00 4.75  ? 150 LEU D CA  1 
ATOM   5225  C  C   . LEU D  1 150 ? -57.455  -55.240  46.820  1.00 5.05  ? 150 LEU D C   1 
ATOM   5226  O  O   . LEU D  1 150 ? -57.912  -55.217  45.688  1.00 6.06  ? 150 LEU D O   1 
ATOM   5227  C  CB  . LEU D  1 150 ? -58.845  -55.907  48.735  1.00 4.39  ? 150 LEU D CB  1 
ATOM   5228  C  CG  . LEU D  1 150 ? -60.002  -56.769  49.212  1.00 4.64  ? 150 LEU D CG  1 
ATOM   5229  C  CD1 . LEU D  1 150 ? -59.936  -58.236  48.862  1.00 5.74  ? 150 LEU D CD1 1 
ATOM   5230  C  CD2 . LEU D  1 150 ? -60.159  -56.570  50.695  1.00 4.20  ? 150 LEU D CD2 1 
ATOM   5231  N  N   . GLN D  1 151 ? -56.605  -54.308  47.263  1.00 4.92  ? 151 GLN D N   1 
ATOM   5232  C  CA  . GLN D  1 151 ? -56.248  -53.180  46.385  1.00 4.76  ? 151 GLN D CA  1 
ATOM   5233  C  C   . GLN D  1 151 ? -55.654  -53.693  45.053  1.00 4.77  ? 151 GLN D C   1 
ATOM   5234  O  O   . GLN D  1 151 ? -55.864  -53.130  43.986  1.00 5.04  ? 151 GLN D O   1 
ATOM   5235  C  CB  . GLN D  1 151 ? -55.282  -52.231  47.085  1.00 4.43  ? 151 GLN D CB  1 
ATOM   5236  C  CG  . GLN D  1 151 ? -54.713  -51.130  46.203  1.00 4.15  ? 151 GLN D CG  1 
ATOM   5237  C  CD  . GLN D  1 151 ? -53.478  -50.542  46.786  1.00 4.80  ? 151 GLN D CD  1 
ATOM   5238  O  OE1 . GLN D  1 151 ? -52.944  -51.070  47.702  1.00 8.39  ? 151 GLN D OE1 1 
ATOM   5239  N  NE2 . GLN D  1 151 ? -53.022  -49.452  46.260  1.00 7.25  ? 151 GLN D NE2 1 
ATOM   5240  N  N   . ALA D  1 152 ? -54.936  -54.794  45.127  1.00 4.78  ? 152 ALA D N   1 
ATOM   5241  C  CA  . ALA D  1 152 ? -54.308  -55.346  43.971  1.00 4.77  ? 152 ALA D CA  1 
ATOM   5242  C  C   . ALA D  1 152 ? -55.288  -56.008  43.005  1.00 5.28  ? 152 ALA D C   1 
ATOM   5243  O  O   . ALA D  1 152 ? -54.870  -56.411  41.917  1.00 5.99  ? 152 ALA D O   1 
ATOM   5244  C  CB  . ALA D  1 152 ? -53.268  -56.317  44.396  1.00 4.78  ? 152 ALA D CB  1 
ATOM   5245  N  N   . GLN D  1 153 ? -56.570  -56.121  43.371  1.00 5.06  ? 153 GLN D N   1 
ATOM   5246  C  CA  . GLN D  1 153 ? -57.578  -56.763  42.495  1.00 5.36  ? 153 GLN D CA  1 
ATOM   5247  C  C   . GLN D  1 153 ? -58.464  -55.764  41.763  1.00 5.87  ? 153 GLN D C   1 
ATOM   5248  O  O   . GLN D  1 153 ? -59.322  -56.159  40.975  1.00 5.79  ? 153 GLN D O   1 
ATOM   5249  C  CB  . GLN D  1 153 ? -58.512  -57.705  43.288  1.00 5.13  ? 153 GLN D CB  1 
ATOM   5250  C  CG  . GLN D  1 153 ? -57.834  -58.697  44.175  1.00 5.25  ? 153 GLN D CG  1 
ATOM   5251  C  CD  . GLN D  1 153 ? -56.654  -59.400  43.521  1.00 6.69  ? 153 GLN D CD  1 
ATOM   5252  O  OE1 . GLN D  1 153 ? -56.683  -59.780  42.336  1.00 6.53  ? 153 GLN D OE1 1 
ATOM   5253  N  NE2 . GLN D  1 153 ? -55.600  -59.578  44.305  1.00 7.57  ? 153 GLN D NE2 1 
ATOM   5254  N  N   . ILE D  1 154 ? -58.284  -54.484  42.054  1.00 6.73  ? 154 ILE D N   1 
ATOM   5255  C  CA  . ILE D  1 154 ? -59.183  -53.457  41.588  1.00 8.53  ? 154 ILE D CA  1 
ATOM   5256  C  C   . ILE D  1 154 ? -59.087  -53.219  40.090  1.00 9.67  ? 154 ILE D C   1 
ATOM   5257  O  O   . ILE D  1 154 ? -60.066  -52.855  39.459  1.00 10.60 ? 154 ILE D O   1 
ATOM   5258  C  CB  . ILE D  1 154 ? -58.852  -52.143  42.292  1.00 8.70  ? 154 ILE D CB  1 
ATOM   5259  C  CG1 . ILE D  1 154 ? -59.561  -52.029  43.619  1.00 9.46  ? 154 ILE D CG1 1 
ATOM   5260  C  CG2 . ILE D  1 154 ? -59.263  -50.929  41.466  1.00 9.44  ? 154 ILE D CG2 1 
ATOM   5261  C  CD1 . ILE D  1 154 ? -59.155  -50.675  44.251  1.00 11.53 ? 154 ILE D CD1 1 
ATOM   5262  N  N   A ARG D  1 155 ? -57.897  -53.409  39.531  0.70 10.40 ? 155 ARG D N   1 
ATOM   5263  N  N   B ARG D  1 155 ? -57.910  -53.370  39.505  0.30 10.34 ? 155 ARG D N   1 
ATOM   5264  C  CA  A ARG D  1 155 ? -57.660  -53.181  38.099  0.70 11.68 ? 155 ARG D CA  1 
ATOM   5265  C  CA  B ARG D  1 155 ? -57.835  -53.213  38.055  0.30 11.35 ? 155 ARG D CA  1 
ATOM   5266  C  C   A ARG D  1 155 ? -57.405  -54.507  37.367  0.70 12.70 ? 155 ARG D C   1 
ATOM   5267  C  C   B ARG D  1 155 ? -57.429  -54.492  37.365  0.30 12.34 ? 155 ARG D C   1 
ATOM   5268  O  O   A ARG D  1 155 ? -56.744  -55.409  37.917  0.70 13.31 ? 155 ARG D O   1 
ATOM   5269  O  O   B ARG D  1 155 ? -56.674  -55.307  37.915  0.30 12.65 ? 155 ARG D O   1 
ATOM   5270  C  CB  A ARG D  1 155 ? -56.483  -52.223  37.933  0.70 11.21 ? 155 ARG D CB  1 
ATOM   5271  C  CB  B ARG D  1 155 ? -56.931  -52.061  37.641  0.30 11.14 ? 155 ARG D CB  1 
ATOM   5272  C  CG  A ARG D  1 155 ? -56.710  -50.830  38.611  0.70 11.75 ? 155 ARG D CG  1 
ATOM   5273  C  CG  B ARG D  1 155 ? -55.749  -51.824  38.548  0.30 11.36 ? 155 ARG D CG  1 
ATOM   5274  C  CD  A ARG D  1 155 ? -55.396  -50.034  38.661  0.70 12.71 ? 155 ARG D CD  1 
ATOM   5275  C  CD  B ARG D  1 155 ? -54.815  -50.806  37.921  0.30 12.14 ? 155 ARG D CD  1 
ATOM   5276  N  NE  A ARG D  1 155 ? -55.536  -48.623  39.058  0.70 14.27 ? 155 ARG D NE  1 
ATOM   5277  N  NE  B ARG D  1 155 ? -53.975  -51.417  36.896  0.30 13.25 ? 155 ARG D NE  1 
ATOM   5278  C  CZ  A ARG D  1 155 ? -55.561  -47.585  38.202  0.70 14.74 ? 155 ARG D CZ  1 
ATOM   5279  C  CZ  B ARG D  1 155 ? -53.207  -50.747  36.042  0.30 13.42 ? 155 ARG D CZ  1 
ATOM   5280  N  NH1 A ARG D  1 155 ? -55.485  -47.770  36.878  0.70 13.79 ? 155 ARG D NH1 1 
ATOM   5281  N  NH1 B ARG D  1 155 ? -53.155  -49.421  36.077  0.30 13.11 ? 155 ARG D NH1 1 
ATOM   5282  N  NH2 A ARG D  1 155 ? -55.684  -46.340  38.670  0.70 13.92 ? 155 ARG D NH2 1 
ATOM   5283  N  NH2 B ARG D  1 155 ? -52.481  -51.410  35.155  0.30 12.58 ? 155 ARG D NH2 1 
ATOM   5284  N  N   . GLU D  1 156 ? -57.946  -54.665  36.152  1.00 13.52 ? 156 GLU D N   1 
ATOM   5285  C  CA  . GLU D  1 156 ? -57.754  -55.925  35.435  1.00 14.98 ? 156 GLU D CA  1 
ATOM   5286  C  C   . GLU D  1 156 ? -56.334  -56.021  34.905  1.00 16.89 ? 156 GLU D C   1 
ATOM   5287  O  O   . GLU D  1 156 ? -55.707  -54.990  34.583  1.00 17.53 ? 156 GLU D O   1 
ATOM   5288  C  CB  . GLU D  1 156 ? -58.767  -56.124  34.342  1.00 14.56 ? 156 GLU D CB  1 
ATOM   5289  C  CG  . GLU D  1 156 ? -59.125  -54.908  33.569  1.00 16.04 ? 156 GLU D CG  1 
ATOM   5290  C  CD  . GLU D  1 156 ? -60.505  -55.096  32.918  1.00 21.04 ? 156 GLU D CD  1 
ATOM   5291  O  OE1 . GLU D  1 156 ? -61.183  -56.108  33.280  1.00 20.99 ? 156 GLU D OE1 1 
ATOM   5292  O  OE2 . GLU D  1 156 ? -60.915  -54.242  32.065  1.00 23.05 ? 156 GLU D OE2 1 
ATOM   5293  N  N   . GLU D  1 157 ? -55.801  -57.245  34.856  1.00 18.94 ? 157 GLU D N   1 
ATOM   5294  C  CA  . GLU D  1 157 ? -54.417  -57.419  34.364  1.00 20.31 ? 157 GLU D CA  1 
ATOM   5295  C  C   . GLU D  1 157 ? -54.414  -57.475  32.817  1.00 20.73 ? 157 GLU D C   1 
ATOM   5296  O  O   . GLU D  1 157 ? -55.147  -58.296  32.223  1.00 20.43 ? 157 GLU D O   1 
ATOM   5297  C  CB  . GLU D  1 157 ? -53.650  -58.619  35.011  1.00 19.90 ? 157 GLU D CB  1 
ATOM   5298  C  CG  . GLU D  1 157 ? -52.090  -58.328  35.098  1.00 20.90 ? 157 GLU D CG  1 
ATOM   5299  C  CD  . GLU D  1 157 ? -51.199  -59.582  35.253  1.00 21.10 ? 157 GLU D CD  1 
ATOM   5300  O  OE1 . GLU D  1 157 ? -51.676  -60.590  35.873  1.00 20.43 ? 157 GLU D OE1 1 
ATOM   5301  O  OE2 . GLU D  1 157 ? -50.018  -59.512  34.767  1.00 20.09 ? 157 GLU D OE2 1 
ATOM   5302  N  N   . GLY D  1 158 ? -53.630  -56.564  32.199  1.00 21.43 ? 158 GLY D N   1 
ATOM   5303  C  CA  . GLY D  1 158 ? -53.478  -56.493  30.721  1.00 21.83 ? 158 GLY D CA  1 
ATOM   5304  C  C   . GLY D  1 158 ? -52.699  -57.689  30.149  1.00 21.63 ? 158 GLY D C   1 
ATOM   5305  N  N   . MET E  1 1   ? -4.561   -31.065  -19.958 1.00 7.49  ? 1   MET E N   1 
ATOM   5306  C  CA  . MET E  1 1   ? -3.368   -31.830  -20.441 1.00 8.46  ? 1   MET E CA  1 
ATOM   5307  C  C   . MET E  1 1   ? -3.102   -31.423  -21.879 1.00 8.23  ? 1   MET E C   1 
ATOM   5308  O  O   . MET E  1 1   ? -4.013   -31.480  -22.665 1.00 8.31  ? 1   MET E O   1 
ATOM   5309  C  CB  . MET E  1 1   ? -3.716   -33.300  -20.365 1.00 7.81  ? 1   MET E CB  1 
ATOM   5310  C  CG  . MET E  1 1   ? -2.575   -34.259  -20.393 1.00 7.88  ? 1   MET E CG  1 
ATOM   5311  S  SD  . MET E  1 1   ? -3.375   -35.853  -20.201 1.00 10.93 ? 1   MET E SD  1 
ATOM   5312  C  CE  . MET E  1 1   ? -3.866   -36.259  -21.889 1.00 5.73  ? 1   MET E CE  1 
ATOM   5313  N  N   . LYS E  1 2   ? -1.901   -30.975  -22.230 1.00 9.06  ? 2   LYS E N   1 
ATOM   5314  C  CA  . LYS E  1 2   ? -1.656   -30.488  -23.614 1.00 10.64 ? 2   LYS E CA  1 
ATOM   5315  C  C   . LYS E  1 2   ? -1.682   -31.656  -24.591 1.00 9.28  ? 2   LYS E C   1 
ATOM   5316  O  O   . LYS E  1 2   ? -0.809   -32.527  -24.520 1.00 9.83  ? 2   LYS E O   1 
ATOM   5317  C  CB  . LYS E  1 2   ? -0.286   -29.792  -23.733 1.00 10.62 ? 2   LYS E CB  1 
ATOM   5318  C  CG  . LYS E  1 2   ? -0.347   -28.371  -24.315 1.00 14.38 ? 2   LYS E CG  1 
ATOM   5319  C  CD  . LYS E  1 2   ? 0.911    -27.966  -25.161 1.00 15.09 ? 2   LYS E CD  1 
ATOM   5320  C  CE  . LYS E  1 2   ? 0.878    -28.623  -26.581 1.00 19.15 ? 2   LYS E CE  1 
ATOM   5321  N  NZ  . LYS E  1 2   ? 1.737    -27.881  -27.569 1.00 19.88 ? 2   LYS E NZ  1 
ATOM   5322  N  N   . GLY E  1 3   ? -2.663   -31.685  -25.488 1.00 8.19  ? 3   GLY E N   1 
ATOM   5323  C  CA  . GLY E  1 3   ? -2.782   -32.789  -26.450 1.00 6.88  ? 3   GLY E CA  1 
ATOM   5324  C  C   . GLY E  1 3   ? -1.926   -32.622  -27.689 1.00 6.23  ? 3   GLY E C   1 
ATOM   5325  O  O   . GLY E  1 3   ? -1.299   -31.594  -27.871 1.00 6.60  ? 3   GLY E O   1 
ATOM   5326  N  N   . ASP E  1 4   ? -1.901   -33.630  -28.550 1.00 5.88  ? 4   ASP E N   1 
ATOM   5327  C  CA  . ASP E  1 4   ? -1.232   -33.527  -29.837 1.00 5.69  ? 4   ASP E CA  1 
ATOM   5328  C  C   . ASP E  1 4   ? -2.030   -32.576  -30.728 1.00 5.83  ? 4   ASP E C   1 
ATOM   5329  O  O   . ASP E  1 4   ? -3.242   -32.696  -30.824 1.00 6.66  ? 4   ASP E O   1 
ATOM   5330  C  CB  . ASP E  1 4   ? -1.096   -34.906  -30.442 1.00 5.43  ? 4   ASP E CB  1 
ATOM   5331  C  CG  . ASP E  1 4   ? -0.568   -34.888  -31.850 1.00 6.94  ? 4   ASP E CG  1 
ATOM   5332  O  OD1 . ASP E  1 4   ? -1.393   -34.792  -32.796 1.00 9.32  ? 4   ASP E OD1 1 
ATOM   5333  O  OD2 . ASP E  1 4   ? 0.670    -35.013  -32.031 1.00 6.97  ? 4   ASP E OD2 1 
ATOM   5334  N  N   . THR E  1 5   ? -1.357   -31.607  -31.339 1.00 5.76  ? 5   THR E N   1 
ATOM   5335  C  CA  . THR E  1 5   ? -2.010   -30.590  -32.181 1.00 5.87  ? 5   THR E CA  1 
ATOM   5336  C  C   . THR E  1 5   ? -2.836   -31.188  -33.318 1.00 5.62  ? 5   THR E C   1 
ATOM   5337  O  O   . THR E  1 5   ? -3.949   -30.734  -33.617 1.00 5.73  ? 5   THR E O   1 
ATOM   5338  C  CB  . THR E  1 5   ? -0.953   -29.621  -32.791 1.00 6.01  ? 5   THR E CB  1 
ATOM   5339  O  OG1 . THR E  1 5   ? -0.304   -28.948  -31.722 1.00 7.12  ? 5   THR E OG1 1 
ATOM   5340  C  CG2 . THR E  1 5   ? -1.599   -28.550  -33.689 1.00 5.35  ? 5   THR E CG2 1 
ATOM   5341  N  N   . LYS E  1 6   ? -2.265   -32.187  -33.976 1.00 5.11  ? 6   LYS E N   1 
ATOM   5342  C  CA  . LYS E  1 6   ? -2.907   -32.759  -35.139 1.00 4.76  ? 6   LYS E CA  1 
ATOM   5343  C  C   . LYS E  1 6   ? -4.154   -33.549  -34.689 1.00 4.70  ? 6   LYS E C   1 
ATOM   5344  O  O   . LYS E  1 6   ? -5.167   -33.562  -35.397 1.00 4.98  ? 6   LYS E O   1 
ATOM   5345  C  CB  . LYS E  1 6   ? -1.903   -33.587  -35.948 1.00 4.16  ? 6   LYS E CB  1 
ATOM   5346  C  CG  . LYS E  1 6   ? -2.519   -34.266  -37.130 1.00 6.56  ? 6   LYS E CG  1 
ATOM   5347  C  CD  . LYS E  1 6   ? -1.581   -34.392  -38.350 1.00 9.49  ? 6   LYS E CD  1 
ATOM   5348  C  CE  . LYS E  1 6   ? -2.333   -33.814  -39.622 1.00 13.27 ? 6   LYS E CE  1 
ATOM   5349  N  NZ  . LYS E  1 6   ? -2.640   -34.824  -40.688 1.00 17.03 ? 6   LYS E NZ  1 
ATOM   5350  N  N   . VAL E  1 7   ? -4.101   -34.180  -33.510 1.00 3.68  ? 7   VAL E N   1 
ATOM   5351  C  CA  . VAL E  1 7   ? -5.307   -34.802  -32.956 1.00 3.13  ? 7   VAL E CA  1 
ATOM   5352  C  C   . VAL E  1 7   ? -6.425   -33.775  -32.759 1.00 3.16  ? 7   VAL E C   1 
ATOM   5353  O  O   . VAL E  1 7   ? -7.595   -34.041  -33.076 1.00 3.06  ? 7   VAL E O   1 
ATOM   5354  C  CB  . VAL E  1 7   ? -5.057   -35.531  -31.617 1.00 3.09  ? 7   VAL E CB  1 
ATOM   5355  C  CG1 . VAL E  1 7   ? -6.386   -35.930  -30.945 1.00 2.00  ? 7   VAL E CG1 1 
ATOM   5356  C  CG2 . VAL E  1 7   ? -4.212   -36.765  -31.850 1.00 2.49  ? 7   VAL E CG2 1 
ATOM   5357  N  N   . ILE E  1 8   ? -6.062   -32.611  -32.223 1.00 2.79  ? 8   ILE E N   1 
ATOM   5358  C  CA  . ILE E  1 8   ? -7.015   -31.549  -32.035 1.00 2.55  ? 8   ILE E CA  1 
ATOM   5359  C  C   . ILE E  1 8   ? -7.581   -31.102  -33.384 1.00 3.36  ? 8   ILE E C   1 
ATOM   5360  O  O   . ILE E  1 8   ? -8.791   -30.901  -33.476 1.00 3.27  ? 8   ILE E O   1 
ATOM   5361  C  CB  . ILE E  1 8   ? -6.422   -30.393  -31.249 1.00 2.68  ? 8   ILE E CB  1 
ATOM   5362  C  CG1 . ILE E  1 8   ? -6.164   -30.821  -29.807 1.00 3.41  ? 8   ILE E CG1 1 
ATOM   5363  C  CG2 . ILE E  1 8   ? -7.354   -29.191  -31.262 1.00 2.63  ? 8   ILE E CG2 1 
ATOM   5364  C  CD1 . ILE E  1 8   ? -5.181   -29.957  -29.043 1.00 2.72  ? 8   ILE E CD1 1 
ATOM   5365  N  N   . ASN E  1 9   ? -6.738   -30.973  -34.429 1.00 4.00  ? 9   ASN E N   1 
ATOM   5366  C  CA  . ASN E  1 9   ? -7.235   -30.617  -35.763 1.00 4.75  ? 9   ASN E CA  1 
ATOM   5367  C  C   . ASN E  1 9   ? -8.263   -31.653  -36.227 1.00 4.42  ? 9   ASN E C   1 
ATOM   5368  O  O   . ASN E  1 9   ? -9.317   -31.304  -36.765 1.00 4.84  ? 9   ASN E O   1 
ATOM   5369  C  CB  . ASN E  1 9   ? -6.119   -30.479  -36.816 1.00 5.78  ? 9   ASN E CB  1 
ATOM   5370  C  CG  . ASN E  1 9   ? -5.246   -29.230  -36.624 1.00 10.54 ? 9   ASN E CG  1 
ATOM   5371  O  OD1 . ASN E  1 9   ? -5.745   -28.167  -36.320 1.00 19.61 ? 9   ASN E OD1 1 
ATOM   5372  N  ND2 . ASN E  1 9   ? -3.934   -29.358  -36.833 1.00 12.19 ? 9   ASN E ND2 1 
ATOM   5373  N  N   . TYR E  1 10  ? -7.959   -32.926  -36.017 1.00 3.60  ? 10  TYR E N   1 
ATOM   5374  C  CA  . TYR E  1 10  ? -8.867   -33.968  -36.411 1.00 3.23  ? 10  TYR E CA  1 
ATOM   5375  C  C   . TYR E  1 10  ? -10.176  -33.855  -35.630 1.00 3.22  ? 10  TYR E C   1 
ATOM   5376  O  O   . TYR E  1 10  ? -11.246  -33.902  -36.234 1.00 3.24  ? 10  TYR E O   1 
ATOM   5377  C  CB  . TYR E  1 10  ? -8.258   -35.337  -36.183 1.00 3.20  ? 10  TYR E CB  1 
ATOM   5378  C  CG  . TYR E  1 10  ? -7.503   -35.879  -37.345 1.00 3.09  ? 10  TYR E CG  1 
ATOM   5379  C  CD1 . TYR E  1 10  ? -8.126   -36.056  -38.579 1.00 2.00  ? 10  TYR E CD1 1 
ATOM   5380  C  CD2 . TYR E  1 10  ? -6.164   -36.267  -37.195 1.00 2.36  ? 10  TYR E CD2 1 
ATOM   5381  C  CE1 . TYR E  1 10  ? -7.448   -36.584  -39.654 1.00 2.59  ? 10  TYR E CE1 1 
ATOM   5382  C  CE2 . TYR E  1 10  ? -5.461   -36.797  -38.255 1.00 2.13  ? 10  TYR E CE2 1 
ATOM   5383  C  CZ  . TYR E  1 10  ? -6.107   -36.946  -39.479 1.00 3.90  ? 10  TYR E CZ  1 
ATOM   5384  O  OH  . TYR E  1 10  ? -5.402   -37.467  -40.520 1.00 4.49  ? 10  TYR E OH  1 
ATOM   5385  N  N   . LEU E  1 11  ? -10.076  -33.697  -34.307 1.00 2.63  ? 11  LEU E N   1 
ATOM   5386  C  CA  . LEU E  1 11  ? -11.239  -33.525  -33.474 1.00 2.10  ? 11  LEU E CA  1 
ATOM   5387  C  C   . LEU E  1 11  ? -12.109  -32.360  -33.982 1.00 2.49  ? 11  LEU E C   1 
ATOM   5388  O  O   . LEU E  1 11  ? -13.341  -32.501  -34.068 1.00 2.51  ? 11  LEU E O   1 
ATOM   5389  C  CB  . LEU E  1 11  ? -10.822  -33.337  -32.032 1.00 2.00  ? 11  LEU E CB  1 
ATOM   5390  C  CG  . LEU E  1 11  ? -10.855  -34.563  -31.099 1.00 2.51  ? 11  LEU E CG  1 
ATOM   5391  C  CD1 . LEU E  1 11  ? -10.738  -35.891  -31.792 1.00 2.10  ? 11  LEU E CD1 1 
ATOM   5392  C  CD2 . LEU E  1 11  ? -9.860   -34.460  -29.936 1.00 2.00  ? 11  LEU E CD2 1 
ATOM   5393  N  N   . ASN E  1 12  ? -11.487  -31.234  -34.360 1.00 2.14  ? 12  ASN E N   1 
ATOM   5394  C  CA  . ASN E  1 12  ? -12.265  -30.103  -34.885 1.00 2.07  ? 12  ASN E CA  1 
ATOM   5395  C  C   . ASN E  1 12  ? -12.877  -30.441  -36.231 1.00 2.47  ? 12  ASN E C   1 
ATOM   5396  O  O   . ASN E  1 12  ? -13.989  -30.049  -36.524 1.00 2.62  ? 12  ASN E O   1 
ATOM   5397  C  CB  . ASN E  1 12  ? -11.420  -28.827  -34.985 1.00 2.04  ? 12  ASN E CB  1 
ATOM   5398  C  CG  . ASN E  1 12  ? -11.554  -27.927  -33.752 1.00 2.48  ? 12  ASN E CG  1 
ATOM   5399  O  OD1 . ASN E  1 12  ? -12.646  -27.720  -33.249 1.00 4.18  ? 12  ASN E OD1 1 
ATOM   5400  N  ND2 . ASN E  1 12  ? -10.448  -27.393  -33.273 1.00 2.00  ? 12  ASN E ND2 1 
ATOM   5401  N  N   . LYS E  1 13  ? -12.167  -31.207  -37.040 1.00 2.56  ? 13  LYS E N   1 
ATOM   5402  C  CA  . LYS E  1 13  ? -12.718  -31.580  -38.332 1.00 3.19  ? 13  LYS E CA  1 
ATOM   5403  C  C   . LYS E  1 13  ? -13.931  -32.505  -38.156 1.00 3.58  ? 13  LYS E C   1 
ATOM   5404  O  O   . LYS E  1 13  ? -14.981  -32.301  -38.792 1.00 4.31  ? 13  LYS E O   1 
ATOM   5405  C  CB  . LYS E  1 13  ? -11.651  -32.218  -39.201 1.00 3.14  ? 13  LYS E CB  1 
ATOM   5406  C  CG  . LYS E  1 13  ? -12.152  -32.817  -40.462 1.00 2.86  ? 13  LYS E CG  1 
ATOM   5407  C  CD  . LYS E  1 13  ? -11.047  -32.882  -41.487 1.00 5.51  ? 13  LYS E CD  1 
ATOM   5408  C  CE  . LYS E  1 13  ? -11.387  -33.887  -42.555 1.00 8.08  ? 13  LYS E CE  1 
ATOM   5409  N  NZ  . LYS E  1 13  ? -11.259  -33.270  -43.885 1.00 9.98  ? 13  LYS E NZ  1 
ATOM   5410  N  N   . LEU E  1 14  ? -13.797  -33.495  -37.277 1.00 3.04  ? 14  LEU E N   1 
ATOM   5411  C  CA  . LEU E  1 14  ? -14.899  -34.377  -36.954 1.00 2.92  ? 14  LEU E CA  1 
ATOM   5412  C  C   . LEU E  1 14  ? -16.069  -33.587  -36.368 1.00 3.22  ? 14  LEU E C   1 
ATOM   5413  O  O   . LEU E  1 14  ? -17.215  -33.783  -36.786 1.00 3.02  ? 14  LEU E O   1 
ATOM   5414  C  CB  . LEU E  1 14  ? -14.443  -35.491  -36.033 1.00 2.45  ? 14  LEU E CB  1 
ATOM   5415  C  CG  . LEU E  1 14  ? -13.346  -36.373  -36.622 1.00 2.68  ? 14  LEU E CG  1 
ATOM   5416  C  CD1 . LEU E  1 14  ? -12.916  -37.422  -35.634 1.00 3.79  ? 14  LEU E CD1 1 
ATOM   5417  C  CD2 . LEU E  1 14  ? -13.773  -36.999  -37.896 1.00 2.00  ? 14  LEU E CD2 1 
ATOM   5418  N  N   . LEU E  1 15  ? -15.775  -32.665  -35.451 1.00 3.11  ? 15  LEU E N   1 
ATOM   5419  C  CA  . LEU E  1 15  ? -16.783  -31.768  -34.877 1.00 2.28  ? 15  LEU E CA  1 
ATOM   5420  C  C   . LEU E  1 15  ? -17.510  -31.035  -35.995 1.00 2.78  ? 15  LEU E C   1 
ATOM   5421  O  O   . LEU E  1 15  ? -18.719  -30.912  -35.957 1.00 2.78  ? 15  LEU E O   1 
ATOM   5422  C  CB  . LEU E  1 15  ? -16.132  -30.776  -33.917 1.00 2.00  ? 15  LEU E CB  1 
ATOM   5423  C  CG  . LEU E  1 15  ? -17.021  -29.649  -33.373 1.00 2.01  ? 15  LEU E CG  1 
ATOM   5424  C  CD1 . LEU E  1 15  ? -18.257  -30.135  -32.649 1.00 2.02  ? 15  LEU E CD1 1 
ATOM   5425  C  CD2 . LEU E  1 15  ? -16.220  -28.746  -32.450 1.00 2.00  ? 15  LEU E CD2 1 
ATOM   5426  N  N   . GLY E  1 16  ? -16.759  -30.588  -36.999 1.00 2.99  ? 16  GLY E N   1 
ATOM   5427  C  CA  . GLY E  1 16  ? -17.319  -29.901  -38.129 1.00 3.47  ? 16  GLY E CA  1 
ATOM   5428  C  C   . GLY E  1 16  ? -18.317  -30.777  -38.859 1.00 4.61  ? 16  GLY E C   1 
ATOM   5429  O  O   . GLY E  1 16  ? -19.356  -30.285  -39.299 1.00 4.34  ? 16  GLY E O   1 
ATOM   5430  N  N   . ASN E  1 17  ? -17.990  -32.065  -38.999 1.00 5.39  ? 17  ASN E N   1 
ATOM   5431  C  CA  . ASN E  1 17  ? -18.856  -33.008  -39.687 1.00 6.11  ? 17  ASN E CA  1 
ATOM   5432  C  C   . ASN E  1 17  ? -20.156  -33.139  -38.905 1.00 6.96  ? 17  ASN E C   1 
ATOM   5433  O  O   . ASN E  1 17  ? -21.220  -33.117  -39.513 1.00 7.16  ? 17  ASN E O   1 
ATOM   5434  C  CB  . ASN E  1 17  ? -18.209  -34.400  -39.792 1.00 6.06  ? 17  ASN E CB  1 
ATOM   5435  C  CG  . ASN E  1 17  ? -17.062  -34.457  -40.764 1.00 6.59  ? 17  ASN E CG  1 
ATOM   5436  O  OD1 . ASN E  1 17  ? -16.908  -33.607  -41.622 1.00 5.62  ? 17  ASN E OD1 1 
ATOM   5437  N  ND2 . ASN E  1 17  ? -16.243  -35.493  -40.634 1.00 8.93  ? 17  ASN E ND2 1 
ATOM   5438  N  N   . GLU E  1 18  ? -20.061  -33.276  -37.573 1.00 6.98  ? 18  GLU E N   1 
ATOM   5439  C  CA  . GLU E  1 18  ? -21.244  -33.506  -36.754 1.00 7.63  ? 18  GLU E CA  1 
ATOM   5440  C  C   . GLU E  1 18  ? -22.096  -32.235  -36.800 1.00 7.81  ? 18  GLU E C   1 
ATOM   5441  O  O   . GLU E  1 18  ? -23.342  -32.282  -36.807 1.00 7.47  ? 18  GLU E O   1 
ATOM   5442  C  CB  . GLU E  1 18  ? -20.925  -33.828  -35.297 1.00 7.66  ? 18  GLU E CB  1 
ATOM   5443  C  CG  . GLU E  1 18  ? -20.094  -35.039  -35.050 1.00 9.73  ? 18  GLU E CG  1 
ATOM   5444  C  CD  . GLU E  1 18  ? -20.766  -36.373  -35.304 1.00 13.52 ? 18  GLU E CD  1 
ATOM   5445  O  OE1 . GLU E  1 18  ? -22.014  -36.499  -35.272 1.00 13.03 ? 18  GLU E OE1 1 
ATOM   5446  O  OE2 . GLU E  1 18  ? -20.005  -37.344  -35.518 1.00 15.53 ? 18  GLU E OE2 1 
ATOM   5447  N  N   . LEU E  1 19  ? -21.448  -31.074  -36.844 1.00 7.49  ? 19  LEU E N   1 
ATOM   5448  C  CA  . LEU E  1 19  ? -22.314  -29.964  -36.872 1.00 7.23  ? 19  LEU E CA  1 
ATOM   5449  C  C   . LEU E  1 19  ? -23.046  -29.685  -38.143 1.00 6.87  ? 19  LEU E C   1 
ATOM   5450  O  O   . LEU E  1 19  ? -24.171  -29.214  -38.085 1.00 7.38  ? 19  LEU E O   1 
ATOM   5451  C  CB  . LEU E  1 19  ? -21.950  -28.797  -35.969 1.00 7.68  ? 19  LEU E CB  1 
ATOM   5452  C  CG  . LEU E  1 19  ? -20.881  -27.775  -35.671 1.00 8.51  ? 19  LEU E CG  1 
ATOM   5453  C  CD1 . LEU E  1 19  ? -20.856  -27.922  -34.197 1.00 7.73  ? 19  LEU E CD1 1 
ATOM   5454  C  CD2 . LEU E  1 19  ? -19.513  -28.004  -36.194 1.00 11.91 ? 19  LEU E CD2 1 
ATOM   5455  N  N   . VAL E  1 20  ? -22.506  -30.097  -39.290 1.00 6.25  ? 20  VAL E N   1 
ATOM   5456  C  CA  . VAL E  1 20  ? -23.384  -30.099  -40.466 1.00 4.57  ? 20  VAL E CA  1 
ATOM   5457  C  C   . VAL E  1 20  ? -24.490  -31.158  -40.335 1.00 3.96  ? 20  VAL E C   1 
ATOM   5458  O  O   . VAL E  1 20  ? -25.643  -30.852  -40.594 1.00 3.94  ? 20  VAL E O   1 
ATOM   5459  C  CB  . VAL E  1 20  ? -22.698  -29.956  -41.890 1.00 4.11  ? 20  VAL E CB  1 
ATOM   5460  C  CG1 . VAL E  1 20  ? -21.245  -30.012  -41.847 1.00 3.18  ? 20  VAL E CG1 1 
ATOM   5461  C  CG2 . VAL E  1 20  ? -23.276  -30.930  -42.883 1.00 3.05  ? 20  VAL E CG2 1 
ATOM   5462  N  N   . ALA E  1 21  ? -24.149  -32.358  -39.868 1.00 2.99  ? 21  ALA E N   1 
ATOM   5463  C  CA  . ALA E  1 21  ? -25.145  -33.424  -39.707 1.00 2.40  ? 21  ALA E CA  1 
ATOM   5464  C  C   . ALA E  1 21  ? -26.298  -33.024  -38.787 1.00 2.88  ? 21  ALA E C   1 
ATOM   5465  O  O   . ALA E  1 21  ? -27.443  -33.288  -39.108 1.00 3.37  ? 21  ALA E O   1 
ATOM   5466  C  CB  . ALA E  1 21  ? -24.504  -34.663  -39.211 1.00 2.00  ? 21  ALA E CB  1 
ATOM   5467  N  N   . ILE E  1 22  ? -25.986  -32.381  -37.660 1.00 2.93  ? 22  ILE E N   1 
ATOM   5468  C  CA  . ILE E  1 22  ? -26.986  -31.877  -36.729 1.00 3.07  ? 22  ILE E CA  1 
ATOM   5469  C  C   . ILE E  1 22  ? -28.060  -31.049  -37.427 1.00 3.66  ? 22  ILE E C   1 
ATOM   5470  O  O   . ILE E  1 22  ? -29.267  -31.341  -37.291 1.00 4.19  ? 22  ILE E O   1 
ATOM   5471  C  CB  . ILE E  1 22  ? -26.348  -31.014  -35.582 1.00 3.77  ? 22  ILE E CB  1 
ATOM   5472  C  CG1 . ILE E  1 22  ? -25.648  -31.908  -34.566 1.00 3.22  ? 22  ILE E CG1 1 
ATOM   5473  C  CG2 . ILE E  1 22  ? -27.401  -30.161  -34.869 1.00 2.00  ? 22  ILE E CG2 1 
ATOM   5474  C  CD1 . ILE E  1 22  ? -24.751  -31.164  -33.702 1.00 2.01  ? 22  ILE E CD1 1 
ATOM   5475  N  N   . ASN E  1 23  ? -27.631  -30.039  -38.183 1.00 3.20  ? 23  ASN E N   1 
ATOM   5476  C  CA  . ASN E  1 23  ? -28.546  -29.210  -38.924 1.00 3.17  ? 23  ASN E CA  1 
ATOM   5477  C  C   . ASN E  1 23  ? -29.242  -29.965  -40.050 1.00 3.61  ? 23  ASN E C   1 
ATOM   5478  O  O   . ASN E  1 23  ? -30.464  -29.843  -40.256 1.00 4.03  ? 23  ASN E O   1 
ATOM   5479  C  CB  . ASN E  1 23  ? -27.816  -28.011  -39.487 1.00 3.29  ? 23  ASN E CB  1 
ATOM   5480  C  CG  . ASN E  1 23  ? -27.329  -27.043  -38.403 1.00 4.13  ? 23  ASN E CG  1 
ATOM   5481  O  OD1 . ASN E  1 23  ? -26.809  -25.996  -38.713 1.00 5.85  ? 23  ASN E OD1 1 
ATOM   5482  N  ND2 . ASN E  1 23  ? -27.492  -27.402  -37.137 1.00 5.26  ? 23  ASN E ND2 1 
ATOM   5483  N  N   . GLN E  1 24  ? -28.508  -30.770  -40.791 1.00 3.49  ? 24  GLN E N   1 
ATOM   5484  C  CA  . GLN E  1 24  ? -29.141  -31.387  -41.933 1.00 3.66  ? 24  GLN E CA  1 
ATOM   5485  C  C   . GLN E  1 24  ? -30.217  -32.350  -41.421 1.00 3.78  ? 24  GLN E C   1 
ATOM   5486  O  O   . GLN E  1 24  ? -31.333  -32.367  -41.950 1.00 4.11  ? 24  GLN E O   1 
ATOM   5487  C  CB  . GLN E  1 24  ? -28.112  -32.049  -42.861 1.00 3.64  ? 24  GLN E CB  1 
ATOM   5488  C  CG  . GLN E  1 24  ? -28.710  -32.710  -44.071 1.00 4.33  ? 24  GLN E CG  1 
ATOM   5489  C  CD  . GLN E  1 24  ? -27.661  -33.060  -45.090 1.00 7.15  ? 24  GLN E CD  1 
ATOM   5490  O  OE1 . GLN E  1 24  ? -26.879  -32.188  -45.518 1.00 8.26  ? 24  GLN E OE1 1 
ATOM   5491  N  NE2 . GLN E  1 24  ? -27.635  -34.335  -45.510 1.00 6.63  ? 24  GLN E NE2 1 
ATOM   5492  N  N   . TYR E  1 25  ? -29.909  -33.108  -40.367 1.00 3.62  ? 25  TYR E N   1 
ATOM   5493  C  CA  . TYR E  1 25  ? -30.888  -34.043  -39.823 1.00 4.26  ? 25  TYR E CA  1 
ATOM   5494  C  C   . TYR E  1 25  ? -32.123  -33.337  -39.250 1.00 3.87  ? 25  TYR E C   1 
ATOM   5495  O  O   . TYR E  1 25  ? -33.253  -33.790  -39.448 1.00 3.49  ? 25  TYR E O   1 
ATOM   5496  C  CB  . TYR E  1 25  ? -30.264  -34.910  -38.758 1.00 5.17  ? 25  TYR E CB  1 
ATOM   5497  C  CG  . TYR E  1 25  ? -29.560  -36.138  -39.264 1.00 7.08  ? 25  TYR E CG  1 
ATOM   5498  C  CD1 . TYR E  1 25  ? -30.177  -37.002  -40.186 1.00 8.19  ? 25  TYR E CD1 1 
ATOM   5499  C  CD2 . TYR E  1 25  ? -28.297  -36.478  -38.774 1.00 7.84  ? 25  TYR E CD2 1 
ATOM   5500  C  CE1 . TYR E  1 25  ? -29.546  -38.143  -40.627 1.00 8.80  ? 25  TYR E CE1 1 
ATOM   5501  C  CE2 . TYR E  1 25  ? -27.653  -37.624  -39.200 1.00 8.83  ? 25  TYR E CE2 1 
ATOM   5502  C  CZ  . TYR E  1 25  ? -28.285  -38.449  -40.122 1.00 8.91  ? 25  TYR E CZ  1 
ATOM   5503  O  OH  . TYR E  1 25  ? -27.629  -39.588  -40.513 1.00 8.69  ? 25  TYR E OH  1 
ATOM   5504  N  N   . PHE E  1 26  ? -31.908  -32.222  -38.566 1.00 3.54  ? 26  PHE E N   1 
ATOM   5505  C  CA  . PHE E  1 26  ? -33.018  -31.483  -37.977 1.00 2.94  ? 26  PHE E CA  1 
ATOM   5506  C  C   . PHE E  1 26  ? -33.976  -30.872  -39.022 1.00 3.02  ? 26  PHE E C   1 
ATOM   5507  O  O   . PHE E  1 26  ? -35.202  -30.979  -38.896 1.00 2.38  ? 26  PHE E O   1 
ATOM   5508  C  CB  . PHE E  1 26  ? -32.497  -30.380  -37.075 1.00 2.69  ? 26  PHE E CB  1 
ATOM   5509  C  CG  . PHE E  1 26  ? -33.472  -29.996  -36.056 1.00 3.05  ? 26  PHE E CG  1 
ATOM   5510  C  CD1 . PHE E  1 26  ? -33.505  -30.671  -34.845 1.00 3.14  ? 26  PHE E CD1 1 
ATOM   5511  C  CD2 . PHE E  1 26  ? -34.425  -29.005  -36.315 1.00 3.53  ? 26  PHE E CD2 1 
ATOM   5512  C  CE1 . PHE E  1 26  ? -34.469  -30.345  -33.874 1.00 3.90  ? 26  PHE E CE1 1 
ATOM   5513  C  CE2 . PHE E  1 26  ? -35.403  -28.690  -35.361 1.00 4.11  ? 26  PHE E CE2 1 
ATOM   5514  C  CZ  . PHE E  1 26  ? -35.417  -29.360  -34.136 1.00 4.34  ? 26  PHE E CZ  1 
ATOM   5515  N  N   . LEU E  1 27  ? -33.416  -30.223  -40.050 1.00 2.87  ? 27  LEU E N   1 
ATOM   5516  C  CA  . LEU E  1 27  ? -34.232  -29.708  -41.139 1.00 2.53  ? 27  LEU E CA  1 
ATOM   5517  C  C   . LEU E  1 27  ? -34.973  -30.876  -41.785 1.00 2.48  ? 27  LEU E C   1 
ATOM   5518  O  O   . LEU E  1 27  ? -36.173  -30.796  -41.996 1.00 2.02  ? 27  LEU E O   1 
ATOM   5519  C  CB  . LEU E  1 27  ? -33.371  -28.996  -42.175 1.00 2.52  ? 27  LEU E CB  1 
ATOM   5520  C  CG  . LEU E  1 27  ? -33.930  -27.772  -42.902 1.00 2.49  ? 27  LEU E CG  1 
ATOM   5521  C  CD1 . LEU E  1 27  ? -33.259  -27.560  -44.209 1.00 2.00  ? 27  LEU E CD1 1 
ATOM   5522  C  CD2 . LEU E  1 27  ? -35.430  -27.757  -43.061 1.00 2.95  ? 27  LEU E CD2 1 
ATOM   5523  N  N   . HIS E  1 28  ? -34.273  -31.975  -42.069 1.00 2.14  ? 28  HIS E N   1 
ATOM   5524  C  CA  . HIS E  1 28  ? -34.950  -33.097  -42.705 1.00 2.40  ? 28  HIS E CA  1 
ATOM   5525  C  C   . HIS E  1 28  ? -36.122  -33.534  -41.841 1.00 2.55  ? 28  HIS E C   1 
ATOM   5526  O  O   . HIS E  1 28  ? -37.253  -33.643  -42.317 1.00 2.81  ? 28  HIS E O   1 
ATOM   5527  C  CB  . HIS E  1 28  ? -34.015  -34.267  -43.009 1.00 2.54  ? 28  HIS E CB  1 
ATOM   5528  C  CG  . HIS E  1 28  ? -33.153  -34.040  -44.198 1.00 2.57  ? 28  HIS E CG  1 
ATOM   5529  N  ND1 . HIS E  1 28  ? -32.057  -34.825  -44.472 1.00 2.46  ? 28  HIS E ND1 1 
ATOM   5530  C  CD2 . HIS E  1 28  ? -33.195  -33.090  -45.161 1.00 2.01  ? 28  HIS E CD2 1 
ATOM   5531  C  CE1 . HIS E  1 28  ? -31.468  -34.377  -45.571 1.00 3.21  ? 28  HIS E CE1 1 
ATOM   5532  N  NE2 . HIS E  1 28  ? -32.139  -33.324  -46.007 1.00 3.27  ? 28  HIS E NE2 1 
ATOM   5533  N  N   . ALA E  1 29  ? -35.847  -33.731  -40.560 1.00 2.35  ? 29  ALA E N   1 
ATOM   5534  C  CA  . ALA E  1 29  ? -36.872  -34.123  -39.603 1.00 2.14  ? 29  ALA E CA  1 
ATOM   5535  C  C   . ALA E  1 29  ? -38.116  -33.272  -39.704 1.00 2.09  ? 29  ALA E C   1 
ATOM   5536  O  O   . ALA E  1 29  ? -39.209  -33.808  -39.840 1.00 2.19  ? 29  ALA E O   1 
ATOM   5537  C  CB  . ALA E  1 29  ? -36.328  -34.108  -38.208 1.00 2.00  ? 29  ALA E CB  1 
ATOM   5538  N  N   . ARG E  1 30  ? -37.970  -31.955  -39.640 1.00 2.13  ? 30  ARG E N   1 
ATOM   5539  C  CA  . ARG E  1 30  ? -39.145  -31.072  -39.615 1.00 2.41  ? 30  ARG E CA  1 
ATOM   5540  C  C   . ARG E  1 30  ? -39.797  -30.911  -41.000 1.00 2.68  ? 30  ARG E C   1 
ATOM   5541  O  O   . ARG E  1 30  ? -40.968  -30.574  -41.114 1.00 2.45  ? 30  ARG E O   1 
ATOM   5542  C  CB  . ARG E  1 30  ? -38.791  -29.730  -39.016 1.00 2.00  ? 30  ARG E CB  1 
ATOM   5543  C  CG  . ARG E  1 30  ? -38.136  -29.839  -37.693 1.00 2.00  ? 30  ARG E CG  1 
ATOM   5544  C  CD  . ARG E  1 30  ? -39.085  -29.801  -36.541 1.00 2.02  ? 30  ARG E CD  1 
ATOM   5545  N  NE  . ARG E  1 30  ? -39.135  -31.092  -35.875 1.00 4.28  ? 30  ARG E NE  1 
ATOM   5546  C  CZ  . ARG E  1 30  ? -39.040  -31.306  -34.563 1.00 2.88  ? 30  ARG E CZ  1 
ATOM   5547  N  NH1 . ARG E  1 30  ? -38.921  -30.336  -33.688 1.00 2.70  ? 30  ARG E NH1 1 
ATOM   5548  N  NH2 . ARG E  1 30  ? -39.075  -32.537  -34.125 1.00 4.06  ? 30  ARG E NH2 1 
ATOM   5549  N  N   . MET E  1 31  ? -39.039  -31.203  -42.052 1.00 2.91  ? 31  MET E N   1 
ATOM   5550  C  CA  . MET E  1 31  ? -39.594  -31.305  -43.392 1.00 2.85  ? 31  MET E CA  1 
ATOM   5551  C  C   . MET E  1 31  ? -40.526  -32.518  -43.451 1.00 2.77  ? 31  MET E C   1 
ATOM   5552  O  O   . MET E  1 31  ? -41.686  -32.404  -43.798 1.00 3.03  ? 31  MET E O   1 
ATOM   5553  C  CB  . MET E  1 31  ? -38.476  -31.378  -44.434 1.00 2.62  ? 31  MET E CB  1 
ATOM   5554  C  CG  . MET E  1 31  ? -37.850  -30.047  -44.782 1.00 2.00  ? 31  MET E CG  1 
ATOM   5555  S  SD  . MET E  1 31  ? -36.418  -30.167  -45.876 1.00 3.49  ? 31  MET E SD  1 
ATOM   5556  C  CE  . MET E  1 31  ? -37.142  -30.712  -47.454 1.00 2.00  ? 31  MET E CE  1 
ATOM   5557  N  N   . PHE E  1 32  ? -40.023  -33.671  -43.062 1.00 2.66  ? 32  PHE E N   1 
ATOM   5558  C  CA  . PHE E  1 32  ? -40.858  -34.839  -42.933 1.00 2.36  ? 32  PHE E CA  1 
ATOM   5559  C  C   . PHE E  1 32  ? -42.098  -34.578  -42.083 1.00 2.49  ? 32  PHE E C   1 
ATOM   5560  O  O   . PHE E  1 32  ? -43.215  -35.021  -42.416 1.00 2.61  ? 32  PHE E O   1 
ATOM   5561  C  CB  . PHE E  1 32  ? -40.053  -36.006  -42.365 1.00 2.44  ? 32  PHE E CB  1 
ATOM   5562  C  CG  . PHE E  1 32  ? -38.958  -36.459  -43.266 1.00 2.72  ? 32  PHE E CG  1 
ATOM   5563  C  CD1 . PHE E  1 32  ? -37.704  -36.748  -42.764 1.00 4.23  ? 32  PHE E CD1 1 
ATOM   5564  C  CD2 . PHE E  1 32  ? -39.175  -36.565  -44.616 1.00 2.42  ? 32  PHE E CD2 1 
ATOM   5565  C  CE1 . PHE E  1 32  ? -36.676  -37.161  -43.592 1.00 4.27  ? 32  PHE E CE1 1 
ATOM   5566  C  CE2 . PHE E  1 32  ? -38.166  -36.989  -45.461 1.00 4.97  ? 32  PHE E CE2 1 
ATOM   5567  C  CZ  . PHE E  1 32  ? -36.900  -37.280  -44.939 1.00 4.21  ? 32  PHE E CZ  1 
ATOM   5568  N  N   . LYS E  1 33  ? -41.914  -33.876  -40.978 1.00 2.61  ? 33  LYS E N   1 
ATOM   5569  C  CA  . LYS E  1 33  ? -43.016  -33.594  -40.065 1.00 2.96  ? 33  LYS E CA  1 
ATOM   5570  C  C   . LYS E  1 33  ? -44.064  -32.745  -40.748 1.00 3.08  ? 33  LYS E C   1 
ATOM   5571  O  O   . LYS E  1 33  ? -45.260  -33.043  -40.664 1.00 2.67  ? 33  LYS E O   1 
ATOM   5572  C  CB  . LYS E  1 33  ? -42.497  -32.856  -38.857 1.00 3.13  ? 33  LYS E CB  1 
ATOM   5573  C  CG  . LYS E  1 33  ? -43.552  -32.352  -37.924 1.00 4.08  ? 33  LYS E CG  1 
ATOM   5574  C  CD  . LYS E  1 33  ? -42.984  -32.446  -36.513 1.00 8.21  ? 33  LYS E CD  1 
ATOM   5575  C  CE  . LYS E  1 33  ? -43.569  -31.384  -35.600 1.00 10.44 ? 33  LYS E CE  1 
ATOM   5576  N  NZ  . LYS E  1 33  ? -44.729  -31.931  -34.825 1.00 10.82 ? 33  LYS E NZ  1 
ATOM   5577  N  N   . ASN E  1 34  ? -43.606  -31.701  -41.448 1.00 3.06  ? 34  ASN E N   1 
ATOM   5578  C  CA  . ASN E  1 34  ? -44.507  -30.872  -42.187 1.00 3.41  ? 34  ASN E CA  1 
ATOM   5579  C  C   . ASN E  1 34  ? -45.297  -31.680  -43.192 1.00 3.69  ? 34  ASN E C   1 
ATOM   5580  O  O   . ASN E  1 34  ? -46.509  -31.499  -43.285 1.00 4.83  ? 34  ASN E O   1 
ATOM   5581  C  CB  . ASN E  1 34  ? -43.790  -29.750  -42.886 1.00 3.27  ? 34  ASN E CB  1 
ATOM   5582  C  CG  . ASN E  1 34  ? -44.752  -28.799  -43.561 1.00 4.41  ? 34  ASN E CG  1 
ATOM   5583  O  OD1 . ASN E  1 34  ? -44.868  -28.806  -44.769 1.00 7.32  ? 34  ASN E OD1 1 
ATOM   5584  N  ND2 . ASN E  1 34  ? -45.475  -28.001  -42.774 1.00 6.86  ? 34  ASN E ND2 1 
ATOM   5585  N  N   . TRP E  1 35  ? -44.629  -32.578  -43.922 1.00 3.42  ? 35  TRP E N   1 
ATOM   5586  C  CA  . TRP E  1 35  ? -45.287  -33.468  -44.884 1.00 3.20  ? 35  TRP E CA  1 
ATOM   5587  C  C   . TRP E  1 35  ? -46.160  -34.550  -44.242 1.00 3.39  ? 35  TRP E C   1 
ATOM   5588  O  O   . TRP E  1 35  ? -46.819  -35.299  -44.956 1.00 3.50  ? 35  TRP E O   1 
ATOM   5589  C  CB  . TRP E  1 35  ? -44.259  -34.148  -45.781 1.00 2.82  ? 35  TRP E CB  1 
ATOM   5590  C  CG  . TRP E  1 35  ? -43.587  -33.235  -46.692 1.00 3.70  ? 35  TRP E CG  1 
ATOM   5591  C  CD1 . TRP E  1 35  ? -44.076  -32.040  -47.174 1.00 5.37  ? 35  TRP E CD1 1 
ATOM   5592  C  CD2 . TRP E  1 35  ? -42.291  -33.404  -47.286 1.00 4.18  ? 35  TRP E CD2 1 
ATOM   5593  N  NE1 . TRP E  1 35  ? -43.158  -31.463  -48.016 1.00 5.76  ? 35  TRP E NE1 1 
ATOM   5594  C  CE2 . TRP E  1 35  ? -42.056  -32.272  -48.109 1.00 4.63  ? 35  TRP E CE2 1 
ATOM   5595  C  CE3 . TRP E  1 35  ? -41.316  -34.399  -47.210 1.00 2.56  ? 35  TRP E CE3 1 
ATOM   5596  C  CZ2 . TRP E  1 35  ? -40.885  -32.108  -48.839 1.00 4.26  ? 35  TRP E CZ2 1 
ATOM   5597  C  CZ3 . TRP E  1 35  ? -40.138  -34.232  -47.921 1.00 3.82  ? 35  TRP E CZ3 1 
ATOM   5598  C  CH2 . TRP E  1 35  ? -39.928  -33.098  -48.722 1.00 4.15  ? 35  TRP E CH2 1 
ATOM   5599  N  N   . GLY E  1 36  ? -46.131  -34.675  -42.920 1.00 2.89  ? 36  GLY E N   1 
ATOM   5600  C  CA  . GLY E  1 36  ? -46.999  -35.624  -42.261 1.00 2.75  ? 36  GLY E CA  1 
ATOM   5601  C  C   . GLY E  1 36  ? -46.389  -37.000  -42.171 1.00 3.34  ? 36  GLY E C   1 
ATOM   5602  O  O   . GLY E  1 36  ? -47.053  -37.951  -41.712 1.00 3.96  ? 36  GLY E O   1 
ATOM   5603  N  N   . LEU E  1 37  ? -45.113  -37.101  -42.557 1.00 3.33  ? 37  LEU E N   1 
ATOM   5604  C  CA  . LEU E  1 37  ? -44.339  -38.338  -42.492 1.00 2.83  ? 37  LEU E CA  1 
ATOM   5605  C  C   . LEU E  1 37  ? -43.780  -38.543  -41.060 1.00 3.08  ? 37  LEU E C   1 
ATOM   5606  O  O   . LEU E  1 37  ? -42.557  -38.596  -40.815 1.00 3.27  ? 37  LEU E O   1 
ATOM   5607  C  CB  . LEU E  1 37  ? -43.240  -38.266  -43.563 1.00 2.61  ? 37  LEU E CB  1 
ATOM   5608  C  CG  . LEU E  1 37  ? -43.625  -38.694  -44.996 1.00 3.45  ? 37  LEU E CG  1 
ATOM   5609  C  CD1 . LEU E  1 37  ? -45.114  -38.628  -45.307 1.00 2.00  ? 37  LEU E CD1 1 
ATOM   5610  C  CD2 . LEU E  1 37  ? -42.776  -38.019  -46.074 1.00 2.00  ? 37  LEU E CD2 1 
ATOM   5611  N  N   . LYS E  1 38  ? -44.706  -38.669  -40.113 1.00 3.30  ? 38  LYS E N   1 
ATOM   5612  C  CA  . LYS E  1 38  ? -44.463  -38.636  -38.679 1.00 3.64  ? 38  LYS E CA  1 
ATOM   5613  C  C   . LYS E  1 38  ? -43.243  -39.486  -38.241 1.00 3.58  ? 38  LYS E C   1 
ATOM   5614  O  O   . LYS E  1 38  ? -42.470  -39.124  -37.371 1.00 3.45  ? 38  LYS E O   1 
ATOM   5615  C  CB  . LYS E  1 38  ? -45.760  -39.124  -38.048 1.00 3.92  ? 38  LYS E CB  1 
ATOM   5616  C  CG  . LYS E  1 38  ? -46.257  -38.447  -36.791 1.00 8.07  ? 38  LYS E CG  1 
ATOM   5617  C  CD  . LYS E  1 38  ? -47.437  -37.456  -36.983 1.00 10.92 ? 38  LYS E CD  1 
ATOM   5618  C  CE  . LYS E  1 38  ? -48.691  -38.100  -37.555 1.00 13.69 ? 38  LYS E CE  1 
ATOM   5619  N  NZ  . LYS E  1 38  ? -49.396  -39.085  -36.710 1.00 13.99 ? 38  LYS E NZ  1 
ATOM   5620  N  N   . ARG E  1 39  ? -43.060  -40.615  -38.893 1.00 4.35  ? 39  ARG E N   1 
ATOM   5621  C  CA  . ARG E  1 39  ? -42.115  -41.651  -38.468 1.00 4.49  ? 39  ARG E CA  1 
ATOM   5622  C  C   . ARG E  1 39  ? -40.698  -41.296  -38.839 1.00 4.28  ? 39  ARG E C   1 
ATOM   5623  O  O   . ARG E  1 39  ? -39.757  -41.587  -38.115 1.00 4.81  ? 39  ARG E O   1 
ATOM   5624  C  CB  . ARG E  1 39  ? -42.491  -42.918  -39.196 1.00 5.24  ? 39  ARG E CB  1 
ATOM   5625  C  CG  . ARG E  1 39  ? -42.214  -44.200  -38.487 1.00 7.85  ? 39  ARG E CG  1 
ATOM   5626  C  CD  . ARG E  1 39  ? -40.896  -44.737  -38.994 1.00 14.24 ? 39  ARG E CD  1 
ATOM   5627  N  NE  . ARG E  1 39  ? -41.003  -46.123  -39.477 1.00 18.67 ? 39  ARG E NE  1 
ATOM   5628  C  CZ  . ARG E  1 39  ? -40.131  -46.685  -40.318 1.00 20.84 ? 39  ARG E CZ  1 
ATOM   5629  N  NH1 . ARG E  1 39  ? -39.072  -45.989  -40.795 1.00 16.91 ? 39  ARG E NH1 1 
ATOM   5630  N  NH2 . ARG E  1 39  ? -40.345  -47.945  -40.706 1.00 21.71 ? 39  ARG E NH2 1 
ATOM   5631  N  N   . LEU E  1 40  ? -40.554  -40.685  -40.006 1.00 3.89  ? 40  LEU E N   1 
ATOM   5632  C  CA  . LEU E  1 40  ? -39.284  -40.211  -40.479 1.00 3.21  ? 40  LEU E CA  1 
ATOM   5633  C  C   . LEU E  1 40  ? -38.865  -38.999  -39.664 1.00 3.54  ? 40  LEU E C   1 
ATOM   5634  O  O   . LEU E  1 40  ? -37.683  -38.786  -39.456 1.00 3.45  ? 40  LEU E O   1 
ATOM   5635  C  CB  . LEU E  1 40  ? -39.448  -39.837  -41.951 1.00 3.41  ? 40  LEU E CB  1 
ATOM   5636  C  CG  . LEU E  1 40  ? -38.917  -40.738  -43.064 1.00 2.42  ? 40  LEU E CG  1 
ATOM   5637  C  CD1 . LEU E  1 40  ? -38.739  -42.189  -42.691 1.00 2.57  ? 40  LEU E CD1 1 
ATOM   5638  C  CD2 . LEU E  1 40  ? -39.804  -40.577  -44.256 1.00 2.00  ? 40  LEU E CD2 1 
ATOM   5639  N  N   . ASN E  1 41  ? -39.838  -38.195  -39.213 1.00 3.64  ? 41  ASN E N   1 
ATOM   5640  C  CA  . ASN E  1 41  ? -39.542  -37.079  -38.315 1.00 2.98  ? 41  ASN E CA  1 
ATOM   5641  C  C   . ASN E  1 41  ? -39.022  -37.604  -36.997 1.00 3.17  ? 41  ASN E C   1 
ATOM   5642  O  O   . ASN E  1 41  ? -38.040  -37.114  -36.499 1.00 2.85  ? 41  ASN E O   1 
ATOM   5643  C  CB  . ASN E  1 41  ? -40.773  -36.203  -38.066 1.00 2.70  ? 41  ASN E CB  1 
ATOM   5644  C  CG  . ASN E  1 41  ? -40.590  -35.280  -36.862 1.00 3.37  ? 41  ASN E CG  1 
ATOM   5645  O  OD1 . ASN E  1 41  ? -39.878  -34.277  -36.935 1.00 3.56  ? 41  ASN E OD1 1 
ATOM   5646  N  ND2 . ASN E  1 41  ? -41.192  -35.642  -35.742 1.00 2.00  ? 41  ASN E ND2 1 
ATOM   5647  N  N   . ASP E  1 42  ? -39.677  -38.608  -36.427 1.00 3.85  ? 42  ASP E N   1 
ATOM   5648  C  CA  . ASP E  1 42  ? -39.190  -39.177  -35.181 1.00 5.19  ? 42  ASP E CA  1 
ATOM   5649  C  C   . ASP E  1 42  ? -37.755  -39.689  -35.329 1.00 5.47  ? 42  ASP E C   1 
ATOM   5650  O  O   . ASP E  1 42  ? -36.892  -39.342  -34.517 1.00 5.98  ? 42  ASP E O   1 
ATOM   5651  C  CB  . ASP E  1 42  ? -40.092  -40.309  -34.668 1.00 5.46  ? 42  ASP E CB  1 
ATOM   5652  C  CG  . ASP E  1 42  ? -41.469  -39.824  -34.249 1.00 9.94  ? 42  ASP E CG  1 
ATOM   5653  O  OD1 . ASP E  1 42  ? -41.717  -38.596  -34.154 1.00 13.00 ? 42  ASP E OD1 1 
ATOM   5654  O  OD2 . ASP E  1 42  ? -42.339  -40.689  -34.043 1.00 13.64 ? 42  ASP E OD2 1 
ATOM   5655  N  N   . VAL E  1 43  ? -37.474  -40.494  -36.353 1.00 5.04  ? 43  VAL E N   1 
ATOM   5656  C  CA  . VAL E  1 43  ? -36.142  -41.082  -36.438 1.00 4.91  ? 43  VAL E CA  1 
ATOM   5657  C  C   . VAL E  1 43  ? -35.080  -40.010  -36.683 1.00 4.92  ? 43  VAL E C   1 
ATOM   5658  O  O   . VAL E  1 43  ? -34.052  -39.965  -35.979 1.00 4.74  ? 43  VAL E O   1 
ATOM   5659  C  CB  . VAL E  1 43  ? -36.056  -42.229  -37.455 1.00 4.88  ? 43  VAL E CB  1 
ATOM   5660  C  CG1 . VAL E  1 43  ? -34.589  -42.625  -37.710 1.00 5.14  ? 43  VAL E CG1 1 
ATOM   5661  C  CG2 . VAL E  1 43  ? -36.836  -43.427  -36.950 1.00 4.13  ? 43  VAL E CG2 1 
ATOM   5662  N  N   . GLU E  1 44  ? -35.325  -39.137  -37.657 1.00 4.69  ? 44  GLU E N   1 
ATOM   5663  C  CA  . GLU E  1 44  ? -34.304  -38.128  -38.012 1.00 4.93  ? 44  GLU E CA  1 
ATOM   5664  C  C   . GLU E  1 44  ? -34.077  -37.130  -36.908 1.00 4.71  ? 44  GLU E C   1 
ATOM   5665  O  O   . GLU E  1 44  ? -32.962  -36.667  -36.714 1.00 4.86  ? 44  GLU E O   1 
ATOM   5666  C  CB  . GLU E  1 44  ? -34.639  -37.403  -39.288 1.00 4.26  ? 44  GLU E CB  1 
ATOM   5667  C  CG  . GLU E  1 44  ? -34.652  -38.345  -40.439 1.00 7.82  ? 44  GLU E CG  1 
ATOM   5668  C  CD  . GLU E  1 44  ? -33.506  -38.145  -41.404 1.00 11.32 ? 44  GLU E CD  1 
ATOM   5669  O  OE1 . GLU E  1 44  ? -33.181  -36.995  -41.766 1.00 12.46 ? 44  GLU E OE1 1 
ATOM   5670  O  OE2 . GLU E  1 44  ? -32.938  -39.147  -41.848 1.00 12.58 ? 44  GLU E OE2 1 
ATOM   5671  N  N   . TYR E  1 45  ? -35.127  -36.817  -36.166 1.00 4.66  ? 45  TYR E N   1 
ATOM   5672  C  CA  . TYR E  1 45  ? -34.956  -35.986  -35.022 1.00 4.78  ? 45  TYR E CA  1 
ATOM   5673  C  C   . TYR E  1 45  ? -34.010  -36.667  -34.052 1.00 5.26  ? 45  TYR E C   1 
ATOM   5674  O  O   . TYR E  1 45  ? -33.056  -36.055  -33.587 1.00 5.12  ? 45  TYR E O   1 
ATOM   5675  C  CB  . TYR E  1 45  ? -36.282  -35.725  -34.371 1.00 4.96  ? 45  TYR E CB  1 
ATOM   5676  C  CG  . TYR E  1 45  ? -36.174  -34.972  -33.098 1.00 4.99  ? 45  TYR E CG  1 
ATOM   5677  C  CD1 . TYR E  1 45  ? -36.096  -33.591  -33.100 1.00 5.40  ? 45  TYR E CD1 1 
ATOM   5678  C  CD2 . TYR E  1 45  ? -36.162  -35.639  -31.885 1.00 5.96  ? 45  TYR E CD2 1 
ATOM   5679  C  CE1 . TYR E  1 45  ? -36.010  -32.877  -31.914 1.00 6.99  ? 45  TYR E CE1 1 
ATOM   5680  C  CE2 . TYR E  1 45  ? -36.078  -34.958  -30.685 1.00 6.32  ? 45  TYR E CE2 1 
ATOM   5681  C  CZ  . TYR E  1 45  ? -35.997  -33.575  -30.696 1.00 7.84  ? 45  TYR E CZ  1 
ATOM   5682  O  OH  . TYR E  1 45  ? -35.902  -32.895  -29.484 1.00 8.43  ? 45  TYR E OH  1 
ATOM   5683  N  N   A HIS E  1 46  ? -34.256  -37.937  -33.765 0.50 5.70  ? 46  HIS E N   1 
ATOM   5684  N  N   B HIS E  1 46  ? -34.264  -37.940  -33.753 0.50 5.72  ? 46  HIS E N   1 
ATOM   5685  C  CA  A HIS E  1 46  ? -33.402  -38.659  -32.834 0.50 6.24  ? 46  HIS E CA  1 
ATOM   5686  C  CA  B HIS E  1 46  ? -33.396  -38.706  -32.851 0.50 6.32  ? 46  HIS E CA  1 
ATOM   5687  C  C   A HIS E  1 46  ? -31.961  -38.772  -33.345 0.50 5.74  ? 46  HIS E C   1 
ATOM   5688  C  C   B HIS E  1 46  ? -31.955  -38.643  -33.344 0.50 5.77  ? 46  HIS E C   1 
ATOM   5689  O  O   A HIS E  1 46  ? -31.038  -38.887  -32.552 0.50 6.34  ? 46  HIS E O   1 
ATOM   5690  O  O   B HIS E  1 46  ? -31.035  -38.518  -32.548 0.50 6.30  ? 46  HIS E O   1 
ATOM   5691  C  CB  A HIS E  1 46  ? -34.003  -40.014  -32.432 0.50 6.44  ? 46  HIS E CB  1 
ATOM   5692  C  CB  B HIS E  1 46  ? -33.860  -40.166  -32.694 0.50 6.55  ? 46  HIS E CB  1 
ATOM   5693  C  CG  A HIS E  1 46  ? -35.253  -39.889  -31.616 0.50 9.86  ? 46  HIS E CG  1 
ATOM   5694  C  CG  B HIS E  1 46  ? -33.009  -40.989  -31.766 0.50 10.53 ? 46  HIS E CG  1 
ATOM   5695  N  ND1 A HIS E  1 46  ? -35.262  -39.361  -30.343 0.50 11.97 ? 46  HIS E ND1 1 
ATOM   5696  N  ND1 B HIS E  1 46  ? -33.014  -40.812  -30.396 0.50 14.27 ? 46  HIS E ND1 1 
ATOM   5697  C  CD2 A HIS E  1 46  ? -36.540  -40.198  -31.903 0.50 12.55 ? 46  HIS E CD2 1 
ATOM   5698  C  CD2 B HIS E  1 46  ? -32.145  -42.007  -32.006 0.50 12.25 ? 46  HIS E CD2 1 
ATOM   5699  C  CE1 A HIS E  1 46  ? -36.498  -39.352  -29.881 0.50 13.14 ? 46  HIS E CE1 1 
ATOM   5700  C  CE1 B HIS E  1 46  ? -32.184  -41.676  -29.835 0.50 14.35 ? 46  HIS E CE1 1 
ATOM   5701  N  NE2 A HIS E  1 46  ? -37.293  -39.853  -30.810 0.50 13.29 ? 46  HIS E NE2 1 
ATOM   5702  N  NE2 B HIS E  1 46  ? -31.646  -42.414  -30.789 0.50 13.54 ? 46  HIS E NE2 1 
ATOM   5703  N  N   . GLU E  1 47  ? -31.753  -38.693  -34.653 1.00 5.29  ? 47  GLU E N   1 
ATOM   5704  C  CA  . GLU E  1 47  ? -30.426  -38.673  -35.160 1.00 5.17  ? 47  GLU E CA  1 
ATOM   5705  C  C   . GLU E  1 47  ? -29.749  -37.358  -35.040 1.00 4.48  ? 47  GLU E C   1 
ATOM   5706  O  O   . GLU E  1 47  ? -28.565  -37.304  -34.810 1.00 4.09  ? 47  GLU E O   1 
ATOM   5707  C  CB  . GLU E  1 47  ? -30.375  -39.198  -36.555 1.00 6.19  ? 47  GLU E CB  1 
ATOM   5708  C  CG  . GLU E  1 47  ? -30.184  -40.694  -36.479 1.00 8.88  ? 47  GLU E CG  1 
ATOM   5709  C  CD  . GLU E  1 47  ? -30.621  -41.407  -37.731 1.00 15.06 ? 47  GLU E CD  1 
ATOM   5710  O  OE1 . GLU E  1 47  ? -31.163  -40.771  -38.693 1.00 16.91 ? 47  GLU E OE1 1 
ATOM   5711  O  OE2 . GLU E  1 47  ? -30.415  -42.644  -37.715 1.00 18.44 ? 47  GLU E OE2 1 
ATOM   5712  N  N   . SER E  1 48  ? -30.501  -36.278  -35.173 1.00 4.54  ? 48  SER E N   1 
ATOM   5713  C  CA  . SER E  1 48  ? -29.997  -34.960  -34.818 1.00 4.22  ? 48  SER E CA  1 
ATOM   5714  C  C   . SER E  1 48  ? -29.503  -34.886  -33.352 1.00 4.45  ? 48  SER E C   1 
ATOM   5715  O  O   . SER E  1 48  ? -28.414  -34.373  -33.090 1.00 3.77  ? 48  SER E O   1 
ATOM   5716  C  CB  . SER E  1 48  ? -31.060  -33.912  -35.071 1.00 3.81  ? 48  SER E CB  1 
ATOM   5717  O  OG  . SER E  1 48  ? -30.429  -32.640  -35.125 1.00 4.40  ? 48  SER E OG  1 
ATOM   5718  N  N   . ILE E  1 49  ? -30.304  -35.402  -32.415 1.00 4.71  ? 49  ILE E N   1 
ATOM   5719  C  CA  . ILE E  1 49  ? -29.888  -35.456  -31.003 1.00 5.06  ? 49  ILE E CA  1 
ATOM   5720  C  C   . ILE E  1 49  ? -28.612  -36.265  -30.883 1.00 5.40  ? 49  ILE E C   1 
ATOM   5721  O  O   . ILE E  1 49  ? -27.717  -35.937  -30.130 1.00 5.52  ? 49  ILE E O   1 
ATOM   5722  C  CB  . ILE E  1 49  ? -30.972  -36.078  -30.059 1.00 4.97  ? 49  ILE E CB  1 
ATOM   5723  C  CG1 . ILE E  1 49  ? -32.255  -35.232  -29.990 1.00 5.41  ? 49  ILE E CG1 1 
ATOM   5724  C  CG2 . ILE E  1 49  ? -30.442  -36.281  -28.664 1.00 3.98  ? 49  ILE E CG2 1 
ATOM   5725  C  CD1 . ILE E  1 49  ? -32.069  -33.752  -30.228 1.00 6.07  ? 49  ILE E CD1 1 
ATOM   5726  N  N   . ASP E  1 50  ? -28.538  -37.326  -31.643 1.00 5.89  ? 50  ASP E N   1 
ATOM   5727  C  CA  . ASP E  1 50  ? -27.366  -38.160  -31.611 1.00 7.06  ? 50  ASP E CA  1 
ATOM   5728  C  C   . ASP E  1 50  ? -26.090  -37.408  -31.993 1.00 6.82  ? 50  ASP E C   1 
ATOM   5729  O  O   . ASP E  1 50  ? -25.085  -37.470  -31.295 1.00 6.68  ? 50  ASP E O   1 
ATOM   5730  C  CB  . ASP E  1 50  ? -27.560  -39.362  -32.519 1.00 7.90  ? 50  ASP E CB  1 
ATOM   5731  C  CG  . ASP E  1 50  ? -27.079  -40.607  -31.868 1.00 11.73 ? 50  ASP E CG  1 
ATOM   5732  O  OD1 . ASP E  1 50  ? -27.710  -40.914  -30.817 1.00 14.93 ? 50  ASP E OD1 1 
ATOM   5733  O  OD2 . ASP E  1 50  ? -26.058  -41.238  -32.345 1.00 15.65 ? 50  ASP E OD2 1 
ATOM   5734  N  N   . GLU E  1 51  ? -26.150  -36.685  -33.096 1.00 6.24  ? 51  GLU E N   1 
ATOM   5735  C  CA  . GLU E  1 51  ? -25.006  -35.960  -33.566 1.00 6.44  ? 51  GLU E CA  1 
ATOM   5736  C  C   . GLU E  1 51  ? -24.639  -34.833  -32.606 1.00 6.09  ? 51  GLU E C   1 
ATOM   5737  O  O   . GLU E  1 51  ? -23.462  -34.485  -32.501 1.00 5.09  ? 51  GLU E O   1 
ATOM   5738  C  CB  . GLU E  1 51  ? -25.238  -35.464  -35.008 1.00 7.13  ? 51  GLU E CB  1 
ATOM   5739  C  CG  . GLU E  1 51  ? -25.549  -36.568  -36.038 1.00 8.47  ? 51  GLU E CG  1 
ATOM   5740  C  CD  . GLU E  1 51  ? -24.570  -37.748  -36.012 1.00 12.36 ? 51  GLU E CD  1 
ATOM   5741  O  OE1 . GLU E  1 51  ? -23.983  -38.116  -37.058 1.00 15.22 ? 51  GLU E OE1 1 
ATOM   5742  O  OE2 . GLU E  1 51  ? -24.378  -38.342  -34.934 1.00 15.36 ? 51  GLU E OE2 1 
ATOM   5743  N  N   . MET E  1 52  ? -25.631  -34.295  -31.876 1.00 6.16  ? 52  MET E N   1 
ATOM   5744  C  CA  . MET E  1 52  ? -25.356  -33.295  -30.862 1.00 6.43  ? 52  MET E CA  1 
ATOM   5745  C  C   . MET E  1 52  ? -24.521  -33.887  -29.753 1.00 6.16  ? 52  MET E C   1 
ATOM   5746  O  O   . MET E  1 52  ? -23.569  -33.251  -29.294 1.00 6.44  ? 52  MET E O   1 
ATOM   5747  C  CB  . MET E  1 52  ? -26.614  -32.739  -30.260 1.00 6.24  ? 52  MET E CB  1 
ATOM   5748  C  CG  . MET E  1 52  ? -27.337  -31.781  -31.123 1.00 6.96  ? 52  MET E CG  1 
ATOM   5749  S  SD  . MET E  1 52  ? -28.949  -31.367  -30.421 1.00 9.66  ? 52  MET E SD  1 
ATOM   5750  C  CE  . MET E  1 52  ? -29.924  -31.359  -31.969 1.00 8.45  ? 52  MET E CE  1 
ATOM   5751  N  N   . LYS E  1 53  ? -24.869  -35.102  -29.328 1.00 5.74  ? 53  LYS E N   1 
ATOM   5752  C  CA  . LYS E  1 53  ? -24.114  -35.794  -28.301 1.00 5.75  ? 53  LYS E CA  1 
ATOM   5753  C  C   . LYS E  1 53  ? -22.667  -35.966  -28.734 1.00 5.69  ? 53  LYS E C   1 
ATOM   5754  O  O   . LYS E  1 53  ? -21.741  -35.809  -27.940 1.00 5.94  ? 53  LYS E O   1 
ATOM   5755  C  CB  . LYS E  1 53  ? -24.745  -37.148  -27.978 1.00 6.08  ? 53  LYS E CB  1 
ATOM   5756  C  CG  . LYS E  1 53  ? -26.143  -37.062  -27.392 1.00 7.86  ? 53  LYS E CG  1 
ATOM   5757  C  CD  . LYS E  1 53  ? -26.444  -38.304  -26.572 1.00 12.56 ? 53  LYS E CD  1 
ATOM   5758  C  CE  . LYS E  1 53  ? -27.930  -38.722  -26.659 1.00 16.02 ? 53  LYS E CE  1 
ATOM   5759  N  NZ  . LYS E  1 53  ? -28.311  -39.700  -25.564 1.00 18.01 ? 53  LYS E NZ  1 
ATOM   5760  N  N   . HIS E  1 54  ? -22.465  -36.282  -30.003 1.00 5.75  ? 54  HIS E N   1 
ATOM   5761  C  CA  . HIS E  1 54  ? -21.136  -36.450  -30.537 1.00 5.48  ? 54  HIS E CA  1 
ATOM   5762  C  C   . HIS E  1 54  ? -20.361  -35.140  -30.524 1.00 4.99  ? 54  HIS E C   1 
ATOM   5763  O  O   . HIS E  1 54  ? -19.214  -35.098  -30.076 1.00 4.77  ? 54  HIS E O   1 
ATOM   5764  C  CB  . HIS E  1 54  ? -21.220  -37.029  -31.929 1.00 5.89  ? 54  HIS E CB  1 
ATOM   5765  C  CG  . HIS E  1 54  ? -21.806  -38.406  -31.978 1.00 7.49  ? 54  HIS E CG  1 
ATOM   5766  N  ND1 . HIS E  1 54  ? -22.312  -38.960  -33.137 1.00 10.41 ? 54  HIS E ND1 1 
ATOM   5767  C  CD2 . HIS E  1 54  ? -21.977  -39.341  -31.014 1.00 7.88  ? 54  HIS E CD2 1 
ATOM   5768  C  CE1 . HIS E  1 54  ? -22.772  -40.173  -32.878 1.00 10.33 ? 54  HIS E CE1 1 
ATOM   5769  N  NE2 . HIS E  1 54  ? -22.572  -40.431  -31.601 1.00 7.88  ? 54  HIS E NE2 1 
ATOM   5770  N  N   . ALA E  1 55  ? -21.005  -34.064  -30.972 1.00 4.17  ? 55  ALA E N   1 
ATOM   5771  C  CA  . ALA E  1 55  ? -20.384  -32.738  -30.977 1.00 3.87  ? 55  ALA E CA  1 
ATOM   5772  C  C   . ALA E  1 55  ? -19.944  -32.359  -29.555 1.00 4.14  ? 55  ALA E C   1 
ATOM   5773  O  O   . ALA E  1 55  ? -18.808  -31.890  -29.329 1.00 4.25  ? 55  ALA E O   1 
ATOM   5774  C  CB  . ALA E  1 55  ? -21.324  -31.724  -31.536 1.00 2.88  ? 55  ALA E CB  1 
ATOM   5775  N  N   . ASP E  1 56  ? -20.832  -32.587  -28.601 1.00 3.87  ? 56  ASP E N   1 
ATOM   5776  C  CA  . ASP E  1 56  ? -20.549  -32.344  -27.214 1.00 4.01  ? 56  ASP E CA  1 
ATOM   5777  C  C   . ASP E  1 56  ? -19.268  -33.096  -26.801 1.00 4.35  ? 56  ASP E C   1 
ATOM   5778  O  O   . ASP E  1 56  ? -18.341  -32.511  -26.217 1.00 5.27  ? 56  ASP E O   1 
ATOM   5779  C  CB  . ASP E  1 56  ? -21.756  -32.771  -26.378 1.00 3.83  ? 56  ASP E CB  1 
ATOM   5780  C  CG  . ASP E  1 56  ? -21.683  -32.311  -24.936 1.00 4.30  ? 56  ASP E CG  1 
ATOM   5781  O  OD1 . ASP E  1 56  ? -20.846  -31.457  -24.587 1.00 3.84  ? 56  ASP E OD1 1 
ATOM   5782  O  OD2 . ASP E  1 56  ? -22.484  -32.826  -24.119 1.00 4.95  ? 56  ASP E OD2 1 
ATOM   5783  N  N   . ARG E  1 57  ? -19.166  -34.374  -27.146 1.00 3.76  ? 57  ARG E N   1 
ATOM   5784  C  CA  . ARG E  1 57  ? -18.006  -35.142  -26.740 1.00 3.63  ? 57  ARG E CA  1 
ATOM   5785  C  C   . ARG E  1 57  ? -16.719  -34.602  -27.342 1.00 2.85  ? 57  ARG E C   1 
ATOM   5786  O  O   . ARG E  1 57  ? -15.698  -34.507  -26.636 1.00 2.24  ? 57  ARG E O   1 
ATOM   5787  C  CB  . ARG E  1 57  ? -18.221  -36.630  -26.984 1.00 3.57  ? 57  ARG E CB  1 
ATOM   5788  C  CG  . ARG E  1 57  ? -19.219  -37.238  -26.003 1.00 4.91  ? 57  ARG E CG  1 
ATOM   5789  C  CD  . ARG E  1 57  ? -19.615  -38.686  -26.311 1.00 7.32  ? 57  ARG E CD  1 
ATOM   5790  N  NE  . ARG E  1 57  ? -18.581  -39.684  -25.991 1.00 11.99 ? 57  ARG E NE  1 
ATOM   5791  C  CZ  . ARG E  1 57  ? -18.517  -40.905  -26.576 1.00 14.25 ? 57  ARG E CZ  1 
ATOM   5792  N  NH1 . ARG E  1 57  ? -19.448  -41.279  -27.488 1.00 12.22 ? 57  ARG E NH1 1 
ATOM   5793  N  NH2 . ARG E  1 57  ? -17.517  -41.753  -26.265 1.00 11.95 ? 57  ARG E NH2 1 
ATOM   5794  N  N   . TYR E  1 58  ? -16.751  -34.216  -28.620 1.00 2.24  ? 58  TYR E N   1 
ATOM   5795  C  CA  . TYR E  1 58  ? -15.586  -33.592  -29.258 1.00 2.00  ? 58  TYR E CA  1 
ATOM   5796  C  C   . TYR E  1 58  ? -15.202  -32.292  -28.561 1.00 2.10  ? 58  TYR E C   1 
ATOM   5797  O  O   . TYR E  1 58  ? -14.006  -32.050  -28.274 1.00 2.02  ? 58  TYR E O   1 
ATOM   5798  C  CB  . TYR E  1 58  ? -15.850  -33.323  -30.729 1.00 2.00  ? 58  TYR E CB  1 
ATOM   5799  C  CG  . TYR E  1 58  ? -15.907  -34.554  -31.577 1.00 2.10  ? 58  TYR E CG  1 
ATOM   5800  C  CD1 . TYR E  1 58  ? -14.920  -35.513  -31.493 1.00 2.93  ? 58  TYR E CD1 1 
ATOM   5801  C  CD2 . TYR E  1 58  ? -16.935  -34.762  -32.464 1.00 2.00  ? 58  TYR E CD2 1 
ATOM   5802  C  CE1 . TYR E  1 58  ? -14.964  -36.632  -32.259 1.00 2.02  ? 58  TYR E CE1 1 
ATOM   5803  C  CE2 . TYR E  1 58  ? -16.988  -35.882  -33.222 1.00 2.00  ? 58  TYR E CE2 1 
ATOM   5804  C  CZ  . TYR E  1 58  ? -16.003  -36.808  -33.128 1.00 2.00  ? 58  TYR E CZ  1 
ATOM   5805  O  OH  . TYR E  1 58  ? -16.028  -37.944  -33.895 1.00 2.00  ? 58  TYR E OH  1 
ATOM   5806  N  N   . ILE E  1 59  ? -16.216  -31.458  -28.277 1.00 2.06  ? 59  ILE E N   1 
ATOM   5807  C  CA  . ILE E  1 59  ? -15.985  -30.137  -27.706 1.00 2.19  ? 59  ILE E CA  1 
ATOM   5808  C  C   . ILE E  1 59  ? -15.307  -30.314  -26.379 1.00 2.77  ? 59  ILE E C   1 
ATOM   5809  O  O   . ILE E  1 59  ? -14.321  -29.645  -26.104 1.00 3.45  ? 59  ILE E O   1 
ATOM   5810  C  CB  . ILE E  1 59  ? -17.270  -29.319  -27.555 1.00 2.00  ? 59  ILE E CB  1 
ATOM   5811  C  CG1 . ILE E  1 59  ? -17.729  -28.833  -28.912 1.00 2.00  ? 59  ILE E CG1 1 
ATOM   5812  C  CG2 . ILE E  1 59  ? -17.043  -28.113  -26.712 1.00 2.00  ? 59  ILE E CG2 1 
ATOM   5813  C  CD1 . ILE E  1 59  ? -19.232  -28.501  -28.982 1.00 2.00  ? 59  ILE E CD1 1 
ATOM   5814  N  N   . GLU E  1 60  ? -15.800  -31.255  -25.572 1.00 2.86  ? 60  GLU E N   1 
ATOM   5815  C  CA  . GLU E  1 60  ? -15.231  -31.458  -24.252 1.00 2.89  ? 60  GLU E CA  1 
ATOM   5816  C  C   . GLU E  1 60  ? -13.835  -31.981  -24.293 1.00 2.56  ? 60  GLU E C   1 
ATOM   5817  O  O   . GLU E  1 60  ? -13.017  -31.642  -23.468 1.00 3.09  ? 60  GLU E O   1 
ATOM   5818  C  CB  . GLU E  1 60  ? -16.121  -32.339  -23.416 1.00 2.88  ? 60  GLU E CB  1 
ATOM   5819  C  CG  . GLU E  1 60  ? -17.386  -31.579  -23.012 1.00 5.19  ? 60  GLU E CG  1 
ATOM   5820  C  CD  . GLU E  1 60  ? -18.317  -32.400  -22.172 1.00 7.96  ? 60  GLU E CD  1 
ATOM   5821  O  OE1 . GLU E  1 60  ? -19.337  -31.875  -21.694 1.00 8.98  ? 60  GLU E OE1 1 
ATOM   5822  O  OE2 . GLU E  1 60  ? -18.027  -33.592  -21.999 1.00 10.79 ? 60  GLU E OE2 1 
ATOM   5823  N  N   . ARG E  1 61  ? -13.574  -32.796  -25.293 1.00 2.77  ? 61  ARG E N   1 
ATOM   5824  C  CA  . ARG E  1 61  ? -12.291  -33.437  -25.420 1.00 2.58  ? 61  ARG E CA  1 
ATOM   5825  C  C   . ARG E  1 61  ? -11.273  -32.412  -25.926 1.00 2.87  ? 61  ARG E C   1 
ATOM   5826  O  O   . ARG E  1 61  ? -10.172  -32.331  -25.369 1.00 2.53  ? 61  ARG E O   1 
ATOM   5827  C  CB  . ARG E  1 61  ? -12.405  -34.653  -26.346 1.00 2.62  ? 61  ARG E CB  1 
ATOM   5828  C  CG  . ARG E  1 61  ? -11.135  -35.467  -26.486 1.00 2.08  ? 61  ARG E CG  1 
ATOM   5829  C  CD  . ARG E  1 61  ? -10.805  -36.281  -25.248 1.00 2.31  ? 61  ARG E CD  1 
ATOM   5830  N  NE  . ARG E  1 61  ? -9.521   -36.900  -25.437 1.00 3.02  ? 61  ARG E NE  1 
ATOM   5831  C  CZ  . ARG E  1 61  ? -8.778   -37.438  -24.471 1.00 5.07  ? 61  ARG E CZ  1 
ATOM   5832  N  NH1 . ARG E  1 61  ? -9.223   -37.468  -23.211 1.00 3.74  ? 61  ARG E NH1 1 
ATOM   5833  N  NH2 . ARG E  1 61  ? -7.569   -37.940  -24.776 1.00 4.52  ? 61  ARG E NH2 1 
ATOM   5834  N  N   . ILE E  1 62  ? -11.638  -31.627  -26.960 1.00 2.54  ? 62  ILE E N   1 
ATOM   5835  C  CA  . ILE E  1 62  ? -10.761  -30.572  -27.453 1.00 2.41  ? 62  ILE E CA  1 
ATOM   5836  C  C   . ILE E  1 62  ? -10.380  -29.637  -26.288 1.00 2.80  ? 62  ILE E C   1 
ATOM   5837  O  O   . ILE E  1 62  ? -9.208   -29.225  -26.138 1.00 2.88  ? 62  ILE E O   1 
ATOM   5838  C  CB  . ILE E  1 62  ? -11.395  -29.769  -28.601 1.00 2.16  ? 62  ILE E CB  1 
ATOM   5839  C  CG1 . ILE E  1 62  ? -11.574  -30.641  -29.835 1.00 3.12  ? 62  ILE E CG1 1 
ATOM   5840  C  CG2 . ILE E  1 62  ? -10.529  -28.608  -28.978 1.00 2.00  ? 62  ILE E CG2 1 
ATOM   5841  C  CD1 . ILE E  1 62  ? -12.364  -30.002  -30.929 1.00 2.00  ? 62  ILE E CD1 1 
ATOM   5842  N  N   . LEU E  1 63  ? -11.363  -29.327  -25.447 1.00 2.50  ? 63  LEU E N   1 
ATOM   5843  C  CA  . LEU E  1 63  ? -11.145  -28.405  -24.358 1.00 2.78  ? 63  LEU E CA  1 
ATOM   5844  C  C   . LEU E  1 63  ? -10.201  -29.033  -23.357 1.00 3.16  ? 63  LEU E C   1 
ATOM   5845  O  O   . LEU E  1 63  ? -9.273   -28.379  -22.869 1.00 3.80  ? 63  LEU E O   1 
ATOM   5846  C  CB  . LEU E  1 63  ? -12.462  -28.028  -23.713 1.00 2.68  ? 63  LEU E CB  1 
ATOM   5847  C  CG  . LEU E  1 63  ? -13.130  -26.662  -23.886 1.00 2.04  ? 63  LEU E CG  1 
ATOM   5848  C  CD1 . LEU E  1 63  ? -12.499  -25.733  -24.875 1.00 2.00  ? 63  LEU E CD1 1 
ATOM   5849  C  CD2 . LEU E  1 63  ? -14.603  -26.864  -24.125 1.00 2.00  ? 63  LEU E CD2 1 
ATOM   5850  N  N   . PHE E  1 64  ? -10.394  -30.322  -23.094 1.00 3.12  ? 64  PHE E N   1 
ATOM   5851  C  CA  . PHE E  1 64  ? -9.551   -31.016  -22.131 1.00 3.07  ? 64  PHE E CA  1 
ATOM   5852  C  C   . PHE E  1 64  ? -8.138   -31.017  -22.633 1.00 3.29  ? 64  PHE E C   1 
ATOM   5853  O  O   . PHE E  1 64  ? -7.206   -30.788  -21.844 1.00 4.37  ? 64  PHE E O   1 
ATOM   5854  C  CB  . PHE E  1 64  ? -10.018  -32.442  -21.868 1.00 2.43  ? 64  PHE E CB  1 
ATOM   5855  C  CG  . PHE E  1 64  ? -9.029   -33.255  -21.112 1.00 2.06  ? 64  PHE E CG  1 
ATOM   5856  C  CD1 . PHE E  1 64  ? -8.642   -32.895  -19.824 1.00 2.00  ? 64  PHE E CD1 1 
ATOM   5857  C  CD2 . PHE E  1 64  ? -8.474   -34.397  -21.678 1.00 3.22  ? 64  PHE E CD2 1 
ATOM   5858  C  CE1 . PHE E  1 64  ? -7.726   -33.663  -19.117 1.00 2.00  ? 64  PHE E CE1 1 
ATOM   5859  C  CE2 . PHE E  1 64  ? -7.541   -35.180  -20.953 1.00 2.00  ? 64  PHE E CE2 1 
ATOM   5860  C  CZ  . PHE E  1 64  ? -7.180   -34.807  -19.679 1.00 2.00  ? 64  PHE E CZ  1 
ATOM   5861  N  N   . LEU E  1 65  ? -7.980   -31.247  -23.930 1.00 2.43  ? 65  LEU E N   1 
ATOM   5862  C  CA  . LEU E  1 65  ? -6.670   -31.350  -24.566 1.00 2.24  ? 65  LEU E CA  1 
ATOM   5863  C  C   . LEU E  1 65  ? -6.067   -29.979  -24.789 1.00 2.30  ? 65  LEU E C   1 
ATOM   5864  O  O   . LEU E  1 65  ? -4.998   -29.870  -25.385 1.00 2.18  ? 65  LEU E O   1 
ATOM   5865  C  CB  . LEU E  1 65  ? -6.778   -32.093  -25.908 1.00 2.24  ? 65  LEU E CB  1 
ATOM   5866  C  CG  . LEU E  1 65  ? -7.120   -33.571  -25.791 1.00 2.33  ? 65  LEU E CG  1 
ATOM   5867  C  CD1 . LEU E  1 65  ? -7.137   -34.218  -27.156 1.00 2.00  ? 65  LEU E CD1 1 
ATOM   5868  C  CD2 . LEU E  1 65  ? -6.132   -34.259  -24.792 1.00 2.00  ? 65  LEU E CD2 1 
ATOM   5869  N  N   . GLU E  1 66  ? -6.771   -28.953  -24.332 1.00 2.33  ? 66  GLU E N   1 
ATOM   5870  C  CA  . GLU E  1 66  ? -6.333   -27.541  -24.414 1.00 3.39  ? 66  GLU E CA  1 
ATOM   5871  C  C   . GLU E  1 66  ? -6.320   -26.915  -25.811 1.00 2.99  ? 66  GLU E C   1 
ATOM   5872  O  O   . GLU E  1 66  ? -5.541   -26.032  -26.063 1.00 3.13  ? 66  GLU E O   1 
ATOM   5873  C  CB  . GLU E  1 66  ? -5.022   -27.307  -23.669 1.00 2.95  ? 66  GLU E CB  1 
ATOM   5874  C  CG  . GLU E  1 66  ? -5.128   -27.692  -22.163 1.00 6.18  ? 66  GLU E CG  1 
ATOM   5875  C  CD  . GLU E  1 66  ? -3.820   -27.646  -21.388 1.00 5.85  ? 66  GLU E CD  1 
ATOM   5876  O  OE1 . GLU E  1 66  ? -2.960   -26.787  -21.689 1.00 11.39 ? 66  GLU E OE1 1 
ATOM   5877  O  OE2 . GLU E  1 66  ? -3.667   -28.469  -20.452 1.00 6.72  ? 66  GLU E OE2 1 
ATOM   5878  N  N   . GLY E  1 67  ? -7.215   -27.349  -26.700 1.00 2.90  ? 67  GLY E N   1 
ATOM   5879  C  CA  . GLY E  1 67  ? -7.396   -26.711  -27.998 1.00 3.05  ? 67  GLY E CA  1 
ATOM   5880  C  C   . GLY E  1 67  ? -8.656   -25.857  -28.027 1.00 4.24  ? 67  GLY E C   1 
ATOM   5881  O  O   . GLY E  1 67  ? -9.373   -25.768  -27.030 1.00 4.49  ? 67  GLY E O   1 
ATOM   5882  N  N   . LEU E  1 68  ? -8.913   -25.218  -29.171 1.00 4.24  ? 68  LEU E N   1 
ATOM   5883  C  CA  . LEU E  1 68  ? -10.019  -24.307  -29.352 1.00 4.16  ? 68  LEU E CA  1 
ATOM   5884  C  C   . LEU E  1 68  ? -11.059  -24.956  -30.235 1.00 3.81  ? 68  LEU E C   1 
ATOM   5885  O  O   . LEU E  1 68  ? -10.845  -25.091  -31.429 1.00 3.76  ? 68  LEU E O   1 
ATOM   5886  C  CB  . LEU E  1 68  ? -9.509   -23.070  -30.054 1.00 4.21  ? 68  LEU E CB  1 
ATOM   5887  C  CG  . LEU E  1 68  ? -9.011   -21.793  -29.332 1.00 6.83  ? 68  LEU E CG  1 
ATOM   5888  C  CD1 . LEU E  1 68  ? -8.978   -21.857  -27.788 1.00 5.20  ? 68  LEU E CD1 1 
ATOM   5889  C  CD2 . LEU E  1 68  ? -7.658   -21.345  -29.945 1.00 6.26  ? 68  LEU E CD2 1 
ATOM   5890  N  N   . PRO E  1 69  ? -12.204  -25.381  -29.660 1.00 3.52  ? 69  PRO E N   1 
ATOM   5891  C  CA  . PRO E  1 69  ? -13.240  -25.967  -30.505 1.00 3.07  ? 69  PRO E CA  1 
ATOM   5892  C  C   . PRO E  1 69  ? -13.734  -24.938  -31.511 1.00 3.59  ? 69  PRO E C   1 
ATOM   5893  O  O   . PRO E  1 69  ? -13.923  -23.767  -31.172 1.00 3.65  ? 69  PRO E O   1 
ATOM   5894  C  CB  . PRO E  1 69  ? -14.351  -26.331  -29.519 1.00 2.06  ? 69  PRO E CB  1 
ATOM   5895  C  CG  . PRO E  1 69  ? -13.733  -26.369  -28.234 1.00 2.00  ? 69  PRO E CG  1 
ATOM   5896  C  CD  . PRO E  1 69  ? -12.614  -25.367  -28.247 1.00 2.84  ? 69  PRO E CD  1 
ATOM   5897  N  N   . ASN E  1 70  ? -13.921  -25.382  -32.743 1.00 4.03  ? 70  ASN E N   1 
ATOM   5898  C  CA  . ASN E  1 70  ? -14.319  -24.510  -33.811 1.00 4.41  ? 70  ASN E CA  1 
ATOM   5899  C  C   . ASN E  1 70  ? -15.771  -24.784  -34.163 1.00 4.81  ? 70  ASN E C   1 
ATOM   5900  O  O   . ASN E  1 70  ? -16.067  -25.789  -34.802 1.00 5.56  ? 70  ASN E O   1 
ATOM   5901  C  CB  . ASN E  1 70  ? -13.453  -24.779  -35.020 1.00 4.02  ? 70  ASN E CB  1 
ATOM   5902  C  CG  . ASN E  1 70  ? -13.738  -23.833  -36.158 1.00 5.28  ? 70  ASN E CG  1 
ATOM   5903  O  OD1 . ASN E  1 70  ? -14.669  -23.015  -36.108 1.00 6.71  ? 70  ASN E OD1 1 
ATOM   5904  N  ND2 . ASN E  1 70  ? -12.931  -23.938  -37.212 1.00 4.52  ? 70  ASN E ND2 1 
ATOM   5905  N  N   . LEU E  1 71  ? -16.666  -23.894  -33.743 1.00 4.77  ? 71  LEU E N   1 
ATOM   5906  C  CA  . LEU E  1 71  ? -18.078  -23.969  -34.095 1.00 4.85  ? 71  LEU E CA  1 
ATOM   5907  C  C   . LEU E  1 71  ? -18.444  -22.855  -35.094 1.00 6.10  ? 71  LEU E C   1 
ATOM   5908  O  O   . LEU E  1 71  ? -19.620  -22.618  -35.375 1.00 6.84  ? 71  LEU E O   1 
ATOM   5909  C  CB  . LEU E  1 71  ? -18.930  -23.849  -32.839 1.00 4.06  ? 71  LEU E CB  1 
ATOM   5910  C  CG  . LEU E  1 71  ? -19.032  -25.125  -32.002 1.00 4.60  ? 71  LEU E CG  1 
ATOM   5911  C  CD1 . LEU E  1 71  ? -17.878  -25.267  -31.058 1.00 3.67  ? 71  LEU E CD1 1 
ATOM   5912  C  CD2 . LEU E  1 71  ? -20.337  -25.170  -31.241 1.00 2.87  ? 71  LEU E CD2 1 
ATOM   5913  N  N   . GLN E  1 72  ? -17.447  -22.166  -35.627 1.00 7.00  ? 72  GLN E N   1 
ATOM   5914  C  CA  . GLN E  1 72  ? -17.708  -21.018  -36.465 1.00 7.64  ? 72  GLN E CA  1 
ATOM   5915  C  C   . GLN E  1 72  ? -17.905  -21.488  -37.883 1.00 8.18  ? 72  GLN E C   1 
ATOM   5916  O  O   . GLN E  1 72  ? -18.795  -21.014  -38.549 1.00 8.80  ? 72  GLN E O   1 
ATOM   5917  C  CB  . GLN E  1 72  ? -16.551  -20.004  -36.380 1.00 7.95  ? 72  GLN E CB  1 
ATOM   5918  C  CG  . GLN E  1 72  ? -16.661  -18.829  -37.356 1.00 9.02  ? 72  GLN E CG  1 
ATOM   5919  C  CD  . GLN E  1 72  ? -17.824  -17.926  -37.014 1.00 11.26 ? 72  GLN E CD  1 
ATOM   5920  O  OE1 . GLN E  1 72  ? -17.730  -17.077  -36.099 1.00 12.91 ? 72  GLN E OE1 1 
ATOM   5921  N  NE2 . GLN E  1 72  ? -18.946  -18.113  -37.723 1.00 7.91  ? 72  GLN E NE2 1 
ATOM   5922  N  N   . ASP E  1 73  ? -17.076  -22.423  -38.348 1.00 8.83  ? 73  ASP E N   1 
ATOM   5923  C  CA  . ASP E  1 73  ? -17.125  -22.836  -39.754 1.00 9.64  ? 73  ASP E CA  1 
ATOM   5924  C  C   . ASP E  1 73  ? -18.122  -23.962  -39.926 1.00 10.11 ? 73  ASP E C   1 
ATOM   5925  O  O   . ASP E  1 73  ? -18.127  -24.940  -39.125 1.00 12.28 ? 73  ASP E O   1 
ATOM   5926  C  CB  . ASP E  1 73  ? -15.738  -23.244  -40.250 1.00 9.48  ? 73  ASP E CB  1 
ATOM   5927  C  CG  . ASP E  1 73  ? -14.706  -22.119  -40.072 1.00 11.90 ? 73  ASP E CG  1 
ATOM   5928  O  OD1 . ASP E  1 73  ? -15.070  -20.922  -40.285 1.00 13.92 ? 73  ASP E OD1 1 
ATOM   5929  O  OD2 . ASP E  1 73  ? -13.547  -22.418  -39.688 1.00 12.39 ? 73  ASP E OD2 1 
ATOM   5930  N  N   . LEU E  1 74  ? -18.997  -23.827  -40.920 1.00 9.55  ? 74  LEU E N   1 
ATOM   5931  C  CA  . LEU E  1 74  ? -20.026  -24.830  -41.175 1.00 8.34  ? 74  LEU E CA  1 
ATOM   5932  C  C   . LEU E  1 74  ? -19.922  -25.280  -42.619 1.00 8.41  ? 74  LEU E C   1 
ATOM   5933  O  O   . LEU E  1 74  ? -20.063  -24.455  -43.527 1.00 8.73  ? 74  LEU E O   1 
ATOM   5934  C  CB  . LEU E  1 74  ? -21.412  -24.242  -40.888 1.00 7.92  ? 74  LEU E CB  1 
ATOM   5935  C  CG  . LEU E  1 74  ? -22.605  -25.220  -40.842 1.00 7.53  ? 74  LEU E CG  1 
ATOM   5936  C  CD1 . LEU E  1 74  ? -22.478  -26.264  -39.755 1.00 4.11  ? 74  LEU E CD1 1 
ATOM   5937  C  CD2 . LEU E  1 74  ? -23.946  -24.495  -40.690 1.00 7.41  ? 74  LEU E CD2 1 
ATOM   5938  N  N   . GLY E  1 75  ? -19.686  -26.575  -42.831 1.00 8.29  ? 75  GLY E N   1 
ATOM   5939  C  CA  . GLY E  1 75  ? -19.580  -27.145  -44.183 1.00 8.43  ? 75  GLY E CA  1 
ATOM   5940  C  C   . GLY E  1 75  ? -20.865  -27.121  -45.004 1.00 9.37  ? 75  GLY E C   1 
ATOM   5941  O  O   . GLY E  1 75  ? -21.918  -26.673  -44.530 1.00 9.30  ? 75  GLY E O   1 
ATOM   5942  N  N   . LYS E  1 76  ? -20.787  -27.596  -46.249 1.00 10.21 ? 76  LYS E N   1 
ATOM   5943  C  CA  . LYS E  1 76  ? -21.954  -27.595  -47.123 1.00 11.64 ? 76  LYS E CA  1 
ATOM   5944  C  C   . LYS E  1 76  ? -23.045  -28.561  -46.654 1.00 10.51 ? 76  LYS E C   1 
ATOM   5945  O  O   . LYS E  1 76  ? -22.817  -29.773  -46.511 1.00 10.78 ? 76  LYS E O   1 
ATOM   5946  C  CB  . LYS E  1 76  ? -21.607  -27.825  -48.613 1.00 11.55 ? 76  LYS E CB  1 
ATOM   5947  C  CG  . LYS E  1 76  ? -22.754  -27.263  -49.528 1.00 15.48 ? 76  LYS E CG  1 
ATOM   5948  C  CD  . LYS E  1 76  ? -22.565  -27.485  -51.071 1.00 15.69 ? 76  LYS E CD  1 
ATOM   5949  C  CE  . LYS E  1 76  ? -23.896  -27.221  -51.866 1.00 18.63 ? 76  LYS E CE  1 
ATOM   5950  N  NZ  . LYS E  1 76  ? -23.743  -27.609  -53.366 1.00 20.34 ? 76  LYS E NZ  1 
ATOM   5951  N  N   . LEU E  1 77  ? -24.218  -27.990  -46.383 1.00 9.98  ? 77  LEU E N   1 
ATOM   5952  C  CA  . LEU E  1 77  ? -25.473  -28.740  -46.267 1.00 9.42  ? 77  LEU E CA  1 
ATOM   5953  C  C   . LEU E  1 77  ? -25.977  -29.083  -47.658 1.00 9.39  ? 77  LEU E C   1 
ATOM   5954  O  O   . LEU E  1 77  ? -25.837  -28.282  -48.591 1.00 9.88  ? 77  LEU E O   1 
ATOM   5955  C  CB  . LEU E  1 77  ? -26.527  -27.851  -45.598 1.00 9.20  ? 77  LEU E CB  1 
ATOM   5956  C  CG  . LEU E  1 77  ? -26.887  -28.031  -44.129 1.00 8.97  ? 77  LEU E CG  1 
ATOM   5957  C  CD1 . LEU E  1 77  ? -25.638  -28.082  -43.298 1.00 7.30  ? 77  LEU E CD1 1 
ATOM   5958  C  CD2 . LEU E  1 77  ? -27.719  -26.855  -43.749 1.00 9.55  ? 77  LEU E CD2 1 
ATOM   5959  N  N   . ASN E  1 78  ? -26.555  -30.269  -47.828 1.00 9.56  ? 78  ASN E N   1 
ATOM   5960  C  CA  . ASN E  1 78  ? -27.226  -30.584  -49.091 1.00 9.46  ? 78  ASN E CA  1 
ATOM   5961  C  C   . ASN E  1 78  ? -28.588  -31.114  -48.684 1.00 9.25  ? 78  ASN E C   1 
ATOM   5962  O  O   . ASN E  1 78  ? -28.678  -32.202  -48.142 1.00 9.77  ? 78  ASN E O   1 
ATOM   5963  C  CB  . ASN E  1 78  ? -26.405  -31.567  -49.933 1.00 9.36  ? 78  ASN E CB  1 
ATOM   5964  C  CG  . ASN E  1 78  ? -27.143  -32.033  -51.224 1.00 12.27 ? 78  ASN E CG  1 
ATOM   5965  O  OD1 . ASN E  1 78  ? -28.169  -31.459  -51.635 1.00 13.91 ? 78  ASN E OD1 1 
ATOM   5966  N  ND2 . ASN E  1 78  ? -26.614  -33.088  -51.861 1.00 12.53 ? 78  ASN E ND2 1 
ATOM   5967  N  N   . ILE E  1 79  ? -29.630  -30.307  -48.886 1.00 8.79  ? 79  ILE E N   1 
ATOM   5968  C  CA  . ILE E  1 79  ? -30.945  -30.572  -48.306 1.00 8.24  ? 79  ILE E CA  1 
ATOM   5969  C  C   . ILE E  1 79  ? -31.770  -31.517  -49.149 1.00 8.74  ? 79  ILE E C   1 
ATOM   5970  O  O   . ILE E  1 79  ? -32.196  -32.550  -48.647 1.00 9.23  ? 79  ILE E O   1 
ATOM   5971  C  CB  . ILE E  1 79  ? -31.751  -29.295  -48.014 1.00 8.07  ? 79  ILE E CB  1 
ATOM   5972  C  CG1 . ILE E  1 79  ? -30.956  -28.323  -47.120 1.00 7.60  ? 79  ILE E CG1 1 
ATOM   5973  C  CG2 . ILE E  1 79  ? -33.046  -29.653  -47.371 1.00 7.78  ? 79  ILE E CG2 1 
ATOM   5974  C  CD1 . ILE E  1 79  ? -30.388  -28.930  -45.794 1.00 5.77  ? 79  ILE E CD1 1 
ATOM   5975  N  N   . GLY E  1 80  ? -31.981  -31.197  -50.423 1.00 8.43  ? 80  GLY E N   1 
ATOM   5976  C  CA  . GLY E  1 80  ? -32.749  -32.087  -51.292 1.00 8.55  ? 80  GLY E CA  1 
ATOM   5977  C  C   . GLY E  1 80  ? -34.213  -31.704  -51.221 1.00 9.08  ? 80  GLY E C   1 
ATOM   5978  O  O   . GLY E  1 80  ? -34.622  -31.006  -50.286 1.00 9.06  ? 80  GLY E O   1 
ATOM   5979  N  N   . GLU E  1 81  ? -35.014  -32.141  -52.194 1.00 9.30  ? 81  GLU E N   1 
ATOM   5980  C  CA  . GLU E  1 81  ? -36.393  -31.680  -52.232 1.00 10.15 ? 81  GLU E CA  1 
ATOM   5981  C  C   . GLU E  1 81  ? -37.431  -32.791  -52.025 1.00 9.39  ? 81  GLU E C   1 
ATOM   5982  O  O   . GLU E  1 81  ? -38.598  -32.480  -51.774 1.00 10.30 ? 81  GLU E O   1 
ATOM   5983  C  CB  . GLU E  1 81  ? -36.682  -30.879  -53.513 1.00 9.65  ? 81  GLU E CB  1 
ATOM   5984  C  CG  . GLU E  1 81  ? -35.847  -29.573  -53.685 1.00 12.24 ? 81  GLU E CG  1 
ATOM   5985  C  CD  . GLU E  1 81  ? -35.734  -29.138  -55.190 1.00 15.05 ? 81  GLU E CD  1 
ATOM   5986  O  OE1 . GLU E  1 81  ? -35.350  -29.981  -56.059 1.00 20.82 ? 81  GLU E OE1 1 
ATOM   5987  O  OE2 . GLU E  1 81  ? -36.023  -27.962  -55.513 1.00 19.46 ? 81  GLU E OE2 1 
ATOM   5988  N  N   . ASP E  1 82  ? -37.024  -34.062  -52.157 1.00 8.71  ? 82  ASP E N   1 
ATOM   5989  C  CA  . ASP E  1 82  ? -37.904  -35.225  -51.887 1.00 7.39  ? 82  ASP E CA  1 
ATOM   5990  C  C   . ASP E  1 82  ? -37.246  -36.277  -50.989 1.00 6.40  ? 82  ASP E C   1 
ATOM   5991  O  O   . ASP E  1 82  ? -36.038  -36.262  -50.801 1.00 6.36  ? 82  ASP E O   1 
ATOM   5992  C  CB  . ASP E  1 82  ? -38.401  -35.879  -53.185 1.00 7.29  ? 82  ASP E CB  1 
ATOM   5993  C  CG  . ASP E  1 82  ? -37.274  -36.358  -54.072 1.00 10.34 ? 82  ASP E CG  1 
ATOM   5994  O  OD1 . ASP E  1 82  ? -37.212  -35.889  -55.218 1.00 16.61 ? 82  ASP E OD1 1 
ATOM   5995  O  OD2 . ASP E  1 82  ? -36.438  -37.189  -53.664 1.00 12.01 ? 82  ASP E OD2 1 
ATOM   5996  N  N   . VAL E  1 83  ? -38.046  -37.195  -50.461 1.00 5.62  ? 83  VAL E N   1 
ATOM   5997  C  CA  . VAL E  1 83  ? -37.588  -38.176  -49.458 1.00 4.98  ? 83  VAL E CA  1 
ATOM   5998  C  C   . VAL E  1 83  ? -36.279  -38.895  -49.844 1.00 5.07  ? 83  VAL E C   1 
ATOM   5999  O  O   . VAL E  1 83  ? -35.286  -38.844  -49.091 1.00 5.04  ? 83  VAL E O   1 
ATOM   6000  C  CB  . VAL E  1 83  ? -38.686  -39.229  -49.153 1.00 4.70  ? 83  VAL E CB  1 
ATOM   6001  C  CG1 . VAL E  1 83  ? -38.234  -40.179  -48.080 1.00 4.00  ? 83  VAL E CG1 1 
ATOM   6002  C  CG2 . VAL E  1 83  ? -39.921  -38.527  -48.718 1.00 4.69  ? 83  VAL E CG2 1 
ATOM   6003  N  N   . GLU E  1 84  ? -36.297  -39.551  -51.005 1.00 4.69  ? 84  GLU E N   1 
ATOM   6004  C  CA  . GLU E  1 84  ? -35.124  -40.243  -51.485 1.00 5.42  ? 84  GLU E CA  1 
ATOM   6005  C  C   . GLU E  1 84  ? -33.895  -39.325  -51.516 1.00 5.71  ? 84  GLU E C   1 
ATOM   6006  O  O   . GLU E  1 84  ? -32.864  -39.632  -50.923 1.00 5.77  ? 84  GLU E O   1 
ATOM   6007  C  CB  . GLU E  1 84  ? -35.358  -40.826  -52.879 1.00 5.55  ? 84  GLU E CB  1 
ATOM   6008  C  CG  . GLU E  1 84  ? -34.651  -42.162  -53.068 1.00 9.22  ? 84  GLU E CG  1 
ATOM   6009  C  CD  . GLU E  1 84  ? -34.488  -42.576  -54.528 1.00 13.97 ? 84  GLU E CD  1 
ATOM   6010  O  OE1 . GLU E  1 84  ? -35.483  -42.477  -55.296 1.00 16.29 ? 84  GLU E OE1 1 
ATOM   6011  O  OE2 . GLU E  1 84  ? -33.358  -43.013  -54.898 1.00 13.51 ? 84  GLU E OE2 1 
ATOM   6012  N  N   . GLU E  1 85  ? -34.013  -38.199  -52.197 1.00 5.74  ? 85  GLU E N   1 
ATOM   6013  C  CA  . GLU E  1 85  ? -32.933  -37.264  -52.337 1.00 6.69  ? 85  GLU E CA  1 
ATOM   6014  C  C   . GLU E  1 85  ? -32.439  -36.895  -50.940 1.00 5.76  ? 85  GLU E C   1 
ATOM   6015  O  O   . GLU E  1 85  ? -31.213  -36.816  -50.689 1.00 5.38  ? 85  GLU E O   1 
ATOM   6016  C  CB  . GLU E  1 85  ? -33.488  -36.047  -53.045 1.00 6.71  ? 85  GLU E CB  1 
ATOM   6017  C  CG  . GLU E  1 85  ? -32.577  -35.315  -54.017 1.00 9.97  ? 85  GLU E CG  1 
ATOM   6018  C  CD  . GLU E  1 85  ? -33.391  -34.368  -54.971 1.00 11.74 ? 85  GLU E CD  1 
ATOM   6019  O  OE1 . GLU E  1 85  ? -34.421  -34.826  -55.572 1.00 15.06 ? 85  GLU E OE1 1 
ATOM   6020  O  OE2 . GLU E  1 85  ? -32.995  -33.175  -55.109 1.00 16.80 ? 85  GLU E OE2 1 
ATOM   6021  N  N   . MET E  1 86  ? -33.368  -36.696  -49.992 1.00 5.00  ? 86  MET E N   1 
ATOM   6022  C  CA  . MET E  1 86  ? -32.891  -36.245  -48.694 1.00 5.00  ? 86  MET E CA  1 
ATOM   6023  C  C   . MET E  1 86  ? -32.245  -37.347  -47.905 1.00 4.94  ? 86  MET E C   1 
ATOM   6024  O  O   . MET E  1 86  ? -31.230  -37.139  -47.244 1.00 5.52  ? 86  MET E O   1 
ATOM   6025  C  CB  . MET E  1 86  ? -33.867  -35.352  -47.901 1.00 4.77  ? 86  MET E CB  1 
ATOM   6026  C  CG  . MET E  1 86  ? -35.304  -35.703  -47.945 1.00 6.72  ? 86  MET E CG  1 
ATOM   6027  S  SD  . MET E  1 86  ? -36.414  -34.319  -47.786 1.00 4.95  ? 86  MET E SD  1 
ATOM   6028  C  CE  . MET E  1 86  ? -36.529  -34.084  -46.004 1.00 3.21  ? 86  MET E CE  1 
ATOM   6029  N  N   . LEU E  1 87  ? -32.777  -38.549  -48.032 1.00 4.79  ? 87  LEU E N   1 
ATOM   6030  C  CA  . LEU E  1 87  ? -32.171  -39.684  -47.349 1.00 3.94  ? 87  LEU E CA  1 
ATOM   6031  C  C   . LEU E  1 87  ? -30.793  -39.953  -47.912 1.00 4.00  ? 87  LEU E C   1 
ATOM   6032  O  O   . LEU E  1 87  ? -29.836  -40.171  -47.177 1.00 4.34  ? 87  LEU E O   1 
ATOM   6033  C  CB  . LEU E  1 87  ? -33.089  -40.894  -47.443 1.00 3.57  ? 87  LEU E CB  1 
ATOM   6034  C  CG  . LEU E  1 87  ? -33.944  -41.267  -46.228 1.00 3.36  ? 87  LEU E CG  1 
ATOM   6035  C  CD1 . LEU E  1 87  ? -34.311  -40.129  -45.294 1.00 2.58  ? 87  LEU E CD1 1 
ATOM   6036  C  CD2 . LEU E  1 87  ? -35.178  -41.951  -46.719 1.00 4.17  ? 87  LEU E CD2 1 
ATOM   6037  N  N   . ARG E  1 88  ? -30.690  -39.889  -49.227 1.00 4.01  ? 88  ARG E N   1 
ATOM   6038  C  CA  . ARG E  1 88  ? -29.450  -40.182  -49.940 1.00 4.82  ? 88  ARG E CA  1 
ATOM   6039  C  C   . ARG E  1 88  ? -28.409  -39.161  -49.511 1.00 4.70  ? 88  ARG E C   1 
ATOM   6040  O  O   . ARG E  1 88  ? -27.236  -39.467  -49.363 1.00 5.49  ? 88  ARG E O   1 
ATOM   6041  C  CB  . ARG E  1 88  ? -29.697  -40.089  -51.450 1.00 4.22  ? 88  ARG E CB  1 
ATOM   6042  C  CG  . ARG E  1 88  ? -29.253  -41.277  -52.230 1.00 5.38  ? 88  ARG E CG  1 
ATOM   6043  C  CD  . ARG E  1 88  ? -29.751  -41.261  -53.691 1.00 7.16  ? 88  ARG E CD  1 
ATOM   6044  N  NE  . ARG E  1 88  ? -30.712  -42.346  -53.979 1.00 13.56 ? 88  ARG E NE  1 
ATOM   6045  C  CZ  . ARG E  1 88  ? -30.466  -43.672  -53.832 1.00 14.68 ? 88  ARG E CZ  1 
ATOM   6046  N  NH1 . ARG E  1 88  ? -29.300  -44.140  -53.352 1.00 13.81 ? 88  ARG E NH1 1 
ATOM   6047  N  NH2 . ARG E  1 88  ? -31.419  -44.549  -54.134 1.00 13.12 ? 88  ARG E NH2 1 
ATOM   6048  N  N   . SER E  1 89  ? -28.849  -37.937  -49.275 1.00 4.71  ? 89  SER E N   1 
ATOM   6049  C  CA  . SER E  1 89  ? -27.911  -36.896  -48.909 1.00 4.21  ? 89  SER E CA  1 
ATOM   6050  C  C   . SER E  1 89  ? -27.343  -37.115  -47.498 1.00 4.52  ? 89  SER E C   1 
ATOM   6051  O  O   . SER E  1 89  ? -26.147  -36.879  -47.285 1.00 4.79  ? 89  SER E O   1 
ATOM   6052  C  CB  . SER E  1 89  ? -28.578  -35.530  -49.042 1.00 4.06  ? 89  SER E CB  1 
ATOM   6053  O  OG  . SER E  1 89  ? -27.697  -34.525  -48.613 1.00 3.46  ? 89  SER E OG  1 
ATOM   6054  N  N   . ASP E  1 90  ? -28.192  -37.556  -46.555 1.00 3.87  ? 90  ASP E N   1 
ATOM   6055  C  CA  . ASP E  1 90  ? -27.742  -37.904  -45.219 1.00 3.80  ? 90  ASP E CA  1 
ATOM   6056  C  C   . ASP E  1 90  ? -26.761  -39.056  -45.293 1.00 3.88  ? 90  ASP E C   1 
ATOM   6057  O  O   . ASP E  1 90  ? -25.738  -39.032  -44.607 1.00 4.19  ? 90  ASP E O   1 
ATOM   6058  C  CB  . ASP E  1 90  ? -28.898  -38.274  -44.311 1.00 4.08  ? 90  ASP E CB  1 
ATOM   6059  C  CG  . ASP E  1 90  ? -29.827  -37.068  -43.973 1.00 6.83  ? 90  ASP E CG  1 
ATOM   6060  O  OD1 . ASP E  1 90  ? -31.079  -37.286  -43.795 1.00 9.13  ? 90  ASP E OD1 1 
ATOM   6061  O  OD2 . ASP E  1 90  ? -29.332  -35.906  -43.852 1.00 9.70  ? 90  ASP E OD2 1 
ATOM   6062  N  N   . LEU E  1 91  ? -27.052  -40.055  -46.130 1.00 3.64  ? 91  LEU E N   1 
ATOM   6063  C  CA  . LEU E  1 91  ? -26.133  -41.185  -46.330 1.00 2.83  ? 91  LEU E CA  1 
ATOM   6064  C  C   . LEU E  1 91  ? -24.774  -40.730  -46.866 1.00 3.09  ? 91  LEU E C   1 
ATOM   6065  O  O   . LEU E  1 91  ? -23.762  -41.140  -46.342 1.00 3.76  ? 91  LEU E O   1 
ATOM   6066  C  CB  . LEU E  1 91  ? -26.750  -42.246  -47.253 1.00 2.85  ? 91  LEU E CB  1 
ATOM   6067  C  CG  . LEU E  1 91  ? -25.926  -43.445  -47.668 1.00 2.00  ? 91  LEU E CG  1 
ATOM   6068  C  CD1 . LEU E  1 91  ? -25.483  -44.194  -46.419 1.00 2.70  ? 91  LEU E CD1 1 
ATOM   6069  C  CD2 . LEU E  1 91  ? -26.702  -44.351  -48.597 1.00 2.00  ? 91  LEU E CD2 1 
ATOM   6070  N  N   . ALA E  1 92  ? -24.732  -39.881  -47.890 1.00 3.23  ? 92  ALA E N   1 
ATOM   6071  C  CA  . ALA E  1 92  ? -23.435  -39.413  -48.414 1.00 3.20  ? 92  ALA E CA  1 
ATOM   6072  C  C   . ALA E  1 92  ? -22.637  -38.728  -47.296 1.00 3.64  ? 92  ALA E C   1 
ATOM   6073  O  O   . ALA E  1 92  ? -21.403  -38.895  -47.176 1.00 4.27  ? 92  ALA E O   1 
ATOM   6074  C  CB  . ALA E  1 92  ? -23.603  -38.505  -49.622 1.00 2.00  ? 92  ALA E CB  1 
ATOM   6075  N  N   . LEU E  1 93  ? -23.346  -37.994  -46.455 1.00 3.83  ? 93  LEU E N   1 
ATOM   6076  C  CA  . LEU E  1 93  ? -22.720  -37.249  -45.384 1.00 4.31  ? 93  LEU E CA  1 
ATOM   6077  C  C   . LEU E  1 93  ? -22.112  -38.163  -44.334 1.00 4.80  ? 93  LEU E C   1 
ATOM   6078  O  O   . LEU E  1 93  ? -20.993  -37.898  -43.880 1.00 5.14  ? 93  LEU E O   1 
ATOM   6079  C  CB  . LEU E  1 93  ? -23.740  -36.325  -44.743 1.00 4.18  ? 93  LEU E CB  1 
ATOM   6080  C  CG  . LEU E  1 93  ? -23.164  -35.267  -43.838 1.00 5.17  ? 93  LEU E CG  1 
ATOM   6081  C  CD1 . LEU E  1 93  ? -22.230  -34.334  -44.643 1.00 5.04  ? 93  LEU E CD1 1 
ATOM   6082  C  CD2 . LEU E  1 93  ? -24.317  -34.498  -43.250 1.00 4.55  ? 93  LEU E CD2 1 
ATOM   6083  N  N   . GLU E  1 94  ? -22.839  -39.224  -43.957 1.00 4.92  ? 94  GLU E N   1 
ATOM   6084  C  CA  . GLU E  1 94  ? -22.356  -40.205  -42.998 1.00 5.03  ? 94  GLU E CA  1 
ATOM   6085  C  C   . GLU E  1 94  ? -21.137  -40.913  -43.555 1.00 4.86  ? 94  GLU E C   1 
ATOM   6086  O  O   . GLU E  1 94  ? -20.142  -41.119  -42.848 1.00 4.45  ? 94  GLU E O   1 
ATOM   6087  C  CB  . GLU E  1 94  ? -23.446  -41.213  -42.648 1.00 5.06  ? 94  GLU E CB  1 
ATOM   6088  C  CG  . GLU E  1 94  ? -24.639  -40.621  -41.930 1.00 7.77  ? 94  GLU E CG  1 
ATOM   6089  C  CD  . GLU E  1 94  ? -24.464  -40.546  -40.407 1.00 13.85 ? 94  GLU E CD  1 
ATOM   6090  O  OE1 . GLU E  1 94  ? -23.350  -40.889  -39.917 1.00 15.12 ? 94  GLU E OE1 1 
ATOM   6091  O  OE2 . GLU E  1 94  ? -25.438  -40.125  -39.696 1.00 14.49 ? 94  GLU E OE2 1 
ATOM   6092  N  N   . LEU E  1 95  ? -21.204  -41.262  -44.831 1.00 4.96  ? 95  LEU E N   1 
ATOM   6093  C  CA  . LEU E  1 95  ? -20.088  -41.895  -45.500 1.00 4.80  ? 95  LEU E CA  1 
ATOM   6094  C  C   . LEU E  1 95  ? -18.828  -41.023  -45.487 1.00 5.52  ? 95  LEU E C   1 
ATOM   6095  O  O   . LEU E  1 95  ? -17.741  -41.541  -45.206 1.00 5.95  ? 95  LEU E O   1 
ATOM   6096  C  CB  . LEU E  1 95  ? -20.485  -42.294  -46.911 1.00 4.58  ? 95  LEU E CB  1 
ATOM   6097  C  CG  . LEU E  1 95  ? -20.838  -43.772  -47.181 1.00 4.47  ? 95  LEU E CG  1 
ATOM   6098  C  CD1 . LEU E  1 95  ? -21.159  -44.564  -45.948 1.00 2.65  ? 95  LEU E CD1 1 
ATOM   6099  C  CD2 . LEU E  1 95  ? -21.944  -43.885  -48.175 1.00 3.36  ? 95  LEU E CD2 1 
ATOM   6100  N  N   . ASP E  1 96  ? -18.941  -39.716  -45.744 1.00 5.50  ? 96  ASP E N   1 
ATOM   6101  C  CA  . ASP E  1 96  ? -17.754  -38.884  -45.670 1.00 6.31  ? 96  ASP E CA  1 
ATOM   6102  C  C   . ASP E  1 96  ? -17.224  -38.724  -44.263 1.00 5.91  ? 96  ASP E C   1 
ATOM   6103  O  O   . ASP E  1 96  ? -16.021  -38.604  -44.052 1.00 5.86  ? 96  ASP E O   1 
ATOM   6104  C  CB  . ASP E  1 96  ? -17.984  -37.514  -46.275 1.00 7.35  ? 96  ASP E CB  1 
ATOM   6105  C  CG  . ASP E  1 96  ? -17.963  -37.539  -47.790 1.00 13.91 ? 96  ASP E CG  1 
ATOM   6106  O  OD1 . ASP E  1 96  ? -17.269  -38.432  -48.409 1.00 19.36 ? 96  ASP E OD1 1 
ATOM   6107  O  OD2 . ASP E  1 96  ? -18.648  -36.659  -48.378 1.00 19.44 ? 96  ASP E OD2 1 
ATOM   6108  N  N   . GLY E  1 97  ? -18.114  -38.685  -43.286 1.00 5.50  ? 97  GLY E N   1 
ATOM   6109  C  CA  . GLY E  1 97  ? -17.663  -38.595  -41.926 1.00 5.60  ? 97  GLY E CA  1 
ATOM   6110  C  C   . GLY E  1 97  ? -17.016  -39.880  -41.456 1.00 5.89  ? 97  GLY E C   1 
ATOM   6111  O  O   . GLY E  1 97  ? -16.084  -39.845  -40.681 1.00 5.91  ? 97  GLY E O   1 
ATOM   6112  N  N   . ALA E  1 98  ? -17.520  -41.023  -41.901 1.00 6.51  ? 98  ALA E N   1 
ATOM   6113  C  CA  . ALA E  1 98  ? -16.927  -42.293  -41.485 1.00 7.78  ? 98  ALA E CA  1 
ATOM   6114  C  C   . ALA E  1 98  ? -15.485  -42.355  -41.987 1.00 9.24  ? 98  ALA E C   1 
ATOM   6115  O  O   . ALA E  1 98  ? -14.588  -42.805  -41.282 1.00 8.85  ? 98  ALA E O   1 
ATOM   6116  C  CB  . ALA E  1 98  ? -17.739  -43.469  -41.989 1.00 6.35  ? 98  ALA E CB  1 
ATOM   6117  N  N   . LYS E  1 99  ? -15.280  -41.860  -43.205 1.00 11.35 ? 99  LYS E N   1 
ATOM   6118  C  CA  . LYS E  1 99  ? -13.984  -41.814  -43.839 1.00 13.64 ? 99  LYS E CA  1 
ATOM   6119  C  C   . LYS E  1 99  ? -13.041  -40.998  -42.961 1.00 11.99 ? 99  LYS E C   1 
ATOM   6120  O  O   . LYS E  1 99  ? -11.985  -41.502  -42.575 1.00 12.42 ? 99  LYS E O   1 
ATOM   6121  C  CB  . LYS E  1 99  ? -14.142  -41.220  -45.249 1.00 14.35 ? 99  LYS E CB  1 
ATOM   6122  C  CG  . LYS E  1 99  ? -13.064  -41.581  -46.282 1.00 18.33 ? 99  LYS E CG  1 
ATOM   6123  C  CD  . LYS E  1 99  ? -13.530  -41.221  -47.732 1.00 19.23 ? 99  LYS E CD  1 
ATOM   6124  C  CE  . LYS E  1 99  ? -14.594  -42.238  -48.364 1.00 22.80 ? 99  LYS E CE  1 
ATOM   6125  N  NZ  . LYS E  1 99  ? -15.735  -41.562  -49.138 1.00 22.12 ? 99  LYS E NZ  1 
ATOM   6126  N  N   . ASN E  1 100 ? -13.439  -39.764  -42.619 1.00 9.85  ? 100 ASN E N   1 
ATOM   6127  C  CA  . ASN E  1 100 ? -12.652  -38.920  -41.714 1.00 8.11  ? 100 ASN E CA  1 
ATOM   6128  C  C   . ASN E  1 100 ? -12.358  -39.576  -40.347 1.00 7.36  ? 100 ASN E C   1 
ATOM   6129  O  O   . ASN E  1 100 ? -11.255  -39.443  -39.798 1.00 6.42  ? 100 ASN E O   1 
ATOM   6130  C  CB  . ASN E  1 100 ? -13.336  -37.573  -41.471 1.00 7.88  ? 100 ASN E CB  1 
ATOM   6131  C  CG  . ASN E  1 100 ? -13.513  -36.742  -42.741 1.00 8.34  ? 100 ASN E CG  1 
ATOM   6132  O  OD1 . ASN E  1 100 ? -14.426  -35.925  -42.817 1.00 9.73  ? 100 ASN E OD1 1 
ATOM   6133  N  ND2 . ASN E  1 100 ? -12.657  -36.942  -43.724 1.00 6.51  ? 100 ASN E ND2 1 
ATOM   6134  N  N   . LEU E  1 101 ? -13.365  -40.288  -39.804 1.00 5.83  ? 101 LEU E N   1 
ATOM   6135  C  CA  . LEU E  1 101 ? -13.230  -40.959  -38.545 1.00 3.84  ? 101 LEU E CA  1 
ATOM   6136  C  C   . LEU E  1 101 ? -12.198  -42.050  -38.626 1.00 3.42  ? 101 LEU E C   1 
ATOM   6137  O  O   . LEU E  1 101 ? -11.367  -42.175  -37.717 1.00 3.01  ? 101 LEU E O   1 
ATOM   6138  C  CB  . LEU E  1 101 ? -14.557  -41.497  -38.088 1.00 4.16  ? 101 LEU E CB  1 
ATOM   6139  C  CG  . LEU E  1 101 ? -15.414  -40.624  -37.156 1.00 2.80  ? 101 LEU E CG  1 
ATOM   6140  C  CD1 . LEU E  1 101 ? -16.875  -41.108  -37.175 1.00 3.14  ? 101 LEU E CD1 1 
ATOM   6141  C  CD2 . LEU E  1 101 ? -14.888  -40.704  -35.772 1.00 2.00  ? 101 LEU E CD2 1 
ATOM   6142  N  N   . ARG E  1 102 ? -12.227  -42.827  -39.712 1.00 3.02  ? 102 ARG E N   1 
ATOM   6143  C  CA  A ARG E  1 102 ? -11.249  -43.910  -39.911 0.50 3.15  ? 102 ARG E CA  1 
ATOM   6144  C  CA  B ARG E  1 102 ? -11.257  -43.913  -39.907 0.50 3.16  ? 102 ARG E CA  1 
ATOM   6145  C  C   . ARG E  1 102 ? -9.840   -43.330  -39.914 1.00 3.56  ? 102 ARG E C   1 
ATOM   6146  O  O   . ARG E  1 102 ? -8.923   -43.871  -39.274 1.00 3.75  ? 102 ARG E O   1 
ATOM   6147  C  CB  A ARG E  1 102 ? -11.557  -44.725  -41.175 0.50 2.53  ? 102 ARG E CB  1 
ATOM   6148  C  CB  B ARG E  1 102 ? -11.594  -44.747  -41.157 0.50 2.54  ? 102 ARG E CB  1 
ATOM   6149  C  CG  A ARG E  1 102 ? -12.960  -45.325  -41.143 0.50 3.08  ? 102 ARG E CG  1 
ATOM   6150  C  CG  B ARG E  1 102 ? -12.861  -45.621  -40.970 0.50 3.16  ? 102 ARG E CG  1 
ATOM   6151  C  CD  A ARG E  1 102 ? -13.230  -46.517  -42.070 0.50 3.44  ? 102 ARG E CD  1 
ATOM   6152  C  CD  B ARG E  1 102 ? -13.429  -46.339  -42.230 0.50 3.52  ? 102 ARG E CD  1 
ATOM   6153  N  NE  A ARG E  1 102 ? -14.145  -47.449  -41.408 0.50 4.47  ? 102 ARG E NE  1 
ATOM   6154  N  NE  B ARG E  1 102 ? -13.833  -45.393  -43.274 0.50 5.97  ? 102 ARG E NE  1 
ATOM   6155  C  CZ  A ARG E  1 102 ? -15.460  -47.432  -41.520 0.50 5.96  ? 102 ARG E CZ  1 
ATOM   6156  C  CZ  B ARG E  1 102 ? -14.176  -45.711  -44.527 0.50 7.21  ? 102 ARG E CZ  1 
ATOM   6157  N  NH1 A ARG E  1 102 ? -16.056  -46.560  -42.293 0.50 9.11  ? 102 ARG E NH1 1 
ATOM   6158  N  NH1 B ARG E  1 102 ? -14.205  -46.977  -44.951 0.50 10.63 ? 102 ARG E NH1 1 
ATOM   6159  N  NH2 A ARG E  1 102 ? -16.185  -48.304  -40.856 0.50 7.38  ? 102 ARG E NH2 1 
ATOM   6160  N  NH2 B ARG E  1 102 ? -14.487  -44.752  -45.369 0.50 7.29  ? 102 ARG E NH2 1 
ATOM   6161  N  N   . GLU E  1 103 ? -9.679   -42.182  -40.578 1.00 4.17  ? 103 GLU E N   1 
ATOM   6162  C  CA  . GLU E  1 103 ? -8.377   -41.579  -40.674 1.00 5.89  ? 103 GLU E CA  1 
ATOM   6163  C  C   . GLU E  1 103 ? -7.934   -41.110  -39.306 1.00 4.49  ? 103 GLU E C   1 
ATOM   6164  O  O   . GLU E  1 103 ? -6.893   -41.544  -38.854 1.00 6.51  ? 103 GLU E O   1 
ATOM   6165  C  CB  . GLU E  1 103 ? -8.360   -40.492  -41.722 1.00 5.28  ? 103 GLU E CB  1 
ATOM   6166  C  CG  . GLU E  1 103 ? -7.084   -39.627  -41.727 1.00 10.19 ? 103 GLU E CG  1 
ATOM   6167  C  CD  . GLU E  1 103 ? -7.086   -38.559  -42.891 1.00 12.28 ? 103 GLU E CD  1 
ATOM   6168  O  OE1 . GLU E  1 103 ? -8.044   -38.609  -43.757 1.00 19.82 ? 103 GLU E OE1 1 
ATOM   6169  O  OE2 . GLU E  1 103 ? -6.145   -37.700  -42.929 1.00 13.54 ? 103 GLU E OE2 1 
ATOM   6170  N  N   . ALA E  1 104 ? -8.757   -40.325  -38.614 1.00 2.87  ? 104 ALA E N   1 
ATOM   6171  C  CA  . ALA E  1 104 ? -8.444   -39.793  -37.288 1.00 2.21  ? 104 ALA E CA  1 
ATOM   6172  C  C   . ALA E  1 104 ? -8.086   -40.876  -36.264 1.00 2.26  ? 104 ALA E C   1 
ATOM   6173  O  O   . ALA E  1 104 ? -7.158   -40.715  -35.490 1.00 2.01  ? 104 ALA E O   1 
ATOM   6174  C  CB  . ALA E  1 104 ? -9.567   -38.974  -36.781 1.00 2.00  ? 104 ALA E CB  1 
ATOM   6175  N  N   . ILE E  1 105 ? -8.821   -41.983  -36.287 1.00 2.42  ? 105 ILE E N   1 
ATOM   6176  C  CA  . ILE E  1 105 ? -8.614   -43.099  -35.368 1.00 2.26  ? 105 ILE E CA  1 
ATOM   6177  C  C   . ILE E  1 105 ? -7.216   -43.683  -35.518 1.00 2.27  ? 105 ILE E C   1 
ATOM   6178  O  O   . ILE E  1 105 ? -6.544   -43.949  -34.521 1.00 2.00  ? 105 ILE E O   1 
ATOM   6179  C  CB  . ILE E  1 105 ? -9.718   -44.186  -35.549 1.00 2.00  ? 105 ILE E CB  1 
ATOM   6180  C  CG1 . ILE E  1 105 ? -11.029  -43.680  -34.968 1.00 2.01  ? 105 ILE E CG1 1 
ATOM   6181  C  CG2 . ILE E  1 105 ? -9.354   -45.459  -34.825 1.00 2.56  ? 105 ILE E CG2 1 
ATOM   6182  C  CD1 . ILE E  1 105 ? -12.214  -44.365  -35.450 1.00 2.00  ? 105 ILE E CD1 1 
ATOM   6183  N  N   . GLY E  1 106 ? -6.795   -43.865  -36.770 1.00 2.23  ? 106 GLY E N   1 
ATOM   6184  C  CA  . GLY E  1 106 ? -5.499   -44.464  -37.062 1.00 2.06  ? 106 GLY E CA  1 
ATOM   6185  C  C   . GLY E  1 106 ? -4.410   -43.540  -36.565 1.00 2.40  ? 106 GLY E C   1 
ATOM   6186  O  O   . GLY E  1 106 ? -3.387   -44.006  -36.013 1.00 3.01  ? 106 GLY E O   1 
ATOM   6187  N  N   . TYR E  1 107 ? -4.625   -42.231  -36.739 1.00 2.01  ? 107 TYR E N   1 
ATOM   6188  C  CA  . TYR E  1 107 ? -3.602   -41.276  -36.356 1.00 2.03  ? 107 TYR E CA  1 
ATOM   6189  C  C   . TYR E  1 107 ? -3.485   -41.143  -34.821 1.00 2.71  ? 107 TYR E C   1 
ATOM   6190  O  O   . TYR E  1 107 ? -2.366   -41.097  -34.269 1.00 2.65  ? 107 TYR E O   1 
ATOM   6191  C  CB  . TYR E  1 107 ? -3.811   -39.929  -37.020 1.00 2.24  ? 107 TYR E CB  1 
ATOM   6192  C  CG  . TYR E  1 107 ? -2.814   -38.946  -36.508 1.00 2.10  ? 107 TYR E CG  1 
ATOM   6193  C  CD1 . TYR E  1 107 ? -1.530   -38.895  -37.023 1.00 2.00  ? 107 TYR E CD1 1 
ATOM   6194  C  CD2 . TYR E  1 107 ? -3.132   -38.124  -35.447 1.00 2.03  ? 107 TYR E CD2 1 
ATOM   6195  C  CE1 . TYR E  1 107 ? -0.601   -38.000  -36.526 1.00 2.15  ? 107 TYR E CE1 1 
ATOM   6196  C  CE2 . TYR E  1 107 ? -2.221   -37.231  -34.934 1.00 3.54  ? 107 TYR E CE2 1 
ATOM   6197  C  CZ  . TYR E  1 107 ? -0.957   -37.174  -35.478 1.00 3.72  ? 107 TYR E CZ  1 
ATOM   6198  O  OH  . TYR E  1 107 ? -0.052   -36.286  -34.956 1.00 4.45  ? 107 TYR E OH  1 
ATOM   6199  N  N   . ALA E  1 108 ? -4.634   -41.109  -34.135 1.00 2.82  ? 108 ALA E N   1 
ATOM   6200  C  CA  . ALA E  1 108 ? -4.659   -41.089  -32.668 1.00 2.69  ? 108 ALA E CA  1 
ATOM   6201  C  C   . ALA E  1 108 ? -3.879   -42.264  -32.054 1.00 2.91  ? 108 ALA E C   1 
ATOM   6202  O  O   . ALA E  1 108 ? -3.145   -42.100  -31.079 1.00 2.71  ? 108 ALA E O   1 
ATOM   6203  C  CB  . ALA E  1 108 ? -6.083   -41.036  -32.140 1.00 2.00  ? 108 ALA E CB  1 
ATOM   6204  N  N   . ASP E  1 109 ? -4.012   -43.435  -32.653 1.00 2.96  ? 109 ASP E N   1 
ATOM   6205  C  CA  . ASP E  1 109 ? -3.260   -44.610  -32.249 1.00 3.23  ? 109 ASP E CA  1 
ATOM   6206  C  C   . ASP E  1 109 ? -1.777   -44.389  -32.426 1.00 3.31  ? 109 ASP E C   1 
ATOM   6207  O  O   . ASP E  1 109 ? -0.975   -44.812  -31.612 1.00 2.65  ? 109 ASP E O   1 
ATOM   6208  C  CB  . ASP E  1 109 ? -3.679   -45.818  -33.075 1.00 3.42  ? 109 ASP E CB  1 
ATOM   6209  C  CG  . ASP E  1 109 ? -3.168   -47.114  -32.508 1.00 5.64  ? 109 ASP E CG  1 
ATOM   6210  O  OD1 . ASP E  1 109 ? -2.094   -47.566  -32.964 1.00 8.77  ? 109 ASP E OD1 1 
ATOM   6211  O  OD2 . ASP E  1 109 ? -3.808   -47.696  -31.596 1.00 8.50  ? 109 ASP E OD2 1 
ATOM   6212  N  N   . SER E  1 110 ? -1.386   -43.708  -33.495 1.00 3.75  ? 110 SER E N   1 
ATOM   6213  C  CA  . SER E  1 110 ? 0.033    -43.655  -33.751 1.00 4.43  ? 110 SER E CA  1 
ATOM   6214  C  C   . SER E  1 110 ? 0.737    -42.625  -32.885 1.00 3.83  ? 110 SER E C   1 
ATOM   6215  O  O   . SER E  1 110 ? 1.924    -42.774  -32.629 1.00 4.04  ? 110 SER E O   1 
ATOM   6216  C  CB  . SER E  1 110 ? 0.317    -43.539  -35.236 1.00 4.64  ? 110 SER E CB  1 
ATOM   6217  O  OG  . SER E  1 110 ? -0.267   -42.354  -35.690 1.00 10.42 ? 110 SER E OG  1 
ATOM   6218  N  N   . VAL E  1 111 ? 0.009    -41.619  -32.384 1.00 3.46  ? 111 VAL E N   1 
ATOM   6219  C  CA  . VAL E  1 111 ? 0.558    -40.722  -31.357 1.00 2.86  ? 111 VAL E CA  1 
ATOM   6220  C  C   . VAL E  1 111 ? 0.159    -41.112  -29.930 1.00 2.80  ? 111 VAL E C   1 
ATOM   6221  O  O   . VAL E  1 111 ? 0.378    -40.353  -28.997 1.00 2.00  ? 111 VAL E O   1 
ATOM   6222  C  CB  . VAL E  1 111 ? 0.189    -39.245  -31.571 1.00 2.94  ? 111 VAL E CB  1 
ATOM   6223  C  CG1 . VAL E  1 111 ? 0.852    -38.703  -32.797 1.00 3.08  ? 111 VAL E CG1 1 
ATOM   6224  C  CG2 . VAL E  1 111 ? -1.324   -39.062  -31.646 1.00 3.53  ? 111 VAL E CG2 1 
ATOM   6225  N  N   . HIS E  1 112 ? -0.423   -42.298  -29.757 1.00 3.25  ? 112 HIS E N   1 
ATOM   6226  C  CA  . HIS E  1 112 ? -0.720   -42.824  -28.417 1.00 3.77  ? 112 HIS E CA  1 
ATOM   6227  C  C   . HIS E  1 112 ? -1.864   -42.121  -27.670 1.00 3.48  ? 112 HIS E C   1 
ATOM   6228  O  O   . HIS E  1 112 ? -1.977   -42.269  -26.471 1.00 4.06  ? 112 HIS E O   1 
ATOM   6229  C  CB  . HIS E  1 112 ? 0.553    -42.880  -27.556 1.00 3.87  ? 112 HIS E CB  1 
ATOM   6230  C  CG  . HIS E  1 112 ? 1.610    -43.784  -28.129 1.00 8.25  ? 112 HIS E CG  1 
ATOM   6231  N  ND1 . HIS E  1 112 ? 2.599    -43.322  -28.975 1.00 12.10 ? 112 HIS E ND1 1 
ATOM   6232  C  CD2 . HIS E  1 112 ? 1.790    -45.129  -28.040 1.00 11.28 ? 112 HIS E CD2 1 
ATOM   6233  C  CE1 . HIS E  1 112 ? 3.347    -44.342  -29.368 1.00 12.97 ? 112 HIS E CE1 1 
ATOM   6234  N  NE2 . HIS E  1 112 ? 2.880    -45.447  -28.809 1.00 12.48 ? 112 HIS E NE2 1 
ATOM   6235  N  N   . ASP E  1 113 ? -2.715   -41.365  -28.368 1.00 3.03  ? 113 ASP E N   1 
ATOM   6236  C  CA  . ASP E  1 113 ? -3.893   -40.779  -27.761 1.00 2.49  ? 113 ASP E CA  1 
ATOM   6237  C  C   . ASP E  1 113 ? -5.023   -41.813  -27.782 1.00 2.16  ? 113 ASP E C   1 
ATOM   6238  O  O   . ASP E  1 113 ? -6.029   -41.702  -28.498 1.00 2.02  ? 113 ASP E O   1 
ATOM   6239  C  CB  . ASP E  1 113 ? -4.320   -39.486  -28.460 1.00 2.56  ? 113 ASP E CB  1 
ATOM   6240  C  CG  . ASP E  1 113 ? -5.401   -38.697  -27.670 1.00 3.38  ? 113 ASP E CG  1 
ATOM   6241  O  OD1 . ASP E  1 113 ? -5.989   -39.202  -26.669 1.00 3.54  ? 113 ASP E OD1 1 
ATOM   6242  O  OD2 . ASP E  1 113 ? -5.672   -37.547  -28.076 1.00 3.85  ? 113 ASP E OD2 1 
ATOM   6243  N  N   . TYR E  1 114 ? -4.839   -42.817  -26.957 1.00 2.00  ? 114 TYR E N   1 
ATOM   6244  C  CA  . TYR E  1 114 ? -5.731   -43.930  -26.886 1.00 2.22  ? 114 TYR E CA  1 
ATOM   6245  C  C   . TYR E  1 114 ? -7.129   -43.576  -26.388 1.00 2.54  ? 114 TYR E C   1 
ATOM   6246  O  O   . TYR E  1 114 ? -8.092   -44.209  -26.813 1.00 2.02  ? 114 TYR E O   1 
ATOM   6247  C  CB  . TYR E  1 114 ? -5.080   -45.026  -26.060 1.00 2.00  ? 114 TYR E CB  1 
ATOM   6248  C  CG  . TYR E  1 114 ? -3.820   -45.539  -26.724 1.00 2.48  ? 114 TYR E CG  1 
ATOM   6249  C  CD1 . TYR E  1 114 ? -3.860   -46.108  -28.014 1.00 2.00  ? 114 TYR E CD1 1 
ATOM   6250  C  CD2 . TYR E  1 114 ? -2.586   -45.457  -26.077 1.00 2.16  ? 114 TYR E CD2 1 
ATOM   6251  C  CE1 . TYR E  1 114 ? -2.744   -46.585  -28.615 1.00 2.00  ? 114 TYR E CE1 1 
ATOM   6252  C  CE2 . TYR E  1 114 ? -1.424   -45.950  -26.686 1.00 2.04  ? 114 TYR E CE2 1 
ATOM   6253  C  CZ  . TYR E  1 114 ? -1.515   -46.510  -27.952 1.00 2.02  ? 114 TYR E CZ  1 
ATOM   6254  O  OH  . TYR E  1 114 ? -0.360   -46.985  -28.563 1.00 2.00  ? 114 TYR E OH  1 
ATOM   6255  N  N   . VAL E  1 115 ? -7.269   -42.563  -25.531 1.00 2.62  ? 115 VAL E N   1 
ATOM   6256  C  CA  . VAL E  1 115 ? -8.619   -42.232  -25.135 1.00 2.54  ? 115 VAL E CA  1 
ATOM   6257  C  C   . VAL E  1 115 ? -9.396   -41.444  -26.167 1.00 2.92  ? 115 VAL E C   1 
ATOM   6258  O  O   . VAL E  1 115 ? -10.560  -41.754  -26.404 1.00 3.43  ? 115 VAL E O   1 
ATOM   6259  C  CB  . VAL E  1 115 ? -8.823   -41.890  -23.641 1.00 2.33  ? 115 VAL E CB  1 
ATOM   6260  C  CG1 . VAL E  1 115 ? -7.557   -41.944  -22.890 1.00 2.92  ? 115 VAL E CG1 1 
ATOM   6261  C  CG2 . VAL E  1 115 ? -9.635   -40.621  -23.401 1.00 2.00  ? 115 VAL E CG2 1 
ATOM   6262  N  N   . SER E  1 116 ? -8.758   -40.494  -26.843 1.00 2.76  ? 116 SER E N   1 
ATOM   6263  C  CA  . SER E  1 116 ? -9.388   -39.930  -28.029 1.00 2.48  ? 116 SER E CA  1 
ATOM   6264  C  C   . SER E  1 116 ? -9.774   -41.026  -29.017 1.00 2.78  ? 116 SER E C   1 
ATOM   6265  O  O   . SER E  1 116 ? -10.878  -40.995  -29.557 1.00 3.15  ? 116 SER E O   1 
ATOM   6266  C  CB  . SER E  1 116 ? -8.514   -38.901  -28.710 1.00 2.00  ? 116 SER E CB  1 
ATOM   6267  O  OG  . SER E  1 116 ? -8.308   -37.789  -27.862 1.00 2.02  ? 116 SER E OG  1 
ATOM   6268  N  N   . ARG E  1 117 ? -8.900   -42.015  -29.225 1.00 2.55  ? 117 ARG E N   1 
ATOM   6269  C  CA  . ARG E  1 117 ? -9.211   -43.069  -30.167 1.00 2.22  ? 117 ARG E CA  1 
ATOM   6270  C  C   . ARG E  1 117 ? -10.477  -43.807  -29.742 1.00 3.12  ? 117 ARG E C   1 
ATOM   6271  O  O   . ARG E  1 117 ? -11.391  -44.067  -30.558 1.00 3.07  ? 117 ARG E O   1 
ATOM   6272  C  CB  . ARG E  1 117 ? -8.059   -44.041  -30.280 1.00 2.00  ? 117 ARG E CB  1 
ATOM   6273  C  CG  . ARG E  1 117 ? -8.366   -45.224  -31.169 1.00 2.00  ? 117 ARG E CG  1 
ATOM   6274  C  CD  . ARG E  1 117 ? -7.105   -45.949  -31.505 1.00 2.00  ? 117 ARG E CD  1 
ATOM   6275  N  NE  . ARG E  1 117 ? -7.338   -47.356  -31.837 1.00 2.92  ? 117 ARG E NE  1 
ATOM   6276  C  CZ  . ARG E  1 117 ? -6.999   -47.945  -32.984 1.00 2.71  ? 117 ARG E CZ  1 
ATOM   6277  N  NH1 . ARG E  1 117 ? -6.396   -47.254  -33.954 1.00 2.00  ? 117 ARG E NH1 1 
ATOM   6278  N  NH2 . ARG E  1 117 ? -7.241   -49.233  -33.154 1.00 2.00  ? 117 ARG E NH2 1 
ATOM   6279  N  N   . ASP E  1 118 ? -10.528  -44.121  -28.452 1.00 3.53  ? 118 ASP E N   1 
ATOM   6280  C  CA  . ASP E  1 118 ? -11.593  -44.917  -27.872 1.00 3.92  ? 118 ASP E CA  1 
ATOM   6281  C  C   . ASP E  1 118 ? -12.917  -44.152  -28.022 1.00 4.01  ? 118 ASP E C   1 
ATOM   6282  O  O   . ASP E  1 118 ? -13.913  -44.706  -28.434 1.00 5.13  ? 118 ASP E O   1 
ATOM   6283  C  CB  . ASP E  1 118 ? -11.264  -45.185  -26.396 1.00 4.79  ? 118 ASP E CB  1 
ATOM   6284  C  CG  . ASP E  1 118 ? -12.244  -46.153  -25.730 1.00 7.80  ? 118 ASP E CG  1 
ATOM   6285  O  OD1 . ASP E  1 118 ? -12.341  -47.322  -26.177 1.00 11.68 ? 118 ASP E OD1 1 
ATOM   6286  O  OD2 . ASP E  1 118 ? -12.896  -45.768  -24.729 1.00 11.15 ? 118 ASP E OD2 1 
ATOM   6287  N  N   . MET E  1 119 ? -12.914  -42.866  -27.734 1.00 3.99  ? 119 MET E N   1 
ATOM   6288  C  CA  . MET E  1 119 ? -14.093  -42.067  -27.958 1.00 4.18  ? 119 MET E CA  1 
ATOM   6289  C  C   . MET E  1 119 ? -14.500  -42.062  -29.432 1.00 3.86  ? 119 MET E C   1 
ATOM   6290  O  O   . MET E  1 119 ? -15.685  -42.167  -29.736 1.00 4.56  ? 119 MET E O   1 
ATOM   6291  C  CB  . MET E  1 119 ? -13.879  -40.641  -27.465 1.00 4.12  ? 119 MET E CB  1 
ATOM   6292  C  CG  . MET E  1 119 ? -14.873  -39.614  -28.008 1.00 4.21  ? 119 MET E CG  1 
ATOM   6293  S  SD  . MET E  1 119 ? -14.149  -37.955  -27.961 1.00 5.73  ? 119 MET E SD  1 
ATOM   6294  C  CE  . MET E  1 119 ? -14.226  -37.712  -26.187 1.00 9.20  ? 119 MET E CE  1 
ATOM   6295  N  N   . MET E  1 120 ? -13.535  -41.951  -30.337 1.00 3.09  ? 120 MET E N   1 
ATOM   6296  C  CA  . MET E  1 120 ? -13.867  -41.934  -31.757 1.00 3.23  ? 120 MET E CA  1 
ATOM   6297  C  C   . MET E  1 120 ? -14.449  -43.254  -32.253 1.00 3.20  ? 120 MET E C   1 
ATOM   6298  O  O   . MET E  1 120 ? -15.319  -43.237  -33.101 1.00 2.69  ? 120 MET E O   1 
ATOM   6299  C  CB  . MET E  1 120 ? -12.663  -41.513  -32.599 1.00 2.56  ? 120 MET E CB  1 
ATOM   6300  C  CG  . MET E  1 120 ? -12.284  -40.108  -32.347 1.00 2.68  ? 120 MET E CG  1 
ATOM   6301  S  SD  . MET E  1 120 ? -11.013  -39.484  -33.400 1.00 5.62  ? 120 MET E SD  1 
ATOM   6302  C  CE  . MET E  1 120 ? -9.557   -40.395  -32.864 1.00 2.44  ? 120 MET E CE  1 
ATOM   6303  N  N   . ILE E  1 121 ? -13.964  -44.388  -31.727 1.00 3.55  ? 121 ILE E N   1 
ATOM   6304  C  CA  . ILE E  1 121 ? -14.449  -45.681  -32.171 1.00 3.28  ? 121 ILE E CA  1 
ATOM   6305  C  C   . ILE E  1 121 ? -15.901  -45.849  -31.764 1.00 4.03  ? 121 ILE E C   1 
ATOM   6306  O  O   . ILE E  1 121 ? -16.696  -46.361  -32.549 1.00 3.57  ? 121 ILE E O   1 
ATOM   6307  C  CB  . ILE E  1 121 ? -13.618  -46.848  -31.640 1.00 3.13  ? 121 ILE E CB  1 
ATOM   6308  C  CG1 . ILE E  1 121 ? -12.305  -46.938  -32.379 1.00 2.66  ? 121 ILE E CG1 1 
ATOM   6309  C  CG2 . ILE E  1 121 ? -14.312  -48.144  -31.889 1.00 2.00  ? 121 ILE E CG2 1 
ATOM   6310  C  CD1 . ILE E  1 121 ? -11.237  -47.714  -31.596 1.00 2.83  ? 121 ILE E CD1 1 
ATOM   6311  N  N   . GLU E  1 122 ? -16.271  -45.400  -30.557 1.00 4.74  ? 122 GLU E N   1 
ATOM   6312  C  CA  . GLU E  1 122 ? -17.686  -45.461  -30.166 1.00 5.54  ? 122 GLU E CA  1 
ATOM   6313  C  C   . GLU E  1 122 ? -18.556  -44.605  -31.087 1.00 5.39  ? 122 GLU E C   1 
ATOM   6314  O  O   . GLU E  1 122 ? -19.629  -45.047  -31.519 1.00 6.39  ? 122 GLU E O   1 
ATOM   6315  C  CB  . GLU E  1 122 ? -17.915  -45.151  -28.678 1.00 5.85  ? 122 GLU E CB  1 
ATOM   6316  C  CG  . GLU E  1 122 ? -17.331  -46.245  -27.663 1.00 11.57 ? 122 GLU E CG  1 
ATOM   6317  C  CD  . GLU E  1 122 ? -17.672  -47.791  -28.033 1.00 19.42 ? 122 GLU E CD  1 
ATOM   6318  O  OE1 . GLU E  1 122 ? -18.855  -48.255  -27.789 1.00 20.90 ? 122 GLU E OE1 1 
ATOM   6319  O  OE2 . GLU E  1 122 ? -16.740  -48.534  -28.534 1.00 19.00 ? 122 GLU E OE2 1 
ATOM   6320  N  N   . ILE E  1 123 ? -18.085  -43.405  -31.440 1.00 4.54  ? 123 ILE E N   1 
ATOM   6321  C  CA  . ILE E  1 123 ? -18.834  -42.529  -32.336 1.00 3.58  ? 123 ILE E CA  1 
ATOM   6322  C  C   . ILE E  1 123 ? -19.025  -43.205  -33.709 1.00 4.08  ? 123 ILE E C   1 
ATOM   6323  O  O   . ILE E  1 123 ? -20.150  -43.224  -34.239 1.00 3.88  ? 123 ILE E O   1 
ATOM   6324  C  CB  . ILE E  1 123 ? -18.185  -41.136  -32.419 1.00 3.53  ? 123 ILE E CB  1 
ATOM   6325  C  CG1 . ILE E  1 123 ? -18.431  -40.411  -31.094 1.00 2.48  ? 123 ILE E CG1 1 
ATOM   6326  C  CG2 . ILE E  1 123 ? -18.690  -40.317  -33.624 1.00 2.44  ? 123 ILE E CG2 1 
ATOM   6327  C  CD1 . ILE E  1 123 ? -17.545  -39.218  -30.888 1.00 2.00  ? 123 ILE E CD1 1 
ATOM   6328  N  N   . LEU E  1 124 ? -17.948  -43.800  -34.249 1.00 3.94  ? 124 LEU E N   1 
ATOM   6329  C  CA  . LEU E  1 124 ? -17.986  -44.462  -35.543 1.00 3.92  ? 124 LEU E CA  1 
ATOM   6330  C  C   . LEU E  1 124 ? -19.010  -45.592  -35.528 1.00 4.53  ? 124 LEU E C   1 
ATOM   6331  O  O   . LEU E  1 124 ? -19.740  -45.796  -36.495 1.00 4.89  ? 124 LEU E O   1 
ATOM   6332  C  CB  . LEU E  1 124 ? -16.607  -44.997  -35.924 1.00 3.45  ? 124 LEU E CB  1 
ATOM   6333  C  CG  . LEU E  1 124 ? -16.453  -45.774  -37.244 1.00 2.98  ? 124 LEU E CG  1 
ATOM   6334  C  CD1 . LEU E  1 124 ? -16.802  -44.965  -38.505 1.00 2.00  ? 124 LEU E CD1 1 
ATOM   6335  C  CD2 . LEU E  1 124 ? -15.055  -46.325  -37.306 1.00 2.00  ? 124 LEU E CD2 1 
ATOM   6336  N  N   . ARG E  1 125 ? -19.078  -46.310  -34.414 1.00 4.97  ? 125 ARG E N   1 
ATOM   6337  C  CA  . ARG E  1 125 ? -20.074  -47.340  -34.224 1.00 5.52  ? 125 ARG E CA  1 
ATOM   6338  C  C   . ARG E  1 125 ? -21.502  -46.759  -34.293 1.00 5.78  ? 125 ARG E C   1 
ATOM   6339  O  O   . ARG E  1 125 ? -22.368  -47.381  -34.886 1.00 5.63  ? 125 ARG E O   1 
ATOM   6340  C  CB  . ARG E  1 125 ? -19.831  -48.058  -32.904 1.00 5.57  ? 125 ARG E CB  1 
ATOM   6341  C  CG  . ARG E  1 125 ? -20.776  -49.180  -32.646 1.00 7.89  ? 125 ARG E CG  1 
ATOM   6342  C  CD  . ARG E  1 125 ? -20.382  -49.986  -31.417 1.00 12.92 ? 125 ARG E CD  1 
ATOM   6343  N  NE  . ARG E  1 125 ? -21.452  -50.952  -31.085 1.00 19.06 ? 125 ARG E NE  1 
ATOM   6344  C  CZ  . ARG E  1 125 ? -21.549  -51.621  -29.922 1.00 22.48 ? 125 ARG E CZ  1 
ATOM   6345  N  NH1 . ARG E  1 125 ? -20.641  -51.441  -28.930 1.00 21.48 ? 125 ARG E NH1 1 
ATOM   6346  N  NH2 . ARG E  1 125 ? -22.559  -52.481  -29.746 1.00 19.89 ? 125 ARG E NH2 1 
ATOM   6347  N  N   . ASP E  1 126 ? -21.740  -45.578  -33.718 1.00 6.01  ? 126 ASP E N   1 
ATOM   6348  C  CA  . ASP E  1 126 ? -23.050  -44.954  -33.860 1.00 6.50  ? 126 ASP E CA  1 
ATOM   6349  C  C   . ASP E  1 126 ? -23.314  -44.548  -35.298 1.00 6.72  ? 126 ASP E C   1 
ATOM   6350  O  O   . ASP E  1 126 ? -24.440  -44.632  -35.743 1.00 7.37  ? 126 ASP E O   1 
ATOM   6351  C  CB  . ASP E  1 126 ? -23.277  -43.747  -32.917 1.00 6.65  ? 126 ASP E CB  1 
ATOM   6352  C  CG  . ASP E  1 126 ? -23.094  -44.092  -31.422 1.00 9.55  ? 126 ASP E CG  1 
ATOM   6353  O  OD1 . ASP E  1 126 ? -22.814  -43.161  -30.611 1.00 10.14 ? 126 ASP E OD1 1 
ATOM   6354  O  OD2 . ASP E  1 126 ? -23.211  -45.295  -31.039 1.00 13.12 ? 126 ASP E OD2 1 
ATOM   6355  N  N   . GLU E  1 127 ? -22.279  -44.136  -36.026 1.00 6.85  ? 127 GLU E N   1 
ATOM   6356  C  CA  . GLU E  1 127 ? -22.455  -43.640  -37.400 1.00 6.88  ? 127 GLU E CA  1 
ATOM   6357  C  C   . GLU E  1 127 ? -22.772  -44.771  -38.300 1.00 5.99  ? 127 GLU E C   1 
ATOM   6358  O  O   . GLU E  1 127 ? -23.655  -44.681  -39.127 1.00 5.38  ? 127 GLU E O   1 
ATOM   6359  C  CB  . GLU E  1 127 ? -21.213  -42.909  -37.924 1.00 6.96  ? 127 GLU E CB  1 
ATOM   6360  C  CG  . GLU E  1 127 ? -20.763  -41.727  -37.028 1.00 11.06 ? 127 GLU E CG  1 
ATOM   6361  C  CD  . GLU E  1 127 ? -21.761  -40.554  -36.913 1.00 12.28 ? 127 GLU E CD  1 
ATOM   6362  O  OE1 . GLU E  1 127 ? -21.383  -39.537  -36.310 1.00 14.04 ? 127 GLU E OE1 1 
ATOM   6363  O  OE2 . GLU E  1 127 ? -22.896  -40.617  -37.416 1.00 12.85 ? 127 GLU E OE2 1 
ATOM   6364  N  N   . GLU E  1 128 ? -22.013  -45.840  -38.122 1.00 6.05  ? 128 GLU E N   1 
ATOM   6365  C  CA  . GLU E  1 128 ? -22.176  -47.067  -38.845 1.00 5.50  ? 128 GLU E CA  1 
ATOM   6366  C  C   . GLU E  1 128 ? -23.667  -47.523  -38.654 1.00 5.43  ? 128 GLU E C   1 
ATOM   6367  O  O   . GLU E  1 128 ? -24.315  -47.980  -39.607 1.00 5.31  ? 128 GLU E O   1 
ATOM   6368  C  CB  . GLU E  1 128 ? -21.152  -48.020  -38.256 1.00 5.53  ? 128 GLU E CB  1 
ATOM   6369  C  CG  . GLU E  1 128 ? -20.615  -49.097  -39.143 1.00 6.76  ? 128 GLU E CG  1 
ATOM   6370  C  CD  . GLU E  1 128 ? -19.103  -49.050  -39.318 1.00 7.24  ? 128 GLU E CD  1 
ATOM   6371  O  OE1 . GLU E  1 128 ? -18.544  -47.984  -39.571 1.00 9.78  ? 128 GLU E OE1 1 
ATOM   6372  O  OE2 . GLU E  1 128 ? -18.452  -50.094  -39.252 1.00 7.50  ? 128 GLU E OE2 1 
ATOM   6373  N  N   . GLY E  1 129 ? -24.219  -47.329  -37.438 1.00 4.78  ? 129 GLY E N   1 
ATOM   6374  C  CA  . GLY E  1 129 ? -25.638  -47.566  -37.165 1.00 4.13  ? 129 GLY E CA  1 
ATOM   6375  C  C   . GLY E  1 129 ? -26.576  -46.708  -38.009 1.00 5.03  ? 129 GLY E C   1 
ATOM   6376  O  O   . GLY E  1 129 ? -27.541  -47.211  -38.569 1.00 5.06  ? 129 GLY E O   1 
ATOM   6377  N  N   . HIS E  1 130 ? -26.313  -45.404  -38.098 1.00 5.22  ? 130 HIS E N   1 
ATOM   6378  C  CA  . HIS E  1 130 ? -27.099  -44.529  -38.954 1.00 5.81  ? 130 HIS E CA  1 
ATOM   6379  C  C   . HIS E  1 130 ? -26.979  -44.947  -40.426 1.00 5.56  ? 130 HIS E C   1 
ATOM   6380  O  O   . HIS E  1 130 ? -27.977  -44.980  -41.150 1.00 5.64  ? 130 HIS E O   1 
ATOM   6381  C  CB  . HIS E  1 130 ? -26.660  -43.091  -38.815 1.00 6.65  ? 130 HIS E CB  1 
ATOM   6382  C  CG  . HIS E  1 130 ? -26.773  -42.543  -37.430 1.00 10.70 ? 130 HIS E CG  1 
ATOM   6383  N  ND1 . HIS E  1 130 ? -26.081  -41.423  -37.020 1.00 14.40 ? 130 HIS E ND1 1 
ATOM   6384  C  CD2 . HIS E  1 130 ? -27.479  -42.958  -36.354 1.00 11.85 ? 130 HIS E CD2 1 
ATOM   6385  C  CE1 . HIS E  1 130 ? -26.356  -41.170  -35.755 1.00 14.21 ? 130 HIS E CE1 1 
ATOM   6386  N  NE2 . HIS E  1 130 ? -27.204  -42.086  -35.328 1.00 12.94 ? 130 HIS E NE2 1 
ATOM   6387  N  N   . ILE E  1 131 ? -25.768  -45.262  -40.869 1.00 4.95  ? 131 ILE E N   1 
ATOM   6388  C  CA  . ILE E  1 131 ? -25.562  -45.764  -42.205 1.00 4.08  ? 131 ILE E CA  1 
ATOM   6389  C  C   . ILE E  1 131 ? -26.471  -47.002  -42.440 1.00 4.71  ? 131 ILE E C   1 
ATOM   6390  O  O   . ILE E  1 131 ? -27.157  -47.103  -43.458 1.00 4.78  ? 131 ILE E O   1 
ATOM   6391  C  CB  . ILE E  1 131 ? -24.057  -46.075  -42.474 1.00 3.99  ? 131 ILE E CB  1 
ATOM   6392  C  CG1 . ILE E  1 131 ? -23.253  -44.767  -42.440 1.00 3.95  ? 131 ILE E CG1 1 
ATOM   6393  C  CG2 . ILE E  1 131 ? -23.873  -46.802  -43.789 1.00 2.66  ? 131 ILE E CG2 1 
ATOM   6394  C  CD1 . ILE E  1 131 ? -21.723  -44.905  -42.438 1.00 2.06  ? 131 ILE E CD1 1 
ATOM   6395  N  N   . ASP E  1 132 ? -26.509  -47.923  -41.487 1.00 4.30  ? 132 ASP E N   1 
ATOM   6396  C  CA  . ASP E  1 132 ? -27.349  -49.096  -41.638 1.00 4.29  ? 132 ASP E CA  1 
ATOM   6397  C  C   . ASP E  1 132 ? -28.814  -48.673  -41.871 1.00 4.13  ? 132 ASP E C   1 
ATOM   6398  O  O   . ASP E  1 132 ? -29.477  -49.126  -42.822 1.00 4.06  ? 132 ASP E O   1 
ATOM   6399  C  CB  . ASP E  1 132 ? -27.220  -49.960  -40.401 1.00 4.63  ? 132 ASP E CB  1 
ATOM   6400  C  CG  . ASP E  1 132 ? -27.870  -51.322  -40.555 1.00 6.34  ? 132 ASP E CG  1 
ATOM   6401  O  OD1 . ASP E  1 132 ? -28.387  -51.653  -41.628 1.00 4.72  ? 132 ASP E OD1 1 
ATOM   6402  O  OD2 . ASP E  1 132 ? -27.820  -52.096  -39.567 1.00 10.47 ? 132 ASP E OD2 1 
ATOM   6403  N  N   . TRP E  1 133 ? -29.302  -47.767  -41.034 1.00 3.86  ? 133 TRP E N   1 
ATOM   6404  C  CA  . TRP E  1 133 ? -30.684  -47.367  -41.118 1.00 3.78  ? 133 TRP E CA  1 
ATOM   6405  C  C   . TRP E  1 133 ? -31.000  -46.692  -42.453 1.00 3.75  ? 133 TRP E C   1 
ATOM   6406  O  O   . TRP E  1 133 ? -31.974  -47.060  -43.100 1.00 3.97  ? 133 TRP E O   1 
ATOM   6407  C  CB  . TRP E  1 133 ? -31.094  -46.496  -39.924 1.00 3.78  ? 133 TRP E CB  1 
ATOM   6408  C  CG  . TRP E  1 133 ? -32.531  -46.148  -39.968 1.00 4.09  ? 133 TRP E CG  1 
ATOM   6409  C  CD1 . TRP E  1 133 ? -33.585  -46.925  -39.541 1.00 4.07  ? 133 TRP E CD1 1 
ATOM   6410  C  CD2 . TRP E  1 133 ? -33.107  -44.960  -40.511 1.00 4.37  ? 133 TRP E CD2 1 
ATOM   6411  N  NE1 . TRP E  1 133 ? -34.772  -46.269  -39.760 1.00 3.70  ? 133 TRP E NE1 1 
ATOM   6412  C  CE2 . TRP E  1 133 ? -34.510  -45.065  -40.355 1.00 3.85  ? 133 TRP E CE2 1 
ATOM   6413  C  CE3 . TRP E  1 133 ? -32.577  -43.807  -41.085 1.00 4.10  ? 133 TRP E CE3 1 
ATOM   6414  C  CZ2 . TRP E  1 133 ? -35.383  -44.075  -40.770 1.00 4.26  ? 133 TRP E CZ2 1 
ATOM   6415  C  CZ3 . TRP E  1 133 ? -33.458  -42.797  -41.497 1.00 3.85  ? 133 TRP E CZ3 1 
ATOM   6416  C  CH2 . TRP E  1 133 ? -34.844  -42.944  -41.334 1.00 4.49  ? 133 TRP E CH2 1 
ATOM   6417  N  N   . LEU E  1 134 ? -30.184  -45.721  -42.857 1.00 3.42  ? 134 LEU E N   1 
ATOM   6418  C  CA  . LEU E  1 134 ? -30.391  -45.021  -44.119 1.00 2.61  ? 134 LEU E CA  1 
ATOM   6419  C  C   . LEU E  1 134 ? -30.388  -45.979  -45.307 1.00 2.53  ? 134 LEU E C   1 
ATOM   6420  O  O   . LEU E  1 134 ? -31.230  -45.876  -46.189 1.00 2.40  ? 134 LEU E O   1 
ATOM   6421  C  CB  . LEU E  1 134 ? -29.311  -43.981  -44.342 1.00 2.48  ? 134 LEU E CB  1 
ATOM   6422  C  CG  . LEU E  1 134 ? -29.359  -42.522  -43.888 1.00 2.38  ? 134 LEU E CG  1 
ATOM   6423  C  CD1 . LEU E  1 134 ? -30.684  -42.041  -43.438 1.00 2.00  ? 134 LEU E CD1 1 
ATOM   6424  C  CD2 . LEU E  1 134 ? -28.275  -42.207  -42.866 1.00 2.00  ? 134 LEU E CD2 1 
ATOM   6425  N  N   . GLU E  1 135 ? -29.427  -46.887  -45.353 1.00 2.82  ? 135 GLU E N   1 
ATOM   6426  C  CA  . GLU E  1 135 ? -29.343  -47.837  -46.473 1.00 3.40  ? 135 GLU E CA  1 
ATOM   6427  C  C   . GLU E  1 135 ? -30.629  -48.683  -46.541 1.00 3.62  ? 135 GLU E C   1 
ATOM   6428  O  O   . GLU E  1 135 ? -31.208  -48.897  -47.621 1.00 4.00  ? 135 GLU E O   1 
ATOM   6429  C  CB  . GLU E  1 135 ? -28.130  -48.751  -46.342 1.00 2.45  ? 135 GLU E CB  1 
ATOM   6430  C  CG  . GLU E  1 135 ? -26.822  -48.069  -46.636 1.00 3.73  ? 135 GLU E CG  1 
ATOM   6431  C  CD  . GLU E  1 135 ? -25.576  -48.973  -46.352 1.00 5.16  ? 135 GLU E CD  1 
ATOM   6432  O  OE1 . GLU E  1 135 ? -25.682  -50.013  -45.627 1.00 4.26  ? 135 GLU E OE1 1 
ATOM   6433  O  OE2 . GLU E  1 135 ? -24.483  -48.604  -46.868 1.00 6.62  ? 135 GLU E OE2 1 
ATOM   6434  N  N   . THR E  1 136 ? -31.085  -49.140  -45.382 1.00 2.94  ? 136 THR E N   1 
ATOM   6435  C  CA  . THR E  1 136 ? -32.255  -49.951  -45.341 1.00 2.73  ? 136 THR E CA  1 
ATOM   6436  C  C   . THR E  1 136 ? -33.475  -49.181  -45.833 1.00 2.76  ? 136 THR E C   1 
ATOM   6437  O  O   . THR E  1 136 ? -34.233  -49.706  -46.641 1.00 3.24  ? 136 THR E O   1 
ATOM   6438  C  CB  . THR E  1 136 ? -32.445  -50.487  -43.942 1.00 2.97  ? 136 THR E CB  1 
ATOM   6439  O  OG1 . THR E  1 136 ? -31.188  -51.015  -43.503 1.00 2.60  ? 136 THR E OG1 1 
ATOM   6440  C  CG2 . THR E  1 136 ? -33.513  -51.574  -43.915 1.00 2.29  ? 136 THR E CG2 1 
ATOM   6441  N  N   . GLU E  1 137 ? -33.672  -47.960  -45.364 1.00 2.13  ? 137 GLU E N   1 
ATOM   6442  C  CA  . GLU E  1 137 ? -34.776  -47.159  -45.827 1.00 2.38  ? 137 GLU E CA  1 
ATOM   6443  C  C   . GLU E  1 137 ? -34.707  -46.990  -47.346 1.00 2.45  ? 137 GLU E C   1 
ATOM   6444  O  O   . GLU E  1 137 ? -35.687  -47.219  -48.033 1.00 3.23  ? 137 GLU E O   1 
ATOM   6445  C  CB  . GLU E  1 137 ? -34.793  -45.785  -45.152 1.00 2.45  ? 137 GLU E CB  1 
ATOM   6446  C  CG  . GLU E  1 137 ? -35.103  -45.790  -43.660 1.00 4.77  ? 137 GLU E CG  1 
ATOM   6447  C  CD  . GLU E  1 137 ? -36.363  -46.569  -43.297 1.00 7.98  ? 137 GLU E CD  1 
ATOM   6448  O  OE1 . GLU E  1 137 ? -36.241  -47.626  -42.621 1.00 8.95  ? 137 GLU E OE1 1 
ATOM   6449  O  OE2 . GLU E  1 137 ? -37.474  -46.145  -43.689 1.00 9.35  ? 137 GLU E OE2 1 
ATOM   6450  N  N   . LEU E  1 138 ? -33.567  -46.604  -47.887 1.00 2.30  ? 138 LEU E N   1 
ATOM   6451  C  CA  . LEU E  1 138 ? -33.473  -46.423  -49.307 1.00 2.81  ? 138 LEU E CA  1 
ATOM   6452  C  C   . LEU E  1 138 ? -33.808  -47.682  -50.086 1.00 3.75  ? 138 LEU E C   1 
ATOM   6453  O  O   . LEU E  1 138 ? -34.427  -47.586  -51.147 1.00 4.45  ? 138 LEU E O   1 
ATOM   6454  C  CB  . LEU E  1 138 ? -32.086  -45.925  -49.685 1.00 2.59  ? 138 LEU E CB  1 
ATOM   6455  C  CG  . LEU E  1 138 ? -31.792  -44.489  -49.237 1.00 3.01  ? 138 LEU E CG  1 
ATOM   6456  C  CD1 . LEU E  1 138 ? -30.332  -44.260  -49.466 1.00 3.73  ? 138 LEU E CD1 1 
ATOM   6457  C  CD2 . LEU E  1 138 ? -32.614  -43.481  -50.033 1.00 2.80  ? 138 LEU E CD2 1 
ATOM   6458  N  N   . ASP E  1 139 ? -33.408  -48.852  -49.585 1.00 3.94  ? 139 ASP E N   1 
ATOM   6459  C  CA  . ASP E  1 139 ? -33.757  -50.089  -50.252 1.00 4.63  ? 139 ASP E CA  1 
ATOM   6460  C  C   . ASP E  1 139 ? -35.258  -50.398  -50.114 1.00 4.40  ? 139 ASP E C   1 
ATOM   6461  O  O   . ASP E  1 139 ? -35.876  -50.940  -51.019 1.00 4.45  ? 139 ASP E O   1 
ATOM   6462  C  CB  . ASP E  1 139 ? -32.950  -51.268  -49.720 1.00 5.26  ? 139 ASP E CB  1 
ATOM   6463  C  CG  . ASP E  1 139 ? -31.467  -51.252  -50.165 1.00 8.75  ? 139 ASP E CG  1 
ATOM   6464  O  OD1 . ASP E  1 139 ? -31.047  -50.461  -51.053 1.00 10.90 ? 139 ASP E OD1 1 
ATOM   6465  O  OD2 . ASP E  1 139 ? -30.708  -52.095  -49.606 1.00 11.22 ? 139 ASP E OD2 1 
ATOM   6466  N  N   . LEU E  1 140 ? -35.844  -50.052  -48.982 1.00 3.85  ? 140 LEU E N   1 
ATOM   6467  C  CA  . LEU E  1 140 ? -37.270  -50.288  -48.806 1.00 4.29  ? 140 LEU E CA  1 
ATOM   6468  C  C   . LEU E  1 140 ? -38.060  -49.493  -49.817 1.00 4.79  ? 140 LEU E C   1 
ATOM   6469  O  O   . LEU E  1 140 ? -39.055  -50.001  -50.333 1.00 5.76  ? 140 LEU E O   1 
ATOM   6470  C  CB  . LEU E  1 140 ? -37.761  -49.949  -47.388 1.00 3.88  ? 140 LEU E CB  1 
ATOM   6471  C  CG  . LEU E  1 140 ? -37.402  -50.961  -46.300 1.00 3.78  ? 140 LEU E CG  1 
ATOM   6472  C  CD1 . LEU E  1 140 ? -37.703  -50.414  -44.915 1.00 2.00  ? 140 LEU E CD1 1 
ATOM   6473  C  CD2 . LEU E  1 140 ? -38.087  -52.324  -46.552 1.00 2.00  ? 140 LEU E CD2 1 
ATOM   6474  N  N   . ILE E  1 141 ? -37.621  -48.260  -50.100 1.00 4.72  ? 141 ILE E N   1 
ATOM   6475  C  CA  . ILE E  1 141 ? -38.311  -47.427  -51.058 1.00 4.69  ? 141 ILE E CA  1 
ATOM   6476  C  C   . ILE E  1 141 ? -38.376  -48.120  -52.418 1.00 6.34  ? 141 ILE E C   1 
ATOM   6477  O  O   . ILE E  1 141 ? -39.420  -48.104  -53.055 1.00 7.37  ? 141 ILE E O   1 
ATOM   6478  C  CB  . ILE E  1 141 ? -37.669  -46.043  -51.201 1.00 4.84  ? 141 ILE E CB  1 
ATOM   6479  C  CG1 . ILE E  1 141 ? -37.773  -45.220  -49.896 1.00 4.04  ? 141 ILE E CG1 1 
ATOM   6480  C  CG2 . ILE E  1 141 ? -38.280  -45.294  -52.400 1.00 3.49  ? 141 ILE E CG2 1 
ATOM   6481  C  CD1 . ILE E  1 141 ? -37.018  -43.878  -49.982 1.00 3.33  ? 141 ILE E CD1 1 
ATOM   6482  N  N   . GLN E  1 142 ? -37.279  -48.733  -52.866 1.00 7.39  ? 142 GLN E N   1 
ATOM   6483  C  CA  . GLN E  1 142 ? -37.278  -49.437  -54.146 1.00 8.50  ? 142 GLN E CA  1 
ATOM   6484  C  C   . GLN E  1 142 ? -38.107  -50.711  -54.060 1.00 8.11  ? 142 GLN E C   1 
ATOM   6485  O  O   . GLN E  1 142 ? -38.812  -51.057  -55.012 1.00 8.40  ? 142 GLN E O   1 
ATOM   6486  C  CB  . GLN E  1 142 ? -35.851  -49.765  -54.663 1.00 9.10  ? 142 GLN E CB  1 
ATOM   6487  C  CG  . GLN E  1 142 ? -34.947  -48.533  -54.884 1.00 13.46 ? 142 GLN E CG  1 
ATOM   6488  C  CD  . GLN E  1 142 ? -35.496  -47.513  -55.943 1.00 19.47 ? 142 GLN E CD  1 
ATOM   6489  O  OE1 . GLN E  1 142 ? -35.489  -47.782  -57.171 1.00 19.85 ? 142 GLN E OE1 1 
ATOM   6490  N  NE2 . GLN E  1 142 ? -35.952  -46.334  -55.458 1.00 18.92 ? 142 GLN E NE2 1 
ATOM   6491  N  N   . LYS E  1 143 ? -38.036  -51.419  -52.940 1.00 7.61  ? 143 LYS E N   1 
ATOM   6492  C  CA  . LYS E  1 143 ? -38.652  -52.741  -52.892 1.00 7.74  ? 143 LYS E CA  1 
ATOM   6493  C  C   . LYS E  1 143 ? -40.171  -52.648  -52.817 1.00 7.73  ? 143 LYS E C   1 
ATOM   6494  O  O   . LYS E  1 143 ? -40.874  -53.426  -53.473 1.00 8.48  ? 143 LYS E O   1 
ATOM   6495  C  CB  . LYS E  1 143 ? -38.109  -53.601  -51.752 1.00 7.65  ? 143 LYS E CB  1 
ATOM   6496  C  CG  . LYS E  1 143 ? -36.655  -53.975  -51.891 1.00 9.62  ? 143 LYS E CG  1 
ATOM   6497  C  CD  . LYS E  1 143 ? -36.287  -55.132  -50.937 1.00 13.34 ? 143 LYS E CD  1 
ATOM   6498  C  CE  . LYS E  1 143 ? -34.759  -55.298  -50.726 1.00 13.03 ? 143 LYS E CE  1 
ATOM   6499  N  NZ  . LYS E  1 143 ? -34.591  -54.831  -49.337 1.00 16.84 ? 143 LYS E NZ  1 
ATOM   6500  N  N   . MET E  1 144 ? -40.689  -51.698  -52.042 1.00 7.12  ? 144 MET E N   1 
ATOM   6501  C  CA  . MET E  1 144 ? -42.143  -51.591  -51.865 1.00 6.79  ? 144 MET E CA  1 
ATOM   6502  C  C   . MET E  1 144 ? -42.784  -50.489  -52.709 1.00 5.68  ? 144 MET E C   1 
ATOM   6503  O  O   . MET E  1 144 ? -44.020  -50.431  -52.801 1.00 5.41  ? 144 MET E O   1 
ATOM   6504  C  CB  . MET E  1 144 ? -42.525  -51.476  -50.381 1.00 6.22  ? 144 MET E CB  1 
ATOM   6505  C  CG  . MET E  1 144 ? -42.337  -50.132  -49.792 1.00 6.63  ? 144 MET E CG  1 
ATOM   6506  S  SD  . MET E  1 144 ? -42.752  -50.089  -48.016 1.00 10.17 ? 144 MET E SD  1 
ATOM   6507  C  CE  . MET E  1 144 ? -41.509  -51.190  -47.405 1.00 10.35 ? 144 MET E CE  1 
ATOM   6508  N  N   . GLY E  1 145 ? -41.938  -49.648  -53.331 1.00 4.48  ? 145 GLY E N   1 
ATOM   6509  C  CA  . GLY E  1 145 ? -42.371  -48.510  -54.128 1.00 3.23  ? 145 GLY E CA  1 
ATOM   6510  C  C   . GLY E  1 145 ? -42.582  -47.256  -53.296 1.00 3.26  ? 145 GLY E C   1 
ATOM   6511  O  O   . GLY E  1 145 ? -42.814  -47.329  -52.089 1.00 3.35  ? 145 GLY E O   1 
ATOM   6512  N  N   . LEU E  1 146 ? -42.514  -46.087  -53.917 1.00 3.08  ? 146 LEU E N   1 
ATOM   6513  C  CA  . LEU E  1 146 ? -42.590  -44.852  -53.152 1.00 2.62  ? 146 LEU E CA  1 
ATOM   6514  C  C   . LEU E  1 146 ? -43.933  -44.623  -52.433 1.00 2.77  ? 146 LEU E C   1 
ATOM   6515  O  O   . LEU E  1 146 ? -43.943  -44.284  -51.248 1.00 3.07  ? 146 LEU E O   1 
ATOM   6516  C  CB  . LEU E  1 146 ? -42.195  -43.659  -54.027 1.00 3.05  ? 146 LEU E CB  1 
ATOM   6517  C  CG  . LEU E  1 146 ? -42.162  -42.272  -53.375 1.00 3.63  ? 146 LEU E CG  1 
ATOM   6518  C  CD1 . LEU E  1 146 ? -41.236  -42.275  -52.139 1.00 2.05  ? 146 LEU E CD1 1 
ATOM   6519  C  CD2 . LEU E  1 146 ? -41.829  -41.180  -54.385 1.00 2.00  ? 146 LEU E CD2 1 
ATOM   6520  N  N   . GLN E  1 147 ? -45.049  -44.819  -53.126 1.00 2.75  ? 147 GLN E N   1 
ATOM   6521  C  CA  . GLN E  1 147 ? -46.369  -44.650  -52.525 1.00 2.49  ? 147 GLN E CA  1 
ATOM   6522  C  C   . GLN E  1 147 ? -46.549  -45.482  -51.272 1.00 2.79  ? 147 GLN E C   1 
ATOM   6523  O  O   . GLN E  1 147 ? -46.909  -44.942  -50.244 1.00 3.31  ? 147 GLN E O   1 
ATOM   6524  C  CB  . GLN E  1 147 ? -47.480  -44.931  -53.538 1.00 2.28  ? 147 GLN E CB  1 
ATOM   6525  C  CG  . GLN E  1 147 ? -47.455  -43.951  -54.701 1.00 2.04  ? 147 GLN E CG  1 
ATOM   6526  C  CD  . GLN E  1 147 ? -48.687  -44.043  -55.579 1.00 2.83  ? 147 GLN E CD  1 
ATOM   6527  O  OE1 . GLN E  1 147 ? -49.159  -45.132  -55.895 1.00 3.62  ? 147 GLN E OE1 1 
ATOM   6528  N  NE2 . GLN E  1 147 ? -49.208  -42.895  -55.979 1.00 2.23  ? 147 GLN E NE2 1 
ATOM   6529  N  N   . ASN E  1 148 ? -46.285  -46.782  -51.336 1.00 3.17  ? 148 ASN E N   1 
ATOM   6530  C  CA  . ASN E  1 148 ? -46.351  -47.629  -50.143 1.00 3.74  ? 148 ASN E CA  1 
ATOM   6531  C  C   . ASN E  1 148 ? -45.358  -47.212  -49.058 1.00 4.44  ? 148 ASN E C   1 
ATOM   6532  O  O   . ASN E  1 148 ? -45.644  -47.302  -47.859 1.00 5.31  ? 148 ASN E O   1 
ATOM   6533  C  CB  . ASN E  1 148 ? -46.078  -49.082  -50.487 1.00 3.89  ? 148 ASN E CB  1 
ATOM   6534  C  CG  . ASN E  1 148 ? -47.307  -49.822  -50.990 1.00 3.66  ? 148 ASN E CG  1 
ATOM   6535  O  OD1 . ASN E  1 148 ? -47.204  -50.978  -51.381 1.00 5.72  ? 148 ASN E OD1 1 
ATOM   6536  N  ND2 . ASN E  1 148 ? -48.455  -49.170  -50.996 1.00 3.52  ? 148 ASN E ND2 1 
ATOM   6537  N  N   . TYR E  1 149 ? -44.188  -46.756  -49.453 1.00 4.20  ? 149 TYR E N   1 
ATOM   6538  C  CA  . TYR E  1 149 ? -43.242  -46.363  -48.461 1.00 4.68  ? 149 TYR E CA  1 
ATOM   6539  C  C   . TYR E  1 149 ? -43.740  -45.157  -47.661 1.00 4.82  ? 149 TYR E C   1 
ATOM   6540  O  O   . TYR E  1 149 ? -43.605  -45.097  -46.431 1.00 4.34  ? 149 TYR E O   1 
ATOM   6541  C  CB  . TYR E  1 149 ? -41.919  -46.032  -49.114 1.00 5.02  ? 149 TYR E CB  1 
ATOM   6542  C  CG  . TYR E  1 149 ? -40.879  -45.586  -48.128 1.00 5.18  ? 149 TYR E CG  1 
ATOM   6543  C  CD1 . TYR E  1 149 ? -40.159  -46.515  -47.397 1.00 4.33  ? 149 TYR E CD1 1 
ATOM   6544  C  CD2 . TYR E  1 149 ? -40.636  -44.215  -47.913 1.00 5.92  ? 149 TYR E CD2 1 
ATOM   6545  C  CE1 . TYR E  1 149 ? -39.184  -46.096  -46.460 1.00 6.73  ? 149 TYR E CE1 1 
ATOM   6546  C  CE2 . TYR E  1 149 ? -39.653  -43.777  -46.986 1.00 5.68  ? 149 TYR E CE2 1 
ATOM   6547  C  CZ  . TYR E  1 149 ? -38.935  -44.727  -46.264 1.00 5.98  ? 149 TYR E CZ  1 
ATOM   6548  O  OH  . TYR E  1 149 ? -37.983  -44.318  -45.353 1.00 5.22  ? 149 TYR E OH  1 
ATOM   6549  N  N   . LEU E  1 150 ? -44.292  -44.177  -48.377 1.00 5.17  ? 150 LEU E N   1 
ATOM   6550  C  CA  . LEU E  1 150 ? -44.825  -42.987  -47.736 1.00 4.77  ? 150 LEU E CA  1 
ATOM   6551  C  C   . LEU E  1 150 ? -45.946  -43.359  -46.821 1.00 5.03  ? 150 LEU E C   1 
ATOM   6552  O  O   . LEU E  1 150 ? -45.964  -42.910  -45.701 1.00 6.01  ? 150 LEU E O   1 
ATOM   6553  C  CB  . LEU E  1 150 ? -45.279  -41.974  -48.755 1.00 4.41  ? 150 LEU E CB  1 
ATOM   6554  C  CG  . LEU E  1 150 ? -44.409  -40.813  -49.234 1.00 4.61  ? 150 LEU E CG  1 
ATOM   6555  C  CD1 . LEU E  1 150 ? -42.953  -40.898  -48.889 1.00 5.73  ? 150 LEU E CD1 1 
ATOM   6556  C  CD2 . LEU E  1 150 ? -44.611  -40.650  -50.707 1.00 4.17  ? 150 LEU E CD2 1 
ATOM   6557  N  N   . GLN E  1 151 ? -46.878  -44.196  -47.264 1.00 4.95  ? 151 GLN E N   1 
ATOM   6558  C  CA  . GLN E  1 151 ? -48.023  -44.555  -46.385 1.00 4.78  ? 151 GLN E CA  1 
ATOM   6559  C  C   . GLN E  1 151 ? -47.499  -45.150  -45.055 1.00 4.78  ? 151 GLN E C   1 
ATOM   6560  O  O   . GLN E  1 151 ? -48.044  -44.938  -43.984 1.00 5.01  ? 151 GLN E O   1 
ATOM   6561  C  CB  . GLN E  1 151 ? -48.974  -45.520  -47.081 1.00 4.40  ? 151 GLN E CB  1 
ATOM   6562  C  CG  . GLN E  1 151 ? -50.053  -46.071  -46.208 1.00 4.13  ? 151 GLN E CG  1 
ATOM   6563  C  CD  . GLN E  1 151 ? -50.662  -47.319  -46.798 1.00 4.86  ? 151 GLN E CD  1 
ATOM   6564  O  OE1 . GLN E  1 151 ? -50.147  -47.866  -47.745 1.00 8.38  ? 151 GLN E OE1 1 
ATOM   6565  N  NE2 . GLN E  1 151 ? -51.770  -47.764  -46.250 1.00 7.28  ? 151 GLN E NE2 1 
ATOM   6566  N  N   . ALA E  1 152 ? -46.396  -45.863  -45.137 1.00 4.81  ? 152 ALA E N   1 
ATOM   6567  C  CA  . ALA E  1 152 ? -45.842  -46.503  -43.980 1.00 4.80  ? 152 ALA E CA  1 
ATOM   6568  C  C   . ALA E  1 152 ? -45.167  -45.533  -43.022 1.00 5.29  ? 152 ALA E C   1 
ATOM   6569  O  O   . ALA E  1 152 ? -44.763  -45.959  -41.929 1.00 6.00  ? 152 ALA E O   1 
ATOM   6570  C  CB  . ALA E  1 152 ? -44.873  -47.554  -44.410 1.00 4.80  ? 152 ALA E CB  1 
ATOM   6571  N  N   . GLN E  1 153 ? -45.059  -44.248  -43.387 1.00 5.07  ? 153 GLN E N   1 
ATOM   6572  C  CA  . GLN E  1 153 ? -44.416  -43.239  -42.509 1.00 5.33  ? 153 GLN E CA  1 
ATOM   6573  C  C   . GLN E  1 153 ? -45.409  -42.356  -41.784 1.00 5.83  ? 153 GLN E C   1 
ATOM   6574  O  O   . GLN E  1 153 ? -45.022  -41.507  -40.984 1.00 5.79  ? 153 GLN E O   1 
ATOM   6575  C  CB  . GLN E  1 153 ? -43.465  -42.317  -43.288 1.00 5.10  ? 153 GLN E CB  1 
ATOM   6576  C  CG  . GLN E  1 153 ? -42.486  -42.996  -44.193 1.00 5.24  ? 153 GLN E CG  1 
ATOM   6577  C  CD  . GLN E  1 153 ? -41.780  -44.189  -43.537 1.00 6.72  ? 153 GLN E CD  1 
ATOM   6578  O  OE1 . GLN E  1 153 ? -41.389  -44.167  -42.344 1.00 6.54  ? 153 GLN E OE1 1 
ATOM   6579  N  NE2 . GLN E  1 153 ? -41.606  -45.241  -44.327 1.00 7.59  ? 153 GLN E NE2 1 
ATOM   6580  N  N   . ILE E  1 154 ? -46.681  -42.530  -42.076 1.00 6.71  ? 154 ILE E N   1 
ATOM   6581  C  CA  . ILE E  1 154 ? -47.707  -41.630  -41.598 1.00 8.53  ? 154 ILE E CA  1 
ATOM   6582  C  C   . ILE E  1 154 ? -47.952  -41.730  -40.092 1.00 9.67  ? 154 ILE E C   1 
ATOM   6583  O  O   . ILE E  1 154 ? -48.311  -40.751  -39.457 1.00 10.61 ? 154 ILE E O   1 
ATOM   6584  C  CB  . ILE E  1 154 ? -49.022  -41.957  -42.291 1.00 8.70  ? 154 ILE E CB  1 
ATOM   6585  C  CG1 . ILE E  1 154 ? -49.132  -41.249  -43.623 1.00 9.48  ? 154 ILE E CG1 1 
ATOM   6586  C  CG2 . ILE E  1 154 ? -50.241  -41.552  -41.453 1.00 9.44  ? 154 ILE E CG2 1 
ATOM   6587  C  CD1 . ILE E  1 154 ? -50.488  -41.652  -44.264 1.00 11.53 ? 154 ILE E CD1 1 
ATOM   6588  N  N   A ARG E  1 155 ? -47.767  -42.921  -39.534 0.70 10.41 ? 155 ARG E N   1 
ATOM   6589  N  N   B ARG E  1 155 ? -47.800  -42.906  -39.509 0.30 10.34 ? 155 ARG E N   1 
ATOM   6590  C  CA  A ARG E  1 155 ? -47.986  -43.154  -38.100 0.70 11.67 ? 155 ARG E CA  1 
ATOM   6591  C  CA  B ARG E  1 155 ? -47.951  -42.979  -38.059 0.30 11.34 ? 155 ARG E CA  1 
ATOM   6592  C  C   A ARG E  1 155 ? -46.663  -43.418  -37.375 0.70 12.69 ? 155 ARG E C   1 
ATOM   6593  C  C   B ARG E  1 155 ? -46.674  -43.392  -37.374 0.30 12.34 ? 155 ARG E C   1 
ATOM   6594  O  O   A ARG E  1 155 ? -45.769  -44.076  -37.926 0.70 13.31 ? 155 ARG E O   1 
ATOM   6595  O  O   B ARG E  1 155 ? -45.865  -44.147  -37.925 0.30 12.65 ? 155 ARG E O   1 
ATOM   6596  C  CB  A ARG E  1 155 ? -48.946  -44.320  -37.929 0.70 11.19 ? 155 ARG E CB  1 
ATOM   6597  C  CB  B ARG E  1 155 ? -49.103  -43.877  -37.642 0.30 11.13 ? 155 ARG E CB  1 
ATOM   6598  C  CG  A ARG E  1 155 ? -50.338  -44.090  -38.606 0.70 11.75 ? 155 ARG E CG  1 
ATOM   6599  C  CG  B ARG E  1 155 ? -49.351  -45.055  -38.547 0.30 11.36 ? 155 ARG E CG  1 
ATOM   6600  C  CD  A ARG E  1 155 ? -51.143  -45.402  -38.660 0.70 12.71 ? 155 ARG E CD  1 
ATOM   6601  C  CD  B ARG E  1 155 ? -50.370  -45.987  -37.920 0.30 12.14 ? 155 ARG E CD  1 
ATOM   6602  N  NE  A ARG E  1 155 ? -52.556  -45.254  -39.055 0.70 14.26 ? 155 ARG E NE  1 
ATOM   6603  N  NE  B ARG E  1 155 ? -49.759  -46.830  -36.898 0.30 13.24 ? 155 ARG E NE  1 
ATOM   6604  C  CZ  A ARG E  1 155 ? -53.590  -45.230  -38.198 0.70 14.73 ? 155 ARG E CZ  1 
ATOM   6605  C  CZ  B ARG E  1 155 ? -50.430  -47.597  -36.046 0.30 13.42 ? 155 ARG E CZ  1 
ATOM   6606  N  NH1 A ARG E  1 155 ? -53.404  -45.309  -36.873 0.70 13.80 ? 155 ARG E NH1 1 
ATOM   6607  N  NH1 B ARG E  1 155 ? -51.758  -47.642  -36.078 0.30 13.11 ? 155 ARG E NH1 1 
ATOM   6608  N  NH2 A ARG E  1 155 ? -54.831  -45.108  -38.665 0.70 13.91 ? 155 ARG E NH2 1 
ATOM   6609  N  NH2 B ARG E  1 155 ? -49.767  -48.328  -35.162 0.30 12.58 ? 155 ARG E NH2 1 
ATOM   6610  N  N   . GLU E  1 156 ? -46.496  -42.884  -36.163 1.00 13.54 ? 156 GLU E N   1 
ATOM   6611  C  CA  . GLU E  1 156 ? -45.227  -43.075  -35.446 1.00 14.98 ? 156 GLU E CA  1 
ATOM   6612  C  C   . GLU E  1 156 ? -45.141  -44.489  -34.912 1.00 16.89 ? 156 GLU E C   1 
ATOM   6613  O  O   . GLU E  1 156 ? -46.175  -45.103  -34.587 1.00 17.52 ? 156 GLU E O   1 
ATOM   6614  C  CB  . GLU E  1 156 ? -45.020  -42.064  -34.351 1.00 14.56 ? 156 GLU E CB  1 
ATOM   6615  C  CG  . GLU E  1 156 ? -46.232  -41.698  -33.568 1.00 16.05 ? 156 GLU E CG  1 
ATOM   6616  C  CD  . GLU E  1 156 ? -46.037  -40.325  -32.922 1.00 21.04 ? 156 GLU E CD  1 
ATOM   6617  O  OE1 . GLU E  1 156 ? -45.026  -39.650  -33.295 1.00 21.00 ? 156 GLU E OE1 1 
ATOM   6618  O  OE2 . GLU E  1 156 ? -46.880  -39.912  -32.066 1.00 23.06 ? 156 GLU E OE2 1 
ATOM   6619  N  N   . GLU E  1 157 ? -43.914  -45.028  -34.862 1.00 18.96 ? 157 GLU E N   1 
ATOM   6620  C  CA  . GLU E  1 157 ? -43.743  -46.420  -34.378 1.00 20.31 ? 157 GLU E CA  1 
ATOM   6621  C  C   . GLU E  1 157 ? -43.684  -46.430  -32.838 1.00 20.73 ? 157 GLU E C   1 
ATOM   6622  O  O   . GLU E  1 157 ? -42.858  -45.708  -32.245 1.00 20.44 ? 157 GLU E O   1 
ATOM   6623  C  CB  . GLU E  1 157 ? -42.550  -47.184  -35.032 1.00 19.89 ? 157 GLU E CB  1 
ATOM   6624  C  CG  . GLU E  1 157 ? -42.853  -48.745  -35.125 1.00 20.89 ? 157 GLU E CG  1 
ATOM   6625  C  CD  . GLU E  1 157 ? -41.595  -49.646  -35.287 1.00 21.10 ? 157 GLU E CD  1 
ATOM   6626  O  OE1 . GLU E  1 157 ? -40.587  -49.179  -35.905 1.00 20.40 ? 157 GLU E OE1 1 
ATOM   6627  O  OE2 . GLU E  1 157 ? -41.658  -50.825  -34.792 1.00 20.12 ? 157 GLU E OE2 1 
ATOM   6628  N  N   . GLY E  1 158 ? -44.600  -47.204  -32.222 1.00 21.42 ? 158 GLY E N   1 
ATOM   6629  C  CA  . GLY E  1 158 ? -44.665  -47.353  -30.739 1.00 21.83 ? 158 GLY E CA  1 
ATOM   6630  C  C   . GLY E  1 158 ? -43.476  -48.138  -30.171 1.00 21.63 ? 158 GLY E C   1 
ATOM   6631  N  N   . MET F  1 1   ? -49.717  -23.095  -46.126 1.00 7.46  ? 1   MET F N   1 
ATOM   6632  C  CA  . MET F  1 1   ? -50.353  -21.796  -46.414 1.00 8.45  ? 1   MET F CA  1 
ATOM   6633  C  C   . MET F  1 1   ? -49.266  -20.841  -46.889 1.00 8.24  ? 1   MET F C   1 
ATOM   6634  O  O   . MET F  1 1   ? -48.273  -20.706  -46.207 1.00 8.29  ? 1   MET F O   1 
ATOM   6635  C  CB  . MET F  1 1   ? -50.968  -21.299  -45.124 1.00 7.81  ? 1   MET F CB  1 
ATOM   6636  C  CG  . MET F  1 1   ? -52.008  -20.229  -45.247 1.00 7.89  ? 1   MET F CG  1 
ATOM   6637  S  SD  . MET F  1 1   ? -52.535  -19.951  -43.530 1.00 10.92 ? 1   MET F SD  1 
ATOM   6638  C  CE  . MET F  1 1   ? -51.292  -18.799  -42.914 1.00 5.72  ? 1   MET F CE  1 
ATOM   6639  N  N   . LYS F  1 2   ? -49.409  -20.200  -48.053 1.00 9.07  ? 2   LYS F N   1 
ATOM   6640  C  CA  . LYS F  1 2   ? -48.311  -19.343  -48.576 1.00 10.62 ? 2   LYS F CA  1 
ATOM   6641  C  C   . LYS F  1 2   ? -48.194  -18.081  -47.719 1.00 9.28  ? 2   LYS F C   1 
ATOM   6642  O  O   . LYS F  1 2   ? -49.111  -17.268  -47.696 1.00 9.80  ? 2   LYS F O   1 
ATOM   6643  C  CB  . LYS F  1 2   ? -48.565  -18.927  -50.025 1.00 10.60 ? 2   LYS F CB  1 
ATOM   6644  C  CG  . LYS F  1 2   ? -47.411  -19.253  -50.989 1.00 14.42 ? 2   LYS F CG  1 
ATOM   6645  C  CD  . LYS F  1 2   ? -47.248  -18.224  -52.176 1.00 15.10 ? 2   LYS F CD  1 
ATOM   6646  C  CE  . LYS F  1 2   ? -46.562  -16.901  -51.691 1.00 19.16 ? 2   LYS F CE  1 
ATOM   6647  N  NZ  . LYS F  1 2   ? -45.917  -16.141  -52.817 1.00 19.84 ? 2   LYS F NZ  1 
ATOM   6648  N  N   . GLY F  1 3   ? -47.080  -17.916  -47.007 1.00 8.21  ? 3   GLY F N   1 
ATOM   6649  C  CA  . GLY F  1 3   ? -46.888  -16.748  -46.159 1.00 6.87  ? 3   GLY F CA  1 
ATOM   6650  C  C   . GLY F  1 3   ? -46.360  -15.531  -46.884 1.00 6.21  ? 3   GLY F C   1 
ATOM   6651  O  O   . GLY F  1 3   ? -46.039  -15.594  -48.047 1.00 6.55  ? 3   GLY F O   1 
ATOM   6652  N  N   . ASP F  1 4   ? -46.263  -14.411  -46.187 1.00 5.88  ? 4   ASP F N   1 
ATOM   6653  C  CA  . ASP F  1 4   ? -45.657  -13.214  -46.733 1.00 5.71  ? 4   ASP F CA  1 
ATOM   6654  C  C   . ASP F  1 4   ? -44.152  -13.445  -46.837 1.00 5.83  ? 4   ASP F C   1 
ATOM   6655  O  O   . ASP F  1 4   ? -43.538  -13.917  -45.893 1.00 6.65  ? 4   ASP F O   1 
ATOM   6656  C  CB  . ASP F  1 4   ? -46.002  -12.019  -45.844 1.00 5.44  ? 4   ASP F CB  1 
ATOM   6657  C  CG  . ASP F  1 4   ? -45.262  -10.764  -46.230 1.00 6.95  ? 4   ASP F CG  1 
ATOM   6658  O  OD1 . ASP F  1 4   ? -44.128  -10.560  -45.716 1.00 9.31  ? 4   ASP F OD1 1 
ATOM   6659  O  OD2 . ASP F  1 4   ? -45.818  -9.958   -47.013 1.00 6.96  ? 4   ASP F OD2 1 
ATOM   6660  N  N   . THR F  1 5   ? -43.576  -13.146  -47.996 1.00 5.77  ? 5   THR F N   1 
ATOM   6661  C  CA  . THR F  1 5   ? -42.147  -13.386  -48.265 1.00 5.89  ? 5   THR F CA  1 
ATOM   6662  C  C   . THR F  1 5   ? -41.223  -12.702  -47.263 1.00 5.62  ? 5   THR F C   1 
ATOM   6663  O  O   . THR F  1 5   ? -40.222  -13.287  -46.795 1.00 5.73  ? 5   THR F O   1 
ATOM   6664  C  CB  . THR F  1 5   ? -41.760  -12.912  -49.706 1.00 6.01  ? 5   THR F CB  1 
ATOM   6665  O  OG1 . THR F  1 5   ? -42.504  -13.680  -50.635 1.00 7.10  ? 5   THR F OG1 1 
ATOM   6666  C  CG2 . THR F  1 5   ? -40.273  -13.137  -50.007 1.00 5.34  ? 5   THR F CG2 1 
ATOM   6667  N  N   . LYS F  1 6   ? -41.543  -11.455  -46.966 1.00 5.12  ? 6   LYS F N   1 
ATOM   6668  C  CA  . LYS F  1 6   ? -40.689  -10.661  -46.099 1.00 4.76  ? 6   LYS F CA  1 
ATOM   6669  C  C   . LYS F  1 6   ? -40.774  -11.212  -44.661 1.00 4.69  ? 6   LYS F C   1 
ATOM   6670  O  O   . LYS F  1 6   ? -39.764  -11.219  -43.951 1.00 4.94  ? 6   LYS F O   1 
ATOM   6671  C  CB  . LYS F  1 6   ? -41.041  -9.173   -46.214 1.00 4.14  ? 6   LYS F CB  1 
ATOM   6672  C  CG  . LYS F  1 6   ? -40.238  -8.302   -45.307 1.00 6.54  ? 6   LYS F CG  1 
ATOM   6673  C  CD  . LYS F  1 6   ? -39.911  -6.914   -45.879 1.00 9.49  ? 6   LYS F CD  1 
ATOM   6674  C  CE  . LYS F  1 6   ? -38.352  -6.676   -45.759 1.00 13.27 ? 6   LYS F CE  1 
ATOM   6675  N  NZ  . LYS F  1 6   ? -37.945  -5.561   -44.826 1.00 17.03 ? 6   LYS F NZ  1 
ATOM   6676  N  N   . VAL F  1 7   ? -41.950  -11.705  -44.247 1.00 3.68  ? 7   VAL F N   1 
ATOM   6677  C  CA  . VAL F  1 7   ? -42.049  -12.390  -42.949 1.00 3.13  ? 7   VAL F CA  1 
ATOM   6678  C  C   . VAL F  1 7   ? -41.107  -13.596  -42.890 1.00 3.16  ? 7   VAL F C   1 
ATOM   6679  O  O   . VAL F  1 7   ? -40.411  -13.827  -41.877 1.00 3.04  ? 7   VAL F O   1 
ATOM   6680  C  CB  . VAL F  1 7   ? -43.472  -12.848  -42.607 1.00 3.07  ? 7   VAL F CB  1 
ATOM   6681  C  CG1 . VAL F  1 7   ? -43.474  -13.778  -41.385 1.00 2.00  ? 7   VAL F CG1 1 
ATOM   6682  C  CG2 . VAL F  1 7   ? -44.355  -11.649  -42.325 1.00 2.46  ? 7   VAL F CG2 1 
ATOM   6683  N  N   . ILE F  1 8   ? -41.084  -14.369  -43.972 1.00 2.82  ? 8   ILE F N   1 
ATOM   6684  C  CA  . ILE F  1 8   ? -40.199  -15.519  -44.053 1.00 2.58  ? 8   ILE F CA  1 
ATOM   6685  C  C   . ILE F  1 8   ? -38.746  -15.058  -43.974 1.00 3.38  ? 8   ILE F C   1 
ATOM   6686  O  O   . ILE F  1 8   ? -37.967  -15.692  -43.262 1.00 3.28  ? 8   ILE F O   1 
ATOM   6687  C  CB  . ILE F  1 8   ? -40.474  -16.354  -45.291 1.00 2.68  ? 8   ILE F CB  1 
ATOM   6688  C  CG1 . ILE F  1 8   ? -41.840  -17.035  -45.165 1.00 3.44  ? 8   ILE F CG1 1 
ATOM   6689  C  CG2 . ILE F  1 8   ? -39.405  -17.403  -45.474 1.00 2.63  ? 8   ILE F CG2 1 
ATOM   6690  C  CD1 . ILE F  1 8   ? -42.439  -17.519  -46.485 1.00 2.71  ? 8   ILE F CD1 1 
ATOM   6691  N  N   . ASN F  1 9   ? -38.374  -13.960  -44.669 1.00 4.00  ? 9   ASN F N   1 
ATOM   6692  C  CA  . ASN F  1 9   ? -36.997  -13.443  -44.565 1.00 4.75  ? 9   ASN F CA  1 
ATOM   6693  C  C   . ASN F  1 9   ? -36.668  -13.107  -43.107 1.00 4.41  ? 9   ASN F C   1 
ATOM   6694  O  O   . ASN F  1 9   ? -35.596  -13.422  -42.611 1.00 4.83  ? 9   ASN F O   1 
ATOM   6695  C  CB  . ASN F  1 9   ? -36.750  -12.204  -45.447 1.00 5.79  ? 9   ASN F CB  1 
ATOM   6696  C  CG  . ASN F  1 9   ? -36.700  -12.525  -46.950 1.00 10.55 ? 9   ASN F CG  1 
ATOM   6697  O  OD1 . ASN F  1 9   ? -36.129  -13.525  -47.352 1.00 19.61 ? 9   ASN F OD1 1 
ATOM   6698  N  ND2 . ASN F  1 9   ? -37.293  -11.656  -47.784 1.00 12.19 ? 9   ASN F ND2 1 
ATOM   6699  N  N   . TYR F  1 10  ? -37.602  -12.468  -42.415 1.00 3.61  ? 10  TYR F N   1 
ATOM   6700  C  CA  . TYR F  1 10  ? -37.400  -12.130  -41.031 1.00 3.20  ? 10  TYR F CA  1 
ATOM   6701  C  C   . TYR F  1 10  ? -37.230  -13.389  -40.194 1.00 3.21  ? 10  TYR F C   1 
ATOM   6702  O  O   . TYR F  1 10  ? -36.292  -13.476  -39.414 1.00 3.21  ? 10  TYR F O   1 
ATOM   6703  C  CB  . TYR F  1 10  ? -38.557  -11.315  -40.494 1.00 3.16  ? 10  TYR F CB  1 
ATOM   6704  C  CG  . TYR F  1 10  ? -38.389  -9.836   -40.640 1.00 3.10  ? 10  TYR F CG  1 
ATOM   6705  C  CD1 . TYR F  1 10  ? -37.288  -9.184   -40.083 1.00 2.00  ? 10  TYR F CD1 1 
ATOM   6706  C  CD2 . TYR F  1 10  ? -39.357  -9.078   -41.313 1.00 2.35  ? 10  TYR F CD2 1 
ATOM   6707  C  CE1 . TYR F  1 10  ? -37.143  -7.823   -40.200 1.00 2.61  ? 10  TYR F CE1 1 
ATOM   6708  C  CE2 . TYR F  1 10  ? -39.225  -7.718   -41.436 1.00 2.13  ? 10  TYR F CE2 1 
ATOM   6709  C  CZ  . TYR F  1 10  ? -38.117  -7.091   -40.884 1.00 3.88  ? 10  TYR F CZ  1 
ATOM   6710  O  OH  . TYR F  1 10  ? -37.989  -5.737   -41.016 1.00 4.43  ? 10  TYR F OH  1 
ATOM   6711  N  N   . LEU F  1 11  ? -38.132  -14.362  -40.380 1.00 2.66  ? 11  LEU F N   1 
ATOM   6712  C  CA  . LEU F  1 11  ? -38.047  -15.623  -39.689 1.00 2.08  ? 11  LEU F CA  1 
ATOM   6713  C  C   . LEU F  1 11  ? -36.677  -16.270  -39.891 1.00 2.46  ? 11  LEU F C   1 
ATOM   6714  O  O   . LEU F  1 11  ? -36.058  -16.746  -38.906 1.00 2.47  ? 11  LEU F O   1 
ATOM   6715  C  CB  . LEU F  1 11  ? -39.174  -16.528  -40.109 1.00 2.00  ? 11  LEU F CB  1 
ATOM   6716  C  CG  . LEU F  1 11  ? -40.428  -16.600  -39.216 1.00 2.50  ? 11  LEU F CG  1 
ATOM   6717  C  CD1 . LEU F  1 11  ? -40.666  -15.367  -38.339 1.00 2.12  ? 11  LEU F CD1 1 
ATOM   6718  C  CD2 . LEU F  1 11  ? -41.702  -16.976  -39.987 1.00 2.00  ? 11  LEU F CD2 1 
ATOM   6719  N  N   . ASN F  1 12  ? -36.160  -16.246  -41.124 1.00 2.15  ? 12  ASN F N   1 
ATOM   6720  C  CA  . ASN F  1 12  ? -34.829  -16.822  -41.386 1.00 2.07  ? 12  ASN F CA  1 
ATOM   6721  C  C   . ASN F  1 12  ? -33.738  -16.003  -40.710 1.00 2.49  ? 12  ASN F C   1 
ATOM   6722  O  O   . ASN F  1 12  ? -32.758  -16.548  -40.183 1.00 2.62  ? 12  ASN F O   1 
ATOM   6723  C  CB  . ASN F  1 12  ? -34.543  -16.971  -42.877 1.00 2.03  ? 12  ASN F CB  1 
ATOM   6724  C  CG  . ASN F  1 12  ? -34.900  -18.367  -43.416 1.00 2.49  ? 12  ASN F CG  1 
ATOM   6725  O  OD1 . ASN F  1 12  ? -34.608  -19.369  -42.786 1.00 4.15  ? 12  ASN F OD1 1 
ATOM   6726  N  ND2 . ASN F  1 12  ? -35.534  -18.423  -44.586 1.00 2.01  ? 12  ASN F ND2 1 
ATOM   6727  N  N   . LYS F  1 13  ? -33.915  -14.693  -40.669 1.00 2.57  ? 13  LYS F N   1 
ATOM   6728  C  CA  . LYS F  1 13  ? -32.905  -13.873  -40.022 1.00 3.20  ? 13  LYS F CA  1 
ATOM   6729  C  C   . LYS F  1 13  ? -32.882  -14.151  -38.508 1.00 3.57  ? 13  LYS F C   1 
ATOM   6730  O  O   . LYS F  1 13  ? -31.810  -14.328  -37.906 1.00 4.27  ? 13  LYS F O   1 
ATOM   6731  C  CB  . LYS F  1 13  ? -33.150  -12.407  -40.323 1.00 3.13  ? 13  LYS F CB  1 
ATOM   6732  C  CG  . LYS F  1 13  ? -32.306  -11.466  -39.543 1.00 2.84  ? 13  LYS F CG  1 
ATOM   6733  C  CD  . LYS F  1 13  ? -32.174  -10.155  -40.279 1.00 5.54  ? 13  LYS F CD  1 
ATOM   6734  C  CE  . LYS F  1 13  ? -31.750  -9.064   -39.325 1.00 8.09  ? 13  LYS F CE  1 
ATOM   6735  N  NZ  . LYS F  1 13  ? -30.584  -8.355   -39.856 1.00 9.99  ? 13  LYS F NZ  1 
ATOM   6736  N  N   . LEU F  1 14  ? -34.062  -14.192  -37.903 1.00 3.00  ? 14  LEU F N   1 
ATOM   6737  C  CA  . LEU F  1 14  ? -34.169  -14.534  -36.496 1.00 2.96  ? 14  LEU F CA  1 
ATOM   6738  C  C   . LEU F  1 14  ? -33.594  -15.939  -36.231 1.00 3.25  ? 14  LEU F C   1 
ATOM   6739  O  O   . LEU F  1 14  ? -32.806  -16.113  -35.296 1.00 2.98  ? 14  LEU F O   1 
ATOM   6740  C  CB  . LEU F  1 14  ? -35.620  -14.417  -36.002 1.00 2.49  ? 14  LEU F CB  1 
ATOM   6741  C  CG  . LEU F  1 14  ? -36.196  -13.011  -36.157 1.00 2.70  ? 14  LEU F CG  1 
ATOM   6742  C  CD1 . LEU F  1 14  ? -37.627  -12.969  -35.718 1.00 3.79  ? 14  LEU F CD1 1 
ATOM   6743  C  CD2 . LEU F  1 14  ? -35.399  -12.023  -35.414 1.00 2.00  ? 14  LEU F CD2 1 
ATOM   6744  N  N   . LEU F  1 15  ? -33.950  -16.909  -37.089 1.00 3.11  ? 15  LEU F N   1 
ATOM   6745  C  CA  . LEU F  1 15  ? -33.388  -18.255  -37.015 1.00 2.30  ? 15  LEU F CA  1 
ATOM   6746  C  C   . LEU F  1 15  ? -31.868  -18.187  -37.020 1.00 2.80  ? 15  LEU F C   1 
ATOM   6747  O  O   . LEU F  1 15  ? -31.223  -18.876  -36.246 1.00 2.81  ? 15  LEU F O   1 
ATOM   6748  C  CB  . LEU F  1 15  ? -33.884  -19.110  -38.182 1.00 2.01  ? 15  LEU F CB  1 
ATOM   6749  C  CG  . LEU F  1 15  ? -33.263  -20.497  -38.345 1.00 2.00  ? 15  LEU F CG  1 
ATOM   6750  C  CD1 . LEU F  1 15  ? -33.398  -21.372  -37.117 1.00 2.00  ? 15  LEU F CD1 1 
ATOM   6751  C  CD2 . LEU F  1 15  ? -33.861  -21.193  -39.559 1.00 2.00  ? 15  LEU F CD2 1 
ATOM   6752  N  N   . GLY F  1 16  ? -31.311  -17.332  -37.885 1.00 3.03  ? 16  GLY F N   1 
ATOM   6753  C  CA  . GLY F  1 16  ? -29.886  -17.142  -37.970 1.00 3.45  ? 16  GLY F CA  1 
ATOM   6754  C  C   . GLY F  1 16  ? -29.315  -16.687  -36.641 1.00 4.60  ? 16  GLY F C   1 
ATOM   6755  O  O   . GLY F  1 16  ? -28.244  -17.138  -36.247 1.00 4.33  ? 16  GLY F O   1 
ATOM   6756  N  N   . ASN F  1 17  ? -30.032  -15.793  -35.954 1.00 5.40  ? 17  ASN F N   1 
ATOM   6757  C  CA  . ASN F  1 17  ? -29.586  -15.267  -34.675 1.00 6.10  ? 17  ASN F CA  1 
ATOM   6758  C  C   . ASN F  1 17  ? -29.539  -16.390  -33.672 1.00 6.96  ? 17  ASN F C   1 
ATOM   6759  O  O   . ASN F  1 17  ? -28.562  -16.494  -32.940 1.00 7.17  ? 17  ASN F O   1 
ATOM   6760  C  CB  . ASN F  1 17  ? -30.532  -14.175  -34.145 1.00 6.05  ? 17  ASN F CB  1 
ATOM   6761  C  CG  . ASN F  1 17  ? -30.450  -12.872  -34.920 1.00 6.60  ? 17  ASN F CG  1 
ATOM   6762  O  OD1 . ASN F  1 17  ? -29.491  -12.607  -35.638 1.00 5.63  ? 17  ASN F OD1 1 
ATOM   6763  N  ND2 . ASN F  1 17  ? -31.469  -12.043  -34.770 1.00 8.91  ? 17  ASN F ND2 1 
ATOM   6764  N  N   . GLU F  1 18  ? -30.591  -17.228  -33.644 1.00 7.03  ? 18  GLU F N   1 
ATOM   6765  C  CA  . GLU F  1 18  ? -30.690  -18.288  -32.647 1.00 7.64  ? 18  GLU F CA  1 
ATOM   6766  C  C   . GLU F  1 18  ? -29.590  -19.301  -32.941 1.00 7.77  ? 18  GLU F C   1 
ATOM   6767  O  O   . GLU F  1 18  ? -28.973  -19.882  -32.026 1.00 7.45  ? 18  GLU F O   1 
ATOM   6768  C  CB  . GLU F  1 18  ? -32.042  -18.996  -32.638 1.00 7.65  ? 18  GLU F CB  1 
ATOM   6769  C  CG  . GLU F  1 18  ? -33.229  -18.151  -32.365 1.00 9.71  ? 18  GLU F CG  1 
ATOM   6770  C  CD  . GLU F  1 18  ? -33.386  -17.655  -30.942 1.00 13.53 ? 18  GLU F CD  1 
ATOM   6771  O  OE1 . GLU F  1 18  ? -32.850  -18.254  -29.969 1.00 13.02 ? 18  GLU F OE1 1 
ATOM   6772  O  OE2 . GLU F  1 18  ? -34.104  -16.642  -30.790 1.00 15.53 ? 18  GLU F OE2 1 
ATOM   6773  N  N   . LEU F  1 19  ? -29.321  -19.533  -34.215 1.00 7.47  ? 19  LEU F N   1 
ATOM   6774  C  CA  . LEU F  1 19  ? -28.300  -20.502  -34.398 1.00 7.26  ? 19  LEU F CA  1 
ATOM   6775  C  C   . LEU F  1 19  ? -26.881  -20.091  -34.081 1.00 6.89  ? 19  LEU F C   1 
ATOM   6776  O  O   . LEU F  1 19  ? -26.111  -20.917  -33.617 1.00 7.39  ? 19  LEU F O   1 
ATOM   6777  C  CB  . LEU F  1 19  ? -28.533  -21.551  -35.476 1.00 7.65  ? 19  LEU F CB  1 
ATOM   6778  C  CG  . LEU F  1 19  ? -28.769  -21.728  -36.950 1.00 8.51  ? 19  LEU F CG  1 
ATOM   6779  C  CD1 . LEU F  1 19  ? -29.884  -22.688  -36.864 1.00 7.73  ? 19  LEU F CD1 1 
ATOM   6780  C  CD2 . LEU F  1 19  ? -29.211  -20.551  -37.762 1.00 11.90 ? 19  LEU F CD2 1 
ATOM   6781  N  N   . VAL F  1 20  ? -26.556  -18.809  -34.172 1.00 6.23  ? 20  VAL F N   1 
ATOM   6782  C  CA  . VAL F  1 20  ? -25.292  -18.419  -33.554 1.00 4.57  ? 20  VAL F CA  1 
ATOM   6783  C  C   . VAL F  1 20  ? -25.358  -18.523  -32.014 1.00 3.96  ? 20  VAL F C   1 
ATOM   6784  O  O   . VAL F  1 20  ? -24.443  -19.058  -31.406 1.00 3.95  ? 20  VAL F O   1 
ATOM   6785  C  CB  . VAL F  1 20  ? -24.562  -17.118  -34.143 1.00 4.10  ? 20  VAL F CB  1 
ATOM   6786  C  CG1 . VAL F  1 20  ? -25.347  -16.404  -35.124 1.00 3.17  ? 20  VAL F CG1 1 
ATOM   6787  C  CG2 . VAL F  1 20  ? -24.070  -16.213  -33.042 1.00 3.03  ? 20  VAL F CG2 1 
ATOM   6788  N  N   . ALA F  1 21  ? -26.455  -18.084  -31.409 1.00 2.98  ? 21  ALA F N   1 
ATOM   6789  C  CA  . ALA F  1 21  ? -26.603  -18.168  -29.946 1.00 2.42  ? 21  ALA F CA  1 
ATOM   6790  C  C   . ALA F  1 21  ? -26.461  -19.596  -29.428 1.00 2.90  ? 21  ALA F C   1 
ATOM   6791  O  O   . ALA F  1 21  ? -25.776  -19.812  -28.432 1.00 3.38  ? 21  ALA F O   1 
ATOM   6792  C  CB  . ALA F  1 21  ? -27.889  -17.588  -29.508 1.00 2.00  ? 21  ALA F CB  1 
ATOM   6793  N  N   . ILE F  1 22  ? -27.092  -20.562  -30.110 1.00 2.93  ? 22  ILE F N   1 
ATOM   6794  C  CA  . ILE F  1 22  ? -27.002  -21.983  -29.746 1.00 3.08  ? 22  ILE F CA  1 
ATOM   6795  C  C   . ILE F  1 22  ? -25.548  -22.423  -29.571 1.00 3.67  ? 22  ILE F C   1 
ATOM   6796  O  O   . ILE F  1 22  ? -25.170  -22.969  -28.506 1.00 4.19  ? 22  ILE F O   1 
ATOM   6797  C  CB  . ILE F  1 22  ? -27.693  -22.908  -30.787 1.00 3.78  ? 22  ILE F CB  1 
ATOM   6798  C  CG1 . ILE F  1 22  ? -29.216  -22.824  -30.656 1.00 3.24  ? 22  ILE F CG1 1 
ATOM   6799  C  CG2 . ILE F  1 22  ? -27.226  -24.352  -30.646 1.00 2.00  ? 22  ILE F CG2 1 
ATOM   6800  C  CD1 . ILE F  1 22  ? -29.908  -23.361  -31.827 1.00 2.00  ? 22  ILE F CD1 1 
ATOM   6801  N  N   . ASN F  1 23  ? -24.733  -22.168  -30.594 1.00 3.21  ? 23  ASN F N   1 
ATOM   6802  C  CA  . ASN F  1 23  ? -23.332  -22.519  -30.546 1.00 3.20  ? 23  ASN F CA  1 
ATOM   6803  C  C   . ASN F  1 23  ? -22.555  -21.696  -29.511 1.00 3.62  ? 23  ASN F C   1 
ATOM   6804  O  O   . ASN F  1 23  ? -21.735  -22.231  -28.749 1.00 4.00  ? 23  ASN F O   1 
ATOM   6805  C  CB  . ASN F  1 23  ? -22.706  -22.360  -31.914 1.00 3.25  ? 23  ASN F CB  1 
ATOM   6806  C  CG  . ASN F  1 23  ? -23.227  -23.369  -32.927 1.00 4.09  ? 23  ASN F CG  1 
ATOM   6807  O  OD1 . ASN F  1 23  ? -22.747  -23.425  -34.030 1.00 5.86  ? 23  ASN F OD1 1 
ATOM   6808  N  ND2 . ASN F  1 23  ? -24.213  -24.162  -32.556 1.00 5.26  ? 23  ASN F ND2 1 
ATOM   6809  N  N   . GLN F  1 24  ? -22.809  -20.398  -29.452 1.00 3.51  ? 24  GLN F N   1 
ATOM   6810  C  CA  . GLN F  1 24  ? -22.005  -19.592  -28.572 1.00 3.66  ? 24  GLN F CA  1 
ATOM   6811  C  C   . GLN F  1 24  ? -22.299  -20.007  -27.129 1.00 3.74  ? 24  GLN F C   1 
ATOM   6812  O  O   . GLN F  1 24  ? -21.382  -20.193  -26.337 1.00 4.11  ? 24  GLN F O   1 
ATOM   6813  C  CB  . GLN F  1 24  ? -22.198  -18.094  -28.837 1.00 3.62  ? 24  GLN F CB  1 
ATOM   6814  C  CG  . GLN F  1 24  ? -21.380  -17.208  -27.950 1.00 4.31  ? 24  GLN F CG  1 
ATOM   6815  C  CD  . GLN F  1 24  ? -21.363  -15.787  -28.448 1.00 7.14  ? 24  GLN F CD  1 
ATOM   6816  O  OE1 . GLN F  1 24  ? -21.024  -15.517  -29.612 1.00 8.23  ? 24  GLN F OE1 1 
ATOM   6817  N  NE2 . GLN F  1 24  ? -21.717  -14.848  -27.563 1.00 6.65  ? 24  GLN F NE2 1 
ATOM   6818  N  N   . TYR F  1 25  ? -23.566  -20.217  -26.802 1.00 3.63  ? 25  TYR F N   1 
ATOM   6819  C  CA  . TYR F  1 25  ? -23.923  -20.637  -25.453 1.00 4.27  ? 25  TYR F CA  1 
ATOM   6820  C  C   . TYR F  1 25  ? -23.360  -22.013  -25.084 1.00 3.87  ? 25  TYR F C   1 
ATOM   6821  O  O   . TYR F  1 25  ? -22.884  -22.214  -23.970 1.00 3.47  ? 25  TYR F O   1 
ATOM   6822  C  CB  . TYR F  1 25  ? -25.435  -20.660  -25.286 1.00 5.18  ? 25  TYR F CB  1 
ATOM   6823  C  CG  . TYR F  1 25  ? -26.042  -19.338  -24.911 1.00 7.08  ? 25  TYR F CG  1 
ATOM   6824  C  CD1 . TYR F  1 25  ? -25.507  -18.562  -23.877 1.00 8.17  ? 25  TYR F CD1 1 
ATOM   6825  C  CD2 . TYR F  1 25  ? -27.203  -18.890  -25.556 1.00 7.86  ? 25  TYR F CD2 1 
ATOM   6826  C  CE1 . TYR F  1 25  ? -26.085  -17.371  -23.518 1.00 8.83  ? 25  TYR F CE1 1 
ATOM   6827  C  CE2 . TYR F  1 25  ? -27.800  -17.691  -25.204 1.00 8.82  ? 25  TYR F CE2 1 
ATOM   6828  C  CZ  . TYR F  1 25  ? -27.240  -16.942  -24.187 1.00 8.93  ? 25  TYR F CZ  1 
ATOM   6829  O  OH  . TYR F  1 25  ? -27.862  -15.767  -23.835 1.00 8.71  ? 25  TYR F OH  1 
ATOM   6830  N  N   . PHE F  1 26  ? -23.405  -22.953  -26.033 1.00 3.56  ? 26  PHE F N   1 
ATOM   6831  C  CA  . PHE F  1 26  ? -22.870  -24.291  -25.786 1.00 2.97  ? 26  PHE F CA  1 
ATOM   6832  C  C   . PHE F  1 26  ? -21.355  -24.330  -25.535 1.00 3.00  ? 26  PHE F C   1 
ATOM   6833  O  O   . PHE F  1 26  ? -20.884  -24.965  -24.590 1.00 2.39  ? 26  PHE F O   1 
ATOM   6834  C  CB  . PHE F  1 26  ? -23.223  -25.227  -26.926 1.00 2.70  ? 26  PHE F CB  1 
ATOM   6835  C  CG  . PHE F  1 26  ? -23.265  -26.626  -26.501 1.00 3.02  ? 26  PHE F CG  1 
ATOM   6836  C  CD1 . PHE F  1 26  ? -24.431  -27.169  -25.998 1.00 3.09  ? 26  PHE F CD1 1 
ATOM   6837  C  CD2 . PHE F  1 26  ? -22.108  -27.400  -26.529 1.00 3.56  ? 26  PHE F CD2 1 
ATOM   6838  C  CE1 . PHE F  1 26  ? -24.470  -28.481  -25.549 1.00 3.89  ? 26  PHE F CE1 1 
ATOM   6839  C  CE2 . PHE F  1 26  ? -22.125  -28.743  -26.070 1.00 4.13  ? 26  PHE F CE2 1 
ATOM   6840  C  CZ  . PHE F  1 26  ? -23.317  -29.276  -25.582 1.00 4.35  ? 26  PHE F CZ  1 
ATOM   6841  N  N   . LEU F  1 27  ? -20.593  -23.647  -26.388 1.00 2.85  ? 27  LEU F N   1 
ATOM   6842  C  CA  . LEU F  1 27  ? -19.163  -23.532  -26.179 1.00 2.53  ? 27  LEU F CA  1 
ATOM   6843  C  C   . LEU F  1 27  ? -18.917  -22.863  -24.831 1.00 2.46  ? 27  LEU F C   1 
ATOM   6844  O  O   . LEU F  1 27  ? -18.122  -23.363  -24.040 1.00 2.03  ? 27  LEU F O   1 
ATOM   6845  C  CB  . LEU F  1 27  ? -18.515  -22.730  -27.304 1.00 2.54  ? 27  LEU F CB  1 
ATOM   6846  C  CG  . LEU F  1 27  ? -17.098  -23.107  -27.780 1.00 2.49  ? 27  LEU F CG  1 
ATOM   6847  C  CD1 . LEU F  1 27  ? -16.402  -21.942  -28.398 1.00 2.00  ? 27  LEU F CD1 1 
ATOM   6848  C  CD2 . LEU F  1 27  ? -16.213  -23.750  -26.719 1.00 2.95  ? 27  LEU F CD2 1 
ATOM   6849  N  N   . HIS F  1 28  ? -19.622  -21.765  -24.546 1.00 2.12  ? 28  HIS F N   1 
ATOM   6850  C  CA  . HIS F  1 28  ? -19.393  -21.088  -23.269 1.00 2.39  ? 28  HIS F CA  1 
ATOM   6851  C  C   . HIS F  1 28  ? -19.625  -22.057  -22.126 1.00 2.57  ? 28  HIS F C   1 
ATOM   6852  O  O   . HIS F  1 28  ? -18.765  -22.228  -21.256 1.00 2.81  ? 28  HIS F O   1 
ATOM   6853  C  CB  . HIS F  1 28  ? -20.233  -19.836  -23.106 1.00 2.53  ? 28  HIS F CB  1 
ATOM   6854  C  CG  . HIS F  1 28  ? -19.717  -18.667  -23.876 1.00 2.59  ? 28  HIS F CG  1 
ATOM   6855  N  ND1 . HIS F  1 28  ? -20.470  -17.535  -24.100 1.00 2.43  ? 28  HIS F ND1 1 
ATOM   6856  C  CD2 . HIS F  1 28  ? -18.535  -18.471  -24.511 1.00 2.02  ? 28  HIS F CD2 1 
ATOM   6857  C  CE1 . HIS F  1 28  ? -19.767  -16.680  -24.822 1.00 3.17  ? 28  HIS F CE1 1 
ATOM   6858  N  NE2 . HIS F  1 28  ? -18.588  -17.225  -25.082 1.00 3.29  ? 28  HIS F NE2 1 
ATOM   6859  N  N   . ALA F  1 29  ? -20.770  -22.741  -22.177 1.00 2.36  ? 29  ALA F N   1 
ATOM   6860  C  CA  . ALA F  1 29  ? -21.117  -23.738  -21.180 1.00 2.14  ? 29  ALA F CA  1 
ATOM   6861  C  C   . ALA F  1 29  ? -19.982  -24.713  -20.909 1.00 2.09  ? 29  ALA F C   1 
ATOM   6862  O  O   . ALA F  1 29  ? -19.602  -24.899  -19.752 1.00 2.18  ? 29  ALA F O   1 
ATOM   6863  C  CB  . ALA F  1 29  ? -22.369  -24.475  -21.580 1.00 2.00  ? 29  ALA F CB  1 
ATOM   6864  N  N   . ARG F  1 30  ? -19.444  -25.333  -21.953 1.00 2.12  ? 30  ARG F N   1 
ATOM   6865  C  CA  . ARG F  1 30  ? -18.443  -26.385  -21.743 1.00 2.45  ? 30  ARG F CA  1 
ATOM   6866  C  C   . ARG F  1 30  ? -17.047  -25.797  -21.391 1.00 2.70  ? 30  ARG F C   1 
ATOM   6867  O  O   . ARG F  1 30  ? -16.209  -26.477  -20.805 1.00 2.42  ? 30  ARG F O   1 
ATOM   6868  C  CB  . ARG F  1 30  ? -18.379  -27.319  -22.944 1.00 2.00  ? 30  ARG F CB  1 
ATOM   6869  C  CG  . ARG F  1 30  ? -19.680  -27.859  -23.328 1.00 2.00  ? 30  ARG F CG  1 
ATOM   6870  C  CD  . ARG F  1 30  ? -20.001  -29.162  -22.689 1.00 2.02  ? 30  ARG F CD  1 
ATOM   6871  N  NE  . ARG F  1 30  ? -21.091  -29.017  -21.736 1.00 4.27  ? 30  ARG F NE  1 
ATOM   6872  C  CZ  . ARG F  1 30  ? -22.160  -29.798  -21.641 1.00 2.87  ? 30  ARG F CZ  1 
ATOM   6873  N  NH1 . ARG F  1 30  ? -22.356  -30.849  -22.420 1.00 2.73  ? 30  ARG F NH1 1 
ATOM   6874  N  NH2 . ARG F  1 30  ? -23.052  -29.519  -20.731 1.00 4.04  ? 30  ARG F NH2 1 
ATOM   6875  N  N   . MET F  1 31  ? -16.836  -24.529  -21.734 1.00 2.85  ? 31  MET F N   1 
ATOM   6876  C  CA  . MET F  1 31  ? -15.666  -23.812  -21.274 1.00 2.84  ? 31  MET F CA  1 
ATOM   6877  C  C   . MET F  1 31  ? -15.753  -23.621  -19.752 1.00 2.79  ? 31  MET F C   1 
ATOM   6878  O  O   . MET F  1 31  ? -14.853  -24.007  -19.006 1.00 3.04  ? 31  MET F O   1 
ATOM   6879  C  CB  . MET F  1 31  ? -15.524  -22.481  -22.001 1.00 2.61  ? 31  MET F CB  1 
ATOM   6880  C  CG  . MET F  1 31  ? -14.929  -22.580  -23.384 1.00 2.00  ? 31  MET F CG  1 
ATOM   6881  S  SD  . MET F  1 31  ? -14.953  -21.008  -24.315 1.00 3.57  ? 31  MET F SD  1 
ATOM   6882  C  CE  . MET F  1 31  ? -13.748  -20.010  -23.416 1.00 2.00  ? 31  MET F CE  1 
ATOM   6883  N  N   . PHE F  1 32  ? -16.863  -23.071  -19.284 1.00 2.66  ? 32  PHE F N   1 
ATOM   6884  C  CA  . PHE F  1 32  ? -17.115  -23.008  -17.870 1.00 2.35  ? 32  PHE F CA  1 
ATOM   6885  C  C   . PHE F  1 32  ? -16.961  -24.357  -17.178 1.00 2.47  ? 32  PHE F C   1 
ATOM   6886  O  O   . PHE F  1 32  ? -16.380  -24.451  -16.082 1.00 2.59  ? 32  PHE F O   1 
ATOM   6887  C  CB  . PHE F  1 32  ? -18.498  -22.433  -17.620 1.00 2.44  ? 32  PHE F CB  1 
ATOM   6888  C  CG  . PHE F  1 32  ? -18.640  -21.025  -18.071 1.00 2.71  ? 32  PHE F CG  1 
ATOM   6889  C  CD1 . PHE F  1 32  ? -19.783  -20.605  -18.741 1.00 4.21  ? 32  PHE F CD1 1 
ATOM   6890  C  CD2 . PHE F  1 32  ? -17.623  -20.118  -17.834 1.00 2.42  ? 32  PHE F CD2 1 
ATOM   6891  C  CE1 . PHE F  1 32  ? -19.930  -19.305  -19.169 1.00 4.24  ? 32  PHE F CE1 1 
ATOM   6892  C  CE2 . PHE F  1 32  ? -17.744  -18.802  -18.239 1.00 4.97  ? 32  PHE F CE2 1 
ATOM   6893  C  CZ  . PHE F  1 32  ? -18.925  -18.393  -18.932 1.00 4.23  ? 32  PHE F CZ  1 
ATOM   6894  N  N   . LYS F  1 33  ? -17.483  -25.406  -17.801 1.00 2.62  ? 33  LYS F N   1 
ATOM   6895  C  CA  . LYS F  1 33  ? -17.428  -26.748  -17.228 1.00 2.95  ? 33  LYS F CA  1 
ATOM   6896  C  C   . LYS F  1 33  ? -15.990  -27.198  -17.093 1.00 3.07  ? 33  LYS F C   1 
ATOM   6897  O  O   . LYS F  1 33  ? -15.585  -27.712  -16.045 1.00 2.67  ? 33  LYS F O   1 
ATOM   6898  C  CB  . LYS F  1 33  ? -18.176  -27.713  -18.110 1.00 3.10  ? 33  LYS F CB  1 
ATOM   6899  C  CG  . LYS F  1 33  ? -18.050  -29.145  -17.727 1.00 4.04  ? 33  LYS F CG  1 
ATOM   6900  C  CD  . LYS F  1 33  ? -19.366  -29.821  -18.059 1.00 8.22  ? 33  LYS F CD  1 
ATOM   6901  C  CE  . LYS F  1 33  ? -19.192  -31.281  -18.407 1.00 10.44 ? 33  LYS F CE  1 
ATOM   6902  N  NZ  . LYS F  1 33  ? -19.430  -32.143  -17.197 1.00 10.85 ? 33  LYS F NZ  1 
ATOM   6903  N  N   . ASN F  1 34  ? -15.214  -26.985  -18.151 1.00 3.03  ? 34  ASN F N   1 
ATOM   6904  C  CA  . ASN F  1 34  ? -13.822  -27.323  -18.105 1.00 3.43  ? 34  ASN F CA  1 
ATOM   6905  C  C   . ASN F  1 34  ? -13.115  -26.610  -16.983 1.00 3.68  ? 34  ASN F C   1 
ATOM   6906  O  O   . ASN F  1 34  ? -12.354  -27.240  -16.264 1.00 4.83  ? 34  ASN F O   1 
ATOM   6907  C  CB  . ASN F  1 34  ? -13.122  -27.040  -19.417 1.00 3.26  ? 34  ASN F CB  1 
ATOM   6908  C  CG  . ASN F  1 34  ? -11.699  -27.511  -19.399 1.00 4.40  ? 34  ASN F CG  1 
ATOM   6909  O  OD1 . ASN F  1 34  ? -10.803  -26.710  -19.303 1.00 7.32  ? 34  ASN F OD1 1 
ATOM   6910  N  ND2 . ASN F  1 34  ? -11.486  -28.834  -19.438 1.00 6.86  ? 34  ASN F ND2 1 
ATOM   6911  N  N   . TRP F  1 35  ? -13.376  -25.311  -16.825 1.00 3.41  ? 35  TRP F N   1 
ATOM   6912  C  CA  . TRP F  1 35  ? -12.820  -24.523  -15.721 1.00 3.19  ? 35  TRP F CA  1 
ATOM   6913  C  C   . TRP F  1 35  ? -13.370  -24.870  -14.340 1.00 3.36  ? 35  TRP F C   1 
ATOM   6914  O  O   . TRP F  1 35  ? -12.901  -24.320  -13.352 1.00 3.49  ? 35  TRP F O   1 
ATOM   6915  C  CB  . TRP F  1 35  ? -13.040  -23.035  -15.965 1.00 2.85  ? 35  TRP F CB  1 
ATOM   6916  C  CG  . TRP F  1 35  ? -12.280  -22.506  -17.089 1.00 3.67  ? 35  TRP F CG  1 
ATOM   6917  C  CD1 . TRP F  1 35  ? -11.111  -22.995  -17.582 1.00 5.33  ? 35  TRP F CD1 1 
ATOM   6918  C  CD2 . TRP F  1 35  ? -12.611  -21.357  -17.891 1.00 4.18  ? 35  TRP F CD2 1 
ATOM   6919  N  NE1 . TRP F  1 35  ? -10.688  -22.233  -18.645 1.00 5.76  ? 35  TRP F NE1 1 
ATOM   6920  C  CE2 . TRP F  1 35  ? -11.587  -21.213  -18.850 1.00 4.66  ? 35  TRP F CE2 1 
ATOM   6921  C  CE3 . TRP F  1 35  ? -13.660  -20.428  -17.877 1.00 2.55  ? 35  TRP F CE3 1 
ATOM   6922  C  CZ2 . TRP F  1 35  ? -11.586  -20.183  -19.793 1.00 4.26  ? 35  TRP F CZ2 1 
ATOM   6923  C  CZ3 . TRP F  1 35  ? -13.660  -19.419  -18.812 1.00 3.82  ? 35  TRP F CZ3 1 
ATOM   6924  C  CH2 . TRP F  1 35  ? -12.631  -19.303  -19.765 1.00 4.13  ? 35  TRP F CH2 1 
ATOM   6925  N  N   . GLY F  1 36  ? -14.385  -25.733  -14.264 1.00 2.89  ? 36  GLY F N   1 
ATOM   6926  C  CA  . GLY F  1 36  ? -14.896  -26.178  -12.980 1.00 2.74  ? 36  GLY F CA  1 
ATOM   6927  C  C   . GLY F  1 36  ? -15.954  -25.247  -12.432 1.00 3.35  ? 36  GLY F C   1 
ATOM   6928  O  O   . GLY F  1 36  ? -16.416  -25.420  -11.295 1.00 3.97  ? 36  GLY F O   1 
ATOM   6929  N  N   . LEU F  1 37  ? -16.374  -24.282  -13.257 1.00 3.36  ? 37  LEU F N   1 
ATOM   6930  C  CA  . LEU F  1 37  ? -17.431  -23.315  -12.926 1.00 2.83  ? 37  LEU F CA  1 
ATOM   6931  C  C   . LEU F  1 37  ? -18.813  -23.955  -13.190 1.00 3.06  ? 37  LEU F C   1 
ATOM   6932  O  O   . LEU F  1 37  ? -19.609  -23.512  -14.023 1.00 3.23  ? 37  LEU F O   1 
ATOM   6933  C  CB  . LEU F  1 37  ? -17.191  -22.044  -13.755 1.00 2.60  ? 37  LEU F CB  1 
ATOM   6934  C  CG  . LEU F  1 37  ? -16.195  -21.009  -13.190 1.00 3.44  ? 37  LEU F CG  1 
ATOM   6935  C  CD1 . LEU F  1 37  ? -15.181  -21.570  -12.189 1.00 2.00  ? 37  LEU F CD1 1 
ATOM   6936  C  CD2 . LEU F  1 37  ? -15.520  -20.168  -14.271 1.00 2.00  ? 37  LEU F CD2 1 
ATOM   6937  N  N   . LYS F  1 38  ? -19.069  -25.026  -12.456 1.00 3.32  ? 38  LYS F N   1 
ATOM   6938  C  CA  . LYS F  1 38  ? -20.198  -25.940  -12.637 1.00 3.66  ? 38  LYS F CA  1 
ATOM   6939  C  C   . LYS F  1 38  ? -21.555  -25.218  -12.888 1.00 3.60  ? 38  LYS F C   1 
ATOM   6940  O  O   . LYS F  1 38  ? -22.377  -25.624  -13.687 1.00 3.43  ? 38  LYS F O   1 
ATOM   6941  C  CB  . LYS F  1 38  ? -20.240  -26.789  -11.360 1.00 3.92  ? 38  LYS F CB  1 
ATOM   6942  C  CG  . LYS F  1 38  ? -20.530  -28.273  -11.497 1.00 8.08  ? 38  LYS F CG  1 
ATOM   6943  C  CD  . LYS F  1 38  ? -19.313  -29.221  -11.359 1.00 10.93 ? 38  LYS F CD  1 
ATOM   6944  C  CE  . LYS F  1 38  ? -18.589  -29.111  -10.015 1.00 13.67 ? 38  LYS F CE  1 
ATOM   6945  N  NZ  . LYS F  1 38  ? -19.323  -29.579  -8.836  1.00 13.97 ? 38  LYS F NZ  1 
ATOM   6946  N  N   . ARG F  1 39  ? -21.756  -24.106  -12.208 1.00 4.34  ? 39  ARG F N   1 
ATOM   6947  C  CA  . ARG F  1 39  ? -23.033  -23.424  -12.154 1.00 4.48  ? 39  ARG F CA  1 
ATOM   6948  C  C   . ARG F  1 39  ? -23.304  -22.631  -13.402 1.00 4.26  ? 39  ARG F C   1 
ATOM   6949  O  O   . ARG F  1 39  ? -24.434  -22.523  -13.858 1.00 4.80  ? 39  ARG F O   1 
ATOM   6950  C  CB  . ARG F  1 39  ? -22.963  -22.453  -10.989 1.00 5.26  ? 39  ARG F CB  1 
ATOM   6951  C  CG  . ARG F  1 39  ? -24.246  -22.179  -10.274 1.00 7.84  ? 39  ARG F CG  1 
ATOM   6952  C  CD  . ARG F  1 39  ? -24.821  -20.907  -10.826 1.00 14.22 ? 39  ARG F CD  1 
ATOM   6953  N  NE  . ARG F  1 39  ? -25.116  -19.924  -9.764  1.00 18.69 ? 39  ARG F NE  1 
ATOM   6954  C  CZ  . ARG F  1 39  ? -25.242  -18.604  -9.977  1.00 20.85 ? 39  ARG F CZ  1 
ATOM   6955  N  NH1 . ARG F  1 39  ? -25.092  -18.081  -11.219 1.00 16.91 ? 39  ARG F NH1 1 
ATOM   6956  N  NH2 . ARG F  1 39  ? -25.491  -17.806  -8.931  1.00 21.69 ? 39  ARG F NH2 1 
ATOM   6957  N  N   . LEU F  1 40  ? -22.256  -22.024  -13.928 1.00 3.89  ? 40  LEU F N   1 
ATOM   6958  C  CA  . LEU F  1 40  ? -22.320  -21.289  -15.160 1.00 3.19  ? 40  LEU F CA  1 
ATOM   6959  C  C   . LEU F  1 40  ? -22.498  -22.276  -16.322 1.00 3.56  ? 40  LEU F C   1 
ATOM   6960  O  O   . LEU F  1 40  ? -23.134  -21.947  -17.319 1.00 3.49  ? 40  LEU F O   1 
ATOM   6961  C  CB  . LEU F  1 40  ? -21.024  -20.517  -15.311 1.00 3.39  ? 40  LEU F CB  1 
ATOM   6962  C  CG  . LEU F  1 40  ? -20.950  -19.025  -15.060 1.00 2.42  ? 40  LEU F CG  1 
ATOM   6963  C  CD1 . LEU F  1 40  ? -22.039  -18.476  -14.154 1.00 2.58  ? 40  LEU F CD1 1 
ATOM   6964  C  CD2 . LEU F  1 40  ? -19.578  -18.692  -14.561 1.00 2.00  ? 40  LEU F CD2 1 
ATOM   6965  N  N   . ASN F  1 41  ? -21.937  -23.486  -16.200 1.00 3.63  ? 41  ASN F N   1 
ATOM   6966  C  CA  . ASN F  1 41  ? -22.151  -24.519  -17.197 1.00 2.96  ? 41  ASN F CA  1 
ATOM   6967  C  C   . ASN F  1 41  ? -23.602  -24.923  -17.193 1.00 3.16  ? 41  ASN F C   1 
ATOM   6968  O  O   . ASN F  1 41  ? -24.192  -25.025  -18.235 1.00 2.87  ? 41  ASN F O   1 
ATOM   6969  C  CB  . ASN F  1 41  ? -21.265  -25.749  -16.958 1.00 2.68  ? 41  ASN F CB  1 
ATOM   6970  C  CG  . ASN F  1 41  ? -21.732  -26.969  -17.739 1.00 3.33  ? 41  ASN F CG  1 
ATOM   6971  O  OD1 . ASN F  1 41  ? -21.523  -27.068  -18.943 1.00 3.50  ? 41  ASN F OD1 1 
ATOM   6972  N  ND2 . ASN F  1 41  ? -22.410  -27.879  -17.058 1.00 2.00  ? 41  ASN F ND2 1 
ATOM   6973  N  N   . ASP F  1 42  ? -24.176  -25.165  -16.026 1.00 3.84  ? 42  ASP F N   1 
ATOM   6974  C  CA  . ASP F  1 42  ? -25.594  -25.524  -15.955 1.00 5.18  ? 42  ASP F CA  1 
ATOM   6975  C  C   . ASP F  1 42  ? -26.474  -24.448  -16.603 1.00 5.47  ? 42  ASP F C   1 
ATOM   6976  O  O   . ASP F  1 42  ? -27.315  -24.763  -17.453 1.00 5.95  ? 42  ASP F O   1 
ATOM   6977  C  CB  . ASP F  1 42  ? -26.071  -25.781  -14.524 1.00 5.45  ? 42  ASP F CB  1 
ATOM   6978  C  CG  . ASP F  1 42  ? -25.416  -27.000  -13.885 1.00 9.94  ? 42  ASP F CG  1 
ATOM   6979  O  OD1 . ASP F  1 42  ? -24.739  -27.801  -14.587 1.00 13.01 ? 42  ASP F OD1 1 
ATOM   6980  O  OD2 . ASP F  1 42  ? -25.560  -27.148  -12.650 1.00 13.59 ? 42  ASP F OD2 1 
ATOM   6981  N  N   . VAL F  1 43  ? -26.283  -23.180  -16.241 1.00 5.06  ? 43  VAL F N   1 
ATOM   6982  C  CA  . VAL F  1 43  ? -27.192  -22.163  -16.763 1.00 4.92  ? 43  VAL F CA  1 
ATOM   6983  C  C   . VAL F  1 43  ? -27.015  -21.990  -18.272 1.00 4.92  ? 43  VAL F C   1 
ATOM   6984  O  O   . VAL F  1 43  ? -28.000  -22.003  -19.035 1.00 4.73  ? 43  VAL F O   1 
ATOM   6985  C  CB  . VAL F  1 43  ? -27.094  -20.825  -16.008 1.00 4.87  ? 43  VAL F CB  1 
ATOM   6986  C  CG1 . VAL F  1 43  ? -27.838  -19.723  -16.759 1.00 5.13  ? 43  VAL F CG1 1 
ATOM   6987  C  CG2 . VAL F  1 43  ? -27.667  -20.978  -14.618 1.00 4.15  ? 43  VAL F CG2 1 
ATOM   6988  N  N   . GLU F  1 44  ? -25.768  -21.849  -18.717 1.00 4.68  ? 44  GLU F N   1 
ATOM   6989  C  CA  . GLU F  1 44  ? -25.535  -21.603  -20.146 1.00 4.92  ? 44  GLU F CA  1 
ATOM   6990  C  C   . GLU F  1 44  ? -25.922  -22.768  -21.016 1.00 4.69  ? 44  GLU F C   1 
ATOM   6991  O  O   . GLU F  1 44  ? -26.390  -22.577  -22.135 1.00 4.87  ? 44  GLU F O   1 
ATOM   6992  C  CB  . GLU F  1 44  ? -24.112  -21.218  -20.431 1.00 4.29  ? 44  GLU F CB  1 
ATOM   6993  C  CG  . GLU F  1 44  ? -23.765  -19.936  -19.760 1.00 7.82  ? 44  GLU F CG  1 
ATOM   6994  C  CD  . GLU F  1 44  ? -23.549  -18.782  -20.714 1.00 11.30 ? 44  GLU F CD  1 
ATOM   6995  O  OE1 . GLU F  1 44  ? -22.872  -18.920  -21.743 1.00 12.43 ? 44  GLU F OE1 1 
ATOM   6996  O  OE2 . GLU F  1 44  ? -24.023  -17.688  -20.409 1.00 12.57 ? 44  GLU F OE2 1 
ATOM   6997  N  N   . TYR F  1 45  ? -25.754  -23.971  -20.501 1.00 4.64  ? 45  TYR F N   1 
ATOM   6998  C  CA  . TYR F  1 45  ? -26.237  -25.108  -21.199 1.00 4.77  ? 45  TYR F CA  1 
ATOM   6999  C  C   . TYR F  1 45  ? -27.737  -24.998  -21.388 1.00 5.27  ? 45  TYR F C   1 
ATOM   7000  O  O   . TYR F  1 45  ? -28.242  -25.179  -22.495 1.00 5.11  ? 45  TYR F O   1 
ATOM   7001  C  CB  . TYR F  1 45  ? -25.894  -26.364  -20.448 1.00 4.98  ? 45  TYR F CB  1 
ATOM   7002  C  CG  . TYR F  1 45  ? -26.466  -27.606  -21.063 1.00 5.02  ? 45  TYR F CG  1 
ATOM   7003  C  CD1 . TYR F  1 45  ? -25.829  -28.245  -22.112 1.00 5.34  ? 45  TYR F CD1 1 
ATOM   7004  C  CD2 . TYR F  1 45  ? -27.665  -28.134  -20.589 1.00 5.99  ? 45  TYR F CD2 1 
ATOM   7005  C  CE1 . TYR F  1 45  ? -26.347  -29.382  -22.660 1.00 6.94  ? 45  TYR F CE1 1 
ATOM   7006  C  CE2 . TYR F  1 45  ? -28.217  -29.276  -21.140 1.00 6.30  ? 45  TYR F CE2 1 
ATOM   7007  C  CZ  . TYR F  1 45  ? -27.558  -29.901  -22.171 1.00 7.81  ? 45  TYR F CZ  1 
ATOM   7008  O  OH  . TYR F  1 45  ? -28.126  -31.055  -22.704 1.00 8.41  ? 45  TYR F OH  1 
ATOM   7009  N  N   A HIS F  1 46  ? -28.449  -24.687  -20.316 0.50 5.71  ? 46  HIS F N   1 
ATOM   7010  N  N   B HIS F  1 46  ? -28.456  -24.698  -20.309 0.50 5.73  ? 46  HIS F N   1 
ATOM   7011  C  CA  A HIS F  1 46  ? -29.901  -24.561  -20.402 0.50 6.24  ? 46  HIS F CA  1 
ATOM   7012  C  CA  B HIS F  1 46  ? -29.915  -24.522  -20.375 0.50 6.32  ? 46  HIS F CA  1 
ATOM   7013  C  C   A HIS F  1 46  ? -30.326  -23.425  -21.336 0.50 5.73  ? 46  HIS F C   1 
ATOM   7014  C  C   B HIS F  1 46  ? -30.266  -23.486  -21.431 0.50 5.76  ? 46  HIS F C   1 
ATOM   7015  O  O   A HIS F  1 46  ? -31.409  -23.466  -21.904 0.50 6.32  ? 46  HIS F O   1 
ATOM   7016  O  O   B HIS F  1 46  ? -31.231  -23.649  -22.166 0.50 6.29  ? 46  HIS F O   1 
ATOM   7017  C  CB  A HIS F  1 46  ? -30.555  -24.472  -19.018 0.50 6.45  ? 46  HIS F CB  1 
ATOM   7018  C  CB  B HIS F  1 46  ? -30.517  -24.137  -19.015 0.50 6.56  ? 46  HIS F CB  1 
ATOM   7019  C  CG  A HIS F  1 46  ? -30.440  -25.736  -18.221 0.50 9.87  ? 46  HIS F CG  1 
ATOM   7020  C  CG  B HIS F  1 46  ? -32.014  -23.968  -19.027 0.50 10.56 ? 46  HIS F CG  1 
ATOM   7021  N  ND1 A HIS F  1 46  ? -31.064  -26.910  -18.592 0.50 11.98 ? 46  HIS F ND1 1 
ATOM   7022  N  ND1 B HIS F  1 46  ? -32.888  -25.033  -19.147 0.50 14.27 ? 46  HIS F ND1 1 
ATOM   7023  C  CD2 A HIS F  1 46  ? -29.745  -26.021  -17.093 0.50 12.54 ? 46  HIS F CD2 1 
ATOM   7024  C  CD2 B HIS F  1 46  ? -32.790  -22.859  -18.909 0.50 12.25 ? 46  HIS F CD2 1 
ATOM   7025  C  CE1 A HIS F  1 46  ? -30.761  -27.860  -17.724 0.50 13.13 ? 46  HIS F CE1 1 
ATOM   7026  C  CE1 B HIS F  1 46  ? -34.133  -24.585  -19.115 0.50 14.35 ? 46  HIS F CE1 1 
ATOM   7027  N  NE2 A HIS F  1 46  ? -29.959  -27.346  -16.807 0.50 13.28 ? 46  HIS F NE2 1 
ATOM   7028  N  NE2 B HIS F  1 46  ? -34.102  -23.270  -18.972 0.50 13.53 ? 46  HIS F NE2 1 
ATOM   7029  N  N   . GLU F  1 47  ? -29.466  -22.440  -21.537 1.00 5.31  ? 47  GLU F N   1 
ATOM   7030  C  CA  . GLU F  1 47  ? -29.767  -21.419  -22.497 1.00 5.24  ? 47  GLU F CA  1 
ATOM   7031  C  C   . GLU F  1 47  ? -29.536  -21.830  -23.920 1.00 4.48  ? 47  GLU F C   1 
ATOM   7032  O  O   . GLU F  1 47  ? -30.266  -21.433  -24.787 1.00 4.03  ? 47  GLU F O   1 
ATOM   7033  C  CB  . GLU F  1 47  ? -29.074  -20.129  -22.152 1.00 6.19  ? 47  GLU F CB  1 
ATOM   7034  C  CG  . GLU F  1 47  ? -29.971  -19.370  -21.224 1.00 8.85  ? 47  GLU F CG  1 
ATOM   7035  C  CD  . GLU F  1 47  ? -29.242  -18.342  -20.425 1.00 15.07 ? 47  GLU F CD  1 
ATOM   7036  O  OE1 . GLU F  1 47  ? -27.962  -18.250  -20.495 1.00 16.98 ? 47  GLU F OE1 1 
ATOM   7037  O  OE2 . GLU F  1 47  ? -29.986  -17.628  -19.705 1.00 18.41 ? 47  GLU F OE2 1 
ATOM   7038  N  N   . SER F  1 48  ? -28.523  -22.641  -24.143 1.00 4.50  ? 48  SER F N   1 
ATOM   7039  C  CA  . SER F  1 48  ? -28.369  -23.303  -25.427 1.00 4.22  ? 48  SER F CA  1 
ATOM   7040  C  C   . SER F  1 48  ? -29.613  -24.124  -25.833 1.00 4.45  ? 48  SER F C   1 
ATOM   7041  O  O   . SER F  1 48  ? -30.095  -24.014  -26.959 1.00 3.78  ? 48  SER F O   1 
ATOM   7042  C  CB  . SER F  1 48  ? -27.120  -24.173  -25.424 1.00 3.78  ? 48  SER F CB  1 
ATOM   7043  O  OG  . SER F  1 48  ? -26.765  -24.444  -26.760 1.00 4.36  ? 48  SER F OG  1 
ATOM   7044  N  N   . ILE F  1 49  ? -30.132  -24.936  -24.904 1.00 4.73  ? 49  ILE F N   1 
ATOM   7045  C  CA  . ILE F  1 49  ? -31.352  -25.712  -25.156 1.00 5.04  ? 49  ILE F CA  1 
ATOM   7046  C  C   . ILE F  1 49  ? -32.486  -24.749  -25.484 1.00 5.42  ? 49  ILE F C   1 
ATOM   7047  O  O   . ILE F  1 49  ? -33.312  -25.000  -26.354 1.00 5.52  ? 49  ILE F O   1 
ATOM   7048  C  CB  . ILE F  1 49  ? -31.778  -26.609  -23.944 1.00 4.95  ? 49  ILE F CB  1 
ATOM   7049  C  CG1 . ILE F  1 49  ? -30.761  -27.715  -23.640 1.00 5.39  ? 49  ILE F CG1 1 
ATOM   7050  C  CG2 . ILE F  1 49  ? -33.130  -27.233  -24.165 1.00 4.00  ? 49  ILE F CG2 1 
ATOM   7051  C  CD1 . ILE F  1 49  ? -29.951  -28.193  -24.814 1.00 6.06  ? 49  ILE F CD1 1 
ATOM   7052  N  N   . ASP F  1 50  ? -32.522  -23.637  -24.777 1.00 5.91  ? 50  ASP F N   1 
ATOM   7053  C  CA  . ASP F  1 50  ? -33.551  -22.668  -25.014 1.00 7.06  ? 50  ASP F CA  1 
ATOM   7054  C  C   . ASP F  1 50  ? -33.548  -22.133  -26.446 1.00 6.83  ? 50  ASP F C   1 
ATOM   7055  O  O   . ASP F  1 50  ? -34.580  -22.096  -27.112 1.00 6.68  ? 50  ASP F O   1 
ATOM   7056  C  CB  . ASP F  1 50  ? -33.419  -21.526  -24.031 1.00 7.92  ? 50  ASP F CB  1 
ATOM   7057  C  CG  . ASP F  1 50  ? -34.746  -21.133  -23.483 1.00 11.71 ? 50  ASP F CG  1 
ATOM   7058  O  OD1 . ASP F  1 50  ? -35.322  -22.037  -22.823 1.00 14.91 ? 50  ASP F OD1 1 
ATOM   7059  O  OD2 . ASP F  1 50  ? -35.221  -19.984  -23.748 1.00 15.64 ? 50  ASP F OD2 1 
ATOM   7060  N  N   . GLU F  1 51  ? -32.376  -21.747  -26.919 1.00 6.24  ? 51  GLU F N   1 
ATOM   7061  C  CA  . GLU F  1 51  ? -32.262  -21.203  -28.239 1.00 6.45  ? 51  GLU F CA  1 
ATOM   7062  C  C   . GLU F  1 51  ? -32.556  -22.260  -29.299 1.00 6.07  ? 51  GLU F C   1 
ATOM   7063  O  O   . GLU F  1 51  ? -33.049  -21.927  -30.364 1.00 5.07  ? 51  GLU F O   1 
ATOM   7064  C  CB  . GLU F  1 51  ? -30.888  -20.535  -28.432 1.00 7.14  ? 51  GLU F CB  1 
ATOM   7065  C  CG  . GLU F  1 51  ? -30.556  -19.418  -27.438 1.00 8.48  ? 51  GLU F CG  1 
ATOM   7066  C  CD  . GLU F  1 51  ? -31.658  -18.357  -27.283 1.00 12.35 ? 51  GLU F CD  1 
ATOM   7067  O  OE1 . GLU F  1 51  ? -31.388  -17.140  -27.426 1.00 15.20 ? 51  GLU F OE1 1 
ATOM   7068  O  OE2 . GLU F  1 51  ? -32.808  -18.732  -26.999 1.00 15.34 ? 51  GLU F OE2 1 
ATOM   7069  N  N   . MET F  1 52  ? -32.289  -23.530  -28.984 1.00 6.14  ? 52  MET F N   1 
ATOM   7070  C  CA  . MET F  1 52  ? -32.662  -24.616  -29.887 1.00 6.42  ? 52  MET F CA  1 
ATOM   7071  C  C   . MET F  1 52  ? -34.158  -24.700  -30.050 1.00 6.13  ? 52  MET F C   1 
ATOM   7072  O  O   . MET F  1 52  ? -34.636  -24.853  -31.159 1.00 6.42  ? 52  MET F O   1 
ATOM   7073  C  CB  . MET F  1 52  ? -32.173  -25.953  -29.385 1.00 6.26  ? 52  MET F CB  1 
ATOM   7074  C  CG  . MET F  1 52  ? -30.714  -26.176  -29.552 1.00 6.96  ? 52  MET F CG  1 
ATOM   7075  S  SD  . MET F  1 52  ? -30.192  -27.683  -28.698 1.00 9.67  ? 52  MET F SD  1 
ATOM   7076  C  CE  . MET F  1 52  ? -28.616  -27.072  -28.014 1.00 8.43  ? 52  MET F CE  1 
ATOM   7077  N  N   . LYS F  1 53  ? -34.896  -24.585  -28.940 1.00 5.75  ? 53  LYS F N   1 
ATOM   7078  C  CA  . LYS F  1 53  ? -36.339  -24.582  -28.975 1.00 5.76  ? 53  LYS F CA  1 
ATOM   7079  C  C   . LYS F  1 53  ? -36.856  -23.462  -29.877 1.00 5.69  ? 53  LYS F C   1 
ATOM   7080  O  O   . LYS F  1 53  ? -37.803  -23.641  -30.637 1.00 5.90  ? 53  LYS F O   1 
ATOM   7081  C  CB  . LYS F  1 53  ? -36.915  -24.446  -27.564 1.00 6.08  ? 53  LYS F CB  1 
ATOM   7082  C  CG  . LYS F  1 53  ? -36.586  -25.591  -26.648 1.00 7.85  ? 53  LYS F CG  1 
ATOM   7083  C  CD  . LYS F  1 53  ? -37.642  -25.712  -25.549 1.00 12.54 ? 53  LYS F CD  1 
ATOM   7084  C  CE  . LYS F  1 53  ? -37.044  -26.191  -24.214 1.00 16.01 ? 53  LYS F CE  1 
ATOM   7085  N  NZ  . LYS F  1 53  ? -38.108  -26.676  -23.265 1.00 18.00 ? 53  LYS F NZ  1 
ATOM   7086  N  N   . HIS F  1 54  ? -36.219  -22.305  -29.788 1.00 5.75  ? 54  HIS F N   1 
ATOM   7087  C  CA  . HIS F  1 54  ? -36.590  -21.183  -30.616 1.00 5.53  ? 54  HIS F CA  1 
ATOM   7088  C  C   . HIS F  1 54  ? -36.337  -21.452  -32.099 1.00 4.99  ? 54  HIS F C   1 
ATOM   7089  O  O   . HIS F  1 54  ? -37.217  -21.216  -32.937 1.00 4.80  ? 54  HIS F O   1 
ATOM   7090  C  CB  . HIS F  1 54  ? -35.860  -19.944  -30.149 1.00 5.92  ? 54  HIS F CB  1 
ATOM   7091  C  CG  . HIS F  1 54  ? -36.220  -19.520  -28.759 1.00 7.49  ? 54  HIS F CG  1 
ATOM   7092  N  ND1 . HIS F  1 54  ? -35.428  -18.664  -28.018 1.00 10.41 ? 54  HIS F ND1 1 
ATOM   7093  C  CD2 . HIS F  1 54  ? -37.283  -19.827  -27.979 1.00 7.86  ? 54  HIS F CD2 1 
ATOM   7094  C  CE1 . HIS F  1 54  ? -35.994  -18.464  -26.840 1.00 10.35 ? 54  HIS F CE1 1 
ATOM   7095  N  NE2 . HIS F  1 54  ? -37.129  -19.143  -26.799 1.00 7.90  ? 54  HIS F NE2 1 
ATOM   7096  N  N   . ALA F  1 55  ? -35.161  -21.982  -32.405 1.00 4.15  ? 55  ALA F N   1 
ATOM   7097  C  CA  . ALA F  1 55  ? -34.812  -22.329  -33.776 1.00 3.89  ? 55  ALA F CA  1 
ATOM   7098  C  C   . ALA F  1 55  ? -35.850  -23.310  -34.361 1.00 4.13  ? 55  ALA F C   1 
ATOM   7099  O  O   . ALA F  1 55  ? -36.342  -23.139  -35.483 1.00 4.20  ? 55  ALA F O   1 
ATOM   7100  C  CB  . ALA F  1 55  ? -33.418  -22.916  -33.833 1.00 2.89  ? 55  ALA F CB  1 
ATOM   7101  N  N   . ASP F  1 56  ? -36.180  -24.321  -33.577 1.00 3.90  ? 56  ASP F N   1 
ATOM   7102  C  CA  . ASP F  1 56  ? -37.175  -25.290  -33.943 1.00 4.03  ? 56  ASP F CA  1 
ATOM   7103  C  C   . ASP F  1 56  ? -38.492  -24.564  -34.307 1.00 4.33  ? 56  ASP F C   1 
ATOM   7104  O  O   . ASP F  1 56  ? -39.073  -24.826  -35.357 1.00 5.26  ? 56  ASP F O   1 
ATOM   7105  C  CB  . ASP F  1 56  ? -37.358  -26.281  -32.783 1.00 3.82  ? 56  ASP F CB  1 
ATOM   7106  C  CG  . ASP F  1 56  ? -38.196  -27.479  -33.152 1.00 4.31  ? 56  ASP F CG  1 
ATOM   7107  O  OD1 . ASP F  1 56  ? -38.436  -27.733  -34.352 1.00 3.86  ? 56  ASP F OD1 1 
ATOM   7108  O  OD2 . ASP F  1 56  ? -38.633  -28.193  -32.221 1.00 4.96  ? 56  ASP F OD2 1 
ATOM   7109  N  N   . ARG F  1 57  ? -38.934  -23.631  -33.481 1.00 3.70  ? 57  ARG F N   1 
ATOM   7110  C  CA  . ARG F  1 57  ? -40.182  -22.967  -33.748 1.00 3.64  ? 57  ARG F CA  1 
ATOM   7111  C  C   . ARG F  1 57  ? -40.143  -22.161  -35.046 1.00 2.85  ? 57  ARG F C   1 
ATOM   7112  O  O   . ARG F  1 57  ? -41.105  -22.190  -35.833 1.00 2.19  ? 57  ARG F O   1 
ATOM   7113  C  CB  . ARG F  1 57  ? -40.649  -22.154  -32.536 1.00 3.57  ? 57  ARG F CB  1 
ATOM   7114  C  CG  . ARG F  1 57  ? -41.152  -23.052  -31.407 1.00 4.92  ? 57  ARG F CG  1 
ATOM   7115  C  CD  . ARG F  1 57  ? -41.464  -22.306  -30.104 1.00 7.33  ? 57  ARG F CD  1 
ATOM   7116  N  NE  . ARG F  1 57  ? -42.696  -21.515  -30.126 1.00 11.99 ? 57  ARG F NE  1 
ATOM   7117  C  CZ  . ARG F  1 57  ? -42.920  -20.462  -29.304 1.00 14.25 ? 57  ARG F CZ  1 
ATOM   7118  N  NH1 . ARG F  1 57  ? -42.009  -20.088  -28.378 1.00 12.22 ? 57  ARG F NH1 1 
ATOM   7119  N  NH2 . ARG F  1 57  ? -44.066  -19.767  -29.402 1.00 12.00 ? 57  ARG F NH2 1 
ATOM   7120  N  N   . TYR F  1 58  ? -39.034  -21.473  -35.297 1.00 2.23  ? 58  TYR F N   1 
ATOM   7121  C  CA  . TYR F  1 58  ? -38.863  -20.748  -36.562 1.00 2.00  ? 58  TYR F CA  1 
ATOM   7122  C  C   . TYR F  1 58  ? -38.901  -21.693  -37.749 1.00 2.07  ? 58  TYR F C   1 
ATOM   7123  O  O   . TYR F  1 58  ? -39.581  -21.429  -38.754 1.00 2.01  ? 58  TYR F O   1 
ATOM   7124  C  CB  . TYR F  1 58  ? -37.557  -19.950  -36.573 1.00 2.00  ? 58  TYR F CB  1 
ATOM   7125  C  CG  . TYR F  1 58  ? -37.545  -18.778  -35.665 1.00 2.08  ? 58  TYR F CG  1 
ATOM   7126  C  CD1 . TYR F  1 58  ? -38.587  -17.863  -35.679 1.00 2.92  ? 58  TYR F CD1 1 
ATOM   7127  C  CD2 . TYR F  1 58  ? -36.504  -18.571  -34.783 1.00 2.00  ? 58  TYR F CD2 1 
ATOM   7128  C  CE1 . TYR F  1 58  ? -38.592  -16.783  -34.847 1.00 2.00  ? 58  TYR F CE1 1 
ATOM   7129  C  CE2 . TYR F  1 58  ? -36.500  -17.486  -33.939 1.00 2.00  ? 58  TYR F CE2 1 
ATOM   7130  C  CZ  . TYR F  1 58  ? -37.543  -16.596  -33.983 1.00 2.00  ? 58  TYR F CZ  1 
ATOM   7131  O  OH  . TYR F  1 58  ? -37.564  -15.503  -33.157 1.00 2.01  ? 58  TYR F OH  1 
ATOM   7132  N  N   . ILE F  1 59  ? -38.173  -22.806  -37.625 1.00 2.04  ? 59  ILE F N   1 
ATOM   7133  C  CA  . ILE F  1 59  ? -38.033  -23.758  -38.720 1.00 2.20  ? 59  ILE F CA  1 
ATOM   7134  C  C   . ILE F  1 59  ? -39.396  -24.273  -39.073 1.00 2.80  ? 59  ILE F C   1 
ATOM   7135  O  O   . ILE F  1 59  ? -39.744  -24.296  -40.247 1.00 3.47  ? 59  ILE F O   1 
ATOM   7136  C  CB  . ILE F  1 59  ? -37.072  -24.923  -38.398 1.00 2.01  ? 59  ILE F CB  1 
ATOM   7137  C  CG1 . ILE F  1 59  ? -35.638  -24.434  -38.424 1.00 2.00  ? 59  ILE F CG1 1 
ATOM   7138  C  CG2 . ILE F  1 59  ? -37.167  -26.003  -39.419 1.00 2.00  ? 59  ILE F CG2 1 
ATOM   7139  C  CD1 . ILE F  1 59  ? -34.674  -25.295  -37.596 1.00 2.00  ? 59  ILE F CD1 1 
ATOM   7140  N  N   . GLU F  1 60  ? -40.189  -24.642  -38.063 1.00 2.86  ? 60  GLU F N   1 
ATOM   7141  C  CA  . GLU F  1 60  ? -41.500  -25.188  -38.311 1.00 2.84  ? 60  GLU F CA  1 
ATOM   7142  C  C   . GLU F  1 60  ? -42.430  -24.197  -38.909 1.00 2.59  ? 60  GLU F C   1 
ATOM   7143  O  O   . GLU F  1 60  ? -43.278  -24.558  -39.719 1.00 3.19  ? 60  GLU F O   1 
ATOM   7144  C  CB  . GLU F  1 60  ? -42.087  -25.779  -37.066 1.00 2.85  ? 60  GLU F CB  1 
ATOM   7145  C  CG  . GLU F  1 60  ? -41.352  -27.071  -36.699 1.00 5.21  ? 60  GLU F CG  1 
ATOM   7146  C  CD  . GLU F  1 60  ? -41.886  -27.727  -35.465 1.00 7.96  ? 60  GLU F CD  1 
ATOM   7147  O  OE1 . GLU F  1 60  ? -41.439  -28.833  -35.122 1.00 8.99  ? 60  GLU F OE1 1 
ATOM   7148  O  OE2 . GLU F  1 60  ? -42.754  -27.121  -34.828 1.00 10.79 ? 60  GLU F OE2 1 
ATOM   7149  N  N   . ARG F  1 61  ? -42.257  -22.942  -38.534 1.00 2.76  ? 61  ARG F N   1 
ATOM   7150  C  CA  . ARG F  1 61  ? -43.144  -21.905  -38.982 1.00 2.59  ? 61  ARG F CA  1 
ATOM   7151  C  C   . ARG F  1 61  ? -42.797  -21.539  -40.433 1.00 2.86  ? 61  ARG F C   1 
ATOM   7152  O  O   . ARG F  1 61  ? -43.698  -21.437  -41.273 1.00 2.49  ? 61  ARG F O   1 
ATOM   7153  C  CB  . ARG F  1 61  ? -43.050  -20.697  -38.037 1.00 2.64  ? 61  ARG F CB  1 
ATOM   7154  C  CG  . ARG F  1 61  ? -43.993  -19.556  -38.349 1.00 2.09  ? 61  ARG F CG  1 
ATOM   7155  C  CD  . ARG F  1 61  ? -45.441  -19.876  -38.007 1.00 2.33  ? 61  ARG F CD  1 
ATOM   7156  N  NE  . ARG F  1 61  ? -46.274  -18.790  -38.491 1.00 3.06  ? 61  ARG F NE  1 
ATOM   7157  C  CZ  . ARG F  1 61  ? -47.597  -18.833  -38.629 1.00 5.05  ? 61  ARG F CZ  1 
ATOM   7158  N  NH1 . ARG F  1 61  ? -48.272  -19.919  -38.288 1.00 3.73  ? 61  ARG F NH1 1 
ATOM   7159  N  NH2 . ARG F  1 61  ? -48.237  -17.775  -39.119 1.00 4.52  ? 61  ARG F NH2 1 
ATOM   7160  N  N   . ILE F  1 62  ? -41.494  -21.361  -40.728 1.00 2.60  ? 62  ILE F N   1 
ATOM   7161  C  CA  . ILE F  1 62  ? -41.049  -21.108  -42.112 1.00 2.41  ? 62  ILE F CA  1 
ATOM   7162  C  C   . ILE F  1 62  ? -41.588  -22.222  -43.042 1.00 2.80  ? 62  ILE F C   1 
ATOM   7163  O  O   . ILE F  1 62  ? -42.079  -21.952  -44.158 1.00 2.87  ? 62  ILE F O   1 
ATOM   7164  C  CB  . ILE F  1 62  ? -39.525  -21.028  -42.226 1.00 2.15  ? 62  ILE F CB  1 
ATOM   7165  C  CG1 . ILE F  1 62  ? -39.001  -19.811  -41.478 1.00 3.15  ? 62  ILE F CG1 1 
ATOM   7166  C  CG2 . ILE F  1 62  ? -39.097  -20.922  -43.655 1.00 2.00  ? 62  ILE F CG2 1 
ATOM   7167  C  CD1 . ILE F  1 62  ? -37.508  -19.730  -41.371 1.00 2.00  ? 62  ILE F CD1 1 
ATOM   7168  N  N   . LEU F  1 63  ? -41.526  -23.462  -42.568 1.00 2.49  ? 63  LEU F N   1 
ATOM   7169  C  CA  . LEU F  1 63  ? -41.959  -24.582  -43.359 1.00 2.78  ? 63  LEU F CA  1 
ATOM   7170  C  C   . LEU F  1 63  ? -43.456  -24.505  -43.578 1.00 3.12  ? 63  LEU F C   1 
ATOM   7171  O  O   . LEU F  1 63  ? -43.934  -24.705  -44.688 1.00 3.77  ? 63  LEU F O   1 
ATOM   7172  C  CB  . LEU F  1 63  ? -41.561  -25.893  -42.688 1.00 2.68  ? 63  LEU F CB  1 
ATOM   7173  C  CG  . LEU F  1 63  ? -40.422  -26.791  -43.195 1.00 2.05  ? 63  LEU F CG  1 
ATOM   7174  C  CD1 . LEU F  1 63  ? -39.571  -26.231  -44.300 1.00 2.00  ? 63  LEU F CD1 1 
ATOM   7175  C  CD2 . LEU F  1 63  ? -39.603  -27.251  -42.022 1.00 2.00  ? 63  LEU F CD2 1 
ATOM   7176  N  N   . PHE F  1 64  ? -44.184  -24.163  -42.530 1.00 3.07  ? 64  PHE F N   1 
ATOM   7177  C  CA  . PHE F  1 64  ? -45.633  -24.085  -42.628 1.00 3.10  ? 64  PHE F CA  1 
ATOM   7178  C  C   . PHE F  1 64  ? -46.013  -23.003  -43.625 1.00 3.33  ? 64  PHE F C   1 
ATOM   7179  O  O   . PHE F  1 64  ? -46.933  -23.212  -44.441 1.00 4.33  ? 64  PHE F O   1 
ATOM   7180  C  CB  . PHE F  1 64  ? -46.298  -23.787  -41.288 1.00 2.44  ? 64  PHE F CB  1 
ATOM   7181  C  CG  . PHE F  1 64  ? -47.737  -23.416  -41.415 1.00 2.07  ? 64  PHE F CG  1 
ATOM   7182  C  CD1 . PHE F  1 64  ? -48.662  -24.315  -41.943 1.00 2.02  ? 64  PHE F CD1 1 
ATOM   7183  C  CD2 . PHE F  1 64  ? -48.193  -22.168  -40.995 1.00 3.24  ? 64  PHE F CD2 1 
ATOM   7184  C  CE1 . PHE F  1 64  ? -50.009  -23.984  -42.040 1.00 2.00  ? 64  PHE F CE1 1 
ATOM   7185  C  CE2 . PHE F  1 64  ? -49.561  -21.833  -41.088 1.00 2.00  ? 64  PHE F CE2 1 
ATOM   7186  C  CZ  . PHE F  1 64  ? -50.449  -22.742  -41.611 1.00 2.00  ? 64  PHE F CZ  1 
ATOM   7187  N  N   . LEU F  1 65  ? -45.290  -21.881  -43.570 1.00 2.45  ? 65  LEU F N   1 
ATOM   7188  C  CA  . LEU F  1 65  ? -45.539  -20.738  -44.423 1.00 2.22  ? 65  LEU F CA  1 
ATOM   7189  C  C   . LEU F  1 65  ? -44.998  -20.960  -45.825 1.00 2.32  ? 65  LEU F C   1 
ATOM   7190  O  O   . LEU F  1 65  ? -45.066  -20.051  -46.659 1.00 2.17  ? 65  LEU F O   1 
ATOM   7191  C  CB  . LEU F  1 65  ? -44.911  -19.483  -43.830 1.00 2.24  ? 65  LEU F CB  1 
ATOM   7192  C  CG  . LEU F  1 65  ? -45.556  -19.001  -42.540 1.00 2.35  ? 65  LEU F CG  1 
ATOM   7193  C  CD1 . LEU F  1 65  ? -44.900  -17.707  -42.069 1.00 2.00  ? 65  LEU F CD1 1 
ATOM   7194  C  CD2 . LEU F  1 65  ? -47.108  -18.870  -42.750 1.00 2.00  ? 65  LEU F CD2 1 
ATOM   7195  N  N   . GLU F  1 66  ? -44.455  -22.157  -46.060 1.00 2.36  ? 66  GLU F N   1 
ATOM   7196  C  CA  . GLU F  1 66  ? -43.912  -22.585  -47.357 1.00 3.39  ? 66  GLU F CA  1 
ATOM   7197  C  C   . GLU F  1 66  ? -42.618  -21.899  -47.813 1.00 2.98  ? 66  GLU F C   1 
ATOM   7198  O  O   . GLU F  1 66  ? -42.388  -21.772  -48.993 1.00 3.11  ? 66  GLU F O   1 
ATOM   7199  C  CB  . GLU F  1 66  ? -44.991  -22.568  -48.444 1.00 2.96  ? 66  GLU F CB  1 
ATOM   7200  C  CG  . GLU F  1 66  ? -46.189  -23.492  -48.090 1.00 6.18  ? 66  GLU F CG  1 
ATOM   7201  C  CD  . GLU F  1 66  ? -47.370  -23.421  -49.051 1.00 5.86  ? 66  GLU F CD  1 
ATOM   7202  O  OE1 . GLU F  1 66  ? -47.154  -23.206  -50.270 1.00 11.42 ? 66  GLU F OE1 1 
ATOM   7203  O  OE2 . GLU F  1 66  ? -48.517  -23.596  -48.577 1.00 6.69  ? 66  GLU F OE2 1 
ATOM   7204  N  N   . GLY F  1 67  ? -41.760  -21.496  -46.872 1.00 2.89  ? 67  GLY F N   1 
ATOM   7205  C  CA  . GLY F  1 67  ? -40.438  -20.973  -47.201 1.00 3.03  ? 67  GLY F CA  1 
ATOM   7206  C  C   . GLY F  1 67  ? -39.355  -22.014  -46.923 1.00 4.25  ? 67  GLY F C   1 
ATOM   7207  O  O   . GLY F  1 67  ? -39.644  -23.133  -46.465 1.00 4.46  ? 67  GLY F O   1 
ATOM   7208  N  N   . LEU F  1 68  ? -38.106  -21.651  -47.215 1.00 4.24  ? 68  LEU F N   1 
ATOM   7209  C  CA  . LEU F  1 68  ? -36.962  -22.526  -47.073 1.00 4.17  ? 68  LEU F CA  1 
ATOM   7210  C  C   . LEU F  1 68  ? -36.127  -22.094  -45.869 1.00 3.83  ? 68  LEU F C   1 
ATOM   7211  O  O   . LEU F  1 68  ? -35.466  -21.060  -45.912 1.00 3.74  ? 68  LEU F O   1 
ATOM   7212  C  CB  . LEU F  1 68  ? -36.104  -22.391  -48.308 1.00 4.20  ? 68  LEU F CB  1 
ATOM   7213  C  CG  . LEU F  1 68  ? -36.226  -23.287  -49.552 1.00 6.83  ? 68  LEU F CG  1 
ATOM   7214  C  CD1 . LEU F  1 68  ? -37.367  -24.334  -49.528 1.00 5.18  ? 68  LEU F CD1 1 
ATOM   7215  C  CD2 . LEU F  1 68  ? -36.260  -22.394  -50.834 1.00 6.28  ? 68  LEU F CD2 1 
ATOM   7216  N  N   . PRO F  1 69  ? -36.168  -22.868  -44.766 1.00 3.53  ? 69  PRO F N   1 
ATOM   7217  C  CA  . PRO F  1 69  ? -35.343  -22.487  -43.619 1.00 3.09  ? 69  PRO F CA  1 
ATOM   7218  C  C   . PRO F  1 69  ? -33.881  -22.539  -44.002 1.00 3.60  ? 69  PRO F C   1 
ATOM   7219  O  O   . PRO F  1 69  ? -33.449  -23.446  -44.706 1.00 3.62  ? 69  PRO F O   1 
ATOM   7220  C  CB  . PRO F  1 69  ? -35.654  -23.550  -42.568 1.00 2.07  ? 69  PRO F CB  1 
ATOM   7221  C  CG  . PRO F  1 69  ? -36.910  -24.150  -42.986 1.00 2.02  ? 69  PRO F CG  1 
ATOM   7222  C  CD  . PRO F  1 69  ? -36.960  -24.076  -44.486 1.00 2.82  ? 69  PRO F CD  1 
ATOM   7223  N  N   . ASN F  1 70  ? -33.135  -21.533  -43.555 1.00 4.06  ? 70  ASN F N   1 
ATOM   7224  C  CA  . ASN F  1 70  ? -31.747  -21.402  -43.893 1.00 4.38  ? 70  ASN F CA  1 
ATOM   7225  C  C   . ASN F  1 70  ? -30.906  -21.735  -42.682 1.00 4.78  ? 70  ASN F C   1 
ATOM   7226  O  O   . ASN F  1 70  ? -30.802  -20.931  -41.773 1.00 5.54  ? 70  ASN F O   1 
ATOM   7227  C  CB  . ASN F  1 70  ? -31.474  -19.978  -44.321 1.00 4.02  ? 70  ASN F CB  1 
ATOM   7228  C  CG  . ASN F  1 70  ? -30.052  -19.777  -44.796 1.00 5.27  ? 70  ASN F CG  1 
ATOM   7229  O  OD1 . ASN F  1 70  ? -29.203  -20.676  -44.701 1.00 6.71  ? 70  ASN F OD1 1 
ATOM   7230  N  ND2 . ASN F  1 70  ? -29.771  -18.589  -45.299 1.00 4.51  ? 70  ASN F ND2 1 
ATOM   7231  N  N   . LEU F  1 71  ? -30.318  -22.923  -42.674 1.00 4.75  ? 71  LEU F N   1 
ATOM   7232  C  CA  . LEU F  1 71  ? -29.395  -23.338  -41.630 1.00 4.84  ? 71  LEU F CA  1 
ATOM   7233  C  C   . LEU F  1 71  ? -27.940  -23.367  -42.158 1.00 6.12  ? 71  LEU F C   1 
ATOM   7234  O  O   . LEU F  1 71  ? -27.023  -23.881  -41.497 1.00 6.81  ? 71  LEU F O   1 
ATOM   7235  C  CB  . LEU F  1 71  ? -29.787  -24.714  -41.122 1.00 4.04  ? 71  LEU F CB  1 
ATOM   7236  C  CG  . LEU F  1 71  ? -30.957  -24.723  -40.140 1.00 4.61  ? 71  LEU F CG  1 
ATOM   7237  C  CD1 . LEU F  1 71  ? -32.269  -24.748  -40.845 1.00 3.70  ? 71  LEU F CD1 1 
ATOM   7238  C  CD2 . LEU F  1 71  ? -30.853  -25.895  -39.169 1.00 2.90  ? 71  LEU F CD2 1 
ATOM   7239  N  N   . GLN F  1 72  ? -27.722  -22.828  -43.356 1.00 7.02  ? 72  GLN F N   1 
ATOM   7240  C  CA  . GLN F  1 72  ? -26.429  -22.945  -43.989 1.00 7.65  ? 72  GLN F CA  1 
ATOM   7241  C  C   . GLN F  1 72  ? -25.569  -21.792  -43.510 1.00 8.18  ? 72  GLN F C   1 
ATOM   7242  O  O   . GLN F  1 72  ? -24.419  -21.992  -43.206 1.00 8.81  ? 72  GLN F O   1 
ATOM   7243  C  CB  . GLN F  1 72  ? -26.565  -22.938  -45.517 1.00 7.95  ? 72  GLN F CB  1 
ATOM   7244  C  CG  . GLN F  1 72  ? -25.239  -22.885  -46.270 1.00 9.04  ? 72  GLN F CG  1 
ATOM   7245  C  CD  . GLN F  1 72  ? -24.442  -24.152  -46.087 1.00 11.26 ? 72  GLN F CD  1 
ATOM   7246  O  OE1 . GLN F  1 72  ? -24.704  -25.173  -46.754 1.00 12.94 ? 72  GLN F OE1 1 
ATOM   7247  N  NE2 . GLN F  1 72  ? -23.461  -24.113  -45.175 1.00 7.91  ? 72  GLN F NE2 1 
ATOM   7248  N  N   . ASP F  1 73  ? -26.129  -20.590  -43.428 1.00 8.81  ? 73  ASP F N   1 
ATOM   7249  C  CA  . ASP F  1 73  ? -25.318  -19.412  -43.110 1.00 9.65  ? 73  ASP F CA  1 
ATOM   7250  C  C   . ASP F  1 73  ? -25.256  -19.228  -41.611 1.00 10.11 ? 73  ASP F C   1 
ATOM   7251  O  O   . ASP F  1 73  ? -26.306  -19.297  -40.918 1.00 12.25 ? 73  ASP F O   1 
ATOM   7252  C  CB  . ASP F  1 73  ? -25.866  -18.159  -43.799 1.00 9.48  ? 73  ASP F CB  1 
ATOM   7253  C  CG  . ASP F  1 73  ? -25.962  -18.338  -45.328 1.00 11.91 ? 73  ASP F CG  1 
ATOM   7254  O  OD1 . ASP F  1 73  ? -25.032  -18.974  -45.917 1.00 13.94 ? 73  ASP F OD1 1 
ATOM   7255  O  OD2 . ASP F  1 73  ? -26.972  -17.880  -45.933 1.00 12.35 ? 73  ASP F OD2 1 
ATOM   7256  N  N   . LEU F  1 74  ? -24.043  -19.027  -41.094 1.00 9.54  ? 74  LEU F N   1 
ATOM   7257  C  CA  . LEU F  1 74  ? -23.847  -18.856  -39.659 1.00 8.34  ? 74  LEU F CA  1 
ATOM   7258  C  C   . LEU F  1 74  ? -23.107  -17.555  -39.413 1.00 8.42  ? 74  LEU F C   1 
ATOM   7259  O  O   . LEU F  1 74  ? -21.982  -17.389  -39.896 1.00 8.71  ? 74  LEU F O   1 
ATOM   7260  C  CB  . LEU F  1 74  ? -23.059  -20.039  -39.091 1.00 7.94  ? 74  LEU F CB  1 
ATOM   7261  C  CG  . LEU F  1 74  ? -22.978  -20.176  -37.558 1.00 7.54  ? 74  LEU F CG  1 
ATOM   7262  C  CD1 . LEU F  1 74  ? -24.327  -20.372  -36.911 1.00 4.12  ? 74  LEU F CD1 1 
ATOM   7263  C  CD2 . LEU F  1 74  ? -22.055  -21.323  -37.133 1.00 7.42  ? 74  LEU F CD2 1 
ATOM   7264  N  N   . GLY F  1 75  ? -23.729  -16.639  -38.665 1.00 8.31  ? 75  GLY F N   1 
ATOM   7265  C  CA  . GLY F  1 75  ? -23.115  -15.338  -38.337 1.00 8.43  ? 75  GLY F CA  1 
ATOM   7266  C  C   . GLY F  1 75  ? -21.875  -15.419  -37.449 1.00 9.37  ? 75  GLY F C   1 
ATOM   7267  O  O   . GLY F  1 75  ? -21.461  -16.509  -37.016 1.00 9.29  ? 75  GLY F O   1 
ATOM   7268  N  N   . LYS F  1 76  ? -21.273  -14.263  -37.175 1.00 10.22 ? 76  LYS F N   1 
ATOM   7269  C  CA  . LYS F  1 76  ? -20.065  -14.223  -36.348 1.00 11.65 ? 76  LYS F CA  1 
ATOM   7270  C  C   . LYS F  1 76  ? -20.334  -14.617  -34.886 1.00 10.51 ? 76  LYS F C   1 
ATOM   7271  O  O   . LYS F  1 76  ? -21.156  -13.995  -34.183 1.00 10.78 ? 76  LYS F O   1 
ATOM   7272  C  CB  . LYS F  1 76  ? -19.308  -12.876  -36.432 1.00 11.55 ? 76  LYS F CB  1 
ATOM   7273  C  CG  . LYS F  1 76  ? -17.813  -13.077  -36.022 1.00 15.47 ? 76  LYS F CG  1 
ATOM   7274  C  CD  . LYS F  1 76  ? -16.931  -11.775  -36.002 1.00 15.69 ? 76  LYS F CD  1 
ATOM   7275  C  CE  . LYS F  1 76  ? -15.557  -12.004  -35.244 1.00 18.63 ? 76  LYS F CE  1 
ATOM   7276  N  NZ  . LYS F  1 76  ? -14.770  -10.677  -35.083 1.00 20.32 ? 76  LYS F NZ  1 
ATOM   7277  N  N   . LEU F  1 77  ? -19.653  -15.677  -34.466 1.00 9.98  ? 77  LEU F N   1 
ATOM   7278  C  CA  . LEU F  1 77  ? -19.470  -16.015  -33.049 1.00 9.43  ? 77  LEU F CA  1 
ATOM   7279  C  C   . LEU F  1 77  ? -18.408  -15.107  -32.451 1.00 9.38  ? 77  LEU F C   1 
ATOM   7280  O  O   . LEU F  1 77  ? -17.425  -14.770  -33.121 1.00 9.88  ? 77  LEU F O   1 
ATOM   7281  C  CB  . LEU F  1 77  ? -18.965  -17.451  -32.934 1.00 9.20  ? 77  LEU F CB  1 
ATOM   7282  C  CG  . LEU F  1 77  ? -19.914  -18.582  -32.555 1.00 9.00  ? 77  LEU F CG  1 
ATOM   7283  C  CD1 . LEU F  1 77  ? -21.159  -18.529  -33.389 1.00 7.30  ? 77  LEU F CD1 1 
ATOM   7284  C  CD2 . LEU F  1 77  ? -19.172  -19.862  -32.807 1.00 9.58  ? 77  LEU F CD2 1 
ATOM   7285  N  N   . ASN F  1 78  ? -18.590  -14.685  -31.207 1.00 9.53  ? 78  ASN F N   1 
ATOM   7286  C  CA  . ASN F  1 78  ? -17.522  -13.964  -30.513 1.00 9.46  ? 78  ASN F CA  1 
ATOM   7287  C  C   . ASN F  1 78  ? -17.384  -14.667  -29.169 1.00 9.27  ? 78  ASN F C   1 
ATOM   7288  O  O   . ASN F  1 78  ? -18.268  -14.561  -28.319 1.00 9.78  ? 78  ASN F O   1 
ATOM   7289  C  CB  . ASN F  1 78  ? -17.832  -12.466  -30.396 1.00 9.38  ? 78  ASN F CB  1 
ATOM   7290  C  CG  . ASN F  1 78  ? -16.784  -11.689  -29.548 1.00 12.27 ? 78  ASN F CG  1 
ATOM   7291  O  OD1 . ASN F  1 78  ? -15.689  -12.198  -29.228 1.00 13.90 ? 78  ASN F OD1 1 
ATOM   7292  N  ND2 . ASN F  1 78  ? -17.132  -10.444  -29.182 1.00 12.54 ? 78  ASN F ND2 1 
ATOM   7293  N  N   . ILE F  1 79  ? -16.311  -15.442  -29.015 1.00 8.78  ? 79  ILE F N   1 
ATOM   7294  C  CA  . ILE F  1 79  ? -16.197  -16.376  -27.899 1.00 8.26  ? 79  ILE F CA  1 
ATOM   7295  C  C   . ILE F  1 79  ? -15.655  -15.726  -26.634 1.00 8.75  ? 79  ILE F C   1 
ATOM   7296  O  O   . ILE F  1 79  ? -16.312  -15.793  -25.591 1.00 9.19  ? 79  ILE F O   1 
ATOM   7297  C  CB  . ILE F  1 79  ? -15.361  -17.624  -28.236 1.00 8.09  ? 79  ILE F CB  1 
ATOM   7298  C  CG1 . ILE F  1 79  ? -15.908  -18.351  -29.478 1.00 7.59  ? 79  ILE F CG1 1 
ATOM   7299  C  CG2 . ILE F  1 79  ? -15.327  -18.547  -27.052 1.00 7.81  ? 79  ILE F CG2 1 
ATOM   7300  C  CD1 . ILE F  1 79  ? -17.422  -18.706  -29.438 1.00 5.77  ? 79  ILE F CD1 1 
ATOM   7301  N  N   . GLY F  1 80  ? -14.488  -15.082  -26.722 1.00 8.41  ? 80  GLY F N   1 
ATOM   7302  C  CA  . GLY F  1 80  ? -13.935  -14.401  -25.561 1.00 8.54  ? 80  GLY F CA  1 
ATOM   7303  C  C   . GLY F  1 80  ? -13.057  -15.373  -24.792 1.00 9.10  ? 80  GLY F C   1 
ATOM   7304  O  O   . GLY F  1 80  ? -13.153  -16.587  -24.997 1.00 9.10  ? 80  GLY F O   1 
ATOM   7305  N  N   . GLU F  1 81  ? -12.192  -14.868  -23.908 1.00 9.32  ? 81  GLU F N   1 
ATOM   7306  C  CA  . GLU F  1 81  ? -11.241  -15.761  -23.269 1.00 10.15 ? 81  GLU F CA  1 
ATOM   7307  C  C   . GLU F  1 81  ? -11.415  -15.868  -21.759 1.00 9.39  ? 81  GLU F C   1 
ATOM   7308  O  O   . GLU F  1 81  ? -10.842  -16.781  -21.158 1.00 10.31 ? 81  GLU F O   1 
ATOM   7309  C  CB  . GLU F  1 81  ? -9.791   -15.385  -23.633 1.00 9.64  ? 81  GLU F CB  1 
ATOM   7310  C  CG  . GLU F  1 81  ? -9.440   -15.494  -25.157 1.00 12.26 ? 81  GLU F CG  1 
ATOM   7311  C  CD  . GLU F  1 81  ? -8.215   -14.593  -25.547 1.00 15.07 ? 81  GLU F CD  1 
ATOM   7312  O  OE1 . GLU F  1 81  ? -8.215   -13.361  -25.216 1.00 20.82 ? 81  GLU F OE1 1 
ATOM   7313  O  OE2 . GLU F  1 81  ? -7.251   -15.102  -26.178 1.00 19.46 ? 81  GLU F OE2 1 
ATOM   7314  N  N   . ASP F  1 82  ? -12.164  -14.939  -21.138 1.00 8.72  ? 82  ASP F N   1 
ATOM   7315  C  CA  . ASP F  1 82  ? -12.490  -14.994  -19.689 1.00 7.38  ? 82  ASP F CA  1 
ATOM   7316  C  C   . ASP F  1 82  ? -13.980  -14.786  -19.418 1.00 6.40  ? 82  ASP F C   1 
ATOM   7317  O  O   . ASP F  1 82  ? -14.704  -14.325  -20.280 1.00 6.35  ? 82  ASP F O   1 
ATOM   7318  C  CB  . ASP F  1 82  ? -11.655  -13.998  -18.879 1.00 7.29  ? 82  ASP F CB  1 
ATOM   7319  C  CG  . ASP F  1 82  ? -11.832  -12.563  -19.336 1.00 10.33 ? 82  ASP F CG  1 
ATOM   7320  O  OD1 . ASP F  1 82  ? -10.821  -11.952  -19.717 1.00 16.58 ? 82  ASP F OD1 1 
ATOM   7321  O  OD2 . ASP F  1 82  ? -12.962  -12.020  -19.331 1.00 12.03 ? 82  ASP F OD2 1 
ATOM   7322  N  N   . VAL F  1 83  ? -14.418  -15.100  -18.201 1.00 5.66  ? 83  VAL F N   1 
ATOM   7323  C  CA  . VAL F  1 83  ? -15.839  -15.082  -17.819 1.00 4.95  ? 83  VAL F CA  1 
ATOM   7324  C  C   . VAL F  1 83  ? -16.577  -13.806  -18.232 1.00 5.05  ? 83  VAL F C   1 
ATOM   7325  O  O   . VAL F  1 83  ? -17.584  -13.863  -18.973 1.00 5.05  ? 83  VAL F O   1 
ATOM   7326  C  CB  . VAL F  1 83  ? -16.022  -15.325  -16.308 1.00 4.69  ? 83  VAL F CB  1 
ATOM   7327  C  CG1 . VAL F  1 83  ? -17.488  -15.391  -15.944 1.00 4.00  ? 83  VAL F CG1 1 
ATOM   7328  C  CG2 . VAL F  1 83  ? -15.360  -16.598  -15.932 1.00 4.68  ? 83  VAL F CG2 1 
ATOM   7329  N  N   . GLU F  1 84  ? -16.081  -12.668  -17.758 1.00 4.70  ? 84  GLU F N   1 
ATOM   7330  C  CA  . GLU F  1 84  ? -16.684  -11.392  -18.094 1.00 5.43  ? 84  GLU F CA  1 
ATOM   7331  C  C   . GLU F  1 84  ? -16.824  -11.210  -19.612 1.00 5.72  ? 84  GLU F C   1 
ATOM   7332  O  O   . GLU F  1 84  ? -17.919  -10.959  -20.126 1.00 5.75  ? 84  GLU F O   1 
ATOM   7333  C  CB  . GLU F  1 84  ? -15.879  -10.234  -17.518 1.00 5.56  ? 84  GLU F CB  1 
ATOM   7334  C  CG  . GLU F  1 84  ? -16.775  -9.083   -17.071 1.00 9.22  ? 84  GLU F CG  1 
ATOM   7335  C  CD  . GLU F  1 84  ? -16.026  -7.751   -16.900 1.00 13.97 ? 84  GLU F CD  1 
ATOM   7336  O  OE1 . GLU F  1 84  ? -14.931  -7.746   -16.269 1.00 16.28 ? 84  GLU F OE1 1 
ATOM   7337  O  OE2 . GLU F  1 84  ? -16.545  -6.706   -17.386 1.00 13.51 ? 84  GLU F OE2 1 
ATOM   7338  N  N   . GLU F  1 85  ? -15.713  -11.349  -20.320 1.00 5.75  ? 85  GLU F N   1 
ATOM   7339  C  CA  . GLU F  1 85  ? -15.692  -11.180  -21.755 1.00 6.72  ? 85  GLU F CA  1 
ATOM   7340  C  C   . GLU F  1 85  ? -16.751  -12.116  -22.369 1.00 5.76  ? 85  GLU F C   1 
ATOM   7341  O  O   . GLU F  1 85  ? -17.500  -11.721  -23.290 1.00 5.39  ? 85  GLU F O   1 
ATOM   7342  C  CB  . GLU F  1 85  ? -14.303  -11.557  -22.227 1.00 6.70  ? 85  GLU F CB  1 
ATOM   7343  C  CG  . GLU F  1 85  ? -13.714  -10.778  -23.384 1.00 9.96  ? 85  GLU F CG  1 
ATOM   7344  C  CD  . GLU F  1 85  ? -12.169  -10.975  -23.490 1.00 11.75 ? 85  GLU F CD  1 
ATOM   7345  O  OE1 . GLU F  1 85  ? -11.454  -10.833  -22.439 1.00 15.08 ? 85  GLU F OE1 1 
ATOM   7346  O  OE2 . GLU F  1 85  ? -11.673  -11.273  -24.612 1.00 16.80 ? 85  GLU F OE2 1 
ATOM   7347  N  N   . MET F  1 86  ? -16.853  -13.345  -21.855 1.00 4.97  ? 86  MET F N   1 
ATOM   7348  C  CA  . MET F  1 86  ? -17.774  -14.255  -22.499 1.00 5.00  ? 86  MET F CA  1 
ATOM   7349  C  C   . MET F  1 86  ? -19.212  -13.940  -22.169 1.00 4.96  ? 86  MET F C   1 
ATOM   7350  O  O   . MET F  1 86  ? -20.097  -14.027  -23.028 1.00 5.52  ? 86  MET F O   1 
ATOM   7351  C  CB  . MET F  1 86  ? -17.399  -15.756  -22.435 1.00 4.74  ? 86  MET F CB  1 
ATOM   7352  C  CG  . MET F  1 86  ? -16.828  -16.261  -21.182 1.00 6.69  ? 86  MET F CG  1 
ATOM   7353  S  SD  . MET F  1 86  ? -15.683  -17.636  -21.350 1.00 4.96  ? 86  MET F SD  1 
ATOM   7354  C  CE  . MET F  1 86  ? -16.758  -19.051  -21.478 1.00 3.18  ? 86  MET F CE  1 
ATOM   7355  N  N   . LEU F  1 87  ? -19.454  -13.518  -20.942 1.00 4.81  ? 87  LEU F N   1 
ATOM   7356  C  CA  . LEU F  1 87  ? -20.806  -13.143  -20.570 1.00 3.95  ? 87  LEU F CA  1 
ATOM   7357  C  C   . LEU F  1 87  ? -21.241  -11.911  -21.360 1.00 4.00  ? 87  LEU F C   1 
ATOM   7358  O  O   . LEU F  1 87  ? -22.350  -11.845  -21.880 1.00 4.32  ? 87  LEU F O   1 
ATOM   7359  C  CB  . LEU F  1 87  ? -20.876  -12.931  -19.065 1.00 3.59  ? 87  LEU F CB  1 
ATOM   7360  C  CG  . LEU F  1 87  ? -21.500  -14.036  -18.194 1.00 3.37  ? 87  LEU F CG  1 
ATOM   7361  C  CD1 . LEU F  1 87  ? -21.406  -15.436  -18.727 1.00 2.56  ? 87  LEU F CD1 1 
ATOM   7362  C  CD2 . LEU F  1 87  ? -20.886  -13.954  -16.831 1.00 4.16  ? 87  LEU F CD2 1 
ATOM   7363  N  N   . ARG F  1 88  ? -20.332  -10.964  -21.484 1.00 4.00  ? 88  ARG F N   1 
ATOM   7364  C  CA  . ARG F  1 88  ? -20.598  -9.699   -22.144 1.00 4.82  ? 88  ARG F CA  1 
ATOM   7365  C  C   . ARG F  1 88  ? -20.916  -9.986   -23.596 1.00 4.70  ? 88  ARG F C   1 
ATOM   7366  O  O   . ARG F  1 88  ? -21.768  -9.340   -24.214 1.00 5.46  ? 88  ARG F O   1 
ATOM   7367  C  CB  . ARG F  1 88  ? -19.367  -8.791   -22.034 1.00 4.23  ? 88  ARG F CB  1 
ATOM   7368  C  CG  . ARG F  1 88  ? -19.638  -7.425   -21.500 1.00 5.37  ? 88  ARG F CG  1 
ATOM   7369  C  CD  . ARG F  1 88  ? -18.348  -6.640   -21.165 1.00 7.15  ? 88  ARG F CD  1 
ATOM   7370  N  NE  . ARG F  1 88  ? -18.202  -6.374   -19.723 1.00 13.55 ? 88  ARG F NE  1 
ATOM   7371  C  CZ  . ARG F  1 88  ? -19.096  -5.706   -18.955 1.00 14.68 ? 88  ARG F CZ  1 
ATOM   7372  N  NH1 . ARG F  1 88  ? -20.258  -5.232   -19.448 1.00 13.82 ? 88  ARG F NH1 1 
ATOM   7373  N  NH2 . ARG F  1 88  ? -18.845  -5.533   -17.660 1.00 13.12 ? 88  ARG F NH2 1 
ATOM   7374  N  N   . SER F  1 89  ? -20.246  -10.983  -24.154 1.00 4.69  ? 89  SER F N   1 
ATOM   7375  C  CA  . SER F  1 89  ? -20.458  -11.294  -25.556 1.00 4.18  ? 89  SER F CA  1 
ATOM   7376  C  C   . SER F  1 89  ? -21.847  -11.904  -25.802 1.00 4.53  ? 89  SER F C   1 
ATOM   7377  O  O   . SER F  1 89  ? -22.487  -11.576  -26.808 1.00 4.81  ? 89  SER F O   1 
ATOM   7378  C  CB  . SER F  1 89  ? -19.360  -12.207  -26.053 1.00 4.07  ? 89  SER F CB  1 
ATOM   7379  O  OG  . SER F  1 89  ? -19.599  -12.564  -27.394 1.00 3.47  ? 89  SER F OG  1 
ATOM   7380  N  N   . ASP F  1 90  ? -22.306  -12.780  -24.893 1.00 3.89  ? 90  ASP F N   1 
ATOM   7381  C  CA  . ASP F  1 90  ? -23.648  -13.327  -24.955 1.00 3.82  ? 90  ASP F CA  1 
ATOM   7382  C  C   . ASP F  1 90  ? -24.670  -12.207  -24.822 1.00 3.89  ? 90  ASP F C   1 
ATOM   7383  O  O   . ASP F  1 90  ? -25.669  -12.191  -25.546 1.00 4.20  ? 90  ASP F O   1 
ATOM   7384  C  CB  . ASP F  1 90  ? -23.888  -14.367  -23.860 1.00 4.11  ? 90  ASP F CB  1 
ATOM   7385  C  CG  . ASP F  1 90  ? -23.070  -15.669  -24.062 1.00 6.83  ? 90  ASP F CG  1 
ATOM   7386  O  OD1 . ASP F  1 90  ? -22.673  -16.308  -23.023 1.00 9.13  ? 90  ASP F OD1 1 
ATOM   7387  O  OD2 . ASP F  1 90  ? -22.828  -16.080  -25.243 1.00 9.73  ? 90  ASP F OD2 1 
ATOM   7388  N  N   . LEU F  1 91  ? -24.424  -11.260  -23.913 1.00 3.65  ? 91  LEU F N   1 
ATOM   7389  C  CA  . LEU F  1 91  ? -25.316  -10.096  -23.762 1.00 2.83  ? 91  LEU F CA  1 
ATOM   7390  C  C   . LEU F  1 91  ? -25.396  -9.269   -25.049 1.00 3.10  ? 91  LEU F C   1 
ATOM   7391  O  O   . LEU F  1 91  ? -26.475  -8.923   -25.477 1.00 3.75  ? 91  LEU F O   1 
ATOM   7392  C  CB  . LEU F  1 91  ? -24.889  -9.232   -22.581 1.00 2.83  ? 91  LEU F CB  1 
ATOM   7393  C  CG  . LEU F  1 91  ? -25.619  -7.928   -22.302 1.00 2.00  ? 91  LEU F CG  1 
ATOM   7394  C  CD1 . LEU F  1 91  ? -27.088  -8.214   -22.078 1.00 2.68  ? 91  LEU F CD1 1 
ATOM   7395  C  CD2 . LEU F  1 91  ? -25.021  -7.188   -21.125 1.00 2.00  ? 91  LEU F CD2 1 
ATOM   7396  N  N   . ALA F  1 92  ? -24.276  -8.951   -25.686 1.00 3.22  ? 92  ALA F N   1 
ATOM   7397  C  CA  . ALA F  1 92  ? -24.335  -8.150   -26.918 1.00 3.18  ? 92  ALA F CA  1 
ATOM   7398  C  C   . ALA F  1 92  ? -25.175  -8.889   -27.969 1.00 3.64  ? 92  ALA F C   1 
ATOM   7399  O  O   . ALA F  1 92  ? -25.955  -8.273   -28.732 1.00 4.26  ? 92  ALA F O   1 
ATOM   7400  C  CB  . ALA F  1 92  ? -22.938  -7.831   -27.445 1.00 2.00  ? 92  ALA F CB  1 
ATOM   7401  N  N   . LEU F  1 93  ? -25.036  -10.212  -27.994 1.00 3.84  ? 93  LEU F N   1 
ATOM   7402  C  CA  . LEU F  1 93  ? -25.734  -11.034  -28.959 1.00 4.31  ? 93  LEU F CA  1 
ATOM   7403  C  C   . LEU F  1 93  ? -27.246  -11.021  -28.741 1.00 4.79  ? 93  LEU F C   1 
ATOM   7404  O  O   . LEU F  1 93  ? -27.999  -10.893  -29.707 1.00 5.11  ? 93  LEU F O   1 
ATOM   7405  C  CB  . LEU F  1 93  ? -25.211  -12.451  -28.881 1.00 4.20  ? 93  LEU F CB  1 
ATOM   7406  C  CG  . LEU F  1 93  ? -25.603  -13.344  -30.045 1.00 5.19  ? 93  LEU F CG  1 
ATOM   7407  C  CD1 . LEU F  1 93  ? -25.054  -12.772  -31.364 1.00 5.06  ? 93  LEU F CD1 1 
ATOM   7408  C  CD2 . LEU F  1 93  ? -25.051  -14.712  -29.773 1.00 4.51  ? 93  LEU F CD2 1 
ATOM   7409  N  N   . GLU F  1 94  ? -27.676  -11.138  -27.479 1.00 4.92  ? 94  GLU F N   1 
ATOM   7410  C  CA  . GLU F  1 94  ? -29.079  -11.079  -27.118 1.00 5.02  ? 94  GLU F CA  1 
ATOM   7411  C  C   . GLU F  1 94  ? -29.661  -9.705   -27.472 1.00 4.86  ? 94  GLU F C   1 
ATOM   7412  O  O   . GLU F  1 94  ? -30.761  -9.604   -28.011 1.00 4.44  ? 94  GLU F O   1 
ATOM   7413  C  CB  . GLU F  1 94  ? -29.269  -11.378  -25.633 1.00 5.04  ? 94  GLU F CB  1 
ATOM   7414  C  CG  . GLU F  1 94  ? -28.888  -12.761  -25.212 1.00 7.73  ? 94  GLU F CG  1 
ATOM   7415  C  CD  . GLU F  1 94  ? -30.010  -13.782  -25.374 1.00 13.83 ? 94  GLU F CD  1 
ATOM   7416  O  OE1 . GLU F  1 94  ? -31.091  -13.409  -25.905 1.00 15.08 ? 94  GLU F OE1 1 
ATOM   7417  O  OE2 . GLU F  1 94  ? -29.807  -14.975  -24.986 1.00 14.51 ? 94  GLU F OE2 1 
ATOM   7418  N  N   . LEU F  1 95  ? -28.904  -8.658   -27.182 1.00 4.93  ? 95  LEU F N   1 
ATOM   7419  C  CA  . LEU F  1 95  ? -29.305  -7.330   -27.522 1.00 4.79  ? 95  LEU F CA  1 
ATOM   7420  C  C   . LEU F  1 95  ? -29.517  -7.138   -29.028 1.00 5.50  ? 95  LEU F C   1 
ATOM   7421  O  O   . LEU F  1 95  ? -30.513  -6.537   -29.432 1.00 5.90  ? 95  LEU F O   1 
ATOM   7422  C  CB  . LEU F  1 95  ? -28.314  -6.329   -26.958 1.00 4.58  ? 95  LEU F CB  1 
ATOM   7423  C  CG  . LEU F  1 95  ? -28.676  -5.571   -25.670 1.00 4.46  ? 95  LEU F CG  1 
ATOM   7424  C  CD1 . LEU F  1 95  ? -29.782  -6.208   -24.873 1.00 2.66  ? 95  LEU F CD1 1 
ATOM   7425  C  CD2 . LEU F  1 95  ? -27.470  -5.371   -24.809 1.00 3.34  ? 95  LEU F CD2 1 
ATOM   7426  N  N   . ASP F  1 96  ? -28.627  -7.661   -29.869 1.00 5.53  ? 96  ASP F N   1 
ATOM   7427  C  CA  . ASP F  1 96  ? -28.858  -7.541   -31.300 1.00 6.33  ? 96  ASP F CA  1 
ATOM   7428  C  C   . ASP F  1 96  ? -30.040  -8.353   -31.786 1.00 5.92  ? 96  ASP F C   1 
ATOM   7429  O  O   . ASP F  1 96  ? -30.744  -7.955   -32.713 1.00 5.85  ? 96  ASP F O   1 
ATOM   7430  C  CB  . ASP F  1 96  ? -27.626  -7.907   -32.111 1.00 7.36  ? 96  ASP F CB  1 
ATOM   7431  C  CG  . ASP F  1 96  ? -26.580  -6.804   -32.107 1.00 13.90 ? 96  ASP F CG  1 
ATOM   7432  O  OD1 . ASP F  1 96  ? -26.935  -5.577   -31.975 1.00 19.36 ? 96  ASP F OD1 1 
ATOM   7433  O  OD2 . ASP F  1 96  ? -25.385  -7.168   -32.241 1.00 19.44 ? 96  ASP F OD2 1 
ATOM   7434  N  N   . GLY F  1 97  ? -30.251  -9.511   -31.193 1.00 5.48  ? 97  GLY F N   1 
ATOM   7435  C  CA  . GLY F  1 97  ? -31.391  -10.289  -31.582 1.00 5.58  ? 97  GLY F CA  1 
ATOM   7436  C  C   . GLY F  1 97  ? -32.690  -9.663   -31.111 1.00 5.91  ? 97  GLY F C   1 
ATOM   7437  O  O   . GLY F  1 97  ? -33.701  -9.781   -31.787 1.00 5.95  ? 97  GLY F O   1 
ATOM   7438  N  N   . ALA F  1 98  ? -32.697  -9.028   -29.942 1.00 6.51  ? 98  ALA F N   1 
ATOM   7439  C  CA  . ALA F  1 98  ? -33.921  -8.395   -29.460 1.00 7.78  ? 98  ALA F CA  1 
ATOM   7440  C  C   . ALA F  1 98  ? -34.330  -7.293   -30.430 1.00 9.22  ? 98  ALA F C   1 
ATOM   7441  O  O   . ALA F  1 98  ? -35.503  -7.128   -30.732 1.00 8.82  ? 98  ALA F O   1 
ATOM   7442  C  CB  . ALA F  1 98  ? -33.738  -7.856   -28.058 1.00 6.33  ? 98  ALA F CB  1 
ATOM   7443  N  N   . LYS F  1 99  ? -33.328  -6.574   -30.936 1.00 11.34 ? 99  LYS F N   1 
ATOM   7444  C  CA  . LYS F  1 99  ? -33.510  -5.498   -31.879 1.00 13.63 ? 99  LYS F CA  1 
ATOM   7445  C  C   . LYS F  1 99  ? -34.195  -6.061   -33.126 1.00 11.99 ? 99  LYS F C   1 
ATOM   7446  O  O   . LYS F  1 99  ? -35.251  -5.559   -33.520 1.00 12.42 ? 99  LYS F O   1 
ATOM   7447  C  CB  . LYS F  1 99  ? -32.147  -4.878   -32.197 1.00 14.36 ? 99  LYS F CB  1 
ATOM   7448  C  CG  . LYS F  1 99  ? -32.143  -3.422   -32.703 1.00 18.33 ? 99  LYS F CG  1 
ATOM   7449  C  CD  . LYS F  1 99  ? -30.699  -2.802   -32.629 1.00 19.24 ? 99  LYS F CD  1 
ATOM   7450  C  CE  . LYS F  1 99  ? -30.232  -2.384   -31.157 1.00 22.80 ? 99  LYS F CE  1 
ATOM   7451  N  NZ  . LYS F  1 99  ? -28.770  -2.754   -30.840 1.00 22.14 ? 99  LYS F NZ  1 
ATOM   7452  N  N   . ASN F  1 100 ? -33.626  -7.118   -33.712 1.00 9.85  ? 100 ASN F N   1 
ATOM   7453  C  CA  . ASN F  1 100 ? -34.232  -7.793   -34.859 1.00 8.11  ? 100 ASN F CA  1 
ATOM   7454  C  C   . ASN F  1 100 ? -35.668  -8.292   -34.599 1.00 7.37  ? 100 ASN F C   1 
ATOM   7455  O  O   . ASN F  1 100 ? -36.558  -8.204   -35.475 1.00 6.47  ? 100 ASN F O   1 
ATOM   7456  C  CB  . ASN F  1 100 ? -33.385  -8.972   -35.332 1.00 7.86  ? 100 ASN F CB  1 
ATOM   7457  C  CG  . ASN F  1 100 ? -31.978  -8.572   -35.799 1.00 8.33  ? 100 ASN F CG  1 
ATOM   7458  O  OD1 . ASN F  1 100 ? -31.058  -9.378   -35.731 1.00 9.71  ? 100 ASN F OD1 1 
ATOM   7459  N  ND2 . ASN F  1 100 ? -31.813  -7.349   -36.267 1.00 6.52  ? 100 ASN F ND2 1 
ATOM   7460  N  N   . LEU F  1 101 ? -35.896  -8.814   -33.391 1.00 5.81  ? 101 LEU F N   1 
ATOM   7461  C  CA  . LEU F  1 101 ? -37.189  -9.307   -33.014 1.00 3.84  ? 101 LEU F CA  1 
ATOM   7462  C  C   . LEU F  1 101 ? -38.195  -8.189   -32.971 1.00 3.44  ? 101 LEU F C   1 
ATOM   7463  O  O   . LEU F  1 101 ? -39.328  -8.356   -33.473 1.00 3.05  ? 101 LEU F O   1 
ATOM   7464  C  CB  . LEU F  1 101 ? -37.119  -10.030  -31.684 1.00 4.13  ? 101 LEU F CB  1 
ATOM   7465  C  CG  . LEU F  1 101 ? -36.911  -11.541  -31.689 1.00 2.78  ? 101 LEU F CG  1 
ATOM   7466  C  CD1 . LEU F  1 101 ? -36.399  -12.022  -30.342 1.00 3.15  ? 101 LEU F CD1 1 
ATOM   7467  C  CD2 . LEU F  1 101 ? -38.180  -12.232  -32.008 1.00 2.00  ? 101 LEU F CD2 1 
ATOM   7468  N  N   . ARG F  1 102 ? -37.804  -7.049   -32.399 1.00 2.99  ? 102 ARG F N   1 
ATOM   7469  C  CA  A ARG F  1 102 ? -38.701  -5.887   -32.320 0.50 3.16  ? 102 ARG F CA  1 
ATOM   7470  C  CA  B ARG F  1 102 ? -38.701  -5.893   -32.312 0.50 3.17  ? 102 ARG F CA  1 
ATOM   7471  C  C   . ARG F  1 102 ? -39.125  -5.469   -33.725 1.00 3.58  ? 102 ARG F C   1 
ATOM   7472  O  O   . ARG F  1 102 ? -40.310  -5.220   -33.989 1.00 3.76  ? 102 ARG F O   1 
ATOM   7473  C  CB  A ARG F  1 102 ? -38.063  -4.733   -31.528 0.50 2.54  ? 102 ARG F CB  1 
ATOM   7474  C  CB  B ARG F  1 102 ? -38.068  -4.753   -31.486 0.50 2.55  ? 102 ARG F CB  1 
ATOM   7475  C  CG  A ARG F  1 102 ? -37.676  -5.161   -30.106 0.50 3.08  ? 102 ARG F CG  1 
ATOM   7476  C  CG  B ARG F  1 102 ? -37.995  -5.086   -29.966 0.50 3.16  ? 102 ARG F CG  1 
ATOM   7477  C  CD  A ARG F  1 102 ? -37.485  -4.050   -29.076 0.50 3.45  ? 102 ARG F CD  1 
ATOM   7478  C  CD  B ARG F  1 102 ? -37.180  -4.121   -29.061 0.50 3.53  ? 102 ARG F CD  1 
ATOM   7479  N  NE  A ARG F  1 102 ? -37.962  -4.514   -27.773 0.50 4.46  ? 102 ARG F NE  1 
ATOM   7480  N  NE  B ARG F  1 102 ? -35.768  -4.045   -29.449 0.50 5.96  ? 102 ARG F NE  1 
ATOM   7481  C  CZ  A ARG F  1 102 ? -37.208  -5.094   -26.857 0.50 5.97  ? 102 ARG F CZ  1 
ATOM   7482  C  CZ  B ARG F  1 102 ? -34.873  -3.170   -28.983 0.50 7.19  ? 102 ARG F CZ  1 
ATOM   7483  N  NH1 A ARG F  1 102 ? -35.924  -5.269   -27.051 0.50 9.10  ? 102 ARG F NH1 1 
ATOM   7484  N  NH1 B ARG F  1 102 ? -35.195  -2.259   -28.068 0.50 10.63 ? 102 ARG F NH1 1 
ATOM   7485  N  NH2 A ARG F  1 102 ? -37.747  -5.496   -25.726 0.50 7.40  ? 102 ARG F NH2 1 
ATOM   7486  N  NH2 B ARG F  1 102 ? -33.649  -3.203   -29.443 0.50 7.27  ? 102 ARG F NH2 1 
ATOM   7487  N  N   . GLU F  1 103 ? -38.157  -5.448   -34.645 1.00 4.80  ? 103 GLU F N   1 
ATOM   7488  C  CA  . GLU F  1 103 ? -38.414  -5.043   -36.005 1.00 5.76  ? 103 GLU F CA  1 
ATOM   7489  C  C   . GLU F  1 103 ? -39.364  -6.037   -36.700 1.00 4.12  ? 103 GLU F C   1 
ATOM   7490  O  O   . GLU F  1 103 ? -40.367  -5.611   -37.269 1.00 5.00  ? 103 GLU F O   1 
ATOM   7491  C  CB  . GLU F  1 103 ? -37.109  -4.806   -36.735 1.00 4.52  ? 103 GLU F CB  1 
ATOM   7492  C  CG  . GLU F  1 103 ? -37.293  -4.454   -38.211 1.00 10.04 ? 103 GLU F CG  1 
ATOM   7493  C  CD  . GLU F  1 103 ? -35.940  -4.210   -38.948 1.00 11.84 ? 103 GLU F CD  1 
ATOM   7494  O  OE1 . GLU F  1 103 ? -34.938  -3.878   -38.213 1.00 19.46 ? 103 GLU F OE1 1 
ATOM   7495  O  OE2 . GLU F  1 103 ? -35.888  -4.353   -40.223 1.00 14.15 ? 103 GLU F OE2 1 
ATOM   7496  N  N   . ALA F  1 104 ? -39.081  -7.336   -36.607 1.00 2.86  ? 104 ALA F N   1 
ATOM   7497  C  CA  . ALA F  1 104 ? -39.908  -8.386   -37.208 1.00 2.23  ? 104 ALA F CA  1 
ATOM   7498  C  C   . ALA F  1 104 ? -41.348  -8.400   -36.685 1.00 2.26  ? 104 ALA F C   1 
ATOM   7499  O  O   . ALA F  1 104 ? -42.290  -8.566   -37.454 1.00 2.04  ? 104 ALA F O   1 
ATOM   7500  C  CB  . ALA F  1 104 ? -39.282  -9.725   -36.989 1.00 2.02  ? 104 ALA F CB  1 
ATOM   7501  N  N   . ILE F  1 105 ? -41.509  -8.211   -35.379 1.00 2.39  ? 105 ILE F N   1 
ATOM   7502  C  CA  . ILE F  1 105 ? -42.821  -8.206   -34.745 1.00 2.25  ? 105 ILE F CA  1 
ATOM   7503  C  C   . ILE F  1 105 ? -43.715  -7.093   -35.315 1.00 2.28  ? 105 ILE F C   1 
ATOM   7504  O  O   . ILE F  1 105 ? -44.886  -7.314   -35.605 1.00 2.05  ? 105 ILE F O   1 
ATOM   7505  C  CB  . ILE F  1 105 ? -42.690  -8.097   -33.205 1.00 2.02  ? 105 ILE F CB  1 
ATOM   7506  C  CG1 . ILE F  1 105 ? -42.196  -9.411   -32.642 1.00 2.00  ? 105 ILE F CG1 1 
ATOM   7507  C  CG2 . ILE F  1 105 ? -44.023  -7.795   -32.549 1.00 2.57  ? 105 ILE F CG2 1 
ATOM   7508  C  CD1 . ILE F  1 105 ? -41.587  -9.310   -31.305 1.00 2.01  ? 105 ILE F CD1 1 
ATOM   7509  N  N   . GLY F  1 106 ? -43.150  -5.903   -35.469 1.00 2.22  ? 106 GLY F N   1 
ATOM   7510  C  CA  . GLY F  1 106 ? -43.883  -4.774   -35.978 1.00 2.05  ? 106 GLY F CA  1 
ATOM   7511  C  C   . GLY F  1 106 ? -44.314  -5.037   -37.394 1.00 2.39  ? 106 GLY F C   1 
ATOM   7512  O  O   . GLY F  1 106 ? -45.444  -4.684   -37.772 1.00 3.05  ? 106 GLY F O   1 
ATOM   7513  N  N   . TYR F  1 107 ? -43.435  -5.671   -38.175 1.00 2.00  ? 107 TYR F N   1 
ATOM   7514  C  CA  . TYR F  1 107 ? -43.742  -5.903   -39.574 1.00 2.00  ? 107 TYR F CA  1 
ATOM   7515  C  C   . TYR F  1 107 ? -44.810  -7.000   -39.748 1.00 2.69  ? 107 TYR F C   1 
ATOM   7516  O  O   . TYR F  1 107 ? -45.731  -6.861   -40.560 1.00 2.64  ? 107 TYR F O   1 
ATOM   7517  C  CB  . TYR F  1 107 ? -42.494  -6.201   -40.379 1.00 2.22  ? 107 TYR F CB  1 
ATOM   7518  C  CG  . TYR F  1 107 ? -42.860  -6.563   -41.780 1.00 2.13  ? 107 TYR F CG  1 
ATOM   7519  C  CD1 . TYR F  1 107 ? -43.131  -5.574   -42.735 1.00 2.01  ? 107 TYR F CD1 1 
ATOM   7520  C  CD2 . TYR F  1 107 ? -43.035  -7.882   -42.135 1.00 2.03  ? 107 TYR F CD2 1 
ATOM   7521  C  CE1 . TYR F  1 107 ? -43.510  -5.909   -44.014 1.00 2.12  ? 107 TYR F CE1 1 
ATOM   7522  C  CE2 . TYR F  1 107 ? -43.414  -8.231   -43.413 1.00 3.55  ? 107 TYR F CE2 1 
ATOM   7523  C  CZ  . TYR F  1 107 ? -43.656  -7.242   -44.342 1.00 3.73  ? 107 TYR F CZ  1 
ATOM   7524  O  OH  . TYR F  1 107 ? -44.032  -7.614   -45.620 1.00 4.48  ? 107 TYR F OH  1 
ATOM   7525  N  N   . ALA F  1 108 ? -44.700  -8.073   -38.955 1.00 2.83  ? 108 ALA F N   1 
ATOM   7526  C  CA  . ALA F  1 108 ? -45.711  -9.138   -38.946 1.00 2.71  ? 108 ALA F CA  1 
ATOM   7527  C  C   . ALA F  1 108 ? -47.128  -8.605   -38.670 1.00 2.91  ? 108 ALA F C   1 
ATOM   7528  O  O   . ALA F  1 108 ? -48.099  -9.021   -39.309 1.00 2.71  ? 108 ALA F O   1 
ATOM   7529  C  CB  . ALA F  1 108 ? -45.336  -10.250  -37.967 1.00 2.00  ? 108 ALA F CB  1 
ATOM   7530  N  N   . ASP F  1 109 ? -47.226  -7.669   -37.735 1.00 2.98  ? 109 ASP F N   1 
ATOM   7531  C  CA  . ASP F  1 109 ? -48.478  -6.991   -37.437 1.00 3.26  ? 109 ASP F CA  1 
ATOM   7532  C  C   . ASP F  1 109 ? -48.988  -6.232   -38.650 1.00 3.31  ? 109 ASP F C   1 
ATOM   7533  O  O   . ASP F  1 109 ? -50.170  -6.209   -38.921 1.00 2.65  ? 109 ASP F O   1 
ATOM   7534  C  CB  . ASP F  1 109 ? -48.291  -6.011   -36.296 1.00 3.43  ? 109 ASP F CB  1 
ATOM   7535  C  CG  . ASP F  1 109 ? -49.585  -5.516   -35.744 1.00 5.60  ? 109 ASP F CG  1 
ATOM   7536  O  OD1 . ASP F  1 109 ? -50.030  -4.443   -36.189 1.00 8.73  ? 109 ASP F OD1 1 
ATOM   7537  O  OD2 . ASP F  1 109 ? -50.178  -6.203   -34.880 1.00 8.50  ? 109 ASP F OD2 1 
ATOM   7538  N  N   . SER F  1 110 ? -48.094  -5.618   -39.405 1.00 3.72  ? 110 SER F N   1 
ATOM   7539  C  CA  . SER F  1 110 ? -48.600  -4.761   -40.444 1.00 4.44  ? 110 SER F CA  1 
ATOM   7540  C  C   . SER F  1 110 ? -49.044  -5.536   -41.673 1.00 3.82  ? 110 SER F C   1 
ATOM   7541  O  O   . SER F  1 110 ? -49.881  -5.045   -42.405 1.00 4.08  ? 110 SER F O   1 
ATOM   7542  C  CB  . SER F  1 110 ? -47.638  -3.622   -40.729 1.00 4.65  ? 110 SER F CB  1 
ATOM   7543  O  OG  . SER F  1 110 ? -46.422  -4.175   -41.170 1.00 10.42 ? 110 SER F OG  1 
ATOM   7544  N  N   . VAL F  1 111 ? -48.533  -6.749   -41.879 1.00 3.44  ? 111 VAL F N   1 
ATOM   7545  C  CA  . VAL F  1 111 ? -49.082  -7.650   -42.898 1.00 2.86  ? 111 VAL F CA  1 
ATOM   7546  C  C   . VAL F  1 111 ? -50.084  -8.666   -42.334 1.00 2.82  ? 111 VAL F C   1 
ATOM   7547  O  O   . VAL F  1 111 ? -50.458  -9.602   -43.029 1.00 2.01  ? 111 VAL F O   1 
ATOM   7548  C  CB  . VAL F  1 111 ? -48.009  -8.427   -43.677 1.00 2.93  ? 111 VAL F CB  1 
ATOM   7549  C  CG1 . VAL F  1 111 ? -47.201  -7.513   -44.538 1.00 3.11  ? 111 VAL F CG1 1 
ATOM   7550  C  CG2 . VAL F  1 111 ? -47.095  -9.197   -42.729 1.00 3.50  ? 111 VAL F CG2 1 
ATOM   7551  N  N   . HIS F  1 112 ? -50.508  -8.488   -41.079 1.00 3.24  ? 112 HIS F N   1 
ATOM   7552  C  CA  . HIS F  1 112 ? -51.559  -9.330   -40.492 1.00 3.77  ? 112 HIS F CA  1 
ATOM   7553  C  C   . HIS F  1 112 ? -51.155  -10.774  -40.188 1.00 3.48  ? 112 HIS F C   1 
ATOM   7554  O  O   . HIS F  1 112 ? -52.017  -11.607  -39.998 1.00 4.08  ? 112 HIS F O   1 
ATOM   7555  C  CB  . HIS F  1 112 ? -52.840  -9.277   -41.346 1.00 3.88  ? 112 HIS F CB  1 
ATOM   7556  C  CG  . HIS F  1 112 ? -53.420  -7.895   -41.457 1.00 8.26  ? 112 HIS F CG  1 
ATOM   7557  N  ND1 . HIS F  1 112 ? -53.088  -7.030   -42.484 1.00 12.12 ? 112 HIS F ND1 1 
ATOM   7558  C  CD2 . HIS F  1 112 ? -54.246  -7.197   -40.631 1.00 11.29 ? 112 HIS F CD2 1 
ATOM   7559  C  CE1 . HIS F  1 112 ? -53.693  -5.864   -42.287 1.00 12.97 ? 112 HIS F CE1 1 
ATOM   7560  N  NE2 . HIS F  1 112 ? -54.403  -5.942   -41.171 1.00 12.49 ? 112 HIS F NE2 1 
ATOM   7561  N  N   . ASP F  1 113 ? -49.854  -11.079  -40.128 1.00 3.04  ? 113 ASP F N   1 
ATOM   7562  C  CA  . ASP F  1 113 ? -49.395  -12.396  -39.703 1.00 2.50  ? 113 ASP F CA  1 
ATOM   7563  C  C   . ASP F  1 113 ? -49.332  -12.439  -38.181 1.00 2.14  ? 113 ASP F C   1 
ATOM   7564  O  O   . ASP F  1 113 ? -48.278  -12.500  -37.554 1.00 2.00  ? 113 ASP F O   1 
ATOM   7565  C  CB  . ASP F  1 113 ? -48.047  -12.756  -40.327 1.00 2.57  ? 113 ASP F CB  1 
ATOM   7566  C  CG  . ASP F  1 113 ? -47.666  -14.248  -40.118 1.00 3.40  ? 113 ASP F CG  1 
ATOM   7567  O  OD1 . ASP F  1 113 ? -48.337  -14.987  -39.335 1.00 3.52  ? 113 ASP F OD1 1 
ATOM   7568  O  OD2 . ASP F  1 113 ? -46.666  -14.676  -40.741 1.00 3.85  ? 113 ASP F OD2 1 
ATOM   7569  N  N   . TYR F  1 114 ? -50.506  -12.416  -37.597 1.00 2.01  ? 114 TYR F N   1 
ATOM   7570  C  CA  . TYR F  1 114 ? -50.666  -12.361  -36.166 1.00 2.22  ? 114 TYR F CA  1 
ATOM   7571  C  C   . TYR F  1 114 ? -50.143  -13.594  -35.431 1.00 2.56  ? 114 TYR F C   1 
ATOM   7572  O  O   . TYR F  1 114 ? -49.670  -13.468  -34.304 1.00 2.03  ? 114 TYR F O   1 
ATOM   7573  C  CB  . TYR F  1 114 ? -52.126  -12.086  -35.843 1.00 2.00  ? 114 TYR F CB  1 
ATOM   7574  C  CG  . TYR F  1 114 ? -52.552  -10.734  -36.371 1.00 2.51  ? 114 TYR F CG  1 
ATOM   7575  C  CD1 . TYR F  1 114 ? -51.902  -9.550   -35.941 1.00 2.02  ? 114 TYR F CD1 1 
ATOM   7576  C  CD2 . TYR F  1 114 ? -53.585  -10.611  -37.308 1.00 2.16  ? 114 TYR F CD2 1 
ATOM   7577  C  CE1 . TYR F  1 114 ? -52.281  -8.310   -36.409 1.00 2.00  ? 114 TYR F CE1 1 
ATOM   7578  C  CE2 . TYR F  1 114 ? -53.976  -9.350   -37.785 1.00 2.03  ? 114 TYR F CE2 1 
ATOM   7579  C  CZ  . TYR F  1 114 ? -53.321  -8.222   -37.326 1.00 2.00  ? 114 TYR F CZ  1 
ATOM   7580  O  OH  . TYR F  1 114 ? -53.706  -6.993   -37.787 1.00 2.03  ? 114 TYR F OH  1 
ATOM   7581  N  N   . VAL F  1 115 ? -50.179  -14.779  -36.052 1.00 2.64  ? 115 VAL F N   1 
ATOM   7582  C  CA  . VAL F  1 115 ? -49.597  -15.897  -35.349 1.00 2.55  ? 115 VAL F CA  1 
ATOM   7583  C  C   . VAL F  1 115 ? -48.086  -15.943  -35.350 1.00 2.92  ? 115 VAL F C   1 
ATOM   7584  O  O   . VAL F  1 115 ? -47.486  -16.192  -34.298 1.00 3.41  ? 115 VAL F O   1 
ATOM   7585  C  CB  . VAL F  1 115 ? -50.378  -17.234  -35.443 1.00 2.34  ? 115 VAL F CB  1 
ATOM   7586  C  CG1 . VAL F  1 115 ? -51.587  -17.094  -36.287 1.00 2.90  ? 115 VAL F CG1 1 
ATOM   7587  C  CG2 . VAL F  1 115 ? -49.502  -18.437  -35.764 1.00 2.00  ? 115 VAL F CG2 1 
ATOM   7588  N  N   . SER F  1 116 ? -47.456  -15.614  -36.475 1.00 2.81  ? 116 SER F N   1 
ATOM   7589  C  CA  . SER F  1 116 ? -46.012  -15.361  -36.440 1.00 2.47  ? 116 SER F CA  1 
ATOM   7590  C  C   . SER F  1 116 ? -45.674  -14.313  -35.393 1.00 2.73  ? 116 SER F C   1 
ATOM   7591  O  O   . SER F  1 116 ? -44.721  -14.496  -34.643 1.00 3.13  ? 116 SER F O   1 
ATOM   7592  C  CB  . SER F  1 116 ? -45.466  -14.966  -37.780 1.00 2.00  ? 116 SER F CB  1 
ATOM   7593  O  OG  . SER F  1 116 ? -45.615  -16.016  -38.695 1.00 2.00  ? 116 SER F OG  1 
ATOM   7594  N  N   . ARG F  1 117 ? -46.471  -13.245  -35.301 1.00 2.53  ? 117 ARG F N   1 
ATOM   7595  C  CA  . ARG F  1 117 ? -46.184  -12.203  -34.326 1.00 2.21  ? 117 ARG F CA  1 
ATOM   7596  C  C   . ARG F  1 117 ? -46.205  -12.759  -32.922 1.00 3.09  ? 117 ARG F C   1 
ATOM   7597  O  O   . ARG F  1 117 ? -45.282  -12.520  -32.114 1.00 3.03  ? 117 ARG F O   1 
ATOM   7598  C  CB  . ARG F  1 117 ? -47.158  -11.067  -34.449 1.00 2.00  ? 117 ARG F CB  1 
ATOM   7599  C  CG  . ARG F  1 117 ? -46.966  -10.000  -33.411 1.00 2.00  ? 117 ARG F CG  1 
ATOM   7600  C  CD  . ARG F  1 117 ? -47.721  -8.768   -33.787 1.00 2.00  ? 117 ARG F CD  1 
ATOM   7601  N  NE  . ARG F  1 117 ? -48.091  -7.959   -32.626 1.00 2.93  ? 117 ARG F NE  1 
ATOM   7602  C  CZ  . ARG F  1 117 ? -47.740  -6.679   -32.445 1.00 2.74  ? 117 ARG F CZ  1 
ATOM   7603  N  NH1 . ARG F  1 117 ? -46.994  -6.039   -33.356 1.00 2.00  ? 117 ARG F NH1 1 
ATOM   7604  N  NH2 . ARG F  1 117 ? -48.159  -6.037   -31.354 1.00 2.00  ? 117 ARG F NH2 1 
ATOM   7605  N  N   . ASP F  1 118 ? -47.251  -13.545  -32.655 1.00 3.50  ? 118 ASP F N   1 
ATOM   7606  C  CA  . ASP F  1 118 ? -47.513  -14.092  -31.342 1.00 3.88  ? 118 ASP F CA  1 
ATOM   7607  C  C   . ASP F  1 118 ? -46.358  -15.020  -30.948 1.00 4.03  ? 118 ASP F C   1 
ATOM   7608  O  O   . ASP F  1 118 ? -45.836  -14.937  -29.848 1.00 5.13  ? 118 ASP F O   1 
ATOM   7609  C  CB  . ASP F  1 118 ? -48.841  -14.846  -31.386 1.00 4.83  ? 118 ASP F CB  1 
ATOM   7610  C  CG  . ASP F  1 118 ? -49.319  -15.329  -29.999 1.00 7.80  ? 118 ASP F CG  1 
ATOM   7611  O  OD1 . ASP F  1 118 ? -49.549  -14.487  -29.104 1.00 11.65 ? 118 ASP F OD1 1 
ATOM   7612  O  OD2 . ASP F  1 118 ? -49.494  -16.555  -29.823 1.00 11.15 ? 118 ASP F OD2 1 
ATOM   7613  N  N   . MET F  1 119 ? -45.920  -15.882  -31.863 1.00 4.03  ? 119 MET F N   1 
ATOM   7614  C  CA  . MET F  1 119 ? -44.763  -16.708  -31.601 1.00 4.16  ? 119 MET F CA  1 
ATOM   7615  C  C   . MET F  1 119 ? -43.527  -15.860  -31.318 1.00 3.86  ? 119 MET F C   1 
ATOM   7616  O  O   . MET F  1 119 ? -42.781  -16.179  -30.399 1.00 4.58  ? 119 MET F O   1 
ATOM   7617  C  CB  . MET F  1 119 ? -44.512  -17.642  -32.770 1.00 4.09  ? 119 MET F CB  1 
ATOM   7618  C  CG  . MET F  1 119 ? -43.116  -18.270  -32.802 1.00 4.23  ? 119 MET F CG  1 
ATOM   7619  S  SD  . MET F  1 119 ? -42.658  -18.766  -34.490 1.00 5.79  ? 119 MET F SD  1 
ATOM   7620  C  CE  . MET F  1 119 ? -43.779  -20.194  -34.590 1.00 9.20  ? 119 MET F CE  1 
ATOM   7621  N  N   . MET F  1 120 ? -43.306  -14.795  -32.085 1.00 3.08  ? 120 MET F N   1 
ATOM   7622  C  CA  . MET F  1 120 ? -42.138  -13.966  -31.862 1.00 3.22  ? 120 MET F CA  1 
ATOM   7623  C  C   . MET F  1 120 ? -42.160  -13.225  -30.521 1.00 3.20  ? 120 MET F C   1 
ATOM   7624  O  O   . MET F  1 120 ? -41.120  -13.047  -29.920 1.00 2.70  ? 120 MET F O   1 
ATOM   7625  C  CB  . MET F  1 120 ? -41.942  -12.984  -33.007 1.00 2.59  ? 120 MET F CB  1 
ATOM   7626  C  CG  . MET F  1 120 ? -41.617  -13.674  -34.276 1.00 2.69  ? 120 MET F CG  1 
ATOM   7627  S  SD  . MET F  1 120 ? -41.222  -12.596  -35.620 1.00 5.70  ? 120 MET F SD  1 
ATOM   7628  C  CE  . MET F  1 120 ? -42.779  -11.801  -35.988 1.00 2.37  ? 120 MET F CE  1 
ATOM   7629  N  N   . ILE F  1 121 ? -43.341  -12.798  -30.062 1.00 3.55  ? 121 ILE F N   1 
ATOM   7630  C  CA  . ILE F  1 121 ? -43.428  -12.095  -28.796 1.00 3.29  ? 121 ILE F CA  1 
ATOM   7631  C  C   . ILE F  1 121 ? -43.066  -13.017  -27.647 1.00 4.00  ? 121 ILE F C   1 
ATOM   7632  O  O   . ILE F  1 121 ? -42.367  -12.600  -26.745 1.00 3.53  ? 121 ILE F O   1 
ATOM   7633  C  CB  . ILE F  1 121 ? -44.800  -11.478  -28.555 1.00 3.15  ? 121 ILE F CB  1 
ATOM   7634  C  CG1 . ILE F  1 121 ? -44.993  -10.257  -29.422 1.00 2.65  ? 121 ILE F CG1 1 
ATOM   7635  C  CG2 . ILE F  1 121 ? -44.918  -11.012  -27.132 1.00 2.02  ? 121 ILE F CG2 1 
ATOM   7636  C  CD1 . ILE F  1 121 ? -46.462  -9.893   -29.634 1.00 2.82  ? 121 ILE F CD1 1 
ATOM   7637  N  N   . GLU F  1 122 ? -43.518  -14.277  -27.689 1.00 4.73  ? 122 GLU F N   1 
ATOM   7638  C  CA  . GLU F  1 122 ? -43.106  -15.235  -26.658 1.00 5.52  ? 122 GLU F CA  1 
ATOM   7639  C  C   . GLU F  1 122 ? -41.581  -15.453  -26.667 1.00 5.41  ? 122 GLU F C   1 
ATOM   7640  O  O   . GLU F  1 122 ? -40.952  -15.464  -25.595 1.00 6.42  ? 122 GLU F O   1 
ATOM   7641  C  CB  . GLU F  1 122 ? -43.877  -16.549  -26.712 1.00 5.84  ? 122 GLU F CB  1 
ATOM   7642  C  CG  . GLU F  1 122 ? -45.419  -16.438  -26.356 1.00 11.58 ? 122 GLU F CG  1 
ATOM   7643  C  CD  . GLU F  1 122 ? -45.768  -15.579  -25.010 1.00 19.44 ? 122 GLU F CD  1 
ATOM   7644  O  OE1 . GLU F  1 122 ? -45.573  -16.120  -23.840 1.00 20.90 ? 122 GLU F OE1 1 
ATOM   7645  O  OE2 . GLU F  1 122 ? -46.262  -14.382  -25.137 1.00 19.01 ? 122 GLU F OE2 1 
ATOM   7646  N  N   . ILE F  1 123 ? -40.971  -15.552  -27.850 1.00 4.49  ? 123 ILE F N   1 
ATOM   7647  C  CA  . ILE F  1 123 ? -39.533  -15.723  -27.932 1.00 3.57  ? 123 ILE F CA  1 
ATOM   7648  C  C   . ILE F  1 123 ? -38.810  -14.518  -27.315 1.00 4.05  ? 123 ILE F C   1 
ATOM   7649  O  O   . ILE F  1 123 ? -37.888  -14.688  -26.514 1.00 3.87  ? 123 ILE F O   1 
ATOM   7650  C  CB  . ILE F  1 123 ? -39.104  -16.046  -29.376 1.00 3.54  ? 123 ILE F CB  1 
ATOM   7651  C  CG1 . ILE F  1 123 ? -39.546  -17.467  -29.734 1.00 2.43  ? 123 ILE F CG1 1 
ATOM   7652  C  CG2 . ILE F  1 123 ? -37.578  -15.846  -29.587 1.00 2.47  ? 123 ILE F CG2 1 
ATOM   7653  C  CD1 . ILE F  1 123 ? -39.541  -17.762  -31.178 1.00 2.00  ? 123 ILE F CD1 1 
ATOM   7654  N  N   . LEU F  1 124 ? -39.273  -13.307  -27.646 1.00 3.97  ? 124 LEU F N   1 
ATOM   7655  C  CA  . LEU F  1 124 ? -38.665  -12.064  -27.161 1.00 3.93  ? 124 LEU F CA  1 
ATOM   7656  C  C   . LEU F  1 124 ? -38.722  -12.022  -25.647 1.00 4.51  ? 124 LEU F C   1 
ATOM   7657  O  O   . LEU F  1 124 ? -37.784  -11.594  -25.007 1.00 4.89  ? 124 LEU F O   1 
ATOM   7658  C  CB  . LEU F  1 124 ? -39.347  -10.840  -27.763 1.00 3.44  ? 124 LEU F CB  1 
ATOM   7659  C  CG  . LEU F  1 124 ? -38.883  -9.444   -27.327 1.00 2.98  ? 124 LEU F CG  1 
ATOM   7660  C  CD1 . LEU F  1 124 ? -37.413  -9.123   -27.656 1.00 2.00  ? 124 LEU F CD1 1 
ATOM   7661  C  CD2 . LEU F  1 124 ? -39.816  -8.436   -27.929 1.00 2.00  ? 124 LEU F CD2 1 
ATOM   7662  N  N   . ARG F  1 125 ? -39.821  -12.497  -25.085 1.00 4.95  ? 125 ARG F N   1 
ATOM   7663  C  CA  . ARG F  1 125 ? -39.968  -12.613  -23.652 1.00 5.50  ? 125 ARG F CA  1 
ATOM   7664  C  C   . ARG F  1 125 ? -38.906  -13.559  -23.051 1.00 5.77  ? 125 ARG F C   1 
ATOM   7665  O  O   . ARG F  1 125 ? -38.369  -13.276  -21.993 1.00 5.60  ? 125 ARG F O   1 
ATOM   7666  C  CB  . ARG F  1 125 ? -41.377  -13.090  -23.313 1.00 5.58  ? 125 ARG F CB  1 
ATOM   7667  C  CG  . ARG F  1 125 ? -41.651  -13.178  -21.842 1.00 7.90  ? 125 ARG F CG  1 
ATOM   7668  C  CD  . ARG F  1 125 ? -43.121  -13.437  -21.557 1.00 12.91 ? 125 ARG F CD  1 
ATOM   7669  N  NE  . ARG F  1 125 ? -43.294  -13.729  -20.121 1.00 19.06 ? 125 ARG F NE  1 
ATOM   7670  C  CZ  . ARG F  1 125 ? -44.397  -14.277  -19.573 1.00 22.49 ? 125 ARG F CZ  1 
ATOM   7671  N  NH1 . ARG F  1 125 ? -45.468  -14.614  -20.338 1.00 21.50 ? 125 ARG F NH1 1 
ATOM   7672  N  NH2 . ARG F  1 125 ? -44.449  -14.482  -18.251 1.00 19.90 ? 125 ARG F NH2 1 
ATOM   7673  N  N   . ASP F  1 126 ? -38.590  -14.669  -23.726 1.00 6.04  ? 126 ASP F N   1 
ATOM   7674  C  CA  . ASP F  1 126 ? -37.539  -15.547  -23.242 1.00 6.50  ? 126 ASP F CA  1 
ATOM   7675  C  C   . ASP F  1 126 ? -36.194  -14.856  -23.355 1.00 6.75  ? 126 ASP F C   1 
ATOM   7676  O  O   . ASP F  1 126 ? -35.343  -15.069  -22.496 1.00 7.41  ? 126 ASP F O   1 
ATOM   7677  C  CB  . ASP F  1 126 ? -37.488  -16.928  -23.944 1.00 6.61  ? 126 ASP F CB  1 
ATOM   7678  C  CG  . ASP F  1 126 ? -38.785  -17.723  -23.823 1.00 9.53  ? 126 ASP F CG  1 
ATOM   7679  O  OD1 . ASP F  1 126 ? -39.032  -18.618  -24.679 1.00 10.13 ? 126 ASP F OD1 1 
ATOM   7680  O  OD2 . ASP F  1 126 ? -39.582  -17.470  -22.879 1.00 13.14 ? 126 ASP F OD2 1 
ATOM   7681  N  N   . GLU F  1 127 ? -35.999  -14.031  -24.389 1.00 6.82  ? 127 GLU F N   1 
ATOM   7682  C  CA  . GLU F  1 127 ? -34.704  -13.384  -24.605 1.00 6.88  ? 127 GLU F CA  1 
ATOM   7683  C  C   . GLU F  1 127 ? -34.463  -12.338  -23.572 1.00 5.99  ? 127 GLU F C   1 
ATOM   7684  O  O   . GLU F  1 127 ? -33.390  -12.245  -23.003 1.00 5.37  ? 127 GLU F O   1 
ATOM   7685  C  CB  . GLU F  1 127 ? -34.601  -12.748  -26.001 1.00 6.97  ? 127 GLU F CB  1 
ATOM   7686  C  CG  . GLU F  1 127 ? -34.848  -13.751  -27.155 1.00 11.06 ? 127 GLU F CG  1 
ATOM   7687  C  CD  . GLU F  1 127 ? -33.833  -14.918  -27.279 1.00 12.26 ? 127 GLU F CD  1 
ATOM   7688  O  OE1 . GLU F  1 127 ? -33.929  -15.652  -28.270 1.00 14.04 ? 127 GLU F OE1 1 
ATOM   7689  O  OE2 . GLU F  1 127 ? -32.948  -15.103  -26.431 1.00 12.83 ? 127 GLU F OE2 1 
ATOM   7690  N  N   . GLU F  1 128 ? -35.495  -11.544  -23.356 1.00 6.02  ? 128 GLU F N   1 
ATOM   7691  C  CA  . GLU F  1 128 ? -35.528  -10.520  -22.368 1.00 5.48  ? 128 GLU F CA  1 
ATOM   7692  C  C   . GLU F  1 128 ? -35.149  -11.175  -21.000 1.00 5.43  ? 128 GLU F C   1 
ATOM   7693  O  O   . GLU F  1 128 ? -34.374  -10.587  -20.217 1.00 5.38  ? 128 GLU F O   1 
ATOM   7694  C  CB  . GLU F  1 128 ? -36.932  -9.950   -22.416 1.00 5.53  ? 128 GLU F CB  1 
ATOM   7695  C  CG  . GLU F  1 128 ? -37.119  -8.514   -22.033 1.00 6.76  ? 128 GLU F CG  1 
ATOM   7696  C  CD  . GLU F  1 128 ? -37.736  -7.669   -23.135 1.00 7.25  ? 128 GLU F CD  1 
ATOM   7697  O  OE1 . GLU F  1 128 ? -37.310  -7.754   -24.287 1.00 9.79  ? 128 GLU F OE1 1 
ATOM   7698  O  OE2 . GLU F  1 128 ? -38.628  -6.861   -22.857 1.00 7.50  ? 128 GLU F OE2 1 
ATOM   7699  N  N   . GLY F  1 129 ? -35.628  -12.402  -20.741 1.00 4.74  ? 129 GLY F N   1 
ATOM   7700  C  CA  . GLY F  1 129 ? -35.214  -13.174  -19.577 1.00 4.12  ? 129 GLY F CA  1 
ATOM   7701  C  C   . GLY F  1 129 ? -33.717  -13.471  -19.528 1.00 5.04  ? 129 GLY F C   1 
ATOM   7702  O  O   . GLY F  1 129 ? -33.094  -13.307  -18.490 1.00 5.08  ? 129 GLY F O   1 
ATOM   7703  N  N   . HIS F  1 130 ? -33.131  -13.920  -20.640 1.00 5.20  ? 130 HIS F N   1 
ATOM   7704  C  CA  . HIS F  1 130 ? -31.700  -14.150  -20.702 1.00 5.79  ? 130 HIS F CA  1 
ATOM   7705  C  C   . HIS F  1 130 ? -30.932  -12.847  -20.491 1.00 5.56  ? 130 HIS F C   1 
ATOM   7706  O  O   . HIS F  1 130 ? -29.931  -12.817  -19.767 1.00 5.66  ? 130 HIS F O   1 
ATOM   7707  C  CB  . HIS F  1 130 ? -31.299  -14.748  -22.028 1.00 6.66  ? 130 HIS F CB  1 
ATOM   7708  C  CG  . HIS F  1 130 ? -31.944  -16.065  -22.337 1.00 10.70 ? 130 HIS F CG  1 
ATOM   7709  N  ND1 . HIS F  1 130 ? -32.018  -16.571  -23.617 1.00 14.39 ? 130 HIS F ND1 1 
ATOM   7710  C  CD2 . HIS F  1 130 ? -32.547  -16.978  -21.544 1.00 11.84 ? 130 HIS F CD2 1 
ATOM   7711  C  CE1 . HIS F  1 130 ? -32.640  -17.734  -23.601 1.00 14.20 ? 130 HIS F CE1 1 
ATOM   7712  N  NE2 . HIS F  1 130 ? -32.971  -18.003  -22.356 1.00 12.93 ? 130 HIS F NE2 1 
ATOM   7713  N  N   . ILE F  1 131 ? -31.397  -11.765  -21.110 1.00 4.98  ? 131 ILE F N   1 
ATOM   7714  C  CA  . ILE F  1 131 ? -30.804  -10.462  -20.910 1.00 4.07  ? 131 ILE F CA  1 
ATOM   7715  C  C   . ILE F  1 131 ? -30.793  -10.141  -19.396 1.00 4.72  ? 131 ILE F C   1 
ATOM   7716  O  O   . ILE F  1 131 ? -29.764  -9.710   -18.848 1.00 4.77  ? 131 ILE F O   1 
ATOM   7717  C  CB  . ILE F  1 131 ? -31.530  -9.373   -21.755 1.00 3.97  ? 131 ILE F CB  1 
ATOM   7718  C  CG1 . ILE F  1 131 ? -31.301  -9.645   -23.247 1.00 3.93  ? 131 ILE F CG1 1 
ATOM   7719  C  CG2 . ILE F  1 131 ? -31.054  -7.986   -21.378 1.00 2.66  ? 131 ILE F CG2 1 
ATOM   7720  C  CD1 . ILE F  1 131 ? -32.150  -8.832   -24.232 1.00 2.07  ? 131 ILE F CD1 1 
ATOM   7721  N  N   . ASP F  1 132 ? -31.909  -10.375  -18.711 1.00 4.28  ? 132 ASP F N   1 
ATOM   7722  C  CA  . ASP F  1 132 ? -31.958  -10.103  -17.295 1.00 4.27  ? 132 ASP F CA  1 
ATOM   7723  C  C   . ASP F  1 132 ? -30.849  -10.877  -16.563 1.00 4.11  ? 132 ASP F C   1 
ATOM   7724  O  O   . ASP F  1 132 ? -30.077  -10.309  -15.767 1.00 4.06  ? 132 ASP F O   1 
ATOM   7725  C  CB  . ASP F  1 132 ? -33.329  -10.484  -16.771 1.00 4.66  ? 132 ASP F CB  1 
ATOM   7726  C  CG  . ASP F  1 132 ? -33.579  -10.018  -15.337 1.00 6.36  ? 132 ASP F CG  1 
ATOM   7727  O  OD1 . ASP F  1 132 ? -32.728  -9.342   -14.736 1.00 4.75  ? 132 ASP F OD1 1 
ATOM   7728  O  OD2 . ASP F  1 132 ? -34.684  -10.313  -14.819 1.00 10.49 ? 132 ASP F OD2 1 
ATOM   7729  N  N   . TRP F  1 133 ? -30.737  -12.164  -16.860 1.00 3.85  ? 133 TRP F N   1 
ATOM   7730  C  CA  . TRP F  1 133 ? -29.790  -12.991  -16.155 1.00 3.77  ? 133 TRP F CA  1 
ATOM   7731  C  C   . TRP F  1 133 ? -28.344  -12.547  -16.420 1.00 3.76  ? 133 TRP F C   1 
ATOM   7732  O  O   . TRP F  1 133 ? -27.573  -12.398  -15.477 1.00 3.97  ? 133 TRP F O   1 
ATOM   7733  C  CB  . TRP F  1 133 ? -29.987  -14.479  -16.486 1.00 3.80  ? 133 TRP F CB  1 
ATOM   7734  C  CG  . TRP F  1 133 ? -29.059  -15.340  -15.720 1.00 4.09  ? 133 TRP F CG  1 
ATOM   7735  C  CD1 . TRP F  1 133 ? -29.212  -15.780  -14.427 1.00 4.03  ? 133 TRP F CD1 1 
ATOM   7736  C  CD2 . TRP F  1 133 ? -27.796  -15.833  -16.163 1.00 4.39  ? 133 TRP F CD2 1 
ATOM   7737  N  NE1 . TRP F  1 133 ? -28.134  -16.542  -14.048 1.00 3.67  ? 133 TRP F NE1 1 
ATOM   7738  C  CE2 . TRP F  1 133 ? -27.244  -16.595  -15.085 1.00 3.89  ? 133 TRP F CE2 1 
ATOM   7739  C  CE3 . TRP F  1 133 ? -27.082  -15.735  -17.356 1.00 4.08  ? 133 TRP F CE3 1 
ATOM   7740  C  CZ2 . TRP F  1 133 ? -26.007  -17.232  -15.175 1.00 4.24  ? 133 TRP F CZ2 1 
ATOM   7741  C  CZ3 . TRP F  1 133 ? -25.833  -16.384  -17.441 1.00 3.84  ? 133 TRP F CZ3 1 
ATOM   7742  C  CH2 . TRP F  1 133 ? -25.317  -17.117  -16.360 1.00 4.44  ? 133 TRP F CH2 1 
ATOM   7743  N  N   . LEU F  1 134 ? -27.987  -12.336  -17.690 1.00 3.41  ? 134 LEU F N   1 
ATOM   7744  C  CA  . LEU F  1 134 ? -26.644  -11.887  -18.038 1.00 2.61  ? 134 LEU F CA  1 
ATOM   7745  C  C   . LEU F  1 134 ? -26.293  -10.564  -17.365 1.00 2.54  ? 134 LEU F C   1 
ATOM   7746  O  O   . LEU F  1 134 ? -25.200  -10.416  -16.818 1.00 2.41  ? 134 LEU F O   1 
ATOM   7747  C  CB  . LEU F  1 134 ? -26.504  -11.710  -19.531 1.00 2.50  ? 134 LEU F CB  1 
ATOM   7748  C  CG  . LEU F  1 134 ? -26.082  -12.786  -20.541 1.00 2.39  ? 134 LEU F CG  1 
ATOM   7749  C  CD1 . LEU F  1 134 ? -25.484  -13.997  -19.943 1.00 2.00  ? 134 LEU F CD1 1 
ATOM   7750  C  CD2 . LEU F  1 134 ? -27.187  -13.123  -21.511 1.00 2.00  ? 134 LEU F CD2 1 
ATOM   7751  N  N   . GLU F  1 135 ? -27.202  -9.593   -17.407 1.00 2.82  ? 135 GLU F N   1 
ATOM   7752  C  CA  . GLU F  1 135 ? -26.934  -8.292   -16.783 1.00 3.40  ? 135 GLU F CA  1 
ATOM   7753  C  C   . GLU F  1 135 ? -26.662  -8.457   -15.280 1.00 3.59  ? 135 GLU F C   1 
ATOM   7754  O  O   . GLU F  1 135 ? -25.717  -7.874   -14.724 1.00 3.97  ? 135 GLU F O   1 
ATOM   7755  C  CB  . GLU F  1 135 ? -28.085  -7.336   -16.995 1.00 2.46  ? 135 GLU F CB  1 
ATOM   7756  C  CG  . GLU F  1 135 ? -28.192  -6.807   -18.397 1.00 3.74  ? 135 GLU F CG  1 
ATOM   7757  C  CD  . GLU F  1 135 ? -29.478  -5.935   -18.637 1.00 5.15  ? 135 GLU F CD  1 
ATOM   7758  O  OE1 . GLU F  1 135 ? -30.460  -5.989   -17.823 1.00 4.25  ? 135 GLU F OE1 1 
ATOM   7759  O  OE2 . GLU F  1 135 ? -29.469  -5.197   -19.669 1.00 6.60  ? 135 GLU F OE2 1 
ATOM   7760  N  N   . THR F  1 136 ? -27.486  -9.268   -14.638 1.00 2.92  ? 136 THR F N   1 
ATOM   7761  C  CA  . THR F  1 136 ? -27.319  -9.498   -13.225 1.00 2.76  ? 136 THR F CA  1 
ATOM   7762  C  C   . THR F  1 136 ? -25.969  -10.144  -12.890 1.00 2.76  ? 136 THR F C   1 
ATOM   7763  O  O   . THR F  1 136 ? -25.283  -9.670   -11.989 1.00 3.18  ? 136 THR F O   1 
ATOM   7764  C  CB  . THR F  1 136 ? -28.463  -10.327  -12.716 1.00 2.96  ? 136 THR F CB  1 
ATOM   7765  O  OG1 . THR F  1 136 ? -29.661  -9.753   -13.227 1.00 2.64  ? 136 THR F OG1 1 
ATOM   7766  C  CG2 . THR F  1 136 ? -28.492  -10.323  -11.192 1.00 2.30  ? 136 THR F CG2 1 
ATOM   7767  N  N   . GLU F  1 137 ? -25.587  -11.194  -13.616 1.00 2.16  ? 137 GLU F N   1 
ATOM   7768  C  CA  . GLU F  1 137 ? -24.292  -11.803  -13.426 1.00 2.37  ? 137 GLU F CA  1 
ATOM   7769  C  C   . GLU F  1 137 ? -23.173  -10.773  -13.604 1.00 2.45  ? 137 GLU F C   1 
ATOM   7770  O  O   . GLU F  1 137 ? -22.310  -10.648  -12.756 1.00 3.19  ? 137 GLU F O   1 
ATOM   7771  C  CB  . GLU F  1 137 ? -24.072  -12.961  -14.384 1.00 2.45  ? 137 GLU F CB  1 
ATOM   7772  C  CG  . GLU F  1 137 ? -24.981  -14.176  -14.167 1.00 4.79  ? 137 GLU F CG  1 
ATOM   7773  C  CD  . GLU F  1 137 ? -24.993  -14.678  -12.719 1.00 7.99  ? 137 GLU F CD  1 
ATOM   7774  O  OE1 . GLU F  1 137 ? -26.055  -14.572  -12.063 1.00 8.91  ? 137 GLU F OE1 1 
ATOM   7775  O  OE2 . GLU F  1 137 ? -23.939  -15.158  -12.242 1.00 9.34  ? 137 GLU F OE2 1 
ATOM   7776  N  N   . LEU F  1 138 ? -23.182  -10.012  -14.684 1.00 2.31  ? 138 LEU F N   1 
ATOM   7777  C  CA  . LEU F  1 138 ? -22.135  -9.048   -14.883 1.00 2.82  ? 138 LEU F CA  1 
ATOM   7778  C  C   . LEU F  1 138 ? -22.051  -8.029   -13.746 1.00 3.79  ? 138 LEU F C   1 
ATOM   7779  O  O   . LEU F  1 138 ? -20.950  -7.620   -13.378 1.00 4.49  ? 138 LEU F O   1 
ATOM   7780  C  CB  . LEU F  1 138 ? -22.325  -8.332   -16.215 1.00 2.55  ? 138 LEU F CB  1 
ATOM   7781  C  CG  . LEU F  1 138 ? -22.070  -9.203   -17.430 1.00 2.97  ? 138 LEU F CG  1 
ATOM   7782  C  CD1 . LEU F  1 138 ? -22.527  -8.444   -18.623 1.00 3.72  ? 138 LEU F CD1 1 
ATOM   7783  C  CD2 . LEU F  1 138 ? -20.601  -9.564   -17.562 1.00 2.80  ? 138 LEU F CD2 1 
ATOM   7784  N  N   . ASP F  1 139 ? -23.188  -7.602   -13.193 1.00 3.97  ? 139 ASP F N   1 
ATOM   7785  C  CA  . ASP F  1 139 ? -23.161  -6.684   -12.073 1.00 4.62  ? 139 ASP F CA  1 
ATOM   7786  C  C   . ASP F  1 139 ? -22.667  -7.378   -10.804 1.00 4.40  ? 139 ASP F C   1 
ATOM   7787  O  O   . ASP F  1 139 ? -21.980  -6.765   -9.990  1.00 4.48  ? 139 ASP F O   1 
ATOM   7788  C  CB  . ASP F  1 139 ? -24.527  -6.065   -11.803 1.00 5.24  ? 139 ASP F CB  1 
ATOM   7789  C  CG  . ASP F  1 139 ? -24.953  -5.022   -12.855 1.00 8.74  ? 139 ASP F CG  1 
ATOM   7790  O  OD1 . ASP F  1 139 ? -24.148  -4.586   -13.727 1.00 10.92 ? 139 ASP F OD1 1 
ATOM   7791  O  OD2 . ASP F  1 139 ? -26.144  -4.626   -12.792 1.00 11.23 ? 139 ASP F OD2 1 
ATOM   7792  N  N   . LEU F  1 140 ? -23.004  -8.642   -10.627 1.00 3.83  ? 140 LEU F N   1 
ATOM   7793  C  CA  . LEU F  1 140 ? -22.512  -9.363   -9.458  1.00 4.27  ? 140 LEU F CA  1 
ATOM   7794  C  C   . LEU F  1 140 ? -21.007  -9.444   -9.465  1.00 4.77  ? 140 LEU F C   1 
ATOM   7795  O  O   . LEU F  1 140 ? -20.400  -9.317   -8.405  1.00 5.74  ? 140 LEU F O   1 
ATOM   7796  C  CB  . LEU F  1 140 ? -23.095  -10.780  -9.348  1.00 3.91  ? 140 LEU F CB  1 
ATOM   7797  C  CG  . LEU F  1 140 ? -24.557  -10.858  -8.881  1.00 3.77  ? 140 LEU F CG  1 
ATOM   7798  C  CD1 . LEU F  1 140 ? -25.111  -12.277  -9.064  1.00 2.00  ? 140 LEU F CD1 1 
ATOM   7799  C  CD2 . LEU F  1 140 ? -24.711  -10.361  -7.438  1.00 2.00  ? 140 LEU F CD2 1 
ATOM   7800  N  N   . ILE F  1 141 ? -20.409  -9.639   -10.648 1.00 4.71  ? 141 ILE F N   1 
ATOM   7801  C  CA  . ILE F  1 141 ? -18.968  -9.717   -10.756 1.00 4.69  ? 141 ILE F CA  1 
ATOM   7802  C  C   . ILE F  1 141 ? -18.319  -8.429   -10.223 1.00 6.35  ? 141 ILE F C   1 
ATOM   7803  O  O   . ILE F  1 141 ? -17.329  -8.491   -9.499  1.00 7.35  ? 141 ILE F O   1 
ATOM   7804  C  CB  . ILE F  1 141 ? -18.501  -9.983   -12.187 1.00 4.85  ? 141 ILE F CB  1 
ATOM   7805  C  CG1 . ILE F  1 141 ? -18.942  -11.370  -12.683 1.00 4.03  ? 141 ILE F CG1 1 
ATOM   7806  C  CG2 . ILE F  1 141 ? -16.973  -9.799   -12.301 1.00 3.51  ? 141 ILE F CG2 1 
ATOM   7807  C  CD1 . ILE F  1 141 ? -18.599  -11.602  -14.171 1.00 3.36  ? 141 ILE F CD1 1 
ATOM   7808  N  N   . GLN F  1 142 ? -18.870  -7.265   -10.563 1.00 7.39  ? 142 GLN F N   1 
ATOM   7809  C  CA  . GLN F  1 142 ? -18.323  -6.004   -10.061 1.00 8.51  ? 142 GLN F CA  1 
ATOM   7810  C  C   . GLN F  1 142 ? -18.602  -5.838   -8.580  1.00 8.12  ? 142 GLN F C   1 
ATOM   7811  O  O   . GLN F  1 142 ? -17.752  -5.326   -7.846  1.00 8.42  ? 142 GLN F O   1 
ATOM   7812  C  CB  . GLN F  1 142 ? -18.842  -4.761   -10.836 1.00 9.09  ? 142 GLN F CB  1 
ATOM   7813  C  CG  . GLN F  1 142 ? -18.525  -4.769   -12.353 1.00 13.46 ? 142 GLN F CG  1 
ATOM   7814  C  CD  . GLN F  1 142 ? -16.991  -4.797   -12.691 1.00 19.47 ? 142 GLN F CD  1 
ATOM   7815  O  OE1 . GLN F  1 142 ? -16.265  -3.784   -12.504 1.00 19.85 ? 142 GLN F OE1 1 
ATOM   7816  N  NE2 . GLN F  1 142 ? -16.511  -5.955   -13.205 1.00 18.91 ? 142 GLN F NE2 1 
ATOM   7817  N  N   . LYS F  1 143 ? -19.779  -6.249   -8.125  1.00 7.61  ? 143 LYS F N   1 
ATOM   7818  C  CA  . LYS F  1 143 ? -20.160  -5.931   -6.750  1.00 7.75  ? 143 LYS F CA  1 
ATOM   7819  C  C   . LYS F  1 143 ? -19.406  -6.791   -5.746  1.00 7.75  ? 143 LYS F C   1 
ATOM   7820  O  O   . LYS F  1 143 ? -18.973  -6.278   -4.707  1.00 8.49  ? 143 LYS F O   1 
ATOM   7821  C  CB  . LYS F  1 143 ? -21.666  -6.039   -6.514  1.00 7.67  ? 143 LYS F CB  1 
ATOM   7822  C  CG  . LYS F  1 143 ? -22.499  -5.038   -7.300  1.00 9.63  ? 143 LYS F CG  1 
ATOM   7823  C  CD  . LYS F  1 143 ? -23.929  -4.947   -6.728  1.00 13.35 ? 143 LYS F CD  1 
ATOM   7824  C  CE  . LYS F  1 143 ? -24.927  -4.255   -7.675  1.00 13.02 ? 143 LYS F CE  1 
ATOM   7825  N  NZ  . LYS F  1 143 ? -25.748  -5.401   -8.125  1.00 16.85 ? 143 LYS F NZ  1 
ATOM   7826  N  N   . MET F  1 144 ? -19.216  -8.076   -6.056  1.00 7.13  ? 144 MET F N   1 
ATOM   7827  C  CA  . MET F  1 144 ? -18.556  -8.980   -5.106  1.00 6.80  ? 144 MET F CA  1 
ATOM   7828  C  C   . MET F  1 144 ? -17.091  -9.255   -5.436  1.00 5.68  ? 144 MET F C   1 
ATOM   7829  O  O   . MET F  1 144 ? -16.367  -9.835   -4.601  1.00 5.42  ? 144 MET F O   1 
ATOM   7830  C  CB  . MET F  1 144 ? -19.348  -10.276  -4.906  1.00 6.22  ? 144 MET F CB  1 
ATOM   7831  C  CG  . MET F  1 144 ? -19.183  -11.272  -5.994  1.00 6.64  ? 144 MET F CG  1 
ATOM   7832  S  SD  . MET F  1 144 ? -20.216  -12.767  -5.754  1.00 10.19 ? 144 MET F SD  1 
ATOM   7833  C  CE  . MET F  1 144 ? -21.818  -12.025  -5.839  1.00 10.32 ? 144 MET F CE  1 
ATOM   7834  N  N   . GLY F  1 145 ? -16.662  -8.813   -6.627  1.00 4.50  ? 145 GLY F N   1 
ATOM   7835  C  CA  . GLY F  1 145 ? -15.295  -9.018   -7.129  1.00 3.25  ? 145 GLY F CA  1 
ATOM   7836  C  C   . GLY F  1 145 ? -15.151  -10.337  -7.868  1.00 3.26  ? 145 GLY F C   1 
ATOM   7837  O  O   . GLY F  1 145 ? -15.933  -11.266  -7.657  1.00 3.35  ? 145 GLY F O   1 
ATOM   7838  N  N   . LEU F  1 146 ? -14.162  -10.446  -8.743  1.00 3.09  ? 146 LEU F N   1 
ATOM   7839  C  CA  . LEU F  1 146 ? -14.052  -11.639  -9.571  1.00 2.63  ? 146 LEU F CA  1 
ATOM   7840  C  C   . LEU F  1 146 ? -13.757  -12.938  -8.782  1.00 2.78  ? 146 LEU F C   1 
ATOM   7841  O  O   . LEU F  1 146 ? -14.403  -13.958  -9.014  1.00 3.10  ? 146 LEU F O   1 
ATOM   7842  C  CB  . LEU F  1 146 ? -13.036  -11.408  -10.691 1.00 3.02  ? 146 LEU F CB  1 
ATOM   7843  C  CG  . LEU F  1 146 ? -12.824  -12.549  -11.692 1.00 3.63  ? 146 LEU F CG  1 
ATOM   7844  C  CD1 . LEU F  1 146 ? -14.153  -12.963  -12.352 1.00 2.06  ? 146 LEU F CD1 1 
ATOM   7845  C  CD2 . LEU F  1 146 ? -11.734  -12.210  -12.707 1.00 2.01  ? 146 LEU F CD2 1 
ATOM   7846  N  N   . GLN F  1 147 ? -12.806  -12.905  -7.853  1.00 2.74  ? 147 GLN F N   1 
ATOM   7847  C  CA  . GLN F  1 147 ? -12.483  -14.065  -7.044  1.00 2.48  ? 147 GLN F CA  1 
ATOM   7848  C  C   . GLN F  1 147 ? -13.704  -14.632  -6.325  1.00 2.80  ? 147 GLN F C   1 
ATOM   7849  O  O   . GLN F  1 147 ? -13.991  -15.815  -6.467  1.00 3.33  ? 147 GLN F O   1 
ATOM   7850  C  CB  . GLN F  1 147 ? -11.356  -13.759  -6.072  1.00 2.26  ? 147 GLN F CB  1 
ATOM   7851  C  CG  . GLN F  1 147 ? -10.058  -13.421  -6.782  1.00 2.03  ? 147 GLN F CG  1 
ATOM   7852  C  CD  . GLN F  1 147 ? -8.861   -13.357  -5.847  1.00 2.84  ? 147 GLN F CD  1 
ATOM   7853  O  OE1 . GLN F  1 147 ? -8.948   -12.826  -4.741  1.00 3.62  ? 147 GLN F OE1 1 
ATOM   7854  N  NE2 . GLN F  1 147 ? -7.740   -13.910  -6.288  1.00 2.21  ? 147 GLN F NE2 1 
ATOM   7855  N  N   . ASN F  1 148 ? -14.441  -13.808  -5.591  1.00 3.14  ? 148 ASN F N   1 
ATOM   7856  C  CA  . ASN F  1 148 ? -15.660  -14.261  -4.946  1.00 3.74  ? 148 ASN F CA  1 
ATOM   7857  C  C   . ASN F  1 148 ? -16.719  -14.741  -5.928  1.00 4.44  ? 148 ASN F C   1 
ATOM   7858  O  O   . ASN F  1 148 ? -17.472  -15.678  -5.646  1.00 5.32  ? 148 ASN F O   1 
ATOM   7859  C  CB  . ASN F  1 148 ? -16.273  -13.159  -4.101  1.00 3.90  ? 148 ASN F CB  1 
ATOM   7860  C  CG  . ASN F  1 148 ? -15.674  -13.055  -2.722  1.00 3.64  ? 148 ASN F CG  1 
ATOM   7861  O  OD1 . ASN F  1 148 ? -16.033  -12.158  -1.984  1.00 5.76  ? 148 ASN F OD1 1 
ATOM   7862  N  ND2 . ASN F  1 148 ? -14.776  -13.939  -2.370  1.00 3.48  ? 148 ASN F ND2 1 
ATOM   7863  N  N   . TYR F  1 149 ? -16.796  -14.117  -7.078  1.00 4.19  ? 149 TYR F N   1 
ATOM   7864  C  CA  . TYR F  1 149 ? -17.782  -14.543  -8.027  1.00 4.69  ? 149 TYR F CA  1 
ATOM   7865  C  C   . TYR F  1 149 ? -17.483  -15.958  -8.528  1.00 4.80  ? 149 TYR F C   1 
ATOM   7866  O  O   . TYR F  1 149 ? -18.384  -16.792  -8.654  1.00 4.36  ? 149 TYR F O   1 
ATOM   7867  C  CB  . TYR F  1 149 ? -17.833  -13.583  -9.202  1.00 5.01  ? 149 TYR F CB  1 
ATOM   7868  C  CG  . TYR F  1 149 ? -18.816  -13.986  -10.241 1.00 5.16  ? 149 TYR F CG  1 
ATOM   7869  C  CD1 . TYR F  1 149 ? -20.160  -13.689  -10.084 1.00 4.34  ? 149 TYR F CD1 1 
ATOM   7870  C  CD2 . TYR F  1 149 ? -18.407  -14.703  -11.385 1.00 5.91  ? 149 TYR F CD2 1 
ATOM   7871  C  CE1 . TYR F  1 149 ? -21.109  -14.076  -11.073 1.00 6.75  ? 149 TYR F CE1 1 
ATOM   7872  C  CE2 . TYR F  1 149 ? -19.339  -15.086  -12.391 1.00 5.67  ? 149 TYR F CE2 1 
ATOM   7873  C  CZ  . TYR F  1 149 ? -20.680  -14.761  -12.230 1.00 5.98  ? 149 TYR F CZ  1 
ATOM   7874  O  OH  . TYR F  1 149 ? -21.603  -15.132  -13.181 1.00 5.22  ? 149 TYR F OH  1 
ATOM   7875  N  N   . LEU F  1 150 ? -16.211  -16.215  -8.825  1.00 5.15  ? 150 LEU F N   1 
ATOM   7876  C  CA  . LEU F  1 150 ? -15.801  -17.519  -9.303  1.00 4.79  ? 150 LEU F CA  1 
ATOM   7877  C  C   . LEU F  1 150 ? -16.073  -18.541  -8.242  1.00 5.06  ? 150 LEU F C   1 
ATOM   7878  O  O   . LEU F  1 150 ? -16.640  -19.584  -8.551  1.00 6.03  ? 150 LEU F O   1 
ATOM   7879  C  CB  . LEU F  1 150 ? -14.347  -17.538  -9.693  1.00 4.40  ? 150 LEU F CB  1 
ATOM   7880  C  CG  . LEU F  1 150 ? -13.878  -17.339  -11.134 1.00 4.63  ? 150 LEU F CG  1 
ATOM   7881  C  CD1 . LEU F  1 150 ? -14.894  -16.812  -12.107 1.00 5.75  ? 150 LEU F CD1 1 
ATOM   7882  C  CD2 . LEU F  1 150 ? -12.655  -16.477  -11.114 1.00 4.20  ? 150 LEU F CD2 1 
ATOM   7883  N  N   . GLN F  1 151 ? -15.716  -18.264  -6.991  1.00 4.92  ? 151 GLN F N   1 
ATOM   7884  C  CA  . GLN F  1 151 ? -15.937  -19.289  -5.938  1.00 4.78  ? 151 GLN F CA  1 
ATOM   7885  C  C   . GLN F  1 151 ? -17.427  -19.687  -5.886  1.00 4.76  ? 151 GLN F C   1 
ATOM   7886  O  O   . GLN F  1 151 ? -17.792  -20.830  -5.654  1.00 4.98  ? 151 GLN F O   1 
ATOM   7887  C  CB  . GLN F  1 151 ? -15.435  -18.797  -4.578  1.00 4.43  ? 151 GLN F CB  1 
ATOM   7888  C  CG  . GLN F  1 151 ? -15.782  -19.692  -3.412  1.00 4.13  ? 151 GLN F CG  1 
ATOM   7889  C  CD  . GLN F  1 151 ? -15.696  -18.953  -2.114  1.00 4.83  ? 151 GLN F CD  1 
ATOM   7890  O  OE1 . GLN F  1 151 ? -15.571  -17.755  -2.097  1.00 8.38  ? 151 GLN F OE1 1 
ATOM   7891  N  NE2 . GLN F  1 151 ? -15.748  -19.660  -1.020  1.00 7.27  ? 151 GLN F NE2 1 
ATOM   7892  N  N   . ALA F  1 152 ? -18.282  -18.723  -6.148  1.00 4.80  ? 152 ALA F N   1 
ATOM   7893  C  CA  . ALA F  1 152 ? -19.700  -18.947  -6.077  1.00 4.78  ? 152 ALA F CA  1 
ATOM   7894  C  C   . ALA F  1 152 ? -20.224  -19.785  -7.241  1.00 5.30  ? 152 ALA F C   1 
ATOM   7895  O  O   . ALA F  1 152 ? -21.404  -20.146  -7.222  1.00 6.02  ? 152 ALA F O   1 
ATOM   7896  C  CB  . ALA F  1 152 ? -20.408  -17.643  -6.022  1.00 4.77  ? 152 ALA F CB  1 
ATOM   7897  N  N   . GLN F  1 153 ? -19.380  -20.108  -8.236  1.00 5.08  ? 153 GLN F N   1 
ATOM   7898  C  CA  . GLN F  1 153 ? -19.823  -20.903  -9.401  1.00 5.35  ? 153 GLN F CA  1 
ATOM   7899  C  C   . GLN F  1 153 ? -19.396  -22.363  -9.329  1.00 5.84  ? 153 GLN F C   1 
ATOM   7900  O  O   . GLN F  1 153 ? -19.731  -23.157  -10.202 1.00 5.76  ? 153 GLN F O   1 
ATOM   7901  C  CB  . GLN F  1 153 ? -19.279  -20.326  -10.726 1.00 5.11  ? 153 GLN F CB  1 
ATOM   7902  C  CG  . GLN F  1 153 ? -19.488  -18.871  -10.945 1.00 5.25  ? 153 GLN F CG  1 
ATOM   7903  C  CD  . GLN F  1 153 ? -20.893  -18.393  -10.595 1.00 6.72  ? 153 GLN F CD  1 
ATOM   7904  O  OE1 . GLN F  1 153 ? -21.908  -19.062  -10.877 1.00 6.56  ? 153 GLN F OE1 1 
ATOM   7905  N  NE2 . GLN F  1 153 ? -20.956  -17.217  -9.964  1.00 7.58  ? 153 GLN F NE2 1 
ATOM   7906  N  N   . ILE F  1 154 ? -18.629  -22.703  -8.313  1.00 6.72  ? 154 ILE F N   1 
ATOM   7907  C  CA  . ILE F  1 154 ? -17.998  -23.997  -8.223  1.00 8.53  ? 154 ILE F CA  1 
ATOM   7908  C  C   . ILE F  1 154 ? -18.989  -25.133  -7.982  1.00 9.67  ? 154 ILE F C   1 
ATOM   7909  O  O   . ILE F  1 154 ? -18.771  -26.243  -8.437  1.00 10.62 ? 154 ILE F O   1 
ATOM   7910  C  CB  . ILE F  1 154 ? -17.008  -23.997  -7.066  1.00 8.69  ? 154 ILE F CB  1 
ATOM   7911  C  CG1 . ILE F  1 154 ? -15.664  -23.457  -7.497  1.00 9.47  ? 154 ILE F CG1 1 
ATOM   7912  C  CG2 . ILE F  1 154 ? -16.781  -25.392  -6.496  1.00 9.43  ? 154 ILE F CG2 1 
ATOM   7913  C  CD1 . ILE F  1 154 ? -14.721  -23.491  -6.258  1.00 11.54 ? 154 ILE F CD1 1 
ATOM   7914  N  N   A ARG F  1 155 ? -20.067  -24.846  -7.261  0.70 10.39 ? 155 ARG F N   1 
ATOM   7915  N  N   B ARG F  1 155 ? -20.061  -24.889  -7.249  0.30 10.33 ? 155 ARG F N   1 
ATOM   7916  C  CA  A ARG F  1 155 ? -21.084  -25.857  -6.942  0.70 11.67 ? 155 ARG F CA  1 
ATOM   7917  C  CA  B ARG F  1 155 ? -21.044  -25.957  -7.090  0.30 11.34 ? 155 ARG F CA  1 
ATOM   7918  C  C   A ARG F  1 155 ? -22.396  -25.581  -7.685  0.70 12.69 ? 155 ARG F C   1 
ATOM   7919  C  C   B ARG F  1 155 ? -22.377  -25.601  -7.695  0.30 12.34 ? 155 ARG F C   1 
ATOM   7920  O  O   A ARG F  1 155 ? -22.795  -24.413  -7.850  0.70 13.31 ? 155 ARG F O   1 
ATOM   7921  O  O   B ARG F  1 155 ? -22.777  -24.429  -7.731  0.30 12.65 ? 155 ARG F O   1 
ATOM   7922  C  CB  A ARG F  1 155 ? -21.307  -25.872  -5.434  0.70 11.21 ? 155 ARG F CB  1 
ATOM   7923  C  CB  B ARG F  1 155 ? -21.206  -26.382  -5.639  0.30 11.14 ? 155 ARG F CB  1 
ATOM   7924  C  CG  A ARG F  1 155 ? -20.011  -26.203  -4.614  0.70 11.76 ? 155 ARG F CG  1 
ATOM   7925  C  CG  B ARG F  1 155 ? -21.034  -25.271  -4.629  0.30 11.36 ? 155 ARG F CG  1 
ATOM   7926  C  CD  A ARG F  1 155 ? -20.225  -25.916  -3.119  0.70 12.71 ? 155 ARG F CD  1 
ATOM   7927  C  CD  B ARG F  1 155 ? -21.426  -25.765  -3.250  0.30 12.14 ? 155 ARG F CD  1 
ATOM   7928  N  NE  A ARG F  1 155 ? -19.162  -26.412  -2.228  0.70 14.27 ? 155 ARG F NE  1 
ATOM   7929  N  NE  B ARG F  1 155 ? -22.875  -25.766  -3.082  0.30 13.24 ? 155 ARG F NE  1 
ATOM   7930  C  CZ  A ARG F  1 155 ? -19.231  -27.550  -1.516  0.70 14.74 ? 155 ARG F CZ  1 
ATOM   7931  C  CZ  B ARG F  1 155 ? -23.521  -26.324  -2.063  0.30 13.42 ? 155 ARG F CZ  1 
ATOM   7932  N  NH1 A ARG F  1 155 ? -20.296  -28.361  -1.589  0.70 13.79 ? 155 ARG F NH1 1 
ATOM   7933  N  NH1 B ARG F  1 155 ? -22.850  -26.938  -1.094  0.30 13.11 ? 155 ARG F NH1 1 
ATOM   7934  N  NH2 A ARG F  1 155 ? -18.213  -27.894  -0.730  0.70 13.91 ? 155 ARG F NH2 1 
ATOM   7935  N  NH2 B ARG F  1 155 ? -24.843  -26.259  -2.011  0.30 12.58 ? 155 ARG F NH2 1 
ATOM   7936  N  N   . GLU F  1 156 ? -23.063  -26.623  -8.182  1.00 13.55 ? 156 GLU F N   1 
ATOM   7937  C  CA  . GLU F  1 156 ? -24.306  -26.398  -8.936  1.00 14.98 ? 156 GLU F CA  1 
ATOM   7938  C  C   . GLU F  1 156 ? -25.430  -26.033  -7.999  1.00 16.87 ? 156 GLU F C   1 
ATOM   7939  O  O   . GLU F  1 156 ? -25.455  -26.483  -6.834  1.00 17.53 ? 156 GLU F O   1 
ATOM   7940  C  CB  . GLU F  1 156 ? -24.670  -27.584  -9.801  1.00 14.57 ? 156 GLU F CB  1 
ATOM   7941  C  CG  . GLU F  1 156 ? -24.427  -28.925  -9.206  1.00 16.06 ? 156 GLU F CG  1 
ATOM   7942  C  CD  . GLU F  1 156 ? -24.300  -29.966  -10.313 1.00 21.03 ? 156 GLU F CD  1 
ATOM   7943  O  OE1 . GLU F  1 156 ? -24.216  -29.534  -11.499 1.00 20.97 ? 156 GLU F OE1 1 
ATOM   7944  O  OE2 . GLU F  1 156 ? -24.269  -31.199  -10.003 1.00 23.08 ? 156 GLU F OE2 1 
ATOM   7945  N  N   . GLU F  1 157 ? -26.342  -25.188  -8.476  1.00 18.93 ? 157 GLU F N   1 
ATOM   7946  C  CA  . GLU F  1 157 ? -27.476  -24.762  -7.609  1.00 20.31 ? 157 GLU F CA  1 
ATOM   7947  C  C   . GLU F  1 157 ? -28.599  -25.822  -7.641  1.00 20.72 ? 157 GLU F C   1 
ATOM   7948  O  O   . GLU F  1 157 ? -29.076  -26.195  -8.732  1.00 20.43 ? 157 GLU F O   1 
ATOM   7949  C  CB  . GLU F  1 157 ? -28.006  -23.325  -7.909  1.00 19.90 ? 157 GLU F CB  1 
ATOM   7950  C  CG  . GLU F  1 157 ? -28.571  -22.637  -6.591  1.00 20.91 ? 157 GLU F CG  1 
ATOM   7951  C  CD  . GLU F  1 157 ? -29.536  -21.443  -6.839  1.00 21.10 ? 157 GLU F CD  1 
ATOM   7952  O  OE1 . GLU F  1 157 ? -29.366  -20.727  -7.877  1.00 20.44 ? 157 GLU F OE1 1 
ATOM   7953  O  OE2 . GLU F  1 157 ? -30.435  -21.239  -5.962  1.00 20.11 ? 157 GLU F OE2 1 
ATOM   7954  N  N   . GLY F  1 158 ? -28.957  -26.331  -6.448  1.00 21.41 ? 158 GLY F N   1 
ATOM   7955  C  CA  . GLY F  1 158 ? -30.039  -27.337  -6.294  1.00 21.82 ? 158 GLY F CA  1 
ATOM   7956  C  C   . GLY F  1 158 ? -31.433  -26.758  -6.575  1.00 21.63 ? 158 GLY F C   1 
ATOM   7957  N  N   . MET G  1 1   ? -51.293  -23.303  46.156  1.00 7.47  ? 1   MET G N   1 
ATOM   7958  C  CA  . MET G  1 1   ? -50.668  -21.983  46.455  1.00 8.45  ? 1   MET G CA  1 
ATOM   7959  C  C   . MET G  1 1   ? -51.758  -21.034  46.937  1.00 8.23  ? 1   MET G C   1 
ATOM   7960  O  O   . MET G  1 1   ? -52.749  -20.901  46.257  1.00 8.26  ? 1   MET G O   1 
ATOM   7961  C  CB  . MET G  1 1   ? -50.053  -21.471  45.172  1.00 7.81  ? 1   MET G CB  1 
ATOM   7962  C  CG  . MET G  1 1   ? -49.015  -20.413  45.300  1.00 7.88  ? 1   MET G CG  1 
ATOM   7963  S  SD  . MET G  1 1   ? -48.492  -20.151  43.589  1.00 10.89 ? 1   MET G SD  1 
ATOM   7964  C  CE  . MET G  1 1   ? -49.742  -18.980  42.977  1.00 5.74  ? 1   MET G CE  1 
ATOM   7965  N  N   . LYS G  1 2   ? -51.615  -20.402  48.103  1.00 9.06  ? 2   LYS G N   1 
ATOM   7966  C  CA  . LYS G  1 2   ? -52.712  -19.552  48.636  1.00 10.61 ? 2   LYS G CA  1 
ATOM   7967  C  C   . LYS G  1 2   ? -52.839  -18.291  47.801  1.00 9.27  ? 2   LYS G C   1 
ATOM   7968  O  O   . LYS G  1 2   ? -51.915  -17.476  47.789  1.00 9.82  ? 2   LYS G O   1 
ATOM   7969  C  CB  . LYS G  1 2   ? -52.452  -19.142  50.089  1.00 10.58 ? 2   LYS G CB  1 
ATOM   7970  C  CG  . LYS G  1 2   ? -53.603  -19.479  51.055  1.00 14.43 ? 2   LYS G CG  1 
ATOM   7971  C  CD  . LYS G  1 2   ? -53.766  -18.461  52.241  1.00 15.08 ? 2   LYS G CD  1 
ATOM   7972  C  CE  . LYS G  1 2   ? -54.455  -17.139  51.766  1.00 19.16 ? 2   LYS G CE  1 
ATOM   7973  N  NZ  . LYS G  1 2   ? -55.098  -16.379  52.899  1.00 19.87 ? 2   LYS G NZ  1 
ATOM   7974  N  N   . GLY G  1 3   ? -53.957  -18.121  47.096  1.00 8.17  ? 3   GLY G N   1 
ATOM   7975  C  CA  . GLY G  1 3   ? -54.146  -16.950  46.247  1.00 6.88  ? 3   GLY G CA  1 
ATOM   7976  C  C   . GLY G  1 3   ? -54.664  -15.735  46.978  1.00 6.21  ? 3   GLY G C   1 
ATOM   7977  O  O   . GLY G  1 3   ? -54.985  -15.811  48.136  1.00 6.55  ? 3   GLY G O   1 
ATOM   7978  N  N   . ASP G  1 4   ? -54.757  -14.609  46.286  1.00 5.89  ? 4   ASP G N   1 
ATOM   7979  C  CA  . ASP G  1 4   ? -55.386  -13.414  46.841  1.00 5.73  ? 4   ASP G CA  1 
ATOM   7980  C  C   . ASP G  1 4   ? -56.885  -13.659  46.949  1.00 5.82  ? 4   ASP G C   1 
ATOM   7981  O  O   . ASP G  1 4   ? -57.492  -14.130  45.998  1.00 6.63  ? 4   ASP G O   1 
ATOM   7982  C  CB  . ASP G  1 4   ? -55.055  -12.212  45.963  1.00 5.44  ? 4   ASP G CB  1 
ATOM   7983  C  CG  . ASP G  1 4   ? -55.787  -10.977  46.361  1.00 6.93  ? 4   ASP G CG  1 
ATOM   7984  O  OD1 . ASP G  1 4   ? -56.924  -10.761  45.844  1.00 9.29  ? 4   ASP G OD1 1 
ATOM   7985  O  OD2 . ASP G  1 4   ? -55.221  -10.190  47.153  1.00 6.96  ? 4   ASP G OD2 1 
ATOM   7986  N  N   . THR G  1 5   ? -57.461  -13.380  48.115  1.00 5.72  ? 5   THR G N   1 
ATOM   7987  C  CA  . THR G  1 5   ? -58.885  -13.616  48.377  1.00 5.85  ? 5   THR G CA  1 
ATOM   7988  C  C   . THR G  1 5   ? -59.824  -12.920  47.378  1.00 5.64  ? 5   THR G C   1 
ATOM   7989  O  O   . THR G  1 5   ? -60.830  -13.507  46.905  1.00 5.72  ? 5   THR G O   1 
ATOM   7990  C  CB  . THR G  1 5   ? -59.270  -13.152  49.804  1.00 6.01  ? 5   THR G CB  1 
ATOM   7991  O  OG1 . THR G  1 5   ? -58.526  -13.925  50.731  1.00 7.12  ? 5   THR G OG1 1 
ATOM   7992  C  CG2 . THR G  1 5   ? -60.766  -13.379  50.118  1.00 5.33  ? 5   THR G CG2 1 
ATOM   7993  N  N   . LYS G  1 6   ? -59.514  -11.661  47.085  1.00 5.13  ? 6   LYS G N   1 
ATOM   7994  C  CA  . LYS G  1 6   ? -60.367  -10.870  46.225  1.00 4.74  ? 6   LYS G CA  1 
ATOM   7995  C  C   . LYS G  1 6   ? -60.271  -11.422  44.793  1.00 4.70  ? 6   LYS G C   1 
ATOM   7996  O  O   . LYS G  1 6   ? -61.279  -11.425  44.074  1.00 4.96  ? 6   LYS G O   1 
ATOM   7997  C  CB  . LYS G  1 6   ? -60.015  -9.385   46.337  1.00 4.15  ? 6   LYS G CB  1 
ATOM   7998  C  CG  . LYS G  1 6   ? -60.814  -8.521   45.446  1.00 6.51  ? 6   LYS G CG  1 
ATOM   7999  C  CD  . LYS G  1 6   ? -61.153  -7.140   46.022  1.00 9.50  ? 6   LYS G CD  1 
ATOM   8000  C  CE  . LYS G  1 6   ? -62.706  -6.897   45.904  1.00 13.23 ? 6   LYS G CE  1 
ATOM   8001  N  NZ  . LYS G  1 6   ? -63.104  -5.788   44.977  1.00 17.01 ? 6   LYS G NZ  1 
ATOM   8002  N  N   . VAL G  1 7   ? -59.089  -11.908  44.377  1.00 3.66  ? 7   VAL G N   1 
ATOM   8003  C  CA  . VAL G  1 7   ? -58.989  -12.574  43.070  1.00 3.12  ? 7   VAL G CA  1 
ATOM   8004  C  C   . VAL G  1 7   ? -59.929  -13.792  42.998  1.00 3.18  ? 7   VAL G C   1 
ATOM   8005  O  O   . VAL G  1 7   ? -60.621  -14.031  41.979  1.00 3.05  ? 7   VAL G O   1 
ATOM   8006  C  CB  . VAL G  1 7   ? -57.561  -13.029  42.724  1.00 3.06  ? 7   VAL G CB  1 
ATOM   8007  C  CG1 . VAL G  1 7   ? -57.560  -13.951  41.501  1.00 2.00  ? 7   VAL G CG1 1 
ATOM   8008  C  CG2 . VAL G  1 7   ? -56.687  -11.841  42.446  1.00 2.48  ? 7   VAL G CG2 1 
ATOM   8009  N  N   . ILE G  1 8   ? -59.944  -14.571  44.072  1.00 2.81  ? 8   ILE G N   1 
ATOM   8010  C  CA  . ILE G  1 8   ? -60.832  -15.710  44.147  1.00 2.58  ? 8   ILE G CA  1 
ATOM   8011  C  C   . ILE G  1 8   ? -62.289  -15.253  44.069  1.00 3.37  ? 8   ILE G C   1 
ATOM   8012  O  O   . ILE G  1 8   ? -63.055  -15.890  43.357  1.00 3.29  ? 8   ILE G O   1 
ATOM   8013  C  CB  . ILE G  1 8   ? -60.556  -16.559  45.386  1.00 2.66  ? 8   ILE G CB  1 
ATOM   8014  C  CG1 . ILE G  1 8   ? -59.195  -17.235  45.258  1.00 3.42  ? 8   ILE G CG1 1 
ATOM   8015  C  CG2 . ILE G  1 8   ? -61.622  -17.616  45.555  1.00 2.62  ? 8   ILE G CG2 1 
ATOM   8016  C  CD1 . ILE G  1 8   ? -58.594  -17.721  46.574  1.00 2.69  ? 8   ILE G CD1 1 
ATOM   8017  N  N   . ASN G  1 9   ? -62.670  -14.165  44.777  1.00 3.99  ? 9   ASN G N   1 
ATOM   8018  C  CA  . ASN G  1 9   ? -64.036  -13.642  44.673  1.00 4.75  ? 9   ASN G CA  1 
ATOM   8019  C  C   . ASN G  1 9   ? -64.376  -13.298  43.212  1.00 4.42  ? 9   ASN G C   1 
ATOM   8020  O  O   . ASN G  1 9   ? -65.470  -13.611  42.713  1.00 4.80  ? 9   ASN G O   1 
ATOM   8021  C  CB  . ASN G  1 9   ? -64.288  -12.408  45.565  1.00 5.77  ? 9   ASN G CB  1 
ATOM   8022  C  CG  . ASN G  1 9   ? -64.342  -12.746  47.069  1.00 10.56 ? 9   ASN G CG  1 
ATOM   8023  O  OD1 . ASN G  1 9   ? -64.910  -13.748  47.463  1.00 19.63 ? 9   ASN G OD1 1 
ATOM   8024  N  ND2 . ASN G  1 9   ? -63.762  -11.888  47.915  1.00 12.22 ? 9   ASN G ND2 1 
ATOM   8025  N  N   . TYR G  1 10  ? -63.438  -12.661  42.524  1.00 3.60  ? 10  TYR G N   1 
ATOM   8026  C  CA  . TYR G  1 10  ? -63.648  -12.310  41.150  1.00 3.19  ? 10  TYR G CA  1 
ATOM   8027  C  C   . TYR G  1 10  ? -63.809  -13.560  40.306  1.00 3.19  ? 10  TYR G C   1 
ATOM   8028  O  O   . TYR G  1 10  ? -64.733  -13.642  39.518  1.00 3.23  ? 10  TYR G O   1 
ATOM   8029  C  CB  . TYR G  1 10  ? -62.494  -11.485  40.620  1.00 3.19  ? 10  TYR G CB  1 
ATOM   8030  C  CG  . TYR G  1 10  ? -62.658  -10.009  40.774  1.00 3.09  ? 10  TYR G CG  1 
ATOM   8031  C  CD1 . TYR G  1 10  ? -63.751  -9.355   40.216  1.00 2.00  ? 10  TYR G CD1 1 
ATOM   8032  C  CD2 . TYR G  1 10  ? -61.696  -9.263   41.452  1.00 2.34  ? 10  TYR G CD2 1 
ATOM   8033  C  CE1 . TYR G  1 10  ? -63.901  -7.990   40.336  1.00 2.64  ? 10  TYR G CE1 1 
ATOM   8034  C  CE2 . TYR G  1 10  ? -61.825  -7.894   41.576  1.00 2.16  ? 10  TYR G CE2 1 
ATOM   8035  C  CZ  . TYR G  1 10  ? -62.938  -7.262   41.022  1.00 3.91  ? 10  TYR G CZ  1 
ATOM   8036  O  OH  . TYR G  1 10  ? -63.088  -5.912   41.139  1.00 4.44  ? 10  TYR G OH  1 
ATOM   8037  N  N   . LEU G  1 11  ? -62.920  -14.533  40.489  1.00 2.64  ? 11  LEU G N   1 
ATOM   8038  C  CA  . LEU G  1 11  ? -63.000  -15.789  39.784  1.00 2.08  ? 11  LEU G CA  1 
ATOM   8039  C  C   . LEU G  1 11  ? -64.365  -16.447  39.983  1.00 2.43  ? 11  LEU G C   1 
ATOM   8040  O  O   . LEU G  1 11  ? -64.985  -16.920  39.015  1.00 2.45  ? 11  LEU G O   1 
ATOM   8041  C  CB  . LEU G  1 11  ? -61.862  -16.693  40.189  1.00 2.00  ? 11  LEU G CB  1 
ATOM   8042  C  CG  . LEU G  1 11  ? -60.607  -16.757  39.291  1.00 2.48  ? 11  LEU G CG  1 
ATOM   8043  C  CD1 . LEU G  1 11  ? -60.383  -15.530  38.434  1.00 2.12  ? 11  LEU G CD1 1 
ATOM   8044  C  CD2 . LEU G  1 11  ? -59.339  -17.146  40.053  1.00 2.00  ? 11  LEU G CD2 1 
ATOM   8045  N  N   . ASN G  1 12  ? -64.874  -16.442  41.206  1.00 2.12  ? 12  ASN G N   1 
ATOM   8046  C  CA  . ASN G  1 12  ? -66.200  -17.018  41.464  1.00 2.05  ? 12  ASN G CA  1 
ATOM   8047  C  C   . ASN G  1 12  ? -67.294  -16.187  40.789  1.00 2.51  ? 12  ASN G C   1 
ATOM   8048  O  O   . ASN G  1 12  ? -68.270  -16.729  40.247  1.00 2.61  ? 12  ASN G O   1 
ATOM   8049  C  CB  . ASN G  1 12  ? -66.483  -17.174  42.957  1.00 2.03  ? 12  ASN G CB  1 
ATOM   8050  C  CG  . ASN G  1 12  ? -66.126  -18.557  43.485  1.00 2.48  ? 12  ASN G CG  1 
ATOM   8051  O  OD1 . ASN G  1 12  ? -66.423  -19.563  42.851  1.00 4.18  ? 12  ASN G OD1 1 
ATOM   8052  N  ND2 . ASN G  1 12  ? -65.488  -18.611  44.649  1.00 2.00  ? 12  ASN G ND2 1 
ATOM   8053  N  N   . LYS G  1 13  ? -67.123  -14.871  40.769  1.00 2.56  ? 13  LYS G N   1 
ATOM   8054  C  CA  . LYS G  1 13  ? -68.129  -14.051  40.124  1.00 3.18  ? 13  LYS G CA  1 
ATOM   8055  C  C   . LYS G  1 13  ? -68.156  -14.320  38.613  1.00 3.58  ? 13  LYS G C   1 
ATOM   8056  O  O   . LYS G  1 13  ? -69.227  -14.491  38.010  1.00 4.28  ? 13  LYS G O   1 
ATOM   8057  C  CB  . LYS G  1 13  ? -67.879  -12.586  40.436  1.00 3.13  ? 13  LYS G CB  1 
ATOM   8058  C  CG  . LYS G  1 13  ? -68.725  -11.636  39.673  1.00 2.86  ? 13  LYS G CG  1 
ATOM   8059  C  CD  . LYS G  1 13  ? -68.866  -10.335  40.421  1.00 5.52  ? 13  LYS G CD  1 
ATOM   8060  C  CE  . LYS G  1 13  ? -69.298  -9.239   39.475  1.00 8.10  ? 13  LYS G CE  1 
ATOM   8061  N  NZ  . LYS G  1 13  ? -70.471  -8.537   40.012  1.00 9.97  ? 13  LYS G NZ  1 
ATOM   8062  N  N   . LEU G  1 14  ? -66.976  -14.366  38.008  1.00 3.02  ? 14  LEU G N   1 
ATOM   8063  C  CA  . LEU G  1 14  ? -66.867  -14.693  36.601  1.00 2.95  ? 14  LEU G CA  1 
ATOM   8064  C  C   . LEU G  1 14  ? -67.445  -16.088  36.323  1.00 3.25  ? 14  LEU G C   1 
ATOM   8065  O  O   . LEU G  1 14  ? -68.236  -16.265  35.382  1.00 2.98  ? 14  LEU G O   1 
ATOM   8066  C  CB  . LEU G  1 14  ? -65.415  -14.575  36.123  1.00 2.48  ? 14  LEU G CB  1 
ATOM   8067  C  CG  . LEU G  1 14  ? -64.845  -13.158  36.278  1.00 2.72  ? 14  LEU G CG  1 
ATOM   8068  C  CD1 . LEU G  1 14  ? -63.413  -13.121  35.834  1.00 3.80  ? 14  LEU G CD1 1 
ATOM   8069  C  CD2 . LEU G  1 14  ? -65.647  -12.152  35.535  1.00 2.00  ? 14  LEU G CD2 1 
ATOM   8070  N  N   . LEU G  1 15  ? -67.093  -17.060  37.182  1.00 3.15  ? 15  LEU G N   1 
ATOM   8071  C  CA  . LEU G  1 15  ? -67.650  -18.416  37.090  1.00 2.30  ? 15  LEU G CA  1 
ATOM   8072  C  C   . LEU G  1 15  ? -69.168  -18.345  37.087  1.00 2.81  ? 15  LEU G C   1 
ATOM   8073  O  O   . LEU G  1 15  ? -69.813  -19.023  36.299  1.00 2.77  ? 15  LEU G O   1 
ATOM   8074  C  CB  . LEU G  1 15  ? -67.156  -19.280  38.241  1.00 2.01  ? 15  LEU G CB  1 
ATOM   8075  C  CG  . LEU G  1 15  ? -67.773  -20.667  38.402  1.00 2.00  ? 15  LEU G CG  1 
ATOM   8076  C  CD1 . LEU G  1 15  ? -67.634  -21.526  37.172  1.00 2.00  ? 15  LEU G CD1 1 
ATOM   8077  C  CD2 . LEU G  1 15  ? -67.165  -21.361  39.603  1.00 2.00  ? 15  LEU G CD2 1 
ATOM   8078  N  N   . GLY G  1 16  ? -69.721  -17.489  37.959  1.00 3.04  ? 16  GLY G N   1 
ATOM   8079  C  CA  . GLY G  1 16  ? -71.146  -17.312  38.052  1.00 3.45  ? 16  GLY G CA  1 
ATOM   8080  C  C   . GLY G  1 16  ? -71.724  -16.848  36.730  1.00 4.62  ? 16  GLY G C   1 
ATOM   8081  O  O   . GLY G  1 16  ? -72.804  -17.296  36.325  1.00 4.35  ? 16  GLY G O   1 
ATOM   8082  N  N   . ASN G  1 17  ? -71.010  -15.936  36.059  1.00 5.43  ? 17  ASN G N   1 
ATOM   8083  C  CA  . ASN G  1 17  ? -71.452  -15.405  34.771  1.00 6.11  ? 17  ASN G CA  1 
ATOM   8084  C  C   . ASN G  1 17  ? -71.495  -16.523  33.759  1.00 6.99  ? 17  ASN G C   1 
ATOM   8085  O  O   . ASN G  1 17  ? -72.484  -16.621  33.019  1.00 7.21  ? 17  ASN G O   1 
ATOM   8086  C  CB  . ASN G  1 17  ? -70.508  -14.312  34.245  1.00 6.04  ? 17  ASN G CB  1 
ATOM   8087  C  CG  . ASN G  1 17  ? -70.590  -13.018  35.031  1.00 6.58  ? 17  ASN G CG  1 
ATOM   8088  O  OD1 . ASN G  1 17  ? -71.550  -12.753  35.739  1.00 5.62  ? 17  ASN G OD1 1 
ATOM   8089  N  ND2 . ASN G  1 17  ? -69.575  -12.201  34.891  1.00 8.90  ? 17  ASN G ND2 1 
ATOM   8090  N  N   . GLU G  1 18  ? -70.439  -17.360  33.728  1.00 7.03  ? 18  GLU G N   1 
ATOM   8091  C  CA  . GLU G  1 18  ? -70.348  -18.416  32.721  1.00 7.66  ? 18  GLU G CA  1 
ATOM   8092  C  C   . GLU G  1 18  ? -71.443  -19.435  33.012  1.00 7.78  ? 18  GLU G C   1 
ATOM   8093  O  O   . GLU G  1 18  ? -72.051  -20.027  32.092  1.00 7.45  ? 18  GLU G O   1 
ATOM   8094  C  CB  . GLU G  1 18  ? -68.993  -19.135  32.709  1.00 7.67  ? 18  GLU G CB  1 
ATOM   8095  C  CG  . GLU G  1 18  ? -67.790  -18.281  32.438  1.00 9.74  ? 18  GLU G CG  1 
ATOM   8096  C  CD  . GLU G  1 18  ? -67.644  -17.762  31.021  1.00 13.53 ? 18  GLU G CD  1 
ATOM   8097  O  OE1 . GLU G  1 18  ? -68.181  -18.346  30.046  1.00 13.05 ? 18  GLU G OE1 1 
ATOM   8098  O  OE2 . GLU G  1 18  ? -66.936  -16.749  30.877  1.00 15.53 ? 18  GLU G OE2 1 
ATOM   8099  N  N   . LEU G  1 19  ? -71.717  -19.660  34.288  1.00 7.47  ? 19  LEU G N   1 
ATOM   8100  C  CA  . LEU G  1 19  ? -72.733  -20.644  34.460  1.00 7.27  ? 19  LEU G CA  1 
ATOM   8101  C  C   . LEU G  1 19  ? -74.146  -20.244  34.148  1.00 6.87  ? 19  LEU G C   1 
ATOM   8102  O  O   . LEU G  1 19  ? -74.904  -21.076  33.677  1.00 7.37  ? 19  LEU G O   1 
ATOM   8103  C  CB  . LEU G  1 19  ? -72.495  -21.704  35.524  1.00 7.64  ? 19  LEU G CB  1 
ATOM   8104  C  CG  . LEU G  1 19  ? -72.262  -21.883  36.993  1.00 8.53  ? 19  LEU G CG  1 
ATOM   8105  C  CD1 . LEU G  1 19  ? -71.135  -22.859  36.899  1.00 7.72  ? 19  LEU G CD1 1 
ATOM   8106  C  CD2 . LEU G  1 19  ? -71.830  -20.711  37.825  1.00 11.91 ? 19  LEU G CD2 1 
ATOM   8107  N  N   . VAL G  1 20  ? -74.481  -18.963  34.255  1.00 6.25  ? 20  VAL G N   1 
ATOM   8108  C  CA  . VAL G  1 20  ? -75.752  -18.554  33.628  1.00 4.57  ? 20  VAL G CA  1 
ATOM   8109  C  C   . VAL G  1 20  ? -75.680  -18.650  32.087  1.00 3.94  ? 20  VAL G C   1 
ATOM   8110  O  O   . VAL G  1 20  ? -76.587  -19.188  31.478  1.00 3.94  ? 20  VAL G O   1 
ATOM   8111  C  CB  . VAL G  1 20  ? -76.474  -17.270  34.223  1.00 4.10  ? 20  VAL G CB  1 
ATOM   8112  C  CG1 . VAL G  1 20  ? -75.680  -16.555  35.211  1.00 3.16  ? 20  VAL G CG1 1 
ATOM   8113  C  CG2 . VAL G  1 20  ? -76.977  -16.365  33.140  1.00 3.02  ? 20  VAL G CG2 1 
ATOM   8114  N  N   . ALA G  1 21  ? -74.584  -18.204  31.480  1.00 2.95  ? 21  ALA G N   1 
ATOM   8115  C  CA  . ALA G  1 21  ? -74.440  -18.280  30.026  1.00 2.39  ? 21  ALA G CA  1 
ATOM   8116  C  C   . ALA G  1 21  ? -74.580  -19.704  29.499  1.00 2.92  ? 21  ALA G C   1 
ATOM   8117  O  O   . ALA G  1 21  ? -75.263  -19.908  28.486  1.00 3.42  ? 21  ALA G O   1 
ATOM   8118  C  CB  . ALA G  1 21  ? -73.158  -17.706  29.598  1.00 2.00  ? 21  ALA G CB  1 
ATOM   8119  N  N   . ILE G  1 22  ? -73.951  -20.684  30.175  1.00 2.93  ? 22  ILE G N   1 
ATOM   8120  C  CA  . ILE G  1 22  ? -74.043  -22.093  29.802  1.00 3.07  ? 22  ILE G CA  1 
ATOM   8121  C  C   . ILE G  1 22  ? -75.479  -22.534  29.625  1.00 3.65  ? 22  ILE G C   1 
ATOM   8122  O  O   . ILE G  1 22  ? -75.849  -23.077  28.565  1.00 4.19  ? 22  ILE G O   1 
ATOM   8123  C  CB  . ILE G  1 22  ? -73.342  -23.030  30.835  1.00 3.80  ? 22  ILE G CB  1 
ATOM   8124  C  CG1 . ILE G  1 22  ? -71.811  -22.947  30.693  1.00 3.27  ? 22  ILE G CG1 1 
ATOM   8125  C  CG2 . ILE G  1 22  ? -73.793  -24.473  30.673  1.00 2.00  ? 22  ILE G CG2 1 
ATOM   8126  C  CD1 . ILE G  1 22  ? -71.113  -23.482  31.868  1.00 2.00  ? 22  ILE G CD1 1 
ATOM   8127  N  N   . ASN G  1 23  ? -76.293  -22.289  30.645  1.00 3.19  ? 23  ASN G N   1 
ATOM   8128  C  CA  . ASN G  1 23  ? -77.697  -22.649  30.595  1.00 3.19  ? 23  ASN G CA  1 
ATOM   8129  C  C   . ASN G  1 23  ? -78.480  -21.816  29.569  1.00 3.61  ? 23  ASN G C   1 
ATOM   8130  O  O   . ASN G  1 23  ? -79.302  -22.335  28.811  1.00 4.00  ? 23  ASN G O   1 
ATOM   8131  C  CB  . ASN G  1 23  ? -78.325  -22.501  31.958  1.00 3.25  ? 23  ASN G CB  1 
ATOM   8132  C  CG  . ASN G  1 23  ? -77.800  -23.506  32.968  1.00 4.10  ? 23  ASN G CG  1 
ATOM   8133  O  OD1 . ASN G  1 23  ? -78.282  -23.569  34.078  1.00 5.87  ? 23  ASN G OD1 1 
ATOM   8134  N  ND2 . ASN G  1 23  ? -76.808  -24.295  32.589  1.00 5.27  ? 23  ASN G ND2 1 
ATOM   8135  N  N   . GLN G  1 24  ? -78.223  -20.521  29.513  1.00 3.52  ? 24  GLN G N   1 
ATOM   8136  C  CA  . GLN G  1 24  ? -79.033  -19.710  28.647  1.00 3.68  ? 24  GLN G CA  1 
ATOM   8137  C  C   . GLN G  1 24  ? -78.731  -20.114  27.196  1.00 3.75  ? 24  GLN G C   1 
ATOM   8138  O  O   . GLN G  1 24  ? -79.650  -20.287  26.391  1.00 4.11  ? 24  GLN G O   1 
ATOM   8139  C  CB  . GLN G  1 24  ? -78.849  -18.207  28.931  1.00 3.63  ? 24  GLN G CB  1 
ATOM   8140  C  CG  . GLN G  1 24  ? -79.659  -17.317  28.042  1.00 4.32  ? 24  GLN G CG  1 
ATOM   8141  C  CD  . GLN G  1 24  ? -79.681  -15.902  28.547  1.00 7.15  ? 24  GLN G CD  1 
ATOM   8142  O  OE1 . GLN G  1 24  ? -80.022  -15.646  29.715  1.00 8.24  ? 24  GLN G OE1 1 
ATOM   8143  N  NE2 . GLN G  1 24  ? -79.331  -14.954  27.670  1.00 6.64  ? 24  GLN G NE2 1 
ATOM   8144  N  N   . TYR G  1 25  ? -77.465  -20.326  26.879  1.00 3.62  ? 25  TYR G N   1 
ATOM   8145  C  CA  . TYR G  1 25  ? -77.112  -20.735  25.514  1.00 4.26  ? 25  TYR G CA  1 
ATOM   8146  C  C   . TYR G  1 25  ? -77.669  -22.093  25.133  1.00 3.84  ? 25  TYR G C   1 
ATOM   8147  O  O   . TYR G  1 25  ? -78.137  -22.274  24.014  1.00 3.44  ? 25  TYR G O   1 
ATOM   8148  C  CB  . TYR G  1 25  ? -75.604  -20.748  25.344  1.00 5.20  ? 25  TYR G CB  1 
ATOM   8149  C  CG  . TYR G  1 25  ? -74.992  -19.417  24.981  1.00 7.08  ? 25  TYR G CG  1 
ATOM   8150  C  CD1 . TYR G  1 25  ? -75.526  -18.636  23.944  1.00 8.18  ? 25  TYR G CD1 1 
ATOM   8151  C  CD2 . TYR G  1 25  ? -73.836  -18.970  25.632  1.00 7.85  ? 25  TYR G CD2 1 
ATOM   8152  C  CE1 . TYR G  1 25  ? -74.952  -17.437  23.588  1.00 8.82  ? 25  TYR G CE1 1 
ATOM   8153  C  CE2 . TYR G  1 25  ? -73.238  -17.775  25.287  1.00 8.82  ? 25  TYR G CE2 1 
ATOM   8154  C  CZ  . TYR G  1 25  ? -73.801  -17.012  24.264  1.00 8.93  ? 25  TYR G CZ  1 
ATOM   8155  O  OH  . TYR G  1 25  ? -73.190  -15.830  23.922  1.00 8.69  ? 25  TYR G OH  1 
ATOM   8156  N  N   . PHE G  1 26  ? -77.622  -23.045  26.076  1.00 3.55  ? 26  PHE G N   1 
ATOM   8157  C  CA  . PHE G  1 26  ? -78.148  -24.385  25.827  1.00 2.96  ? 26  PHE G CA  1 
ATOM   8158  C  C   . PHE G  1 26  ? -79.681  -24.412  25.573  1.00 3.01  ? 26  PHE G C   1 
ATOM   8159  O  O   . PHE G  1 26  ? -80.152  -25.029  24.613  1.00 2.40  ? 26  PHE G O   1 
ATOM   8160  C  CB  . PHE G  1 26  ? -77.797  -25.325  26.955  1.00 2.67  ? 26  PHE G CB  1 
ATOM   8161  C  CG  . PHE G  1 26  ? -77.759  -26.719  26.527  1.00 3.02  ? 26  PHE G CG  1 
ATOM   8162  C  CD1 . PHE G  1 26  ? -76.591  -27.259  26.015  1.00 3.11  ? 26  PHE G CD1 1 
ATOM   8163  C  CD2 . PHE G  1 26  ? -78.911  -27.491  26.542  1.00 3.54  ? 26  PHE G CD2 1 
ATOM   8164  C  CE1 . PHE G  1 26  ? -76.553  -28.563  25.553  1.00 3.88  ? 26  PHE G CE1 1 
ATOM   8165  C  CE2 . PHE G  1 26  ? -78.884  -28.822  26.067  1.00 4.13  ? 26  PHE G CE2 1 
ATOM   8166  C  CZ  . PHE G  1 26  ? -77.701  -29.348  25.577  1.00 4.34  ? 26  PHE G CZ  1 
ATOM   8167  N  N   . LEU G  1 27  ? -80.443  -23.750  26.435  1.00 2.80  ? 27  LEU G N   1 
ATOM   8168  C  CA  . LEU G  1 27  ? -81.861  -23.645  26.225  1.00 2.53  ? 27  LEU G CA  1 
ATOM   8169  C  C   . LEU G  1 27  ? -82.118  -22.958  24.878  1.00 2.49  ? 27  LEU G C   1 
ATOM   8170  O  O   . LEU G  1 27  ? -82.915  -23.449  24.085  1.00 2.03  ? 27  LEU G O   1 
ATOM   8171  C  CB  . LEU G  1 27  ? -82.519  -22.850  27.355  1.00 2.54  ? 27  LEU G CB  1 
ATOM   8172  C  CG  . LEU G  1 27  ? -83.931  -23.224  27.826  1.00 2.49  ? 27  LEU G CG  1 
ATOM   8173  C  CD1 . LEU G  1 27  ? -84.625  -22.067  28.468  1.00 2.00  ? 27  LEU G CD1 1 
ATOM   8174  C  CD2 . LEU G  1 27  ? -84.813  -23.864  26.752  1.00 2.94  ? 27  LEU G CD2 1 
ATOM   8175  N  N   . HIS G  1 28  ? -81.425  -21.848  24.606  1.00 2.14  ? 28  HIS G N   1 
ATOM   8176  C  CA  . HIS G  1 28  ? -81.646  -21.170  23.329  1.00 2.38  ? 28  HIS G CA  1 
ATOM   8177  C  C   . HIS G  1 28  ? -81.408  -22.131  22.177  1.00 2.55  ? 28  HIS G C   1 
ATOM   8178  O  O   . HIS G  1 28  ? -82.258  -22.287  21.299  1.00 2.79  ? 28  HIS G O   1 
ATOM   8179  C  CB  . HIS G  1 28  ? -80.808  -19.908  23.174  1.00 2.53  ? 28  HIS G CB  1 
ATOM   8180  C  CG  . HIS G  1 28  ? -81.319  -18.747  23.955  1.00 2.57  ? 28  HIS G CG  1 
ATOM   8181  N  ND1 . HIS G  1 28  ? -80.573  -17.614  24.173  1.00 2.41  ? 28  HIS G ND1 1 
ATOM   8182  C  CD2 . HIS G  1 28  ? -82.494  -18.560  24.599  1.00 2.02  ? 28  HIS G CD2 1 
ATOM   8183  C  CE1 . HIS G  1 28  ? -81.273  -16.773  24.905  1.00 3.17  ? 28  HIS G CE1 1 
ATOM   8184  N  NE2 . HIS G  1 28  ? -82.443  -17.325  25.180  1.00 3.27  ? 28  HIS G NE2 1 
ATOM   8185  N  N   . ALA G  1 29  ? -80.263  -22.807  22.222  1.00 2.35  ? 29  ALA G N   1 
ATOM   8186  C  CA  . ALA G  1 29  ? -79.918  -23.804  21.222  1.00 2.14  ? 29  ALA G CA  1 
ATOM   8187  C  C   . ALA G  1 29  ? -81.044  -24.780  20.941  1.00 2.07  ? 29  ALA G C   1 
ATOM   8188  O  O   . ALA G  1 29  ? -81.430  -24.962  19.793  1.00 2.17  ? 29  ALA G O   1 
ATOM   8189  C  CB  . ALA G  1 29  ? -78.656  -24.541  21.621  1.00 2.00  ? 29  ALA G CB  1 
ATOM   8190  N  N   . ARG G  1 30  ? -81.580  -25.407  21.980  1.00 2.13  ? 30  ARG G N   1 
ATOM   8191  C  CA  . ARG G  1 30  ? -82.583  -26.450  21.776  1.00 2.46  ? 30  ARG G CA  1 
ATOM   8192  C  C   . ARG G  1 30  ? -83.989  -25.872  21.436  1.00 2.70  ? 30  ARG G C   1 
ATOM   8193  O  O   . ARG G  1 30  ? -84.826  -26.565  20.840  1.00 2.43  ? 30  ARG G O   1 
ATOM   8194  C  CB  . ARG G  1 30  ? -82.640  -27.399  22.961  1.00 2.00  ? 30  ARG G CB  1 
ATOM   8195  C  CG  . ARG G  1 30  ? -81.338  -27.943  23.335  1.00 2.00  ? 30  ARG G CG  1 
ATOM   8196  C  CD  . ARG G  1 30  ? -81.024  -29.233  22.686  1.00 2.01  ? 30  ARG G CD  1 
ATOM   8197  N  NE  . ARG G  1 30  ? -79.936  -29.083  21.738  1.00 4.26  ? 30  ARG G NE  1 
ATOM   8198  C  CZ  . ARG G  1 30  ? -78.862  -29.864  21.645  1.00 2.87  ? 30  ARG G CZ  1 
ATOM   8199  N  NH1 . ARG G  1 30  ? -78.661  -30.915  22.415  1.00 2.70  ? 30  ARG G NH1 1 
ATOM   8200  N  NH2 . ARG G  1 30  ? -77.969  -29.583  20.734  1.00 4.06  ? 30  ARG G NH2 1 
ATOM   8201  N  N   . MET G  1 31  ? -84.209  -24.606  21.774  1.00 2.86  ? 31  MET G N   1 
ATOM   8202  C  CA  . MET G  1 31  ? -85.378  -23.890  21.319  1.00 2.79  ? 31  MET G CA  1 
ATOM   8203  C  C   . MET G  1 31  ? -85.283  -23.685  19.806  1.00 2.78  ? 31  MET G C   1 
ATOM   8204  O  O   . MET G  1 31  ? -86.187  -24.059  19.052  1.00 3.07  ? 31  MET G O   1 
ATOM   8205  C  CB  . MET G  1 31  ? -85.511  -22.564  22.054  1.00 2.61  ? 31  MET G CB  1 
ATOM   8206  C  CG  . MET G  1 31  ? -86.101  -22.660  23.431  1.00 2.02  ? 31  MET G CG  1 
ATOM   8207  S  SD  . MET G  1 31  ? -86.086  -21.109  24.365  1.00 3.56  ? 31  MET G SD  1 
ATOM   8208  C  CE  . MET G  1 31  ? -87.287  -20.094  23.482  1.00 2.00  ? 31  MET G CE  1 
ATOM   8209  N  N   . PHE G  1 32  ? -84.174  -23.141  19.342  1.00 2.67  ? 32  PHE G N   1 
ATOM   8210  C  CA  . PHE G  1 32  ? -83.924  -23.062  17.917  1.00 2.39  ? 32  PHE G CA  1 
ATOM   8211  C  C   . PHE G  1 32  ? -84.066  -24.403  17.220  1.00 2.45  ? 32  PHE G C   1 
ATOM   8212  O  O   . PHE G  1 32  ? -84.643  -24.493  16.133  1.00 2.58  ? 32  PHE G O   1 
ATOM   8213  C  CB  . PHE G  1 32  ? -82.533  -22.475  17.670  1.00 2.47  ? 32  PHE G CB  1 
ATOM   8214  C  CG  . PHE G  1 32  ? -82.395  -21.070  18.133  1.00 2.72  ? 32  PHE G CG  1 
ATOM   8215  C  CD1 . PHE G  1 32  ? -81.250  -20.660  18.813  1.00 4.23  ? 32  PHE G CD1 1 
ATOM   8216  C  CD2 . PHE G  1 32  ? -83.411  -20.164  17.902  1.00 2.42  ? 32  PHE G CD2 1 
ATOM   8217  C  CE1 . PHE G  1 32  ? -81.101  -19.348  19.248  1.00 4.25  ? 32  PHE G CE1 1 
ATOM   8218  C  CE2 . PHE G  1 32  ? -83.291  -18.848  18.323  1.00 4.97  ? 32  PHE G CE2 1 
ATOM   8219  C  CZ  . PHE G  1 32  ? -82.118  -18.439  19.019  1.00 4.22  ? 32  PHE G CZ  1 
ATOM   8220  N  N   . LYS G  1 33  ? -83.536  -25.437  17.840  1.00 2.56  ? 33  LYS G N   1 
ATOM   8221  C  CA  . LYS G  1 33  ? -83.605  -26.781  17.260  1.00 2.99  ? 33  LYS G CA  1 
ATOM   8222  C  C   . LYS G  1 33  ? -85.041  -27.242  17.121  1.00 3.07  ? 33  LYS G C   1 
ATOM   8223  O  O   . LYS G  1 33  ? -85.442  -27.749  16.067  1.00 2.67  ? 33  LYS G O   1 
ATOM   8224  C  CB  . LYS G  1 33  ? -82.850  -27.764  18.129  1.00 3.11  ? 33  LYS G CB  1 
ATOM   8225  C  CG  . LYS G  1 33  ? -82.973  -29.193  17.728  1.00 4.03  ? 33  LYS G CG  1 
ATOM   8226  C  CD  . LYS G  1 33  ? -81.662  -29.863  18.058  1.00 8.20  ? 33  LYS G CD  1 
ATOM   8227  C  CE  . LYS G  1 33  ? -81.834  -31.325  18.391  1.00 10.43 ? 33  LYS G CE  1 
ATOM   8228  N  NZ  . LYS G  1 33  ? -81.595  -32.180  17.179  1.00 10.84 ? 33  LYS G NZ  1 
ATOM   8229  N  N   . ASN G  1 34  ? -85.810  -27.046  18.182  1.00 3.00  ? 34  ASN G N   1 
ATOM   8230  C  CA  . ASN G  1 34  ? -87.200  -27.380  18.128  1.00 3.45  ? 34  ASN G CA  1 
ATOM   8231  C  C   . ASN G  1 34  ? -87.912  -26.654  17.008  1.00 3.69  ? 34  ASN G C   1 
ATOM   8232  O  O   . ASN G  1 34  ? -88.681  -27.275  16.291  1.00 4.82  ? 34  ASN G O   1 
ATOM   8233  C  CB  . ASN G  1 34  ? -87.903  -27.099  19.440  1.00 3.27  ? 34  ASN G CB  1 
ATOM   8234  C  CG  . ASN G  1 34  ? -89.326  -27.579  19.419  1.00 4.40  ? 34  ASN G CG  1 
ATOM   8235  O  OD1 . ASN G  1 34  ? -90.224  -26.773  19.340  1.00 7.33  ? 34  ASN G OD1 1 
ATOM   8236  N  ND2 . ASN G  1 34  ? -89.535  -28.903  19.442  1.00 6.83  ? 34  ASN G ND2 1 
ATOM   8237  N  N   . TRP G  1 35  ? -87.639  -25.355  16.859  1.00 3.41  ? 35  TRP G N   1 
ATOM   8238  C  CA  . TRP G  1 35  ? -88.202  -24.558  15.767  1.00 3.22  ? 35  TRP G CA  1 
ATOM   8239  C  C   . TRP G  1 35  ? -87.655  -24.897  14.368  1.00 3.38  ? 35  TRP G C   1 
ATOM   8240  O  O   . TRP G  1 35  ? -88.126  -24.342  13.379  1.00 3.48  ? 35  TRP G O   1 
ATOM   8241  C  CB  . TRP G  1 35  ? -87.991  -23.071  16.018  1.00 2.86  ? 35  TRP G CB  1 
ATOM   8242  C  CG  . TRP G  1 35  ? -88.756  -22.553  17.151  1.00 3.67  ? 35  TRP G CG  1 
ATOM   8243  C  CD1 . TRP G  1 35  ? -89.926  -23.052  17.637  1.00 5.33  ? 35  TRP G CD1 1 
ATOM   8244  C  CD2 . TRP G  1 35  ? -88.429  -21.412  17.956  1.00 4.16  ? 35  TRP G CD2 1 
ATOM   8245  N  NE1 . TRP G  1 35  ? -90.346  -22.299  18.699  1.00 5.77  ? 35  TRP G NE1 1 
ATOM   8246  C  CE2 . TRP G  1 35  ? -89.446  -21.279  18.912  1.00 4.66  ? 35  TRP G CE2 1 
ATOM   8247  C  CE3 . TRP G  1 35  ? -87.381  -20.485  17.949  1.00 2.54  ? 35  TRP G CE3 1 
ATOM   8248  C  CZ2 . TRP G  1 35  ? -89.449  -20.255  19.870  1.00 4.28  ? 35  TRP G CZ2 1 
ATOM   8249  C  CZ3 . TRP G  1 35  ? -87.379  -19.481  18.892  1.00 3.83  ? 35  TRP G CZ3 1 
ATOM   8250  C  CH2 . TRP G  1 35  ? -88.406  -19.370  19.847  1.00 4.14  ? 35  TRP G CH2 1 
ATOM   8251  N  N   . GLY G  1 36  ? -86.640  -25.757  14.288  1.00 2.89  ? 36  GLY G N   1 
ATOM   8252  C  CA  . GLY G  1 36  ? -86.130  -26.182  13.009  1.00 2.74  ? 36  GLY G CA  1 
ATOM   8253  C  C   . GLY G  1 36  ? -85.077  -25.252  12.470  1.00 3.32  ? 36  GLY G C   1 
ATOM   8254  O  O   . GLY G  1 36  ? -84.619  -25.414  11.340  1.00 3.97  ? 36  GLY G O   1 
ATOM   8255  N  N   . LEU G  1 37  ? -84.664  -24.299  13.292  1.00 3.33  ? 37  LEU G N   1 
ATOM   8256  C  CA  . LEU G  1 37  ? -83.609  -23.321  12.970  1.00 2.83  ? 37  LEU G CA  1 
ATOM   8257  C  C   . LEU G  1 37  ? -82.216  -23.956  13.229  1.00 3.08  ? 37  LEU G C   1 
ATOM   8258  O  O   . LEU G  1 37  ? -81.416  -23.511  14.066  1.00 3.20  ? 37  LEU G O   1 
ATOM   8259  C  CB  . LEU G  1 37  ? -83.841  -22.053  13.813  1.00 2.60  ? 37  LEU G CB  1 
ATOM   8260  C  CG  . LEU G  1 37  ? -84.839  -21.020  13.260  1.00 3.45  ? 37  LEU G CG  1 
ATOM   8261  C  CD1 . LEU G  1 37  ? -85.851  -21.580  12.252  1.00 2.00  ? 37  LEU G CD1 1 
ATOM   8262  C  CD2 . LEU G  1 37  ? -85.518  -20.184  14.347  1.00 2.00  ? 37  LEU G CD2 1 
ATOM   8263  N  N   . LYS G  1 38  ? -81.956  -25.032  12.482  1.00 3.35  ? 38  LYS G N   1 
ATOM   8264  C  CA  . LYS G  1 38  ? -80.837  -25.951  12.658  1.00 3.65  ? 38  LYS G CA  1 
ATOM   8265  C  C   . LYS G  1 38  ? -79.481  -25.224  12.910  1.00 3.63  ? 38  LYS G C   1 
ATOM   8266  O  O   . LYS G  1 38  ? -78.637  -25.642  13.717  1.00 3.47  ? 38  LYS G O   1 
ATOM   8267  C  CB  . LYS G  1 38  ? -80.800  -26.779  11.390  1.00 3.91  ? 38  LYS G CB  1 
ATOM   8268  C  CG  . LYS G  1 38  ? -80.507  -28.262  11.513  1.00 8.09  ? 38  LYS G CG  1 
ATOM   8269  C  CD  . LYS G  1 38  ? -81.727  -29.214  11.370  1.00 10.92 ? 38  LYS G CD  1 
ATOM   8270  C  CE  . LYS G  1 38  ? -82.444  -29.102  10.025  1.00 13.68 ? 38  LYS G CE  1 
ATOM   8271  N  NZ  . LYS G  1 38  ? -81.709  -29.556  8.835   1.00 13.98 ? 38  LYS G NZ  1 
ATOM   8272  N  N   . ARG G  1 39  ? -79.289  -24.099  12.240  1.00 4.35  ? 39  ARG G N   1 
ATOM   8273  C  CA  . ARG G  1 39  ? -78.005  -23.411  12.195  1.00 4.48  ? 39  ARG G CA  1 
ATOM   8274  C  C   . ARG G  1 39  ? -77.733  -22.636  13.452  1.00 4.26  ? 39  ARG G C   1 
ATOM   8275  O  O   . ARG G  1 39  ? -76.603  -22.521  13.905  1.00 4.80  ? 39  ARG G O   1 
ATOM   8276  C  CB  . ARG G  1 39  ? -78.081  -22.437  11.034  1.00 5.26  ? 39  ARG G CB  1 
ATOM   8277  C  CG  . ARG G  1 39  ? -76.804  -22.153  10.325  1.00 7.85  ? 39  ARG G CG  1 
ATOM   8278  C  CD  . ARG G  1 39  ? -76.224  -20.885  10.887  1.00 14.22 ? 39  ARG G CD  1 
ATOM   8279  N  NE  . ARG G  1 39  ? -75.931  -19.894  9.833   1.00 18.68 ? 39  ARG G NE  1 
ATOM   8280  C  CZ  . ARG G  1 39  ? -75.808  -18.579  10.054  1.00 20.85 ? 39  ARG G CZ  1 
ATOM   8281  N  NH1 . ARG G  1 39  ? -75.965  -18.065  11.300  1.00 16.92 ? 39  ARG G NH1 1 
ATOM   8282  N  NH2 . ARG G  1 39  ? -75.558  -17.774  9.011   1.00 21.69 ? 39  ARG G NH2 1 
ATOM   8283  N  N   . LEU G  1 40  ? -78.787  -22.047  13.990  1.00 3.90  ? 40  LEU G N   1 
ATOM   8284  C  CA  . LEU G  1 40  ? -78.723  -21.309  15.228  1.00 3.21  ? 40  LEU G CA  1 
ATOM   8285  C  C   . LEU G  1 40  ? -78.542  -22.296  16.378  1.00 3.55  ? 40  LEU G C   1 
ATOM   8286  O  O   . LEU G  1 40  ? -77.919  -21.971  17.375  1.00 3.46  ? 40  LEU G O   1 
ATOM   8287  C  CB  . LEU G  1 40  ? -80.021  -20.536  15.386  1.00 3.38  ? 40  LEU G CB  1 
ATOM   8288  C  CG  . LEU G  1 40  ? -80.099  -19.041  15.143  1.00 2.43  ? 40  LEU G CG  1 
ATOM   8289  C  CD1 . LEU G  1 40  ? -79.001  -18.476  14.238  1.00 2.61  ? 40  LEU G CD1 1 
ATOM   8290  C  CD2 . LEU G  1 40  ? -81.459  -18.697  14.646  1.00 2.00  ? 40  LEU G CD2 1 
ATOM   8291  N  N   . ASN G  1 41  ? -79.103  -23.503  16.242  1.00 3.65  ? 41  ASN G N   1 
ATOM   8292  C  CA  . ASN G  1 41  ? -78.888  -24.550  17.236  1.00 2.97  ? 41  ASN G CA  1 
ATOM   8293  C  C   . ASN G  1 41  ? -77.424  -24.958  17.224  1.00 3.19  ? 41  ASN G C   1 
ATOM   8294  O  O   . ASN G  1 41  ? -76.822  -25.066  18.272  1.00 2.86  ? 41  ASN G O   1 
ATOM   8295  C  CB  . ASN G  1 41  ? -79.766  -25.775  16.991  1.00 2.67  ? 41  ASN G CB  1 
ATOM   8296  C  CG  . ASN G  1 41  ? -79.281  -26.999  17.759  1.00 3.34  ? 41  ASN G CG  1 
ATOM   8297  O  OD1 . ASN G  1 41  ? -79.487  -27.104  18.965  1.00 3.55  ? 41  ASN G OD1 1 
ATOM   8298  N  ND2 . ASN G  1 41  ? -78.604  -27.908  17.071  1.00 2.00  ? 41  ASN G ND2 1 
ATOM   8299  N  N   . ASP G  1 42  ? -76.852  -25.187  16.048  1.00 3.85  ? 42  ASP G N   1 
ATOM   8300  C  CA  . ASP G  1 42  ? -75.434  -25.538  15.979  1.00 5.18  ? 42  ASP G CA  1 
ATOM   8301  C  C   . ASP G  1 42  ? -74.558  -24.469  16.629  1.00 5.46  ? 42  ASP G C   1 
ATOM   8302  O  O   . ASP G  1 42  ? -73.719  -24.789  17.478  1.00 5.97  ? 42  ASP G O   1 
ATOM   8303  C  CB  . ASP G  1 42  ? -74.957  -25.787  14.551  1.00 5.44  ? 42  ASP G CB  1 
ATOM   8304  C  CG  . ASP G  1 42  ? -75.615  -27.002  13.907  1.00 9.93  ? 42  ASP G CG  1 
ATOM   8305  O  OD1 . ASP G  1 42  ? -76.286  -27.803  14.599  1.00 13.01 ? 42  ASP G OD1 1 
ATOM   8306  O  OD2 . ASP G  1 42  ? -75.475  -27.151  12.675  1.00 13.63 ? 42  ASP G OD2 1 
ATOM   8307  N  N   . VAL G  1 43  ? -74.752  -23.200  16.276  1.00 5.05  ? 43  VAL G N   1 
ATOM   8308  C  CA  . VAL G  1 43  ? -73.848  -22.183  16.815  1.00 4.92  ? 43  VAL G CA  1 
ATOM   8309  C  C   . VAL G  1 43  ? -74.016  -22.027  18.326  1.00 4.89  ? 43  VAL G C   1 
ATOM   8310  O  O   . VAL G  1 43  ? -73.039  -22.047  19.077  1.00 4.70  ? 43  VAL G O   1 
ATOM   8311  C  CB  . VAL G  1 43  ? -73.951  -20.836  16.072  1.00 4.87  ? 43  VAL G CB  1 
ATOM   8312  C  CG1 . VAL G  1 43  ? -73.210  -19.733  16.831  1.00 5.13  ? 43  VAL G CG1 1 
ATOM   8313  C  CG2 . VAL G  1 43  ? -73.381  -20.974  14.678  1.00 4.15  ? 43  VAL G CG2 1 
ATOM   8314  N  N   . GLU G  1 44  ? -75.257  -21.897  18.775  1.00 4.69  ? 44  GLU G N   1 
ATOM   8315  C  CA  . GLU G  1 44  ? -75.498  -21.645  20.207  1.00 4.93  ? 44  GLU G CA  1 
ATOM   8316  C  C   . GLU G  1 44  ? -75.123  -22.820  21.068  1.00 4.70  ? 44  GLU G C   1 
ATOM   8317  O  O   . GLU G  1 44  ? -74.652  -22.645  22.195  1.00 4.89  ? 44  GLU G O   1 
ATOM   8318  C  CB  . GLU G  1 44  ? -76.924  -21.262  20.495  1.00 4.30  ? 44  GLU G CB  1 
ATOM   8319  C  CG  . GLU G  1 44  ? -77.271  -19.981  19.834  1.00 7.83  ? 44  GLU G CG  1 
ATOM   8320  C  CD  . GLU G  1 44  ? -77.493  -18.836  20.786  1.00 11.31 ? 44  GLU G CD  1 
ATOM   8321  O  OE1 . GLU G  1 44  ? -78.166  -18.986  21.818  1.00 12.44 ? 44  GLU G OE1 1 
ATOM   8322  O  OE2 . GLU G  1 44  ? -77.034  -17.738  20.481  1.00 12.56 ? 44  GLU G OE2 1 
ATOM   8323  N  N   . TYR G  1 45  ? -75.289  -24.015  20.540  1.00 4.67  ? 45  TYR G N   1 
ATOM   8324  C  CA  . TYR G  1 45  ? -74.788  -25.169  21.231  1.00 4.80  ? 45  TYR G CA  1 
ATOM   8325  C  C   . TYR G  1 45  ? -73.294  -25.060  21.415  1.00 5.24  ? 45  TYR G C   1 
ATOM   8326  O  O   . TYR G  1 45  ? -72.801  -25.241  22.511  1.00 5.11  ? 45  TYR G O   1 
ATOM   8327  C  CB  . TYR G  1 45  ? -75.140  -26.426  20.464  1.00 4.96  ? 45  TYR G CB  1 
ATOM   8328  C  CG  . TYR G  1 45  ? -74.567  -27.656  21.067  1.00 5.02  ? 45  TYR G CG  1 
ATOM   8329  C  CD1 . TYR G  1 45  ? -75.205  -28.309  22.103  1.00 5.36  ? 45  TYR G CD1 1 
ATOM   8330  C  CD2 . TYR G  1 45  ? -73.361  -28.179  20.595  1.00 6.01  ? 45  TYR G CD2 1 
ATOM   8331  C  CE1 . TYR G  1 45  ? -74.679  -29.459  22.648  1.00 6.95  ? 45  TYR G CE1 1 
ATOM   8332  C  CE2 . TYR G  1 45  ? -72.809  -29.327  21.131  1.00 6.32  ? 45  TYR G CE2 1 
ATOM   8333  C  CZ  . TYR G  1 45  ? -73.472  -29.968  22.161  1.00 7.82  ? 45  TYR G CZ  1 
ATOM   8334  O  OH  . TYR G  1 45  ? -72.906  -31.123  22.693  1.00 8.40  ? 45  TYR G OH  1 
ATOM   8335  N  N   A HIS G  1 46  ? -72.582  -24.732  20.346  0.50 5.70  ? 46  HIS G N   1 
ATOM   8336  N  N   B HIS G  1 46  ? -72.575  -24.742  20.338  0.50 5.72  ? 46  HIS G N   1 
ATOM   8337  C  CA  A HIS G  1 46  ? -71.133  -24.599  20.434  0.50 6.24  ? 46  HIS G CA  1 
ATOM   8338  C  CA  B HIS G  1 46  ? -71.118  -24.560  20.406  0.50 6.32  ? 46  HIS G CA  1 
ATOM   8339  C  C   A HIS G  1 46  ? -70.708  -23.470  21.373  0.50 5.72  ? 46  HIS G C   1 
ATOM   8340  C  C   B HIS G  1 46  ? -70.768  -23.532  21.469  0.50 5.75  ? 46  HIS G C   1 
ATOM   8341  O  O   A HIS G  1 46  ? -69.629  -23.515  21.940  0.50 6.33  ? 46  HIS G O   1 
ATOM   8342  O  O   B HIS G  1 46  ? -69.806  -23.699  22.202  0.50 6.30  ? 46  HIS G O   1 
ATOM   8343  C  CB  A HIS G  1 46  ? -70.476  -24.502  19.051  0.50 6.45  ? 46  HIS G CB  1 
ATOM   8344  C  CB  B HIS G  1 46  ? -70.515  -24.165  19.049  0.50 6.56  ? 46  HIS G CB  1 
ATOM   8345  C  CG  A HIS G  1 46  ? -70.592  -25.764  18.247  0.50 9.87  ? 46  HIS G CG  1 
ATOM   8346  C  CG  B HIS G  1 46  ? -69.020  -23.995  19.061  0.50 10.55 ? 46  HIS G CG  1 
ATOM   8347  N  ND1 A HIS G  1 46  ? -69.966  -26.939  18.608  0.50 11.97 ? 46  HIS G ND1 1 
ATOM   8348  N  ND1 B HIS G  1 46  ? -68.145  -25.060  19.174  0.50 14.26 ? 46  HIS G ND1 1 
ATOM   8349  C  CD2 A HIS G  1 46  ? -71.288  -26.041  17.118  0.50 12.54 ? 46  HIS G CD2 1 
ATOM   8350  C  CD2 B HIS G  1 46  ? -68.246  -22.885  18.952  0.50 12.25 ? 46  HIS G CD2 1 
ATOM   8351  C  CE1 A HIS G  1 46  ? -70.267  -27.882  17.733  0.50 13.13 ? 46  HIS G CE1 1 
ATOM   8352  C  CE1 B HIS G  1 46  ? -66.902  -24.609  19.149  0.50 14.36 ? 46  HIS G CE1 1 
ATOM   8353  N  NE2 A HIS G  1 46  ? -71.068  -27.362  16.820  0.50 13.28 ? 46  HIS G NE2 1 
ATOM   8354  N  NE2 B HIS G  1 46  ? -66.935  -23.294  19.013  0.50 13.53 ? 46  HIS G NE2 1 
ATOM   8355  N  N   . GLU G  1 47  ? -71.567  -22.491  21.587  1.00 5.29  ? 47  GLU G N   1 
ATOM   8356  C  CA  . GLU G  1 47  ? -71.272  -21.476  22.555  1.00 5.22  ? 47  GLU G CA  1 
ATOM   8357  C  C   . GLU G  1 47  ? -71.500  -21.888  23.964  1.00 4.51  ? 47  GLU G C   1 
ATOM   8358  O  O   . GLU G  1 47  ? -70.760  -21.493  24.836  1.00 4.07  ? 47  GLU G O   1 
ATOM   8359  C  CB  . GLU G  1 47  ? -71.966  -20.190  22.228  1.00 6.17  ? 47  GLU G CB  1 
ATOM   8360  C  CG  . GLU G  1 47  ? -71.067  -19.417  21.299  1.00 8.85  ? 47  GLU G CG  1 
ATOM   8361  C  CD  . GLU G  1 47  ? -71.802  -18.381  20.497  1.00 15.07 ? 47  GLU G CD  1 
ATOM   8362  O  OE1 . GLU G  1 47  ? -73.083  -18.284  20.564  1.00 16.98 ? 47  GLU G OE1 1 
ATOM   8363  O  OE2 . GLU G  1 47  ? -71.058  -17.658  19.787  1.00 18.40 ? 47  GLU G OE2 1 
ATOM   8364  N  N   . SER G  1 48  ? -72.513  -22.711  24.189  1.00 4.55  ? 48  SER G N   1 
ATOM   8365  C  CA  . SER G  1 48  ? -72.667  -23.384  25.473  1.00 4.21  ? 48  SER G CA  1 
ATOM   8366  C  C   . SER G  1 48  ? -71.420  -24.209  25.866  1.00 4.46  ? 48  SER G C   1 
ATOM   8367  O  O   . SER G  1 48  ? -70.931  -24.108  27.000  1.00 3.79  ? 48  SER G O   1 
ATOM   8368  C  CB  . SER G  1 48  ? -73.905  -24.256  25.459  1.00 3.78  ? 48  SER G CB  1 
ATOM   8369  O  OG  . SER G  1 48  ? -74.255  -24.548  26.786  1.00 4.37  ? 48  SER G OG  1 
ATOM   8370  N  N   . ILE G  1 49  ? -70.901  -25.012  24.928  1.00 4.72  ? 49  ILE G N   1 
ATOM   8371  C  CA  . ILE G  1 49  ? -69.674  -25.789  25.175  1.00 5.03  ? 49  ILE G CA  1 
ATOM   8372  C  C   . ILE G  1 49  ? -68.544  -24.830  25.505  1.00 5.43  ? 49  ILE G C   1 
ATOM   8373  O  O   . ILE G  1 49  ? -67.720  -25.100  26.374  1.00 5.55  ? 49  ILE G O   1 
ATOM   8374  C  CB  . ILE G  1 49  ? -69.249  -26.669  23.960  1.00 4.93  ? 49  ILE G CB  1 
ATOM   8375  C  CG1 . ILE G  1 49  ? -70.262  -27.775  23.646  1.00 5.39  ? 49  ILE G CG1 1 
ATOM   8376  C  CG2 . ILE G  1 49  ? -67.889  -27.296  24.175  1.00 4.00  ? 49  ILE G CG2 1 
ATOM   8377  C  CD1 . ILE G  1 49  ? -71.076  -28.263  24.807  1.00 6.07  ? 49  ILE G CD1 1 
ATOM   8378  N  N   . ASP G  1 50  ? -68.507  -23.703  24.805  1.00 5.90  ? 50  ASP G N   1 
ATOM   8379  C  CA  . ASP G  1 50  ? -67.486  -22.735  25.053  1.00 7.06  ? 50  ASP G CA  1 
ATOM   8380  C  C   . ASP G  1 50  ? -67.481  -22.212  26.500  1.00 6.84  ? 50  ASP G C   1 
ATOM   8381  O  O   . ASP G  1 50  ? -66.450  -22.183  27.172  1.00 6.62  ? 50  ASP G O   1 
ATOM   8382  C  CB  . ASP G  1 50  ? -67.621  -21.587  24.088  1.00 7.90  ? 50  ASP G CB  1 
ATOM   8383  C  CG  . ASP G  1 50  ? -66.291  -21.182  23.540  1.00 11.70 ? 50  ASP G CG  1 
ATOM   8384  O  OD1 . ASP G  1 50  ? -65.712  -22.082  22.872  1.00 14.91 ? 50  ASP G OD1 1 
ATOM   8385  O  OD2 . ASP G  1 50  ? -65.816  -20.029  23.815  1.00 15.62 ? 50  ASP G OD2 1 
ATOM   8386  N  N   . GLU G  1 51  ? -68.655  -21.838  26.973  1.00 6.24  ? 51  GLU G N   1 
ATOM   8387  C  CA  . GLU G  1 51  ? -68.770  -21.300  28.294  1.00 6.45  ? 51  GLU G CA  1 
ATOM   8388  C  C   . GLU G  1 51  ? -68.468  -22.364  29.342  1.00 6.09  ? 51  GLU G C   1 
ATOM   8389  O  O   . GLU G  1 51  ? -67.980  -22.039  30.417  1.00 5.09  ? 51  GLU G O   1 
ATOM   8390  C  CB  . GLU G  1 51  ? -70.148  -20.626  28.497  1.00 7.12  ? 51  GLU G CB  1 
ATOM   8391  C  CG  . GLU G  1 51  ? -70.478  -19.502  27.512  1.00 8.46  ? 51  GLU G CG  1 
ATOM   8392  C  CD  . GLU G  1 51  ? -69.382  -18.454  27.360  1.00 12.34 ? 51  GLU G CD  1 
ATOM   8393  O  OE1 . GLU G  1 51  ? -69.650  -17.240  27.518  1.00 15.25 ? 51  GLU G OE1 1 
ATOM   8394  O  OE2 . GLU G  1 51  ? -68.234  -18.818  27.067  1.00 15.32 ? 51  GLU G OE2 1 
ATOM   8395  N  N   . MET G  1 52  ? -68.729  -23.636  29.017  1.00 6.15  ? 52  MET G N   1 
ATOM   8396  C  CA  . MET G  1 52  ? -68.364  -24.724  29.914  1.00 6.42  ? 52  MET G CA  1 
ATOM   8397  C  C   . MET G  1 52  ? -66.869  -24.808  30.075  1.00 6.15  ? 52  MET G C   1 
ATOM   8398  O  O   . MET G  1 52  ? -66.382  -24.982  31.187  1.00 6.43  ? 52  MET G O   1 
ATOM   8399  C  CB  . MET G  1 52  ? -68.845  -26.056  29.402  1.00 6.26  ? 52  MET G CB  1 
ATOM   8400  C  CG  . MET G  1 52  ? -70.302  -26.284  29.565  1.00 6.99  ? 52  MET G CG  1 
ATOM   8401  S  SD  . MET G  1 52  ? -70.825  -27.794  28.712  1.00 9.66  ? 52  MET G SD  1 
ATOM   8402  C  CE  . MET G  1 52  ? -72.409  -27.181  28.040  1.00 8.44  ? 52  MET G CE  1 
ATOM   8403  N  N   . LYS G  1 53  ? -66.137  -24.682  28.963  1.00 5.75  ? 53  LYS G N   1 
ATOM   8404  C  CA  . LYS G  1 53  ? -64.689  -24.677  29.002  1.00 5.77  ? 53  LYS G CA  1 
ATOM   8405  C  C   . LYS G  1 53  ? -64.169  -23.555  29.915  1.00 5.69  ? 53  LYS G C   1 
ATOM   8406  O  O   . LYS G  1 53  ? -63.222  -23.748  30.670  1.00 5.90  ? 53  LYS G O   1 
ATOM   8407  C  CB  . LYS G  1 53  ? -64.110  -24.529  27.595  1.00 6.08  ? 53  LYS G CB  1 
ATOM   8408  C  CG  . LYS G  1 53  ? -64.434  -25.677  26.678  1.00 7.85  ? 53  LYS G CG  1 
ATOM   8409  C  CD  . LYS G  1 53  ? -63.385  -25.789  25.570  1.00 12.55 ? 53  LYS G CD  1 
ATOM   8410  C  CE  . LYS G  1 53  ? -63.988  -26.249  24.225  1.00 16.01 ? 53  LYS G CE  1 
ATOM   8411  N  NZ  . LYS G  1 53  ? -62.921  -26.712  23.268  1.00 17.99 ? 53  LYS G NZ  1 
ATOM   8412  N  N   . HIS G  1 54  ? -64.802  -22.394  29.843  1.00 5.72  ? 54  HIS G N   1 
ATOM   8413  C  CA  . HIS G  1 54  ? -64.435  -21.287  30.666  1.00 5.48  ? 54  HIS G CA  1 
ATOM   8414  C  C   . HIS G  1 54  ? -64.691  -21.572  32.145  1.00 4.98  ? 54  HIS G C   1 
ATOM   8415  O  O   . HIS G  1 54  ? -63.809  -21.343  32.984  1.00 4.78  ? 54  HIS G O   1 
ATOM   8416  C  CB  . HIS G  1 54  ? -65.162  -20.046  30.210  1.00 5.91  ? 54  HIS G CB  1 
ATOM   8417  C  CG  . HIS G  1 54  ? -64.810  -19.613  28.825  1.00 7.48  ? 54  HIS G CG  1 
ATOM   8418  N  ND1 . HIS G  1 54  ? -65.609  -18.763  28.085  1.00 10.42 ? 54  HIS G ND1 1 
ATOM   8419  C  CD2 . HIS G  1 54  ? -63.748  -19.908  28.041  1.00 7.87  ? 54  HIS G CD2 1 
ATOM   8420  C  CE1 . HIS G  1 54  ? -65.047  -18.551  26.907  1.00 10.34 ? 54  HIS G CE1 1 
ATOM   8421  N  NE2 . HIS G  1 54  ? -63.915  -19.231  26.856  1.00 7.90  ? 54  HIS G NE2 1 
ATOM   8422  N  N   . ALA G  1 55  ? -65.869  -22.106  32.452  1.00 4.12  ? 55  ALA G N   1 
ATOM   8423  C  CA  . ALA G  1 55  ? -66.217  -22.454  33.822  1.00 3.87  ? 55  ALA G CA  1 
ATOM   8424  C  C   . ALA G  1 55  ? -65.164  -23.434  34.397  1.00 4.12  ? 55  ALA G C   1 
ATOM   8425  O  O   . ALA G  1 55  ? -64.669  -23.268  35.511  1.00 4.16  ? 55  ALA G O   1 
ATOM   8426  C  CB  . ALA G  1 55  ? -67.607  -23.047  33.877  1.00 2.88  ? 55  ALA G CB  1 
ATOM   8427  N  N   . ASP G  1 56  ? -64.835  -24.452  33.609  1.00 3.89  ? 56  ASP G N   1 
ATOM   8428  C  CA  . ASP G  1 56  ? -63.848  -25.420  33.967  1.00 4.00  ? 56  ASP G CA  1 
ATOM   8429  C  C   . ASP G  1 56  ? -62.531  -24.698  34.337  1.00 4.35  ? 56  ASP G C   1 
ATOM   8430  O  O   . ASP G  1 56  ? -61.945  -24.957  35.395  1.00 5.24  ? 56  ASP G O   1 
ATOM   8431  C  CB  . ASP G  1 56  ? -63.660  -26.387  32.805  1.00 3.81  ? 56  ASP G CB  1 
ATOM   8432  C  CG  . ASP G  1 56  ? -62.814  -27.591  33.163  1.00 4.31  ? 56  ASP G CG  1 
ATOM   8433  O  OD1 . ASP G  1 56  ? -62.568  -27.856  34.357  1.00 3.86  ? 56  ASP G OD1 1 
ATOM   8434  O  OD2 . ASP G  1 56  ? -62.365  -28.298  32.225  1.00 4.98  ? 56  ASP G OD2 1 
ATOM   8435  N  N   . ARG G  1 57  ? -62.085  -23.765  33.506  1.00 3.74  ? 57  ARG G N   1 
ATOM   8436  C  CA  . ARG G  1 57  ? -60.839  -23.086  33.784  1.00 3.65  ? 57  ARG G CA  1 
ATOM   8437  C  C   . ARG G  1 57  ? -60.875  -22.282  35.083  1.00 2.84  ? 57  ARG G C   1 
ATOM   8438  O  O   . ARG G  1 57  ? -59.912  -22.320  35.857  1.00 2.19  ? 57  ARG G O   1 
ATOM   8439  C  CB  . ARG G  1 57  ? -60.387  -22.262  32.575  1.00 3.58  ? 57  ARG G CB  1 
ATOM   8440  C  CG  . ARG G  1 57  ? -59.887  -23.157  31.437  1.00 4.90  ? 57  ARG G CG  1 
ATOM   8441  C  CD  . ARG G  1 57  ? -59.571  -22.401  30.139  1.00 7.30  ? 57  ARG G CD  1 
ATOM   8442  N  NE  . ARG G  1 57  ? -58.334  -21.612  30.166  1.00 11.99 ? 57  ARG G NE  1 
ATOM   8443  C  CZ  . ARG G  1 57  ? -58.110  -20.551  29.359  1.00 14.26 ? 57  ARG G CZ  1 
ATOM   8444  N  NH1 . ARG G  1 57  ? -59.024  -20.174  28.433  1.00 12.24 ? 57  ARG G NH1 1 
ATOM   8445  N  NH2 . ARG G  1 57  ? -56.967  -19.853  29.473  1.00 11.99 ? 57  ARG G NH2 1 
ATOM   8446  N  N   . TYR G  1 58  ? -61.987  -21.594  35.341  1.00 2.23  ? 58  TYR G N   1 
ATOM   8447  C  CA  . TYR G  1 58  ? -62.169  -20.889  36.618  1.00 2.00  ? 58  TYR G CA  1 
ATOM   8448  C  C   . TYR G  1 58  ? -62.129  -21.845  37.790  1.00 2.08  ? 58  TYR G C   1 
ATOM   8449  O  O   . TYR G  1 58  ? -61.438  -21.588  38.799  1.00 2.06  ? 58  TYR G O   1 
ATOM   8450  C  CB  . TYR G  1 58  ? -63.476  -20.105  36.637  1.00 2.00  ? 58  TYR G CB  1 
ATOM   8451  C  CG  . TYR G  1 58  ? -63.488  -18.923  35.718  1.00 2.12  ? 58  TYR G CG  1 
ATOM   8452  C  CD1 . TYR G  1 58  ? -62.445  -18.001  35.739  1.00 2.92  ? 58  TYR G CD1 1 
ATOM   8453  C  CD2 . TYR G  1 58  ? -64.533  -18.708  34.847  1.00 2.00  ? 58  TYR G CD2 1 
ATOM   8454  C  CE1 . TYR G  1 58  ? -62.446  -16.919  34.923  1.00 2.00  ? 58  TYR G CE1 1 
ATOM   8455  C  CE2 . TYR G  1 58  ? -64.533  -17.629  34.021  1.00 2.00  ? 58  TYR G CE2 1 
ATOM   8456  C  CZ  . TYR G  1 58  ? -63.483  -16.725  34.063  1.00 2.01  ? 58  TYR G CZ  1 
ATOM   8457  O  OH  . TYR G  1 58  ? -63.453  -15.622  33.240  1.00 2.00  ? 58  TYR G OH  1 
ATOM   8458  N  N   . ILE G  1 59  ? -62.853  -22.961  37.657  1.00 2.04  ? 59  ILE G N   1 
ATOM   8459  C  CA  . ILE G  1 59  ? -62.995  -23.915  38.751  1.00 2.22  ? 59  ILE G CA  1 
ATOM   8460  C  C   . ILE G  1 59  ? -61.619  -24.429  39.103  1.00 2.79  ? 59  ILE G C   1 
ATOM   8461  O  O   . ILE G  1 59  ? -61.257  -24.464  40.268  1.00 3.47  ? 59  ILE G O   1 
ATOM   8462  C  CB  . ILE G  1 59  ? -63.952  -25.076  38.427  1.00 2.02  ? 59  ILE G CB  1 
ATOM   8463  C  CG1 . ILE G  1 59  ? -65.389  -24.582  38.450  1.00 2.00  ? 59  ILE G CG1 1 
ATOM   8464  C  CG2 . ILE G  1 59  ? -63.838  -26.166  39.440  1.00 2.00  ? 59  ILE G CG2 1 
ATOM   8465  C  CD1 . ILE G  1 59  ? -66.351  -25.441  37.613  1.00 2.00  ? 59  ILE G CD1 1 
ATOM   8466  N  N   . GLU G  1 60  ? -60.833  -24.778  38.091  1.00 2.89  ? 60  GLU G N   1 
ATOM   8467  C  CA  . GLU G  1 60  ? -59.518  -25.337  38.332  1.00 2.86  ? 60  GLU G CA  1 
ATOM   8468  C  C   . GLU G  1 60  ? -58.587  -24.342  38.935  1.00 2.59  ? 60  GLU G C   1 
ATOM   8469  O  O   . GLU G  1 60  ? -57.737  -24.693  39.754  1.00 3.18  ? 60  GLU G O   1 
ATOM   8470  C  CB  . GLU G  1 60  ? -58.934  -25.925  37.076  1.00 2.85  ? 60  GLU G CB  1 
ATOM   8471  C  CG  . GLU G  1 60  ? -59.661  -27.206  36.710  1.00 5.19  ? 60  GLU G CG  1 
ATOM   8472  C  CD  . GLU G  1 60  ? -59.127  -27.848  35.473  1.00 7.96  ? 60  GLU G CD  1 
ATOM   8473  O  OE1 . GLU G  1 60  ? -59.578  -28.952  35.109  1.00 9.02  ? 60  GLU G OE1 1 
ATOM   8474  O  OE2 . GLU G  1 60  ? -58.266  -27.230  34.841  1.00 10.77 ? 60  GLU G OE2 1 
ATOM   8475  N  N   . ARG G  1 61  ? -58.764  -23.091  38.560  1.00 2.76  ? 61  ARG G N   1 
ATOM   8476  C  CA  . ARG G  1 61  ? -57.879  -22.053  39.024  1.00 2.58  ? 61  ARG G CA  1 
ATOM   8477  C  C   . ARG G  1 61  ? -58.229  -21.703  40.479  1.00 2.87  ? 61  ARG G C   1 
ATOM   8478  O  O   . ARG G  1 61  ? -57.326  -21.617  41.309  1.00 2.48  ? 61  ARG G O   1 
ATOM   8479  C  CB  . ARG G  1 61  ? -57.980  -20.843  38.094  1.00 2.63  ? 61  ARG G CB  1 
ATOM   8480  C  CG  . ARG G  1 61  ? -57.035  -19.701  38.426  1.00 2.09  ? 61  ARG G CG  1 
ATOM   8481  C  CD  . ARG G  1 61  ? -55.587  -20.013  38.081  1.00 2.34  ? 61  ARG G CD  1 
ATOM   8482  N  NE  . ARG G  1 61  ? -54.765  -18.935  38.580  1.00 3.02  ? 61  ARG G NE  1 
ATOM   8483  C  CZ  . ARG G  1 61  ? -53.445  -18.980  38.703  1.00 5.05  ? 61  ARG G CZ  1 
ATOM   8484  N  NH1 . ARG G  1 61  ? -52.773  -20.065  38.355  1.00 3.74  ? 61  ARG G NH1 1 
ATOM   8485  N  NH2 . ARG G  1 61  ? -52.798  -17.919  39.184  1.00 4.54  ? 61  ARG G NH2 1 
ATOM   8486  N  N   . ILE G  1 62  ? -59.534  -21.535  40.780  1.00 2.56  ? 62  ILE G N   1 
ATOM   8487  C  CA  . ILE G  1 62  ? -59.971  -21.293  42.153  1.00 2.41  ? 62  ILE G CA  1 
ATOM   8488  C  C   . ILE G  1 62  ? -59.429  -22.403  43.076  1.00 2.81  ? 62  ILE G C   1 
ATOM   8489  O  O   . ILE G  1 62  ? -58.942  -22.137  44.196  1.00 2.89  ? 62  ILE G O   1 
ATOM   8490  C  CB  . ILE G  1 62  ? -61.502  -21.220  42.271  1.00 2.18  ? 62  ILE G CB  1 
ATOM   8491  C  CG1 . ILE G  1 62  ? -62.037  -19.992  41.534  1.00 3.14  ? 62  ILE G CG1 1 
ATOM   8492  C  CG2 . ILE G  1 62  ? -61.915  -21.122  43.722  1.00 2.00  ? 62  ILE G CG2 1 
ATOM   8493  C  CD1 . ILE G  1 62  ? -63.516  -19.933  41.429  1.00 2.00  ? 62  ILE G CD1 1 
ATOM   8494  N  N   . LEU G  1 63  ? -59.480  -23.643  42.588  1.00 2.50  ? 63  LEU G N   1 
ATOM   8495  C  CA  . LEU G  1 63  ? -59.063  -24.772  43.385  1.00 2.78  ? 63  LEU G CA  1 
ATOM   8496  C  C   . LEU G  1 63  ? -57.557  -24.698  43.595  1.00 3.15  ? 63  LEU G C   1 
ATOM   8497  O  O   . LEU G  1 63  ? -57.057  -24.909  44.711  1.00 3.80  ? 63  LEU G O   1 
ATOM   8498  C  CB  . LEU G  1 63  ? -59.459  -26.077  42.707  1.00 2.67  ? 63  LEU G CB  1 
ATOM   8499  C  CG  . LEU G  1 63  ? -60.597  -26.970  43.205  1.00 2.04  ? 63  LEU G CG  1 
ATOM   8500  C  CD1 . LEU G  1 63  ? -61.436  -26.427  44.313  1.00 2.00  ? 63  LEU G CD1 1 
ATOM   8501  C  CD2 . LEU G  1 63  ? -61.424  -27.421  42.032  1.00 2.00  ? 63  LEU G CD2 1 
ATOM   8502  N  N   . PHE G  1 64  ? -56.836  -24.345  42.544  1.00 3.07  ? 64  PHE G N   1 
ATOM   8503  C  CA  . PHE G  1 64  ? -55.390  -24.263  42.657  1.00 3.10  ? 64  PHE G CA  1 
ATOM   8504  C  C   . PHE G  1 64  ? -55.013  -23.191  43.669  1.00 3.31  ? 64  PHE G C   1 
ATOM   8505  O  O   . PHE G  1 64  ? -54.099  -23.405  44.477  1.00 4.31  ? 64  PHE G O   1 
ATOM   8506  C  CB  . PHE G  1 64  ? -54.716  -23.955  41.310  1.00 2.47  ? 64  PHE G CB  1 
ATOM   8507  C  CG  . PHE G  1 64  ? -53.281  -23.585  41.434  1.00 2.05  ? 64  PHE G CG  1 
ATOM   8508  C  CD1 . PHE G  1 64  ? -52.360  -24.481  41.951  1.00 2.00  ? 64  PHE G CD1 1 
ATOM   8509  C  CD2 . PHE G  1 64  ? -52.833  -22.333  41.032  1.00 3.23  ? 64  PHE G CD2 1 
ATOM   8510  C  CE1 . PHE G  1 64  ? -51.012  -24.144  42.063  1.00 2.00  ? 64  PHE G CE1 1 
ATOM   8511  C  CE2 . PHE G  1 64  ? -51.469  -21.990  41.142  1.00 2.00  ? 64  PHE G CE2 1 
ATOM   8512  C  CZ  . PHE G  1 64  ? -50.575  -22.907  41.656  1.00 2.00  ? 64  PHE G CZ  1 
ATOM   8513  N  N   . LEU G  1 65  ? -55.730  -22.065  43.618  1.00 2.46  ? 65  LEU G N   1 
ATOM   8514  C  CA  . LEU G  1 65  ? -55.478  -20.919  44.480  1.00 2.23  ? 65  LEU G CA  1 
ATOM   8515  C  C   . LEU G  1 65  ? -56.031  -21.153  45.875  1.00 2.30  ? 65  LEU G C   1 
ATOM   8516  O  O   . LEU G  1 65  ? -55.968  -20.265  46.711  1.00 2.15  ? 65  LEU G O   1 
ATOM   8517  C  CB  . LEU G  1 65  ? -56.106  -19.661  43.897  1.00 2.23  ? 65  LEU G CB  1 
ATOM   8518  C  CG  . LEU G  1 65  ? -55.457  -19.166  42.615  1.00 2.33  ? 65  LEU G CG  1 
ATOM   8519  C  CD1 . LEU G  1 65  ? -56.120  -17.876  42.149  1.00 2.00  ? 65  LEU G CD1 1 
ATOM   8520  C  CD2 . LEU G  1 65  ? -53.933  -19.044  42.827  1.00 2.00  ? 65  LEU G CD2 1 
ATOM   8521  N  N   . GLU G  1 66  ? -56.579  -22.348  46.095  1.00 2.37  ? 66  GLU G N   1 
ATOM   8522  C  CA  . GLU G  1 66  ? -57.114  -22.796  47.396  1.00 3.42  ? 66  GLU G CA  1 
ATOM   8523  C  C   . GLU G  1 66  ? -58.399  -22.112  47.859  1.00 3.00  ? 66  GLU G C   1 
ATOM   8524  O  O   . GLU G  1 66  ? -58.628  -21.996  49.044  1.00 3.13  ? 66  GLU G O   1 
ATOM   8525  C  CB  . GLU G  1 66  ? -56.028  -22.793  48.492  1.00 2.97  ? 66  GLU G CB  1 
ATOM   8526  C  CG  . GLU G  1 66  ? -54.828  -23.708  48.121  1.00 6.17  ? 66  GLU G CG  1 
ATOM   8527  C  CD  . GLU G  1 66  ? -53.650  -23.639  49.078  1.00 5.86  ? 66  GLU G CD  1 
ATOM   8528  O  OE1 . GLU G  1 66  ? -53.862  -23.430  50.302  1.00 11.45 ? 66  GLU G OE1 1 
ATOM   8529  O  OE2 . GLU G  1 66  ? -52.509  -23.815  48.605  1.00 6.69  ? 66  GLU G OE2 1 
ATOM   8530  N  N   . GLY G  1 67  ? -59.251  -21.692  46.922  1.00 2.93  ? 67  GLY G N   1 
ATOM   8531  C  CA  . GLY G  1 67  ? -60.591  -21.184  47.253  1.00 3.05  ? 67  GLY G CA  1 
ATOM   8532  C  C   . GLY G  1 67  ? -61.673  -22.231  46.977  1.00 4.23  ? 67  GLY G C   1 
ATOM   8533  O  O   . GLY G  1 67  ? -61.383  -23.338  46.522  1.00 4.47  ? 67  GLY G O   1 
ATOM   8534  N  N   . LEU G  1 68  ? -62.918  -21.868  47.259  1.00 4.23  ? 68  LEU G N   1 
ATOM   8535  C  CA  . LEU G  1 68  ? -64.055  -22.735  47.115  1.00 4.18  ? 68  LEU G CA  1 
ATOM   8536  C  C   . LEU G  1 68  ? -64.887  -22.302  45.914  1.00 3.82  ? 68  LEU G C   1 
ATOM   8537  O  O   . LEU G  1 68  ? -65.560  -21.284  45.986  1.00 3.75  ? 68  LEU G O   1 
ATOM   8538  C  CB  . LEU G  1 68  ? -64.913  -22.607  48.355  1.00 4.20  ? 68  LEU G CB  1 
ATOM   8539  C  CG  . LEU G  1 68  ? -64.792  -23.522  49.591  1.00 6.83  ? 68  LEU G CG  1 
ATOM   8540  C  CD1 . LEU G  1 68  ? -63.655  -24.569  49.564  1.00 5.19  ? 68  LEU G CD1 1 
ATOM   8541  C  CD2 . LEU G  1 68  ? -64.765  -22.656  50.877  1.00 6.26  ? 68  LEU G CD2 1 
ATOM   8542  N  N   . PRO G  1 69  ? -64.846  -23.064  44.801  1.00 3.49  ? 69  PRO G N   1 
ATOM   8543  C  CA  . PRO G  1 69  ? -65.669  -22.676  43.658  1.00 3.06  ? 69  PRO G CA  1 
ATOM   8544  C  C   . PRO G  1 69  ? -67.132  -22.731  44.045  1.00 3.63  ? 69  PRO G C   1 
ATOM   8545  O  O   . PRO G  1 69  ? -67.567  -23.655  44.758  1.00 3.63  ? 69  PRO G O   1 
ATOM   8546  C  CB  . PRO G  1 69  ? -65.364  -23.738  42.607  1.00 2.07  ? 69  PRO G CB  1 
ATOM   8547  C  CG  . PRO G  1 69  ? -64.105  -24.345  43.018  1.00 2.01  ? 69  PRO G CG  1 
ATOM   8548  C  CD  . PRO G  1 69  ? -64.059  -24.277  44.517  1.00 2.82  ? 69  PRO G CD  1 
ATOM   8549  N  N   . ASN G  1 70  ? -67.882  -21.721  43.596  1.00 4.06  ? 70  ASN G N   1 
ATOM   8550  C  CA  . ASN G  1 70  ? -69.272  -21.601  43.942  1.00 4.41  ? 70  ASN G CA  1 
ATOM   8551  C  C   . ASN G  1 70  ? -70.116  -21.942  42.727  1.00 4.81  ? 70  ASN G C   1 
ATOM   8552  O  O   . ASN G  1 70  ? -70.219  -21.130  41.814  1.00 5.56  ? 70  ASN G O   1 
ATOM   8553  C  CB  . ASN G  1 70  ? -69.554  -20.184  44.375  1.00 4.01  ? 70  ASN G CB  1 
ATOM   8554  C  CG  . ASN G  1 70  ? -70.980  -19.992  44.853  1.00 5.26  ? 70  ASN G CG  1 
ATOM   8555  O  OD1 . ASN G  1 70  ? -71.817  -20.893  44.762  1.00 6.70  ? 70  ASN G OD1 1 
ATOM   8556  N  ND2 . ASN G  1 70  ? -71.266  -18.813  45.363  1.00 4.50  ? 70  ASN G ND2 1 
ATOM   8557  N  N   . LEU G  1 71  ? -70.702  -23.133  42.716  1.00 4.73  ? 71  LEU G N   1 
ATOM   8558  C  CA  . LEU G  1 71  ? -71.624  -23.535  41.678  1.00 4.85  ? 71  LEU G CA  1 
ATOM   8559  C  C   . LEU G  1 71  ? -73.079  -23.569  42.205  1.00 6.11  ? 71  LEU G C   1 
ATOM   8560  O  O   . LEU G  1 71  ? -73.992  -24.075  41.537  1.00 6.82  ? 71  LEU G O   1 
ATOM   8561  C  CB  . LEU G  1 71  ? -71.227  -24.908  41.159  1.00 4.05  ? 71  LEU G CB  1 
ATOM   8562  C  CG  . LEU G  1 71  ? -70.066  -24.903  40.159  1.00 4.62  ? 71  LEU G CG  1 
ATOM   8563  C  CD1 . LEU G  1 71  ? -68.748  -24.914  40.863  1.00 3.71  ? 71  LEU G CD1 1 
ATOM   8564  C  CD2 . LEU G  1 71  ? -70.171  -26.062  39.179  1.00 2.87  ? 71  LEU G CD2 1 
ATOM   8565  N  N   . GLN G  1 72  ? -73.298  -23.044  43.407  1.00 7.02  ? 72  GLN G N   1 
ATOM   8566  C  CA  . GLN G  1 72  ? -74.587  -23.160  44.035  1.00 7.64  ? 72  GLN G CA  1 
ATOM   8567  C  C   . GLN G  1 72  ? -75.451  -22.009  43.565  1.00 8.18  ? 72  GLN G C   1 
ATOM   8568  O  O   . GLN G  1 72  ? -76.610  -22.209  43.254  1.00 8.83  ? 72  GLN G O   1 
ATOM   8569  C  CB  . GLN G  1 72  ? -74.449  -23.158  45.557  1.00 7.95  ? 72  GLN G CB  1 
ATOM   8570  C  CG  . GLN G  1 72  ? -75.785  -23.117  46.321  1.00 9.05  ? 72  GLN G CG  1 
ATOM   8571  C  CD  . GLN G  1 72  ? -76.582  -24.388  46.128  1.00 11.25 ? 72  GLN G CD  1 
ATOM   8572  O  OE1 . GLN G  1 72  ? -76.316  -25.421  46.785  1.00 12.93 ? 72  GLN G OE1 1 
ATOM   8573  N  NE2 . GLN G  1 72  ? -77.547  -24.342  45.212  1.00 7.90  ? 72  GLN G NE2 1 
ATOM   8574  N  N   . ASP G  1 73  ? -74.895  -20.807  43.499  1.00 8.81  ? 73  ASP G N   1 
ATOM   8575  C  CA  . ASP G  1 73  ? -75.707  -19.630  43.184  1.00 9.66  ? 73  ASP G CA  1 
ATOM   8576  C  C   . ASP G  1 73  ? -75.769  -19.428  41.683  1.00 10.11 ? 73  ASP G C   1 
ATOM   8577  O  O   . ASP G  1 73  ? -74.720  -19.486  40.996  1.00 12.25 ? 73  ASP G O   1 
ATOM   8578  C  CB  . ASP G  1 73  ? -75.160  -18.381  43.886  1.00 9.50  ? 73  ASP G CB  1 
ATOM   8579  C  CG  . ASP G  1 73  ? -75.072  -18.564  45.406  1.00 11.89 ? 73  ASP G CG  1 
ATOM   8580  O  OD1 . ASP G  1 73  ? -76.003  -19.200  45.987  1.00 13.93 ? 73  ASP G OD1 1 
ATOM   8581  O  OD2 . ASP G  1 73  ? -74.072  -18.111  46.015  1.00 12.35 ? 73  ASP G OD2 1 
ATOM   8582  N  N   . LEU G  1 74  ? -76.979  -19.226  41.165  1.00 9.55  ? 74  LEU G N   1 
ATOM   8583  C  CA  . LEU G  1 74  ? -77.180  -19.046  39.729  1.00 8.35  ? 74  LEU G CA  1 
ATOM   8584  C  C   . LEU G  1 74  ? -77.929  -17.746  39.495  1.00 8.41  ? 74  LEU G C   1 
ATOM   8585  O  O   . LEU G  1 74  ? -79.048  -17.590  39.983  1.00 8.69  ? 74  LEU G O   1 
ATOM   8586  C  CB  . LEU G  1 74  ? -77.964  -20.230  39.157  1.00 7.93  ? 74  LEU G CB  1 
ATOM   8587  C  CG  . LEU G  1 74  ? -78.052  -20.362  37.629  1.00 7.55  ? 74  LEU G CG  1 
ATOM   8588  C  CD1 . LEU G  1 74  ? -76.691  -20.532  36.978  1.00 4.13  ? 74  LEU G CD1 1 
ATOM   8589  C  CD2 . LEU G  1 74  ? -78.976  -21.502  37.193  1.00 7.40  ? 74  LEU G CD2 1 
ATOM   8590  N  N   . GLY G  1 75  ? -77.310  -16.823  38.752  1.00 8.30  ? 75  GLY G N   1 
ATOM   8591  C  CA  . GLY G  1 75  ? -77.918  -15.522  38.434  1.00 8.43  ? 75  GLY G CA  1 
ATOM   8592  C  C   . GLY G  1 75  ? -79.150  -15.594  37.542  1.00 9.38  ? 75  GLY G C   1 
ATOM   8593  O  O   . GLY G  1 75  ? -79.569  -16.692  37.109  1.00 9.30  ? 75  GLY G O   1 
ATOM   8594  N  N   . LYS G  1 76  ? -79.754  -14.430  37.277  1.00 10.21 ? 76  LYS G N   1 
ATOM   8595  C  CA  . LYS G  1 76  ? -80.970  -14.389  36.455  1.00 11.65 ? 76  LYS G CA  1 
ATOM   8596  C  C   . LYS G  1 76  ? -80.714  -14.772  34.997  1.00 10.51 ? 76  LYS G C   1 
ATOM   8597  O  O   . LYS G  1 76  ? -79.896  -14.144  34.304  1.00 10.80 ? 76  LYS G O   1 
ATOM   8598  C  CB  . LYS G  1 76  ? -81.733  -13.050  36.549  1.00 11.56 ? 76  LYS G CB  1 
ATOM   8599  C  CG  . LYS G  1 76  ? -83.231  -13.250  36.141  1.00 15.46 ? 76  LYS G CG  1 
ATOM   8600  C  CD  . LYS G  1 76  ? -84.111  -11.956  36.127  1.00 15.70 ? 76  LYS G CD  1 
ATOM   8601  C  CE  . LYS G  1 76  ? -85.483  -12.175  35.372  1.00 18.65 ? 76  LYS G CE  1 
ATOM   8602  N  NZ  . LYS G  1 76  ? -86.271  -10.840  35.225  1.00 20.33 ? 76  LYS G NZ  1 
ATOM   8603  N  N   . LEU G  1 77  ? -81.399  -15.834  34.567  1.00 9.99  ? 77  LEU G N   1 
ATOM   8604  C  CA  . LEU G  1 77  ? -81.571  -16.165  33.149  1.00 9.44  ? 77  LEU G CA  1 
ATOM   8605  C  C   . LEU G  1 77  ? -82.638  -15.257  32.558  1.00 9.38  ? 77  LEU G C   1 
ATOM   8606  O  O   . LEU G  1 77  ? -83.617  -14.935  33.226  1.00 9.87  ? 77  LEU G O   1 
ATOM   8607  C  CB  . LEU G  1 77  ? -82.067  -17.603  33.020  1.00 9.21  ? 77  LEU G CB  1 
ATOM   8608  C  CG  . LEU G  1 77  ? -81.119  -18.724  32.632  1.00 8.99  ? 77  LEU G CG  1 
ATOM   8609  C  CD1 . LEU G  1 77  ? -79.880  -18.675  33.465  1.00 7.31  ? 77  LEU G CD1 1 
ATOM   8610  C  CD2 . LEU G  1 77  ? -81.860  -20.014  32.876  1.00 9.57  ? 77  LEU G CD2 1 
ATOM   8611  N  N   . ASN G  1 78  ? -82.456  -14.819  31.318  1.00 9.53  ? 78  ASN G N   1 
ATOM   8612  C  CA  . ASN G  1 78  ? -83.522  -14.096  30.630  1.00 9.46  ? 78  ASN G CA  1 
ATOM   8613  C  C   . ASN G  1 78  ? -83.662  -14.789  29.280  1.00 9.28  ? 78  ASN G C   1 
ATOM   8614  O  O   . ASN G  1 78  ? -82.773  -14.674  28.438  1.00 9.78  ? 78  ASN G O   1 
ATOM   8615  C  CB  . ASN G  1 78  ? -83.211  -12.600  30.520  1.00 9.39  ? 78  ASN G CB  1 
ATOM   8616  C  CG  . ASN G  1 78  ? -84.260  -11.818  29.678  1.00 12.27 ? 78  ASN G CG  1 
ATOM   8617  O  OD1 . ASN G  1 78  ? -85.352  -12.325  29.352  1.00 13.89 ? 78  ASN G OD1 1 
ATOM   8618  N  ND2 . ASN G  1 78  ? -83.913  -10.572  29.321  1.00 12.53 ? 78  ASN G ND2 1 
ATOM   8619  N  N   . ILE G  1 79  ? -84.739  -15.572  29.118  1.00 8.78  ? 79  ILE G N   1 
ATOM   8620  C  CA  . ILE G  1 79  ? -84.844  -16.495  28.001  1.00 8.25  ? 79  ILE G CA  1 
ATOM   8621  C  C   . ILE G  1 79  ? -85.387  -15.830  26.739  1.00 8.75  ? 79  ILE G C   1 
ATOM   8622  O  O   . ILE G  1 79  ? -84.732  -15.881  25.689  1.00 9.19  ? 79  ILE G O   1 
ATOM   8623  C  CB  . ILE G  1 79  ? -85.672  -17.748  28.328  1.00 8.10  ? 79  ILE G CB  1 
ATOM   8624  C  CG1 . ILE G  1 79  ? -85.129  -18.483  29.563  1.00 7.59  ? 79  ILE G CG1 1 
ATOM   8625  C  CG2 . ILE G  1 79  ? -85.701  -18.676  27.129  1.00 7.80  ? 79  ILE G CG2 1 
ATOM   8626  C  CD1 . ILE G  1 79  ? -83.620  -18.837  29.523  1.00 5.78  ? 79  ILE G CD1 1 
ATOM   8627  N  N   . GLY G  1 80  ? -86.551  -15.195  26.834  1.00 8.40  ? 80  GLY G N   1 
ATOM   8628  C  CA  . GLY G  1 80  ? -87.111  -14.510  25.673  1.00 8.55  ? 80  GLY G CA  1 
ATOM   8629  C  C   . GLY G  1 80  ? -87.989  -15.482  24.900  1.00 9.10  ? 80  GLY G C   1 
ATOM   8630  O  O   . GLY G  1 80  ? -87.894  -16.702  25.099  1.00 9.09  ? 80  GLY G O   1 
ATOM   8631  N  N   . GLU G  1 81  ? -88.852  -14.971  24.019  1.00 9.34  ? 81  GLU G N   1 
ATOM   8632  C  CA  . GLU G  1 81  ? -89.807  -15.859  23.374  1.00 10.14 ? 81  GLU G CA  1 
ATOM   8633  C  C   . GLU G  1 81  ? -89.639  -15.949  21.865  1.00 9.37  ? 81  GLU G C   1 
ATOM   8634  O  O   . GLU G  1 81  ? -90.209  -16.862  21.258  1.00 10.28 ? 81  GLU G O   1 
ATOM   8635  C  CB  . GLU G  1 81  ? -91.249  -15.484  23.746  1.00 9.66  ? 81  GLU G CB  1 
ATOM   8636  C  CG  . GLU G  1 81  ? -91.608  -15.616  25.266  1.00 12.25 ? 81  GLU G CG  1 
ATOM   8637  C  CD  . GLU G  1 81  ? -92.829  -14.714  25.660  1.00 15.06 ? 81  GLU G CD  1 
ATOM   8638  O  OE1 . GLU G  1 81  ? -92.830  -13.479  25.339  1.00 20.84 ? 81  GLU G OE1 1 
ATOM   8639  O  OE2 . GLU G  1 81  ? -93.786  -15.221  26.287  1.00 19.47 ? 81  GLU G OE2 1 
ATOM   8640  N  N   . ASP G  1 82  ? -88.892  -15.009  21.256  1.00 8.72  ? 82  ASP G N   1 
ATOM   8641  C  CA  . ASP G  1 82  ? -88.560  -15.052  19.797  1.00 7.39  ? 82  ASP G CA  1 
ATOM   8642  C  C   . ASP G  1 82  ? -87.065  -14.841  19.520  1.00 6.42  ? 82  ASP G C   1 
ATOM   8643  O  O   . ASP G  1 82  ? -86.339  -14.384  20.385  1.00 6.39  ? 82  ASP G O   1 
ATOM   8644  C  CB  . ASP G  1 82  ? -89.393  -14.056  18.991  1.00 7.26  ? 82  ASP G CB  1 
ATOM   8645  C  CG  . ASP G  1 82  ? -89.217  -12.631  19.462  1.00 10.33 ? 82  ASP G CG  1 
ATOM   8646  O  OD1 . ASP G  1 82  ? -90.228  -12.013  19.849  1.00 16.59 ? 82  ASP G OD1 1 
ATOM   8647  O  OD2 . ASP G  1 82  ? -88.088  -12.088  19.470  1.00 12.03 ? 82  ASP G OD2 1 
ATOM   8648  N  N   . VAL G  1 83  ? -86.624  -15.142  18.305  1.00 5.65  ? 83  VAL G N   1 
ATOM   8649  C  CA  . VAL G  1 83  ? -85.210  -15.129  17.930  1.00 4.92  ? 83  VAL G CA  1 
ATOM   8650  C  C   . VAL G  1 83  ? -84.483  -13.863  18.347  1.00 5.06  ? 83  VAL G C   1 
ATOM   8651  O  O   . VAL G  1 83  ? -83.472  -13.935  19.089  1.00 5.08  ? 83  VAL G O   1 
ATOM   8652  C  CB  . VAL G  1 83  ? -85.027  -15.358  16.420  1.00 4.68  ? 83  VAL G CB  1 
ATOM   8653  C  CG1 . VAL G  1 83  ? -83.569  -15.419  16.049  1.00 4.01  ? 83  VAL G CG1 1 
ATOM   8654  C  CG2 . VAL G  1 83  ? -85.684  -16.638  16.034  1.00 4.70  ? 83  VAL G CG2 1 
ATOM   8655  N  N   . GLU G  1 84  ? -84.975  -12.715  17.883  1.00 4.69  ? 84  GLU G N   1 
ATOM   8656  C  CA  . GLU G  1 84  ? -84.369  -11.439  18.227  1.00 5.41  ? 84  GLU G CA  1 
ATOM   8657  C  C   . GLU G  1 84  ? -84.231  -11.268  19.748  1.00 5.72  ? 84  GLU G C   1 
ATOM   8658  O  O   . GLU G  1 84  ? -83.140  -11.017  20.263  1.00 5.74  ? 84  GLU G O   1 
ATOM   8659  C  CB  . GLU G  1 84  ? -85.184  -10.275  17.670  1.00 5.57  ? 84  GLU G CB  1 
ATOM   8660  C  CG  . GLU G  1 84  ? -84.291  -9.115   17.219  1.00 9.23  ? 84  GLU G CG  1 
ATOM   8661  C  CD  . GLU G  1 84  ? -85.032  -7.799   17.058  1.00 13.96 ? 84  GLU G CD  1 
ATOM   8662  O  OE1 . GLU G  1 84  ? -86.123  -7.798   16.426  1.00 16.30 ? 84  GLU G OE1 1 
ATOM   8663  O  OE2 . GLU G  1 84  ? -84.513  -6.761   17.552  1.00 13.51 ? 84  GLU G OE2 1 
ATOM   8664  N  N   . GLU G  1 85  ? -85.341  -11.426  20.460  1.00 5.76  ? 85  GLU G N   1 
ATOM   8665  C  CA  . GLU G  1 85  ? -85.359  -11.267  21.888  1.00 6.71  ? 85  GLU G CA  1 
ATOM   8666  C  C   . GLU G  1 85  ? -84.305  -12.194  22.488  1.00 5.73  ? 85  GLU G C   1 
ATOM   8667  O  O   . GLU G  1 85  ? -83.559  -11.814  23.408  1.00 5.40  ? 85  GLU G O   1 
ATOM   8668  C  CB  . GLU G  1 85  ? -86.748  -11.641  22.358  1.00 6.72  ? 85  GLU G CB  1 
ATOM   8669  C  CG  . GLU G  1 85  ? -87.342  -10.859  23.526  1.00 9.96  ? 85  GLU G CG  1 
ATOM   8670  C  CD  . GLU G  1 85  ? -88.882  -11.071  23.628  1.00 11.72 ? 85  GLU G CD  1 
ATOM   8671  O  OE1 . GLU G  1 85  ? -89.598  -10.926  22.583  1.00 15.08 ? 85  GLU G OE1 1 
ATOM   8672  O  OE2 . GLU G  1 85  ? -89.380  -11.374  24.743  1.00 16.79 ? 85  GLU G OE2 1 
ATOM   8673  N  N   . MET G  1 86  ? -84.200  -13.410  21.966  1.00 4.97  ? 86  MET G N   1 
ATOM   8674  C  CA  . MET G  1 86  ? -83.277  -14.323  22.613  1.00 5.01  ? 86  MET G CA  1 
ATOM   8675  C  C   . MET G  1 86  ? -81.836  -14.015  22.277  1.00 4.96  ? 86  MET G C   1 
ATOM   8676  O  O   . MET G  1 86  ? -80.954  -14.101  23.139  1.00 5.56  ? 86  MET G O   1 
ATOM   8677  C  CB  . MET G  1 86  ? -83.660  -15.827  22.544  1.00 4.77  ? 86  MET G CB  1 
ATOM   8678  C  CG  . MET G  1 86  ? -84.233  -16.326  21.278  1.00 6.70  ? 86  MET G CG  1 
ATOM   8679  S  SD  . MET G  1 86  ? -85.364  -17.694  21.450  1.00 4.96  ? 86  MET G SD  1 
ATOM   8680  C  CE  . MET G  1 86  ? -84.278  -19.120  21.557  1.00 3.17  ? 86  MET G CE  1 
ATOM   8681  N  N   . LEU G  1 87  ? -81.595  -13.582  21.054  1.00 4.78  ? 87  LEU G N   1 
ATOM   8682  C  CA  . LEU G  1 87  ? -80.249  -13.197  20.684  1.00 3.92  ? 87  LEU G CA  1 
ATOM   8683  C  C   . LEU G  1 87  ? -79.818  -11.974  21.474  1.00 4.00  ? 87  LEU G C   1 
ATOM   8684  O  O   . LEU G  1 87  ? -78.704  -11.915  21.984  1.00 4.38  ? 87  LEU G O   1 
ATOM   8685  C  CB  . LEU G  1 87  ? -80.180  -12.964  19.184  1.00 3.57  ? 87  LEU G CB  1 
ATOM   8686  C  CG  . LEU G  1 87  ? -79.553  -14.068  18.303  1.00 3.39  ? 87  LEU G CG  1 
ATOM   8687  C  CD1 . LEU G  1 87  ? -79.638  -15.489  18.818  1.00 2.57  ? 87  LEU G CD1 1 
ATOM   8688  C  CD2 . LEU G  1 87  ? -80.164  -13.984  16.944  1.00 4.17  ? 87  LEU G CD2 1 
ATOM   8689  N  N   . ARG G  1 88  ? -80.718  -11.019  21.610  1.00 4.00  ? 88  ARG G N   1 
ATOM   8690  C  CA  . ARG G  1 88  ? -80.456  -9.761   22.287  1.00 4.79  ? 88  ARG G CA  1 
ATOM   8691  C  C   . ARG G  1 88  ? -80.141  -10.061  23.738  1.00 4.69  ? 88  ARG G C   1 
ATOM   8692  O  O   . ARG G  1 88  ? -79.295  -9.424   24.356  1.00 5.43  ? 88  ARG G O   1 
ATOM   8693  C  CB  . ARG G  1 88  ? -81.689  -8.860   22.187  1.00 4.19  ? 88  ARG G CB  1 
ATOM   8694  C  CG  . ARG G  1 88  ? -81.425  -7.497   21.663  1.00 5.33  ? 88  ARG G CG  1 
ATOM   8695  C  CD  . ARG G  1 88  ? -82.712  -6.708   21.333  1.00 7.14  ? 88  ARG G CD  1 
ATOM   8696  N  NE  . ARG G  1 88  ? -82.868  -6.422   19.895  1.00 13.54 ? 88  ARG G NE  1 
ATOM   8697  C  CZ  . ARG G  1 88  ? -81.976  -5.752   19.129  1.00 14.68 ? 88  ARG G CZ  1 
ATOM   8698  N  NH1 . ARG G  1 88  ? -80.810  -5.283   19.624  1.00 13.83 ? 88  ARG G NH1 1 
ATOM   8699  N  NH2 . ARG G  1 88  ? -82.226  -5.575   17.838  1.00 13.12 ? 88  ARG G NH2 1 
ATOM   8700  N  N   . SER G  1 89  ? -80.806  -11.072  24.291  1.00 4.71  ? 89  SER G N   1 
ATOM   8701  C  CA  . SER G  1 89  ? -80.597  -11.397  25.688  1.00 4.19  ? 89  SER G CA  1 
ATOM   8702  C  C   . SER G  1 89  ? -79.199  -11.999  25.928  1.00 4.52  ? 89  SER G C   1 
ATOM   8703  O  O   . SER G  1 89  ? -78.554  -11.666  26.935  1.00 4.77  ? 89  SER G O   1 
ATOM   8704  C  CB  . SER G  1 89  ? -81.685  -12.313  26.172  1.00 4.05  ? 89  SER G CB  1 
ATOM   8705  O  OG  . SER G  1 89  ? -81.445  -12.660  27.518  1.00 3.48  ? 89  SER G OG  1 
ATOM   8706  N  N   . ASP G  1 90  ? -78.740  -12.864  25.011  1.00 3.85  ? 90  ASP G N   1 
ATOM   8707  C  CA  . ASP G  1 90  ? -77.406  -13.412  25.076  1.00 3.79  ? 90  ASP G CA  1 
ATOM   8708  C  C   . ASP G  1 90  ? -76.388  -12.298  24.953  1.00 3.88  ? 90  ASP G C   1 
ATOM   8709  O  O   . ASP G  1 90  ? -75.388  -12.307  25.675  1.00 4.17  ? 90  ASP G O   1 
ATOM   8710  C  CB  . ASP G  1 90  ? -77.166  -14.447  23.981  1.00 4.12  ? 90  ASP G CB  1 
ATOM   8711  C  CG  . ASP G  1 90  ? -77.979  -15.749  24.171  1.00 6.82  ? 90  ASP G CG  1 
ATOM   8712  O  OD1 . ASP G  1 90  ? -78.376  -16.385  23.140  1.00 9.14  ? 90  ASP G OD1 1 
ATOM   8713  O  OD2 . ASP G  1 90  ? -78.207  -16.170  25.342  1.00 9.73  ? 90  ASP G OD2 1 
ATOM   8714  N  N   . LEU G  1 91  ? -76.632  -11.334  24.052  1.00 3.65  ? 91  LEU G N   1 
ATOM   8715  C  CA  . LEU G  1 91  ? -75.746  -10.164  23.901  1.00 2.83  ? 91  LEU G CA  1 
ATOM   8716  C  C   . LEU G  1 91  ? -75.658  -9.338   25.184  1.00 3.08  ? 91  LEU G C   1 
ATOM   8717  O  O   . LEU G  1 91  ? -74.576  -8.998   25.612  1.00 3.72  ? 91  LEU G O   1 
ATOM   8718  C  CB  . LEU G  1 91  ? -76.170  -9.296   22.720  1.00 2.84  ? 91  LEU G CB  1 
ATOM   8719  C  CG  . LEU G  1 91  ? -75.439  -7.992   22.455  1.00 2.00  ? 91  LEU G CG  1 
ATOM   8720  C  CD1 . LEU G  1 91  ? -73.971  -8.269   22.231  1.00 2.68  ? 91  LEU G CD1 1 
ATOM   8721  C  CD2 . LEU G  1 91  ? -76.038  -7.253   21.287  1.00 2.00  ? 91  LEU G CD2 1 
ATOM   8722  N  N   . ALA G  1 92  ? -76.781  -9.037   25.830  1.00 3.25  ? 92  ALA G N   1 
ATOM   8723  C  CA  . ALA G  1 92  ? -76.728  -8.259   27.077  1.00 3.19  ? 92  ALA G CA  1 
ATOM   8724  C  C   . ALA G  1 92  ? -75.877  -9.000   28.112  1.00 3.62  ? 92  ALA G C   1 
ATOM   8725  O  O   . ALA G  1 92  ? -75.080  -8.393   28.869  1.00 4.27  ? 92  ALA G O   1 
ATOM   8726  C  CB  . ALA G  1 92  ? -78.124  -7.937   27.605  1.00 2.00  ? 92  ALA G CB  1 
ATOM   8727  N  N   . LEU G  1 93  ? -76.017  -10.313  28.124  1.00 3.81  ? 93  LEU G N   1 
ATOM   8728  C  CA  . LEU G  1 93  ? -75.312  -11.143  29.083  1.00 4.32  ? 93  LEU G CA  1 
ATOM   8729  C  C   . LEU G  1 93  ? -73.808  -11.127  28.869  1.00 4.80  ? 93  LEU G C   1 
ATOM   8730  O  O   . LEU G  1 93  ? -73.049  -11.007  29.839  1.00 5.12  ? 93  LEU G O   1 
ATOM   8731  C  CB  . LEU G  1 93  ? -75.830  -12.565  29.006  1.00 4.20  ? 93  LEU G CB  1 
ATOM   8732  C  CG  . LEU G  1 93  ? -75.433  -13.463  30.160  1.00 5.17  ? 93  LEU G CG  1 
ATOM   8733  C  CD1 . LEU G  1 93  ? -75.979  -12.899  31.490  1.00 5.05  ? 93  LEU G CD1 1 
ATOM   8734  C  CD2 . LEU G  1 93  ? -75.985  -14.837  29.867  1.00 4.50  ? 93  LEU G CD2 1 
ATOM   8735  N  N   . GLU G  1 94  ? -73.383  -11.231  27.600  1.00 4.94  ? 94  GLU G N   1 
ATOM   8736  C  CA  . GLU G  1 94  ? -71.972  -11.174  27.240  1.00 5.04  ? 94  GLU G CA  1 
ATOM   8737  C  C   . GLU G  1 94  ? -71.391  -9.799   27.611  1.00 4.87  ? 94  GLU G C   1 
ATOM   8738  O  O   . GLU G  1 94  ? -70.288  -9.688   28.154  1.00 4.45  ? 94  GLU G O   1 
ATOM   8739  C  CB  . GLU G  1 94  ? -71.773  -11.460  25.761  1.00 5.03  ? 94  GLU G CB  1 
ATOM   8740  C  CG  . GLU G  1 94  ? -72.153  -12.836  25.324  1.00 7.75  ? 94  GLU G CG  1 
ATOM   8741  C  CD  . GLU G  1 94  ? -71.036  -13.861  25.485  1.00 13.84 ? 94  GLU G CD  1 
ATOM   8742  O  OE1 . GLU G  1 94  ? -69.957  -13.493  26.030  1.00 15.12 ? 94  GLU G OE1 1 
ATOM   8743  O  OE2 . GLU G  1 94  ? -71.229  -15.046  25.082  1.00 14.51 ? 94  GLU G OE2 1 
ATOM   8744  N  N   . LEU G  1 95  ? -72.154  -8.754   27.326  1.00 4.98  ? 95  LEU G N   1 
ATOM   8745  C  CA  . LEU G  1 95  ? -71.753  -7.415   27.678  1.00 4.83  ? 95  LEU G CA  1 
ATOM   8746  C  C   . LEU G  1 95  ? -71.544  -7.238   29.197  1.00 5.52  ? 95  LEU G C   1 
ATOM   8747  O  O   . LEU G  1 95  ? -70.553  -6.643   29.605  1.00 5.91  ? 95  LEU G O   1 
ATOM   8748  C  CB  . LEU G  1 95  ? -72.746  -6.412   27.123  1.00 4.57  ? 95  LEU G CB  1 
ATOM   8749  C  CG  . LEU G  1 95  ? -72.377  -5.649   25.843  1.00 4.46  ? 95  LEU G CG  1 
ATOM   8750  C  CD1 . LEU G  1 95  ? -71.272  -6.279   25.045  1.00 2.66  ? 95  LEU G CD1 1 
ATOM   8751  C  CD2 . LEU G  1 95  ? -73.593  -5.435   24.980  1.00 3.33  ? 95  LEU G CD2 1 
ATOM   8752  N  N   . ASP G  1 96  ? -72.431  -7.775   30.028  1.00 5.50  ? 96  ASP G N   1 
ATOM   8753  C  CA  . ASP G  1 96  ? -72.193  -7.662   31.451  1.00 6.34  ? 96  ASP G CA  1 
ATOM   8754  C  C   . ASP G  1 96  ? -71.006  -8.476   31.935  1.00 5.91  ? 96  ASP G C   1 
ATOM   8755  O  O   . ASP G  1 96  ? -70.301  -8.093   32.869  1.00 5.81  ? 96  ASP G O   1 
ATOM   8756  C  CB  . ASP G  1 96  ? -73.429  -8.040   32.266  1.00 7.37  ? 96  ASP G CB  1 
ATOM   8757  C  CG  . ASP G  1 96  ? -74.479  -6.936   32.272  1.00 13.91 ? 96  ASP G CG  1 
ATOM   8758  O  OD1 . ASP G  1 96  ? -74.125  -5.706   32.145  1.00 19.36 ? 96  ASP G OD1 1 
ATOM   8759  O  OD2 . ASP G  1 96  ? -75.673  -7.306   32.398  1.00 19.45 ? 96  ASP G OD2 1 
ATOM   8760  N  N   . GLY G  1 97  ? -70.801  -9.631   31.335  1.00 5.50  ? 97  GLY G N   1 
ATOM   8761  C  CA  . GLY G  1 97  ? -69.662  -10.419  31.709  1.00 5.58  ? 97  GLY G CA  1 
ATOM   8762  C  C   . GLY G  1 97  ? -68.355  -9.784   31.247  1.00 5.92  ? 97  GLY G C   1 
ATOM   8763  O  O   . GLY G  1 97  ? -67.340  -9.900   31.926  1.00 5.93  ? 97  GLY G O   1 
ATOM   8764  N  N   . ALA G  1 98  ? -68.350  -9.138   30.081  1.00 6.51  ? 98  ALA G N   1 
ATOM   8765  C  CA  . ALA G  1 98  ? -67.137  -8.501   29.607  1.00 7.78  ? 98  ALA G CA  1 
ATOM   8766  C  C   . ALA G  1 98  ? -66.733  -7.393   30.583  1.00 9.22  ? 98  ALA G C   1 
ATOM   8767  O  O   . ALA G  1 98  ? -65.556  -7.218   30.893  1.00 8.86  ? 98  ALA G O   1 
ATOM   8768  C  CB  . ALA G  1 98  ? -67.323  -7.961   28.203  1.00 6.35  ? 98  ALA G CB  1 
ATOM   8769  N  N   . LYS G  1 99  ? -67.736  -6.680   31.089  1.00 11.33 ? 99  LYS G N   1 
ATOM   8770  C  CA  . LYS G  1 99  ? -67.552  -5.618   32.050  1.00 13.63 ? 99  LYS G CA  1 
ATOM   8771  C  C   . LYS G  1 99  ? -66.866  -6.182   33.292  1.00 11.98 ? 99  LYS G C   1 
ATOM   8772  O  O   . LYS G  1 99  ? -65.816  -5.679   33.684  1.00 12.41 ? 99  LYS G O   1 
ATOM   8773  C  CB  . LYS G  1 99  ? -68.910  -4.997   32.367  1.00 14.35 ? 99  LYS G CB  1 
ATOM   8774  C  CG  . LYS G  1 99  ? -68.918  -3.551   32.880  1.00 18.33 ? 99  LYS G CG  1 
ATOM   8775  C  CD  . LYS G  1 99  ? -70.362  -2.933   32.816  1.00 19.23 ? 99  LYS G CD  1 
ATOM   8776  C  CE  . LYS G  1 99  ? -70.833  -2.505   31.346  1.00 22.80 ? 99  LYS G CE  1 
ATOM   8777  N  NZ  . LYS G  1 99  ? -72.298  -2.868   31.019  1.00 22.13 ? 99  LYS G NZ  1 
ATOM   8778  N  N   . ASN G  1 100 ? -67.430  -7.248   33.867  1.00 9.87  ? 100 ASN G N   1 
ATOM   8779  C  CA  . ASN G  1 100 ? -66.819  -7.932   35.011  1.00 8.12  ? 100 ASN G CA  1 
ATOM   8780  C  C   . ASN G  1 100 ? -65.383  -8.415   34.746  1.00 7.34  ? 100 ASN G C   1 
ATOM   8781  O  O   . ASN G  1 100 ? -64.502  -8.321   35.617  1.00 6.43  ? 100 ASN G O   1 
ATOM   8782  C  CB  . ASN G  1 100 ? -67.671  -9.116   35.474  1.00 7.86  ? 100 ASN G CB  1 
ATOM   8783  C  CG  . ASN G  1 100 ? -69.068  -8.720   35.945  1.00 8.33  ? 100 ASN G CG  1 
ATOM   8784  O  OD1 . ASN G  1 100 ? -69.982  -9.520   35.865  1.00 9.74  ? 100 ASN G OD1 1 
ATOM   8785  N  ND2 . ASN G  1 100 ? -69.237  -7.502   36.426  1.00 6.52  ? 100 ASN G ND2 1 
ATOM   8786  N  N   . LEU G  1 101 ? -65.157  -8.931   33.536  1.00 5.79  ? 101 LEU G N   1 
ATOM   8787  C  CA  . LEU G  1 101 ? -63.863  -9.432   33.156  1.00 3.83  ? 101 LEU G CA  1 
ATOM   8788  C  C   . LEU G  1 101 ? -62.856  -8.311   33.111  1.00 3.46  ? 101 LEU G C   1 
ATOM   8789  O  O   . LEU G  1 101 ? -61.718  -8.484   33.603  1.00 3.07  ? 101 LEU G O   1 
ATOM   8790  C  CB  . LEU G  1 101 ? -63.932  -10.141  31.818  1.00 4.14  ? 101 LEU G CB  1 
ATOM   8791  C  CG  . LEU G  1 101 ? -64.127  -11.653  31.809  1.00 2.80  ? 101 LEU G CG  1 
ATOM   8792  C  CD1 . LEU G  1 101 ? -64.658  -12.126  30.454  1.00 3.15  ? 101 LEU G CD1 1 
ATOM   8793  C  CD2 . LEU G  1 101 ? -62.854  -12.340  32.130  1.00 2.00  ? 101 LEU G CD2 1 
ATOM   8794  N  N   . ARG G  1 102 ? -63.251  -7.167   32.543  1.00 3.00  ? 102 ARG G N   1 
ATOM   8795  C  CA  A ARG G  1 102 ? -62.361  -5.999   32.482  0.50 3.17  ? 102 ARG G CA  1 
ATOM   8796  C  CA  B ARG G  1 102 ? -62.361  -6.004   32.474  0.50 3.19  ? 102 ARG G CA  1 
ATOM   8797  C  C   . ARG G  1 102 ? -61.926  -5.591   33.892  1.00 3.58  ? 102 ARG G C   1 
ATOM   8798  O  O   . ARG G  1 102 ? -60.748  -5.327   34.143  1.00 3.77  ? 102 ARG G O   1 
ATOM   8799  C  CB  A ARG G  1 102 ? -63.004  -4.834   31.695  0.50 2.54  ? 102 ARG G CB  1 
ATOM   8800  C  CB  B ARG G  1 102 ? -62.999  -4.854   31.653  0.50 2.55  ? 102 ARG G CB  1 
ATOM   8801  C  CG  A ARG G  1 102 ? -63.384  -5.256   30.277  0.50 3.08  ? 102 ARG G CG  1 
ATOM   8802  C  CG  B ARG G  1 102 ? -63.065  -5.179   30.136  0.50 3.15  ? 102 ARG G CG  1 
ATOM   8803  C  CD  A ARG G  1 102 ? -63.574  -4.144   29.256  0.50 3.45  ? 102 ARG G CD  1 
ATOM   8804  C  CD  B ARG G  1 102 ? -63.879  -4.215   29.241  0.50 3.53  ? 102 ARG G CD  1 
ATOM   8805  N  NE  A ARG G  1 102 ? -63.102  -4.596   27.946  0.50 4.47  ? 102 ARG G NE  1 
ATOM   8806  N  NE  B ARG G  1 102 ? -65.293  -4.140   29.628  0.50 5.98  ? 102 ARG G NE  1 
ATOM   8807  C  CZ  A ARG G  1 102 ? -63.855  -5.168   27.024  0.50 5.97  ? 102 ARG G CZ  1 
ATOM   8808  C  CZ  B ARG G  1 102 ? -66.190  -3.260   29.168  0.50 7.19  ? 102 ARG G CZ  1 
ATOM   8809  N  NH1 A ARG G  1 102 ? -65.132  -5.351   27.220  0.50 9.09  ? 102 ARG G NH1 1 
ATOM   8810  N  NH1 B ARG G  1 102 ? -65.869  -2.344   28.261  0.50 10.62 ? 102 ARG G NH1 1 
ATOM   8811  N  NH2 A ARG G  1 102 ? -63.316  -5.559   25.889  0.50 7.39  ? 102 ARG G NH2 1 
ATOM   8812  N  NH2 B ARG G  1 102 ? -67.417  -3.302   29.626  0.50 7.28  ? 102 ARG G NH2 1 
ATOM   8813  N  N   . GLU G  1 103 ? -62.858  -5.627   34.829  1.00 4.02  ? 103 GLU G N   1 
ATOM   8814  C  CA  . GLU G  1 103 ? -62.577  -5.196   36.151  1.00 5.26  ? 103 GLU G CA  1 
ATOM   8815  C  C   . GLU G  1 103 ? -61.649  -6.200   36.832  1.00 4.49  ? 103 GLU G C   1 
ATOM   8816  O  O   . GLU G  1 103 ? -60.628  -5.817   37.392  1.00 5.65  ? 103 GLU G O   1 
ATOM   8817  C  CB  . GLU G  1 103 ? -63.905  -5.067   36.802  1.00 6.24  ? 103 GLU G CB  1 
ATOM   8818  C  CG  . GLU G  1 103 ? -63.939  -4.538   38.191  1.00 15.59 ? 103 GLU G CG  1 
ATOM   8819  C  CD  . GLU G  1 103 ? -65.433  -4.394   38.670  1.00 24.46 ? 103 GLU G CD  1 
ATOM   8820  O  OE1 . GLU G  1 103 ? -66.345  -4.138   37.772  1.00 21.75 ? 103 GLU G OE1 1 
ATOM   8821  O  OE2 . GLU G  1 103 ? -65.638  -4.576   39.925  1.00 23.60 ? 103 GLU G OE2 1 
ATOM   8822  N  N   . ALA G  1 104 ? -61.966  -7.488   36.747  1.00 2.88  ? 104 ALA G N   1 
ATOM   8823  C  CA  . ALA G  1 104 ? -61.146  -8.537   37.353  1.00 2.24  ? 104 ALA G CA  1 
ATOM   8824  C  C   . ALA G  1 104 ? -59.702  -8.529   36.844  1.00 2.27  ? 104 ALA G C   1 
ATOM   8825  O  O   . ALA G  1 104 ? -58.765  -8.705   37.618  1.00 2.00  ? 104 ALA G O   1 
ATOM   8826  C  CB  . ALA G  1 104 ? -61.769  -9.873   37.131  1.00 2.00  ? 104 ALA G CB  1 
ATOM   8827  N  N   . ILE G  1 105 ? -59.544  -8.326   35.537  1.00 2.42  ? 105 ILE G N   1 
ATOM   8828  C  CA  . ILE G  1 105 ? -58.229  -8.319   34.888  1.00 2.28  ? 105 ILE G CA  1 
ATOM   8829  C  C   . ILE G  1 105 ? -57.334  -7.212   35.460  1.00 2.27  ? 105 ILE G C   1 
ATOM   8830  O  O   . ILE G  1 105 ? -56.161  -7.449   35.742  1.00 2.00  ? 105 ILE G O   1 
ATOM   8831  C  CB  . ILE G  1 105 ? -58.370  -8.198   33.343  1.00 2.01  ? 105 ILE G CB  1 
ATOM   8832  C  CG1 . ILE G  1 105 ? -58.867  -9.512   32.778  1.00 2.00  ? 105 ILE G CG1 1 
ATOM   8833  C  CG2 . ILE G  1 105 ? -57.034  -7.884   32.696  1.00 2.56  ? 105 ILE G CG2 1 
ATOM   8834  C  CD1 . ILE G  1 105 ? -59.460  -9.416   31.442  1.00 2.00  ? 105 ILE G CD1 1 
ATOM   8835  N  N   . GLY G  1 106 ? -57.900  -6.022   35.629  1.00 2.18  ? 106 GLY G N   1 
ATOM   8836  C  CA  . GLY G  1 106 ? -57.181  -4.897   36.140  1.00 2.00  ? 106 GLY G CA  1 
ATOM   8837  C  C   . GLY G  1 106 ? -56.758  -5.164   37.563  1.00 2.39  ? 106 GLY G C   1 
ATOM   8838  O  O   . GLY G  1 106 ? -55.626  -4.803   37.953  1.00 3.07  ? 106 GLY G O   1 
ATOM   8839  N  N   . TYR G  1 107 ? -57.630  -5.815   38.341  1.00 2.00  ? 107 TYR G N   1 
ATOM   8840  C  CA  . TYR G  1 107 ? -57.314  -6.061   39.728  1.00 2.00  ? 107 TYR G CA  1 
ATOM   8841  C  C   . TYR G  1 107 ? -56.237  -7.154   39.896  1.00 2.67  ? 107 TYR G C   1 
ATOM   8842  O  O   . TYR G  1 107 ? -55.313  -7.025   40.708  1.00 2.67  ? 107 TYR G O   1 
ATOM   8843  C  CB  . TYR G  1 107 ? -58.566  -6.369   40.533  1.00 2.24  ? 107 TYR G CB  1 
ATOM   8844  C  CG  . TYR G  1 107 ? -58.196  -6.750   41.940  1.00 2.11  ? 107 TYR G CG  1 
ATOM   8845  C  CD1 . TYR G  1 107 ? -57.927  -5.775   42.893  1.00 2.00  ? 107 TYR G CD1 1 
ATOM   8846  C  CD2 . TYR G  1 107 ? -58.022  -8.071   42.284  1.00 2.00  ? 107 TYR G CD2 1 
ATOM   8847  C  CE1 . TYR G  1 107 ? -57.552  -6.113   44.162  1.00 2.11  ? 107 TYR G CE1 1 
ATOM   8848  C  CE2 . TYR G  1 107 ? -57.638  -8.433   43.549  1.00 3.53  ? 107 TYR G CE2 1 
ATOM   8849  C  CZ  . TYR G  1 107 ? -57.396  -7.457   44.490  1.00 3.74  ? 107 TYR G CZ  1 
ATOM   8850  O  OH  . TYR G  1 107 ? -57.003  -7.861   45.750  1.00 4.38  ? 107 TYR G OH  1 
ATOM   8851  N  N   . ALA G  1 108 ? -56.341  -8.225   39.109  1.00 2.84  ? 108 ALA G N   1 
ATOM   8852  C  CA  . ALA G  1 108 ? -55.335  -9.289   39.105  1.00 2.70  ? 108 ALA G CA  1 
ATOM   8853  C  C   . ALA G  1 108 ? -53.929  -8.735   38.820  1.00 2.94  ? 108 ALA G C   1 
ATOM   8854  O  O   . ALA G  1 108 ? -52.951  -9.150   39.456  1.00 2.75  ? 108 ALA G O   1 
ATOM   8855  C  CB  . ALA G  1 108 ? -55.704  -10.403  38.121  1.00 2.02  ? 108 ALA G CB  1 
ATOM   8856  N  N   . ASP G  1 109 ? -53.838  -7.783   37.895  1.00 2.95  ? 109 ASP G N   1 
ATOM   8857  C  CA  . ASP G  1 109 ? -52.584  -7.121   37.594  1.00 3.24  ? 109 ASP G CA  1 
ATOM   8858  C  C   . ASP G  1 109 ? -52.070  -6.379   38.804  1.00 3.33  ? 109 ASP G C   1 
ATOM   8859  O  O   . ASP G  1 109 ? -50.869  -6.354   39.066  1.00 2.70  ? 109 ASP G O   1 
ATOM   8860  C  CB  . ASP G  1 109 ? -52.770  -6.132   36.460  1.00 3.42  ? 109 ASP G CB  1 
ATOM   8861  C  CG  . ASP G  1 109 ? -51.461  -5.631   35.905  1.00 5.62  ? 109 ASP G CG  1 
ATOM   8862  O  OD1 . ASP G  1 109 ? -51.003  -4.547   36.348  1.00 8.72  ? 109 ASP G OD1 1 
ATOM   8863  O  OD2 . ASP G  1 109 ? -50.858  -6.315   35.030  1.00 8.51  ? 109 ASP G OD2 1 
ATOM   8864  N  N   . SER G  1 110 ? -52.962  -5.762   39.564  1.00 3.74  ? 110 SER G N   1 
ATOM   8865  C  CA  . SER G  1 110 ? -52.456  -4.917   40.610  1.00 4.44  ? 110 SER G CA  1 
ATOM   8866  C  C   . SER G  1 110 ? -52.011  -5.698   41.832  1.00 3.84  ? 110 SER G C   1 
ATOM   8867  O  O   . SER G  1 110 ? -51.166  -5.210   42.574  1.00 4.08  ? 110 SER G O   1 
ATOM   8868  C  CB  . SER G  1 110 ? -53.421  -3.799   40.926  1.00 4.69  ? 110 SER G CB  1 
ATOM   8869  O  OG  . SER G  1 110 ? -54.626  -4.362   41.377  1.00 10.39 ? 110 SER G OG  1 
ATOM   8870  N  N   . VAL G  1 111 ? -52.511  -6.920   42.012  1.00 3.44  ? 111 VAL G N   1 
ATOM   8871  C  CA  . VAL G  1 111 ? -51.954  -7.823   43.038  1.00 2.86  ? 111 VAL G CA  1 
ATOM   8872  C  C   . VAL G  1 111 ? -50.963  -8.833   42.475  1.00 2.82  ? 111 VAL G C   1 
ATOM   8873  O  O   . VAL G  1 111 ? -50.580  -9.786   43.163  1.00 2.00  ? 111 VAL G O   1 
ATOM   8874  C  CB  . VAL G  1 111 ? -53.035  -8.610   43.832  1.00 2.93  ? 111 VAL G CB  1 
ATOM   8875  C  CG1 . VAL G  1 111 ? -53.835  -7.694   44.699  1.00 3.09  ? 111 VAL G CG1 1 
ATOM   8876  C  CG2 . VAL G  1 111 ? -53.949  -9.386   42.874  1.00 3.52  ? 111 VAL G CG2 1 
ATOM   8877  N  N   . HIS G  1 112 ? -50.547  -8.646   41.220  1.00 3.27  ? 112 HIS G N   1 
ATOM   8878  C  CA  . HIS G  1 112 ? -49.486  -9.483   40.620  1.00 3.76  ? 112 HIS G CA  1 
ATOM   8879  C  C   . HIS G  1 112 ? -49.887  -10.929  40.309  1.00 3.47  ? 112 HIS G C   1 
ATOM   8880  O  O   . HIS G  1 112 ? -49.022  -11.757  40.108  1.00 4.05  ? 112 HIS G O   1 
ATOM   8881  C  CB  . HIS G  1 112 ? -48.203  -9.430   41.473  1.00 3.87  ? 112 HIS G CB  1 
ATOM   8882  C  CG  . HIS G  1 112 ? -47.633  -8.051   41.606  1.00 8.23  ? 112 HIS G CG  1 
ATOM   8883  N  ND1 . HIS G  1 112 ? -47.964  -7.194   42.643  1.00 12.07 ? 112 HIS G ND1 1 
ATOM   8884  C  CD2 . HIS G  1 112 ? -46.804  -7.350   40.791  1.00 11.32 ? 112 HIS G CD2 1 
ATOM   8885  C  CE1 . HIS G  1 112 ? -47.357  -6.032   42.462  1.00 12.94 ? 112 HIS G CE1 1 
ATOM   8886  N  NE2 . HIS G  1 112 ? -46.639  -6.101   41.353  1.00 12.51 ? 112 HIS G NE2 1 
ATOM   8887  N  N   . ASP G  1 113 ? -51.184  -11.243  40.254  1.00 3.02  ? 113 ASP G N   1 
ATOM   8888  C  CA  . ASP G  1 113 ? -51.639  -12.549  39.819  1.00 2.46  ? 113 ASP G CA  1 
ATOM   8889  C  C   . ASP G  1 113 ? -51.710  -12.574  38.298  1.00 2.13  ? 113 ASP G C   1 
ATOM   8890  O  O   . ASP G  1 113 ? -52.767  -12.626  37.686  1.00 2.00  ? 113 ASP G O   1 
ATOM   8891  C  CB  . ASP G  1 113 ? -52.978  -12.918  40.449  1.00 2.58  ? 113 ASP G CB  1 
ATOM   8892  C  CG  . ASP G  1 113 ? -53.367  -14.406  40.223  1.00 3.40  ? 113 ASP G CG  1 
ATOM   8893  O  OD1 . ASP G  1 113 ? -52.699  -15.140  39.435  1.00 3.55  ? 113 ASP G OD1 1 
ATOM   8894  O  OD2 . ASP G  1 113 ? -54.368  -14.838  40.830  1.00 3.84  ? 113 ASP G OD2 1 
ATOM   8895  N  N   . TYR G  1 114 ? -50.535  -12.554  37.703  1.00 2.00  ? 114 TYR G N   1 
ATOM   8896  C  CA  . TYR G  1 114 ? -50.375  -12.485  36.276  1.00 2.20  ? 114 TYR G CA  1 
ATOM   8897  C  C   . TYR G  1 114 ? -50.900  -13.705  35.536  1.00 2.57  ? 114 TYR G C   1 
ATOM   8898  O  O   . TYR G  1 114 ? -51.370  -13.551  34.409  1.00 2.01  ? 114 TYR G O   1 
ATOM   8899  C  CB  . TYR G  1 114 ? -48.925  -12.201  35.956  1.00 2.00  ? 114 TYR G CB  1 
ATOM   8900  C  CG  . TYR G  1 114 ? -48.496  -10.847  36.500  1.00 2.50  ? 114 TYR G CG  1 
ATOM   8901  C  CD1 . TYR G  1 114 ? -49.140  -9.667   36.068  1.00 2.00  ? 114 TYR G CD1 1 
ATOM   8902  C  CD2 . TYR G  1 114 ? -47.469  -10.735  37.431  1.00 2.12  ? 114 TYR G CD2 1 
ATOM   8903  C  CE1 . TYR G  1 114 ? -48.760  -8.429   36.537  1.00 2.00  ? 114 TYR G CE1 1 
ATOM   8904  C  CE2 . TYR G  1 114 ? -47.074  -9.482   37.909  1.00 2.06  ? 114 TYR G CE2 1 
ATOM   8905  C  CZ  . TYR G  1 114 ? -47.725  -8.340   37.456  1.00 2.01  ? 114 TYR G CZ  1 
ATOM   8906  O  OH  . TYR G  1 114 ? -47.358  -7.123   37.948  1.00 2.00  ? 114 TYR G OH  1 
ATOM   8907  N  N   . VAL G  1 115 ? -50.870  -14.906  36.155  1.00 2.61  ? 115 VAL G N   1 
ATOM   8908  C  CA  . VAL G  1 115 ? -51.436  -16.015  35.443  1.00 2.53  ? 115 VAL G CA  1 
ATOM   8909  C  C   . VAL G  1 115 ? -52.954  -16.046  35.436  1.00 2.93  ? 115 VAL G C   1 
ATOM   8910  O  O   . VAL G  1 115 ? -53.561  -16.296  34.379  1.00 3.41  ? 115 VAL G O   1 
ATOM   8911  C  CB  . VAL G  1 115 ? -50.654  -17.348  35.516  1.00 2.32  ? 115 VAL G CB  1 
ATOM   8912  C  CG1 . VAL G  1 115 ? -49.456  -17.218  36.352  1.00 2.93  ? 115 VAL G CG1 1 
ATOM   8913  C  CG2 . VAL G  1 115 ? -51.528  -18.557  35.832  1.00 2.00  ? 115 VAL G CG2 1 
ATOM   8914  N  N   . SER G  1 116 ? -53.584  -15.736  36.564  1.00 2.78  ? 116 SER G N   1 
ATOM   8915  C  CA  . SER G  1 116 ? -55.026  -15.503  36.525  1.00 2.47  ? 116 SER G CA  1 
ATOM   8916  C  C   . SER G  1 116 ? -55.373  -14.432  35.486  1.00 2.76  ? 116 SER G C   1 
ATOM   8917  O  O   . SER G  1 116 ? -56.327  -14.598  34.741  1.00 3.14  ? 116 SER G O   1 
ATOM   8918  C  CB  . SER G  1 116 ? -55.581  -15.112  37.876  1.00 2.00  ? 116 SER G CB  1 
ATOM   8919  O  OG  . SER G  1 116 ? -55.438  -16.160  38.788  1.00 2.00  ? 116 SER G OG  1 
ATOM   8920  N  N   . ARG G  1 117 ? -54.587  -13.355  35.403  1.00 2.56  ? 117 ARG G N   1 
ATOM   8921  C  CA  . ARG G  1 117 ? -54.870  -12.312  34.445  1.00 2.21  ? 117 ARG G CA  1 
ATOM   8922  C  C   . ARG G  1 117 ? -54.843  -12.865  33.030  1.00 3.11  ? 117 ARG G C   1 
ATOM   8923  O  O   . ARG G  1 117 ? -55.774  -12.622  32.224  1.00 3.06  ? 117 ARG G O   1 
ATOM   8924  C  CB  . ARG G  1 117 ? -53.900  -11.178  34.579  1.00 2.00  ? 117 ARG G CB  1 
ATOM   8925  C  CG  . ARG G  1 117 ? -54.085  -10.112  33.548  1.00 2.00  ? 117 ARG G CG  1 
ATOM   8926  C  CD  . ARG G  1 117 ? -53.323  -8.872   33.933  1.00 2.00  ? 117 ARG G CD  1 
ATOM   8927  N  NE  . ARG G  1 117 ? -52.964  -8.045   32.771  1.00 2.94  ? 117 ARG G NE  1 
ATOM   8928  C  CZ  . ARG G  1 117 ? -53.316  -6.777   32.604  1.00 2.69  ? 117 ARG G CZ  1 
ATOM   8929  N  NH1 . ARG G  1 117 ? -54.042  -6.152   33.513  1.00 2.00  ? 117 ARG G NH1 1 
ATOM   8930  N  NH2 . ARG G  1 117 ? -52.904  -6.146   31.524  1.00 2.00  ? 117 ARG G NH2 1 
ATOM   8931  N  N   . ASP G  1 118 ? -53.795  -13.641  32.751  1.00 3.51  ? 118 ASP G N   1 
ATOM   8932  C  CA  . ASP G  1 118 ? -53.534  -14.183  31.437  1.00 3.87  ? 118 ASP G CA  1 
ATOM   8933  C  C   . ASP G  1 118 ? -54.673  -15.108  31.049  1.00 4.00  ? 118 ASP G C   1 
ATOM   8934  O  O   . ASP G  1 118 ? -55.184  -15.025  29.949  1.00 5.15  ? 118 ASP G O   1 
ATOM   8935  C  CB  . ASP G  1 118 ? -52.199  -14.935  31.475  1.00 4.84  ? 118 ASP G CB  1 
ATOM   8936  C  CG  . ASP G  1 118 ? -51.718  -15.410  30.092  1.00 7.80  ? 118 ASP G CG  1 
ATOM   8937  O  OD1 . ASP G  1 118 ? -51.495  -14.558  29.211  1.00 11.66 ? 118 ASP G OD1 1 
ATOM   8938  O  OD2 . ASP G  1 118 ? -51.534  -16.639  29.903  1.00 11.13 ? 118 ASP G OD2 1 
ATOM   8939  N  N   . MET G  1 119 ? -55.113  -15.967  31.959  1.00 4.00  ? 119 MET G N   1 
ATOM   8940  C  CA  . MET G  1 119 ? -56.274  -16.798  31.690  1.00 4.16  ? 119 MET G CA  1 
ATOM   8941  C  C   . MET G  1 119 ? -57.519  -15.951  31.408  1.00 3.85  ? 119 MET G C   1 
ATOM   8942  O  O   . MET G  1 119 ? -58.267  -16.267  30.487  1.00 4.57  ? 119 MET G O   1 
ATOM   8943  C  CB  . MET G  1 119 ? -56.524  -17.751  32.838  1.00 4.08  ? 119 MET G CB  1 
ATOM   8944  C  CG  . MET G  1 119 ? -57.921  -18.379  32.866  1.00 4.23  ? 119 MET G CG  1 
ATOM   8945  S  SD  . MET G  1 119 ? -58.356  -18.896  34.557  1.00 5.85  ? 119 MET G SD  1 
ATOM   8946  C  CE  . MET G  1 119 ? -57.251  -20.314  34.639  1.00 9.21  ? 119 MET G CE  1 
ATOM   8947  N  N   . MET G  1 120 ? -57.729  -14.883  32.169  1.00 3.08  ? 120 MET G N   1 
ATOM   8948  C  CA  . MET G  1 120 ? -58.898  -14.059  31.963  1.00 3.22  ? 120 MET G CA  1 
ATOM   8949  C  C   . MET G  1 120 ? -58.887  -13.321  30.634  1.00 3.22  ? 120 MET G C   1 
ATOM   8950  O  O   . MET G  1 120 ? -59.935  -13.145  30.039  1.00 2.71  ? 120 MET G O   1 
ATOM   8951  C  CB  . MET G  1 120 ? -59.099  -13.084  33.117  1.00 2.57  ? 120 MET G CB  1 
ATOM   8952  C  CG  . MET G  1 120 ? -59.423  -13.793  34.382  1.00 2.71  ? 120 MET G CG  1 
ATOM   8953  S  SD  . MET G  1 120 ? -59.829  -12.711  35.741  1.00 5.73  ? 120 MET G SD  1 
ATOM   8954  C  CE  . MET G  1 120 ? -58.269  -11.927  36.124  1.00 2.37  ? 120 MET G CE  1 
ATOM   8955  N  N   . ILE G  1 121 ? -57.702  -12.886  30.171  1.00 3.58  ? 121 ILE G N   1 
ATOM   8956  C  CA  . ILE G  1 121 ? -57.612  -12.173  28.910  1.00 3.29  ? 121 ILE G CA  1 
ATOM   8957  C  C   . ILE G  1 121 ? -57.976  -13.090  27.757  1.00 4.01  ? 121 ILE G C   1 
ATOM   8958  O  O   . ILE G  1 121 ? -58.676  -12.659  26.848  1.00 3.54  ? 121 ILE G O   1 
ATOM   8959  C  CB  . ILE G  1 121 ? -56.251  -11.559  28.679  1.00 3.14  ? 121 ILE G CB  1 
ATOM   8960  C  CG1 . ILE G  1 121 ? -56.064  -10.338  29.562  1.00 2.67  ? 121 ILE G CG1 1 
ATOM   8961  C  CG2 . ILE G  1 121 ? -56.136  -11.068  27.255  1.00 2.01  ? 121 ILE G CG2 1 
ATOM   8962  C  CD1 . ILE G  1 121 ? -54.581  -9.968   29.769  1.00 2.82  ? 121 ILE G CD1 1 
ATOM   8963  N  N   . GLU G  1 122 ? -57.533  -14.351  27.799  1.00 4.70  ? 122 GLU G N   1 
ATOM   8964  C  CA  . GLU G  1 122 ? -57.939  -15.298  26.756  1.00 5.54  ? 122 GLU G CA  1 
ATOM   8965  C  C   . GLU G  1 122 ? -59.459  -15.513  26.756  1.00 5.40  ? 122 GLU G C   1 
ATOM   8966  O  O   . GLU G  1 122 ? -60.082  -15.512  25.679  1.00 6.40  ? 122 GLU G O   1 
ATOM   8967  C  CB  . GLU G  1 122 ? -57.165  -16.615  26.796  1.00 5.85  ? 122 GLU G CB  1 
ATOM   8968  C  CG  . GLU G  1 122 ? -55.626  -16.501  26.433  1.00 11.57 ? 122 GLU G CG  1 
ATOM   8969  C  CD  . GLU G  1 122 ? -55.279  -15.624  25.099  1.00 19.43 ? 122 GLU G CD  1 
ATOM   8970  O  OE1 . GLU G  1 122 ? -55.464  -16.154  23.923  1.00 20.92 ? 122 GLU G OE1 1 
ATOM   8971  O  OE2 . GLU G  1 122 ? -54.794  -14.426  25.236  1.00 18.99 ? 122 GLU G OE2 1 
ATOM   8972  N  N   . ILE G  1 123 ? -60.068  -15.626  27.937  1.00 4.51  ? 123 ILE G N   1 
ATOM   8973  C  CA  . ILE G  1 123 ? -61.513  -15.801  28.025  1.00 3.58  ? 123 ILE G CA  1 
ATOM   8974  C  C   . ILE G  1 123 ? -62.242  -14.587  27.429  1.00 4.05  ? 123 ILE G C   1 
ATOM   8975  O  O   . ILE G  1 123 ? -63.170  -14.755  26.623  1.00 3.88  ? 123 ILE G O   1 
ATOM   8976  C  CB  . ILE G  1 123 ? -61.941  -16.135  29.463  1.00 3.55  ? 123 ILE G CB  1 
ATOM   8977  C  CG1 . ILE G  1 123 ? -61.493  -17.563  29.798  1.00 2.45  ? 123 ILE G CG1 1 
ATOM   8978  C  CG2 . ILE G  1 123 ? -63.463  -15.943  29.690  1.00 2.47  ? 123 ILE G CG2 1 
ATOM   8979  C  CD1 . ILE G  1 123 ? -61.497  -17.867  31.256  1.00 2.00  ? 123 ILE G CD1 1 
ATOM   8980  N  N   . LEU G  1 124 ? -61.786  -13.384  27.778  1.00 3.93  ? 124 LEU G N   1 
ATOM   8981  C  CA  . LEU G  1 124 ? -62.385  -12.136  27.290  1.00 3.94  ? 124 LEU G CA  1 
ATOM   8982  C  C   . LEU G  1 124 ? -62.327  -12.075  25.761  1.00 4.53  ? 124 LEU G C   1 
ATOM   8983  O  O   . LEU G  1 124 ? -63.269  -11.649  25.117  1.00 4.88  ? 124 LEU G O   1 
ATOM   8984  C  CB  . LEU G  1 124 ? -61.696  -10.916  27.899  1.00 3.41  ? 124 LEU G CB  1 
ATOM   8985  C  CG  . LEU G  1 124 ? -62.163  -9.526   27.463  1.00 2.98  ? 124 LEU G CG  1 
ATOM   8986  C  CD1 . LEU G  1 124 ? -63.633  -9.191   27.787  1.00 2.00  ? 124 LEU G CD1 1 
ATOM   8987  C  CD2 . LEU G  1 124 ? -61.232  -8.528   28.073  1.00 2.00  ? 124 LEU G CD2 1 
ATOM   8988  N  N   . ARG G  1 125 ? -61.224  -12.540  25.195  1.00 4.98  ? 125 ARG G N   1 
ATOM   8989  C  CA  . ARG G  1 125 ? -61.084  -12.652  23.759  1.00 5.52  ? 125 ARG G CA  1 
ATOM   8990  C  C   . ARG G  1 125 ? -62.144  -13.601  23.166  1.00 5.76  ? 125 ARG G C   1 
ATOM   8991  O  O   . ARG G  1 125 ? -62.684  -13.311  22.123  1.00 5.61  ? 125 ARG G O   1 
ATOM   8992  C  CB  . ARG G  1 125 ? -59.673  -13.116  23.411  1.00 5.59  ? 125 ARG G CB  1 
ATOM   8993  C  CG  . ARG G  1 125 ? -59.404  -13.198  21.951  1.00 7.87  ? 125 ARG G CG  1 
ATOM   8994  C  CD  . ARG G  1 125 ? -57.937  -13.463  21.664  1.00 12.90 ? 125 ARG G CD  1 
ATOM   8995  N  NE  . ARG G  1 125 ? -57.759  -13.751  20.223  1.00 19.06 ? 125 ARG G NE  1 
ATOM   8996  C  CZ  . ARG G  1 125 ? -56.655  -14.288  19.671  1.00 22.49 ? 125 ARG G CZ  1 
ATOM   8997  N  NH1 . ARG G  1 125 ? -55.580  -14.632  20.434  1.00 21.50 ? 125 ARG G NH1 1 
ATOM   8998  N  NH2 . ARG G  1 125 ? -56.613  -14.478  18.345  1.00 19.90 ? 125 ARG G NH2 1 
ATOM   8999  N  N   . ASP G  1 126 ? -62.449  -14.717  23.831  1.00 6.03  ? 126 ASP G N   1 
ATOM   9000  C  CA  . ASP G  1 126 ? -63.504  -15.594  23.333  1.00 6.51  ? 126 ASP G CA  1 
ATOM   9001  C  C   . ASP G  1 126 ? -64.851  -14.894  23.441  1.00 6.74  ? 126 ASP G C   1 
ATOM   9002  O  O   . ASP G  1 126 ? -65.693  -15.088  22.589  1.00 7.38  ? 126 ASP G O   1 
ATOM   9003  C  CB  . ASP G  1 126 ? -63.553  -16.978  24.025  1.00 6.62  ? 126 ASP G CB  1 
ATOM   9004  C  CG  . ASP G  1 126 ? -62.250  -17.769  23.899  1.00 9.55  ? 126 ASP G CG  1 
ATOM   9005  O  OD1 . ASP G  1 126 ? -61.995  -18.680  24.749  1.00 10.15 ? 126 ASP G OD1 1 
ATOM   9006  O  OD2 . ASP G  1 126 ? -61.455  -17.499  22.955  1.00 13.14 ? 126 ASP G OD2 1 
ATOM   9007  N  N   . GLU G  1 127 ? -65.050  -14.080  24.477  1.00 6.85  ? 127 GLU G N   1 
ATOM   9008  C  CA  . GLU G  1 127 ? -66.356  -13.450  24.711  1.00 6.89  ? 127 GLU G CA  1 
ATOM   9009  C  C   . GLU G  1 127 ? -66.595  -12.398  23.698  1.00 5.99  ? 127 GLU G C   1 
ATOM   9010  O  O   . GLU G  1 127 ? -67.661  -12.308  23.142  1.00 5.38  ? 127 GLU G O   1 
ATOM   9011  C  CB  . GLU G  1 127 ? -66.459  -12.831  26.116  1.00 6.98  ? 127 GLU G CB  1 
ATOM   9012  C  CG  . GLU G  1 127 ? -66.194  -13.838  27.260  1.00 11.06 ? 127 GLU G CG  1 
ATOM   9013  C  CD  . GLU G  1 127 ? -67.205  -15.007  27.375  1.00 12.26 ? 127 GLU G CD  1 
ATOM   9014  O  OE1 . GLU G  1 127 ? -67.104  -15.754  28.363  1.00 14.02 ? 127 GLU G OE1 1 
ATOM   9015  O  OE2 . GLU G  1 127 ? -68.095  -15.179  26.526  1.00 12.83 ? 127 GLU G OE2 1 
ATOM   9016  N  N   . GLU G  1 128 ? -65.564  -11.597  23.484  1.00 6.04  ? 128 GLU G N   1 
ATOM   9017  C  CA  . GLU G  1 128 ? -65.537  -10.556  22.501  1.00 5.48  ? 128 GLU G CA  1 
ATOM   9018  C  C   . GLU G  1 128 ? -65.910  -11.209  21.124  1.00 5.43  ? 128 GLU G C   1 
ATOM   9019  O  O   . GLU G  1 128 ? -66.697  -10.627  20.351  1.00 5.38  ? 128 GLU G O   1 
ATOM   9020  C  CB  . GLU G  1 128 ? -64.131  -9.989   22.549  1.00 5.55  ? 128 GLU G CB  1 
ATOM   9021  C  CG  . GLU G  1 128 ? -63.946  -8.546   22.176  1.00 6.79  ? 128 GLU G CG  1 
ATOM   9022  C  CD  . GLU G  1 128 ? -63.331  -7.703   23.281  1.00 7.24  ? 128 GLU G CD  1 
ATOM   9023  O  OE1 . GLU G  1 128 ? -63.760  -7.790   24.432  1.00 9.79  ? 128 GLU G OE1 1 
ATOM   9024  O  OE2 . GLU G  1 128 ? -62.444  -6.902   22.997  1.00 7.48  ? 128 GLU G OE2 1 
ATOM   9025  N  N   . GLY G  1 129 ? -65.423  -12.434  20.853  1.00 4.75  ? 129 GLY G N   1 
ATOM   9026  C  CA  . GLY G  1 129 ? -65.832  -13.198  19.688  1.00 4.12  ? 129 GLY G CA  1 
ATOM   9027  C  C   . GLY G  1 129 ? -67.333  -13.507  19.634  1.00 5.05  ? 129 GLY G C   1 
ATOM   9028  O  O   . GLY G  1 129 ? -67.964  -13.340  18.586  1.00 5.09  ? 129 GLY G O   1 
ATOM   9029  N  N   . HIS G  1 130 ? -67.919  -13.963  20.746  1.00 5.21  ? 130 HIS G N   1 
ATOM   9030  C  CA  . HIS G  1 130 ? -69.353  -14.189  20.809  1.00 5.79  ? 130 HIS G CA  1 
ATOM   9031  C  C   . HIS G  1 130 ? -70.124  -12.889  20.608  1.00 5.54  ? 130 HIS G C   1 
ATOM   9032  O  O   . HIS G  1 130 ? -71.128  -12.855  19.892  1.00 5.61  ? 130 HIS G O   1 
ATOM   9033  C  CB  . HIS G  1 130 ? -69.747  -14.799  22.137  1.00 6.66  ? 130 HIS G CB  1 
ATOM   9034  C  CG  . HIS G  1 130 ? -69.104  -16.116  22.432  1.00 10.69 ? 130 HIS G CG  1 
ATOM   9035  N  ND1 . HIS G  1 130 ? -69.030  -16.630  23.706  1.00 14.38 ? 130 HIS G ND1 1 
ATOM   9036  C  CD2 . HIS G  1 130 ? -68.492  -17.018  21.632  1.00 11.84 ? 130 HIS G CD2 1 
ATOM   9037  C  CE1 . HIS G  1 130 ? -68.399  -17.790  23.680  1.00 14.20 ? 130 HIS G CE1 1 
ATOM   9038  N  NE2 . HIS G  1 130 ? -68.060  -18.046  22.435  1.00 12.92 ? 130 HIS G NE2 1 
ATOM   9039  N  N   . ILE G  1 131 ? -69.652  -11.811  21.233  1.00 4.97  ? 131 ILE G N   1 
ATOM   9040  C  CA  . ILE G  1 131 ? -70.246  -10.504  21.047  1.00 4.10  ? 131 ILE G CA  1 
ATOM   9041  C  C   . ILE G  1 131 ? -70.260  -10.162  19.531  1.00 4.73  ? 131 ILE G C   1 
ATOM   9042  O  O   . ILE G  1 131 ? -71.290  -9.738   18.980  1.00 4.77  ? 131 ILE G O   1 
ATOM   9043  C  CB  . ILE G  1 131 ? -69.527  -9.425   21.894  1.00 3.98  ? 131 ILE G CB  1 
ATOM   9044  C  CG1 . ILE G  1 131 ? -69.761  -9.698   23.381  1.00 3.94  ? 131 ILE G CG1 1 
ATOM   9045  C  CG2 . ILE G  1 131 ? -70.006  -8.037   21.527  1.00 2.67  ? 131 ILE G CG2 1 
ATOM   9046  C  CD1 . ILE G  1 131 ? -68.909  -8.878   24.366  1.00 2.06  ? 131 ILE G CD1 1 
ATOM   9047  N  N   . ASP G  1 132 ? -69.141  -10.382  18.854  1.00 4.28  ? 132 ASP G N   1 
ATOM   9048  C  CA  . ASP G  1 132 ? -69.102  -10.114  17.430  1.00 4.29  ? 132 ASP G CA  1 
ATOM   9049  C  C   . ASP G  1 132 ? -70.212  -10.884  16.698  1.00 4.10  ? 132 ASP G C   1 
ATOM   9050  O  O   . ASP G  1 132 ? -70.975  -10.305  15.917  1.00 4.03  ? 132 ASP G O   1 
ATOM   9051  C  CB  . ASP G  1 132 ? -67.725  -10.493  16.898  1.00 4.66  ? 132 ASP G CB  1 
ATOM   9052  C  CG  . ASP G  1 132 ? -67.479  -10.016  15.479  1.00 6.33  ? 132 ASP G CG  1 
ATOM   9053  O  OD1 . ASP G  1 132 ? -68.329  -9.343   14.889  1.00 4.74  ? 132 ASP G OD1 1 
ATOM   9054  O  OD2 . ASP G  1 132 ? -66.384  -10.307  14.955  1.00 10.49 ? 132 ASP G OD2 1 
ATOM   9055  N  N   . TRP G  1 133 ? -70.320  -12.178  16.982  1.00 3.85  ? 133 TRP G N   1 
ATOM   9056  C  CA  . TRP G  1 133 ? -71.267  -13.003  16.280  1.00 3.77  ? 133 TRP G CA  1 
ATOM   9057  C  C   . TRP G  1 133 ? -72.705  -12.562  16.536  1.00 3.77  ? 133 TRP G C   1 
ATOM   9058  O  O   . TRP G  1 133 ? -73.471  -12.404  15.584  1.00 3.95  ? 133 TRP G O   1 
ATOM   9059  C  CB  . TRP G  1 133 ? -71.064  -14.488  16.603  1.00 3.79  ? 133 TRP G CB  1 
ATOM   9060  C  CG  . TRP G  1 133 ? -71.992  -15.346  15.821  1.00 4.10  ? 133 TRP G CG  1 
ATOM   9061  C  CD1 . TRP G  1 133 ? -71.835  -15.782  14.517  1.00 4.04  ? 133 TRP G CD1 1 
ATOM   9062  C  CD2 . TRP G  1 133 ? -73.255  -15.842  16.257  1.00 4.40  ? 133 TRP G CD2 1 
ATOM   9063  N  NE1 . TRP G  1 133 ? -72.915  -16.540  14.136  1.00 3.66  ? 133 TRP G NE1 1 
ATOM   9064  C  CE2 . TRP G  1 133 ? -73.805  -16.598  15.174  1.00 3.88  ? 133 TRP G CE2 1 
ATOM   9065  C  CE3 . TRP G  1 133 ? -73.966  -15.757  17.452  1.00 4.10  ? 133 TRP G CE3 1 
ATOM   9066  C  CZ2 . TRP G  1 133 ? -75.036  -17.237  15.261  1.00 4.26  ? 133 TRP G CZ2 1 
ATOM   9067  C  CZ3 . TRP G  1 133 ? -75.217  -16.416  17.537  1.00 3.85  ? 133 TRP G CZ3 1 
ATOM   9068  C  CH2 . TRP G  1 133 ? -75.725  -17.138  16.454  1.00 4.45  ? 133 TRP G CH2 1 
ATOM   9069  N  N   . LEU G  1 134 ? -73.063  -12.357  17.810  1.00 3.44  ? 134 LEU G N   1 
ATOM   9070  C  CA  . LEU G  1 134 ? -74.413  -11.910  18.164  1.00 2.61  ? 134 LEU G CA  1 
ATOM   9071  C  C   . LEU G  1 134 ? -74.773  -10.594  17.500  1.00 2.50  ? 134 LEU G C   1 
ATOM   9072  O  O   . LEU G  1 134 ? -75.852  -10.449  16.966  1.00 2.37  ? 134 LEU G O   1 
ATOM   9073  C  CB  . LEU G  1 134 ? -74.545  -11.748  19.654  1.00 2.49  ? 134 LEU G CB  1 
ATOM   9074  C  CG  . LEU G  1 134 ? -74.973  -12.836  20.654  1.00 2.40  ? 134 LEU G CG  1 
ATOM   9075  C  CD1 . LEU G  1 134 ? -75.562  -14.040  20.055  1.00 2.00  ? 134 LEU G CD1 1 
ATOM   9076  C  CD2 . LEU G  1 134 ? -73.870  -13.191  21.627  1.00 2.00  ? 134 LEU G CD2 1 
ATOM   9077  N  N   . GLU G  1 135 ? -73.873  -9.622   17.545  1.00 2.85  ? 135 GLU G N   1 
ATOM   9078  C  CA  . GLU G  1 135 ? -74.133  -8.307   16.935  1.00 3.39  ? 135 GLU G CA  1 
ATOM   9079  C  C   . GLU G  1 135 ? -74.407  -8.470   15.426  1.00 3.59  ? 135 GLU G C   1 
ATOM   9080  O  O   . GLU G  1 135 ? -75.357  -7.881   14.870  1.00 3.97  ? 135 GLU G O   1 
ATOM   9081  C  CB  . GLU G  1 135 ? -72.979  -7.353   17.153  1.00 2.43  ? 135 GLU G CB  1 
ATOM   9082  C  CG  . GLU G  1 135 ? -72.863  -6.849   18.561  1.00 3.73  ? 135 GLU G CG  1 
ATOM   9083  C  CD  . GLU G  1 135 ? -71.581  -5.973   18.804  1.00 5.12  ? 135 GLU G CD  1 
ATOM   9084  O  OE1 . GLU G  1 135 ? -70.603  -6.019   17.990  1.00 4.20  ? 135 GLU G OE1 1 
ATOM   9085  O  OE2 . GLU G  1 135 ? -71.592  -5.240   19.828  1.00 6.57  ? 135 GLU G OE2 1 
ATOM   9086  N  N   . THR G  1 136 ? -73.597  -9.288   14.778  1.00 2.90  ? 136 THR G N   1 
ATOM   9087  C  CA  . THR G  1 136 ? -73.748  -9.486   13.369  1.00 2.72  ? 136 THR G CA  1 
ATOM   9088  C  C   . THR G  1 136 ? -75.087  -10.127  13.035  1.00 2.78  ? 136 THR G C   1 
ATOM   9089  O  O   . THR G  1 136 ? -75.770  -9.652   12.128  1.00 3.24  ? 136 THR G O   1 
ATOM   9090  C  CB  . THR G  1 136 ? -72.591  -10.309  12.845  1.00 2.97  ? 136 THR G CB  1 
ATOM   9091  O  OG1 . THR G  1 136 ? -71.386  -9.737   13.355  1.00 2.63  ? 136 THR G OG1 1 
ATOM   9092  C  CG2 . THR G  1 136 ? -72.559  -10.312  11.339  1.00 2.29  ? 136 THR G CG2 1 
ATOM   9093  N  N   . GLU G  1 137 ? -75.475  -11.185  13.756  1.00 2.20  ? 137 GLU G N   1 
ATOM   9094  C  CA  . GLU G  1 137 ? -76.765  -11.806  13.552  1.00 2.38  ? 137 GLU G CA  1 
ATOM   9095  C  C   . GLU G  1 137 ? -77.888  -10.768  13.736  1.00 2.43  ? 137 GLU G C   1 
ATOM   9096  O  O   . GLU G  1 137 ? -78.753  -10.637  12.888  1.00 3.16  ? 137 GLU G O   1 
ATOM   9097  C  CB  . GLU G  1 137 ? -76.971  -12.971  14.512  1.00 2.45  ? 137 GLU G CB  1 
ATOM   9098  C  CG  . GLU G  1 137 ? -76.065  -14.171  14.283  1.00 4.78  ? 137 GLU G CG  1 
ATOM   9099  C  CD  . GLU G  1 137 ? -76.060  -14.664  12.832  1.00 8.01  ? 137 GLU G CD  1 
ATOM   9100  O  OE1 . GLU G  1 137 ? -74.993  -14.553  12.166  1.00 8.93  ? 137 GLU G OE1 1 
ATOM   9101  O  OE2 . GLU G  1 137 ? -77.127  -15.151  12.355  1.00 9.39  ? 137 GLU G OE2 1 
ATOM   9102  N  N   . LEU G  1 138 ? -77.875  -10.018  14.819  1.00 2.27  ? 138 LEU G N   1 
ATOM   9103  C  CA  . LEU G  1 138 ? -78.926  -9.060   15.030  1.00 2.80  ? 138 LEU G CA  1 
ATOM   9104  C  C   . LEU G  1 138 ? -79.018  -8.036   13.911  1.00 3.79  ? 138 LEU G C   1 
ATOM   9105  O  O   . LEU G  1 138 ? -80.124  -7.627   13.552  1.00 4.45  ? 138 LEU G O   1 
ATOM   9106  C  CB  . LEU G  1 138 ? -78.745  -8.355   16.357  1.00 2.55  ? 138 LEU G CB  1 
ATOM   9107  C  CG  . LEU G  1 138 ? -78.995  -9.241   17.574  1.00 2.99  ? 138 LEU G CG  1 
ATOM   9108  C  CD1 . LEU G  1 138 ? -78.526  -8.489   18.782  1.00 3.73  ? 138 LEU G CD1 1 
ATOM   9109  C  CD2 . LEU G  1 138 ? -80.463  -9.614   17.703  1.00 2.79  ? 138 LEU G CD2 1 
ATOM   9110  N  N   . ASP G  1 139 ? -77.874  -7.606   13.356  1.00 4.00  ? 139 ASP G N   1 
ATOM   9111  C  CA  . ASP G  1 139 ? -77.904  -6.680   12.237  1.00 4.63  ? 139 ASP G CA  1 
ATOM   9112  C  C   . ASP G  1 139 ? -78.402  -7.359   10.965  1.00 4.42  ? 139 ASP G C   1 
ATOM   9113  O  O   . ASP G  1 139 ? -79.088  -6.732   10.154  1.00 4.45  ? 139 ASP G O   1 
ATOM   9114  C  CB  . ASP G  1 139 ? -76.528  -6.064   11.976  1.00 5.24  ? 139 ASP G CB  1 
ATOM   9115  C  CG  . ASP G  1 139 ? -76.108  -5.015   13.037  1.00 8.76  ? 139 ASP G CG  1 
ATOM   9116  O  OD1 . ASP G  1 139 ? -76.921  -4.575   13.918  1.00 10.93 ? 139 ASP G OD1 1 
ATOM   9117  O  OD2 . ASP G  1 139 ? -74.921  -4.613   12.975  1.00 11.21 ? 139 ASP G OD2 1 
ATOM   9118  N  N   . LEU G  1 140 ? -78.064  -8.633   10.785  1.00 3.85  ? 140 LEU G N   1 
ATOM   9119  C  CA  . LEU G  1 140 ? -78.551  -9.346   9.605   1.00 4.28  ? 140 LEU G CA  1 
ATOM   9120  C  C   . LEU G  1 140 ? -80.059  -9.413   9.616   1.00 4.78  ? 140 LEU G C   1 
ATOM   9121  O  O   . LEU G  1 140 ? -80.674  -9.262   8.563   1.00 5.74  ? 140 LEU G O   1 
ATOM   9122  C  CB  . LEU G  1 140 ? -77.971  -10.755  9.483   1.00 3.89  ? 140 LEU G CB  1 
ATOM   9123  C  CG  . LEU G  1 140 ? -76.506  -10.823  9.013   1.00 3.78  ? 140 LEU G CG  1 
ATOM   9124  C  CD1 . LEU G  1 140 ? -75.953  -12.238  9.186   1.00 2.01  ? 140 LEU G CD1 1 
ATOM   9125  C  CD2 . LEU G  1 140 ? -76.355  -10.322  7.579   1.00 2.00  ? 140 LEU G CD2 1 
ATOM   9126  N  N   . ILE G  1 141 ? -80.652  -9.621   10.799  1.00 4.72  ? 141 ILE G N   1 
ATOM   9127  C  CA  . ILE G  1 141 ? -82.092  -9.707   10.905  1.00 4.69  ? 141 ILE G CA  1 
ATOM   9128  C  C   . ILE G  1 141 ? -82.746  -8.419   10.379  1.00 6.36  ? 141 ILE G C   1 
ATOM   9129  O  O   . ILE G  1 141 ? -83.745  -8.480   9.660   1.00 7.35  ? 141 ILE G O   1 
ATOM   9130  C  CB  . ILE G  1 141 ? -82.558  -9.986   12.332  1.00 4.83  ? 141 ILE G CB  1 
ATOM   9131  C  CG1 . ILE G  1 141 ? -82.107  -11.364  12.825  1.00 4.02  ? 141 ILE G CG1 1 
ATOM   9132  C  CG2 . ILE G  1 141 ? -84.084  -9.811   12.449  1.00 3.52  ? 141 ILE G CG2 1 
ATOM   9133  C  CD1 . ILE G  1 141 ? -82.461  -11.614  14.301  1.00 3.35  ? 141 ILE G CD1 1 
ATOM   9134  N  N   . GLN G  1 142 ? -82.199  -7.254   10.726  1.00 7.41  ? 142 GLN G N   1 
ATOM   9135  C  CA  . GLN G  1 142 ? -82.752  -5.988   10.237  1.00 8.51  ? 142 GLN G CA  1 
ATOM   9136  C  C   . GLN G  1 142 ? -82.470  -5.809   8.751   1.00 8.12  ? 142 GLN G C   1 
ATOM   9137  O  O   . GLN G  1 142 ? -83.325  -5.300   8.018   1.00 8.41  ? 142 GLN G O   1 
ATOM   9138  C  CB  . GLN G  1 142 ? -82.230  -4.755   11.020  1.00 9.09  ? 142 GLN G CB  1 
ATOM   9139  C  CG  . GLN G  1 142 ? -82.544  -4.773   12.536  1.00 13.45 ? 142 GLN G CG  1 
ATOM   9140  C  CD  . GLN G  1 142 ? -84.077  -4.808   12.870  1.00 19.48 ? 142 GLN G CD  1 
ATOM   9141  O  OE1 . GLN G  1 142 ? -84.810  -3.794   12.694  1.00 19.85 ? 142 GLN G OE1 1 
ATOM   9142  N  NE2 . GLN G  1 142 ? -84.554  -5.976   13.368  1.00 18.91 ? 142 GLN G NE2 1 
ATOM   9143  N  N   . LYS G  1 143 ? -81.292  -6.219   8.294   1.00 7.62  ? 143 LYS G N   1 
ATOM   9144  C  CA  . LYS G  1 143 ? -80.907  -5.891   6.918   1.00 7.75  ? 143 LYS G CA  1 
ATOM   9145  C  C   . LYS G  1 143 ? -81.659  -6.746   5.906   1.00 7.74  ? 143 LYS G C   1 
ATOM   9146  O  O   . LYS G  1 143 ? -82.090  -6.228   4.876   1.00 8.47  ? 143 LYS G O   1 
ATOM   9147  C  CB  . LYS G  1 143 ? -79.400  -6.002   6.682   1.00 7.65  ? 143 LYS G CB  1 
ATOM   9148  C  CG  . LYS G  1 143 ? -78.568  -5.005   7.467   1.00 9.64  ? 143 LYS G CG  1 
ATOM   9149  C  CD  . LYS G  1 143 ? -77.143  -4.898   6.899   1.00 13.34 ? 143 LYS G CD  1 
ATOM   9150  C  CE  . LYS G  1 143 ? -76.148  -4.208   7.852   1.00 13.02 ? 143 LYS G CE  1 
ATOM   9151  N  NZ  . LYS G  1 143 ? -75.316  -5.353   8.292   1.00 16.86 ? 143 LYS G NZ  1 
ATOM   9152  N  N   . MET G  1 144 ? -81.846  -8.033   6.204   1.00 7.13  ? 144 MET G N   1 
ATOM   9153  C  CA  . MET G  1 144 ? -82.505  -8.930   5.253   1.00 6.78  ? 144 MET G CA  1 
ATOM   9154  C  C   . MET G  1 144 ? -83.970  -9.213   5.588   1.00 5.69  ? 144 MET G C   1 
ATOM   9155  O  O   . MET G  1 144 ? -84.692  -9.794   4.743   1.00 5.45  ? 144 MET G O   1 
ATOM   9156  C  CB  . MET G  1 144 ? -81.712  -10.214  5.048   1.00 6.22  ? 144 MET G CB  1 
ATOM   9157  C  CG  . MET G  1 144 ? -81.875  -11.228  6.135   1.00 6.65  ? 144 MET G CG  1 
ATOM   9158  S  SD  . MET G  1 144 ? -80.858  -12.713  5.877   1.00 10.13 ? 144 MET G SD  1 
ATOM   9159  C  CE  . MET G  1 144 ? -79.241  -11.976  5.960   1.00 10.33 ? 144 MET G CE  1 
ATOM   9160  N  N   . GLY G  1 145 ? -84.407  -8.784   6.785   1.00 4.50  ? 145 GLY G N   1 
ATOM   9161  C  CA  . GLY G  1 145 ? -85.775  -8.994   7.280   1.00 3.23  ? 145 GLY G CA  1 
ATOM   9162  C  C   . GLY G  1 145 ? -85.906  -10.306  8.005   1.00 3.24  ? 145 GLY G C   1 
ATOM   9163  O  O   . GLY G  1 145 ? -85.132  -11.233  7.771   1.00 3.33  ? 145 GLY G O   1 
ATOM   9164  N  N   . LEU G  1 146 ? -86.884  -10.418  8.884   1.00 3.09  ? 146 LEU G N   1 
ATOM   9165  C  CA  . LEU G  1 146 ? -87.008  -11.632  9.706   1.00 2.65  ? 146 LEU G CA  1 
ATOM   9166  C  C   . LEU G  1 146 ? -87.303  -12.932  8.915   1.00 2.75  ? 146 LEU G C   1 
ATOM   9167  O  O   . LEU G  1 146 ? -86.661  -13.940  9.136   1.00 3.04  ? 146 LEU G O   1 
ATOM   9168  C  CB  . LEU G  1 146 ? -88.022  -11.402  10.834  1.00 3.04  ? 146 LEU G CB  1 
ATOM   9169  C  CG  . LEU G  1 146 ? -88.232  -12.560  11.820  1.00 3.66  ? 146 LEU G CG  1 
ATOM   9170  C  CD1 . LEU G  1 146 ? -86.901  -12.988  12.470  1.00 2.07  ? 146 LEU G CD1 1 
ATOM   9171  C  CD2 . LEU G  1 146 ? -89.321  -12.218  12.849  1.00 2.00  ? 146 LEU G CD2 1 
ATOM   9172  N  N   . GLN G  1 147 ? -88.247  -12.889  7.986   1.00 2.75  ? 147 GLN G N   1 
ATOM   9173  C  CA  . GLN G  1 147 ? -88.575  -14.048  7.161   1.00 2.50  ? 147 GLN G CA  1 
ATOM   9174  C  C   . GLN G  1 147 ? -87.356  -14.599  6.436   1.00 2.80  ? 147 GLN G C   1 
ATOM   9175  O  O   . GLN G  1 147 ? -87.069  -15.778  6.565   1.00 3.33  ? 147 GLN G O   1 
ATOM   9176  C  CB  . GLN G  1 147 ? -89.710  -13.745  6.187   1.00 2.26  ? 147 GLN G CB  1 
ATOM   9177  C  CG  . GLN G  1 147 ? -91.002  -13.412  6.893   1.00 2.04  ? 147 GLN G CG  1 
ATOM   9178  C  CD  . GLN G  1 147 ? -92.198  -13.348  5.959   1.00 2.82  ? 147 GLN G CD  1 
ATOM   9179  O  OE1 . GLN G  1 147 ? -92.112  -12.809  4.870   1.00 3.60  ? 147 GLN G OE1 1 
ATOM   9180  N  NE2 . GLN G  1 147 ? -93.321  -13.902  6.393   1.00 2.21  ? 147 GLN G NE2 1 
ATOM   9181  N  N   . ASN G  1 148 ? -86.623  -13.769  5.702   1.00 3.15  ? 148 ASN G N   1 
ATOM   9182  C  CA  . ASN G  1 148 ? -85.397  -14.220  5.053   1.00 3.74  ? 148 ASN G CA  1 
ATOM   9183  C  C   . ASN G  1 148 ? -84.329  -14.712  6.038   1.00 4.44  ? 148 ASN G C   1 
ATOM   9184  O  O   . ASN G  1 148 ? -83.572  -15.636  5.750   1.00 5.29  ? 148 ASN G O   1 
ATOM   9185  C  CB  . ASN G  1 148 ? -84.786  -13.112  4.222   1.00 3.90  ? 148 ASN G CB  1 
ATOM   9186  C  CG  . ASN G  1 148 ? -85.386  -12.999  2.840   1.00 3.66  ? 148 ASN G CG  1 
ATOM   9187  O  OD1 . ASN G  1 148 ? -85.022  -12.088  2.106   1.00 5.77  ? 148 ASN G OD1 1 
ATOM   9188  N  ND2 . ASN G  1 148 ? -86.290  -13.883  2.481   1.00 3.48  ? 148 ASN G ND2 1 
ATOM   9189  N  N   . TYR G  1 149 ? -84.256  -14.100  7.198   1.00 4.22  ? 149 TYR G N   1 
ATOM   9190  C  CA  . TYR G  1 149 ? -83.275  -14.523  8.142   1.00 4.68  ? 149 TYR G CA  1 
ATOM   9191  C  C   . TYR G  1 149 ? -83.572  -15.929  8.632   1.00 4.79  ? 149 TYR G C   1 
ATOM   9192  O  O   . TYR G  1 149 ? -82.668  -16.757  8.757   1.00 4.37  ? 149 TYR G O   1 
ATOM   9193  C  CB  . TYR G  1 149 ? -83.230  -13.569  9.327   1.00 5.02  ? 149 TYR G CB  1 
ATOM   9194  C  CG  . TYR G  1 149 ? -82.241  -13.982  10.368  1.00 5.16  ? 149 TYR G CG  1 
ATOM   9195  C  CD1 . TYR G  1 149 ? -80.896  -13.678  10.218  1.00 4.36  ? 149 TYR G CD1 1 
ATOM   9196  C  CD2 . TYR G  1 149 ? -82.640  -14.701  11.497  1.00 5.88  ? 149 TYR G CD2 1 
ATOM   9197  C  CE1 . TYR G  1 149 ? -79.950  -14.071  11.194  1.00 6.73  ? 149 TYR G CE1 1 
ATOM   9198  C  CE2 . TYR G  1 149 ? -81.716  -15.081  12.488  1.00 5.63  ? 149 TYR G CE2 1 
ATOM   9199  C  CZ  . TYR G  1 149 ? -80.376  -14.760  12.327  1.00 5.96  ? 149 TYR G CZ  1 
ATOM   9200  O  OH  . TYR G  1 149 ? -79.443  -15.142  13.278  1.00 5.25  ? 149 TYR G OH  1 
ATOM   9201  N  N   . LEU G  1 150 ? -84.839  -16.190  8.929   1.00 5.12  ? 150 LEU G N   1 
ATOM   9202  C  CA  . LEU G  1 150 ? -85.243  -17.503  9.401   1.00 4.76  ? 150 LEU G CA  1 
ATOM   9203  C  C   . LEU G  1 150 ? -84.972  -18.525  8.332   1.00 5.07  ? 150 LEU G C   1 
ATOM   9204  O  O   . LEU G  1 150 ? -84.404  -19.562  8.633   1.00 6.04  ? 150 LEU G O   1 
ATOM   9205  C  CB  . LEU G  1 150 ? -86.695  -17.526  9.789   1.00 4.38  ? 150 LEU G CB  1 
ATOM   9206  C  CG  . LEU G  1 150 ? -87.168  -17.344  11.223  1.00 4.62  ? 150 LEU G CG  1 
ATOM   9207  C  CD1 . LEU G  1 150 ? -86.149  -16.826  12.203  1.00 5.74  ? 150 LEU G CD1 1 
ATOM   9208  C  CD2 . LEU G  1 150 ? -88.394  -16.477  11.212  1.00 4.19  ? 150 LEU G CD2 1 
ATOM   9209  N  N   . GLN G  1 151 ? -85.338  -18.255  7.075   1.00 4.98  ? 151 GLN G N   1 
ATOM   9210  C  CA  . GLN G  1 151 ? -85.115  -19.264  6.015   1.00 4.77  ? 151 GLN G CA  1 
ATOM   9211  C  C   . GLN G  1 151 ? -83.629  -19.644  5.959   1.00 4.77  ? 151 GLN G C   1 
ATOM   9212  O  O   . GLN G  1 151 ? -83.272  -20.786  5.714   1.00 5.01  ? 151 GLN G O   1 
ATOM   9213  C  CB  . GLN G  1 151 ? -85.609  -18.748  4.664   1.00 4.43  ? 151 GLN G CB  1 
ATOM   9214  C  CG  . GLN G  1 151 ? -85.267  -19.636  3.487   1.00 4.12  ? 151 GLN G CG  1 
ATOM   9215  C  CD  . GLN G  1 151 ? -85.363  -18.889  2.196   1.00 4.82  ? 151 GLN G CD  1 
ATOM   9216  O  OE1 . GLN G  1 151 ? -85.486  -17.694  2.192   1.00 8.38  ? 151 GLN G OE1 1 
ATOM   9217  N  NE2 . GLN G  1 151 ? -85.302  -19.583  1.095   1.00 7.26  ? 151 GLN G NE2 1 
ATOM   9218  N  N   . ALA G  1 152 ? -82.766  -18.676  6.220   1.00 4.79  ? 152 ALA G N   1 
ATOM   9219  C  CA  . ALA G  1 152 ? -81.350  -18.897  6.153   1.00 4.77  ? 152 ALA G CA  1 
ATOM   9220  C  C   . ALA G  1 152 ? -80.818  -19.742  7.316   1.00 5.30  ? 152 ALA G C   1 
ATOM   9221  O  O   . ALA G  1 152 ? -79.637  -20.101  7.292   1.00 6.00  ? 152 ALA G O   1 
ATOM   9222  C  CB  . ALA G  1 152 ? -80.648  -17.594  6.107   1.00 4.77  ? 152 ALA G CB  1 
ATOM   9223  N  N   . GLN G  1 153 ? -81.659  -20.073  8.314   1.00 5.07  ? 153 GLN G N   1 
ATOM   9224  C  CA  . GLN G  1 153 ? -81.220  -20.878  9.474   1.00 5.34  ? 153 GLN G CA  1 
ATOM   9225  C  C   . GLN G  1 153 ? -81.648  -22.339  9.388   1.00 5.86  ? 153 GLN G C   1 
ATOM   9226  O  O   . GLN G  1 153 ? -81.299  -23.141  10.254  1.00 5.78  ? 153 GLN G O   1 
ATOM   9227  C  CB  . GLN G  1 153 ? -81.765  -20.319  10.789  1.00 5.10  ? 153 GLN G CB  1 
ATOM   9228  C  CG  . GLN G  1 153 ? -81.562  -18.862  11.016  1.00 5.24  ? 153 GLN G CG  1 
ATOM   9229  C  CD  . GLN G  1 153 ? -80.151  -18.378  10.677  1.00 6.72  ? 153 GLN G CD  1 
ATOM   9230  O  OE1 . GLN G  1 153 ? -79.128  -19.042  10.969  1.00 6.56  ? 153 GLN G OE1 1 
ATOM   9231  N  NE2 . GLN G  1 153 ? -80.088  -17.196  10.051  1.00 7.59  ? 153 GLN G NE2 1 
ATOM   9232  N  N   . ILE G  1 154 ? -82.414  -22.676  8.364   1.00 6.72  ? 154 ILE G N   1 
ATOM   9233  C  CA  . ILE G  1 154 ? -83.045  -23.971  8.265   1.00 8.53  ? 154 ILE G CA  1 
ATOM   9234  C  C   . ILE G  1 154 ? -82.047  -25.108  8.017   1.00 9.68  ? 154 ILE G C   1 
ATOM   9235  O  O   . ILE G  1 154 ? -82.267  -26.225  8.454   1.00 10.59 ? 154 ILE G O   1 
ATOM   9236  C  CB  . ILE G  1 154 ? -84.033  -23.964  7.108   1.00 8.67  ? 154 ILE G CB  1 
ATOM   9237  C  CG1 . ILE G  1 154 ? -85.374  -23.438  7.540   1.00 9.46  ? 154 ILE G CG1 1 
ATOM   9238  C  CG2 . ILE G  1 154 ? -84.255  -25.357  6.539   1.00 9.44  ? 154 ILE G CG2 1 
ATOM   9239  C  CD1 . ILE G  1 154 ? -86.319  -23.457  6.305   1.00 11.52 ? 154 ILE G CD1 1 
ATOM   9240  N  N   A ARG G  1 155 ? -80.967  -24.812  7.303   0.70 10.39 ? 155 ARG G N   1 
ATOM   9241  N  N   B ARG G  1 155 ? -80.975  -24.854  7.286   0.30 10.33 ? 155 ARG G N   1 
ATOM   9242  C  CA  A ARG G  1 155 ? -79.951  -25.816  6.970   0.70 11.67 ? 155 ARG G CA  1 
ATOM   9243  C  CA  B ARG G  1 155 ? -79.991  -25.916  7.116   0.30 11.34 ? 155 ARG G CA  1 
ATOM   9244  C  C   A ARG G  1 155 ? -78.642  -25.546  7.714   0.70 12.68 ? 155 ARG G C   1 
ATOM   9245  C  C   B ARG G  1 155 ? -78.660  -25.564  7.723   0.30 12.33 ? 155 ARG G C   1 
ATOM   9246  O  O   A ARG G  1 155 ? -78.249  -24.383  7.888   0.70 13.32 ? 155 ARG G O   1 
ATOM   9247  O  O   B ARG G  1 155 ? -78.263  -24.394  7.768   0.30 12.66 ? 155 ARG G O   1 
ATOM   9248  C  CB  A ARG G  1 155 ? -79.730  -25.820  5.465   0.70 11.20 ? 155 ARG G CB  1 
ATOM   9249  C  CB  B ARG G  1 155 ? -79.830  -26.329  5.663   0.30 11.14 ? 155 ARG G CB  1 
ATOM   9250  C  CG  A ARG G  1 155 ? -81.029  -26.151  4.642   0.70 11.76 ? 155 ARG G CG  1 
ATOM   9251  C  CG  B ARG G  1 155 ? -80.004  -25.214  4.662   0.30 11.36 ? 155 ARG G CG  1 
ATOM   9252  C  CD  A ARG G  1 155 ? -80.820  -25.845  3.147   0.70 12.72 ? 155 ARG G CD  1 
ATOM   9253  C  CD  B ARG G  1 155 ? -79.610  -25.695  3.278   0.30 12.15 ? 155 ARG G CD  1 
ATOM   9254  N  NE  A ARG G  1 155 ? -81.879  -26.337  2.253   0.70 14.26 ? 155 ARG G NE  1 
ATOM   9255  N  NE  B ARG G  1 155 ? -78.162  -25.693  3.108   0.30 13.24 ? 155 ARG G NE  1 
ATOM   9256  C  CZ  A ARG G  1 155 ? -81.804  -27.472  1.531   0.70 14.75 ? 155 ARG G CZ  1 
ATOM   9257  C  CZ  B ARG G  1 155 ? -77.517  -26.243  2.086   0.30 13.42 ? 155 ARG G CZ  1 
ATOM   9258  N  NH1 A ARG G  1 155 ? -80.735  -28.284  1.598   0.70 13.78 ? 155 ARG G NH1 1 
ATOM   9259  N  NH1 B ARG G  1 155 ? -78.187  -26.852  1.113   0.30 13.11 ? 155 ARG G NH1 1 
ATOM   9260  N  NH2 A ARG G  1 155 ? -82.822  -27.814  0.745   0.70 13.91 ? 155 ARG G NH2 1 
ATOM   9261  N  NH2 B ARG G  1 155 ? -76.194  -26.175  2.034   0.30 12.58 ? 155 ARG G NH2 1 
ATOM   9262  N  N   . GLU G  1 156 ? -77.972  -26.590  8.202   1.00 13.53 ? 156 GLU G N   1 
ATOM   9263  C  CA  . GLU G  1 156 ? -76.730  -26.367  8.964   1.00 14.98 ? 156 GLU G CA  1 
ATOM   9264  C  C   . GLU G  1 156 ? -75.606  -25.993  8.022   1.00 16.90 ? 156 GLU G C   1 
ATOM   9265  O  O   . GLU G  1 156 ? -75.587  -26.432  6.846   1.00 17.53 ? 156 GLU G O   1 
ATOM   9266  C  CB  . GLU G  1 156 ? -76.354  -27.554  9.814   1.00 14.57 ? 156 GLU G CB  1 
ATOM   9267  C  CG  . GLU G  1 156 ? -76.594  -28.896  9.206   1.00 16.06 ? 156 GLU G CG  1 
ATOM   9268  C  CD  . GLU G  1 156 ? -76.728  -29.950  10.307  1.00 21.04 ? 156 GLU G CD  1 
ATOM   9269  O  OE1 . GLU G  1 156 ? -76.818  -29.527  11.503  1.00 20.98 ? 156 GLU G OE1 1 
ATOM   9270  O  OE2 . GLU G  1 156 ? -76.756  -31.177  9.987   1.00 23.05 ? 156 GLU G OE2 1 
ATOM   9271  N  N   . GLU G  1 157 ? -74.691  -25.147  8.507   1.00 18.95 ? 157 GLU G N   1 
ATOM   9272  C  CA  . GLU G  1 157 ? -73.564  -24.712  7.642   1.00 20.31 ? 157 GLU G CA  1 
ATOM   9273  C  C   . GLU G  1 157 ? -72.439  -25.775  7.668   1.00 20.73 ? 157 GLU G C   1 
ATOM   9274  O  O   . GLU G  1 157 ? -71.965  -26.152  8.759   1.00 20.42 ? 157 GLU G O   1 
ATOM   9275  C  CB  . GLU G  1 157 ? -73.041  -23.272  7.952   1.00 19.90 ? 157 GLU G CB  1 
ATOM   9276  C  CG  . GLU G  1 157 ? -72.480  -22.570  6.637   1.00 20.91 ? 157 GLU G CG  1 
ATOM   9277  C  CD  . GLU G  1 157 ? -71.513  -21.384  6.895   1.00 21.10 ? 157 GLU G CD  1 
ATOM   9278  O  OE1 . GLU G  1 157 ? -71.680  -20.691  7.944   1.00 20.42 ? 157 GLU G OE1 1 
ATOM   9279  O  OE2 . GLU G  1 157 ? -70.609  -21.168  6.015   1.00 20.11 ? 157 GLU G OE2 1 
ATOM   9280  N  N   . GLY G  1 158 ? -72.077  -26.278  6.468   1.00 21.42 ? 158 GLY G N   1 
ATOM   9281  C  CA  . GLY G  1 158 ? -70.993  -27.279  6.305   1.00 21.81 ? 158 GLY G CA  1 
ATOM   9282  C  C   . GLY G  1 158 ? -69.602  -26.700  6.588   1.00 21.63 ? 158 GLY G C   1 
ATOM   9283  N  N   . MET H  1 1   ? -96.462  -31.115  19.986  1.00 7.49  ? 1   MET H N   1 
ATOM   9284  C  CA  . MET H  1 1   ? -97.658  -31.883  20.476  1.00 8.46  ? 1   MET H CA  1 
ATOM   9285  C  C   . MET H  1 1   ? -97.921  -31.477  21.918  1.00 8.23  ? 1   MET H C   1 
ATOM   9286  O  O   . MET H  1 1   ? -97.010  -31.534  22.704  1.00 8.29  ? 1   MET H O   1 
ATOM   9287  C  CB  . MET H  1 1   ? -97.317  -33.350  20.401  1.00 7.81  ? 1   MET H CB  1 
ATOM   9288  C  CG  . MET H  1 1   ? -98.457  -34.309  20.422  1.00 7.88  ? 1   MET H CG  1 
ATOM   9289  S  SD  . MET H  1 1   ? -97.654  -35.906  20.216  1.00 10.93 ? 1   MET H SD  1 
ATOM   9290  C  CE  . MET H  1 1   ? -97.152  -36.323  21.906  1.00 5.74  ? 1   MET H CE  1 
ATOM   9291  N  N   . LYS H  1 2   ? -99.123  -31.030  22.272  1.00 9.06  ? 2   LYS H N   1 
ATOM   9292  C  CA  . LYS H  1 2   ? -99.366  -30.546  23.655  1.00 10.63 ? 2   LYS H CA  1 
ATOM   9293  C  C   . LYS H  1 2   ? -99.343  -31.708  24.626  1.00 9.25  ? 2   LYS H C   1 
ATOM   9294  O  O   . LYS H  1 2   ? -100.213 -32.561  24.553  1.00 9.85  ? 2   LYS H O   1 
ATOM   9295  C  CB  . LYS H  1 2   ? -100.732 -29.851  23.784  1.00 10.62 ? 2   LYS H CB  1 
ATOM   9296  C  CG  . LYS H  1 2   ? -100.669 -28.420  24.360  1.00 14.38 ? 2   LYS H CG  1 
ATOM   9297  C  CD  . LYS H  1 2   ? -101.926 -28.018  25.199  1.00 15.10 ? 2   LYS H CD  1 
ATOM   9298  C  CE  . LYS H  1 2   ? -101.904 -28.685  26.620  1.00 19.17 ? 2   LYS H CE  1 
ATOM   9299  N  NZ  . LYS H  1 2   ? -102.753 -27.946  27.620  1.00 19.88 ? 2   LYS H NZ  1 
ATOM   9300  N  N   . GLY H  1 3   ? -98.359  -31.758  25.516  1.00 8.18  ? 3   GLY H N   1 
ATOM   9301  C  CA  . GLY H  1 3   ? -98.243  -32.854  26.474  1.00 6.87  ? 3   GLY H CA  1 
ATOM   9302  C  C   . GLY H  1 3   ? -99.096  -32.685  27.724  1.00 6.24  ? 3   GLY H C   1 
ATOM   9303  O  O   . GLY H  1 3   ? -99.721  -31.654  27.913  1.00 6.59  ? 3   GLY H O   1 
ATOM   9304  N  N   . ASP H  1 4   ? -99.113  -33.694  28.588  1.00 5.87  ? 4   ASP H N   1 
ATOM   9305  C  CA  . ASP H  1 4   ? -99.785  -33.597  29.861  1.00 5.70  ? 4   ASP H CA  1 
ATOM   9306  C  C   . ASP H  1 4   ? -98.991  -32.649  30.753  1.00 5.85  ? 4   ASP H C   1 
ATOM   9307  O  O   . ASP H  1 4   ? -97.773  -32.780  30.841  1.00 6.67  ? 4   ASP H O   1 
ATOM   9308  C  CB  . ASP H  1 4   ? -99.931  -34.980  30.468  1.00 5.43  ? 4   ASP H CB  1 
ATOM   9309  C  CG  . ASP H  1 4   ? -100.462 -34.950  31.883  1.00 6.92  ? 4   ASP H CG  1 
ATOM   9310  O  OD1 . ASP H  1 4   ? -99.639  -34.848  32.826  1.00 9.26  ? 4   ASP H OD1 1 
ATOM   9311  O  OD2 . ASP H  1 4   ? -101.695 -35.069  32.056  1.00 6.93  ? 4   ASP H OD2 1 
ATOM   9312  N  N   . THR H  1 5   ? -99.670  -31.682  31.381  1.00 5.76  ? 5   THR H N   1 
ATOM   9313  C  CA  . THR H  1 5   ? -99.014  -30.666  32.225  1.00 5.86  ? 5   THR H CA  1 
ATOM   9314  C  C   . THR H  1 5   ? -98.186  -31.256  33.359  1.00 5.61  ? 5   THR H C   1 
ATOM   9315  O  O   . THR H  1 5   ? -97.066  -30.809  33.652  1.00 5.73  ? 5   THR H O   1 
ATOM   9316  C  CB  . THR H  1 5   ? -100.067 -29.701  32.832  1.00 6.02  ? 5   THR H CB  1 
ATOM   9317  O  OG1 . THR H  1 5   ? -100.717 -29.021  31.761  1.00 7.10  ? 5   THR H OG1 1 
ATOM   9318  C  CG2 . THR H  1 5   ? -99.426  -28.633  33.743  1.00 5.37  ? 5   THR H CG2 1 
ATOM   9319  N  N   . LYS H  1 6   ? -98.756  -32.250  34.017  1.00 5.14  ? 6   LYS H N   1 
ATOM   9320  C  CA  . LYS H  1 6   ? -98.112  -32.840  35.177  1.00 4.77  ? 6   LYS H CA  1 
ATOM   9321  C  C   . LYS H  1 6   ? -96.867  -33.632  34.723  1.00 4.68  ? 6   LYS H C   1 
ATOM   9322  O  O   . LYS H  1 6   ? -95.857  -33.647  35.430  1.00 4.93  ? 6   LYS H O   1 
ATOM   9323  C  CB  . LYS H  1 6   ? -99.121  -33.669  35.989  1.00 4.15  ? 6   LYS H CB  1 
ATOM   9324  C  CG  . LYS H  1 6   ? -98.515  -34.355  37.157  1.00 6.56  ? 6   LYS H CG  1 
ATOM   9325  C  CD  . LYS H  1 6   ? -99.438  -34.486  38.368  1.00 9.49  ? 6   LYS H CD  1 
ATOM   9326  C  CE  . LYS H  1 6   ? -98.686  -33.908  39.650  1.00 13.28 ? 6   LYS H CE  1 
ATOM   9327  N  NZ  . LYS H  1 6   ? -98.378  -34.928  40.718  1.00 17.04 ? 6   LYS H NZ  1 
ATOM   9328  N  N   . VAL H  1 7   ? -96.924  -34.252  33.539  1.00 3.68  ? 7   VAL H N   1 
ATOM   9329  C  CA  . VAL H  1 7   ? -95.720  -34.881  32.982  1.00 3.14  ? 7   VAL H CA  1 
ATOM   9330  C  C   . VAL H  1 7   ? -94.601  -33.848  32.796  1.00 3.15  ? 7   VAL H C   1 
ATOM   9331  O  O   . VAL H  1 7   ? -93.431  -34.103  33.112  1.00 3.05  ? 7   VAL H O   1 
ATOM   9332  C  CB  . VAL H  1 7   ? -95.972  -35.613  31.643  1.00 3.08  ? 7   VAL H CB  1 
ATOM   9333  C  CG1 . VAL H  1 7   ? -94.640  -36.024  30.976  1.00 2.00  ? 7   VAL H CG1 1 
ATOM   9334  C  CG2 . VAL H  1 7   ? -96.814  -36.833  31.871  1.00 2.48  ? 7   VAL H CG2 1 
ATOM   9335  N  N   . ILE H  1 8   ? -94.962  -32.692  32.264  1.00 2.79  ? 8   ILE H N   1 
ATOM   9336  C  CA  . ILE H  1 8   ? -94.006  -31.633  32.072  1.00 2.56  ? 8   ILE H CA  1 
ATOM   9337  C  C   . ILE H  1 8   ? -93.442  -31.191  33.423  1.00 3.36  ? 8   ILE H C   1 
ATOM   9338  O  O   . ILE H  1 8   ? -92.230  -30.978  33.512  1.00 3.27  ? 8   ILE H O   1 
ATOM   9339  C  CB  . ILE H  1 8   ? -94.598  -30.469  31.279  1.00 2.66  ? 8   ILE H CB  1 
ATOM   9340  C  CG1 . ILE H  1 8   ? -94.850  -30.887  29.844  1.00 3.42  ? 8   ILE H CG1 1 
ATOM   9341  C  CG2 . ILE H  1 8   ? -93.663  -29.275  31.288  1.00 2.63  ? 8   ILE H CG2 1 
ATOM   9342  C  CD1 . ILE H  1 8   ? -95.842  -30.019  29.081  1.00 2.73  ? 8   ILE H CD1 1 
ATOM   9343  N  N   . ASN H  1 9   ? -94.288  -31.059  34.467  1.00 3.98  ? 9   ASN H N   1 
ATOM   9344  C  CA  . ASN H  1 9   ? -93.782  -30.699  35.802  1.00 4.74  ? 9   ASN H CA  1 
ATOM   9345  C  C   . ASN H  1 9   ? -92.752  -31.741  36.268  1.00 4.43  ? 9   ASN H C   1 
ATOM   9346  O  O   . ASN H  1 9   ? -91.699  -31.393  36.806  1.00 4.84  ? 9   ASN H O   1 
ATOM   9347  C  CB  . ASN H  1 9   ? -94.893  -30.570  36.850  1.00 5.78  ? 9   ASN H CB  1 
ATOM   9348  C  CG  . ASN H  1 9   ? -95.771  -29.322  36.659  1.00 10.56 ? 9   ASN H CG  1 
ATOM   9349  O  OD1 . ASN H  1 9   ? -95.273  -28.251  36.358  1.00 19.62 ? 9   ASN H OD1 1 
ATOM   9350  N  ND2 . ASN H  1 9   ? -97.084  -29.456  36.869  1.00 12.19 ? 9   ASN H ND2 1 
ATOM   9351  N  N   . TYR H  1 10  ? -93.052  -33.019  36.051  1.00 3.62  ? 10  TYR H N   1 
ATOM   9352  C  CA  . TYR H  1 10  ? -92.151  -34.069  36.438  1.00 3.21  ? 10  TYR H CA  1 
ATOM   9353  C  C   . TYR H  1 10  ? -90.849  -33.944  35.671  1.00 3.22  ? 10  TYR H C   1 
ATOM   9354  O  O   . TYR H  1 10  ? -89.785  -33.994  36.285  1.00 3.21  ? 10  TYR H O   1 
ATOM   9355  C  CB  . TYR H  1 10  ? -92.765  -35.436  36.200  1.00 3.15  ? 10  TYR H CB  1 
ATOM   9356  C  CG  . TYR H  1 10  ? -93.515  -35.985  37.356  1.00 3.07  ? 10  TYR H CG  1 
ATOM   9357  C  CD1 . TYR H  1 10  ? -92.895  -36.160  38.596  1.00 2.00  ? 10  TYR H CD1 1 
ATOM   9358  C  CD2 . TYR H  1 10  ? -94.852  -36.365  37.214  1.00 2.37  ? 10  TYR H CD2 1 
ATOM   9359  C  CE1 . TYR H  1 10  ? -93.580  -36.678  39.671  1.00 2.60  ? 10  TYR H CE1 1 
ATOM   9360  C  CE2 . TYR H  1 10  ? -95.560  -36.898  38.276  1.00 2.13  ? 10  TYR H CE2 1 
ATOM   9361  C  CZ  . TYR H  1 10  ? -94.921  -37.049  39.499  1.00 3.91  ? 10  TYR H CZ  1 
ATOM   9362  O  OH  . TYR H  1 10  ? -95.628  -37.572  40.544  1.00 4.48  ? 10  TYR H OH  1 
ATOM   9363  N  N   . LEU H  1 11  ? -90.942  -33.781  34.342  1.00 2.65  ? 11  LEU H N   1 
ATOM   9364  C  CA  . LEU H  1 11  ? -89.780  -33.614  33.500  1.00 2.07  ? 11  LEU H CA  1 
ATOM   9365  C  C   . LEU H  1 11  ? -88.911  -32.455  34.018  1.00 2.47  ? 11  LEU H C   1 
ATOM   9366  O  O   . LEU H  1 11  ? -87.684  -32.601  34.111  1.00 2.46  ? 11  LEU H O   1 
ATOM   9367  C  CB  . LEU H  1 11  ? -90.199  -33.423  32.058  1.00 2.00  ? 11  LEU H CB  1 
ATOM   9368  C  CG  . LEU H  1 11  ? -90.174  -34.642  31.122  1.00 2.52  ? 11  LEU H CG  1 
ATOM   9369  C  CD1 . LEU H  1 11  ? -90.303  -35.977  31.827  1.00 2.13  ? 11  LEU H CD1 1 
ATOM   9370  C  CD2 . LEU H  1 11  ? -91.161  -34.534  29.960  1.00 2.00  ? 11  LEU H CD2 1 
ATOM   9371  N  N   . ASN H  1 12  ? -89.535  -31.328  34.410  1.00 2.15  ? 12  ASN H N   1 
ATOM   9372  C  CA  . ASN H  1 12  ? -88.759  -30.199  34.927  1.00 2.06  ? 12  ASN H CA  1 
ATOM   9373  C  C   . ASN H  1 12  ? -88.140  -30.545  36.266  1.00 2.48  ? 12  ASN H C   1 
ATOM   9374  O  O   . ASN H  1 12  ? -87.009  -30.156  36.556  1.00 2.61  ? 12  ASN H O   1 
ATOM   9375  C  CB  . ASN H  1 12  ? -89.594  -28.923  35.032  1.00 2.04  ? 12  ASN H CB  1 
ATOM   9376  C  CG  . ASN H  1 12  ? -89.459  -28.016  33.796  1.00 2.50  ? 12  ASN H CG  1 
ATOM   9377  O  OD1 . ASN H  1 12  ? -88.370  -27.805  33.287  1.00 4.18  ? 12  ASN H OD1 1 
ATOM   9378  N  ND2 . ASN H  1 12  ? -90.575  -27.475  33.324  1.00 2.00  ? 12  ASN H ND2 1 
ATOM   9379  N  N   . LYS H  1 13  ? -88.856  -31.303  37.076  1.00 2.55  ? 13  LYS H N   1 
ATOM   9380  C  CA  . LYS H  1 13  ? -88.298  -31.678  38.363  1.00 3.19  ? 13  LYS H CA  1 
ATOM   9381  C  C   . LYS H  1 13  ? -87.085  -32.608  38.190  1.00 3.56  ? 13  LYS H C   1 
ATOM   9382  O  O   . LYS H  1 13  ? -86.042  -32.418  38.825  1.00 4.27  ? 13  LYS H O   1 
ATOM   9383  C  CB  . LYS H  1 13  ? -89.367  -32.317  39.232  1.00 3.17  ? 13  LYS H CB  1 
ATOM   9384  C  CG  . LYS H  1 13  ? -88.871  -32.926  40.497  1.00 2.86  ? 13  LYS H CG  1 
ATOM   9385  C  CD  . LYS H  1 13  ? -89.980  -32.987  41.517  1.00 5.50  ? 13  LYS H CD  1 
ATOM   9386  C  CE  . LYS H  1 13  ? -89.632  -33.991  42.579  1.00 8.10  ? 13  LYS H CE  1 
ATOM   9387  N  NZ  . LYS H  1 13  ? -89.765  -33.377  43.917  1.00 9.99  ? 13  LYS H NZ  1 
ATOM   9388  N  N   . LEU H  1 14  ? -87.225  -33.588  37.313  1.00 3.02  ? 14  LEU H N   1 
ATOM   9389  C  CA  . LEU H  1 14  ? -86.125  -34.472  36.983  1.00 2.94  ? 14  LEU H CA  1 
ATOM   9390  C  C   . LEU H  1 14  ? -84.955  -33.676  36.401  1.00 3.22  ? 14  LEU H C   1 
ATOM   9391  O  O   . LEU H  1 14  ? -83.812  -33.863  36.822  1.00 3.03  ? 14  LEU H O   1 
ATOM   9392  C  CB  . LEU H  1 14  ? -86.583  -35.594  36.042  1.00 2.47  ? 14  LEU H CB  1 
ATOM   9393  C  CG  . LEU H  1 14  ? -87.677  -36.486  36.632  1.00 2.69  ? 14  LEU H CG  1 
ATOM   9394  C  CD1 . LEU H  1 14  ? -88.106  -37.521  35.656  1.00 3.78  ? 14  LEU H CD1 1 
ATOM   9395  C  CD2 . LEU H  1 14  ? -87.247  -37.118  37.909  1.00 2.00  ? 14  LEU H CD2 1 
ATOM   9396  N  N   . LEU H  1 15  ? -85.247  -32.759  35.483  1.00 3.09  ? 15  LEU H N   1 
ATOM   9397  C  CA  . LEU H  1 15  ? -84.238  -31.873  34.915  1.00 2.28  ? 15  LEU H CA  1 
ATOM   9398  C  C   . LEU H  1 15  ? -83.511  -31.153  36.036  1.00 2.80  ? 15  LEU H C   1 
ATOM   9399  O  O   . LEU H  1 15  ? -82.292  -31.044  35.991  1.00 2.80  ? 15  LEU H O   1 
ATOM   9400  C  CB  . LEU H  1 15  ? -84.880  -30.869  33.955  1.00 2.00  ? 15  LEU H CB  1 
ATOM   9401  C  CG  . LEU H  1 15  ? -83.995  -29.750  33.406  1.00 2.00  ? 15  LEU H CG  1 
ATOM   9402  C  CD1 . LEU H  1 15  ? -82.758  -30.242  32.692  1.00 2.00  ? 15  LEU H CD1 1 
ATOM   9403  C  CD2 . LEU H  1 15  ? -84.797  -28.839  32.496  1.00 2.00  ? 15  LEU H CD2 1 
ATOM   9404  N  N   . GLY H  1 16  ? -84.264  -30.692  37.045  1.00 3.00  ? 16  GLY H N   1 
ATOM   9405  C  CA  . GLY H  1 16  ? -83.702  -30.005  38.172  1.00 3.43  ? 16  GLY H CA  1 
ATOM   9406  C  C   . GLY H  1 16  ? -82.704  -30.891  38.902  1.00 4.62  ? 16  GLY H C   1 
ATOM   9407  O  O   . GLY H  1 16  ? -81.666  -30.413  39.350  1.00 4.34  ? 16  GLY H O   1 
ATOM   9408  N  N   . ASN H  1 17  ? -83.026  -32.180  39.034  1.00 5.39  ? 17  ASN H N   1 
ATOM   9409  C  CA  . ASN H  1 17  ? -82.164  -33.125  39.708  1.00 6.09  ? 17  ASN H CA  1 
ATOM   9410  C  C   . ASN H  1 17  ? -80.867  -33.252  38.938  1.00 6.96  ? 17  ASN H C   1 
ATOM   9411  O  O   . ASN H  1 17  ? -79.795  -33.237  39.550  1.00 7.12  ? 17  ASN H O   1 
ATOM   9412  C  CB  . ASN H  1 17  ? -82.812  -34.513  39.805  1.00 6.04  ? 17  ASN H CB  1 
ATOM   9413  C  CG  . ASN H  1 17  ? -83.963  -34.577  40.786  1.00 6.59  ? 17  ASN H CG  1 
ATOM   9414  O  OD1 . ASN H  1 17  ? -84.124  -33.728  41.650  1.00 5.62  ? 17  ASN H OD1 1 
ATOM   9415  N  ND2 . ASN H  1 17  ? -84.776  -35.613  40.653  1.00 8.91  ? 17  ASN H ND2 1 
ATOM   9416  N  N   . GLU H  1 18  ? -80.962  -33.380  37.602  1.00 7.02  ? 18  GLU H N   1 
ATOM   9417  C  CA  . GLU H  1 18  ? -79.783  -33.610  36.780  1.00 7.63  ? 18  GLU H CA  1 
ATOM   9418  C  C   . GLU H  1 18  ? -78.931  -32.342  36.828  1.00 7.79  ? 18  GLU H C   1 
ATOM   9419  O  O   . GLU H  1 18  ? -77.677  -32.392  36.832  1.00 7.46  ? 18  GLU H O   1 
ATOM   9420  C  CB  . GLU H  1 18  ? -80.101  -33.938  35.323  1.00 7.67  ? 18  GLU H CB  1 
ATOM   9421  C  CG  . GLU H  1 18  ? -80.935  -35.148  35.074  1.00 9.73  ? 18  GLU H CG  1 
ATOM   9422  C  CD  . GLU H  1 18  ? -80.255  -36.480  35.322  1.00 13.53 ? 18  GLU H CD  1 
ATOM   9423  O  OE1 . GLU H  1 18  ? -79.005  -36.606  35.282  1.00 12.99 ? 18  GLU H OE1 1 
ATOM   9424  O  OE2 . GLU H  1 18  ? -81.019  -37.455  35.531  1.00 15.55 ? 18  GLU H OE2 1 
ATOM   9425  N  N   . LEU H  1 19  ? -79.576  -31.185  36.873  1.00 7.45  ? 19  LEU H N   1 
ATOM   9426  C  CA  . LEU H  1 19  ? -78.708  -30.075  36.908  1.00 7.21  ? 19  LEU H CA  1 
ATOM   9427  C  C   . LEU H  1 19  ? -77.978  -29.792  38.185  1.00 6.87  ? 19  LEU H C   1 
ATOM   9428  O  O   . LEU H  1 19  ? -76.847  -29.331  38.127  1.00 7.38  ? 19  LEU H O   1 
ATOM   9429  C  CB  . LEU H  1 19  ? -79.058  -28.911  35.999  1.00 7.66  ? 19  LEU H CB  1 
ATOM   9430  C  CG  . LEU H  1 19  ? -80.136  -27.882  35.704  1.00 8.52  ? 19  LEU H CG  1 
ATOM   9431  C  CD1 . LEU H  1 19  ? -80.160  -28.030  34.240  1.00 7.74  ? 19  LEU H CD1 1 
ATOM   9432  C  CD2 . LEU H  1 19  ? -81.516  -28.101  36.229  1.00 11.89 ? 19  LEU H CD2 1 
ATOM   9433  N  N   . VAL H  1 20  ? -78.516  -30.195  39.334  1.00 6.23  ? 20  VAL H N   1 
ATOM   9434  C  CA  . VAL H  1 20  ? -77.639  -30.219  40.499  1.00 4.56  ? 20  VAL H CA  1 
ATOM   9435  C  C   . VAL H  1 20  ? -76.533  -31.286  40.378  1.00 3.96  ? 20  VAL H C   1 
ATOM   9436  O  O   . VAL H  1 20  ? -75.374  -30.984  40.645  1.00 3.96  ? 20  VAL H O   1 
ATOM   9437  C  CB  . VAL H  1 20  ? -78.325  -30.087  41.920  1.00 4.11  ? 20  VAL H CB  1 
ATOM   9438  C  CG1 . VAL H  1 20  ? -79.766  -30.137  41.876  1.00 3.18  ? 20  VAL H CG1 1 
ATOM   9439  C  CG2 . VAL H  1 20  ? -77.748  -31.069  42.914  1.00 3.05  ? 20  VAL H CG2 1 
ATOM   9440  N  N   . ALA H  1 21  ? -76.875  -32.480  39.902  1.00 2.97  ? 21  ALA H N   1 
ATOM   9441  C  CA  . ALA H  1 21  ? -75.877  -33.544  39.727  1.00 2.41  ? 21  ALA H CA  1 
ATOM   9442  C  C   . ALA H  1 21  ? -74.728  -33.140  38.819  1.00 2.87  ? 21  ALA H C   1 
ATOM   9443  O  O   . ALA H  1 21  ? -73.583  -33.415  39.135  1.00 3.38  ? 21  ALA H O   1 
ATOM   9444  C  CB  . ALA H  1 21  ? -76.520  -34.795  39.224  1.00 2.00  ? 21  ALA H CB  1 
ATOM   9445  N  N   . ILE H  1 22  ? -75.039  -32.488  37.700  1.00 2.93  ? 22  ILE H N   1 
ATOM   9446  C  CA  . ILE H  1 22  ? -74.030  -31.990  36.759  1.00 3.07  ? 22  ILE H CA  1 
ATOM   9447  C  C   . ILE H  1 22  ? -72.961  -31.179  37.466  1.00 3.67  ? 22  ILE H C   1 
ATOM   9448  O  O   . ILE H  1 22  ? -71.751  -31.470  37.329  1.00 4.19  ? 22  ILE H O   1 
ATOM   9449  C  CB  . ILE H  1 22  ? -74.660  -31.122  35.611  1.00 3.76  ? 22  ILE H CB  1 
ATOM   9450  C  CG1 . ILE H  1 22  ? -75.364  -32.022  34.590  1.00 3.24  ? 22  ILE H CG1 1 
ATOM   9451  C  CG2 . ILE H  1 22  ? -73.621  -30.280  34.907  1.00 2.00  ? 22  ILE H CG2 1 
ATOM   9452  C  CD1 . ILE H  1 22  ? -76.269  -31.278  33.723  1.00 2.00  ? 22  ILE H CD1 1 
ATOM   9453  N  N   . ASN H  1 23  ? -73.394  -30.177  38.233  1.00 3.22  ? 23  ASN H N   1 
ATOM   9454  C  CA  . ASN H  1 23  ? -72.473  -29.340  38.966  1.00 3.19  ? 23  ASN H CA  1 
ATOM   9455  C  C   . ASN H  1 23  ? -71.776  -30.099  40.083  1.00 3.60  ? 23  ASN H C   1 
ATOM   9456  O  O   . ASN H  1 23  ? -70.569  -29.964  40.290  1.00 4.02  ? 23  ASN H O   1 
ATOM   9457  C  CB  . ASN H  1 23  ? -73.197  -28.133  39.529  1.00 3.27  ? 23  ASN H CB  1 
ATOM   9458  C  CG  . ASN H  1 23  ? -73.678  -27.170  38.448  1.00 4.12  ? 23  ASN H CG  1 
ATOM   9459  O  OD1 . ASN H  1 23  ? -74.206  -26.115  38.762  1.00 5.85  ? 23  ASN H OD1 1 
ATOM   9460  N  ND2 . ASN H  1 23  ? -73.506  -27.535  37.175  1.00 5.25  ? 23  ASN H ND2 1 
ATOM   9461  N  N   . GLN H  1 24  ? -72.507  -30.910  40.820  1.00 3.48  ? 24  GLN H N   1 
ATOM   9462  C  CA  . GLN H  1 24  ? -71.880  -31.526  41.957  1.00 3.64  ? 24  GLN H CA  1 
ATOM   9463  C  C   . GLN H  1 24  ? -70.808  -32.499  41.457  1.00 3.75  ? 24  GLN H C   1 
ATOM   9464  O  O   . GLN H  1 24  ? -69.693  -32.520  41.981  1.00 4.10  ? 24  GLN H O   1 
ATOM   9465  C  CB  . GLN H  1 24  ? -72.908  -32.179  42.884  1.00 3.64  ? 24  GLN H CB  1 
ATOM   9466  C  CG  . GLN H  1 24  ? -72.314  -32.845  44.103  1.00 4.32  ? 24  GLN H CG  1 
ATOM   9467  C  CD  . GLN H  1 24  ? -73.368  -33.198  45.115  1.00 7.13  ? 24  GLN H CD  1 
ATOM   9468  O  OE1 . GLN H  1 24  ? -74.137  -32.342  45.545  1.00 8.24  ? 24  GLN H OE1 1 
ATOM   9469  N  NE2 . GLN H  1 24  ? -73.407  -34.470  45.517  1.00 6.65  ? 24  GLN H NE2 1 
ATOM   9470  N  N   . TYR H  1 25  ? -71.111  -33.246  40.408  1.00 3.59  ? 25  TYR H N   1 
ATOM   9471  C  CA  . TYR H  1 25  ? -70.132  -34.169  39.852  1.00 4.26  ? 25  TYR H CA  1 
ATOM   9472  C  C   . TYR H  1 25  ? -68.899  -33.468  39.282  1.00 3.86  ? 25  TYR H C   1 
ATOM   9473  O  O   . TYR H  1 25  ? -67.778  -33.927  39.473  1.00 3.49  ? 25  TYR H O   1 
ATOM   9474  C  CB  . TYR H  1 25  ? -70.758  -35.034  38.773  1.00 5.18  ? 25  TYR H CB  1 
ATOM   9475  C  CG  . TYR H  1 25  ? -71.465  -36.273  39.277  1.00 7.10  ? 25  TYR H CG  1 
ATOM   9476  C  CD1 . TYR H  1 25  ? -70.847  -37.135  40.200  1.00 8.17  ? 25  TYR H CD1 1 
ATOM   9477  C  CD2 . TYR H  1 25  ? -72.730  -36.612  38.786  1.00 7.84  ? 25  TYR H CD2 1 
ATOM   9478  C  CE1 . TYR H  1 25  ? -71.478  -38.271  40.637  1.00 8.82  ? 25  TYR H CE1 1 
ATOM   9479  C  CE2 . TYR H  1 25  ? -73.368  -37.746  39.208  1.00 8.83  ? 25  TYR H CE2 1 
ATOM   9480  C  CZ  . TYR H  1 25  ? -72.740  -38.574  40.134  1.00 8.93  ? 25  TYR H CZ  1 
ATOM   9481  O  OH  . TYR H  1 25  ? -73.393  -39.718  40.539  1.00 8.71  ? 25  TYR H OH  1 
ATOM   9482  N  N   . PHE H  1 26  ? -69.109  -32.350  38.602  1.00 3.54  ? 26  PHE H N   1 
ATOM   9483  C  CA  . PHE H  1 26  ? -68.004  -31.605  38.018  1.00 2.95  ? 26  PHE H CA  1 
ATOM   9484  C  C   . PHE H  1 26  ? -67.051  -31.012  39.060  1.00 3.00  ? 26  PHE H C   1 
ATOM   9485  O  O   . PHE H  1 26  ? -65.829  -31.126  38.926  1.00 2.40  ? 26  PHE H O   1 
ATOM   9486  C  CB  . PHE H  1 26  ? -68.524  -30.499  37.109  1.00 2.69  ? 26  PHE H CB  1 
ATOM   9487  C  CG  . PHE H  1 26  ? -67.550  -30.122  36.086  1.00 3.05  ? 26  PHE H CG  1 
ATOM   9488  C  CD1 . PHE H  1 26  ? -67.514  -30.801  34.873  1.00 3.12  ? 26  PHE H CD1 1 
ATOM   9489  C  CD2 . PHE H  1 26  ? -66.590  -29.131  36.346  1.00 3.55  ? 26  PHE H CD2 1 
ATOM   9490  C  CE1 . PHE H  1 26  ? -66.551  -30.476  33.905  1.00 3.92  ? 26  PHE H CE1 1 
ATOM   9491  C  CE2 . PHE H  1 26  ? -65.603  -28.813  35.390  1.00 4.09  ? 26  PHE H CE2 1 
ATOM   9492  C  CZ  . PHE H  1 26  ? -65.587  -29.481  34.171  1.00 4.34  ? 26  PHE H CZ  1 
ATOM   9493  N  N   . LEU H  1 27  ? -67.603  -30.369  40.094  1.00 2.83  ? 27  LEU H N   1 
ATOM   9494  C  CA  . LEU H  1 27  ? -66.788  -29.851  41.171  1.00 2.50  ? 27  LEU H CA  1 
ATOM   9495  C  C   . LEU H  1 27  ? -66.047  -31.013  41.815  1.00 2.48  ? 27  LEU H C   1 
ATOM   9496  O  O   . LEU H  1 27  ? -64.833  -30.931  42.024  1.00 2.01  ? 27  LEU H O   1 
ATOM   9497  C  CB  . LEU H  1 27  ? -67.642  -29.135  42.201  1.00 2.54  ? 27  LEU H CB  1 
ATOM   9498  C  CG  . LEU H  1 27  ? -67.086  -27.904  42.926  1.00 2.49  ? 27  LEU H CG  1 
ATOM   9499  C  CD1 . LEU H  1 27  ? -67.765  -27.692  44.233  1.00 2.00  ? 27  LEU H CD1 1 
ATOM   9500  C  CD2 . LEU H  1 27  ? -65.582  -27.898  43.091  1.00 2.95  ? 27  LEU H CD2 1 
ATOM   9501  N  N   . HIS H  1 28  ? -66.749  -32.115  42.100  1.00 2.16  ? 28  HIS H N   1 
ATOM   9502  C  CA  . HIS H  1 28  ? -66.071  -33.254  42.732  1.00 2.38  ? 28  HIS H CA  1 
ATOM   9503  C  C   . HIS H  1 28  ? -64.911  -33.698  41.870  1.00 2.56  ? 28  HIS H C   1 
ATOM   9504  O  O   . HIS H  1 28  ? -63.776  -33.821  42.347  1.00 2.86  ? 28  HIS H O   1 
ATOM   9505  C  CB  . HIS H  1 28  ? -67.003  -34.419  43.029  1.00 2.49  ? 28  HIS H CB  1 
ATOM   9506  C  CG  . HIS H  1 28  ? -67.870  -34.192  44.215  1.00 2.58  ? 28  HIS H CG  1 
ATOM   9507  N  ND1 . HIS H  1 28  ? -68.969  -34.975  44.489  1.00 2.47  ? 28  HIS H ND1 1 
ATOM   9508  C  CD2 . HIS H  1 28  ? -67.829  -33.238  45.186  1.00 2.03  ? 28  HIS H CD2 1 
ATOM   9509  C  CE1 . HIS H  1 28  ? -69.557  -34.526  45.594  1.00 3.21  ? 28  HIS H CE1 1 
ATOM   9510  N  NE2 . HIS H  1 28  ? -68.879  -33.477  46.039  1.00 3.25  ? 28  HIS H NE2 1 
ATOM   9511  N  N   . ALA H  1 29  ? -65.182  -33.882  40.588  1.00 2.32  ? 29  ALA H N   1 
ATOM   9512  C  CA  . ALA H  1 29  ? -64.157  -34.262  39.636  1.00 2.15  ? 29  ALA H CA  1 
ATOM   9513  C  C   . ALA H  1 29  ? -62.906  -33.400  39.747  1.00 2.11  ? 29  ALA H C   1 
ATOM   9514  O  O   . ALA H  1 29  ? -61.802  -33.943  39.890  1.00 2.20  ? 29  ALA H O   1 
ATOM   9515  C  CB  . ALA H  1 29  ? -64.698  -34.245  38.229  1.00 2.01  ? 29  ALA H CB  1 
ATOM   9516  N  N   . ARG H  1 30  ? -63.057  -32.083  39.689  1.00 2.09  ? 30  ARG H N   1 
ATOM   9517  C  CA  . ARG H  1 30  ? -61.885  -31.210  39.652  1.00 2.41  ? 30  ARG H CA  1 
ATOM   9518  C  C   . ARG H  1 30  ? -61.226  -31.059  41.031  1.00 2.71  ? 30  ARG H C   1 
ATOM   9519  O  O   . ARG H  1 30  ? -60.033  -30.722  41.145  1.00 2.43  ? 30  ARG H O   1 
ATOM   9520  C  CB  . ARG H  1 30  ? -62.218  -29.866  39.047  1.00 2.00  ? 30  ARG H CB  1 
ATOM   9521  C  CG  . ARG H  1 30  ? -62.887  -29.977  37.731  1.00 2.00  ? 30  ARG H CG  1 
ATOM   9522  C  CD  . ARG H  1 30  ? -61.941  -29.936  36.572  1.00 2.04  ? 30  ARG H CD  1 
ATOM   9523  N  NE  . ARG H  1 30  ? -61.893  -31.231  35.901  1.00 4.30  ? 30  ARG H NE  1 
ATOM   9524  C  CZ  . ARG H  1 30  ? -61.981  -31.443  34.589  1.00 2.88  ? 30  ARG H CZ  1 
ATOM   9525  N  NH1 . ARG H  1 30  ? -62.089  -30.467  33.716  1.00 2.73  ? 30  ARG H NH1 1 
ATOM   9526  N  NH2 . ARG H  1 30  ? -61.947  -32.672  34.152  1.00 4.03  ? 30  ARG H NH2 1 
ATOM   9527  N  N   . MET H  1 31  ? -61.990  -31.348  42.083  1.00 2.91  ? 31  MET H N   1 
ATOM   9528  C  CA  . MET H  1 31  ? -61.424  -31.455  43.428  1.00 2.82  ? 31  MET H CA  1 
ATOM   9529  C  C   . MET H  1 31  ? -60.499  -32.665  43.486  1.00 2.76  ? 31  MET H C   1 
ATOM   9530  O  O   . MET H  1 31  ? -59.331  -32.553  43.824  1.00 3.03  ? 31  MET H O   1 
ATOM   9531  C  CB  . MET H  1 31  ? -62.536  -31.542  44.464  1.00 2.62  ? 31  MET H CB  1 
ATOM   9532  C  CG  . MET H  1 31  ? -63.163  -30.198  44.820  1.00 2.03  ? 31  MET H CG  1 
ATOM   9533  S  SD  . MET H  1 31  ? -64.602  -30.340  45.909  1.00 3.52  ? 31  MET H SD  1 
ATOM   9534  C  CE  . MET H  1 31  ? -63.872  -30.884  47.477  1.00 2.00  ? 31  MET H CE  1 
ATOM   9535  N  N   . PHE H  1 32  ? -61.007  -33.822  43.100  1.00 2.67  ? 32  PHE H N   1 
ATOM   9536  C  CA  . PHE H  1 32  ? -60.167  -34.996  42.959  1.00 2.37  ? 32  PHE H CA  1 
ATOM   9537  C  C   . PHE H  1 32  ? -58.922  -34.737  42.105  1.00 2.50  ? 32  PHE H C   1 
ATOM   9538  O  O   . PHE H  1 32  ? -57.805  -35.188  42.441  1.00 2.59  ? 32  PHE H O   1 
ATOM   9539  C  CB  . PHE H  1 32  ? -60.971  -36.157  42.380  1.00 2.42  ? 32  PHE H CB  1 
ATOM   9540  C  CG  . PHE H  1 32  ? -62.060  -36.616  43.277  1.00 2.73  ? 32  PHE H CG  1 
ATOM   9541  C  CD1 . PHE H  1 32  ? -63.317  -36.901  42.770  1.00 4.23  ? 32  PHE H CD1 1 
ATOM   9542  C  CD2 . PHE H  1 32  ? -61.844  -36.733  44.638  1.00 2.42  ? 32  PHE H CD2 1 
ATOM   9543  C  CE1 . PHE H  1 32  ? -64.349  -37.321  43.609  1.00 4.29  ? 32  PHE H CE1 1 
ATOM   9544  C  CE2 . PHE H  1 32  ? -62.857  -37.158  45.482  1.00 4.95  ? 32  PHE H CE2 1 
ATOM   9545  C  CZ  . PHE H  1 32  ? -64.124  -37.448  44.967  1.00 4.19  ? 32  PHE H CZ  1 
ATOM   9546  N  N   . LYS H  1 33  ? -59.105  -34.031  40.995  1.00 2.62  ? 33  LYS H N   1 
ATOM   9547  C  CA  . LYS H  1 33  ? -58.000  -33.738  40.082  1.00 2.96  ? 33  LYS H CA  1 
ATOM   9548  C  C   . LYS H  1 33  ? -56.952  -32.889  40.772  1.00 3.07  ? 33  LYS H C   1 
ATOM   9549  O  O   . LYS H  1 33  ? -55.751  -33.188  40.704  1.00 2.63  ? 33  LYS H O   1 
ATOM   9550  C  CB  . LYS H  1 33  ? -58.521  -32.993  38.877  1.00 3.12  ? 33  LYS H CB  1 
ATOM   9551  C  CG  . LYS H  1 33  ? -57.477  -32.495  37.945  1.00 4.05  ? 33  LYS H CG  1 
ATOM   9552  C  CD  . LYS H  1 33  ? -58.037  -32.586  36.541  1.00 8.20  ? 33  LYS H CD  1 
ATOM   9553  C  CE  . LYS H  1 33  ? -57.454  -31.526  35.626  1.00 10.43 ? 33  LYS H CE  1 
ATOM   9554  N  NZ  . LYS H  1 33  ? -56.307  -32.061  34.850  1.00 10.83 ? 33  LYS H NZ  1 
ATOM   9555  N  N   . ASN H  1 34  ? -57.414  -31.847  41.465  1.00 3.05  ? 34  ASN H N   1 
ATOM   9556  C  CA  . ASN H  1 34  ? -56.518  -31.029  42.220  1.00 3.42  ? 34  ASN H CA  1 
ATOM   9557  C  C   . ASN H  1 34  ? -55.725  -31.842  43.221  1.00 3.70  ? 34  ASN H C   1 
ATOM   9558  O  O   . ASN H  1 34  ? -54.500  -31.663  43.319  1.00 4.83  ? 34  ASN H O   1 
ATOM   9559  C  CB  . ASN H  1 34  ? -57.224  -29.900  42.921  1.00 3.26  ? 34  ASN H CB  1 
ATOM   9560  C  CG  . ASN H  1 34  ? -56.254  -28.967  43.593  1.00 4.37  ? 34  ASN H CG  1 
ATOM   9561  O  OD1 . ASN H  1 34  ? -56.141  -28.975  44.788  1.00 7.30  ? 34  ASN H OD1 1 
ATOM   9562  N  ND2 . ASN H  1 34  ? -55.516  -28.187  42.812  1.00 6.86  ? 34  ASN H ND2 1 
ATOM   9563  N  N   . TRP H  1 35  ? -56.399  -32.727  43.954  1.00 3.41  ? 35  TRP H N   1 
ATOM   9564  C  CA  . TRP H  1 35  ? -55.734  -33.624  44.912  1.00 3.20  ? 35  TRP H CA  1 
ATOM   9565  C  C   . TRP H  1 35  ? -54.868  -34.712  44.266  1.00 3.40  ? 35  TRP H C   1 
ATOM   9566  O  O   . TRP H  1 35  ? -54.201  -35.462  44.986  1.00 3.51  ? 35  TRP H O   1 
ATOM   9567  C  CB  . TRP H  1 35  ? -56.759  -34.303  45.804  1.00 2.84  ? 35  TRP H CB  1 
ATOM   9568  C  CG  . TRP H  1 35  ? -57.435  -33.388  46.713  1.00 3.68  ? 35  TRP H CG  1 
ATOM   9569  C  CD1 . TRP H  1 35  ? -56.945  -32.213  47.194  1.00 5.37  ? 35  TRP H CD1 1 
ATOM   9570  C  CD2 . TRP H  1 35  ? -58.736  -33.553  47.300  1.00 4.16  ? 35  TRP H CD2 1 
ATOM   9571  N  NE1 . TRP H  1 35  ? -57.863  -31.634  48.041  1.00 5.77  ? 35  TRP H NE1 1 
ATOM   9572  C  CE2 . TRP H  1 35  ? -58.965  -32.439  48.128  1.00 4.64  ? 35  TRP H CE2 1 
ATOM   9573  C  CE3 . TRP H  1 35  ? -59.719  -34.546  47.223  1.00 2.55  ? 35  TRP H CE3 1 
ATOM   9574  C  CZ2 . TRP H  1 35  ? -60.136  -32.282  48.864  1.00 4.29  ? 35  TRP H CZ2 1 
ATOM   9575  C  CZ3 . TRP H  1 35  ? -60.882  -34.388  47.940  1.00 3.79  ? 35  TRP H CZ3 1 
ATOM   9576  C  CH2 . TRP H  1 35  ? -61.088  -33.269  48.749  1.00 4.12  ? 35  TRP H CH2 1 
ATOM   9577  N  N   . GLY H  1 36  ? -54.899  -34.837  42.935  1.00 2.88  ? 36  GLY H N   1 
ATOM   9578  C  CA  . GLY H  1 36  ? -54.021  -35.785  42.275  1.00 2.73  ? 36  GLY H CA  1 
ATOM   9579  C  C   . GLY H  1 36  ? -54.628  -37.162  42.178  1.00 3.34  ? 36  GLY H C   1 
ATOM   9580  O  O   . GLY H  1 36  ? -53.973  -38.108  41.723  1.00 3.94  ? 36  GLY H O   1 
ATOM   9581  N  N   . LEU H  1 37  ? -55.906  -37.267  42.559  1.00 3.38  ? 37  LEU H N   1 
ATOM   9582  C  CA  . LEU H  1 37  ? -56.682  -38.501  42.499  1.00 2.83  ? 37  LEU H CA  1 
ATOM   9583  C  C   . LEU H  1 37  ? -57.245  -38.688  41.072  1.00 3.04  ? 37  LEU H C   1 
ATOM   9584  O  O   . LEU H  1 37  ? -58.452  -38.734  40.829  1.00 3.26  ? 37  LEU H O   1 
ATOM   9585  C  CB  . LEU H  1 37  ? -57.783  -38.427  43.577  1.00 2.61  ? 37  LEU H CB  1 
ATOM   9586  C  CG  . LEU H  1 37  ? -57.398  -38.847  45.005  1.00 3.44  ? 37  LEU H CG  1 
ATOM   9587  C  CD1 . LEU H  1 37  ? -55.914  -38.777  45.308  1.00 2.00  ? 37  LEU H CD1 1 
ATOM   9588  C  CD2 . LEU H  1 37  ? -58.247  -38.170  46.088  1.00 2.00  ? 37  LEU H CD2 1 
ATOM   9589  N  N   . LYS H  1 38  ? -56.330  -38.806  40.137  1.00 3.28  ? 38  LYS H N   1 
ATOM   9590  C  CA  . LYS H  1 38  ? -56.572  -38.787  38.695  1.00 3.66  ? 38  LYS H CA  1 
ATOM   9591  C  C   . LYS H  1 38  ? -57.786  -39.631  38.249  1.00 3.59  ? 38  LYS H C   1 
ATOM   9592  O  O   . LYS H  1 38  ? -58.549  -39.257  37.366  1.00 3.45  ? 38  LYS H O   1 
ATOM   9593  C  CB  . LYS H  1 38  ? -55.267  -39.290  38.053  1.00 3.92  ? 38  LYS H CB  1 
ATOM   9594  C  CG  . LYS H  1 38  ? -54.766  -38.591  36.796  1.00 8.07  ? 38  LYS H CG  1 
ATOM   9595  C  CD  . LYS H  1 38  ? -53.596  -37.601  36.996  1.00 10.93 ? 38  LYS H CD  1 
ATOM   9596  C  CE  . LYS H  1 38  ? -52.335  -38.248  37.572  1.00 13.69 ? 38  LYS H CE  1 
ATOM   9597  N  NZ  . LYS H  1 38  ? -51.628  -39.227  36.707  1.00 14.00 ? 38  LYS H NZ  1 
ATOM   9598  N  N   . ARG H  1 39  ? -57.977  -40.764  38.908  1.00 4.34  ? 39  ARG H N   1 
ATOM   9599  C  CA  . ARG H  1 39  ? -58.916  -41.792  38.480  1.00 4.49  ? 39  ARG H CA  1 
ATOM   9600  C  C   . ARG H  1 39  ? -60.328  -41.434  38.846  1.00 4.29  ? 39  ARG H C   1 
ATOM   9601  O  O   . ARG H  1 39  ? -61.269  -41.729  38.106  1.00 4.83  ? 39  ARG H O   1 
ATOM   9602  C  CB  . ARG H  1 39  ? -58.545  -43.064  39.200  1.00 5.23  ? 39  ARG H CB  1 
ATOM   9603  C  CG  . ARG H  1 39  ? -58.824  -44.332  38.489  1.00 7.84  ? 39  ARG H CG  1 
ATOM   9604  C  CD  . ARG H  1 39  ? -60.145  -44.868  38.990  1.00 14.23 ? 39  ARG H CD  1 
ATOM   9605  N  NE  . ARG H  1 39  ? -60.041  -46.264  39.471  1.00 18.69 ? 39  ARG H NE  1 
ATOM   9606  C  CZ  . ARG H  1 39  ? -60.906  -46.830  40.316  1.00 20.84 ? 39  ARG H CZ  1 
ATOM   9607  N  NH1 . ARG H  1 39  ? -61.963  -46.132  40.803  1.00 16.91 ? 39  ARG H NH1 1 
ATOM   9608  N  NH2 . ARG H  1 39  ? -60.694  -48.092  40.692  1.00 21.71 ? 39  ARG H NH2 1 
ATOM   9609  N  N   . LEU H  1 40  ? -60.478  -40.835  40.019  1.00 3.88  ? 40  LEU H N   1 
ATOM   9610  C  CA  . LEU H  1 40  ? -61.747  -40.364  40.485  1.00 3.18  ? 40  LEU H CA  1 
ATOM   9611  C  C   . LEU H  1 40  ? -62.165  -39.136  39.666  1.00 3.51  ? 40  LEU H C   1 
ATOM   9612  O  O   . LEU H  1 40  ? -63.330  -38.915  39.449  1.00 3.44  ? 40  LEU H O   1 
ATOM   9613  C  CB  . LEU H  1 40  ? -61.576  -40.004  41.958  1.00 3.43  ? 40  LEU H CB  1 
ATOM   9614  C  CG  . LEU H  1 40  ? -62.107  -40.890  43.064  1.00 2.44  ? 40  LEU H CG  1 
ATOM   9615  C  CD1 . LEU H  1 40  ? -62.295  -42.337  42.687  1.00 2.57  ? 40  LEU H CD1 1 
ATOM   9616  C  CD2 . LEU H  1 40  ? -61.218  -40.725  44.254  1.00 2.00  ? 40  LEU H CD2 1 
ATOM   9617  N  N   . ASN H  1 41  ? -61.203  -38.336  39.220  1.00 3.61  ? 41  ASN H N   1 
ATOM   9618  C  CA  . ASN H  1 41  ? -61.488  -37.224  38.335  1.00 2.97  ? 41  ASN H CA  1 
ATOM   9619  C  C   . ASN H  1 41  ? -62.008  -37.749  37.019  1.00 3.17  ? 41  ASN H C   1 
ATOM   9620  O  O   . ASN H  1 41  ? -62.990  -37.253  36.526  1.00 2.86  ? 41  ASN H O   1 
ATOM   9621  C  CB  . ASN H  1 41  ? -60.251  -36.346  38.085  1.00 2.69  ? 41  ASN H CB  1 
ATOM   9622  C  CG  . ASN H  1 41  ? -60.435  -35.408  36.884  1.00 3.38  ? 41  ASN H CG  1 
ATOM   9623  O  OD1 . ASN H  1 41  ? -61.150  -34.408  36.965  1.00 3.54  ? 41  ASN H OD1 1 
ATOM   9624  N  ND2 . ASN H  1 41  ? -59.835  -35.757  35.759  1.00 2.00  ? 41  ASN H ND2 1 
ATOM   9625  N  N   . ASP H  1 42  ? -61.355  -38.744  36.443  1.00 3.82  ? 42  ASP H N   1 
ATOM   9626  C  CA  . ASP H  1 42  ? -61.841  -39.311  35.189  1.00 5.18  ? 42  ASP H CA  1 
ATOM   9627  C  C   . ASP H  1 42  ? -63.269  -39.827  35.329  1.00 5.48  ? 42  ASP H C   1 
ATOM   9628  O  O   . ASP H  1 42  ? -64.142  -39.482  34.503  1.00 5.99  ? 42  ASP H O   1 
ATOM   9629  C  CB  . ASP H  1 42  ? -60.947  -40.442  34.659  1.00 5.46  ? 42  ASP H CB  1 
ATOM   9630  C  CG  . ASP H  1 42  ? -59.563  -39.965  34.256  1.00 9.94  ? 42  ASP H CG  1 
ATOM   9631  O  OD1 . ASP H  1 42  ? -59.313  -38.727  34.167  1.00 13.02 ? 42  ASP H OD1 1 
ATOM   9632  O  OD2 . ASP H  1 42  ? -58.695  -40.843  34.052  1.00 13.61 ? 42  ASP H OD2 1 
ATOM   9633  N  N   . VAL H  1 43  ? -63.545  -40.629  36.362  1.00 5.06  ? 43  VAL H N   1 
ATOM   9634  C  CA  . VAL H  1 43  ? -64.886  -41.213  36.450  1.00 4.94  ? 43  VAL H CA  1 
ATOM   9635  C  C   . VAL H  1 43  ? -65.954  -40.132  36.691  1.00 4.93  ? 43  VAL H C   1 
ATOM   9636  O  O   . VAL H  1 43  ? -66.977  -40.078  35.973  1.00 4.72  ? 43  VAL H O   1 
ATOM   9637  C  CB  . VAL H  1 43  ? -64.975  -42.362  37.472  1.00 4.89  ? 43  VAL H CB  1 
ATOM   9638  C  CG1 . VAL H  1 43  ? -66.441  -42.750  37.721  1.00 5.15  ? 43  VAL H CG1 1 
ATOM   9639  C  CG2 . VAL H  1 43  ? -64.202  -43.560  36.960  1.00 4.15  ? 43  VAL H CG2 1 
ATOM   9640  N  N   . GLU H  1 44  ? -65.702  -39.261  37.672  1.00 4.69  ? 44  GLU H N   1 
ATOM   9641  C  CA  . GLU H  1 44  ? -66.725  -38.259  38.023  1.00 4.92  ? 44  GLU H CA  1 
ATOM   9642  C  C   . GLU H  1 44  ? -66.956  -37.266  36.925  1.00 4.69  ? 44  GLU H C   1 
ATOM   9643  O  O   . GLU H  1 44  ? -68.066  -36.813  36.733  1.00 4.84  ? 44  GLU H O   1 
ATOM   9644  C  CB  . GLU H  1 44  ? -66.390  -37.539  39.300  1.00 4.26  ? 44  GLU H CB  1 
ATOM   9645  C  CG  . GLU H  1 44  ? -66.377  -38.485  40.454  1.00 7.82  ? 44  GLU H CG  1 
ATOM   9646  C  CD  . GLU H  1 44  ? -67.517  -38.286  41.424  1.00 11.32 ? 44  GLU H CD  1 
ATOM   9647  O  OE1 . GLU H  1 44  ? -67.830  -37.134  41.798  1.00 12.47 ? 44  GLU H OE1 1 
ATOM   9648  O  OE2 . GLU H  1 44  ? -68.093  -39.292  41.860  1.00 12.56 ? 44  GLU H OE2 1 
ATOM   9649  N  N   . TYR H  1 45  ? -65.905  -36.941  36.191  1.00 4.68  ? 45  TYR H N   1 
ATOM   9650  C  CA  . TYR H  1 45  ? -66.074  -36.102  35.044  1.00 4.78  ? 45  TYR H CA  1 
ATOM   9651  C  C   . TYR H  1 45  ? -67.012  -36.782  34.066  1.00 5.26  ? 45  TYR H C   1 
ATOM   9652  O  O   . TYR H  1 45  ? -67.951  -36.164  33.589  1.00 5.12  ? 45  TYR H O   1 
ATOM   9653  C  CB  . TYR H  1 45  ? -64.747  -35.849  34.391  1.00 4.98  ? 45  TYR H CB  1 
ATOM   9654  C  CG  . TYR H  1 45  ? -64.847  -35.086  33.118  1.00 5.01  ? 45  TYR H CG  1 
ATOM   9655  C  CD1 . TYR H  1 45  ? -64.930  -33.709  33.117  1.00 5.36  ? 45  TYR H CD1 1 
ATOM   9656  C  CD2 . TYR H  1 45  ? -64.849  -35.755  31.898  1.00 6.00  ? 45  TYR H CD2 1 
ATOM   9657  C  CE1 . TYR H  1 45  ? -65.014  -33.007  31.943  1.00 6.96  ? 45  TYR H CE1 1 
ATOM   9658  C  CE2 . TYR H  1 45  ? -64.937  -35.065  30.695  1.00 6.31  ? 45  TYR H CE2 1 
ATOM   9659  C  CZ  . TYR H  1 45  ? -65.024  -33.696  30.719  1.00 7.82  ? 45  TYR H CZ  1 
ATOM   9660  O  OH  . TYR H  1 45  ? -65.117  -33.018  29.507  1.00 8.43  ? 45  TYR H OH  1 
ATOM   9661  N  N   A HIS H  1 46  ? -66.769  -38.056  33.782  0.50 5.71  ? 46  HIS H N   1 
ATOM   9662  N  N   B HIS H  1 46  ? -66.761  -38.059  33.770  0.50 5.73  ? 46  HIS H N   1 
ATOM   9663  C  CA  A HIS H  1 46  ? -67.629  -38.780  32.851  0.50 6.26  ? 46  HIS H CA  1 
ATOM   9664  C  CA  B HIS H  1 46  ? -67.636  -38.825  32.868  0.50 6.34  ? 46  HIS H CA  1 
ATOM   9665  C  C   A HIS H  1 46  ? -69.070  -38.895  33.359  0.50 5.73  ? 46  HIS H C   1 
ATOM   9666  C  C   B HIS H  1 46  ? -69.077  -38.768  33.359  0.50 5.75  ? 46  HIS H C   1 
ATOM   9667  O  O   A HIS H  1 46  ? -69.989  -39.009  32.567  0.50 6.33  ? 46  HIS H O   1 
ATOM   9668  O  O   B HIS H  1 46  ? -69.995  -38.645  32.565  0.50 6.30  ? 46  HIS H O   1 
ATOM   9669  C  CB  A HIS H  1 46  ? -67.024  -40.135  32.447  0.50 6.46  ? 46  HIS H CB  1 
ATOM   9670  C  CB  B HIS H  1 46  ? -67.173  -40.287  32.710  0.50 6.57  ? 46  HIS H CB  1 
ATOM   9671  C  CG  A HIS H  1 46  ? -65.776  -40.008  31.625  0.50 9.86  ? 46  HIS H CG  1 
ATOM   9672  C  CG  B HIS H  1 46  ? -68.026  -41.106  31.774  0.50 10.55 ? 46  HIS H CG  1 
ATOM   9673  N  ND1 A HIS H  1 46  ? -65.767  -39.472  30.354  0.50 11.96 ? 46  HIS H ND1 1 
ATOM   9674  N  ND1 B HIS H  1 46  ? -68.022  -40.922  30.403  0.50 14.27 ? 46  HIS H ND1 1 
ATOM   9675  C  CD2 A HIS H  1 46  ? -64.491  -40.324  31.908  0.50 12.55 ? 46  HIS H CD2 1 
ATOM   9676  C  CD2 B HIS H  1 46  ? -68.889  -42.127  32.011  0.50 12.25 ? 46  HIS H CD2 1 
ATOM   9677  C  CE1 A HIS H  1 46  ? -64.531  -39.464  29.892  0.50 13.13 ? 46  HIS H CE1 1 
ATOM   9678  C  CE1 B HIS H  1 46  ? -68.852  -41.786  29.842  0.50 14.36 ? 46  HIS H CE1 1 
ATOM   9679  N  NE2 A HIS H  1 46  ? -63.738  -39.977  30.815  0.50 13.28 ? 46  HIS H NE2 1 
ATOM   9680  N  NE2 B HIS H  1 46  ? -69.389  -42.529  30.794  0.50 13.53 ? 46  HIS H NE2 1 
ATOM   9681  N  N   . GLU H  1 47  ? -69.277  -38.827  34.664  1.00 5.28  ? 47  GLU H N   1 
ATOM   9682  C  CA  . GLU H  1 47  ? -70.607  -38.806  35.171  1.00 5.19  ? 47  GLU H CA  1 
ATOM   9683  C  C   . GLU H  1 47  ? -71.280  -37.472  35.051  1.00 4.51  ? 47  GLU H C   1 
ATOM   9684  O  O   . GLU H  1 47  ? -72.463  -37.418  34.815  1.00 4.13  ? 47  GLU H O   1 
ATOM   9685  C  CB  . GLU H  1 47  ? -70.664  -39.339  36.564  1.00 6.17  ? 47  GLU H CB  1 
ATOM   9686  C  CG  . GLU H  1 47  ? -70.843  -40.813  36.478  1.00 8.85  ? 47  GLU H CG  1 
ATOM   9687  C  CD  . GLU H  1 47  ? -70.417  -41.534  37.725  1.00 15.06 ? 47  GLU H CD  1 
ATOM   9688  O  OE1 . GLU H  1 47  ? -69.869  -40.897  38.689  1.00 16.95 ? 47  GLU H OE1 1 
ATOM   9689  O  OE2 . GLU H  1 47  ? -70.630  -42.769  37.702  1.00 18.40 ? 47  GLU H OE2 1 
ATOM   9690  N  N   . SER H  1 48  ? -70.531  -36.390  35.191  1.00 4.51  ? 48  SER H N   1 
ATOM   9691  C  CA  . SER H  1 48  ? -71.026  -35.080  34.837  1.00 4.19  ? 48  SER H CA  1 
ATOM   9692  C  C   . SER H  1 48  ? -71.523  -35.000  33.375  1.00 4.47  ? 48  SER H C   1 
ATOM   9693  O  O   . SER H  1 48  ? -72.618  -34.481  33.119  1.00 3.79  ? 48  SER H O   1 
ATOM   9694  C  CB  . SER H  1 48  ? -69.957  -34.035  35.085  1.00 3.79  ? 48  SER H CB  1 
ATOM   9695  O  OG  . SER H  1 48  ? -70.576  -32.763  35.147  1.00 4.41  ? 48  SER H OG  1 
ATOM   9696  N  N   . ILE H  1 49  ? -70.728  -35.515  32.427  1.00 4.70  ? 49  ILE H N   1 
ATOM   9697  C  CA  . ILE H  1 49  ? -71.138  -35.559  31.025  1.00 5.01  ? 49  ILE H CA  1 
ATOM   9698  C  C   . ILE H  1 49  ? -72.407  -36.373  30.900  1.00 5.40  ? 49  ILE H C   1 
ATOM   9699  O  O   . ILE H  1 49  ? -73.308  -36.054  30.141  1.00 5.53  ? 49  ILE H O   1 
ATOM   9700  C  CB  . ILE H  1 49  ? -70.052  -36.184  30.087  1.00 4.96  ? 49  ILE H CB  1 
ATOM   9701  C  CG1 . ILE H  1 49  ? -68.766  -35.343  30.010  1.00 5.40  ? 49  ILE H CG1 1 
ATOM   9702  C  CG2 . ILE H  1 49  ? -70.581  -36.389  28.685  1.00 4.01  ? 49  ILE H CG2 1 
ATOM   9703  C  CD1 . ILE H  1 49  ? -68.947  -33.867  30.244  1.00 6.08  ? 49  ILE H CD1 1 
ATOM   9704  N  N   . ASP H  1 50  ? -72.483  -37.439  31.662  1.00 5.92  ? 50  ASP H N   1 
ATOM   9705  C  CA  . ASP H  1 50  ? -73.665  -38.271  31.631  1.00 7.08  ? 50  ASP H CA  1 
ATOM   9706  C  C   . ASP H  1 50  ? -74.937  -37.514  32.017  1.00 6.84  ? 50  ASP H C   1 
ATOM   9707  O  O   . ASP H  1 50  ? -75.943  -37.572  31.312  1.00 6.70  ? 50  ASP H O   1 
ATOM   9708  C  CB  . ASP H  1 50  ? -73.479  -39.475  32.534  1.00 7.88  ? 50  ASP H CB  1 
ATOM   9709  C  CG  . ASP H  1 50  ? -73.955  -40.710  31.876  1.00 11.69 ? 50  ASP H CG  1 
ATOM   9710  O  OD1 . ASP H  1 50  ? -73.332  -41.015  30.832  1.00 14.92 ? 50  ASP H OD1 1 
ATOM   9711  O  OD2 . ASP H  1 50  ? -74.959  -41.338  32.345  1.00 15.64 ? 50  ASP H OD2 1 
ATOM   9712  N  N   . GLU H  1 51  ? -74.867  -36.787  33.121  1.00 6.22  ? 51  GLU H N   1 
ATOM   9713  C  CA  . GLU H  1 51  ? -76.011  -36.069  33.586  1.00 6.45  ? 51  GLU H CA  1 
ATOM   9714  C  C   . GLU H  1 51  ? -76.388  -34.942  32.629  1.00 6.09  ? 51  GLU H C   1 
ATOM   9715  O  O   . GLU H  1 51  ? -77.566  -34.593  32.530  1.00 5.09  ? 51  GLU H O   1 
ATOM   9716  C  CB  . GLU H  1 51  ? -75.798  -35.575  35.030  1.00 7.14  ? 51  GLU H CB  1 
ATOM   9717  C  CG  . GLU H  1 51  ? -75.481  -36.686  36.059  1.00 8.48  ? 51  GLU H CG  1 
ATOM   9718  C  CD  . GLU H  1 51  ? -76.452  -37.868  36.021  1.00 12.36 ? 51  GLU H CD  1 
ATOM   9719  O  OE1 . GLU H  1 51  ? -77.027  -38.243  37.068  1.00 15.23 ? 51  GLU H OE1 1 
ATOM   9720  O  OE2 . GLU H  1 51  ? -76.641  -38.449  34.943  1.00 15.33 ? 51  GLU H OE2 1 
ATOM   9721  N  N   . MET H  1 52  ? -75.400  -34.397  31.911  1.00 6.16  ? 52  MET H N   1 
ATOM   9722  C  CA  . MET H  1 52  ? -75.674  -33.400  30.890  1.00 6.42  ? 52  MET H CA  1 
ATOM   9723  C  C   . MET H  1 52  ? -76.500  -33.989  29.774  1.00 6.14  ? 52  MET H C   1 
ATOM   9724  O  O   . MET H  1 52  ? -77.443  -33.351  29.318  1.00 6.43  ? 52  MET H O   1 
ATOM   9725  C  CB  . MET H  1 52  ? -74.402  -32.845  30.286  1.00 6.25  ? 52  MET H CB  1 
ATOM   9726  C  CG  . MET H  1 52  ? -73.681  -31.880  31.147  1.00 6.95  ? 52  MET H CG  1 
ATOM   9727  S  SD  . MET H  1 52  ? -72.072  -31.474  30.441  1.00 9.64  ? 52  MET H SD  1 
ATOM   9728  C  CE  . MET H  1 52  ? -71.091  -31.482  31.997  1.00 8.43  ? 52  MET H CE  1 
ATOM   9729  N  N   . LYS H  1 53  ? -76.156  -35.202  29.341  1.00 5.73  ? 53  LYS H N   1 
ATOM   9730  C  CA  . LYS H  1 53  ? -76.911  -35.890  28.328  1.00 5.72  ? 53  LYS H CA  1 
ATOM   9731  C  C   . LYS H  1 53  ? -78.356  -36.063  28.760  1.00 5.68  ? 53  LYS H C   1 
ATOM   9732  O  O   . LYS H  1 53  ? -79.283  -35.906  27.970  1.00 5.93  ? 53  LYS H O   1 
ATOM   9733  C  CB  . LYS H  1 53  ? -76.284  -37.238  28.009  1.00 6.08  ? 53  LYS H CB  1 
ATOM   9734  C  CG  . LYS H  1 53  ? -74.883  -37.151  27.406  1.00 7.87  ? 53  LYS H CG  1 
ATOM   9735  C  CD  . LYS H  1 53  ? -74.581  -38.395  26.579  1.00 12.55 ? 53  LYS H CD  1 
ATOM   9736  C  CE  . LYS H  1 53  ? -73.102  -38.817  26.672  1.00 16.01 ? 53  LYS H CE  1 
ATOM   9737  N  NZ  . LYS H  1 53  ? -72.729  -39.790  25.578  1.00 18.01 ? 53  LYS H NZ  1 
ATOM   9738  N  N   . HIS H  1 54  ? -78.557  -36.373  30.029  1.00 5.73  ? 54  HIS H N   1 
ATOM   9739  C  CA  . HIS H  1 54  ? -79.885  -36.541  30.554  1.00 5.48  ? 54  HIS H CA  1 
ATOM   9740  C  C   . HIS H  1 54  ? -80.665  -35.230  30.536  1.00 4.98  ? 54  HIS H C   1 
ATOM   9741  O  O   . HIS H  1 54  ? -81.808  -35.186  30.083  1.00 4.80  ? 54  HIS H O   1 
ATOM   9742  C  CB  . HIS H  1 54  ? -79.813  -37.136  31.945  1.00 5.89  ? 54  HIS H CB  1 
ATOM   9743  C  CG  . HIS H  1 54  ? -79.227  -38.509  31.988  1.00 7.47  ? 54  HIS H CG  1 
ATOM   9744  N  ND1 . HIS H  1 54  ? -78.719  -39.064  33.142  1.00 10.42 ? 54  HIS H ND1 1 
ATOM   9745  C  CD2 . HIS H  1 54  ? -79.060  -39.441  31.024  1.00 7.86  ? 54  HIS H CD2 1 
ATOM   9746  C  CE1 . HIS H  1 54  ? -78.268  -40.278  32.884  1.00 10.32 ? 54  HIS H CE1 1 
ATOM   9747  N  NE2 . HIS H  1 54  ? -78.477  -40.533  31.611  1.00 7.87  ? 54  HIS H NE2 1 
ATOM   9748  N  N   . ALA H  1 55  ? -80.038  -34.157  31.001  1.00 4.15  ? 55  ALA H N   1 
ATOM   9749  C  CA  . ALA H  1 55  ? -80.648  -32.835  31.004  1.00 3.83  ? 55  ALA H CA  1 
ATOM   9750  C  C   . ALA H  1 55  ? -81.087  -32.455  29.594  1.00 4.14  ? 55  ALA H C   1 
ATOM   9751  O  O   . ALA H  1 55  ? -82.221  -31.996  29.369  1.00 4.22  ? 55  ALA H O   1 
ATOM   9752  C  CB  . ALA H  1 55  ? -79.695  -31.821  31.551  1.00 2.89  ? 55  ALA H CB  1 
ATOM   9753  N  N   . ASP H  1 56  ? -80.197  -32.674  28.633  1.00 3.91  ? 56  ASP H N   1 
ATOM   9754  C  CA  . ASP H  1 56  ? -80.476  -32.428  27.241  1.00 4.00  ? 56  ASP H CA  1 
ATOM   9755  C  C   . ASP H  1 56  ? -81.754  -33.176  26.835  1.00 4.35  ? 56  ASP H C   1 
ATOM   9756  O  O   . ASP H  1 56  ? -82.671  -32.585  26.245  1.00 5.29  ? 56  ASP H O   1 
ATOM   9757  C  CB  . ASP H  1 56  ? -79.266  -32.862  26.409  1.00 3.82  ? 56  ASP H CB  1 
ATOM   9758  C  CG  . ASP H  1 56  ? -79.341  -32.403  24.960  1.00 4.32  ? 56  ASP H CG  1 
ATOM   9759  O  OD1 . ASP H  1 56  ? -80.173  -31.535  24.608  1.00 3.84  ? 56  ASP H OD1 1 
ATOM   9760  O  OD2 . ASP H  1 56  ? -78.550  -32.921  24.141  1.00 4.96  ? 56  ASP H OD2 1 
ATOM   9761  N  N   . ARG H  1 57  ? -81.864  -34.455  27.180  1.00 3.76  ? 57  ARG H N   1 
ATOM   9762  C  CA  . ARG H  1 57  ? -83.023  -35.225  26.768  1.00 3.64  ? 57  ARG H CA  1 
ATOM   9763  C  C   . ARG H  1 57  ? -84.307  -34.686  27.369  1.00 2.84  ? 57  ARG H C   1 
ATOM   9764  O  O   . ARG H  1 57  ? -85.322  -34.590  26.662  1.00 2.21  ? 57  ARG H O   1 
ATOM   9765  C  CB  . ARG H  1 57  ? -82.803  -36.724  27.012  1.00 3.56  ? 57  ARG H CB  1 
ATOM   9766  C  CG  . ARG H  1 57  ? -81.820  -37.321  26.022  1.00 4.90  ? 57  ARG H CG  1 
ATOM   9767  C  CD  . ARG H  1 57  ? -81.420  -38.770  26.326  1.00 7.34  ? 57  ARG H CD  1 
ATOM   9768  N  NE  . ARG H  1 57  ? -82.457  -39.768  26.006  1.00 12.01 ? 57  ARG H NE  1 
ATOM   9769  C  CZ  . ARG H  1 57  ? -82.514  -40.988  26.583  1.00 14.24 ? 57  ARG H CZ  1 
ATOM   9770  N  NH1 . ARG H  1 57  ? -81.581  -41.364  27.490  1.00 12.24 ? 57  ARG H NH1 1 
ATOM   9771  N  NH2 . ARG H  1 57  ? -83.509  -41.830  26.271  1.00 11.97 ? 57  ARG H NH2 1 
ATOM   9772  N  N   . TYR H  1 58  ? -84.266  -34.304  28.650  1.00 2.23  ? 58  TYR H N   1 
ATOM   9773  C  CA  . TYR H  1 58  ? -85.434  -33.671  29.287  1.00 2.00  ? 58  TYR H CA  1 
ATOM   9774  C  C   . TYR H  1 58  ? -85.824  -32.372  28.591  1.00 2.07  ? 58  TYR H C   1 
ATOM   9775  O  O   . TYR H  1 58  ? -87.007  -32.133  28.307  1.00 2.00  ? 58  TYR H O   1 
ATOM   9776  C  CB  . TYR H  1 58  ? -85.175  -33.402  30.766  1.00 2.00  ? 58  TYR H CB  1 
ATOM   9777  C  CG  . TYR H  1 58  ? -85.119  -34.640  31.608  1.00 2.09  ? 58  TYR H CG  1 
ATOM   9778  C  CD1 . TYR H  1 58  ? -86.113  -35.598  31.515  1.00 2.92  ? 58  TYR H CD1 1 
ATOM   9779  C  CD2 . TYR H  1 58  ? -84.082  -34.853  32.494  1.00 2.00  ? 58  TYR H CD2 1 
ATOM   9780  C  CE1 . TYR H  1 58  ? -86.069  -36.723  32.279  1.00 2.02  ? 58  TYR H CE1 1 
ATOM   9781  C  CE2 . TYR H  1 58  ? -84.028  -35.970  33.249  1.00 2.00  ? 58  TYR H CE2 1 
ATOM   9782  C  CZ  . TYR H  1 58  ? -85.025  -36.907  33.150  1.00 2.00  ? 58  TYR H CZ  1 
ATOM   9783  O  OH  . TYR H  1 58  ? -85.002  -38.051  33.906  1.00 2.00  ? 58  TYR H OH  1 
ATOM   9784  N  N   . ILE H  1 59  ? -84.811  -31.540  28.317  1.00 2.04  ? 59  ILE H N   1 
ATOM   9785  C  CA  . ILE H  1 59  ? -85.034  -30.221  27.748  1.00 2.19  ? 59  ILE H CA  1 
ATOM   9786  C  C   . ILE H  1 59  ? -85.719  -30.399  26.411  1.00 2.80  ? 59  ILE H C   1 
ATOM   9787  O  O   . ILE H  1 59  ? -86.712  -29.729  26.133  1.00 3.44  ? 59  ILE H O   1 
ATOM   9788  C  CB  . ILE H  1 59  ? -83.753  -29.399  27.595  1.00 2.00  ? 59  ILE H CB  1 
ATOM   9789  C  CG1 . ILE H  1 59  ? -83.284  -28.911  28.946  1.00 2.00  ? 59  ILE H CG1 1 
ATOM   9790  C  CG2 . ILE H  1 59  ? -83.975  -28.187  26.753  1.00 2.00  ? 59  ILE H CG2 1 
ATOM   9791  C  CD1 . ILE H  1 59  ? -81.781  -28.587  29.016  1.00 2.00  ? 59  ILE H CD1 1 
ATOM   9792  N  N   . GLU H  1 60  ? -85.224  -31.333  25.602  1.00 2.85  ? 60  GLU H N   1 
ATOM   9793  C  CA  . GLU H  1 60  ? -85.790  -31.531  24.289  1.00 2.87  ? 60  GLU H CA  1 
ATOM   9794  C  C   . GLU H  1 60  ? -87.184  -32.055  24.330  1.00 2.57  ? 60  GLU H C   1 
ATOM   9795  O  O   . GLU H  1 60  ? -88.012  -31.721  23.485  1.00 3.15  ? 60  GLU H O   1 
ATOM   9796  C  CB  . GLU H  1 60  ? -84.894  -32.415  23.449  1.00 2.87  ? 60  GLU H CB  1 
ATOM   9797  C  CG  . GLU H  1 60  ? -83.634  -31.658  23.048  1.00 5.18  ? 60  GLU H CG  1 
ATOM   9798  C  CD  . GLU H  1 60  ? -82.707  -32.478  22.204  1.00 7.96  ? 60  GLU H CD  1 
ATOM   9799  O  OE1 . GLU H  1 60  ? -81.693  -31.957  21.722  1.00 8.98  ? 60  GLU H OE1 1 
ATOM   9800  O  OE2 . GLU H  1 60  ? -82.996  -33.666  22.028  1.00 10.80 ? 60  GLU H OE2 1 
ATOM   9801  N  N   . ARG H  1 61  ? -87.444  -32.872  25.329  1.00 2.77  ? 61  ARG H N   1 
ATOM   9802  C  CA  . ARG H  1 61  ? -88.727  -33.509  25.456  1.00 2.59  ? 61  ARG H CA  1 
ATOM   9803  C  C   . ARG H  1 61  ? -89.749  -32.482  25.958  1.00 2.86  ? 61  ARG H C   1 
ATOM   9804  O  O   . ARG H  1 61  ? -90.840  -32.377  25.377  1.00 2.53  ? 61  ARG H O   1 
ATOM   9805  C  CB  . ARG H  1 61  ? -88.614  -34.737  26.376  1.00 2.62  ? 61  ARG H CB  1 
ATOM   9806  C  CG  . ARG H  1 61  ? -89.880  -35.549  26.514  1.00 2.09  ? 61  ARG H CG  1 
ATOM   9807  C  CD  . ARG H  1 61  ? -90.218  -36.351  25.266  1.00 2.33  ? 61  ARG H CD  1 
ATOM   9808  N  NE  . ARG H  1 61  ? -91.511  -36.970  25.447  1.00 3.06  ? 61  ARG H NE  1 
ATOM   9809  C  CZ  . ARG H  1 61  ? -92.253  -37.506  24.484  1.00 5.06  ? 61  ARG H CZ  1 
ATOM   9810  N  NH1 . ARG H  1 61  ? -91.812  -37.532  23.228  1.00 3.72  ? 61  ARG H NH1 1 
ATOM   9811  N  NH2 . ARG H  1 61  ? -93.457  -38.008  24.790  1.00 4.51  ? 61  ARG H NH2 1 
ATOM   9812  N  N   . ILE H  1 62  ? -89.392  -31.717  27.007  1.00 2.55  ? 62  ILE H N   1 
ATOM   9813  C  CA  . ILE H  1 62  ? -90.265  -30.642  27.497  1.00 2.42  ? 62  ILE H CA  1 
ATOM   9814  C  C   . ILE H  1 62  ? -90.648  -29.703  26.336  1.00 2.81  ? 62  ILE H C   1 
ATOM   9815  O  O   . ILE H  1 62  ? -91.818  -29.305  26.191  1.00 2.85  ? 62  ILE H O   1 
ATOM   9816  C  CB  . ILE H  1 62  ? -89.621  -29.841  28.632  1.00 2.15  ? 62  ILE H CB  1 
ATOM   9817  C  CG1 . ILE H  1 62  ? -89.445  -30.729  29.863  1.00 3.14  ? 62  ILE H CG1 1 
ATOM   9818  C  CG2 . ILE H  1 62  ? -90.481  -28.686  29.015  1.00 2.00  ? 62  ILE H CG2 1 
ATOM   9819  C  CD1 . ILE H  1 62  ? -88.663  -30.088  30.974  1.00 2.03  ? 62  ILE H CD1 1 
ATOM   9820  N  N   . LEU H  1 63  ? -89.665  -29.384  25.494  1.00 2.51  ? 63  LEU H N   1 
ATOM   9821  C  CA  . LEU H  1 63  ? -89.880  -28.469  24.398  1.00 2.77  ? 63  LEU H CA  1 
ATOM   9822  C  C   . LEU H  1 63  ? -90.810  -29.100  23.397  1.00 3.14  ? 63  LEU H C   1 
ATOM   9823  O  O   . LEU H  1 63  ? -91.739  -28.448  22.911  1.00 3.79  ? 63  LEU H O   1 
ATOM   9824  C  CB  . LEU H  1 63  ? -88.562  -28.088  23.740  1.00 2.70  ? 63  LEU H CB  1 
ATOM   9825  C  CG  . LEU H  1 63  ? -87.889  -26.724  23.919  1.00 2.03  ? 63  LEU H CG  1 
ATOM   9826  C  CD1 . LEU H  1 63  ? -88.513  -25.808  24.913  1.00 2.00  ? 63  LEU H CD1 1 
ATOM   9827  C  CD2 . LEU H  1 63  ? -86.410  -26.934  24.168  1.00 2.00  ? 63  LEU H CD2 1 
ATOM   9828  N  N   . PHE H  1 64  ? -90.613  -30.388  23.134  1.00 3.10  ? 64  PHE H N   1 
ATOM   9829  C  CA  . PHE H  1 64  ? -91.466  -31.074  22.169  1.00 3.09  ? 64  PHE H CA  1 
ATOM   9830  C  C   . PHE H  1 64  ? -92.894  -31.080  22.666  1.00 3.30  ? 64  PHE H C   1 
ATOM   9831  O  O   . PHE H  1 64  ? -93.826  -30.851  21.877  1.00 4.32  ? 64  PHE H O   1 
ATOM   9832  C  CB  . PHE H  1 64  ? -91.001  -32.510  21.906  1.00 2.45  ? 64  PHE H CB  1 
ATOM   9833  C  CG  . PHE H  1 64  ? -91.998  -33.323  21.142  1.00 2.06  ? 64  PHE H CG  1 
ATOM   9834  C  CD1 . PHE H  1 64  ? -92.385  -32.959  19.852  1.00 2.00  ? 64  PHE H CD1 1 
ATOM   9835  C  CD2 . PHE H  1 64  ? -92.559  -34.456  21.705  1.00 3.20  ? 64  PHE H CD2 1 
ATOM   9836  C  CE1 . PHE H  1 64  ? -93.301  -33.716  19.150  1.00 2.00  ? 64  PHE H CE1 1 
ATOM   9837  C  CE2 . PHE H  1 64  ? -93.485  -35.228  20.984  1.00 2.00  ? 64  PHE H CE2 1 
ATOM   9838  C  CZ  . PHE H  1 64  ? -93.847  -34.853  19.707  1.00 2.00  ? 64  PHE H CZ  1 
ATOM   9839  N  N   . LEU H  1 65  ? -93.049  -31.328  23.967  1.00 2.43  ? 65  LEU H N   1 
ATOM   9840  C  CA  . LEU H  1 65  ? -94.353  -31.420  24.600  1.00 2.24  ? 65  LEU H CA  1 
ATOM   9841  C  C   . LEU H  1 65  ? -94.957  -30.037  24.825  1.00 2.30  ? 65  LEU H C   1 
ATOM   9842  O  O   . LEU H  1 65  ? -96.018  -29.920  25.433  1.00 2.18  ? 65  LEU H O   1 
ATOM   9843  C  CB  . LEU H  1 65  ? -94.252  -32.167  25.937  1.00 2.23  ? 65  LEU H CB  1 
ATOM   9844  C  CG  . LEU H  1 65  ? -93.906  -33.634  25.816  1.00 2.30  ? 65  LEU H CG  1 
ATOM   9845  C  CD1 . LEU H  1 65  ? -93.888  -34.282  27.171  1.00 2.00  ? 65  LEU H CD1 1 
ATOM   9846  C  CD2 . LEU H  1 65  ? -94.885  -34.322  24.833  1.00 2.00  ? 65  LEU H CD2 1 
ATOM   9847  N  N   . GLU H  1 66  ? -94.254  -29.009  24.366  1.00 2.33  ? 66  GLU H N   1 
ATOM   9848  C  CA  . GLU H  1 66  ? -94.676  -27.604  24.450  1.00 3.38  ? 66  GLU H CA  1 
ATOM   9849  C  C   . GLU H  1 66  ? -94.690  -26.977  25.850  1.00 3.00  ? 66  GLU H C   1 
ATOM   9850  O  O   . GLU H  1 66  ? -95.473  -26.094  26.105  1.00 3.12  ? 66  GLU H O   1 
ATOM   9851  C  CB  . GLU H  1 66  ? -95.987  -27.371  23.711  1.00 2.96  ? 66  GLU H CB  1 
ATOM   9852  C  CG  . GLU H  1 66  ? -95.885  -27.751  22.205  1.00 6.19  ? 66  GLU H CG  1 
ATOM   9853  C  CD  . GLU H  1 66  ? -97.202  -27.702  21.428  1.00 5.87  ? 66  GLU H CD  1 
ATOM   9854  O  OE1 . GLU H  1 66  ? -98.066  -26.842  21.733  1.00 11.40 ? 66  GLU H OE1 1 
ATOM   9855  O  OE2 . GLU H  1 66  ? -97.361  -28.517  20.486  1.00 6.73  ? 66  GLU H OE2 1 
ATOM   9856  N  N   . GLY H  1 67  ? -93.793  -27.414  26.742  1.00 2.90  ? 67  GLY H N   1 
ATOM   9857  C  CA  . GLY H  1 67  ? -93.617  -26.780  28.052  1.00 3.02  ? 67  GLY H CA  1 
ATOM   9858  C  C   . GLY H  1 67  ? -92.363  -25.931  28.083  1.00 4.23  ? 67  GLY H C   1 
ATOM   9859  O  O   . GLY H  1 67  ? -91.636  -25.827  27.083  1.00 4.51  ? 67  GLY H O   1 
ATOM   9860  N  N   . LEU H  1 68  ? -92.113  -25.300  29.227  1.00 4.24  ? 68  LEU H N   1 
ATOM   9861  C  CA  . LEU H  1 68  ? -90.996  -24.387  29.406  1.00 4.18  ? 68  LEU H CA  1 
ATOM   9862  C  C   . LEU H  1 68  ? -89.945  -25.030  30.288  1.00 3.80  ? 68  LEU H C   1 
ATOM   9863  O  O   . LEU H  1 68  ? -90.153  -25.173  31.482  1.00 3.74  ? 68  LEU H O   1 
ATOM   9864  C  CB  . LEU H  1 68  ? -91.505  -23.149  30.108  1.00 4.22  ? 68  LEU H CB  1 
ATOM   9865  C  CG  . LEU H  1 68  ? -92.000  -21.872  29.383  1.00 6.84  ? 68  LEU H CG  1 
ATOM   9866  C  CD1 . LEU H  1 68  ? -92.028  -21.933  27.842  1.00 5.18  ? 68  LEU H CD1 1 
ATOM   9867  C  CD2 . LEU H  1 68  ? -93.361  -21.425  29.996  1.00 6.26  ? 68  LEU H CD2 1 
ATOM   9868  N  N   . PRO H  1 69  ? -88.805  -25.452  29.705  1.00 3.52  ? 69  PRO H N   1 
ATOM   9869  C  CA  . PRO H  1 69  ? -87.771  -26.052  30.555  1.00 3.07  ? 69  PRO H CA  1 
ATOM   9870  C  C   . PRO H  1 69  ? -87.280  -25.026  31.555  1.00 3.60  ? 69  PRO H C   1 
ATOM   9871  O  O   . PRO H  1 69  ? -87.094  -23.847  31.218  1.00 3.61  ? 69  PRO H O   1 
ATOM   9872  C  CB  . PRO H  1 69  ? -86.662  -26.418  29.575  1.00 2.06  ? 69  PRO H CB  1 
ATOM   9873  C  CG  . PRO H  1 69  ? -87.283  -26.440  28.272  1.00 2.01  ? 69  PRO H CG  1 
ATOM   9874  C  CD  . PRO H  1 69  ? -88.402  -25.440  28.289  1.00 2.81  ? 69  PRO H CD  1 
ATOM   9875  N  N   . ASN H  1 70  ? -87.093  -25.478  32.789  1.00 4.05  ? 70  ASN H N   1 
ATOM   9876  C  CA  . ASN H  1 70  ? -86.689  -24.601  33.861  1.00 4.41  ? 70  ASN H CA  1 
ATOM   9877  C  C   . ASN H  1 70  ? -85.237  -24.876  34.206  1.00 4.80  ? 70  ASN H C   1 
ATOM   9878  O  O   . ASN H  1 70  ? -84.938  -25.884  34.841  1.00 5.57  ? 70  ASN H O   1 
ATOM   9879  C  CB  . ASN H  1 70  ? -87.557  -24.871  35.065  1.00 4.02  ? 70  ASN H CB  1 
ATOM   9880  C  CG  . ASN H  1 70  ? -87.273  -23.932  36.204  1.00 5.28  ? 70  ASN H CG  1 
ATOM   9881  O  OD1 . ASN H  1 70  ? -86.335  -23.114  36.153  1.00 6.72  ? 70  ASN H OD1 1 
ATOM   9882  N  ND2 . ASN H  1 70  ? -88.080  -24.041  37.259  1.00 4.53  ? 70  ASN H ND2 1 
ATOM   9883  N  N   . LEU H  1 71  ? -84.344  -23.995  33.782  1.00 4.74  ? 71  LEU H N   1 
ATOM   9884  C  CA  . LEU H  1 71  ? -82.937  -24.070  34.138  1.00 4.84  ? 71  LEU H CA  1 
ATOM   9885  C  C   . LEU H  1 71  ? -82.561  -22.969  35.148  1.00 6.10  ? 71  LEU H C   1 
ATOM   9886  O  O   . LEU H  1 71  ? -81.383  -22.741  35.423  1.00 6.82  ? 71  LEU H O   1 
ATOM   9887  C  CB  . LEU H  1 71  ? -82.093  -23.942  32.891  1.00 4.06  ? 71  LEU H CB  1 
ATOM   9888  C  CG  . LEU H  1 71  ? -81.982  -25.220  32.057  1.00 4.62  ? 71  LEU H CG  1 
ATOM   9889  C  CD1 . LEU H  1 71  ? -83.137  -25.361  31.113  1.00 3.71  ? 71  LEU H CD1 1 
ATOM   9890  C  CD2 . LEU H  1 71  ? -80.665  -25.271  31.286  1.00 2.87  ? 71  LEU H CD2 1 
ATOM   9891  N  N   . GLN H  1 72  ? -83.560  -22.270  35.686  1.00 7.03  ? 72  GLN H N   1 
ATOM   9892  C  CA  . GLN H  1 72  ? -83.295  -21.118  36.525  1.00 7.64  ? 72  GLN H CA  1 
ATOM   9893  C  C   . GLN H  1 72  ? -83.101  -21.594  37.939  1.00 8.19  ? 72  GLN H C   1 
ATOM   9894  O  O   . GLN H  1 72  ? -82.206  -21.127  38.604  1.00 8.81  ? 72  GLN H O   1 
ATOM   9895  C  CB  . GLN H  1 72  ? -84.447  -20.110  36.451  1.00 7.97  ? 72  GLN H CB  1 
ATOM   9896  C  CG  . GLN H  1 72  ? -84.340  -18.932  37.421  1.00 9.02  ? 72  GLN H CG  1 
ATOM   9897  C  CD  . GLN H  1 72  ? -83.175  -18.031  37.079  1.00 11.26 ? 72  GLN H CD  1 
ATOM   9898  O  OE1 . GLN H  1 72  ? -83.264  -17.180  36.161  1.00 12.92 ? 72  GLN H OE1 1 
ATOM   9899  N  NE2 . GLN H  1 72  ? -82.052  -18.219  37.788  1.00 7.92  ? 72  GLN H NE2 1 
ATOM   9900  N  N   . ASP H  1 73  ? -83.932  -22.528  38.402  1.00 8.83  ? 73  ASP H N   1 
ATOM   9901  C  CA  . ASP H  1 73  ? -83.881  -22.945  39.809  1.00 9.64  ? 73  ASP H CA  1 
ATOM   9902  C  C   . ASP H  1 73  ? -82.884  -24.074  39.977  1.00 10.11 ? 73  ASP H C   1 
ATOM   9903  O  O   . ASP H  1 73  ? -82.887  -25.048  39.177  1.00 12.27 ? 73  ASP H O   1 
ATOM   9904  C  CB  . ASP H  1 73  ? -85.268  -23.355  40.309  1.00 9.49  ? 73  ASP H CB  1 
ATOM   9905  C  CG  . ASP H  1 73  ? -86.302  -22.232  40.129  1.00 11.92 ? 73  ASP H CG  1 
ATOM   9906  O  OD1 . ASP H  1 73  ? -85.935  -21.030  40.338  1.00 13.94 ? 73  ASP H OD1 1 
ATOM   9907  O  OD2 . ASP H  1 73  ? -87.466  -22.539  39.745  1.00 12.38 ? 73  ASP H OD2 1 
ATOM   9908  N  N   . LEU H  1 74  ? -82.006  -23.940  40.973  1.00 9.53  ? 74  LEU H N   1 
ATOM   9909  C  CA  . LEU H  1 74  ? -80.982  -24.940  41.226  1.00 8.33  ? 74  LEU H CA  1 
ATOM   9910  C  C   . LEU H  1 74  ? -81.086  -25.398  42.668  1.00 8.42  ? 74  LEU H C   1 
ATOM   9911  O  O   . LEU H  1 74  ? -80.943  -24.578  43.572  1.00 8.73  ? 74  LEU H O   1 
ATOM   9912  C  CB  . LEU H  1 74  ? -79.596  -24.360  40.941  1.00 7.91  ? 74  LEU H CB  1 
ATOM   9913  C  CG  . LEU H  1 74  ? -78.409  -25.336  40.891  1.00 7.54  ? 74  LEU H CG  1 
ATOM   9914  C  CD1 . LEU H  1 74  ? -78.538  -26.383  39.795  1.00 4.11  ? 74  LEU H CD1 1 
ATOM   9915  C  CD2 . LEU H  1 74  ? -77.069  -24.617  40.744  1.00 7.42  ? 74  LEU H CD2 1 
ATOM   9916  N  N   . GLY H  1 75  ? -81.323  -26.698  42.883  1.00 8.32  ? 75  GLY H N   1 
ATOM   9917  C  CA  . GLY H  1 75  ? -81.427  -27.276  44.228  1.00 8.43  ? 75  GLY H CA  1 
ATOM   9918  C  C   . GLY H  1 75  ? -80.151  -27.247  45.040  1.00 9.34  ? 75  GLY H C   1 
ATOM   9919  O  O   . GLY H  1 75  ? -79.109  -26.798  44.562  1.00 9.26  ? 75  GLY H O   1 
ATOM   9920  N  N   . LYS H  1 76  ? -80.235  -27.727  46.281  1.00 10.20 ? 76  LYS H N   1 
ATOM   9921  C  CA  . LYS H  1 76  ? -79.058  -27.731  47.162  1.00 11.66 ? 76  LYS H CA  1 
ATOM   9922  C  C   . LYS H  1 76  ? -77.970  -28.698  46.691  1.00 10.51 ? 76  LYS H C   1 
ATOM   9923  O  O   . LYS H  1 76  ? -78.205  -29.909  46.555  1.00 10.78 ? 76  LYS H O   1 
ATOM   9924  C  CB  . LYS H  1 76  ? -79.404  -27.965  48.654  1.00 11.56 ? 76  LYS H CB  1 
ATOM   9925  C  CG  . LYS H  1 76  ? -78.262  -27.402  49.568  1.00 15.47 ? 76  LYS H CG  1 
ATOM   9926  C  CD  . LYS H  1 76  ? -78.447  -27.626  51.114  1.00 15.69 ? 76  LYS H CD  1 
ATOM   9927  C  CE  . LYS H  1 76  ? -77.114  -27.359  51.912  1.00 18.62 ? 76  LYS H CE  1 
ATOM   9928  N  NZ  . LYS H  1 76  ? -77.268  -27.748  53.407  1.00 20.35 ? 76  LYS H NZ  1 
ATOM   9929  N  N   . LEU H  1 77  ? -76.799  -28.131  46.416  1.00 9.97  ? 77  LEU H N   1 
ATOM   9930  C  CA  . LEU H  1 77  ? -75.540  -28.885  46.304  1.00 9.42  ? 77  LEU H CA  1 
ATOM   9931  C  C   . LEU H  1 77  ? -75.038  -29.229  47.695  1.00 9.37  ? 77  LEU H C   1 
ATOM   9932  O  O   . LEU H  1 77  ? -75.174  -28.433  48.627  1.00 9.88  ? 77  LEU H O   1 
ATOM   9933  C  CB  . LEU H  1 77  ? -74.483  -28.002  45.636  1.00 9.22  ? 77  LEU H CB  1 
ATOM   9934  C  CG  . LEU H  1 77  ? -74.122  -28.177  44.161  1.00 8.97  ? 77  LEU H CG  1 
ATOM   9935  C  CD1 . LEU H  1 77  ? -75.376  -28.228  43.333  1.00 7.30  ? 77  LEU H CD1 1 
ATOM   9936  C  CD2 . LEU H  1 77  ? -73.286  -26.995  43.782  1.00 9.54  ? 77  LEU H CD2 1 
ATOM   9937  N  N   . ASN H  1 78  ? -74.475  -30.413  47.865  1.00 9.53  ? 78  ASN H N   1 
ATOM   9938  C  CA  . ASN H  1 78  ? -73.794  -30.731  49.126  1.00 9.48  ? 78  ASN H CA  1 
ATOM   9939  C  C   . ASN H  1 78  ? -72.423  -31.265  48.715  1.00 9.26  ? 78  ASN H C   1 
ATOM   9940  O  O   . ASN H  1 78  ? -72.331  -32.357  48.161  1.00 9.75  ? 78  ASN H O   1 
ATOM   9941  C  CB  . ASN H  1 78  ? -74.613  -31.717  49.968  1.00 9.38  ? 78  ASN H CB  1 
ATOM   9942  C  CG  . ASN H  1 78  ? -73.872  -32.185  51.248  1.00 12.25 ? 78  ASN H CG  1 
ATOM   9943  O  OD1 . ASN H  1 78  ? -72.840  -31.620  51.655  1.00 13.88 ? 78  ASN H OD1 1 
ATOM   9944  N  ND2 . ASN H  1 78  ? -74.407  -33.233  51.879  1.00 12.54 ? 78  ASN H ND2 1 
ATOM   9945  N  N   . ILE H  1 79  ? -71.384  -30.460  48.920  1.00 8.78  ? 79  ILE H N   1 
ATOM   9946  C  CA  . ILE H  1 79  ? -70.081  -30.728  48.334  1.00 8.23  ? 79  ILE H CA  1 
ATOM   9947  C  C   . ILE H  1 79  ? -69.249  -31.676  49.179  1.00 8.74  ? 79  ILE H C   1 
ATOM   9948  O  O   . ILE H  1 79  ? -68.810  -32.700  48.673  1.00 9.23  ? 79  ILE H O   1 
ATOM   9949  C  CB  . ILE H  1 79  ? -69.269  -29.446  48.043  1.00 8.10  ? 79  ILE H CB  1 
ATOM   9950  C  CG1 . ILE H  1 79  ? -70.061  -28.480  47.151  1.00 7.62  ? 79  ILE H CG1 1 
ATOM   9951  C  CG2 . ILE H  1 79  ? -67.958  -29.796  47.404  1.00 7.78  ? 79  ILE H CG2 1 
ATOM   9952  C  CD1 . ILE H  1 79  ? -70.628  -29.099  45.828  1.00 5.74  ? 79  ILE H CD1 1 
ATOM   9953  N  N   . GLY H  1 80  ? -69.035  -31.355  50.451  1.00 8.42  ? 80  GLY H N   1 
ATOM   9954  C  CA  . GLY H  1 80  ? -68.273  -32.246  51.319  1.00 8.56  ? 80  GLY H CA  1 
ATOM   9955  C  C   . GLY H  1 80  ? -66.804  -31.869  51.249  1.00 9.10  ? 80  GLY H C   1 
ATOM   9956  O  O   . GLY H  1 80  ? -66.399  -31.169  50.314  1.00 9.09  ? 80  GLY H O   1 
ATOM   9957  N  N   . GLU H  1 81  ? -65.997  -32.310  52.224  1.00 9.32  ? 81  GLU H N   1 
ATOM   9958  C  CA  . GLU H  1 81  ? -64.620  -31.848  52.261  1.00 10.13 ? 81  GLU H CA  1 
ATOM   9959  C  C   . GLU H  1 81  ? -63.589  -32.955  52.058  1.00 9.37  ? 81  GLU H C   1 
ATOM   9960  O  O   . GLU H  1 81  ? -62.432  -32.646  51.820  1.00 10.30 ? 81  GLU H O   1 
ATOM   9961  C  CB  . GLU H  1 81  ? -64.339  -31.054  53.542  1.00 9.64  ? 81  GLU H CB  1 
ATOM   9962  C  CG  . GLU H  1 81  ? -65.177  -29.747  53.718  1.00 12.23 ? 81  GLU H CG  1 
ATOM   9963  C  CD  . GLU H  1 81  ? -65.285  -29.312  55.222  1.00 15.06 ? 81  GLU H CD  1 
ATOM   9964  O  OE1 . GLU H  1 81  ? -65.671  -30.154  56.089  1.00 20.83 ? 81  GLU H OE1 1 
ATOM   9965  O  OE2 . GLU H  1 81  ? -64.982  -28.135  55.556  1.00 19.48 ? 81  GLU H OE2 1 
ATOM   9966  N  N   . ASP H  1 82  ? -63.990  -34.231  52.180  1.00 8.72  ? 82  ASP H N   1 
ATOM   9967  C  CA  . ASP H  1 82  ? -63.116  -35.388  51.906  1.00 7.37  ? 82  ASP H CA  1 
ATOM   9968  C  C   . ASP H  1 82  ? -63.778  -36.425  51.005  1.00 6.42  ? 82  ASP H C   1 
ATOM   9969  O  O   . ASP H  1 82  ? -64.991  -36.405  50.827  1.00 6.36  ? 82  ASP H O   1 
ATOM   9970  C  CB  . ASP H  1 82  ? -62.626  -36.043  53.200  1.00 7.30  ? 82  ASP H CB  1 
ATOM   9971  C  CG  . ASP H  1 82  ? -63.753  -36.525  54.087  1.00 10.33 ? 82  ASP H CG  1 
ATOM   9972  O  OD1 . ASP H  1 82  ? -63.811  -36.064  55.236  1.00 16.60 ? 82  ASP H OD1 1 
ATOM   9973  O  OD2 . ASP H  1 82  ? -64.586  -37.353  53.675  1.00 12.02 ? 82  ASP H OD2 1 
ATOM   9974  N  N   . VAL H  1 83  ? -62.976  -37.356  50.471  1.00 5.68  ? 83  VAL H N   1 
ATOM   9975  C  CA  . VAL H  1 83  ? -63.438  -38.345  49.469  1.00 4.96  ? 83  VAL H CA  1 
ATOM   9976  C  C   . VAL H  1 83  ? -64.740  -39.051  49.856  1.00 5.06  ? 83  VAL H C   1 
ATOM   9977  O  O   . VAL H  1 83  ? -65.734  -38.990  49.105  1.00 5.06  ? 83  VAL H O   1 
ATOM   9978  C  CB  . VAL H  1 83  ? -62.350  -39.386  49.166  1.00 4.69  ? 83  VAL H CB  1 
ATOM   9979  C  CG1 . VAL H  1 83  ? -62.800  -40.350  48.094  1.00 4.00  ? 83  VAL H CG1 1 
ATOM   9980  C  CG2 . VAL H  1 83  ? -61.111  -38.682  48.731  1.00 4.68  ? 83  VAL H CG2 1 
ATOM   9981  N  N   . GLU H  1 84  ? -64.728  -39.707  51.014  1.00 4.71  ? 84  GLU H N   1 
ATOM   9982  C  CA  . GLU H  1 84  ? -65.907  -40.409  51.498  1.00 5.43  ? 84  GLU H CA  1 
ATOM   9983  C  C   . GLU H  1 84  ? -67.136  -39.488  51.534  1.00 5.71  ? 84  GLU H C   1 
ATOM   9984  O  O   . GLU H  1 84  ? -68.176  -39.790  50.940  1.00 5.76  ? 84  GLU H O   1 
ATOM   9985  C  CB  . GLU H  1 84  ? -65.665  -41.001  52.888  1.00 5.55  ? 84  GLU H CB  1 
ATOM   9986  C  CG  . GLU H  1 84  ? -66.372  -42.330  53.069  1.00 9.23  ? 84  GLU H CG  1 
ATOM   9987  C  CD  . GLU H  1 84  ? -66.547  -42.736  54.532  1.00 13.98 ? 84  GLU H CD  1 
ATOM   9988  O  OE1 . GLU H  1 84  ? -65.545  -42.639  55.299  1.00 16.30 ? 84  GLU H OE1 1 
ATOM   9989  O  OE2 . GLU H  1 84  ? -67.687  -43.160  54.904  1.00 13.49 ? 84  GLU H OE2 1 
ATOM   9990  N  N   . GLU H  1 85  ? -67.003  -38.361  52.211  1.00 5.72  ? 85  GLU H N   1 
ATOM   9991  C  CA  . GLU H  1 85  ? -68.088  -37.425  52.351  1.00 6.71  ? 85  GLU H CA  1 
ATOM   9992  C  C   . GLU H  1 85  ? -68.590  -37.053  50.948  1.00 5.75  ? 85  GLU H C   1 
ATOM   9993  O  O   . GLU H  1 85  ? -69.809  -36.963  50.693  1.00 5.36  ? 85  GLU H O   1 
ATOM   9994  C  CB  . GLU H  1 85  ? -67.539  -36.210  53.067  1.00 6.72  ? 85  GLU H CB  1 
ATOM   9995  C  CG  . GLU H  1 85  ? -68.448  -35.483  54.040  1.00 9.97  ? 85  GLU H CG  1 
ATOM   9996  C  CD  . GLU H  1 85  ? -67.626  -34.536  54.995  1.00 11.75 ? 85  GLU H CD  1 
ATOM   9997  O  OE1 . GLU H  1 85  ? -66.595  -34.999  55.589  1.00 15.06 ? 85  GLU H OE1 1 
ATOM   9998  O  OE2 . GLU H  1 85  ? -68.022  -33.346  55.145  1.00 16.80 ? 85  GLU H OE2 1 
ATOM   9999  N  N   . MET H  1 86  ? -67.666  -36.862  50.006  1.00 4.99  ? 86  MET H N   1 
ATOM   10000 C  CA  . MET H  1 86  ? -68.137  -36.404  48.713  1.00 5.01  ? 86  MET H CA  1 
ATOM   10001 C  C   . MET H  1 86  ? -68.779  -37.507  47.924  1.00 4.96  ? 86  MET H C   1 
ATOM   10002 O  O   . MET H  1 86  ? -69.786  -37.293  47.250  1.00 5.54  ? 86  MET H O   1 
ATOM   10003 C  CB  . MET H  1 86  ? -67.159  -35.507  47.911  1.00 4.78  ? 86  MET H CB  1 
ATOM   10004 C  CG  . MET H  1 86  ? -65.713  -35.854  47.964  1.00 6.74  ? 86  MET H CG  1 
ATOM   10005 S  SD  . MET H  1 86  ? -64.602  -34.453  47.791  1.00 4.93  ? 86  MET H SD  1 
ATOM   10006 C  CE  . MET H  1 86  ? -64.496  -34.230  46.031  1.00 3.19  ? 86  MET H CE  1 
ATOM   10007 N  N   . LEU H  1 87  ? -68.252  -38.711  48.053  1.00 4.79  ? 87  LEU H N   1 
ATOM   10008 C  CA  . LEU H  1 87  ? -68.849  -39.830  47.361  1.00 3.92  ? 87  LEU H CA  1 
ATOM   10009 C  C   . LEU H  1 87  ? -70.234  -40.099  47.928  1.00 4.02  ? 87  LEU H C   1 
ATOM   10010 O  O   . LEU H  1 87  ? -71.204  -40.309  47.188  1.00 4.38  ? 87  LEU H O   1 
ATOM   10011 C  CB  . LEU H  1 87  ? -67.936  -41.034  47.459  1.00 3.57  ? 87  LEU H CB  1 
ATOM   10012 C  CG  . LEU H  1 87  ? -67.088  -41.414  46.234  1.00 3.38  ? 87  LEU H CG  1 
ATOM   10013 C  CD1 . LEU H  1 87  ? -66.723  -40.287  45.291  1.00 2.56  ? 87  LEU H CD1 1 
ATOM   10014 C  CD2 . LEU H  1 87  ? -65.851  -42.117  46.721  1.00 4.17  ? 87  LEU H CD2 1 
ATOM   10015 N  N   . ARG H  1 88  ? -70.337  -40.040  49.245  1.00 4.03  ? 88  ARG H N   1 
ATOM   10016 C  CA  . ARG H  1 88  ? -71.579  -40.329  49.954  1.00 4.83  ? 88  ARG H CA  1 
ATOM   10017 C  C   . ARG H  1 88  ? -72.621  -39.303  49.526  1.00 4.69  ? 88  ARG H C   1 
ATOM   10018 O  O   . ARG H  1 88  ? -73.801  -39.607  49.381  1.00 5.47  ? 88  ARG H O   1 
ATOM   10019 C  CB  . ARG H  1 88  ? -71.335  -40.245  51.464  1.00 4.21  ? 88  ARG H CB  1 
ATOM   10020 C  CG  . ARG H  1 88  ? -71.784  -41.433  52.241  1.00 5.35  ? 88  ARG H CG  1 
ATOM   10021 C  CD  . ARG H  1 88  ? -71.297  -41.427  53.699  1.00 7.15  ? 88  ARG H CD  1 
ATOM   10022 N  NE  . ARG H  1 88  ? -70.328  -42.512  53.991  1.00 13.60 ? 88  ARG H NE  1 
ATOM   10023 C  CZ  . ARG H  1 88  ? -70.568  -43.840  53.831  1.00 14.69 ? 88  ARG H CZ  1 
ATOM   10024 N  NH1 . ARG H  1 88  ? -71.735  -44.299  53.351  1.00 13.82 ? 88  ARG H NH1 1 
ATOM   10025 N  NH2 . ARG H  1 88  ? -69.620  -44.724  54.125  1.00 13.10 ? 88  ARG H NH2 1 
ATOM   10026 N  N   . SER H  1 89  ? -72.179  -38.085  49.283  1.00 4.66  ? 89  SER H N   1 
ATOM   10027 C  CA  . SER H  1 89  ? -73.117  -37.047  48.926  1.00 4.19  ? 89  SER H CA  1 
ATOM   10028 C  C   . SER H  1 89  ? -73.686  -37.254  47.521  1.00 4.52  ? 89  SER H C   1 
ATOM   10029 O  O   . SER H  1 89  ? -74.875  -37.015  47.304  1.00 4.77  ? 89  SER H O   1 
ATOM   10030 C  CB  . SER H  1 89  ? -72.450  -35.684  49.054  1.00 4.08  ? 89  SER H CB  1 
ATOM   10031 O  OG  . SER H  1 89  ? -73.331  -34.678  48.627  1.00 3.46  ? 89  SER H OG  1 
ATOM   10032 N  N   . ASP H  1 90  ? -72.838  -37.696  46.575  1.00 3.89  ? 90  ASP H N   1 
ATOM   10033 C  CA  . ASP H  1 90  ? -73.286  -38.044  45.238  1.00 3.80  ? 90  ASP H CA  1 
ATOM   10034 C  C   . ASP H  1 90  ? -74.261  -39.193  45.307  1.00 3.88  ? 90  ASP H C   1 
ATOM   10035 O  O   . ASP H  1 90  ? -75.284  -39.157  44.632  1.00 4.19  ? 90  ASP H O   1 
ATOM   10036 C  CB  . ASP H  1 90  ? -72.122  -38.419  44.331  1.00 4.11  ? 90  ASP H CB  1 
ATOM   10037 C  CG  . ASP H  1 90  ? -71.190  -37.209  43.978  1.00 6.82  ? 90  ASP H CG  1 
ATOM   10038 O  OD1 . ASP H  1 90  ? -69.943  -37.414  43.803  1.00 9.08  ? 90  ASP H OD1 1 
ATOM   10039 O  OD2 . ASP H  1 90  ? -71.694  -36.052  43.855  1.00 9.73  ? 90  ASP H OD2 1 
ATOM   10040 N  N   . LEU H  1 91  ? -73.959  -40.207  46.130  1.00 3.64  ? 91  LEU H N   1 
ATOM   10041 C  CA  . LEU H  1 91  ? -74.893  -41.322  46.349  1.00 2.83  ? 91  LEU H CA  1 
ATOM   10042 C  C   . LEU H  1 91  ? -76.258  -40.859  46.885  1.00 3.08  ? 91  LEU H C   1 
ATOM   10043 O  O   . LEU H  1 91  ? -77.278  -41.263  46.363  1.00 3.75  ? 91  LEU H O   1 
ATOM   10044 C  CB  . LEU H  1 91  ? -74.280  -42.380  47.260  1.00 2.84  ? 91  LEU H CB  1 
ATOM   10045 C  CG  . LEU H  1 91  ? -75.108  -43.595  47.667  1.00 2.00  ? 91  LEU H CG  1 
ATOM   10046 C  CD1 . LEU H  1 91  ? -75.556  -44.347  46.422  1.00 2.68  ? 91  LEU H CD1 1 
ATOM   10047 C  CD2 . LEU H  1 91  ? -74.340  -44.505  48.606  1.00 2.00  ? 91  LEU H CD2 1 
ATOM   10048 N  N   . ALA H  1 92  ? -76.294  -40.018  47.907  1.00 3.17  ? 92  ALA H N   1 
ATOM   10049 C  CA  . ALA H  1 92  ? -77.589  -39.568  48.427  1.00 3.20  ? 92  ALA H CA  1 
ATOM   10050 C  C   . ALA H  1 92  ? -78.394  -38.871  47.307  1.00 3.66  ? 92  ALA H C   1 
ATOM   10051 O  O   . ALA H  1 92  ? -79.632  -39.029  47.186  1.00 4.28  ? 92  ALA H O   1 
ATOM   10052 C  CB  . ALA H  1 92  ? -77.427  -38.664  49.641  1.00 2.00  ? 92  ALA H CB  1 
ATOM   10053 N  N   . LEU H  1 93  ? -77.684  -38.124  46.471  1.00 3.86  ? 93  LEU H N   1 
ATOM   10054 C  CA  . LEU H  1 93  ? -78.306  -37.375  45.398  1.00 4.31  ? 93  LEU H CA  1 
ATOM   10055 C  C   . LEU H  1 93  ? -78.918  -38.287  44.349  1.00 4.81  ? 93  LEU H C   1 
ATOM   10056 O  O   . LEU H  1 93  ? -80.047  -38.038  43.909  1.00 5.15  ? 93  LEU H O   1 
ATOM   10057 C  CB  . LEU H  1 93  ? -77.284  -36.466  44.756  1.00 4.17  ? 93  LEU H CB  1 
ATOM   10058 C  CG  . LEU H  1 93  ? -77.859  -35.404  43.859  1.00 5.16  ? 93  LEU H CG  1 
ATOM   10059 C  CD1 . LEU H  1 93  ? -78.791  -34.458  44.672  1.00 5.04  ? 93  LEU H CD1 1 
ATOM   10060 C  CD2 . LEU H  1 93  ? -76.702  -34.637  43.271  1.00 4.55  ? 93  LEU H CD2 1 
ATOM   10061 N  N   . GLU H  1 94  ? -78.190  -39.345  43.962  1.00 4.94  ? 94  GLU H N   1 
ATOM   10062 C  CA  . GLU H  1 94  ? -78.674  -40.333  43.002  1.00 5.03  ? 94  GLU H CA  1 
ATOM   10063 C  C   . GLU H  1 94  ? -79.891  -41.041  43.561  1.00 4.88  ? 94  GLU H C   1 
ATOM   10064 O  O   . GLU H  1 94  ? -80.879  -41.248  42.850  1.00 4.49  ? 94  GLU H O   1 
ATOM   10065 C  CB  . GLU H  1 94  ? -77.581  -41.339  42.663  1.00 5.05  ? 94  GLU H CB  1 
ATOM   10066 C  CG  . GLU H  1 94  ? -76.389  -40.751  41.940  1.00 7.76  ? 94  GLU H CG  1 
ATOM   10067 C  CD  . GLU H  1 94  ? -76.564  -40.674  40.408  1.00 13.85 ? 94  GLU H CD  1 
ATOM   10068 O  OE1 . GLU H  1 94  ? -77.669  -41.014  39.910  1.00 15.11 ? 94  GLU H OE1 1 
ATOM   10069 O  OE2 . GLU H  1 94  ? -75.601  -40.256  39.694  1.00 14.48 ? 94  GLU H OE2 1 
ATOM   10070 N  N   . LEU H  1 95  ? -79.827  -41.391  44.844  1.00 4.98  ? 95  LEU H N   1 
ATOM   10071 C  CA  . LEU H  1 95  ? -80.946  -42.023  45.511  1.00 4.82  ? 95  LEU H CA  1 
ATOM   10072 C  C   . LEU H  1 95  ? -82.203  -41.151  45.503  1.00 5.51  ? 95  LEU H C   1 
ATOM   10073 O  O   . LEU H  1 95  ? -83.289  -41.664  45.222  1.00 5.94  ? 95  LEU H O   1 
ATOM   10074 C  CB  . LEU H  1 95  ? -80.545  -42.430  46.922  1.00 4.60  ? 95  LEU H CB  1 
ATOM   10075 C  CG  . LEU H  1 95  ? -80.198  -43.904  47.188  1.00 4.46  ? 95  LEU H CG  1 
ATOM   10076 C  CD1 . LEU H  1 95  ? -79.874  -44.688  45.955  1.00 2.66  ? 95  LEU H CD1 1 
ATOM   10077 C  CD2 . LEU H  1 95  ? -79.091  -44.023  48.176  1.00 3.35  ? 95  LEU H CD2 1 
ATOM   10078 N  N   . ASP H  1 96  ? -82.078  -39.846  45.754  1.00 5.51  ? 96  ASP H N   1 
ATOM   10079 C  CA  . ASP H  1 96  ? -83.273  -39.008  45.684  1.00 6.34  ? 96  ASP H CA  1 
ATOM   10080 C  C   . ASP H  1 96  ? -83.806  -38.850  44.274  1.00 5.92  ? 96  ASP H C   1 
ATOM   10081 O  O   . ASP H  1 96  ? -85.010  -38.729  44.062  1.00 5.86  ? 96  ASP H O   1 
ATOM   10082 C  CB  . ASP H  1 96  ? -83.052  -37.643  46.291  1.00 7.34  ? 96  ASP H CB  1 
ATOM   10083 C  CG  . ASP H  1 96  ? -83.065  -37.677  47.812  1.00 13.91 ? 96  ASP H CG  1 
ATOM   10084 O  OD1 . ASP H  1 96  ? -83.758  -38.562  48.435  1.00 19.35 ? 96  ASP H OD1 1 
ATOM   10085 O  OD2 . ASP H  1 96  ? -82.370  -36.805  48.400  1.00 19.46 ? 96  ASP H OD2 1 
ATOM   10086 N  N   . GLY H  1 97  ? -82.913  -38.816  43.303  1.00 5.49  ? 97  GLY H N   1 
ATOM   10087 C  CA  . GLY H  1 97  ? -83.372  -38.711  41.947  1.00 5.59  ? 97  GLY H CA  1 
ATOM   10088 C  C   . GLY H  1 97  ? -84.014  -39.994  41.469  1.00 5.89  ? 97  GLY H C   1 
ATOM   10089 O  O   . GLY H  1 97  ? -84.944  -39.955  40.682  1.00 5.90  ? 97  GLY H O   1 
ATOM   10090 N  N   . ALA H  1 98  ? -83.506  -41.139  41.905  1.00 6.51  ? 98  ALA H N   1 
ATOM   10091 C  CA  . ALA H  1 98  ? -84.101  -42.413  41.499  1.00 7.79  ? 98  ALA H CA  1 
ATOM   10092 C  C   . ALA H  1 98  ? -85.545  -42.479  42.003  1.00 9.23  ? 98  ALA H C   1 
ATOM   10093 O  O   . ALA H  1 98  ? -86.437  -42.934  41.296  1.00 8.84  ? 98  ALA H O   1 
ATOM   10094 C  CB  . ALA H  1 98  ? -83.288  -43.587  42.007  1.00 6.33  ? 98  ALA H CB  1 
ATOM   10095 N  N   . LYS H  1 99  ? -85.755  -41.966  43.219  1.00 11.33 ? 99  LYS H N   1 
ATOM   10096 C  CA  . LYS H  1 99  ? -87.047  -41.925  43.852  1.00 13.62 ? 99  LYS H CA  1 
ATOM   10097 C  C   . LYS H  1 99  ? -87.994  -41.110  42.975  1.00 11.98 ? 99  LYS H C   1 
ATOM   10098 O  O   . LYS H  1 99  ? -89.056  -41.605  42.579  1.00 12.42 ? 99  LYS H O   1 
ATOM   10099 C  CB  . LYS H  1 99  ? -86.891  -41.339  45.255  1.00 14.35 ? 99  LYS H CB  1 
ATOM   10100 C  CG  . LYS H  1 99  ? -87.970  -41.697  46.285  1.00 18.33 ? 99  LYS H CG  1 
ATOM   10101 C  CD  . LYS H  1 99  ? -87.501  -41.349  47.738  1.00 19.24 ? 99  LYS H CD  1 
ATOM   10102 C  CE  . LYS H  1 99  ? -86.440  -42.374  48.367  1.00 22.79 ? 99  LYS H CE  1 
ATOM   10103 N  NZ  . LYS H  1 99  ? -85.301  -41.693  49.148  1.00 22.14 ? 99  LYS H NZ  1 
ATOM   10104 N  N   . ASN H  1 100 ? -87.595  -39.884  42.633  1.00 9.87  ? 100 ASN H N   1 
ATOM   10105 C  CA  . ASN H  1 100 ? -88.378  -39.034  41.728  1.00 8.12  ? 100 ASN H CA  1 
ATOM   10106 C  C   . ASN H  1 100 ? -88.670  -39.686  40.362  1.00 7.37  ? 100 ASN H C   1 
ATOM   10107 O  O   . ASN H  1 100 ? -89.777  -39.557  39.814  1.00 6.46  ? 100 ASN H O   1 
ATOM   10108 C  CB  . ASN H  1 100 ? -87.686  -37.686  41.486  1.00 7.87  ? 100 ASN H CB  1 
ATOM   10109 C  CG  . ASN H  1 100 ? -87.509  -36.855  42.759  1.00 8.34  ? 100 ASN H CG  1 
ATOM   10110 O  OD1 . ASN H  1 100 ? -86.603  -36.038  42.838  1.00 9.74  ? 100 ASN H OD1 1 
ATOM   10111 N  ND2 . ASN H  1 100 ? -88.364  -37.063  43.745  1.00 6.55  ? 100 ASN H ND2 1 
ATOM   10112 N  N   . LEU H  1 101 ? -87.665  -40.375  39.813  1.00 5.81  ? 101 LEU H N   1 
ATOM   10113 C  CA  . LEU H  1 101 ? -87.809  -41.055  38.549  1.00 3.85  ? 101 LEU H CA  1 
ATOM   10114 C  C   . LEU H  1 101 ? -88.844  -42.149  38.635  1.00 3.42  ? 101 LEU H C   1 
ATOM   10115 O  O   . LEU H  1 101 ? -89.671  -42.267  37.740  1.00 3.00  ? 101 LEU H O   1 
ATOM   10116 C  CB  . LEU H  1 101 ? -86.469  -41.613  38.082  1.00 4.15  ? 101 LEU H CB  1 
ATOM   10117 C  CG  . LEU H  1 101 ? -85.611  -40.733  37.160  1.00 2.78  ? 101 LEU H CG  1 
ATOM   10118 C  CD1 . LEU H  1 101 ? -84.160  -41.190  37.178  1.00 3.14  ? 101 LEU H CD1 1 
ATOM   10119 C  CD2 . LEU H  1 101 ? -86.132  -40.806  35.785  1.00 2.00  ? 101 LEU H CD2 1 
ATOM   10120 N  N   . ARG H  1 102 ? -88.813  -42.928  39.718  1.00 3.00  ? 102 ARG H N   1 
ATOM   10121 C  CA  A ARG H  1 102 ? -89.789  -44.009  39.915  0.50 3.16  ? 102 ARG H CA  1 
ATOM   10122 C  CA  B ARG H  1 102 ? -89.781  -44.012  39.911  0.50 3.18  ? 102 ARG H CA  1 
ATOM   10123 C  C   . ARG H  1 102 ? -91.203  -43.436  39.923  1.00 3.55  ? 102 ARG H C   1 
ATOM   10124 O  O   . ARG H  1 102 ? -92.104  -43.967  39.276  1.00 3.77  ? 102 ARG H O   1 
ATOM   10125 C  CB  A ARG H  1 102 ? -89.478  -44.830  41.181  0.50 2.55  ? 102 ARG H CB  1 
ATOM   10126 C  CB  B ARG H  1 102 ? -89.442  -44.852  41.163  0.50 2.56  ? 102 ARG H CB  1 
ATOM   10127 C  CG  A ARG H  1 102 ? -88.070  -45.431  41.143  0.50 3.08  ? 102 ARG H CG  1 
ATOM   10128 C  CG  B ARG H  1 102 ? -88.169  -45.726  40.968  0.50 3.16  ? 102 ARG H CG  1 
ATOM   10129 C  CD  A ARG H  1 102 ? -87.800  -46.624  42.071  0.50 3.46  ? 102 ARG H CD  1 
ATOM   10130 C  CD  B ARG H  1 102 ? -87.603  -46.448  42.232  0.50 3.54  ? 102 ARG H CD  1 
ATOM   10131 N  NE  A ARG H  1 102 ? -86.888  -47.556  41.402  0.50 4.49  ? 102 ARG H NE  1 
ATOM   10132 N  NE  B ARG H  1 102 ? -87.202  -45.509  43.277  0.50 5.97  ? 102 ARG H NE  1 
ATOM   10133 C  CZ  A ARG H  1 102 ? -85.574  -47.543  41.515  0.50 5.97  ? 102 ARG H CZ  1 
ATOM   10134 C  CZ  B ARG H  1 102 ? -86.860  -45.831  44.529  0.50 7.21  ? 102 ARG H CZ  1 
ATOM   10135 N  NH1 A ARG H  1 102 ? -84.977  -46.678  42.292  0.50 9.10  ? 102 ARG H NH1 1 
ATOM   10136 N  NH1 B ARG H  1 102 ? -86.834  -47.100  44.946  0.50 10.63 ? 102 ARG H NH1 1 
ATOM   10137 N  NH2 A ARG H  1 102 ? -84.849  -48.411  40.847  0.50 7.39  ? 102 ARG H NH2 1 
ATOM   10138 N  NH2 B ARG H  1 102 ? -86.547  -44.876  45.373  0.50 7.28  ? 102 ARG H NH2 1 
ATOM   10139 N  N   . GLU H  1 103 ? -91.389  -42.322  40.626  1.00 4.24  ? 103 GLU H N   1 
ATOM   10140 C  CA  . GLU H  1 103 ? -92.682  -41.693  40.707  1.00 5.19  ? 103 GLU H CA  1 
ATOM   10141 C  C   . GLU H  1 103 ? -93.121  -41.197  39.320  1.00 2.93  ? 103 GLU H C   1 
ATOM   10142 O  O   . GLU H  1 103 ? -94.182  -41.567  38.862  1.00 3.14  ? 103 GLU H O   1 
ATOM   10143 C  CB  . GLU H  1 103 ? -92.635  -40.605  41.783  1.00 4.71  ? 103 GLU H CB  1 
ATOM   10144 C  CG  . GLU H  1 103 ? -93.969  -39.911  42.141  1.00 8.51  ? 103 GLU H CG  1 
ATOM   10145 C  CD  . GLU H  1 103 ? -93.752  -38.628  42.996  1.00 11.65 ? 103 GLU H CD  1 
ATOM   10146 O  OE1 . GLU H  1 103 ? -92.699  -38.582  43.723  1.00 22.02 ? 103 GLU H OE1 1 
ATOM   10147 O  OE2 . GLU H  1 103 ? -94.592  -37.669  42.949  1.00 14.92 ? 103 GLU H OE2 1 
ATOM   10148 N  N   . ALA H  1 104 ? -92.280  -40.439  38.632  1.00 2.82  ? 104 ALA H N   1 
ATOM   10149 C  CA  . ALA H  1 104 ? -92.589  -39.904  37.304  1.00 2.21  ? 104 ALA H CA  1 
ATOM   10150 C  C   . ALA H  1 104 ? -92.948  -40.967  36.282  1.00 2.23  ? 104 ALA H C   1 
ATOM   10151 O  O   . ALA H  1 104 ? -93.874  -40.795  35.511  1.00 2.00  ? 104 ALA H O   1 
ATOM   10152 C  CB  . ALA H  1 104 ? -91.453  -39.077  36.797  1.00 2.02  ? 104 ALA H CB  1 
ATOM   10153 N  N   . ILE H  1 105 ? -92.216  -42.074  36.300  1.00 2.40  ? 105 ILE H N   1 
ATOM   10154 C  CA  . ILE H  1 105 ? -92.421  -43.191  35.379  1.00 2.25  ? 105 ILE H CA  1 
ATOM   10155 C  C   . ILE H  1 105 ? -93.823  -43.776  35.532  1.00 2.27  ? 105 ILE H C   1 
ATOM   10156 O  O   . ILE H  1 105 ? -94.509  -44.046  34.545  1.00 2.00  ? 105 ILE H O   1 
ATOM   10157 C  CB  . ILE H  1 105 ? -91.315  -44.278  35.550  1.00 2.00  ? 105 ILE H CB  1 
ATOM   10158 C  CG1 . ILE H  1 105 ? -90.004  -43.775  34.965  1.00 2.00  ? 105 ILE H CG1 1 
ATOM   10159 C  CG2 . ILE H  1 105 ? -91.673  -45.556  34.833  1.00 2.56  ? 105 ILE H CG2 1 
ATOM   10160 C  CD1 . ILE H  1 105 ? -88.824  -44.472  35.449  1.00 2.00  ? 105 ILE H CD1 1 
ATOM   10161 N  N   . GLY H  1 106 ? -94.240  -43.965  36.777  1.00 2.23  ? 106 GLY H N   1 
ATOM   10162 C  CA  . GLY H  1 106 ? -95.541  -44.548  37.061  1.00 2.06  ? 106 GLY H CA  1 
ATOM   10163 C  C   . GLY H  1 106 ? -96.626  -43.626  36.571  1.00 2.38  ? 106 GLY H C   1 
ATOM   10164 O  O   . GLY H  1 106 ? -97.642  -44.093  36.009  1.00 3.01  ? 106 GLY H O   1 
ATOM   10165 N  N   . TYR H  1 107 ? -96.412  -42.322  36.757  1.00 2.00  ? 107 TYR H N   1 
ATOM   10166 C  CA  . TYR H  1 107 ? -97.431  -41.367  36.372  1.00 2.02  ? 107 TYR H CA  1 
ATOM   10167 C  C   . TYR H  1 107 ? -97.542  -41.230  34.831  1.00 2.71  ? 107 TYR H C   1 
ATOM   10168 O  O   . TYR H  1 107 ? -98.655  -41.176  34.280  1.00 2.68  ? 107 TYR H O   1 
ATOM   10169 C  CB  . TYR H  1 107 ? -97.220  -40.014  37.041  1.00 2.23  ? 107 TYR H CB  1 
ATOM   10170 C  CG  . TYR H  1 107 ? -98.208  -39.027  36.532  1.00 2.09  ? 107 TYR H CG  1 
ATOM   10171 C  CD1 . TYR H  1 107 ? -99.493  -38.981  37.038  1.00 2.00  ? 107 TYR H CD1 1 
ATOM   10172 C  CD2 . TYR H  1 107 ? -97.886  -38.203  35.475  1.00 2.03  ? 107 TYR H CD2 1 
ATOM   10173 C  CE1 . TYR H  1 107 ? -100.433 -38.088  36.542  1.00 2.14  ? 107 TYR H CE1 1 
ATOM   10174 C  CE2 . TYR H  1 107 ? -98.797  -37.313  34.959  1.00 3.55  ? 107 TYR H CE2 1 
ATOM   10175 C  CZ  . TYR H  1 107 ? -100.072 -37.260  35.502  1.00 3.74  ? 107 TYR H CZ  1 
ATOM   10176 O  OH  . TYR H  1 107 ? -100.976 -36.372  34.980  1.00 4.47  ? 107 TYR H OH  1 
ATOM   10177 N  N   . ALA H  1 108 ? -96.395  -41.179  34.142  1.00 2.81  ? 108 ALA H N   1 
ATOM   10178 C  CA  . ALA H  1 108 ? -96.376  -41.150  32.686  1.00 2.69  ? 108 ALA H CA  1 
ATOM   10179 C  C   . ALA H  1 108 ? -97.165  -42.340  32.061  1.00 2.93  ? 108 ALA H C   1 
ATOM   10180 O  O   . ALA H  1 108 ? -97.886  -42.181  31.071  1.00 2.70  ? 108 ALA H O   1 
ATOM   10181 C  CB  . ALA H  1 108 ? -94.942  -41.108  32.162  1.00 2.00  ? 108 ALA H CB  1 
ATOM   10182 N  N   . ASP H  1 109 ? -97.031  -43.518  32.660  1.00 2.97  ? 109 ASP H N   1 
ATOM   10183 C  CA  . ASP H  1 109 ? -97.779  -44.687  32.251  1.00 3.24  ? 109 ASP H CA  1 
ATOM   10184 C  C   . ASP H  1 109 ? -99.258  -44.462  32.429  1.00 3.32  ? 109 ASP H C   1 
ATOM   10185 O  O   . ASP H  1 109 ? -100.050 -44.893  31.609  1.00 2.66  ? 109 ASP H O   1 
ATOM   10186 C  CB  . ASP H  1 109 ? -97.368  -45.896  33.079  1.00 3.43  ? 109 ASP H CB  1 
ATOM   10187 C  CG  . ASP H  1 109 ? -97.881  -47.189  32.507  1.00 5.64  ? 109 ASP H CG  1 
ATOM   10188 O  OD1 . ASP H  1 109 ? -98.969  -47.642  32.947  1.00 8.75  ? 109 ASP H OD1 1 
ATOM   10189 O  OD2 . ASP H  1 109 ? -97.226  -47.761  31.603  1.00 8.50  ? 109 ASP H OD2 1 
ATOM   10190 N  N   . SER H  1 110 ? -99.653  -43.786  33.504  1.00 3.72  ? 110 SER H N   1 
ATOM   10191 C  CA  . SER H  1 110 ? -101.062 -43.730  33.755  1.00 4.42  ? 110 SER H CA  1 
ATOM   10192 C  C   . SER H  1 110 ? -101.765 -42.696  32.887  1.00 3.81  ? 110 SER H C   1 
ATOM   10193 O  O   . SER H  1 110 ? -102.954 -42.843  32.624  1.00 4.04  ? 110 SER H O   1 
ATOM   10194 C  CB  . SER H  1 110 ? -101.351 -43.614  35.244  1.00 4.65  ? 110 SER H CB  1 
ATOM   10195 O  OG  . SER H  1 110 ? -100.767 -42.438  35.711  1.00 10.42 ? 110 SER H OG  1 
ATOM   10196 N  N   . VAL H  1 111 ? -101.036 -41.683  32.403  1.00 3.41  ? 111 VAL H N   1 
ATOM   10197 C  CA  . VAL H  1 111 ? -101.576 -40.788  31.380  1.00 2.86  ? 111 VAL H CA  1 
ATOM   10198 C  C   . VAL H  1 111 ? -101.182 -41.176  29.935  1.00 2.81  ? 111 VAL H C   1 
ATOM   10199 O  O   . VAL H  1 111 ? -101.413 -40.418  29.006  1.00 2.00  ? 111 VAL H O   1 
ATOM   10200 C  CB  . VAL H  1 111 ? -101.212 -39.323  31.592  1.00 2.93  ? 111 VAL H CB  1 
ATOM   10201 C  CG1 . VAL H  1 111 ? -101.888 -38.769  32.820  1.00 3.08  ? 111 VAL H CG1 1 
ATOM   10202 C  CG2 . VAL H  1 111 ? -99.703  -39.142  31.663  1.00