data_3ECS
# 
_entry.id   3ECS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ECS         
RCSB  RCSB049160   
WWPDB D_1000049160 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          ar_001001325.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ECS 
_pdbx_database_status.recvd_initial_deposition_date   2008-09-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hiyama, T.B.'                                           1 
'Ito, T.'                                                2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the alpha subunit of human translation initiation factor 2B' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            392 
_citation.page_first                937 
_citation.page_last                 951 
_citation.year                      2009 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19631657 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2009.07.054 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hiyama, T.B.' 1 
primary 'Ito, T.'      2 
primary 'Imataka, H.'  3 
primary 'Yokoyama, S.' 4 
# 
_cell.entry_id           3ECS 
_cell.length_a           70.885 
_cell.length_b           156.394 
_cell.length_c           138.441 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3ECS 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Translation initiation factor eIF-2B subunit alpha' 35253.633 8   ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                                        96.063    10  ? ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                                       35.453    1   ? ? ? ? 
4 water       nat water                                                18.015    185 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'eukaryotic translation initiation factor 2B alpha, eIF-2B GDP-GTP exchange factor subunit alpha' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)DDKELIEYFKSQ(MSE)KEDPD(MSE)ASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSG
GELFLRFISLASLEYSDYSKCKKI(MSE)IERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAA
KKRFSVYVTESQPDLSGKK(MSE)AKALCHLNVPVTVVLDAAVGYI(MSE)EKADLVIVGAEGVVENGGIINKIGTNQ
(MSE)AVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGV
LTPSAVSDELIKLYLAAAEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLAS
LEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLS
GKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAAAEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ar_001001325.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   ASP n 
1 3   ASP n 
1 4   LYS n 
1 5   GLU n 
1 6   LEU n 
1 7   ILE n 
1 8   GLU n 
1 9   TYR n 
1 10  PHE n 
1 11  LYS n 
1 12  SER n 
1 13  GLN n 
1 14  MSE n 
1 15  LYS n 
1 16  GLU n 
1 17  ASP n 
1 18  PRO n 
1 19  ASP n 
1 20  MSE n 
1 21  ALA n 
1 22  SER n 
1 23  ALA n 
1 24  VAL n 
1 25  ALA n 
1 26  ALA n 
1 27  ILE n 
1 28  ARG n 
1 29  THR n 
1 30  LEU n 
1 31  LEU n 
1 32  GLU n 
1 33  PHE n 
1 34  LEU n 
1 35  LYS n 
1 36  ARG n 
1 37  ASP n 
1 38  LYS n 
1 39  GLY n 
1 40  GLU n 
1 41  THR n 
1 42  ILE n 
1 43  GLN n 
1 44  GLY n 
1 45  LEU n 
1 46  ARG n 
1 47  ALA n 
1 48  ASN n 
1 49  LEU n 
1 50  THR n 
1 51  SER n 
1 52  ALA n 
1 53  ILE n 
1 54  GLU n 
1 55  THR n 
1 56  LEU n 
1 57  CYS n 
1 58  GLY n 
1 59  VAL n 
1 60  ASP n 
1 61  SER n 
1 62  SER n 
1 63  VAL n 
1 64  ALA n 
1 65  VAL n 
1 66  SER n 
1 67  SER n 
1 68  GLY n 
1 69  GLY n 
1 70  GLU n 
1 71  LEU n 
1 72  PHE n 
1 73  LEU n 
1 74  ARG n 
1 75  PHE n 
1 76  ILE n 
1 77  SER n 
1 78  LEU n 
1 79  ALA n 
1 80  SER n 
1 81  LEU n 
1 82  GLU n 
1 83  TYR n 
1 84  SER n 
1 85  ASP n 
1 86  TYR n 
1 87  SER n 
1 88  LYS n 
1 89  CYS n 
1 90  LYS n 
1 91  LYS n 
1 92  ILE n 
1 93  MSE n 
1 94  ILE n 
1 95  GLU n 
1 96  ARG n 
1 97  GLY n 
1 98  GLU n 
1 99  LEU n 
1 100 PHE n 
1 101 LEU n 
1 102 ARG n 
1 103 ARG n 
1 104 ILE n 
1 105 SER n 
1 106 LEU n 
1 107 SER n 
1 108 ARG n 
1 109 ASN n 
1 110 LYS n 
1 111 ILE n 
1 112 ALA n 
1 113 ASP n 
1 114 LEU n 
1 115 CYS n 
1 116 HIS n 
1 117 THR n 
1 118 PHE n 
1 119 ILE n 
1 120 LYS n 
1 121 ASP n 
1 122 GLY n 
1 123 ALA n 
1 124 THR n 
1 125 ILE n 
1 126 LEU n 
1 127 THR n 
1 128 HIS n 
1 129 ALA n 
1 130 TYR n 
1 131 SER n 
1 132 ARG n 
1 133 VAL n 
1 134 VAL n 
1 135 LEU n 
1 136 ARG n 
1 137 VAL n 
1 138 LEU n 
1 139 GLU n 
1 140 ALA n 
1 141 ALA n 
1 142 VAL n 
1 143 ALA n 
1 144 ALA n 
1 145 LYS n 
1 146 LYS n 
1 147 ARG n 
1 148 PHE n 
1 149 SER n 
1 150 VAL n 
1 151 TYR n 
1 152 VAL n 
1 153 THR n 
1 154 GLU n 
1 155 SER n 
1 156 GLN n 
1 157 PRO n 
1 158 ASP n 
1 159 LEU n 
1 160 SER n 
1 161 GLY n 
1 162 LYS n 
1 163 LYS n 
1 164 MSE n 
1 165 ALA n 
1 166 LYS n 
1 167 ALA n 
1 168 LEU n 
1 169 CYS n 
1 170 HIS n 
1 171 LEU n 
1 172 ASN n 
1 173 VAL n 
1 174 PRO n 
1 175 VAL n 
1 176 THR n 
1 177 VAL n 
1 178 VAL n 
1 179 LEU n 
1 180 ASP n 
1 181 ALA n 
1 182 ALA n 
1 183 VAL n 
1 184 GLY n 
1 185 TYR n 
1 186 ILE n 
1 187 MSE n 
1 188 GLU n 
1 189 LYS n 
1 190 ALA n 
1 191 ASP n 
1 192 LEU n 
1 193 VAL n 
1 194 ILE n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 GLU n 
1 199 GLY n 
1 200 VAL n 
1 201 VAL n 
1 202 GLU n 
1 203 ASN n 
1 204 GLY n 
1 205 GLY n 
1 206 ILE n 
1 207 ILE n 
1 208 ASN n 
1 209 LYS n 
1 210 ILE n 
1 211 GLY n 
1 212 THR n 
1 213 ASN n 
1 214 GLN n 
1 215 MSE n 
1 216 ALA n 
1 217 VAL n 
1 218 CYS n 
1 219 ALA n 
1 220 LYS n 
1 221 ALA n 
1 222 GLN n 
1 223 ASN n 
1 224 LYS n 
1 225 PRO n 
1 226 PHE n 
1 227 TYR n 
1 228 VAL n 
1 229 VAL n 
1 230 ALA n 
1 231 GLU n 
1 232 SER n 
1 233 PHE n 
1 234 LYS n 
1 235 PHE n 
1 236 VAL n 
1 237 ARG n 
1 238 LEU n 
1 239 PHE n 
1 240 PRO n 
1 241 LEU n 
1 242 ASN n 
1 243 GLN n 
1 244 GLN n 
1 245 ASP n 
1 246 VAL n 
1 247 PRO n 
1 248 ASP n 
1 249 LYS n 
1 250 PHE n 
1 251 LYS n 
1 252 TYR n 
1 253 LYS n 
1 254 ALA n 
1 255 ASP n 
1 256 THR n 
1 257 LEU n 
1 258 LYS n 
1 259 VAL n 
1 260 ALA n 
1 261 GLN n 
1 262 THR n 
1 263 GLY n 
1 264 GLN n 
1 265 ASP n 
1 266 LEU n 
1 267 LYS n 
1 268 GLU n 
1 269 GLU n 
1 270 HIS n 
1 271 PRO n 
1 272 TRP n 
1 273 VAL n 
1 274 ASP n 
1 275 TYR n 
1 276 THR n 
1 277 ALA n 
1 278 PRO n 
1 279 SER n 
1 280 LEU n 
1 281 ILE n 
1 282 THR n 
1 283 LEU n 
1 284 LEU n 
1 285 PHE n 
1 286 THR n 
1 287 ASP n 
1 288 LEU n 
1 289 GLY n 
1 290 VAL n 
1 291 LEU n 
1 292 THR n 
1 293 PRO n 
1 294 SER n 
1 295 ALA n 
1 296 VAL n 
1 297 SER n 
1 298 ASP n 
1 299 GLU n 
1 300 LEU n 
1 301 ILE n 
1 302 LYS n 
1 303 LEU n 
1 304 TYR n 
1 305 LEU n 
1 306 ALA n 
1 307 ALA n 
1 308 ALA n 
1 309 GLU n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
1 313 HIS n 
1 314 HIS n 
1 315 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CodonPlus(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EI2BA_HUMAN 
_struct_ref.pdbx_db_accession          Q14232 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLAS
LEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLS
GKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ECS A 1 ? 305 ? Q14232 1 ? 305 ? 1 305 
2 1 3ECS B 1 ? 305 ? Q14232 1 ? 305 ? 1 305 
3 1 3ECS C 1 ? 305 ? Q14232 1 ? 305 ? 1 305 
4 1 3ECS D 1 ? 305 ? Q14232 1 ? 305 ? 1 305 
5 1 3ECS E 1 ? 305 ? Q14232 1 ? 305 ? 1 305 
6 1 3ECS F 1 ? 305 ? Q14232 1 ? 305 ? 1 305 
7 1 3ECS G 1 ? 305 ? Q14232 1 ? 305 ? 1 305 
8 1 3ECS H 1 ? 305 ? Q14232 1 ? 305 ? 1 305 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ECS ALA A 306 ? UNP Q14232 ? ? 'EXPRESSION TAG' 306 1  
1 3ECS ALA A 307 ? UNP Q14232 ? ? 'EXPRESSION TAG' 307 2  
1 3ECS ALA A 308 ? UNP Q14232 ? ? 'EXPRESSION TAG' 308 3  
1 3ECS GLU A 309 ? UNP Q14232 ? ? 'EXPRESSION TAG' 309 4  
1 3ECS HIS A 310 ? UNP Q14232 ? ? 'EXPRESSION TAG' 310 5  
1 3ECS HIS A 311 ? UNP Q14232 ? ? 'EXPRESSION TAG' 311 6  
1 3ECS HIS A 312 ? UNP Q14232 ? ? 'EXPRESSION TAG' 312 7  
1 3ECS HIS A 313 ? UNP Q14232 ? ? 'EXPRESSION TAG' 313 8  
1 3ECS HIS A 314 ? UNP Q14232 ? ? 'EXPRESSION TAG' 314 9  
1 3ECS HIS A 315 ? UNP Q14232 ? ? 'EXPRESSION TAG' 315 10 
2 3ECS ALA B 306 ? UNP Q14232 ? ? 'EXPRESSION TAG' 306 11 
2 3ECS ALA B 307 ? UNP Q14232 ? ? 'EXPRESSION TAG' 307 12 
2 3ECS ALA B 308 ? UNP Q14232 ? ? 'EXPRESSION TAG' 308 13 
2 3ECS GLU B 309 ? UNP Q14232 ? ? 'EXPRESSION TAG' 309 14 
2 3ECS HIS B 310 ? UNP Q14232 ? ? 'EXPRESSION TAG' 310 15 
2 3ECS HIS B 311 ? UNP Q14232 ? ? 'EXPRESSION TAG' 311 16 
2 3ECS HIS B 312 ? UNP Q14232 ? ? 'EXPRESSION TAG' 312 17 
2 3ECS HIS B 313 ? UNP Q14232 ? ? 'EXPRESSION TAG' 313 18 
2 3ECS HIS B 314 ? UNP Q14232 ? ? 'EXPRESSION TAG' 314 19 
2 3ECS HIS B 315 ? UNP Q14232 ? ? 'EXPRESSION TAG' 315 20 
3 3ECS ALA C 306 ? UNP Q14232 ? ? 'EXPRESSION TAG' 306 21 
3 3ECS ALA C 307 ? UNP Q14232 ? ? 'EXPRESSION TAG' 307 22 
3 3ECS ALA C 308 ? UNP Q14232 ? ? 'EXPRESSION TAG' 308 23 
3 3ECS GLU C 309 ? UNP Q14232 ? ? 'EXPRESSION TAG' 309 24 
3 3ECS HIS C 310 ? UNP Q14232 ? ? 'EXPRESSION TAG' 310 25 
3 3ECS HIS C 311 ? UNP Q14232 ? ? 'EXPRESSION TAG' 311 26 
3 3ECS HIS C 312 ? UNP Q14232 ? ? 'EXPRESSION TAG' 312 27 
3 3ECS HIS C 313 ? UNP Q14232 ? ? 'EXPRESSION TAG' 313 28 
3 3ECS HIS C 314 ? UNP Q14232 ? ? 'EXPRESSION TAG' 314 29 
3 3ECS HIS C 315 ? UNP Q14232 ? ? 'EXPRESSION TAG' 315 30 
4 3ECS ALA D 306 ? UNP Q14232 ? ? 'EXPRESSION TAG' 306 31 
4 3ECS ALA D 307 ? UNP Q14232 ? ? 'EXPRESSION TAG' 307 32 
4 3ECS ALA D 308 ? UNP Q14232 ? ? 'EXPRESSION TAG' 308 33 
4 3ECS GLU D 309 ? UNP Q14232 ? ? 'EXPRESSION TAG' 309 34 
4 3ECS HIS D 310 ? UNP Q14232 ? ? 'EXPRESSION TAG' 310 35 
4 3ECS HIS D 311 ? UNP Q14232 ? ? 'EXPRESSION TAG' 311 36 
4 3ECS HIS D 312 ? UNP Q14232 ? ? 'EXPRESSION TAG' 312 37 
4 3ECS HIS D 313 ? UNP Q14232 ? ? 'EXPRESSION TAG' 313 38 
4 3ECS HIS D 314 ? UNP Q14232 ? ? 'EXPRESSION TAG' 314 39 
4 3ECS HIS D 315 ? UNP Q14232 ? ? 'EXPRESSION TAG' 315 40 
5 3ECS ALA E 306 ? UNP Q14232 ? ? 'EXPRESSION TAG' 306 41 
5 3ECS ALA E 307 ? UNP Q14232 ? ? 'EXPRESSION TAG' 307 42 
5 3ECS ALA E 308 ? UNP Q14232 ? ? 'EXPRESSION TAG' 308 43 
5 3ECS GLU E 309 ? UNP Q14232 ? ? 'EXPRESSION TAG' 309 44 
5 3ECS HIS E 310 ? UNP Q14232 ? ? 'EXPRESSION TAG' 310 45 
5 3ECS HIS E 311 ? UNP Q14232 ? ? 'EXPRESSION TAG' 311 46 
5 3ECS HIS E 312 ? UNP Q14232 ? ? 'EXPRESSION TAG' 312 47 
5 3ECS HIS E 313 ? UNP Q14232 ? ? 'EXPRESSION TAG' 313 48 
5 3ECS HIS E 314 ? UNP Q14232 ? ? 'EXPRESSION TAG' 314 49 
5 3ECS HIS E 315 ? UNP Q14232 ? ? 'EXPRESSION TAG' 315 50 
6 3ECS ALA F 306 ? UNP Q14232 ? ? 'EXPRESSION TAG' 306 51 
6 3ECS ALA F 307 ? UNP Q14232 ? ? 'EXPRESSION TAG' 307 52 
6 3ECS ALA F 308 ? UNP Q14232 ? ? 'EXPRESSION TAG' 308 53 
6 3ECS GLU F 309 ? UNP Q14232 ? ? 'EXPRESSION TAG' 309 54 
6 3ECS HIS F 310 ? UNP Q14232 ? ? 'EXPRESSION TAG' 310 55 
6 3ECS HIS F 311 ? UNP Q14232 ? ? 'EXPRESSION TAG' 311 56 
6 3ECS HIS F 312 ? UNP Q14232 ? ? 'EXPRESSION TAG' 312 57 
6 3ECS HIS F 313 ? UNP Q14232 ? ? 'EXPRESSION TAG' 313 58 
6 3ECS HIS F 314 ? UNP Q14232 ? ? 'EXPRESSION TAG' 314 59 
6 3ECS HIS F 315 ? UNP Q14232 ? ? 'EXPRESSION TAG' 315 60 
7 3ECS ALA G 306 ? UNP Q14232 ? ? 'EXPRESSION TAG' 306 61 
7 3ECS ALA G 307 ? UNP Q14232 ? ? 'EXPRESSION TAG' 307 62 
7 3ECS ALA G 308 ? UNP Q14232 ? ? 'EXPRESSION TAG' 308 63 
7 3ECS GLU G 309 ? UNP Q14232 ? ? 'EXPRESSION TAG' 309 64 
7 3ECS HIS G 310 ? UNP Q14232 ? ? 'EXPRESSION TAG' 310 65 
7 3ECS HIS G 311 ? UNP Q14232 ? ? 'EXPRESSION TAG' 311 66 
7 3ECS HIS G 312 ? UNP Q14232 ? ? 'EXPRESSION TAG' 312 67 
7 3ECS HIS G 313 ? UNP Q14232 ? ? 'EXPRESSION TAG' 313 68 
7 3ECS HIS G 314 ? UNP Q14232 ? ? 'EXPRESSION TAG' 314 69 
7 3ECS HIS G 315 ? UNP Q14232 ? ? 'EXPRESSION TAG' 315 70 
8 3ECS ALA H 306 ? UNP Q14232 ? ? 'EXPRESSION TAG' 306 71 
8 3ECS ALA H 307 ? UNP Q14232 ? ? 'EXPRESSION TAG' 307 72 
8 3ECS ALA H 308 ? UNP Q14232 ? ? 'EXPRESSION TAG' 308 73 
8 3ECS GLU H 309 ? UNP Q14232 ? ? 'EXPRESSION TAG' 309 74 
8 3ECS HIS H 310 ? UNP Q14232 ? ? 'EXPRESSION TAG' 310 75 
8 3ECS HIS H 311 ? UNP Q14232 ? ? 'EXPRESSION TAG' 311 76 
8 3ECS HIS H 312 ? UNP Q14232 ? ? 'EXPRESSION TAG' 312 77 
8 3ECS HIS H 313 ? UNP Q14232 ? ? 'EXPRESSION TAG' 313 78 
8 3ECS HIS H 314 ? UNP Q14232 ? ? 'EXPRESSION TAG' 314 79 
8 3ECS HIS H 315 ? UNP Q14232 ? ? 'EXPRESSION TAG' 315 80 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'   ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'    ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3ECS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.71 
_exptl_crystal.density_percent_sol   54.64 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    
;0.1M Sodium Citrate buffer(pH 4.5), 0.1M Ammonium Sulfate, 13% polyethylene glycol(PEG) 4000, VAPOR DIFFUSION, SITTING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-02-19 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3ECS 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.65 
_reflns.number_obs                   84588 
_reflns.number_all                   84757 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.181 
_reflns.pdbx_Rsym_value              0.181 
_reflns.pdbx_netI_over_sigmaI        16.7 
_reflns.B_iso_Wilson_estimate        39.0 
_reflns.pdbx_redundancy              13.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.70 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           0.806 
_reflns_shell.pdbx_Rsym_value        0.806 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        8.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4166 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3ECS 
_refine.ls_number_reflns_obs                     84095 
_refine.ls_number_reflns_all                     84757 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    99.2 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  4200 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.4 
_refine.aniso_B[1][1]                            5.11 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            5.78 
_refine.aniso_B[1][3]                            10.89 
_refine.aniso_B[2][3]                            -9.79 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3ECS 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.44 
_refine_analyze.Luzzati_sigma_a_free            0.48 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17722 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         51 
_refine_hist.number_atoms_solvent             185 
_refine_hist.number_atoms_total               17958 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.84  ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        4.13  ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       5.96  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.65 
_refine_ls_shell.d_res_low                        2.82 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.287 
_refine_ls_shell.percent_reflns_obs               98.1 
_refine_ls_shell.R_factor_R_free                  0.357 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             682 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                13120 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3ECS 
_struct.title                     'Crystal structure of human eIF2B alpha' 
_struct.pdbx_descriptor           'Translation initiation factor eIF-2B subunit alpha' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ECS 
_struct_keywords.pdbx_keywords   TRANSLATION 
_struct_keywords.text            
;eukaryotic translation initiation factor 2Balpha (eIF2Balpha), guanine nucleotide exchange factor (GEF), translation, initiation, stress response, Disease mutation, Initiation factor, Protein biosynthesis, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'AUTHOR STATES THAT THE BIOLOGICAL UNIT IS UNKNOWN.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASP A 2   ? ASP A 17  ? ASP A 2   ASP A 17  1 ? 16 
HELX_P HELX_P2   2   ALA A 21  ? LYS A 35  ? ALA A 21  LYS A 35  1 ? 15 
HELX_P HELX_P3   3   GLN A 43  ? THR A 55  ? GLN A 43  THR A 55  1 ? 13 
HELX_P HELX_P4   4   SER A 62  ? ILE A 76  ? SER A 62  ILE A 76  1 ? 15 
HELX_P HELX_P5   5   LYS A 91  ? SER A 105 ? LYS A 91  SER A 105 1 ? 15 
HELX_P HELX_P6   6   LEU A 106 ? HIS A 116 ? LEU A 106 HIS A 116 1 ? 11 
HELX_P HELX_P7   7   THR A 117 ? ILE A 119 ? THR A 117 ILE A 119 5 ? 3  
HELX_P HELX_P8   8   SER A 131 ? ALA A 143 ? SER A 131 ALA A 143 1 ? 13 
HELX_P HELX_P9   9   LEU A 159 ? HIS A 170 ? LEU A 159 HIS A 170 1 ? 12 
HELX_P HELX_P10  10  LEU A 179 ? ALA A 181 ? LEU A 179 ALA A 181 5 ? 3  
HELX_P HELX_P11  11  ALA A 182 ? MSE A 187 ? ALA A 182 MSE A 187 1 ? 6  
HELX_P HELX_P12  12  GLU A 188 ? ALA A 190 ? GLU A 188 ALA A 190 5 ? 3  
HELX_P HELX_P13  13  GLY A 211 ? GLN A 222 ? GLY A 211 GLN A 222 1 ? 12 
HELX_P HELX_P14  14  GLU A 231 ? PHE A 235 ? GLU A 231 PHE A 235 5 ? 5  
HELX_P HELX_P15  15  ASN A 242 ? VAL A 246 ? ASN A 242 VAL A 246 5 ? 5  
HELX_P HELX_P16  16  PRO A 247 ? LYS A 251 ? PRO A 247 LYS A 251 5 ? 5  
HELX_P HELX_P17  17  ALA A 277 ? ILE A 281 ? ALA A 277 ILE A 281 5 ? 5  
HELX_P HELX_P18  18  THR A 292 ? SER A 294 ? THR A 292 SER A 294 5 ? 3  
HELX_P HELX_P19  19  ALA A 295 ? LEU A 305 ? ALA A 295 LEU A 305 1 ? 11 
HELX_P HELX_P20  20  ASP B 2   ? GLU B 16  ? ASP B 2   GLU B 16  1 ? 15 
HELX_P HELX_P21  21  ALA B 21  ? ARG B 36  ? ALA B 21  ARG B 36  1 ? 16 
HELX_P HELX_P22  22  LEU B 45  ? VAL B 59  ? LEU B 45  VAL B 59  1 ? 15 
HELX_P HELX_P23  23  SER B 62  ? PHE B 75  ? SER B 62  PHE B 75  1 ? 14 
HELX_P HELX_P24  24  LYS B 91  ? ILE B 104 ? LYS B 91  ILE B 104 1 ? 14 
HELX_P HELX_P25  25  LEU B 106 ? HIS B 116 ? LEU B 106 HIS B 116 1 ? 11 
HELX_P HELX_P26  26  THR B 117 ? ILE B 119 ? THR B 117 ILE B 119 5 ? 3  
HELX_P HELX_P27  27  SER B 131 ? ALA B 143 ? SER B 131 ALA B 143 1 ? 13 
HELX_P HELX_P28  28  LEU B 159 ? LEU B 171 ? LEU B 159 LEU B 171 1 ? 13 
HELX_P HELX_P29  29  LEU B 179 ? ALA B 181 ? LEU B 179 ALA B 181 5 ? 3  
HELX_P HELX_P30  30  ALA B 182 ? GLU B 188 ? ALA B 182 GLU B 188 1 ? 7  
HELX_P HELX_P31  31  GLY B 211 ? GLN B 222 ? GLY B 211 GLN B 222 1 ? 12 
HELX_P HELX_P32  32  GLU B 231 ? PHE B 235 ? GLU B 231 PHE B 235 5 ? 5  
HELX_P HELX_P33  33  ASN B 242 ? VAL B 246 ? ASN B 242 VAL B 246 5 ? 5  
HELX_P HELX_P34  34  PRO B 247 ? TYR B 252 ? PRO B 247 TYR B 252 1 ? 6  
HELX_P HELX_P35  35  ALA B 277 ? ILE B 281 ? ALA B 277 ILE B 281 5 ? 5  
HELX_P HELX_P36  36  THR B 292 ? SER B 294 ? THR B 292 SER B 294 5 ? 3  
HELX_P HELX_P37  37  ALA B 295 ? ALA B 306 ? ALA B 295 ALA B 306 1 ? 12 
HELX_P HELX_P38  38  ASP C 2   ? ASP C 17  ? ASP C 2   ASP C 17  1 ? 16 
HELX_P HELX_P39  39  ALA C 21  ? ASP C 37  ? ALA C 21  ASP C 37  1 ? 17 
HELX_P HELX_P40  40  LYS C 38  ? GLU C 40  ? LYS C 38  GLU C 40  5 ? 3  
HELX_P HELX_P41  41  GLN C 43  ? ASN C 48  ? GLN C 43  ASN C 48  1 ? 6  
HELX_P HELX_P42  42  ASN C 48  ? VAL C 59  ? ASN C 48  VAL C 59  1 ? 12 
HELX_P HELX_P43  43  SER C 62  ? SER C 77  ? SER C 62  SER C 77  1 ? 16 
HELX_P HELX_P44  44  SER C 87  ? LYS C 91  ? SER C 87  LYS C 91  5 ? 5  
HELX_P HELX_P45  45  ILE C 92  ? ILE C 104 ? ILE C 92  ILE C 104 1 ? 13 
HELX_P HELX_P46  46  LEU C 106 ? LEU C 114 ? LEU C 106 LEU C 114 1 ? 9  
HELX_P HELX_P47  47  CYS C 115 ? ILE C 119 ? CYS C 115 ILE C 119 5 ? 5  
HELX_P HELX_P48  48  SER C 131 ? ALA C 143 ? SER C 131 ALA C 143 1 ? 13 
HELX_P HELX_P49  49  LEU C 159 ? HIS C 170 ? LEU C 159 HIS C 170 1 ? 12 
HELX_P HELX_P50  50  LEU C 179 ? ALA C 181 ? LEU C 179 ALA C 181 5 ? 3  
HELX_P HELX_P51  51  ALA C 182 ? MSE C 187 ? ALA C 182 MSE C 187 1 ? 6  
HELX_P HELX_P52  52  GLU C 188 ? ALA C 190 ? GLU C 188 ALA C 190 5 ? 3  
HELX_P HELX_P53  53  GLY C 211 ? GLN C 222 ? GLY C 211 GLN C 222 1 ? 12 
HELX_P HELX_P54  54  GLU C 231 ? PHE C 235 ? GLU C 231 PHE C 235 5 ? 5  
HELX_P HELX_P55  55  ASN C 242 ? VAL C 246 ? ASN C 242 VAL C 246 5 ? 5  
HELX_P HELX_P56  56  PRO C 247 ? TYR C 252 ? PRO C 247 TYR C 252 1 ? 6  
HELX_P HELX_P57  57  ALA C 277 ? ILE C 281 ? ALA C 277 ILE C 281 5 ? 5  
HELX_P HELX_P58  58  THR C 292 ? SER C 294 ? THR C 292 SER C 294 5 ? 3  
HELX_P HELX_P59  59  ALA C 295 ? TYR C 304 ? ALA C 295 TYR C 304 1 ? 10 
HELX_P HELX_P60  60  ASP D 2   ? ASP D 17  ? ASP D 2   ASP D 17  1 ? 16 
HELX_P HELX_P61  61  ALA D 21  ? ASP D 37  ? ALA D 21  ASP D 37  1 ? 17 
HELX_P HELX_P62  62  ILE D 42  ? THR D 50  ? ILE D 42  THR D 50  1 ? 9  
HELX_P HELX_P63  63  SER D 62  ? SER D 77  ? SER D 62  SER D 77  1 ? 16 
HELX_P HELX_P64  64  ILE D 92  ? THR D 117 ? ILE D 92  THR D 117 1 ? 26 
HELX_P HELX_P65  65  SER D 131 ? ALA D 144 ? SER D 131 ALA D 144 1 ? 14 
HELX_P HELX_P66  66  LEU D 159 ? HIS D 170 ? LEU D 159 HIS D 170 1 ? 12 
HELX_P HELX_P67  67  ALA D 182 ? MSE D 187 ? ALA D 182 MSE D 187 1 ? 6  
HELX_P HELX_P68  68  GLU D 188 ? ALA D 190 ? GLU D 188 ALA D 190 5 ? 3  
HELX_P HELX_P69  69  GLY D 211 ? GLN D 222 ? GLY D 211 GLN D 222 1 ? 12 
HELX_P HELX_P70  70  GLU D 231 ? PHE D 235 ? GLU D 231 PHE D 235 5 ? 5  
HELX_P HELX_P71  71  ASN D 242 ? VAL D 246 ? ASN D 242 VAL D 246 5 ? 5  
HELX_P HELX_P72  72  PRO D 247 ? TYR D 252 ? PRO D 247 TYR D 252 1 ? 6  
HELX_P HELX_P73  73  ALA D 277 ? ILE D 281 ? ALA D 277 ILE D 281 5 ? 5  
HELX_P HELX_P74  74  THR D 292 ? SER D 294 ? THR D 292 SER D 294 5 ? 3  
HELX_P HELX_P75  75  ALA D 295 ? ALA D 306 ? ALA D 295 ALA D 306 1 ? 12 
HELX_P HELX_P76  76  ASP E 2   ? ASP E 17  ? ASP E 2   ASP E 17  1 ? 16 
HELX_P HELX_P77  77  ALA E 21  ? ARG E 36  ? ALA E 21  ARG E 36  1 ? 16 
HELX_P HELX_P78  78  ILE E 42  ? THR E 50  ? ILE E 42  THR E 50  1 ? 9  
HELX_P HELX_P79  79  SER E 62  ? ILE E 76  ? SER E 62  ILE E 76  1 ? 15 
HELX_P HELX_P80  80  LYS E 91  ? ILE E 104 ? LYS E 91  ILE E 104 1 ? 14 
HELX_P HELX_P81  81  LEU E 106 ? CYS E 115 ? LEU E 106 CYS E 115 1 ? 10 
HELX_P HELX_P82  82  SER E 131 ? ALA E 143 ? SER E 131 ALA E 143 1 ? 13 
HELX_P HELX_P83  83  LEU E 159 ? HIS E 170 ? LEU E 159 HIS E 170 1 ? 12 
HELX_P HELX_P84  84  LEU E 179 ? ALA E 181 ? LEU E 179 ALA E 181 5 ? 3  
HELX_P HELX_P85  85  ALA E 182 ? MSE E 187 ? ALA E 182 MSE E 187 1 ? 6  
HELX_P HELX_P86  86  GLU E 188 ? ALA E 190 ? GLU E 188 ALA E 190 5 ? 3  
HELX_P HELX_P87  87  GLY E 211 ? GLN E 222 ? GLY E 211 GLN E 222 1 ? 12 
HELX_P HELX_P88  88  GLU E 231 ? PHE E 235 ? GLU E 231 PHE E 235 5 ? 5  
HELX_P HELX_P89  89  ASN E 242 ? VAL E 246 ? ASN E 242 VAL E 246 5 ? 5  
HELX_P HELX_P90  90  PRO E 247 ? TYR E 252 ? PRO E 247 TYR E 252 1 ? 6  
HELX_P HELX_P91  91  ALA E 277 ? ILE E 281 ? ALA E 277 ILE E 281 5 ? 5  
HELX_P HELX_P92  92  THR E 292 ? SER E 294 ? THR E 292 SER E 294 5 ? 3  
HELX_P HELX_P93  93  ALA E 295 ? LEU E 305 ? ALA E 295 LEU E 305 1 ? 11 
HELX_P HELX_P94  94  ASP F 2   ? GLU F 16  ? ASP F 2   GLU F 16  1 ? 15 
HELX_P HELX_P95  95  ALA F 21  ? ARG F 36  ? ALA F 21  ARG F 36  1 ? 16 
HELX_P HELX_P96  96  ILE F 42  ? GLY F 58  ? ILE F 42  GLY F 58  1 ? 17 
HELX_P HELX_P97  97  SER F 62  ? PHE F 75  ? SER F 62  PHE F 75  1 ? 14 
HELX_P HELX_P98  98  ILE F 92  ? HIS F 116 ? ILE F 92  HIS F 116 1 ? 25 
HELX_P HELX_P99  99  THR F 117 ? ILE F 119 ? THR F 117 ILE F 119 5 ? 3  
HELX_P HELX_P100 100 SER F 131 ? ALA F 144 ? SER F 131 ALA F 144 1 ? 14 
HELX_P HELX_P101 101 LEU F 159 ? HIS F 170 ? LEU F 159 HIS F 170 1 ? 12 
HELX_P HELX_P102 102 LEU F 179 ? ALA F 181 ? LEU F 179 ALA F 181 5 ? 3  
HELX_P HELX_P103 103 ALA F 182 ? MSE F 187 ? ALA F 182 MSE F 187 1 ? 6  
HELX_P HELX_P104 104 GLU F 188 ? ALA F 190 ? GLU F 188 ALA F 190 5 ? 3  
HELX_P HELX_P105 105 GLY F 211 ? GLN F 222 ? GLY F 211 GLN F 222 1 ? 12 
HELX_P HELX_P106 106 GLU F 231 ? PHE F 233 ? GLU F 231 PHE F 233 5 ? 3  
HELX_P HELX_P107 107 ASN F 242 ? VAL F 246 ? ASN F 242 VAL F 246 5 ? 5  
HELX_P HELX_P108 108 ALA F 277 ? ILE F 281 ? ALA F 277 ILE F 281 5 ? 5  
HELX_P HELX_P109 109 THR F 292 ? SER F 294 ? THR F 292 SER F 294 5 ? 3  
HELX_P HELX_P110 110 ALA F 295 ? LEU F 305 ? ALA F 295 LEU F 305 1 ? 11 
HELX_P HELX_P111 111 ASP G 2   ? LYS G 15  ? ASP G 2   LYS G 15  1 ? 14 
HELX_P HELX_P112 112 ALA G 21  ? ASP G 37  ? ALA G 21  ASP G 37  1 ? 17 
HELX_P HELX_P113 113 GLN G 43  ? ALA G 52  ? GLN G 43  ALA G 52  1 ? 10 
HELX_P HELX_P114 114 THR G 55  ? ASP G 60  ? THR G 55  ASP G 60  5 ? 6  
HELX_P HELX_P115 115 SER G 62  ? PHE G 75  ? SER G 62  PHE G 75  1 ? 14 
HELX_P HELX_P116 116 ILE G 92  ? ILE G 104 ? ILE G 92  ILE G 104 1 ? 13 
HELX_P HELX_P117 117 LEU G 106 ? HIS G 116 ? LEU G 106 HIS G 116 1 ? 11 
HELX_P HELX_P118 118 SER G 131 ? ALA G 143 ? SER G 131 ALA G 143 1 ? 13 
HELX_P HELX_P119 119 LEU G 159 ? HIS G 170 ? LEU G 159 HIS G 170 1 ? 12 
HELX_P HELX_P120 120 LEU G 179 ? ALA G 181 ? LEU G 179 ALA G 181 5 ? 3  
HELX_P HELX_P121 121 ALA G 182 ? MSE G 187 ? ALA G 182 MSE G 187 1 ? 6  
HELX_P HELX_P122 122 GLU G 188 ? ALA G 190 ? GLU G 188 ALA G 190 5 ? 3  
HELX_P HELX_P123 123 GLY G 211 ? GLN G 222 ? GLY G 211 GLN G 222 1 ? 12 
HELX_P HELX_P124 124 GLU G 231 ? PHE G 235 ? GLU G 231 PHE G 235 5 ? 5  
HELX_P HELX_P125 125 ASN G 242 ? VAL G 246 ? ASN G 242 VAL G 246 5 ? 5  
HELX_P HELX_P126 126 PRO G 247 ? TYR G 252 ? PRO G 247 TYR G 252 1 ? 6  
HELX_P HELX_P127 127 ALA G 277 ? ILE G 281 ? ALA G 277 ILE G 281 5 ? 5  
HELX_P HELX_P128 128 THR G 292 ? SER G 294 ? THR G 292 SER G 294 5 ? 3  
HELX_P HELX_P129 129 ALA G 295 ? LEU G 305 ? ALA G 295 LEU G 305 1 ? 11 
HELX_P HELX_P130 130 ASP H 2   ? GLU H 16  ? ASP H 2   GLU H 16  1 ? 15 
HELX_P HELX_P131 131 ALA H 21  ? ASP H 37  ? ALA H 21  ASP H 37  1 ? 17 
HELX_P HELX_P132 132 LEU H 45  ? THR H 50  ? LEU H 45  THR H 50  1 ? 6  
HELX_P HELX_P133 133 SER H 62  ? ILE H 76  ? SER H 62  ILE H 76  1 ? 15 
HELX_P HELX_P134 134 SER H 87  ? LYS H 91  ? SER H 87  LYS H 91  5 ? 5  
HELX_P HELX_P135 135 ILE H 92  ? ILE H 104 ? ILE H 92  ILE H 104 1 ? 13 
HELX_P HELX_P136 136 LEU H 106 ? LEU H 114 ? LEU H 106 LEU H 114 1 ? 9  
HELX_P HELX_P137 137 CYS H 115 ? ILE H 119 ? CYS H 115 ILE H 119 5 ? 5  
HELX_P HELX_P138 138 SER H 131 ? ALA H 144 ? SER H 131 ALA H 144 1 ? 14 
HELX_P HELX_P139 139 LEU H 159 ? HIS H 170 ? LEU H 159 HIS H 170 1 ? 12 
HELX_P HELX_P140 140 LEU H 179 ? ALA H 181 ? LEU H 179 ALA H 181 5 ? 3  
HELX_P HELX_P141 141 ALA H 182 ? MSE H 187 ? ALA H 182 MSE H 187 1 ? 6  
HELX_P HELX_P142 142 GLU H 188 ? ALA H 190 ? GLU H 188 ALA H 190 5 ? 3  
HELX_P HELX_P143 143 GLY H 211 ? GLN H 222 ? GLY H 211 GLN H 222 1 ? 12 
HELX_P HELX_P144 144 GLU H 231 ? PHE H 235 ? GLU H 231 PHE H 235 5 ? 5  
HELX_P HELX_P145 145 ASN H 242 ? VAL H 246 ? ASN H 242 VAL H 246 5 ? 5  
HELX_P HELX_P146 146 PRO H 247 ? TYR H 252 ? PRO H 247 TYR H 252 1 ? 6  
HELX_P HELX_P147 147 ALA H 277 ? ILE H 281 ? ALA H 277 ILE H 281 5 ? 5  
HELX_P HELX_P148 148 THR H 292 ? SER H 294 ? THR H 292 SER H 294 5 ? 3  
HELX_P HELX_P149 149 ALA H 295 ? LEU H 305 ? ALA H 295 LEU H 305 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale ? ? A MSE 1   C ? ? ? 1_555 A ASP 2   N ? ? A MSE 1   A ASP 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2   covale ? ? A GLN 13  C ? ? ? 1_555 A MSE 14  N ? ? A GLN 13  A MSE 14  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale3   covale ? ? A MSE 14  C ? ? ? 1_555 A LYS 15  N ? ? A MSE 14  A LYS 15  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4   covale ? ? A ASP 19  C ? ? ? 1_555 A MSE 20  N ? ? A ASP 19  A MSE 20  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale5   covale ? ? A MSE 20  C ? ? ? 1_555 A ALA 21  N ? ? A MSE 20  A ALA 21  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale6   covale ? ? A ILE 92  C ? ? ? 1_555 A MSE 93  N ? ? A ILE 92  A MSE 93  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7   covale ? ? A MSE 93  C ? ? ? 1_555 A ILE 94  N ? ? A MSE 93  A ILE 94  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale8   covale ? ? A LYS 163 C ? ? ? 1_555 A MSE 164 N ? ? A LYS 163 A MSE 164 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale9   covale ? ? A MSE 164 C ? ? ? 1_555 A ALA 165 N ? ? A MSE 164 A ALA 165 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale10  covale ? ? A ILE 186 C ? ? ? 1_555 A MSE 187 N ? ? A ILE 186 A MSE 187 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale11  covale ? ? A MSE 187 C ? ? ? 1_555 A GLU 188 N ? ? A MSE 187 A GLU 188 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale12  covale ? ? A GLN 214 C ? ? ? 1_555 A MSE 215 N ? ? A GLN 214 A MSE 215 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale13  covale ? ? A MSE 215 C ? ? ? 1_555 A ALA 216 N ? ? A MSE 215 A ALA 216 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale14  covale ? ? B MSE 1   C ? ? ? 1_555 B ASP 2   N ? ? B MSE 1   B ASP 2   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale15  covale ? ? B GLN 13  C ? ? ? 1_555 B MSE 14  N ? ? B GLN 13  B MSE 14  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale16  covale ? ? B MSE 14  C ? ? ? 1_555 B LYS 15  N ? ? B MSE 14  B LYS 15  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale17  covale ? ? B ASP 19  C ? ? ? 1_555 B MSE 20  N ? ? B ASP 19  B MSE 20  1_555 ? ? ? ? ? ? ? 1.323 ? 
covale18  covale ? ? B MSE 20  C ? ? ? 1_555 B ALA 21  N ? ? B MSE 20  B ALA 21  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale19  covale ? ? B ILE 92  C ? ? ? 1_555 B MSE 93  N ? ? B ILE 92  B MSE 93  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale20  covale ? ? B MSE 93  C ? ? ? 1_555 B ILE 94  N ? ? B MSE 93  B ILE 94  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale21  covale ? ? B LYS 163 C ? ? ? 1_555 B MSE 164 N ? ? B LYS 163 B MSE 164 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale22  covale ? ? B MSE 164 C ? ? ? 1_555 B ALA 165 N ? ? B MSE 164 B ALA 165 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale23  covale ? ? B ILE 186 C ? ? ? 1_555 B MSE 187 N ? ? B ILE 186 B MSE 187 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale24  covale ? ? B MSE 187 C ? ? ? 1_555 B GLU 188 N ? ? B MSE 187 B GLU 188 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale25  covale ? ? B GLN 214 C ? ? ? 1_555 B MSE 215 N ? ? B GLN 214 B MSE 215 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale26  covale ? ? B MSE 215 C ? ? ? 1_555 B ALA 216 N ? ? B MSE 215 B ALA 216 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale27  covale ? ? C MSE 1   C ? ? ? 1_555 C ASP 2   N ? ? C MSE 1   C ASP 2   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale28  covale ? ? C GLN 13  C ? ? ? 1_555 C MSE 14  N ? ? C GLN 13  C MSE 14  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale29  covale ? ? C MSE 14  C ? ? ? 1_555 C LYS 15  N ? ? C MSE 14  C LYS 15  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale30  covale ? ? C ASP 19  C ? ? ? 1_555 C MSE 20  N ? ? C ASP 19  C MSE 20  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale31  covale ? ? C MSE 20  C ? ? ? 1_555 C ALA 21  N ? ? C MSE 20  C ALA 21  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale32  covale ? ? C ILE 92  C ? ? ? 1_555 C MSE 93  N ? ? C ILE 92  C MSE 93  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale33  covale ? ? C MSE 93  C ? ? ? 1_555 C ILE 94  N ? ? C MSE 93  C ILE 94  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale34  covale ? ? C LYS 163 C ? ? ? 1_555 C MSE 164 N ? ? C LYS 163 C MSE 164 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale35  covale ? ? C MSE 164 C ? ? ? 1_555 C ALA 165 N ? ? C MSE 164 C ALA 165 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale36  covale ? ? C ILE 186 C ? ? ? 1_555 C MSE 187 N ? ? C ILE 186 C MSE 187 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale37  covale ? ? C MSE 187 C ? ? ? 1_555 C GLU 188 N ? ? C MSE 187 C GLU 188 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale38  covale ? ? C GLN 214 C ? ? ? 1_555 C MSE 215 N ? ? C GLN 214 C MSE 215 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale39  covale ? ? C MSE 215 C ? ? ? 1_555 C ALA 216 N ? ? C MSE 215 C ALA 216 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale40  covale ? ? D MSE 1   C ? ? ? 1_555 D ASP 2   N ? ? D MSE 1   D ASP 2   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale41  covale ? ? D GLN 13  C ? ? ? 1_555 D MSE 14  N ? ? D GLN 13  D MSE 14  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale42  covale ? ? D MSE 14  C ? ? ? 1_555 D LYS 15  N ? ? D MSE 14  D LYS 15  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale43  covale ? ? D ASP 19  C ? ? ? 1_555 D MSE 20  N ? ? D ASP 19  D MSE 20  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale44  covale ? ? D MSE 20  C ? ? ? 1_555 D ALA 21  N ? ? D MSE 20  D ALA 21  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale45  covale ? ? D ILE 92  C ? ? ? 1_555 D MSE 93  N ? ? D ILE 92  D MSE 93  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale46  covale ? ? D MSE 93  C ? ? ? 1_555 D ILE 94  N ? ? D MSE 93  D ILE 94  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale47  covale ? ? D LYS 163 C ? ? ? 1_555 D MSE 164 N ? ? D LYS 163 D MSE 164 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale48  covale ? ? D MSE 164 C ? ? ? 1_555 D ALA 165 N ? ? D MSE 164 D ALA 165 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale49  covale ? ? D ILE 186 C ? ? ? 1_555 D MSE 187 N ? ? D ILE 186 D MSE 187 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale50  covale ? ? D MSE 187 C ? ? ? 1_555 D GLU 188 N ? ? D MSE 187 D GLU 188 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale51  covale ? ? D GLN 214 C ? ? ? 1_555 D MSE 215 N ? ? D GLN 214 D MSE 215 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale52  covale ? ? D MSE 215 C ? ? ? 1_555 D ALA 216 N ? ? D MSE 215 D ALA 216 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale53  covale ? ? E MSE 1   C ? ? ? 1_555 E ASP 2   N ? ? E MSE 1   E ASP 2   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale54  covale ? ? E GLN 13  C ? ? ? 1_555 E MSE 14  N ? ? E GLN 13  E MSE 14  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale55  covale ? ? E MSE 14  C ? ? ? 1_555 E LYS 15  N ? ? E MSE 14  E LYS 15  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale56  covale ? ? E ASP 19  C ? ? ? 1_555 E MSE 20  N ? ? E ASP 19  E MSE 20  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale57  covale ? ? E MSE 20  C ? ? ? 1_555 E ALA 21  N ? ? E MSE 20  E ALA 21  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale58  covale ? ? E ILE 92  C ? ? ? 1_555 E MSE 93  N ? ? E ILE 92  E MSE 93  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale59  covale ? ? E MSE 93  C ? ? ? 1_555 E ILE 94  N ? ? E MSE 93  E ILE 94  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale60  covale ? ? E LYS 163 C ? ? ? 1_555 E MSE 164 N ? ? E LYS 163 E MSE 164 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale61  covale ? ? E MSE 164 C ? ? ? 1_555 E ALA 165 N ? ? E MSE 164 E ALA 165 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale62  covale ? ? E ILE 186 C ? ? ? 1_555 E MSE 187 N ? ? E ILE 186 E MSE 187 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale63  covale ? ? E MSE 187 C ? ? ? 1_555 E GLU 188 N ? ? E MSE 187 E GLU 188 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale64  covale ? ? E GLN 214 C ? ? ? 1_555 E MSE 215 N ? ? E GLN 214 E MSE 215 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale65  covale ? ? E MSE 215 C ? ? ? 1_555 E ALA 216 N ? ? E MSE 215 E ALA 216 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale66  covale ? ? F MSE 1   C ? ? ? 1_555 F ASP 2   N ? ? F MSE 1   F ASP 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale67  covale ? ? F GLN 13  C ? ? ? 1_555 F MSE 14  N ? ? F GLN 13  F MSE 14  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale68  covale ? ? F MSE 14  C ? ? ? 1_555 F LYS 15  N ? ? F MSE 14  F LYS 15  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale69  covale ? ? F ASP 19  C ? ? ? 1_555 F MSE 20  N ? ? F ASP 19  F MSE 20  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale70  covale ? ? F MSE 20  C ? ? ? 1_555 F ALA 21  N ? ? F MSE 20  F ALA 21  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale71  covale ? ? F ILE 92  C ? ? ? 1_555 F MSE 93  N ? ? F ILE 92  F MSE 93  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale72  covale ? ? F MSE 93  C ? ? ? 1_555 F ILE 94  N ? ? F MSE 93  F ILE 94  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale73  covale ? ? F LYS 163 C ? ? ? 1_555 F MSE 164 N ? ? F LYS 163 F MSE 164 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale74  covale ? ? F MSE 164 C ? ? ? 1_555 F ALA 165 N ? ? F MSE 164 F ALA 165 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale75  covale ? ? F ILE 186 C ? ? ? 1_555 F MSE 187 N ? ? F ILE 186 F MSE 187 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale76  covale ? ? F MSE 187 C ? ? ? 1_555 F GLU 188 N ? ? F MSE 187 F GLU 188 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale77  covale ? ? F GLN 214 C ? ? ? 1_555 F MSE 215 N ? ? F GLN 214 F MSE 215 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale78  covale ? ? F MSE 215 C ? ? ? 1_555 F ALA 216 N ? ? F MSE 215 F ALA 216 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale79  covale ? ? G MSE 1   C ? ? ? 1_555 G ASP 2   N ? ? G MSE 1   G ASP 2   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale80  covale ? ? G GLN 13  C ? ? ? 1_555 G MSE 14  N ? ? G GLN 13  G MSE 14  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale81  covale ? ? G MSE 14  C ? ? ? 1_555 G LYS 15  N ? ? G MSE 14  G LYS 15  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale82  covale ? ? G ASP 19  C ? ? ? 1_555 G MSE 20  N ? ? G ASP 19  G MSE 20  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale83  covale ? ? G MSE 20  C ? ? ? 1_555 G ALA 21  N ? ? G MSE 20  G ALA 21  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale84  covale ? ? G ILE 92  C ? ? ? 1_555 G MSE 93  N ? ? G ILE 92  G MSE 93  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale85  covale ? ? G MSE 93  C ? ? ? 1_555 G ILE 94  N ? ? G MSE 93  G ILE 94  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale86  covale ? ? G LYS 163 C ? ? ? 1_555 G MSE 164 N ? ? G LYS 163 G MSE 164 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale87  covale ? ? G MSE 164 C ? ? ? 1_555 G ALA 165 N ? ? G MSE 164 G ALA 165 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale88  covale ? ? G ILE 186 C ? ? ? 1_555 G MSE 187 N ? ? G ILE 186 G MSE 187 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale89  covale ? ? G MSE 187 C ? ? ? 1_555 G GLU 188 N ? ? G MSE 187 G GLU 188 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale90  covale ? ? G GLN 214 C ? ? ? 1_555 G MSE 215 N ? ? G GLN 214 G MSE 215 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale91  covale ? ? G MSE 215 C ? ? ? 1_555 G ALA 216 N ? ? G MSE 215 G ALA 216 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale92  covale ? ? H MSE 1   C ? ? ? 1_555 H ASP 2   N ? ? H MSE 1   H ASP 2   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale93  covale ? ? H GLN 13  C ? ? ? 1_555 H MSE 14  N ? ? H GLN 13  H MSE 14  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale94  covale ? ? H MSE 14  C ? ? ? 1_555 H LYS 15  N ? ? H MSE 14  H LYS 15  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale95  covale ? ? H ASP 19  C ? ? ? 1_555 H MSE 20  N ? ? H ASP 19  H MSE 20  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale96  covale ? ? H MSE 20  C ? ? ? 1_555 H ALA 21  N ? ? H MSE 20  H ALA 21  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale97  covale ? ? H ILE 92  C ? ? ? 1_555 H MSE 93  N ? ? H ILE 92  H MSE 93  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale98  covale ? ? H MSE 93  C ? ? ? 1_555 H ILE 94  N ? ? H MSE 93  H ILE 94  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale99  covale ? ? H LYS 163 C ? ? ? 1_555 H MSE 164 N ? ? H LYS 163 H MSE 164 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale100 covale ? ? H MSE 164 C ? ? ? 1_555 H ALA 165 N ? ? H MSE 164 H ALA 165 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale101 covale ? ? H ILE 186 C ? ? ? 1_555 H MSE 187 N ? ? H ILE 186 H MSE 187 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale102 covale ? ? H MSE 187 C ? ? ? 1_555 H GLU 188 N ? ? H MSE 187 H GLU 188 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale103 covale ? ? H GLN 214 C ? ? ? 1_555 H MSE 215 N ? ? H GLN 214 H MSE 215 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale104 covale ? ? H MSE 215 C ? ? ? 1_555 H ALA 216 N ? ? H MSE 215 H ALA 216 1_555 ? ? ? ? ? ? ? 1.325 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 156 A . ? GLN 156 A PRO 157 A ? PRO 157 A 1 -0.07 
2 GLN 156 B . ? GLN 156 B PRO 157 B ? PRO 157 B 1 -0.34 
3 GLN 156 C . ? GLN 156 C PRO 157 C ? PRO 157 C 1 0.14  
4 GLN 156 D . ? GLN 156 D PRO 157 D ? PRO 157 D 1 -0.06 
5 GLN 156 E . ? GLN 156 E PRO 157 E ? PRO 157 E 1 -0.01 
6 GLN 156 F . ? GLN 156 F PRO 157 F ? PRO 157 F 1 0.08  
7 GLN 156 G . ? GLN 156 G PRO 157 G ? PRO 157 G 1 0.10  
8 GLN 156 H . ? GLN 156 H PRO 157 H ? PRO 157 H 1 -0.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 3 ? 
C ? 7 ? 
D ? 3 ? 
E ? 8 ? 
F ? 7 ? 
G ? 3 ? 
H ? 8 ? 
I ? 3 ? 
J ? 8 ? 
K ? 3 ? 
L ? 8 ? 
M ? 4 ? 
N ? 8 ? 
O ? 3 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
E 7 8 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
H 6 7 ? parallel      
H 7 8 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? parallel      
J 7 8 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? parallel      
L 7 8 ? parallel      
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
N 4 5 ? parallel      
N 5 6 ? parallel      
N 6 7 ? parallel      
N 7 8 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 289 ? LEU A 291 ? GLY A 289 LEU A 291 
A 2 LEU A 283 ? THR A 286 ? LEU A 283 THR A 286 
A 3 PHE A 226 ? VAL A 229 ? PHE A 226 VAL A 229 
A 4 LEU A 192 ? GLY A 196 ? LEU A 192 GLY A 196 
A 5 ALA A 123 ? THR A 127 ? ALA A 123 THR A 127 
A 6 PHE A 148 ? THR A 153 ? PHE A 148 THR A 153 
A 7 VAL A 175 ? VAL A 178 ? VAL A 175 VAL A 178 
A 8 LEU C 266 ? GLU C 268 ? LEU C 266 GLU C 268 
B 1 GLY A 199 ? VAL A 200 ? GLY A 199 VAL A 200 
B 2 ILE A 206 ? LYS A 209 ? ILE A 206 LYS A 209 
B 3 VAL A 273 ? THR A 276 ? VAL A 273 THR A 276 
C 1 VAL B 175 ? VAL B 178 ? VAL B 175 VAL B 178 
C 2 SER B 149 ? THR B 153 ? SER B 149 THR B 153 
C 3 THR B 124 ? THR B 127 ? THR B 124 THR B 127 
C 4 LEU B 192 ? GLY B 196 ? LEU B 192 GLY B 196 
C 5 PHE B 226 ? VAL B 229 ? PHE B 226 VAL B 229 
C 6 LEU B 283 ? THR B 286 ? LEU B 283 THR B 286 
C 7 GLY B 289 ? LEU B 291 ? GLY B 289 LEU B 291 
D 1 GLY B 199 ? VAL B 200 ? GLY B 199 VAL B 200 
D 2 ILE B 206 ? LYS B 209 ? ILE B 206 LYS B 209 
D 3 VAL B 273 ? THR B 276 ? VAL B 273 THR B 276 
E 1 LYS B 267 ? GLU B 268 ? LYS B 267 GLU B 268 
E 2 VAL H 175 ? VAL H 178 ? VAL H 175 VAL H 178 
E 3 SER H 149 ? THR H 153 ? SER H 149 THR H 153 
E 4 THR H 124 ? HIS H 128 ? THR H 124 HIS H 128 
E 5 LEU H 192 ? GLY H 196 ? LEU H 192 GLY H 196 
E 6 PHE H 226 ? VAL H 229 ? PHE H 226 VAL H 229 
E 7 LEU H 283 ? THR H 286 ? LEU H 283 THR H 286 
E 8 GLY H 289 ? LEU H 291 ? GLY H 289 LEU H 291 
F 1 VAL C 175 ? VAL C 178 ? VAL C 175 VAL C 178 
F 2 SER C 149 ? THR C 153 ? SER C 149 THR C 153 
F 3 THR C 124 ? HIS C 128 ? THR C 124 HIS C 128 
F 4 LEU C 192 ? VAL C 195 ? LEU C 192 VAL C 195 
F 5 PHE C 226 ? VAL C 229 ? PHE C 226 VAL C 229 
F 6 LEU C 283 ? THR C 286 ? LEU C 283 THR C 286 
F 7 GLY C 289 ? LEU C 291 ? GLY C 289 LEU C 291 
G 1 GLY C 199 ? VAL C 200 ? GLY C 199 VAL C 200 
G 2 ILE C 206 ? LYS C 209 ? ILE C 206 LYS C 209 
G 3 VAL C 273 ? THR C 276 ? VAL C 273 THR C 276 
H 1 GLY D 289 ? LEU D 291 ? GLY D 289 LEU D 291 
H 2 LEU D 283 ? THR D 286 ? LEU D 283 THR D 286 
H 3 PHE D 226 ? VAL D 229 ? PHE D 226 VAL D 229 
H 4 LEU D 192 ? VAL D 195 ? LEU D 192 VAL D 195 
H 5 THR D 124 ? THR D 127 ? THR D 124 THR D 127 
H 6 SER D 149 ? THR D 153 ? SER D 149 THR D 153 
H 7 VAL D 175 ? VAL D 178 ? VAL D 175 VAL D 178 
H 8 LEU E 266 ? GLU E 269 ? LEU E 266 GLU E 269 
I 1 GLY D 199 ? VAL D 200 ? GLY D 199 VAL D 200 
I 2 ILE D 206 ? LYS D 209 ? ILE D 206 LYS D 209 
I 3 VAL D 273 ? THR D 276 ? VAL D 273 THR D 276 
J 1 ASP D 265 ? LEU D 266 ? ASP D 265 LEU D 266 
J 2 VAL E 175 ? VAL E 178 ? VAL E 175 VAL E 178 
J 3 SER E 149 ? THR E 153 ? SER E 149 THR E 153 
J 4 THR E 124 ? HIS E 128 ? THR E 124 HIS E 128 
J 5 LEU E 192 ? VAL E 195 ? LEU E 192 VAL E 195 
J 6 PHE E 226 ? VAL E 229 ? PHE E 226 VAL E 229 
J 7 LEU E 283 ? THR E 286 ? LEU E 283 THR E 286 
J 8 GLY E 289 ? LEU E 291 ? GLY E 289 LEU E 291 
K 1 GLY E 199 ? VAL E 200 ? GLY E 199 VAL E 200 
K 2 ILE E 206 ? LYS E 209 ? ILE E 206 LYS E 209 
K 3 VAL E 273 ? THR E 276 ? VAL E 273 THR E 276 
L 1 GLY F 289 ? LEU F 291 ? GLY F 289 LEU F 291 
L 2 LEU F 283 ? THR F 286 ? LEU F 283 THR F 286 
L 3 PHE F 226 ? VAL F 229 ? PHE F 226 VAL F 229 
L 4 LEU F 192 ? VAL F 195 ? LEU F 192 VAL F 195 
L 5 THR F 124 ? HIS F 128 ? THR F 124 HIS F 128 
L 6 SER F 149 ? THR F 153 ? SER F 149 THR F 153 
L 7 VAL F 175 ? VAL F 178 ? VAL F 175 VAL F 178 
L 8 LYS G 267 ? GLU G 268 ? LYS G 267 GLU G 268 
M 1 PHE F 235 ? VAL F 236 ? PHE F 235 VAL F 236 
M 2 GLY F 199 ? VAL F 201 ? GLY F 199 VAL F 201 
M 3 ILE F 206 ? LYS F 209 ? ILE F 206 LYS F 209 
M 4 VAL F 273 ? THR F 276 ? VAL F 273 THR F 276 
N 1 LYS F 267 ? GLU F 268 ? LYS F 267 GLU F 268 
N 2 VAL G 175 ? VAL G 178 ? VAL G 175 VAL G 178 
N 3 SER G 149 ? THR G 153 ? SER G 149 THR G 153 
N 4 THR G 124 ? HIS G 128 ? THR G 124 HIS G 128 
N 5 LEU G 192 ? GLY G 196 ? LEU G 192 GLY G 196 
N 6 PHE G 226 ? VAL G 229 ? PHE G 226 VAL G 229 
N 7 LEU G 283 ? THR G 286 ? LEU G 283 THR G 286 
N 8 GLY G 289 ? LEU G 291 ? GLY G 289 LEU G 291 
O 1 GLY G 199 ? VAL G 200 ? GLY G 199 VAL G 200 
O 2 ILE G 206 ? LYS G 209 ? ILE G 206 LYS G 209 
O 3 VAL G 273 ? THR G 276 ? VAL G 273 THR G 276 
P 1 GLY H 199 ? VAL H 200 ? GLY H 199 VAL H 200 
P 2 ILE H 206 ? LYS H 209 ? ILE H 206 LYS H 209 
P 3 VAL H 273 ? THR H 276 ? VAL H 273 THR H 276 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 291 ? O LEU A 291 N LEU A 284 ? N LEU A 284 
A 2 3 O PHE A 285 ? O PHE A 285 N VAL A 228 ? N VAL A 228 
A 3 4 O TYR A 227 ? O TYR A 227 N VAL A 193 ? N VAL A 193 
A 4 5 O LEU A 192 ? O LEU A 192 N LEU A 126 ? N LEU A 126 
A 5 6 N ILE A 125 ? N ILE A 125 O SER A 149 ? O SER A 149 
A 6 7 N VAL A 150 ? N VAL A 150 O THR A 176 ? O THR A 176 
A 7 8 N VAL A 175 ? N VAL A 175 O LYS C 267 ? O LYS C 267 
B 1 2 N GLY A 199 ? N GLY A 199 O ILE A 207 ? O ILE A 207 
B 2 3 N ILE A 206 ? N ILE A 206 O THR A 276 ? O THR A 276 
C 1 2 O VAL B 178 ? O VAL B 178 N VAL B 152 ? N VAL B 152 
C 2 3 O TYR B 151 ? O TYR B 151 N THR B 127 ? N THR B 127 
C 3 4 N LEU B 126 ? N LEU B 126 O LEU B 192 ? O LEU B 192 
C 4 5 N VAL B 193 ? N VAL B 193 O TYR B 227 ? O TYR B 227 
C 5 6 N VAL B 228 ? N VAL B 228 O PHE B 285 ? O PHE B 285 
C 6 7 N LEU B 284 ? N LEU B 284 O LEU B 291 ? O LEU B 291 
D 1 2 N GLY B 199 ? N GLY B 199 O ILE B 207 ? O ILE B 207 
D 2 3 N ASN B 208 ? N ASN B 208 O ASP B 274 ? O ASP B 274 
E 1 2 N LYS B 267 ? N LYS B 267 O VAL H 175 ? O VAL H 175 
E 2 3 O VAL H 178 ? O VAL H 178 N VAL H 152 ? N VAL H 152 
E 3 4 O SER H 149 ? O SER H 149 N ILE H 125 ? N ILE H 125 
E 4 5 N LEU H 126 ? N LEU H 126 O LEU H 192 ? O LEU H 192 
E 5 6 N VAL H 195 ? N VAL H 195 O TYR H 227 ? O TYR H 227 
E 6 7 N VAL H 228 ? N VAL H 228 O PHE H 285 ? O PHE H 285 
E 7 8 N LEU H 284 ? N LEU H 284 O LEU H 291 ? O LEU H 291 
F 1 2 O THR C 176 ? O THR C 176 N VAL C 150 ? N VAL C 150 
F 2 3 O TYR C 151 ? O TYR C 151 N THR C 127 ? N THR C 127 
F 3 4 N LEU C 126 ? N LEU C 126 O LEU C 192 ? O LEU C 192 
F 4 5 N VAL C 193 ? N VAL C 193 O TYR C 227 ? O TYR C 227 
F 5 6 N VAL C 228 ? N VAL C 228 O PHE C 285 ? O PHE C 285 
F 6 7 N LEU C 284 ? N LEU C 284 O LEU C 291 ? O LEU C 291 
G 1 2 N GLY C 199 ? N GLY C 199 O ILE C 207 ? O ILE C 207 
G 2 3 N ILE C 206 ? N ILE C 206 O THR C 276 ? O THR C 276 
H 1 2 O LEU D 291 ? O LEU D 291 N LEU D 284 ? N LEU D 284 
H 2 3 O PHE D 285 ? O PHE D 285 N VAL D 228 ? N VAL D 228 
H 3 4 O TYR D 227 ? O TYR D 227 N VAL D 193 ? N VAL D 193 
H 4 5 O ILE D 194 ? O ILE D 194 N LEU D 126 ? N LEU D 126 
H 5 6 N ILE D 125 ? N ILE D 125 O SER D 149 ? O SER D 149 
H 6 7 N VAL D 152 ? N VAL D 152 O THR D 176 ? O THR D 176 
H 7 8 N VAL D 177 ? N VAL D 177 O LYS E 267 ? O LYS E 267 
I 1 2 N GLY D 199 ? N GLY D 199 O ILE D 207 ? O ILE D 207 
I 2 3 N ILE D 206 ? N ILE D 206 O THR D 276 ? O THR D 276 
J 1 2 N LEU D 266 ? N LEU D 266 O VAL E 177 ? O VAL E 177 
J 2 3 O THR E 176 ? O THR E 176 N VAL E 150 ? N VAL E 150 
J 3 4 O SER E 149 ? O SER E 149 N ILE E 125 ? N ILE E 125 
J 4 5 N LEU E 126 ? N LEU E 126 O LEU E 192 ? O LEU E 192 
J 5 6 N VAL E 193 ? N VAL E 193 O TYR E 227 ? O TYR E 227 
J 6 7 N VAL E 228 ? N VAL E 228 O PHE E 285 ? O PHE E 285 
J 7 8 N LEU E 284 ? N LEU E 284 O LEU E 291 ? O LEU E 291 
K 1 2 N GLY E 199 ? N GLY E 199 O ILE E 207 ? O ILE E 207 
K 2 3 N ASN E 208 ? N ASN E 208 O ASP E 274 ? O ASP E 274 
L 1 2 O LEU F 291 ? O LEU F 291 N LEU F 284 ? N LEU F 284 
L 2 3 O PHE F 285 ? O PHE F 285 N VAL F 228 ? N VAL F 228 
L 3 4 O TYR F 227 ? O TYR F 227 N VAL F 193 ? N VAL F 193 
L 4 5 O LEU F 192 ? O LEU F 192 N LEU F 126 ? N LEU F 126 
L 5 6 N ILE F 125 ? N ILE F 125 O SER F 149 ? O SER F 149 
L 6 7 N VAL F 150 ? N VAL F 150 O THR F 176 ? O THR F 176 
L 7 8 N VAL F 175 ? N VAL F 175 O LYS G 267 ? O LYS G 267 
M 1 2 O VAL F 236 ? O VAL F 236 N VAL F 200 ? N VAL F 200 
M 2 3 N GLY F 199 ? N GLY F 199 O ILE F 207 ? O ILE F 207 
M 3 4 N ILE F 206 ? N ILE F 206 O THR F 276 ? O THR F 276 
N 1 2 N LYS F 267 ? N LYS F 267 O VAL G 177 ? O VAL G 177 
N 2 3 O THR G 176 ? O THR G 176 N VAL G 150 ? N VAL G 150 
N 3 4 O TYR G 151 ? O TYR G 151 N THR G 127 ? N THR G 127 
N 4 5 N LEU G 126 ? N LEU G 126 O LEU G 192 ? O LEU G 192 
N 5 6 N VAL G 193 ? N VAL G 193 O TYR G 227 ? O TYR G 227 
N 6 7 N VAL G 228 ? N VAL G 228 O PHE G 285 ? O PHE G 285 
N 7 8 N LEU G 284 ? N LEU G 284 O LEU G 291 ? O LEU G 291 
O 1 2 N GLY G 199 ? N GLY G 199 O ILE G 207 ? O ILE G 207 
O 2 3 N ASN G 208 ? N ASN G 208 O ASP G 274 ? O ASP G 274 
P 1 2 N GLY H 199 ? N GLY H 199 O ILE H 207 ? O ILE H 207 
P 2 3 N ILE H 206 ? N ILE H 206 O THR H 276 ? O THR H 276 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 501' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 509' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 601'  
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 B 502' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 C 503' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 D 504' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 E 505' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 F 506' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 F 510' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 G 507' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 H 508' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 SER A 131 ? SER A 131  . ? 1_555 ? 
2  AC1 6 ARG A 132 ? ARG A 132  . ? 1_555 ? 
3  AC1 6 VAL A 133 ? VAL A 133  . ? 1_555 ? 
4  AC1 6 LYS A 234 ? LYS A 234  . ? 1_555 ? 
5  AC1 6 HOH T .   ? HOH A 1052 . ? 1_555 ? 
6  AC1 6 HOH T .   ? HOH A 1093 . ? 1_555 ? 
7  AC2 4 LYS A 120 ? LYS A 120  . ? 1_555 ? 
8  AC2 4 ASP A 121 ? ASP A 121  . ? 1_555 ? 
9  AC2 4 LYS A 146 ? LYS A 146  . ? 1_555 ? 
10 AC2 4 LYS F 110 ? LYS F 110  . ? 1_555 ? 
11 AC3 2 ARG A 108 ? ARG A 108  . ? 1_555 ? 
12 AC3 2 ARG A 136 ? ARG A 136  . ? 1_555 ? 
13 AC4 5 SER B 131 ? SER B 131  . ? 1_555 ? 
14 AC4 5 ARG B 132 ? ARG B 132  . ? 1_555 ? 
15 AC4 5 VAL B 133 ? VAL B 133  . ? 1_555 ? 
16 AC4 5 ALA B 197 ? ALA B 197  . ? 1_555 ? 
17 AC4 5 LYS B 234 ? LYS B 234  . ? 1_555 ? 
18 AC5 4 SER C 131 ? SER C 131  . ? 1_555 ? 
19 AC5 4 ARG C 132 ? ARG C 132  . ? 1_555 ? 
20 AC5 4 VAL C 133 ? VAL C 133  . ? 1_555 ? 
21 AC5 4 LYS C 234 ? LYS C 234  . ? 1_555 ? 
22 AC6 4 SER D 131 ? SER D 131  . ? 1_555 ? 
23 AC6 4 ARG D 132 ? ARG D 132  . ? 1_555 ? 
24 AC6 4 VAL D 133 ? VAL D 133  . ? 1_555 ? 
25 AC6 4 LYS D 234 ? LYS D 234  . ? 1_555 ? 
26 AC7 5 SER E 131 ? SER E 131  . ? 1_555 ? 
27 AC7 5 ARG E 132 ? ARG E 132  . ? 1_555 ? 
28 AC7 5 VAL E 133 ? VAL E 133  . ? 1_555 ? 
29 AC7 5 GLU E 231 ? GLU E 231  . ? 1_555 ? 
30 AC7 5 LYS E 234 ? LYS E 234  . ? 1_555 ? 
31 AC8 6 SER F 131 ? SER F 131  . ? 1_555 ? 
32 AC8 6 ARG F 132 ? ARG F 132  . ? 1_555 ? 
33 AC8 6 VAL F 133 ? VAL F 133  . ? 1_555 ? 
34 AC8 6 ALA F 197 ? ALA F 197  . ? 1_555 ? 
35 AC8 6 LYS F 234 ? LYS F 234  . ? 1_555 ? 
36 AC8 6 HOH Y .   ? HOH F 1049 . ? 1_555 ? 
37 AC9 4 LYS A 110 ? LYS A 110  . ? 1_555 ? 
38 AC9 4 LYS F 120 ? LYS F 120  . ? 1_555 ? 
39 AC9 4 ASP F 121 ? ASP F 121  . ? 1_555 ? 
40 AC9 4 LYS F 146 ? LYS F 146  . ? 1_555 ? 
41 BC1 6 ARG G 108 ? ARG G 108  . ? 1_555 ? 
42 BC1 6 SER G 131 ? SER G 131  . ? 1_555 ? 
43 BC1 6 ARG G 132 ? ARG G 132  . ? 1_555 ? 
44 BC1 6 VAL G 133 ? VAL G 133  . ? 1_555 ? 
45 BC1 6 LYS G 234 ? LYS G 234  . ? 1_555 ? 
46 BC1 6 HOH Z .   ? HOH G 1083 . ? 1_555 ? 
47 BC2 4 SER H 131 ? SER H 131  . ? 1_555 ? 
48 BC2 4 ARG H 132 ? ARG H 132  . ? 1_555 ? 
49 BC2 4 VAL H 133 ? VAL H 133  . ? 1_555 ? 
50 BC2 4 LYS H 234 ? LYS H 234  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3ECS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ECS 
_atom_sites.fract_transf_matrix[1][1]   0.014107 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003570 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006394 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007451 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     N  N   . MSE A  1 1   ? 44.106  48.363  69.876  1.00 103.60 ? 1    MSE A N   1 
HETATM 2     C  CA  . MSE A  1 1   ? 44.519  47.783  71.184  1.00 104.18 ? 1    MSE A CA  1 
HETATM 3     C  C   . MSE A  1 1   ? 43.737  46.517  71.516  1.00 102.76 ? 1    MSE A C   1 
HETATM 4     O  O   . MSE A  1 1   ? 42.984  46.007  70.691  1.00 102.61 ? 1    MSE A O   1 
HETATM 5     C  CB  . MSE A  1 1   ? 44.317  48.806  72.306  1.00 107.93 ? 1    MSE A CB  1 
HETATM 6     C  CG  . MSE A  1 1   ? 45.266  49.998  72.263  1.00 111.34 ? 1    MSE A CG  1 
HETATM 7     SE SE  . MSE A  1 1   ? 45.036  51.218  73.763  1.00 115.22 ? 1    MSE A SE  1 
HETATM 8     C  CE  . MSE A  1 1   ? 46.201  50.333  75.026  1.00 111.76 ? 1    MSE A CE  1 
ATOM   9     N  N   . ASP A  1 2   ? 43.929  46.023  72.735  1.00 101.12 ? 2    ASP A N   1 
ATOM   10    C  CA  . ASP A  1 2   ? 43.260  44.819  73.217  1.00 99.63  ? 2    ASP A CA  1 
ATOM   11    C  C   . ASP A  1 2   ? 43.504  44.723  74.719  1.00 97.94  ? 2    ASP A C   1 
ATOM   12    O  O   . ASP A  1 2   ? 44.088  45.629  75.306  1.00 98.52  ? 2    ASP A O   1 
ATOM   13    C  CB  . ASP A  1 2   ? 43.831  43.585  72.519  1.00 100.57 ? 2    ASP A CB  1 
ATOM   14    C  CG  . ASP A  1 2   ? 45.302  43.381  72.816  1.00 101.19 ? 2    ASP A CG  1 
ATOM   15    O  OD1 . ASP A  1 2   ? 45.629  42.943  73.940  1.00 101.77 ? 2    ASP A OD1 1 
ATOM   16    O  OD2 . ASP A  1 2   ? 46.132  43.672  71.931  1.00 100.65 ? 2    ASP A OD2 1 
ATOM   17    N  N   . ASP A  1 3   ? 43.075  43.627  75.336  1.00 95.50  ? 3    ASP A N   1 
ATOM   18    C  CA  . ASP A  1 3   ? 43.257  43.450  76.775  1.00 94.22  ? 3    ASP A CA  1 
ATOM   19    C  C   . ASP A  1 3   ? 44.710  43.540  77.247  1.00 93.60  ? 3    ASP A C   1 
ATOM   20    O  O   . ASP A  1 3   ? 44.999  44.206  78.242  1.00 92.54  ? 3    ASP A O   1 
ATOM   21    C  CB  . ASP A  1 3   ? 42.637  42.124  77.227  1.00 94.00  ? 3    ASP A CB  1 
ATOM   22    C  CG  . ASP A  1 3   ? 41.143  42.244  77.505  1.00 93.92  ? 3    ASP A CG  1 
ATOM   23    O  OD1 . ASP A  1 3   ? 40.408  42.747  76.626  1.00 92.62  ? 3    ASP A OD1 1 
ATOM   24    O  OD2 . ASP A  1 3   ? 40.705  41.834  78.603  1.00 93.19  ? 3    ASP A OD2 1 
ATOM   25    N  N   . LYS A  1 4   ? 45.620  42.875  76.544  1.00 93.20  ? 4    LYS A N   1 
ATOM   26    C  CA  . LYS A  1 4   ? 47.031  42.919  76.918  1.00 93.04  ? 4    LYS A CA  1 
ATOM   27    C  C   . LYS A  1 4   ? 47.559  44.350  76.910  1.00 92.32  ? 4    LYS A C   1 
ATOM   28    O  O   . LYS A  1 4   ? 48.227  44.782  77.847  1.00 91.31  ? 4    LYS A O   1 
ATOM   29    C  CB  . LYS A  1 4   ? 47.881  42.086  75.957  1.00 93.84  ? 4    LYS A CB  1 
ATOM   30    C  CG  . LYS A  1 4   ? 47.925  40.603  76.250  1.00 93.58  ? 4    LYS A CG  1 
ATOM   31    C  CD  . LYS A  1 4   ? 49.094  39.957  75.513  1.00 93.38  ? 4    LYS A CD  1 
ATOM   32    C  CE  . LYS A  1 4   ? 50.429  40.538  75.984  1.00 92.73  ? 4    LYS A CE  1 
ATOM   33    N  NZ  . LYS A  1 4   ? 51.598  39.980  75.247  1.00 91.92  ? 4    LYS A NZ  1 
ATOM   34    N  N   . GLU A  1 5   ? 47.259  45.079  75.841  1.00 91.44  ? 5    GLU A N   1 
ATOM   35    C  CA  . GLU A  1 5   ? 47.715  46.456  75.701  1.00 91.92  ? 5    GLU A CA  1 
ATOM   36    C  C   . GLU A  1 5   ? 47.008  47.479  76.599  1.00 90.64  ? 5    GLU A C   1 
ATOM   37    O  O   . GLU A  1 5   ? 47.532  48.576  76.832  1.00 90.74  ? 5    GLU A O   1 
ATOM   38    C  CB  . GLU A  1 5   ? 47.610  46.893  74.237  1.00 93.78  ? 5    GLU A CB  1 
ATOM   39    C  CG  . GLU A  1 5   ? 48.792  46.468  73.378  1.00 94.59  ? 5    GLU A CG  1 
ATOM   40    C  CD  . GLU A  1 5   ? 48.746  47.084  71.995  1.00 96.42  ? 5    GLU A CD  1 
ATOM   41    O  OE1 . GLU A  1 5   ? 48.009  46.563  71.130  1.00 96.51  ? 5    GLU A OE1 1 
ATOM   42    O  OE2 . GLU A  1 5   ? 49.437  48.104  71.779  1.00 96.93  ? 5    GLU A OE2 1 
ATOM   43    N  N   . LEU A  1 6   ? 45.824  47.136  77.098  1.00 86.99  ? 6    LEU A N   1 
ATOM   44    C  CA  . LEU A  1 6   ? 45.111  48.055  77.972  1.00 82.91  ? 6    LEU A CA  1 
ATOM   45    C  C   . LEU A  1 6   ? 45.651  47.940  79.384  1.00 81.35  ? 6    LEU A C   1 
ATOM   46    O  O   . LEU A  1 6   ? 46.118  48.927  79.956  1.00 81.86  ? 6    LEU A O   1 
ATOM   47    C  CB  . LEU A  1 6   ? 43.609  47.769  77.978  1.00 81.01  ? 6    LEU A CB  1 
ATOM   48    C  CG  . LEU A  1 6   ? 42.788  48.254  76.786  1.00 78.86  ? 6    LEU A CG  1 
ATOM   49    C  CD1 . LEU A  1 6   ? 41.323  47.959  77.047  1.00 79.14  ? 6    LEU A CD1 1 
ATOM   50    C  CD2 . LEU A  1 6   ? 42.995  49.738  76.581  1.00 78.71  ? 6    LEU A CD2 1 
ATOM   51    N  N   . ILE A  1 7   ? 45.599  46.733  79.944  1.00 78.51  ? 7    ILE A N   1 
ATOM   52    C  CA  . ILE A  1 7   ? 46.086  46.516  81.300  1.00 76.37  ? 7    ILE A CA  1 
ATOM   53    C  C   . ILE A  1 7   ? 47.569  46.861  81.383  1.00 77.78  ? 7    ILE A C   1 
ATOM   54    O  O   . ILE A  1 7   ? 48.218  46.650  82.410  1.00 78.59  ? 7    ILE A O   1 
ATOM   55    C  CB  . ILE A  1 7   ? 45.854  45.064  81.755  1.00 74.16  ? 7    ILE A CB  1 
ATOM   56    C  CG1 . ILE A  1 7   ? 44.375  44.701  81.593  1.00 72.39  ? 7    ILE A CG1 1 
ATOM   57    C  CG2 . ILE A  1 7   ? 46.251  44.904  83.211  1.00 73.27  ? 7    ILE A CG2 1 
ATOM   58    C  CD1 . ILE A  1 7   ? 44.023  43.303  82.068  1.00 71.64  ? 7    ILE A CD1 1 
ATOM   59    N  N   . GLU A  1 8   ? 48.098  47.396  80.286  1.00 78.53  ? 8    GLU A N   1 
ATOM   60    C  CA  . GLU A  1 8   ? 49.492  47.818  80.217  1.00 78.97  ? 8    GLU A CA  1 
ATOM   61    C  C   . GLU A  1 8   ? 49.550  49.332  80.272  1.00 75.73  ? 8    GLU A C   1 
ATOM   62    O  O   . GLU A  1 8   ? 49.850  49.912  81.314  1.00 76.05  ? 8    GLU A O   1 
ATOM   63    C  CB  . GLU A  1 8   ? 50.145  47.373  78.913  1.00 83.53  ? 8    GLU A CB  1 
ATOM   64    C  CG  . GLU A  1 8   ? 50.628  45.949  78.877  1.00 89.08  ? 8    GLU A CG  1 
ATOM   65    C  CD  . GLU A  1 8   ? 51.536  45.714  77.685  1.00 92.94  ? 8    GLU A CD  1 
ATOM   66    O  OE1 . GLU A  1 8   ? 51.145  46.099  76.560  1.00 94.25  ? 8    GLU A OE1 1 
ATOM   67    O  OE2 . GLU A  1 8   ? 52.637  45.150  77.870  1.00 95.20  ? 8    GLU A OE2 1 
ATOM   68    N  N   . TYR A  1 9   ? 49.260  49.962  79.135  1.00 72.22  ? 9    TYR A N   1 
ATOM   69    C  CA  . TYR A  1 9   ? 49.279  51.412  79.022  1.00 70.50  ? 9    TYR A CA  1 
ATOM   70    C  C   . TYR A  1 9   ? 48.753  52.031  80.310  1.00 69.20  ? 9    TYR A C   1 
ATOM   71    O  O   . TYR A  1 9   ? 49.233  53.069  80.759  1.00 69.68  ? 9    TYR A O   1 
ATOM   72    C  CB  . TYR A  1 9   ? 48.416  51.856  77.845  1.00 70.52  ? 9    TYR A CB  1 
ATOM   73    C  CG  . TYR A  1 9   ? 48.559  53.323  77.500  1.00 74.67  ? 9    TYR A CG  1 
ATOM   74    C  CD1 . TYR A  1 9   ? 49.738  53.821  76.939  1.00 74.97  ? 9    TYR A CD1 1 
ATOM   75    C  CD2 . TYR A  1 9   ? 47.507  54.215  77.714  1.00 77.23  ? 9    TYR A CD2 1 
ATOM   76    C  CE1 . TYR A  1 9   ? 49.859  55.173  76.593  1.00 76.13  ? 9    TYR A CE1 1 
ATOM   77    C  CE2 . TYR A  1 9   ? 47.619  55.567  77.376  1.00 76.97  ? 9    TYR A CE2 1 
ATOM   78    C  CZ  . TYR A  1 9   ? 48.792  56.037  76.814  1.00 76.74  ? 9    TYR A CZ  1 
ATOM   79    O  OH  . TYR A  1 9   ? 48.885  57.363  76.463  1.00 77.00  ? 9    TYR A OH  1 
ATOM   80    N  N   . PHE A  1 10  ? 47.767  51.370  80.904  1.00 67.26  ? 10   PHE A N   1 
ATOM   81    C  CA  . PHE A  1 10  ? 47.158  51.820  82.146  1.00 64.32  ? 10   PHE A CA  1 
ATOM   82    C  C   . PHE A  1 10  ? 48.088  51.604  83.345  1.00 65.38  ? 10   PHE A C   1 
ATOM   83    O  O   . PHE A  1 10  ? 48.562  52.565  83.956  1.00 64.47  ? 10   PHE A O   1 
ATOM   84    C  CB  . PHE A  1 10  ? 45.835  51.072  82.358  1.00 59.09  ? 10   PHE A CB  1 
ATOM   85    C  CG  . PHE A  1 10  ? 45.185  51.341  83.682  1.00 54.09  ? 10   PHE A CG  1 
ATOM   86    C  CD1 . PHE A  1 10  ? 44.728  52.614  84.006  1.00 53.21  ? 10   PHE A CD1 1 
ATOM   87    C  CD2 . PHE A  1 10  ? 45.048  50.324  84.620  1.00 51.16  ? 10   PHE A CD2 1 
ATOM   88    C  CE1 . PHE A  1 10  ? 44.145  52.870  85.251  1.00 48.36  ? 10   PHE A CE1 1 
ATOM   89    C  CE2 . PHE A  1 10  ? 44.469  50.571  85.861  1.00 47.68  ? 10   PHE A CE2 1 
ATOM   90    C  CZ  . PHE A  1 10  ? 44.018  51.847  86.174  1.00 47.20  ? 10   PHE A CZ  1 
ATOM   91    N  N   . LYS A  1 11  ? 48.347  50.335  83.659  1.00 66.80  ? 11   LYS A N   1 
ATOM   92    C  CA  . LYS A  1 11  ? 49.189  49.927  84.789  1.00 67.71  ? 11   LYS A CA  1 
ATOM   93    C  C   . LYS A  1 11  ? 50.581  50.569  84.854  1.00 67.94  ? 11   LYS A C   1 
ATOM   94    O  O   . LYS A  1 11  ? 51.179  50.677  85.930  1.00 68.13  ? 11   LYS A O   1 
ATOM   95    C  CB  . LYS A  1 11  ? 49.337  48.401  84.788  1.00 68.67  ? 11   LYS A CB  1 
ATOM   96    C  CG  . LYS A  1 11  ? 50.065  47.844  86.005  1.00 72.34  ? 11   LYS A CG  1 
ATOM   97    C  CD  . LYS A  1 11  ? 50.234  46.323  85.939  1.00 71.42  ? 11   LYS A CD  1 
ATOM   98    C  CE  . LYS A  1 11  ? 50.986  45.808  87.165  1.00 70.70  ? 11   LYS A CE  1 
ATOM   99    N  NZ  . LYS A  1 11  ? 51.408  44.387  87.041  1.00 70.38  ? 11   LYS A NZ  1 
ATOM   100   N  N   . SER A  1 12  ? 51.103  50.984  83.708  1.00 66.96  ? 12   SER A N   1 
ATOM   101   C  CA  . SER A  1 12  ? 52.421  51.606  83.669  1.00 66.87  ? 12   SER A CA  1 
ATOM   102   C  C   . SER A  1 12  ? 52.276  53.127  83.712  1.00 66.83  ? 12   SER A C   1 
ATOM   103   O  O   . SER A  1 12  ? 53.166  53.837  84.192  1.00 66.47  ? 12   SER A O   1 
ATOM   104   C  CB  . SER A  1 12  ? 53.175  51.175  82.402  1.00 66.82  ? 12   SER A CB  1 
ATOM   105   O  OG  . SER A  1 12  ? 52.517  51.613  81.225  1.00 66.28  ? 12   SER A OG  1 
ATOM   106   N  N   . GLN A  1 13  ? 51.148  53.616  83.201  1.00 65.45  ? 13   GLN A N   1 
ATOM   107   C  CA  . GLN A  1 13  ? 50.853  55.039  83.193  1.00 62.62  ? 13   GLN A CA  1 
ATOM   108   C  C   . GLN A  1 13  ? 50.970  55.484  84.652  1.00 62.70  ? 13   GLN A C   1 
ATOM   109   O  O   . GLN A  1 13  ? 51.460  56.573  84.944  1.00 59.64  ? 13   GLN A O   1 
ATOM   110   C  CB  . GLN A  1 13  ? 49.434  55.257  82.666  1.00 60.53  ? 13   GLN A CB  1 
ATOM   111   C  CG  . GLN A  1 13  ? 49.037  56.703  82.411  1.00 62.87  ? 13   GLN A CG  1 
ATOM   112   C  CD  . GLN A  1 13  ? 49.620  57.288  81.134  1.00 64.09  ? 13   GLN A CD  1 
ATOM   113   O  OE1 . GLN A  1 13  ? 49.512  56.702  80.057  1.00 65.59  ? 13   GLN A OE1 1 
ATOM   114   N  NE2 . GLN A  1 13  ? 50.221  58.466  81.246  1.00 64.69  ? 13   GLN A NE2 1 
HETATM 115   N  N   . MSE A  1 14  ? 50.540  54.606  85.559  1.00 64.72  ? 14   MSE A N   1 
HETATM 116   C  CA  . MSE A  1 14  ? 50.584  54.859  86.997  1.00 67.78  ? 14   MSE A CA  1 
HETATM 117   C  C   . MSE A  1 14  ? 51.980  54.699  87.580  1.00 69.40  ? 14   MSE A C   1 
HETATM 118   O  O   . MSE A  1 14  ? 52.300  55.289  88.610  1.00 69.95  ? 14   MSE A O   1 
HETATM 119   C  CB  . MSE A  1 14  ? 49.634  53.917  87.730  1.00 69.10  ? 14   MSE A CB  1 
HETATM 120   C  CG  . MSE A  1 14  ? 48.164  54.198  87.475  1.00 76.33  ? 14   MSE A CG  1 
HETATM 121   SE SE  . MSE A  1 14  ? 46.978  53.020  88.468  1.00 83.60  ? 14   MSE A SE  1 
HETATM 122   C  CE  . MSE A  1 14  ? 46.825  54.042  90.118  1.00 83.29  ? 14   MSE A CE  1 
ATOM   123   N  N   . LYS A  1 15  ? 52.806  53.885  86.935  1.00 71.15  ? 15   LYS A N   1 
ATOM   124   C  CA  . LYS A  1 15  ? 54.169  53.672  87.400  1.00 71.77  ? 15   LYS A CA  1 
ATOM   125   C  C   . LYS A  1 15  ? 54.994  54.926  87.116  1.00 70.55  ? 15   LYS A C   1 
ATOM   126   O  O   . LYS A  1 15  ? 55.660  55.451  88.005  1.00 69.89  ? 15   LYS A O   1 
ATOM   127   C  CB  . LYS A  1 15  ? 54.785  52.472  86.686  1.00 75.53  ? 15   LYS A CB  1 
ATOM   128   C  CG  . LYS A  1 15  ? 53.941  51.202  86.760  1.00 82.18  ? 15   LYS A CG  1 
ATOM   129   C  CD  . LYS A  1 15  ? 53.908  50.597  88.164  1.00 86.20  ? 15   LYS A CD  1 
ATOM   130   C  CE  . LYS A  1 15  ? 53.129  49.275  88.181  1.00 88.51  ? 15   LYS A CE  1 
ATOM   131   N  NZ  . LYS A  1 15  ? 53.265  48.536  89.480  1.00 89.78  ? 15   LYS A NZ  1 
ATOM   132   N  N   . GLU A  1 16  ? 54.934  55.402  85.875  1.00 69.00  ? 16   GLU A N   1 
ATOM   133   C  CA  . GLU A  1 16  ? 55.662  56.602  85.459  1.00 68.63  ? 16   GLU A CA  1 
ATOM   134   C  C   . GLU A  1 16  ? 55.328  57.806  86.345  1.00 67.29  ? 16   GLU A C   1 
ATOM   135   O  O   . GLU A  1 16  ? 56.117  58.748  86.441  1.00 67.26  ? 16   GLU A O   1 
ATOM   136   C  CB  . GLU A  1 16  ? 55.326  56.946  84.003  1.00 70.41  ? 16   GLU A CB  1 
ATOM   137   C  CG  . GLU A  1 16  ? 55.681  55.853  83.002  1.00 77.37  ? 16   GLU A CG  1 
ATOM   138   C  CD  . GLU A  1 16  ? 57.163  55.831  82.637  1.00 79.70  ? 16   GLU A CD  1 
ATOM   139   O  OE1 . GLU A  1 16  ? 58.012  55.985  83.548  1.00 81.48  ? 16   GLU A OE1 1 
ATOM   140   O  OE2 . GLU A  1 16  ? 57.477  55.646  81.438  1.00 78.31  ? 16   GLU A OE2 1 
ATOM   141   N  N   . ASP A  1 17  ? 54.153  57.773  86.973  1.00 64.80  ? 17   ASP A N   1 
ATOM   142   C  CA  . ASP A  1 17  ? 53.699  58.853  87.851  1.00 60.87  ? 17   ASP A CA  1 
ATOM   143   C  C   . ASP A  1 17  ? 52.671  58.349  88.856  1.00 58.69  ? 17   ASP A C   1 
ATOM   144   O  O   . ASP A  1 17  ? 51.470  58.414  88.611  1.00 59.41  ? 17   ASP A O   1 
ATOM   145   C  CB  . ASP A  1 17  ? 53.073  59.982  87.037  1.00 59.04  ? 17   ASP A CB  1 
ATOM   146   C  CG  . ASP A  1 17  ? 52.471  61.058  87.918  1.00 60.72  ? 17   ASP A CG  1 
ATOM   147   O  OD1 . ASP A  1 17  ? 52.596  60.941  89.154  1.00 60.29  ? 17   ASP A OD1 1 
ATOM   148   O  OD2 . ASP A  1 17  ? 51.877  62.022  87.390  1.00 60.79  ? 17   ASP A OD2 1 
ATOM   149   N  N   . PRO A  1 18  ? 53.132  57.865  90.017  1.00 57.17  ? 18   PRO A N   1 
ATOM   150   C  CA  . PRO A  1 18  ? 52.273  57.338  91.081  1.00 56.23  ? 18   PRO A CA  1 
ATOM   151   C  C   . PRO A  1 18  ? 51.500  58.430  91.815  1.00 54.66  ? 18   PRO A C   1 
ATOM   152   O  O   . PRO A  1 18  ? 50.763  58.162  92.763  1.00 53.52  ? 18   PRO A O   1 
ATOM   153   C  CB  . PRO A  1 18  ? 53.268  56.633  91.984  1.00 53.46  ? 18   PRO A CB  1 
ATOM   154   C  CG  . PRO A  1 18  ? 54.427  57.565  91.926  1.00 53.78  ? 18   PRO A CG  1 
ATOM   155   C  CD  . PRO A  1 18  ? 54.542  57.857  90.445  1.00 56.03  ? 18   PRO A CD  1 
ATOM   156   N  N   . ASP A  1 19  ? 51.688  59.661  91.365  1.00 54.49  ? 19   ASP A N   1 
ATOM   157   C  CA  . ASP A  1 19  ? 51.031  60.831  91.943  1.00 54.76  ? 19   ASP A CA  1 
ATOM   158   C  C   . ASP A  1 19  ? 49.687  61.021  91.228  1.00 51.61  ? 19   ASP A C   1 
ATOM   159   O  O   . ASP A  1 19  ? 48.822  61.763  91.685  1.00 46.44  ? 19   ASP A O   1 
ATOM   160   C  CB  . ASP A  1 19  ? 51.918  62.061  91.706  1.00 59.76  ? 19   ASP A CB  1 
ATOM   161   C  CG  . ASP A  1 19  ? 51.796  63.096  92.798  1.00 64.22  ? 19   ASP A CG  1 
ATOM   162   O  OD1 . ASP A  1 19  ? 52.127  62.752  93.955  1.00 64.27  ? 19   ASP A OD1 1 
ATOM   163   O  OD2 . ASP A  1 19  ? 51.381  64.245  92.494  1.00 68.79  ? 19   ASP A OD2 1 
HETATM 164   N  N   . MSE A  1 20  ? 49.542  60.327  90.103  1.00 50.00  ? 20   MSE A N   1 
HETATM 165   C  CA  . MSE A  1 20  ? 48.364  60.395  89.256  1.00 50.38  ? 20   MSE A CA  1 
HETATM 166   C  C   . MSE A  1 20  ? 47.185  59.585  89.741  1.00 51.89  ? 20   MSE A C   1 
HETATM 167   O  O   . MSE A  1 20  ? 47.311  58.398  90.053  1.00 54.16  ? 20   MSE A O   1 
HETATM 168   C  CB  . MSE A  1 20  ? 48.729  59.938  87.855  1.00 51.51  ? 20   MSE A CB  1 
HETATM 169   C  CG  . MSE A  1 20  ? 47.568  59.833  86.907  1.00 56.62  ? 20   MSE A CG  1 
HETATM 170   SE SE  . MSE A  1 20  ? 48.200  59.426  85.124  1.00 65.84  ? 20   MSE A SE  1 
HETATM 171   C  CE  . MSE A  1 20  ? 48.589  57.583  85.469  1.00 64.52  ? 20   MSE A CE  1 
ATOM   172   N  N   . ALA A  1 21  ? 46.027  60.234  89.793  1.00 52.21  ? 21   ALA A N   1 
ATOM   173   C  CA  . ALA A  1 21  ? 44.812  59.563  90.226  1.00 50.04  ? 21   ALA A CA  1 
ATOM   174   C  C   . ALA A  1 21  ? 44.616  58.291  89.403  1.00 49.26  ? 21   ALA A C   1 
ATOM   175   O  O   . ALA A  1 21  ? 44.889  58.255  88.200  1.00 50.40  ? 21   ALA A O   1 
ATOM   176   C  CB  . ALA A  1 21  ? 43.603  60.491  90.062  1.00 45.40  ? 21   ALA A CB  1 
ATOM   177   N  N   . SER A  1 22  ? 44.158  57.245  90.072  1.00 47.82  ? 22   SER A N   1 
ATOM   178   C  CA  . SER A  1 22  ? 43.891  55.975  89.429  1.00 46.39  ? 22   SER A CA  1 
ATOM   179   C  C   . SER A  1 22  ? 42.978  56.223  88.217  1.00 43.83  ? 22   SER A C   1 
ATOM   180   O  O   . SER A  1 22  ? 43.201  55.687  87.129  1.00 42.85  ? 22   SER A O   1 
ATOM   181   C  CB  . SER A  1 22  ? 43.209  55.048  90.448  1.00 50.29  ? 22   SER A CB  1 
ATOM   182   O  OG  . SER A  1 22  ? 43.229  53.694  90.033  1.00 54.36  ? 22   SER A OG  1 
ATOM   183   N  N   . ALA A  1 23  ? 41.958  57.053  88.415  1.00 41.60  ? 23   ALA A N   1 
ATOM   184   C  CA  . ALA A  1 23  ? 40.997  57.388  87.364  1.00 40.93  ? 23   ALA A CA  1 
ATOM   185   C  C   . ALA A  1 23  ? 41.605  58.067  86.130  1.00 39.89  ? 23   ALA A C   1 
ATOM   186   O  O   . ALA A  1 23  ? 41.267  57.742  84.989  1.00 38.63  ? 23   ALA A O   1 
ATOM   187   C  CB  . ALA A  1 23  ? 39.900  58.272  87.944  1.00 41.83  ? 23   ALA A CB  1 
ATOM   188   N  N   . VAL A  1 24  ? 42.488  59.030  86.361  1.00 39.33  ? 24   VAL A N   1 
ATOM   189   C  CA  . VAL A  1 24  ? 43.119  59.746  85.264  1.00 35.77  ? 24   VAL A CA  1 
ATOM   190   C  C   . VAL A  1 24  ? 43.922  58.777  84.413  1.00 35.26  ? 24   VAL A C   1 
ATOM   191   O  O   . VAL A  1 24  ? 43.891  58.850  83.195  1.00 36.24  ? 24   VAL A O   1 
ATOM   192   C  CB  . VAL A  1 24  ? 44.040  60.852  85.796  1.00 35.80  ? 24   VAL A CB  1 
ATOM   193   C  CG1 . VAL A  1 24  ? 44.647  61.637  84.641  1.00 34.85  ? 24   VAL A CG1 1 
ATOM   194   C  CG2 . VAL A  1 24  ? 43.260  61.761  86.715  1.00 31.57  ? 24   VAL A CG2 1 
ATOM   195   N  N   . ALA A  1 25  ? 44.639  57.866  85.062  1.00 35.34  ? 25   ALA A N   1 
ATOM   196   C  CA  . ALA A  1 25  ? 45.438  56.883  84.351  1.00 35.90  ? 25   ALA A CA  1 
ATOM   197   C  C   . ALA A  1 25  ? 44.546  56.151  83.363  1.00 39.68  ? 25   ALA A C   1 
ATOM   198   O  O   . ALA A  1 25  ? 44.889  56.035  82.189  1.00 42.78  ? 25   ALA A O   1 
ATOM   199   C  CB  . ALA A  1 25  ? 46.050  55.897  85.336  1.00 35.39  ? 25   ALA A CB  1 
ATOM   200   N  N   . ALA A  1 26  ? 43.393  55.673  83.841  1.00 42.85  ? 26   ALA A N   1 
ATOM   201   C  CA  . ALA A  1 26  ? 42.434  54.942  83.006  1.00 44.11  ? 26   ALA A CA  1 
ATOM   202   C  C   . ALA A  1 26  ? 41.880  55.797  81.878  1.00 46.42  ? 26   ALA A C   1 
ATOM   203   O  O   . ALA A  1 26  ? 41.887  55.384  80.716  1.00 48.83  ? 26   ALA A O   1 
ATOM   204   C  CB  . ALA A  1 26  ? 41.286  54.408  83.855  1.00 43.05  ? 26   ALA A CB  1 
ATOM   205   N  N   . ILE A  1 27  ? 41.381  56.979  82.211  1.00 47.75  ? 27   ILE A N   1 
ATOM   206   C  CA  . ILE A  1 27  ? 40.852  57.847  81.179  1.00 50.75  ? 27   ILE A CA  1 
ATOM   207   C  C   . ILE A  1 27  ? 41.956  58.058  80.160  1.00 54.45  ? 27   ILE A C   1 
ATOM   208   O  O   . ILE A  1 27  ? 41.714  58.070  78.955  1.00 56.78  ? 27   ILE A O   1 
ATOM   209   C  CB  . ILE A  1 27  ? 40.414  59.197  81.748  1.00 49.85  ? 27   ILE A CB  1 
ATOM   210   C  CG1 . ILE A  1 27  ? 39.101  59.020  82.508  1.00 49.60  ? 27   ILE A CG1 1 
ATOM   211   C  CG2 . ILE A  1 27  ? 40.267  60.212  80.628  1.00 46.74  ? 27   ILE A CG2 1 
ATOM   212   C  CD1 . ILE A  1 27  ? 38.638  60.260  83.232  1.00 51.06  ? 27   ILE A CD1 1 
ATOM   213   N  N   . ARG A  1 28  ? 43.179  58.207  80.647  1.00 56.00  ? 28   ARG A N   1 
ATOM   214   C  CA  . ARG A  1 28  ? 44.305  58.407  79.754  1.00 59.35  ? 28   ARG A CA  1 
ATOM   215   C  C   . ARG A  1 28  ? 44.401  57.199  78.815  1.00 59.18  ? 28   ARG A C   1 
ATOM   216   O  O   . ARG A  1 28  ? 44.660  57.347  77.616  1.00 57.93  ? 28   ARG A O   1 
ATOM   217   C  CB  . ARG A  1 28  ? 45.588  58.582  80.575  1.00 61.84  ? 28   ARG A CB  1 
ATOM   218   C  CG  . ARG A  1 28  ? 46.814  58.947  79.766  1.00 66.13  ? 28   ARG A CG  1 
ATOM   219   C  CD  . ARG A  1 28  ? 47.775  59.778  80.590  1.00 68.85  ? 28   ARG A CD  1 
ATOM   220   N  NE  . ARG A  1 28  ? 47.168  61.048  80.967  1.00 74.70  ? 28   ARG A NE  1 
ATOM   221   C  CZ  . ARG A  1 28  ? 47.839  62.075  81.481  1.00 76.55  ? 28   ARG A CZ  1 
ATOM   222   N  NH1 . ARG A  1 28  ? 49.143  61.978  81.679  1.00 78.55  ? 28   ARG A NH1 1 
ATOM   223   N  NH2 . ARG A  1 28  ? 47.210  63.203  81.787  1.00 77.12  ? 28   ARG A NH2 1 
ATOM   224   N  N   . THR A  1 29  ? 44.164  56.009  79.364  1.00 57.93  ? 29   THR A N   1 
ATOM   225   C  CA  . THR A  1 29  ? 44.212  54.774  78.587  1.00 57.76  ? 29   THR A CA  1 
ATOM   226   C  C   . THR A  1 29  ? 43.111  54.676  77.529  1.00 59.20  ? 29   THR A C   1 
ATOM   227   O  O   . THR A  1 29  ? 43.343  54.195  76.417  1.00 57.73  ? 29   THR A O   1 
ATOM   228   C  CB  . THR A  1 29  ? 44.089  53.557  79.489  1.00 55.13  ? 29   THR A CB  1 
ATOM   229   O  OG1 . THR A  1 29  ? 45.163  53.563  80.432  1.00 54.49  ? 29   THR A OG1 1 
ATOM   230   C  CG2 . THR A  1 29  ? 44.139  52.283  78.661  1.00 54.35  ? 29   THR A CG2 1 
ATOM   231   N  N   . LEU A  1 30  ? 41.907  55.105  77.887  1.00 58.82  ? 30   LEU A N   1 
ATOM   232   C  CA  . LEU A  1 30  ? 40.811  55.060  76.942  1.00 60.10  ? 30   LEU A CA  1 
ATOM   233   C  C   . LEU A  1 30  ? 41.215  55.958  75.800  1.00 63.17  ? 30   LEU A C   1 
ATOM   234   O  O   . LEU A  1 30  ? 41.413  55.490  74.688  1.00 65.35  ? 30   LEU A O   1 
ATOM   235   C  CB  . LEU A  1 30  ? 39.518  55.590  77.559  1.00 57.33  ? 30   LEU A CB  1 
ATOM   236   C  CG  . LEU A  1 30  ? 39.027  54.909  78.832  1.00 55.31  ? 30   LEU A CG  1 
ATOM   237   C  CD1 . LEU A  1 30  ? 37.662  55.474  79.207  1.00 53.16  ? 30   LEU A CD1 1 
ATOM   238   C  CD2 . LEU A  1 30  ? 38.958  53.410  78.611  1.00 52.73  ? 30   LEU A CD2 1 
ATOM   239   N  N   . LEU A  1 31  ? 41.345  57.251  76.088  1.00 66.47  ? 31   LEU A N   1 
ATOM   240   C  CA  . LEU A  1 31  ? 41.728  58.239  75.087  1.00 67.48  ? 31   LEU A CA  1 
ATOM   241   C  C   . LEU A  1 31  ? 42.771  57.661  74.148  1.00 70.97  ? 31   LEU A C   1 
ATOM   242   O  O   . LEU A  1 31  ? 42.755  57.939  72.954  1.00 73.06  ? 31   LEU A O   1 
ATOM   243   C  CB  . LEU A  1 31  ? 42.276  59.486  75.764  1.00 65.47  ? 31   LEU A CB  1 
ATOM   244   C  CG  . LEU A  1 31  ? 42.620  60.635  74.823  1.00 66.04  ? 31   LEU A CG  1 
ATOM   245   C  CD1 . LEU A  1 31  ? 41.420  60.993  73.959  1.00 63.97  ? 31   LEU A CD1 1 
ATOM   246   C  CD2 . LEU A  1 31  ? 43.056  61.823  75.654  1.00 68.85  ? 31   LEU A CD2 1 
ATOM   247   N  N   . GLU A  1 32  ? 43.676  56.851  74.692  1.00 75.07  ? 32   GLU A N   1 
ATOM   248   C  CA  . GLU A  1 32  ? 44.714  56.201  73.895  1.00 78.88  ? 32   GLU A CA  1 
ATOM   249   C  C   . GLU A  1 32  ? 44.056  55.172  72.984  1.00 80.43  ? 32   GLU A C   1 
ATOM   250   O  O   . GLU A  1 32  ? 44.339  55.104  71.789  1.00 80.44  ? 32   GLU A O   1 
ATOM   251   C  CB  . GLU A  1 32  ? 45.712  55.484  74.801  1.00 80.96  ? 32   GLU A CB  1 
ATOM   252   C  CG  . GLU A  1 32  ? 46.741  54.672  74.039  1.00 85.54  ? 32   GLU A CG  1 
ATOM   253   C  CD  . GLU A  1 32  ? 47.721  55.542  73.273  1.00 88.96  ? 32   GLU A CD  1 
ATOM   254   O  OE1 . GLU A  1 32  ? 47.282  56.531  72.641  1.00 89.69  ? 32   GLU A OE1 1 
ATOM   255   O  OE2 . GLU A  1 32  ? 48.932  55.229  73.295  1.00 90.35  ? 32   GLU A OE2 1 
ATOM   256   N  N   . PHE A  1 33  ? 43.182  54.369  73.582  1.00 82.08  ? 33   PHE A N   1 
ATOM   257   C  CA  . PHE A  1 33  ? 42.428  53.329  72.894  1.00 83.43  ? 33   PHE A CA  1 
ATOM   258   C  C   . PHE A  1 33  ? 41.651  53.900  71.699  1.00 84.46  ? 33   PHE A C   1 
ATOM   259   O  O   . PHE A  1 33  ? 41.622  53.296  70.626  1.00 84.36  ? 33   PHE A O   1 
ATOM   260   C  CB  . PHE A  1 33  ? 41.484  52.675  73.905  1.00 84.72  ? 33   PHE A CB  1 
ATOM   261   C  CG  . PHE A  1 33  ? 40.725  51.494  73.373  1.00 86.36  ? 33   PHE A CG  1 
ATOM   262   C  CD1 . PHE A  1 33  ? 39.628  51.671  72.536  1.00 85.27  ? 33   PHE A CD1 1 
ATOM   263   C  CD2 . PHE A  1 33  ? 41.074  50.200  73.762  1.00 87.61  ? 33   PHE A CD2 1 
ATOM   264   C  CE1 . PHE A  1 33  ? 38.883  50.579  72.099  1.00 85.90  ? 33   PHE A CE1 1 
ATOM   265   C  CE2 . PHE A  1 33  ? 40.337  49.098  73.332  1.00 87.27  ? 33   PHE A CE2 1 
ATOM   266   C  CZ  . PHE A  1 33  ? 39.238  49.289  72.499  1.00 87.77  ? 33   PHE A CZ  1 
ATOM   267   N  N   . LEU A  1 34  ? 41.015  55.055  71.881  1.00 84.81  ? 34   LEU A N   1 
ATOM   268   C  CA  . LEU A  1 34  ? 40.283  55.679  70.784  1.00 86.15  ? 34   LEU A CA  1 
ATOM   269   C  C   . LEU A  1 34  ? 41.269  56.039  69.690  1.00 88.02  ? 34   LEU A C   1 
ATOM   270   O  O   . LEU A  1 34  ? 40.890  56.218  68.535  1.00 89.03  ? 34   LEU A O   1 
ATOM   271   C  CB  . LEU A  1 34  ? 39.577  56.958  71.231  1.00 86.17  ? 34   LEU A CB  1 
ATOM   272   C  CG  . LEU A  1 34  ? 38.284  56.877  72.036  1.00 86.55  ? 34   LEU A CG  1 
ATOM   273   C  CD1 . LEU A  1 34  ? 37.661  58.265  72.063  1.00 87.19  ? 34   LEU A CD1 1 
ATOM   274   C  CD2 . LEU A  1 34  ? 37.318  55.884  71.412  1.00 86.76  ? 34   LEU A CD2 1 
ATOM   275   N  N   . LYS A  1 35  ? 42.537  56.169  70.070  1.00 90.07  ? 35   LYS A N   1 
ATOM   276   C  CA  . LYS A  1 35  ? 43.590  56.494  69.120  1.00 91.33  ? 35   LYS A CA  1 
ATOM   277   C  C   . LYS A  1 35  ? 44.106  55.204  68.476  1.00 93.77  ? 35   LYS A C   1 
ATOM   278   O  O   . LYS A  1 35  ? 45.297  55.043  68.196  1.00 93.06  ? 35   LYS A O   1 
ATOM   279   C  CB  . LYS A  1 35  ? 44.707  57.269  69.823  1.00 89.31  ? 35   LYS A CB  1 
ATOM   280   C  CG  . LYS A  1 35  ? 44.283  58.682  70.212  1.00 86.33  ? 35   LYS A CG  1 
ATOM   281   C  CD  . LYS A  1 35  ? 45.372  59.427  70.958  1.00 85.52  ? 35   LYS A CD  1 
ATOM   282   C  CE  . LYS A  1 35  ? 44.943  60.858  71.246  1.00 85.47  ? 35   LYS A CE  1 
ATOM   283   N  NZ  . LYS A  1 35  ? 45.938  61.597  72.074  1.00 84.56  ? 35   LYS A NZ  1 
ATOM   284   N  N   . ARG A  1 36  ? 43.163  54.288  68.265  1.00 96.90  ? 36   ARG A N   1 
ATOM   285   C  CA  . ARG A  1 36  ? 43.400  53.002  67.623  1.00 99.48  ? 36   ARG A CA  1 
ATOM   286   C  C   . ARG A  1 36  ? 42.418  52.938  66.463  1.00 101.17 ? 36   ARG A C   1 
ATOM   287   O  O   . ARG A  1 36  ? 41.889  53.969  66.048  1.00 100.72 ? 36   ARG A O   1 
ATOM   288   C  CB  . ARG A  1 36  ? 43.145  51.847  68.592  1.00 99.93  ? 36   ARG A CB  1 
ATOM   289   C  CG  . ARG A  1 36  ? 44.182  51.746  69.691  1.00 101.16 ? 36   ARG A CG  1 
ATOM   290   C  CD  . ARG A  1 36  ? 45.585  51.798  69.110  1.00 101.31 ? 36   ARG A CD  1 
ATOM   291   N  NE  . ARG A  1 36  ? 46.611  51.573  70.118  1.00 103.20 ? 36   ARG A NE  1 
ATOM   292   C  CZ  . ARG A  1 36  ? 47.910  51.762  69.913  1.00 105.10 ? 36   ARG A CZ  1 
ATOM   293   N  NH1 . ARG A  1 36  ? 48.781  51.531  70.890  1.00 105.10 ? 36   ARG A NH1 1 
ATOM   294   N  NH2 . ARG A  1 36  ? 48.335  52.194  68.733  1.00 104.95 ? 36   ARG A NH2 1 
ATOM   295   N  N   . ASP A  1 37  ? 42.148  51.747  65.943  1.00 103.62 ? 37   ASP A N   1 
ATOM   296   C  CA  . ASP A  1 37  ? 41.229  51.662  64.817  1.00 105.26 ? 37   ASP A CA  1 
ATOM   297   C  C   . ASP A  1 37  ? 40.908  50.229  64.403  1.00 105.04 ? 37   ASP A C   1 
ATOM   298   O  O   . ASP A  1 37  ? 40.965  49.311  65.220  1.00 104.99 ? 37   ASP A O   1 
ATOM   299   C  CB  . ASP A  1 37  ? 41.829  52.430  63.633  1.00 107.54 ? 37   ASP A CB  1 
ATOM   300   C  CG  . ASP A  1 37  ? 40.788  52.855  62.618  1.00 109.84 ? 37   ASP A CG  1 
ATOM   301   O  OD1 . ASP A  1 37  ? 41.137  53.649  61.718  1.00 111.43 ? 37   ASP A OD1 1 
ATOM   302   O  OD2 . ASP A  1 37  ? 39.628  52.400  62.715  1.00 111.58 ? 37   ASP A OD2 1 
ATOM   303   N  N   . LYS A  1 38  ? 40.563  50.069  63.126  1.00 104.93 ? 38   LYS A N   1 
ATOM   304   C  CA  . LYS A  1 38  ? 40.216  48.786  62.513  1.00 104.89 ? 38   LYS A CA  1 
ATOM   305   C  C   . LYS A  1 38  ? 40.546  47.580  63.390  1.00 104.28 ? 38   LYS A C   1 
ATOM   306   O  O   . LYS A  1 38  ? 39.649  46.897  63.887  1.00 102.56 ? 38   LYS A O   1 
ATOM   307   C  CB  . LYS A  1 38  ? 40.932  48.662  61.159  1.00 104.83 ? 38   LYS A CB  1 
ATOM   308   C  CG  . LYS A  1 38  ? 40.648  47.384  60.379  1.00 103.04 ? 38   LYS A CG  1 
ATOM   309   C  CD  . LYS A  1 38  ? 39.233  47.335  59.821  1.00 101.27 ? 38   LYS A CD  1 
ATOM   310   C  CE  . LYS A  1 38  ? 39.045  46.076  58.982  1.00 100.90 ? 38   LYS A CE  1 
ATOM   311   N  NZ  . LYS A  1 38  ? 37.672  45.933  58.436  1.00 100.14 ? 38   LYS A NZ  1 
ATOM   312   N  N   . GLN A  1 43  ? 29.684  52.855  63.135  1.00 110.00 ? 43   GLN A N   1 
ATOM   313   C  CA  . GLN A  1 43  ? 29.937  53.886  64.137  1.00 110.51 ? 43   GLN A CA  1 
ATOM   314   C  C   . GLN A  1 43  ? 29.876  53.317  65.547  1.00 109.31 ? 43   GLN A C   1 
ATOM   315   O  O   . GLN A  1 43  ? 30.910  53.108  66.182  1.00 108.09 ? 43   GLN A O   1 
ATOM   316   C  CB  . GLN A  1 43  ? 28.919  55.022  64.007  1.00 111.81 ? 43   GLN A CB  1 
ATOM   317   C  CG  . GLN A  1 43  ? 29.047  56.087  65.094  1.00 113.22 ? 43   GLN A CG  1 
ATOM   318   C  CD  . GLN A  1 43  ? 30.403  56.782  65.091  1.00 113.66 ? 43   GLN A CD  1 
ATOM   319   O  OE1 . GLN A  1 43  ? 31.452  56.137  65.169  1.00 113.96 ? 43   GLN A OE1 1 
ATOM   320   N  NE2 . GLN A  1 43  ? 30.384  58.107  65.009  1.00 113.62 ? 43   GLN A NE2 1 
ATOM   321   N  N   . GLY A  1 44  ? 28.657  53.080  66.033  1.00 108.57 ? 44   GLY A N   1 
ATOM   322   C  CA  . GLY A  1 44  ? 28.479  52.519  67.360  1.00 106.69 ? 44   GLY A CA  1 
ATOM   323   C  C   . GLY A  1 44  ? 29.245  51.216  67.436  1.00 106.62 ? 44   GLY A C   1 
ATOM   324   O  O   . GLY A  1 44  ? 29.255  50.537  68.462  1.00 105.42 ? 44   GLY A O   1 
ATOM   325   N  N   . LEU A  1 45  ? 29.882  50.876  66.318  1.00 106.89 ? 45   LEU A N   1 
ATOM   326   C  CA  . LEU A  1 45  ? 30.692  49.671  66.185  1.00 106.91 ? 45   LEU A CA  1 
ATOM   327   C  C   . LEU A  1 45  ? 31.866  49.772  67.153  1.00 106.48 ? 45   LEU A C   1 
ATOM   328   O  O   . LEU A  1 45  ? 32.327  48.770  67.704  1.00 106.15 ? 45   LEU A O   1 
ATOM   329   C  CB  . LEU A  1 45  ? 31.223  49.556  64.747  1.00 106.35 ? 45   LEU A CB  1 
ATOM   330   C  CG  . LEU A  1 45  ? 30.230  49.648  63.581  1.00 104.08 ? 45   LEU A CG  1 
ATOM   331   C  CD1 . LEU A  1 45  ? 30.997  49.614  62.278  1.00 102.40 ? 45   LEU A CD1 1 
ATOM   332   C  CD2 . LEU A  1 45  ? 29.225  48.505  63.641  1.00 102.58 ? 45   LEU A CD2 1 
ATOM   333   N  N   . ARG A  1 46  ? 32.340  51.000  67.346  1.00 106.29 ? 46   ARG A N   1 
ATOM   334   C  CA  . ARG A  1 46  ? 33.461  51.280  68.236  1.00 105.23 ? 46   ARG A CA  1 
ATOM   335   C  C   . ARG A  1 46  ? 32.950  51.632  69.634  1.00 103.11 ? 46   ARG A C   1 
ATOM   336   O  O   . ARG A  1 46  ? 33.594  51.316  70.638  1.00 102.57 ? 46   ARG A O   1 
ATOM   337   C  CB  . ARG A  1 46  ? 34.303  52.439  67.676  1.00 107.00 ? 46   ARG A CB  1 
ATOM   338   C  CG  . ARG A  1 46  ? 34.880  52.207  66.268  1.00 110.35 ? 46   ARG A CG  1 
ATOM   339   C  CD  . ARG A  1 46  ? 33.816  52.280  65.162  1.00 111.59 ? 46   ARG A CD  1 
ATOM   340   N  NE  . ARG A  1 46  ? 34.327  51.819  63.869  1.00 112.88 ? 46   ARG A NE  1 
ATOM   341   C  CZ  . ARG A  1 46  ? 33.616  51.793  62.745  1.00 112.97 ? 46   ARG A CZ  1 
ATOM   342   N  NH1 . ARG A  1 46  ? 32.355  52.205  62.744  1.00 113.20 ? 46   ARG A NH1 1 
ATOM   343   N  NH2 . ARG A  1 46  ? 34.162  51.346  61.621  1.00 110.41 ? 46   ARG A NH2 1 
ATOM   344   N  N   . ALA A  1 47  ? 31.784  52.277  69.687  1.00 100.00 ? 47   ALA A N   1 
ATOM   345   C  CA  . ALA A  1 47  ? 31.169  52.680  70.950  1.00 96.57  ? 47   ALA A CA  1 
ATOM   346   C  C   . ALA A  1 47  ? 31.029  51.500  71.908  1.00 94.24  ? 47   ALA A C   1 
ATOM   347   O  O   . ALA A  1 47  ? 31.043  51.676  73.129  1.00 93.96  ? 47   ALA A O   1 
ATOM   348   C  CB  . ALA A  1 47  ? 29.796  53.320  70.695  1.00 95.51  ? 47   ALA A CB  1 
ATOM   349   N  N   . ASN A  1 48  ? 30.889  50.299  71.354  1.00 91.32  ? 48   ASN A N   1 
ATOM   350   C  CA  . ASN A  1 48  ? 30.757  49.097  72.174  1.00 88.23  ? 48   ASN A CA  1 
ATOM   351   C  C   . ASN A  1 48  ? 32.144  48.551  72.439  1.00 84.86  ? 48   ASN A C   1 
ATOM   352   O  O   . ASN A  1 48  ? 32.358  47.804  73.391  1.00 83.85  ? 48   ASN A O   1 
ATOM   353   C  CB  . ASN A  1 48  ? 29.922  48.036  71.455  1.00 90.47  ? 48   ASN A CB  1 
ATOM   354   C  CG  . ASN A  1 48  ? 28.488  48.480  71.212  1.00 91.96  ? 48   ASN A CG  1 
ATOM   355   O  OD1 . ASN A  1 48  ? 28.238  49.501  70.563  1.00 91.30  ? 48   ASN A OD1 1 
ATOM   356   N  ND2 . ASN A  1 48  ? 27.537  47.708  71.731  1.00 92.47  ? 48   ASN A ND2 1 
ATOM   357   N  N   . LEU A  1 49  ? 33.081  48.936  71.581  1.00 81.89  ? 49   LEU A N   1 
ATOM   358   C  CA  . LEU A  1 49  ? 34.462  48.502  71.704  1.00 80.78  ? 49   LEU A CA  1 
ATOM   359   C  C   . LEU A  1 49  ? 35.103  49.179  72.909  1.00 79.95  ? 49   LEU A C   1 
ATOM   360   O  O   . LEU A  1 49  ? 36.022  48.635  73.527  1.00 78.70  ? 49   LEU A O   1 
ATOM   361   C  CB  . LEU A  1 49  ? 35.227  48.842  70.425  1.00 80.86  ? 49   LEU A CB  1 
ATOM   362   C  CG  . LEU A  1 49  ? 34.716  48.139  69.159  1.00 81.00  ? 49   LEU A CG  1 
ATOM   363   C  CD1 . LEU A  1 49  ? 35.458  48.675  67.952  1.00 79.77  ? 49   LEU A CD1 1 
ATOM   364   C  CD2 . LEU A  1 49  ? 34.896  46.627  69.276  1.00 78.45  ? 49   LEU A CD2 1 
ATOM   365   N  N   . THR A  1 50  ? 34.603  50.366  73.243  1.00 78.70  ? 50   THR A N   1 
ATOM   366   C  CA  . THR A  1 50  ? 35.108  51.112  74.389  1.00 77.40  ? 50   THR A CA  1 
ATOM   367   C  C   . THR A  1 50  ? 34.511  50.570  75.686  1.00 77.19  ? 50   THR A C   1 
ATOM   368   O  O   . THR A  1 50  ? 35.244  50.135  76.566  1.00 78.15  ? 50   THR A O   1 
ATOM   369   C  CB  . THR A  1 50  ? 34.772  52.614  74.294  1.00 76.57  ? 50   THR A CB  1 
ATOM   370   O  OG1 . THR A  1 50  ? 35.383  53.173  73.126  1.00 75.05  ? 50   THR A OG1 1 
ATOM   371   C  CG2 . THR A  1 50  ? 35.298  53.349  75.518  1.00 75.57  ? 50   THR A CG2 1 
ATOM   372   N  N   . SER A  1 51  ? 33.183  50.597  75.801  1.00 75.90  ? 51   SER A N   1 
ATOM   373   C  CA  . SER A  1 51  ? 32.503  50.100  76.998  1.00 73.74  ? 51   SER A CA  1 
ATOM   374   C  C   . SER A  1 51  ? 33.107  48.774  77.429  1.00 74.06  ? 51   SER A C   1 
ATOM   375   O  O   . SER A  1 51  ? 33.262  48.507  78.621  1.00 73.37  ? 51   SER A O   1 
ATOM   376   C  CB  . SER A  1 51  ? 31.015  49.892  76.724  1.00 72.51  ? 51   SER A CB  1 
ATOM   377   O  OG  . SER A  1 51  ? 30.429  51.057  76.174  1.00 73.22  ? 51   SER A OG  1 
ATOM   378   N  N   . ALA A  1 52  ? 33.451  47.950  76.445  1.00 75.21  ? 52   ALA A N   1 
ATOM   379   C  CA  . ALA A  1 52  ? 34.036  46.639  76.697  1.00 76.06  ? 52   ALA A CA  1 
ATOM   380   C  C   . ALA A  1 52  ? 35.405  46.722  77.352  1.00 75.77  ? 52   ALA A C   1 
ATOM   381   O  O   . ALA A  1 52  ? 35.972  45.704  77.740  1.00 75.33  ? 52   ALA A O   1 
ATOM   382   C  CB  . ALA A  1 52  ? 34.139  45.859  75.390  1.00 77.46  ? 52   ALA A CB  1 
ATOM   383   N  N   . ILE A  1 53  ? 35.936  47.931  77.480  1.00 76.71  ? 53   ILE A N   1 
ATOM   384   C  CA  . ILE A  1 53  ? 37.252  48.103  78.078  1.00 79.07  ? 53   ILE A CA  1 
ATOM   385   C  C   . ILE A  1 53  ? 37.256  48.746  79.469  1.00 77.73  ? 53   ILE A C   1 
ATOM   386   O  O   . ILE A  1 53  ? 38.224  48.608  80.204  1.00 77.76  ? 53   ILE A O   1 
ATOM   387   C  CB  . ILE A  1 53  ? 38.174  48.899  77.131  1.00 80.78  ? 53   ILE A CB  1 
ATOM   388   C  CG1 . ILE A  1 53  ? 37.840  50.389  77.182  1.00 82.60  ? 53   ILE A CG1 1 
ATOM   389   C  CG2 . ILE A  1 53  ? 38.001  48.381  75.708  1.00 82.79  ? 53   ILE A CG2 1 
ATOM   390   C  CD1 . ILE A  1 53  ? 38.634  51.231  76.202  1.00 84.69  ? 53   ILE A CD1 1 
ATOM   391   N  N   . GLU A  1 54  ? 36.190  49.453  79.828  1.00 76.50  ? 54   GLU A N   1 
ATOM   392   C  CA  . GLU A  1 54  ? 36.115  50.059  81.152  1.00 75.41  ? 54   GLU A CA  1 
ATOM   393   C  C   . GLU A  1 54  ? 35.975  48.902  82.113  1.00 75.05  ? 54   GLU A C   1 
ATOM   394   O  O   . GLU A  1 54  ? 36.638  48.852  83.152  1.00 76.45  ? 54   GLU A O   1 
ATOM   395   C  CB  . GLU A  1 54  ? 34.885  50.954  81.295  1.00 76.85  ? 54   GLU A CB  1 
ATOM   396   C  CG  . GLU A  1 54  ? 35.049  52.372  80.807  1.00 80.30  ? 54   GLU A CG  1 
ATOM   397   C  CD  . GLU A  1 54  ? 35.330  52.458  79.322  1.00 84.54  ? 54   GLU A CD  1 
ATOM   398   O  OE1 . GLU A  1 54  ? 35.102  53.541  78.738  1.00 86.18  ? 54   GLU A OE1 1 
ATOM   399   O  OE2 . GLU A  1 54  ? 35.785  51.454  78.735  1.00 84.71  ? 54   GLU A OE2 1 
ATOM   400   N  N   . THR A  1 55  ? 35.094  47.971  81.755  1.00 73.52  ? 55   THR A N   1 
ATOM   401   C  CA  . THR A  1 55  ? 34.862  46.797  82.581  1.00 72.45  ? 55   THR A CA  1 
ATOM   402   C  C   . THR A  1 55  ? 36.193  46.065  82.667  1.00 69.79  ? 55   THR A C   1 
ATOM   403   O  O   . THR A  1 55  ? 36.562  45.562  83.722  1.00 68.31  ? 55   THR A O   1 
ATOM   404   C  CB  . THR A  1 55  ? 33.798  45.857  81.965  1.00 73.93  ? 55   THR A CB  1 
ATOM   405   O  OG1 . THR A  1 55  ? 34.373  45.155  80.860  1.00 77.36  ? 55   THR A OG1 1 
ATOM   406   C  CG2 . THR A  1 55  ? 32.586  46.651  81.472  1.00 71.36  ? 55   THR A CG2 1 
ATOM   407   N  N   . LEU A  1 56  ? 36.913  46.022  81.548  1.00 68.84  ? 56   LEU A N   1 
ATOM   408   C  CA  . LEU A  1 56  ? 38.216  45.373  81.508  1.00 69.21  ? 56   LEU A CA  1 
ATOM   409   C  C   . LEU A  1 56  ? 39.091  46.023  82.565  1.00 68.84  ? 56   LEU A C   1 
ATOM   410   O  O   . LEU A  1 56  ? 39.814  45.342  83.295  1.00 68.67  ? 56   LEU A O   1 
ATOM   411   C  CB  . LEU A  1 56  ? 38.859  45.524  80.125  1.00 70.35  ? 56   LEU A CB  1 
ATOM   412   C  CG  . LEU A  1 56  ? 38.206  44.712  79.000  1.00 73.78  ? 56   LEU A CG  1 
ATOM   413   C  CD1 . LEU A  1 56  ? 38.880  45.035  77.668  1.00 74.19  ? 56   LEU A CD1 1 
ATOM   414   C  CD2 . LEU A  1 56  ? 38.300  43.217  79.319  1.00 73.80  ? 56   LEU A CD2 1 
ATOM   415   N  N   . CYS A  1 57  ? 39.015  47.346  82.655  1.00 68.88  ? 57   CYS A N   1 
ATOM   416   C  CA  . CYS A  1 57  ? 39.787  48.069  83.651  1.00 68.94  ? 57   CYS A CA  1 
ATOM   417   C  C   . CYS A  1 57  ? 39.205  47.799  85.036  1.00 69.55  ? 57   CYS A C   1 
ATOM   418   O  O   . CYS A  1 57  ? 39.487  48.508  85.995  1.00 69.06  ? 57   CYS A O   1 
ATOM   419   C  CB  . CYS A  1 57  ? 39.819  49.568  83.334  1.00 66.80  ? 57   CYS A CB  1 
ATOM   420   S  SG  . CYS A  1 57  ? 41.159  50.027  82.171  1.00 66.35  ? 57   CYS A SG  1 
ATOM   421   N  N   . GLY A  1 58  ? 38.384  46.755  85.120  1.00 71.16  ? 58   GLY A N   1 
ATOM   422   C  CA  . GLY A  1 58  ? 37.817  46.349  86.390  1.00 70.87  ? 58   GLY A CA  1 
ATOM   423   C  C   . GLY A  1 58  ? 38.941  45.550  87.030  1.00 73.30  ? 58   GLY A C   1 
ATOM   424   O  O   . GLY A  1 58  ? 38.720  44.565  87.739  1.00 72.18  ? 58   GLY A O   1 
ATOM   425   N  N   . VAL A  1 59  ? 40.168  45.982  86.728  1.00 73.41  ? 59   VAL A N   1 
ATOM   426   C  CA  . VAL A  1 59  ? 41.404  45.392  87.240  1.00 70.85  ? 59   VAL A CA  1 
ATOM   427   C  C   . VAL A  1 59  ? 41.851  46.310  88.380  1.00 69.20  ? 59   VAL A C   1 
ATOM   428   O  O   . VAL A  1 59  ? 42.986  46.254  88.858  1.00 66.61  ? 59   VAL A O   1 
ATOM   429   C  CB  . VAL A  1 59  ? 42.497  45.369  86.146  1.00 71.83  ? 59   VAL A CB  1 
ATOM   430   C  CG1 . VAL A  1 59  ? 42.895  46.791  85.782  1.00 70.29  ? 59   VAL A CG1 1 
ATOM   431   C  CG2 . VAL A  1 59  ? 43.700  44.577  86.623  1.00 72.74  ? 59   VAL A CG2 1 
ATOM   432   N  N   . ASP A  1 60  ? 40.922  47.170  88.782  1.00 66.93  ? 60   ASP A N   1 
ATOM   433   C  CA  . ASP A  1 60  ? 41.113  48.129  89.856  1.00 63.38  ? 60   ASP A CA  1 
ATOM   434   C  C   . ASP A  1 60  ? 39.705  48.485  90.324  1.00 61.34  ? 60   ASP A C   1 
ATOM   435   O  O   . ASP A  1 60  ? 38.930  49.113  89.597  1.00 60.40  ? 60   ASP A O   1 
ATOM   436   C  CB  . ASP A  1 60  ? 41.838  49.370  89.338  1.00 63.71  ? 60   ASP A CB  1 
ATOM   437   C  CG  . ASP A  1 60  ? 42.215  50.325  90.450  1.00 63.90  ? 60   ASP A CG  1 
ATOM   438   O  OD1 . ASP A  1 60  ? 42.935  51.308  90.187  1.00 61.81  ? 60   ASP A OD1 1 
ATOM   439   O  OD2 . ASP A  1 60  ? 41.788  50.088  91.596  1.00 68.32  ? 60   ASP A OD2 1 
ATOM   440   N  N   . SER A  1 61  ? 39.380  48.065  91.540  1.00 58.32  ? 61   SER A N   1 
ATOM   441   C  CA  . SER A  1 61  ? 38.058  48.293  92.105  1.00 56.78  ? 61   SER A CA  1 
ATOM   442   C  C   . SER A  1 61  ? 37.665  49.751  92.356  1.00 54.43  ? 61   SER A C   1 
ATOM   443   O  O   . SER A  1 61  ? 36.477  50.048  92.477  1.00 55.95  ? 61   SER A O   1 
ATOM   444   C  CB  . SER A  1 61  ? 37.913  47.492  93.400  1.00 56.93  ? 61   SER A CB  1 
ATOM   445   O  OG  . SER A  1 61  ? 38.914  47.851  94.332  1.00 59.69  ? 61   SER A OG  1 
ATOM   446   N  N   . SER A  1 62  ? 38.650  50.647  92.423  1.00 49.64  ? 62   SER A N   1 
ATOM   447   C  CA  . SER A  1 62  ? 38.417  52.080  92.662  1.00 44.77  ? 62   SER A CA  1 
ATOM   448   C  C   . SER A  1 62  ? 37.077  52.596  92.140  1.00 42.00  ? 62   SER A C   1 
ATOM   449   O  O   . SER A  1 62  ? 36.704  52.350  90.992  1.00 39.36  ? 62   SER A O   1 
ATOM   450   C  CB  . SER A  1 62  ? 39.530  52.917  92.024  1.00 45.30  ? 62   SER A CB  1 
ATOM   451   O  OG  . SER A  1 62  ? 40.808  52.535  92.490  1.00 48.19  ? 62   SER A OG  1 
ATOM   452   N  N   . VAL A  1 63  ? 36.362  53.319  92.992  1.00 38.00  ? 63   VAL A N   1 
ATOM   453   C  CA  . VAL A  1 63  ? 35.083  53.879  92.610  1.00 36.59  ? 63   VAL A CA  1 
ATOM   454   C  C   . VAL A  1 63  ? 35.345  54.866  91.489  1.00 34.68  ? 63   VAL A C   1 
ATOM   455   O  O   . VAL A  1 63  ? 34.596  54.929  90.524  1.00 36.44  ? 63   VAL A O   1 
ATOM   456   C  CB  . VAL A  1 63  ? 34.418  54.645  93.788  1.00 39.74  ? 63   VAL A CB  1 
ATOM   457   C  CG1 . VAL A  1 63  ? 33.139  55.300  93.325  1.00 40.03  ? 63   VAL A CG1 1 
ATOM   458   C  CG2 . VAL A  1 63  ? 34.121  53.703  94.936  1.00 41.62  ? 63   VAL A CG2 1 
ATOM   459   N  N   . ALA A  1 64  ? 36.426  55.625  91.620  1.00 32.56  ? 64   ALA A N   1 
ATOM   460   C  CA  . ALA A  1 64  ? 36.783  56.635  90.631  1.00 34.77  ? 64   ALA A CA  1 
ATOM   461   C  C   . ALA A  1 64  ? 36.987  56.091  89.217  1.00 35.57  ? 64   ALA A C   1 
ATOM   462   O  O   . ALA A  1 64  ? 36.490  56.680  88.254  1.00 34.16  ? 64   ALA A O   1 
ATOM   463   C  CB  . ALA A  1 64  ? 38.024  57.388  91.084  1.00 36.22  ? 64   ALA A CB  1 
ATOM   464   N  N   . VAL A  1 65  ? 37.720  54.983  89.084  1.00 35.00  ? 65   VAL A N   1 
ATOM   465   C  CA  . VAL A  1 65  ? 37.952  54.385  87.764  1.00 32.69  ? 65   VAL A CA  1 
ATOM   466   C  C   . VAL A  1 65  ? 36.608  54.109  87.090  1.00 33.75  ? 65   VAL A C   1 
ATOM   467   O  O   . VAL A  1 65  ? 36.438  54.324  85.888  1.00 31.31  ? 65   VAL A O   1 
ATOM   468   C  CB  . VAL A  1 65  ? 38.740  53.070  87.869  1.00 31.37  ? 65   VAL A CB  1 
ATOM   469   C  CG1 . VAL A  1 65  ? 38.480  52.206  86.636  1.00 27.22  ? 65   VAL A CG1 1 
ATOM   470   C  CG2 . VAL A  1 65  ? 40.221  53.367  88.005  1.00 27.42  ? 65   VAL A CG2 1 
ATOM   471   N  N   . SER A  1 66  ? 35.660  53.630  87.886  1.00 33.70  ? 66   SER A N   1 
ATOM   472   C  CA  . SER A  1 66  ? 34.324  53.343  87.411  1.00 34.49  ? 66   SER A CA  1 
ATOM   473   C  C   . SER A  1 66  ? 33.589  54.641  86.987  1.00 36.88  ? 66   SER A C   1 
ATOM   474   O  O   . SER A  1 66  ? 33.232  54.795  85.816  1.00 38.25  ? 66   SER A O   1 
ATOM   475   C  CB  . SER A  1 66  ? 33.559  52.610  88.520  1.00 34.37  ? 66   SER A CB  1 
ATOM   476   O  OG  . SER A  1 66  ? 32.189  52.434  88.210  1.00 34.89  ? 66   SER A OG  1 
ATOM   477   N  N   . SER A  1 67  ? 33.385  55.577  87.920  1.00 34.34  ? 67   SER A N   1 
ATOM   478   C  CA  . SER A  1 67  ? 32.668  56.816  87.615  1.00 33.71  ? 67   SER A CA  1 
ATOM   479   C  C   . SER A  1 67  ? 33.353  57.741  86.599  1.00 37.24  ? 67   SER A C   1 
ATOM   480   O  O   . SER A  1 67  ? 32.685  58.325  85.742  1.00 39.99  ? 67   SER A O   1 
ATOM   481   C  CB  . SER A  1 67  ? 32.366  57.602  88.908  1.00 32.46  ? 67   SER A CB  1 
ATOM   482   O  OG  . SER A  1 67  ? 33.528  58.126  89.536  1.00 27.92  ? 67   SER A OG  1 
ATOM   483   N  N   . GLY A  1 68  ? 34.673  57.891  86.696  1.00 37.37  ? 68   GLY A N   1 
ATOM   484   C  CA  . GLY A  1 68  ? 35.385  58.746  85.762  1.00 34.77  ? 68   GLY A CA  1 
ATOM   485   C  C   . GLY A  1 68  ? 35.256  58.156  84.370  1.00 36.08  ? 68   GLY A C   1 
ATOM   486   O  O   . GLY A  1 68  ? 35.038  58.867  83.377  1.00 32.70  ? 68   GLY A O   1 
ATOM   487   N  N   . GLY A  1 69  ? 35.386  56.835  84.305  1.00 34.71  ? 69   GLY A N   1 
ATOM   488   C  CA  . GLY A  1 69  ? 35.265  56.155  83.041  1.00 36.63  ? 69   GLY A CA  1 
ATOM   489   C  C   . GLY A  1 69  ? 33.902  56.473  82.463  1.00 40.66  ? 69   GLY A C   1 
ATOM   490   O  O   . GLY A  1 69  ? 33.788  56.832  81.291  1.00 41.98  ? 69   GLY A O   1 
ATOM   491   N  N   . GLU A  1 70  ? 32.864  56.363  83.285  1.00 39.18  ? 70   GLU A N   1 
ATOM   492   C  CA  . GLU A  1 70  ? 31.520  56.631  82.808  1.00 39.98  ? 70   GLU A CA  1 
ATOM   493   C  C   . GLU A  1 70  ? 31.411  58.056  82.290  1.00 39.29  ? 70   GLU A C   1 
ATOM   494   O  O   . GLU A  1 70  ? 30.884  58.283  81.199  1.00 38.78  ? 70   GLU A O   1 
ATOM   495   C  CB  . GLU A  1 70  ? 30.497  56.397  83.923  1.00 45.04  ? 70   GLU A CB  1 
ATOM   496   C  CG  . GLU A  1 70  ? 29.039  56.404  83.451  1.00 52.81  ? 70   GLU A CG  1 
ATOM   497   C  CD  . GLU A  1 70  ? 28.048  55.994  84.547  1.00 59.29  ? 70   GLU A CD  1 
ATOM   498   O  OE1 . GLU A  1 70  ? 28.297  54.965  85.226  1.00 63.04  ? 70   GLU A OE1 1 
ATOM   499   O  OE2 . GLU A  1 70  ? 27.015  56.687  84.722  1.00 57.25  ? 70   GLU A OE2 1 
ATOM   500   N  N   . LEU A  1 71  ? 31.913  59.011  83.070  1.00 37.91  ? 71   LEU A N   1 
ATOM   501   C  CA  . LEU A  1 71  ? 31.861  60.416  82.691  1.00 37.17  ? 71   LEU A CA  1 
ATOM   502   C  C   . LEU A  1 71  ? 32.615  60.715  81.400  1.00 40.59  ? 71   LEU A C   1 
ATOM   503   O  O   . LEU A  1 71  ? 32.169  61.530  80.594  1.00 41.98  ? 71   LEU A O   1 
ATOM   504   C  CB  . LEU A  1 71  ? 32.414  61.274  83.813  1.00 30.97  ? 71   LEU A CB  1 
ATOM   505   C  CG  . LEU A  1 71  ? 31.462  61.491  84.977  1.00 29.82  ? 71   LEU A CG  1 
ATOM   506   C  CD1 . LEU A  1 71  ? 32.208  62.193  86.078  1.00 24.82  ? 71   LEU A CD1 1 
ATOM   507   C  CD2 . LEU A  1 71  ? 30.254  62.304  84.524  1.00 23.02  ? 71   LEU A CD2 1 
ATOM   508   N  N   . PHE A  1 72  ? 33.764  60.070  81.214  1.00 42.79  ? 72   PHE A N   1 
ATOM   509   C  CA  . PHE A  1 72  ? 34.546  60.258  80.002  1.00 43.30  ? 72   PHE A CA  1 
ATOM   510   C  C   . PHE A  1 72  ? 33.708  59.832  78.790  1.00 44.44  ? 72   PHE A C   1 
ATOM   511   O  O   . PHE A  1 72  ? 33.630  60.550  77.800  1.00 45.14  ? 72   PHE A O   1 
ATOM   512   C  CB  . PHE A  1 72  ? 35.824  59.421  80.055  1.00 44.10  ? 72   PHE A CB  1 
ATOM   513   C  CG  . PHE A  1 72  ? 36.666  59.533  78.819  1.00 44.95  ? 72   PHE A CG  1 
ATOM   514   C  CD1 . PHE A  1 72  ? 37.299  60.730  78.501  1.00 45.33  ? 72   PHE A CD1 1 
ATOM   515   C  CD2 . PHE A  1 72  ? 36.799  58.452  77.952  1.00 46.44  ? 72   PHE A CD2 1 
ATOM   516   C  CE1 . PHE A  1 72  ? 38.052  60.852  77.335  1.00 47.16  ? 72   PHE A CE1 1 
ATOM   517   C  CE2 . PHE A  1 72  ? 37.548  58.562  76.782  1.00 47.20  ? 72   PHE A CE2 1 
ATOM   518   C  CZ  . PHE A  1 72  ? 38.175  59.766  76.472  1.00 47.80  ? 72   PHE A CZ  1 
ATOM   519   N  N   . LEU A  1 73  ? 33.081  58.661  78.878  1.00 46.44  ? 73   LEU A N   1 
ATOM   520   C  CA  . LEU A  1 73  ? 32.246  58.143  77.792  1.00 47.24  ? 73   LEU A CA  1 
ATOM   521   C  C   . LEU A  1 73  ? 31.092  59.079  77.472  1.00 46.11  ? 73   LEU A C   1 
ATOM   522   O  O   . LEU A  1 73  ? 30.881  59.448  76.313  1.00 46.64  ? 73   LEU A O   1 
ATOM   523   C  CB  . LEU A  1 73  ? 31.710  56.755  78.147  1.00 46.46  ? 73   LEU A CB  1 
ATOM   524   C  CG  . LEU A  1 73  ? 32.829  55.740  78.413  1.00 50.61  ? 73   LEU A CG  1 
ATOM   525   C  CD1 . LEU A  1 73  ? 32.268  54.327  78.496  1.00 51.49  ? 73   LEU A CD1 1 
ATOM   526   C  CD2 . LEU A  1 73  ? 33.854  55.822  77.294  1.00 50.96  ? 73   LEU A CD2 1 
ATOM   527   N  N   . ARG A  1 74  ? 30.352  59.469  78.500  1.00 43.56  ? 74   ARG A N   1 
ATOM   528   C  CA  . ARG A  1 74  ? 29.234  60.374  78.318  1.00 44.65  ? 74   ARG A CA  1 
ATOM   529   C  C   . ARG A  1 74  ? 29.653  61.706  77.689  1.00 48.44  ? 74   ARG A C   1 
ATOM   530   O  O   . ARG A  1 74  ? 28.854  62.364  77.018  1.00 50.36  ? 74   ARG A O   1 
ATOM   531   C  CB  . ARG A  1 74  ? 28.577  60.662  79.656  1.00 44.80  ? 74   ARG A CB  1 
ATOM   532   C  CG  . ARG A  1 74  ? 28.070  59.452  80.385  1.00 45.82  ? 74   ARG A CG  1 
ATOM   533   C  CD  . ARG A  1 74  ? 27.404  59.902  81.669  1.00 49.61  ? 74   ARG A CD  1 
ATOM   534   N  NE  . ARG A  1 74  ? 26.128  60.562  81.421  1.00 47.58  ? 74   ARG A NE  1 
ATOM   535   C  CZ  . ARG A  1 74  ? 24.951  59.962  81.561  1.00 50.16  ? 74   ARG A CZ  1 
ATOM   536   N  NH1 . ARG A  1 74  ? 24.894  58.692  81.953  1.00 48.86  ? 74   ARG A NH1 1 
ATOM   537   N  NH2 . ARG A  1 74  ? 23.834  60.628  81.305  1.00 49.06  ? 74   ARG A NH2 1 
ATOM   538   N  N   . PHE A  1 75  ? 30.898  62.114  77.906  1.00 50.93  ? 75   PHE A N   1 
ATOM   539   C  CA  . PHE A  1 75  ? 31.359  63.383  77.356  1.00 52.63  ? 75   PHE A CA  1 
ATOM   540   C  C   . PHE A  1 75  ? 31.587  63.326  75.852  1.00 53.73  ? 75   PHE A C   1 
ATOM   541   O  O   . PHE A  1 75  ? 31.501  64.337  75.160  1.00 52.53  ? 75   PHE A O   1 
ATOM   542   C  CB  . PHE A  1 75  ? 32.640  63.839  78.045  1.00 52.09  ? 75   PHE A CB  1 
ATOM   543   C  CG  . PHE A  1 75  ? 32.920  65.292  77.858  1.00 51.33  ? 75   PHE A CG  1 
ATOM   544   C  CD1 . PHE A  1 75  ? 32.121  66.244  78.481  1.00 51.16  ? 75   PHE A CD1 1 
ATOM   545   C  CD2 . PHE A  1 75  ? 33.946  65.711  77.025  1.00 51.38  ? 75   PHE A CD2 1 
ATOM   546   C  CE1 . PHE A  1 75  ? 32.337  67.596  78.278  1.00 54.44  ? 75   PHE A CE1 1 
ATOM   547   C  CE2 . PHE A  1 75  ? 34.177  67.064  76.809  1.00 56.04  ? 75   PHE A CE2 1 
ATOM   548   C  CZ  . PHE A  1 75  ? 33.370  68.013  77.438  1.00 57.82  ? 75   PHE A CZ  1 
ATOM   549   N  N   . ILE A  1 76  ? 31.883  62.137  75.353  1.00 56.11  ? 76   ILE A N   1 
ATOM   550   C  CA  . ILE A  1 76  ? 32.103  61.941  73.933  1.00 59.49  ? 76   ILE A CA  1 
ATOM   551   C  C   . ILE A  1 76  ? 30.754  61.914  73.184  1.00 63.95  ? 76   ILE A C   1 
ATOM   552   O  O   . ILE A  1 76  ? 29.941  60.995  73.363  1.00 63.32  ? 76   ILE A O   1 
ATOM   553   C  CB  . ILE A  1 76  ? 32.860  60.635  73.710  1.00 56.32  ? 76   ILE A CB  1 
ATOM   554   C  CG1 . ILE A  1 76  ? 34.207  60.700  74.422  1.00 50.11  ? 76   ILE A CG1 1 
ATOM   555   C  CG2 . ILE A  1 76  ? 33.034  60.389  72.235  1.00 60.15  ? 76   ILE A CG2 1 
ATOM   556   C  CD1 . ILE A  1 76  ? 34.960  59.418  74.357  1.00 47.96  ? 76   ILE A CD1 1 
ATOM   557   N  N   . SER A  1 77  ? 30.535  62.938  72.356  1.00 68.24  ? 77   SER A N   1 
ATOM   558   C  CA  . SER A  1 77  ? 29.303  63.116  71.568  1.00 71.70  ? 77   SER A CA  1 
ATOM   559   C  C   . SER A  1 77  ? 28.067  63.286  72.460  1.00 72.87  ? 77   SER A C   1 
ATOM   560   O  O   . SER A  1 77  ? 27.213  64.147  72.212  1.00 73.31  ? 77   SER A O   1 
ATOM   561   C  CB  . SER A  1 77  ? 29.074  61.936  70.615  1.00 73.46  ? 77   SER A CB  1 
ATOM   562   O  OG  . SER A  1 77  ? 28.509  60.829  71.295  1.00 74.10  ? 77   SER A OG  1 
ATOM   563   N  N   . CYS A  1 89  ? 35.764  60.722  60.907  1.00 94.34  ? 89   CYS A N   1 
ATOM   564   C  CA  . CYS A  1 89  ? 34.487  60.651  61.608  1.00 97.51  ? 89   CYS A CA  1 
ATOM   565   C  C   . CYS A  1 89  ? 34.650  60.679  63.131  1.00 97.81  ? 89   CYS A C   1 
ATOM   566   O  O   . CYS A  1 89  ? 34.170  61.598  63.802  1.00 98.29  ? 89   CYS A O   1 
ATOM   567   C  CB  . CYS A  1 89  ? 33.727  59.380  61.202  1.00 98.25  ? 89   CYS A CB  1 
ATOM   568   S  SG  . CYS A  1 89  ? 32.959  59.419  59.557  1.00 101.30 ? 89   CYS A SG  1 
ATOM   569   N  N   . LYS A  1 90  ? 35.327  59.669  63.671  1.00 98.07  ? 90   LYS A N   1 
ATOM   570   C  CA  . LYS A  1 90  ? 35.546  59.568  65.114  1.00 96.51  ? 90   LYS A CA  1 
ATOM   571   C  C   . LYS A  1 90  ? 36.768  60.375  65.551  1.00 95.75  ? 90   LYS A C   1 
ATOM   572   O  O   . LYS A  1 90  ? 37.589  59.911  66.348  1.00 93.74  ? 90   LYS A O   1 
ATOM   573   C  CB  . LYS A  1 90  ? 35.712  58.097  65.518  1.00 96.43  ? 90   LYS A CB  1 
ATOM   574   C  CG  . LYS A  1 90  ? 35.539  57.837  67.015  1.00 97.44  ? 90   LYS A CG  1 
ATOM   575   C  CD  . LYS A  1 90  ? 35.302  56.350  67.328  1.00 94.64  ? 90   LYS A CD  1 
ATOM   576   C  CE  . LYS A  1 90  ? 35.006  56.126  68.809  1.00 90.39  ? 90   LYS A CE  1 
ATOM   577   N  NZ  . LYS A  1 90  ? 34.867  54.684  69.148  1.00 87.29  ? 90   LYS A NZ  1 
ATOM   578   N  N   . LYS A  1 91  ? 36.881  61.583  65.007  1.00 95.36  ? 91   LYS A N   1 
ATOM   579   C  CA  . LYS A  1 91  ? 37.982  62.482  65.331  1.00 95.04  ? 91   LYS A CA  1 
ATOM   580   C  C   . LYS A  1 91  ? 37.505  63.333  66.490  1.00 94.34  ? 91   LYS A C   1 
ATOM   581   O  O   . LYS A  1 91  ? 38.171  63.438  67.520  1.00 96.02  ? 91   LYS A O   1 
ATOM   582   C  CB  . LYS A  1 91  ? 38.308  63.412  64.151  1.00 95.07  ? 91   LYS A CB  1 
ATOM   583   C  CG  . LYS A  1 91  ? 38.652  62.720  62.845  1.00 95.04  ? 91   LYS A CG  1 
ATOM   584   C  CD  . LYS A  1 91  ? 38.596  63.704  61.683  1.00 95.27  ? 91   LYS A CD  1 
ATOM   585   C  CE  . LYS A  1 91  ? 38.569  62.978  60.340  1.00 95.66  ? 91   LYS A CE  1 
ATOM   586   N  NZ  . LYS A  1 91  ? 38.325  63.898  59.190  1.00 93.37  ? 91   LYS A NZ  1 
ATOM   587   N  N   . ILE A  1 92  ? 36.332  63.932  66.305  1.00 91.61  ? 92   ILE A N   1 
ATOM   588   C  CA  . ILE A  1 92  ? 35.726  64.802  67.302  1.00 89.78  ? 92   ILE A CA  1 
ATOM   589   C  C   . ILE A  1 92  ? 35.604  64.133  68.670  1.00 88.34  ? 92   ILE A C   1 
ATOM   590   O  O   . ILE A  1 92  ? 35.470  64.802  69.695  1.00 85.77  ? 92   ILE A O   1 
ATOM   591   C  CB  . ILE A  1 92  ? 34.328  65.267  66.850  1.00 89.82  ? 92   ILE A CB  1 
ATOM   592   C  CG1 . ILE A  1 92  ? 34.365  65.719  65.385  1.00 90.84  ? 92   ILE A CG1 1 
ATOM   593   C  CG2 . ILE A  1 92  ? 33.866  66.418  67.724  1.00 88.99  ? 92   ILE A CG2 1 
ATOM   594   C  CD1 . ILE A  1 92  ? 34.513  64.586  64.375  1.00 91.10  ? 92   ILE A CD1 1 
HETATM 595   N  N   . MSE A  1 93  ? 35.659  62.807  68.676  1.00 88.52  ? 93   MSE A N   1 
HETATM 596   C  CA  . MSE A  1 93  ? 35.555  62.043  69.908  1.00 87.38  ? 93   MSE A CA  1 
HETATM 597   C  C   . MSE A  1 93  ? 36.911  61.988  70.580  1.00 83.49  ? 93   MSE A C   1 
HETATM 598   O  O   . MSE A  1 93  ? 37.003  61.968  71.804  1.00 82.53  ? 93   MSE A O   1 
HETATM 599   C  CB  . MSE A  1 93  ? 35.052  60.633  69.608  1.00 92.13  ? 93   MSE A CB  1 
HETATM 600   C  CG  . MSE A  1 93  ? 33.860  60.628  68.665  1.00 99.19  ? 93   MSE A CG  1 
HETATM 601   SE SE  . MSE A  1 93  ? 32.789  59.031  68.742  1.00 109.11 ? 93   MSE A SE  1 
HETATM 602   C  CE  . MSE A  1 93  ? 31.036  59.865  68.870  1.00 105.35 ? 93   MSE A CE  1 
ATOM   603   N  N   . ILE A  1 94  ? 37.964  61.960  69.772  1.00 79.46  ? 94   ILE A N   1 
ATOM   604   C  CA  . ILE A  1 94  ? 39.313  61.937  70.309  1.00 76.17  ? 94   ILE A CA  1 
ATOM   605   C  C   . ILE A  1 94  ? 39.670  63.370  70.668  1.00 74.64  ? 94   ILE A C   1 
ATOM   606   O  O   . ILE A  1 94  ? 40.684  63.623  71.295  1.00 74.65  ? 94   ILE A O   1 
ATOM   607   C  CB  . ILE A  1 94  ? 40.340  61.388  69.285  1.00 72.61  ? 94   ILE A CB  1 
ATOM   608   C  CG1 . ILE A  1 94  ? 40.006  59.934  68.946  1.00 72.10  ? 94   ILE A CG1 1 
ATOM   609   C  CG2 . ILE A  1 94  ? 41.741  61.442  69.868  1.00 72.91  ? 94   ILE A CG2 1 
ATOM   610   C  CD1 . ILE A  1 94  ? 40.976  59.280  67.989  1.00 66.65  ? 94   ILE A CD1 1 
ATOM   611   N  N   . GLU A  1 95  ? 38.818  64.308  70.277  1.00 74.66  ? 95   GLU A N   1 
ATOM   612   C  CA  . GLU A  1 95  ? 39.061  65.717  70.565  1.00 76.45  ? 95   GLU A CA  1 
ATOM   613   C  C   . GLU A  1 95  ? 38.372  66.115  71.871  1.00 76.08  ? 95   GLU A C   1 
ATOM   614   O  O   . GLU A  1 95  ? 39.014  66.655  72.774  1.00 77.51  ? 95   GLU A O   1 
ATOM   615   C  CB  . GLU A  1 95  ? 38.567  66.579  69.397  1.00 78.59  ? 95   GLU A CB  1 
ATOM   616   C  CG  . GLU A  1 95  ? 39.184  66.177  68.054  1.00 83.80  ? 95   GLU A CG  1 
ATOM   617   C  CD  . GLU A  1 95  ? 38.604  66.931  66.855  1.00 87.86  ? 95   GLU A CD  1 
ATOM   618   O  OE1 . GLU A  1 95  ? 37.374  66.865  66.629  1.00 88.22  ? 95   GLU A OE1 1 
ATOM   619   O  OE2 . GLU A  1 95  ? 39.385  67.583  66.127  1.00 89.72  ? 95   GLU A OE2 1 
ATOM   620   N  N   . ARG A  1 96  ? 37.069  65.844  71.968  1.00 74.29  ? 96   ARG A N   1 
ATOM   621   C  CA  . ARG A  1 96  ? 36.302  66.147  73.176  1.00 69.26  ? 96   ARG A CA  1 
ATOM   622   C  C   . ARG A  1 96  ? 36.934  65.394  74.344  1.00 65.68  ? 96   ARG A C   1 
ATOM   623   O  O   . ARG A  1 96  ? 36.920  65.861  75.477  1.00 62.73  ? 96   ARG A O   1 
ATOM   624   C  CB  . ARG A  1 96  ? 34.844  65.687  73.037  1.00 71.25  ? 96   ARG A CB  1 
ATOM   625   C  CG  . ARG A  1 96  ? 34.061  66.314  71.907  1.00 73.14  ? 96   ARG A CG  1 
ATOM   626   C  CD  . ARG A  1 96  ? 32.553  66.314  72.199  1.00 75.42  ? 96   ARG A CD  1 
ATOM   627   N  NE  . ARG A  1 96  ? 32.194  67.296  73.228  1.00 79.32  ? 96   ARG A NE  1 
ATOM   628   C  CZ  . ARG A  1 96  ? 30.947  67.672  73.514  1.00 80.99  ? 96   ARG A CZ  1 
ATOM   629   N  NH1 . ARG A  1 96  ? 29.919  67.152  72.853  1.00 82.34  ? 96   ARG A NH1 1 
ATOM   630   N  NH2 . ARG A  1 96  ? 30.725  68.581  74.456  1.00 80.36  ? 96   ARG A NH2 1 
ATOM   631   N  N   . GLY A  1 97  ? 37.469  64.213  74.052  1.00 62.59  ? 97   GLY A N   1 
ATOM   632   C  CA  . GLY A  1 97  ? 38.106  63.410  75.075  1.00 60.78  ? 97   GLY A CA  1 
ATOM   633   C  C   . GLY A  1 97  ? 39.389  64.054  75.554  1.00 61.42  ? 97   GLY A C   1 
ATOM   634   O  O   . GLY A  1 97  ? 39.754  63.939  76.721  1.00 63.29  ? 97   GLY A O   1 
ATOM   635   N  N   . GLU A  1 98  ? 40.090  64.729  74.657  1.00 59.47  ? 98   GLU A N   1 
ATOM   636   C  CA  . GLU A  1 98  ? 41.315  65.383  75.054  1.00 59.09  ? 98   GLU A CA  1 
ATOM   637   C  C   . GLU A  1 98  ? 40.930  66.611  75.856  1.00 56.54  ? 98   GLU A C   1 
ATOM   638   O  O   . GLU A  1 98  ? 41.572  66.942  76.850  1.00 57.17  ? 98   GLU A O   1 
ATOM   639   C  CB  . GLU A  1 98  ? 42.151  65.750  73.826  1.00 63.00  ? 98   GLU A CB  1 
ATOM   640   C  CG  . GLU A  1 98  ? 42.663  64.513  73.096  1.00 68.64  ? 98   GLU A CG  1 
ATOM   641   C  CD  . GLU A  1 98  ? 43.657  64.812  71.987  1.00 72.11  ? 98   GLU A CD  1 
ATOM   642   O  OE1 . GLU A  1 98  ? 43.473  65.814  71.258  1.00 73.33  ? 98   GLU A OE1 1 
ATOM   643   O  OE2 . GLU A  1 98  ? 44.618  64.021  71.836  1.00 74.73  ? 98   GLU A OE2 1 
ATOM   644   N  N   . LEU A  1 99  ? 39.861  67.270  75.438  1.00 52.94  ? 99   LEU A N   1 
ATOM   645   C  CA  . LEU A  1 99  ? 39.383  68.450  76.142  1.00 52.07  ? 99   LEU A CA  1 
ATOM   646   C  C   . LEU A  1 99  ? 38.882  68.070  77.545  1.00 51.41  ? 99   LEU A C   1 
ATOM   647   O  O   . LEU A  1 99  ? 38.802  68.916  78.441  1.00 54.35  ? 99   LEU A O   1 
ATOM   648   C  CB  . LEU A  1 99  ? 38.268  69.115  75.333  1.00 53.19  ? 99   LEU A CB  1 
ATOM   649   C  CG  . LEU A  1 99  ? 37.712  70.433  75.872  1.00 56.37  ? 99   LEU A CG  1 
ATOM   650   C  CD1 . LEU A  1 99  ? 37.385  71.349  74.699  1.00 59.41  ? 99   LEU A CD1 1 
ATOM   651   C  CD2 . LEU A  1 99  ? 36.475  70.175  76.746  1.00 58.23  ? 99   LEU A CD2 1 
ATOM   652   N  N   . PHE A  1 100 ? 38.553  66.796  77.736  1.00 46.93  ? 100  PHE A N   1 
ATOM   653   C  CA  . PHE A  1 100 ? 38.078  66.306  79.028  1.00 42.35  ? 100  PHE A CA  1 
ATOM   654   C  C   . PHE A  1 100 ? 39.297  65.962  79.889  1.00 41.13  ? 100  PHE A C   1 
ATOM   655   O  O   . PHE A  1 100 ? 39.379  66.365  81.044  1.00 39.06  ? 100  PHE A O   1 
ATOM   656   C  CB  . PHE A  1 100 ? 37.172  65.085  78.811  1.00 39.10  ? 100  PHE A CB  1 
ATOM   657   C  CG  . PHE A  1 100 ? 36.629  64.470  80.074  1.00 39.01  ? 100  PHE A CG  1 
ATOM   658   C  CD1 . PHE A  1 100 ? 37.309  63.426  80.710  1.00 39.73  ? 100  PHE A CD1 1 
ATOM   659   C  CD2 . PHE A  1 100 ? 35.393  64.871  80.587  1.00 41.03  ? 100  PHE A CD2 1 
ATOM   660   C  CE1 . PHE A  1 100 ? 36.765  62.781  81.834  1.00 35.94  ? 100  PHE A CE1 1 
ATOM   661   C  CE2 . PHE A  1 100 ? 34.839  64.233  81.711  1.00 38.90  ? 100  PHE A CE2 1 
ATOM   662   C  CZ  . PHE A  1 100 ? 35.529  63.184  82.332  1.00 37.66  ? 100  PHE A CZ  1 
ATOM   663   N  N   . LEU A  1 101 ? 40.255  65.238  79.324  1.00 40.01  ? 101  LEU A N   1 
ATOM   664   C  CA  . LEU A  1 101 ? 41.452  64.890  80.077  1.00 43.67  ? 101  LEU A CA  1 
ATOM   665   C  C   . LEU A  1 101 ? 42.140  66.176  80.563  1.00 44.84  ? 101  LEU A C   1 
ATOM   666   O  O   . LEU A  1 101 ? 42.440  66.341  81.743  1.00 44.10  ? 101  LEU A O   1 
ATOM   667   C  CB  . LEU A  1 101 ? 42.417  64.097  79.203  1.00 44.47  ? 101  LEU A CB  1 
ATOM   668   C  CG  . LEU A  1 101 ? 43.262  63.079  79.965  1.00 48.10  ? 101  LEU A CG  1 
ATOM   669   C  CD1 . LEU A  1 101 ? 44.236  62.420  79.012  1.00 51.01  ? 101  LEU A CD1 1 
ATOM   670   C  CD2 . LEU A  1 101 ? 44.009  63.760  81.094  1.00 51.38  ? 101  LEU A CD2 1 
ATOM   671   N  N   . ARG A  1 102 ? 42.382  67.090  79.640  1.00 46.34  ? 102  ARG A N   1 
ATOM   672   C  CA  . ARG A  1 102 ? 43.015  68.352  79.973  1.00 48.19  ? 102  ARG A CA  1 
ATOM   673   C  C   . ARG A  1 102 ? 42.264  69.058  81.087  1.00 47.65  ? 102  ARG A C   1 
ATOM   674   O  O   . ARG A  1 102 ? 42.850  69.801  81.863  1.00 52.10  ? 102  ARG A O   1 
ATOM   675   C  CB  . ARG A  1 102 ? 43.038  69.247  78.741  1.00 51.49  ? 102  ARG A CB  1 
ATOM   676   C  CG  . ARG A  1 102 ? 43.469  70.680  78.983  1.00 55.32  ? 102  ARG A CG  1 
ATOM   677   C  CD  . ARG A  1 102 ? 42.893  71.560  77.884  1.00 61.66  ? 102  ARG A CD  1 
ATOM   678   N  NE  . ARG A  1 102 ? 42.922  70.861  76.599  1.00 63.96  ? 102  ARG A NE  1 
ATOM   679   C  CZ  . ARG A  1 102 ? 42.201  71.205  75.538  1.00 63.22  ? 102  ARG A CZ  1 
ATOM   680   N  NH1 . ARG A  1 102 ? 41.384  72.255  75.599  1.00 62.99  ? 102  ARG A NH1 1 
ATOM   681   N  NH2 . ARG A  1 102 ? 42.282  70.481  74.427  1.00 59.03  ? 102  ARG A NH2 1 
ATOM   682   N  N   . ARG A  1 103 ? 40.963  68.832  81.168  1.00 46.96  ? 103  ARG A N   1 
ATOM   683   C  CA  . ARG A  1 103 ? 40.173  69.493  82.191  1.00 45.66  ? 103  ARG A CA  1 
ATOM   684   C  C   . ARG A  1 103 ? 40.244  68.807  83.547  1.00 43.01  ? 103  ARG A C   1 
ATOM   685   O  O   . ARG A  1 103 ? 40.416  69.472  84.567  1.00 42.91  ? 103  ARG A O   1 
ATOM   686   C  CB  . ARG A  1 103 ? 38.718  69.607  81.737  1.00 49.19  ? 103  ARG A CB  1 
ATOM   687   C  CG  . ARG A  1 103 ? 37.890  70.546  82.583  1.00 53.74  ? 103  ARG A CG  1 
ATOM   688   C  CD  . ARG A  1 103 ? 36.949  69.801  83.504  1.00 58.87  ? 103  ARG A CD  1 
ATOM   689   N  NE  . ARG A  1 103 ? 36.738  70.552  84.741  1.00 67.04  ? 103  ARG A NE  1 
ATOM   690   C  CZ  . ARG A  1 103 ? 35.804  70.285  85.653  1.00 67.67  ? 103  ARG A CZ  1 
ATOM   691   N  NH1 . ARG A  1 103 ? 34.956  69.271  85.485  1.00 66.04  ? 103  ARG A NH1 1 
ATOM   692   N  NH2 . ARG A  1 103 ? 35.731  71.034  86.747  1.00 66.30  ? 103  ARG A NH2 1 
ATOM   693   N  N   . ILE A  1 104 ? 40.121  67.484  83.574  1.00 40.03  ? 104  ILE A N   1 
ATOM   694   C  CA  . ILE A  1 104 ? 40.167  66.776  84.850  1.00 37.40  ? 104  ILE A CA  1 
ATOM   695   C  C   . ILE A  1 104 ? 41.522  66.903  85.523  1.00 37.82  ? 104  ILE A C   1 
ATOM   696   O  O   . ILE A  1 104 ? 41.633  66.710  86.731  1.00 39.93  ? 104  ILE A O   1 
ATOM   697   C  CB  . ILE A  1 104 ? 39.866  65.260  84.715  1.00 36.11  ? 104  ILE A CB  1 
ATOM   698   C  CG1 . ILE A  1 104 ? 40.867  64.609  83.771  1.00 30.81  ? 104  ILE A CG1 1 
ATOM   699   C  CG2 . ILE A  1 104 ? 38.435  65.031  84.241  1.00 36.15  ? 104  ILE A CG2 1 
ATOM   700   C  CD1 . ILE A  1 104 ? 40.654  63.131  83.636  1.00 30.16  ? 104  ILE A CD1 1 
ATOM   701   N  N   . SER A  1 105 ? 42.557  67.230  84.753  1.00 35.03  ? 105  SER A N   1 
ATOM   702   C  CA  . SER A  1 105 ? 43.883  67.341  85.338  1.00 31.94  ? 105  SER A CA  1 
ATOM   703   C  C   . SER A  1 105 ? 44.178  68.740  85.844  1.00 30.20  ? 105  SER A C   1 
ATOM   704   O  O   . SER A  1 105 ? 45.320  69.131  86.010  1.00 26.55  ? 105  SER A O   1 
ATOM   705   C  CB  . SER A  1 105 ? 44.943  66.879  84.339  1.00 31.38  ? 105  SER A CB  1 
ATOM   706   O  OG  . SER A  1 105 ? 44.612  67.277  83.033  1.00 37.09  ? 105  SER A OG  1 
ATOM   707   N  N   . LEU A  1 106 ? 43.120  69.484  86.114  1.00 30.31  ? 106  LEU A N   1 
ATOM   708   C  CA  . LEU A  1 106 ? 43.247  70.829  86.620  1.00 27.95  ? 106  LEU A CA  1 
ATOM   709   C  C   . LEU A  1 106 ? 42.513  70.871  87.948  1.00 29.73  ? 106  LEU A C   1 
ATOM   710   O  O   . LEU A  1 106 ? 42.598  71.850  88.705  1.00 31.83  ? 106  LEU A O   1 
ATOM   711   C  CB  . LEU A  1 106 ? 42.617  71.799  85.629  1.00 25.92  ? 106  LEU A CB  1 
ATOM   712   C  CG  . LEU A  1 106 ? 43.516  72.879  85.014  1.00 33.09  ? 106  LEU A CG  1 
ATOM   713   C  CD1 . LEU A  1 106 ? 44.941  72.357  84.803  1.00 28.02  ? 106  LEU A CD1 1 
ATOM   714   C  CD2 . LEU A  1 106 ? 42.891  73.334  83.692  1.00 28.23  ? 106  LEU A CD2 1 
ATOM   715   N  N   . SER A  1 107 ? 41.807  69.782  88.230  1.00 28.70  ? 107  SER A N   1 
ATOM   716   C  CA  . SER A  1 107 ? 41.008  69.679  89.440  1.00 31.44  ? 107  SER A CA  1 
ATOM   717   C  C   . SER A  1 107 ? 41.803  69.844  90.740  1.00 31.80  ? 107  SER A C   1 
ATOM   718   O  O   . SER A  1 107 ? 41.411  70.619  91.620  1.00 30.41  ? 107  SER A O   1 
ATOM   719   C  CB  . SER A  1 107 ? 40.247  68.350  89.421  1.00 32.35  ? 107  SER A CB  1 
ATOM   720   O  OG  . SER A  1 107 ? 39.473  68.248  88.235  1.00 28.04  ? 107  SER A OG  1 
ATOM   721   N  N   . ARG A  1 108 ? 42.918  69.128  90.858  1.00 31.15  ? 108  ARG A N   1 
ATOM   722   C  CA  . ARG A  1 108 ? 43.738  69.231  92.057  1.00 33.01  ? 108  ARG A CA  1 
ATOM   723   C  C   . ARG A  1 108 ? 44.209  70.647  92.378  1.00 33.82  ? 108  ARG A C   1 
ATOM   724   O  O   . ARG A  1 108 ? 44.210  71.019  93.541  1.00 36.67  ? 108  ARG A O   1 
ATOM   725   C  CB  . ARG A  1 108 ? 44.949  68.300  91.969  1.00 32.59  ? 108  ARG A CB  1 
ATOM   726   C  CG  . ARG A  1 108 ? 44.631  66.874  92.337  1.00 36.01  ? 108  ARG A CG  1 
ATOM   727   C  CD  . ARG A  1 108 ? 45.875  66.023  92.424  1.00 38.27  ? 108  ARG A CD  1 
ATOM   728   N  NE  . ARG A  1 108 ? 45.522  64.610  92.449  1.00 40.95  ? 108  ARG A NE  1 
ATOM   729   C  CZ  . ARG A  1 108 ? 46.346  63.642  92.074  1.00 43.57  ? 108  ARG A CZ  1 
ATOM   730   N  NH1 . ARG A  1 108 ? 47.566  63.957  91.658  1.00 44.26  ? 108  ARG A NH1 1 
ATOM   731   N  NH2 . ARG A  1 108 ? 45.941  62.372  92.075  1.00 40.63  ? 108  ARG A NH2 1 
ATOM   732   N  N   . ASN A  1 109 ? 44.622  71.429  91.374  1.00 35.45  ? 109  ASN A N   1 
ATOM   733   C  CA  . ASN A  1 109 ? 45.065  72.810  91.612  1.00 32.54  ? 109  ASN A CA  1 
ATOM   734   C  C   . ASN A  1 109 ? 43.889  73.607  92.124  1.00 33.50  ? 109  ASN A C   1 
ATOM   735   O  O   . ASN A  1 109 ? 44.028  74.400  93.060  1.00 32.81  ? 109  ASN A O   1 
ATOM   736   C  CB  . ASN A  1 109 ? 45.537  73.496  90.336  1.00 36.79  ? 109  ASN A CB  1 
ATOM   737   C  CG  . ASN A  1 109 ? 46.804  72.890  89.768  1.00 39.76  ? 109  ASN A CG  1 
ATOM   738   O  OD1 . ASN A  1 109 ? 47.474  72.066  90.415  1.00 33.05  ? 109  ASN A OD1 1 
ATOM   739   N  ND2 . ASN A  1 109 ? 47.152  73.309  88.542  1.00 31.77  ? 109  ASN A ND2 1 
ATOM   740   N  N   . LYS A  1 110 ? 42.728  73.398  91.501  1.00 30.94  ? 110  LYS A N   1 
ATOM   741   C  CA  . LYS A  1 110 ? 41.520  74.102  91.910  1.00 27.00  ? 110  LYS A CA  1 
ATOM   742   C  C   . LYS A  1 110 ? 41.137  73.778  93.350  1.00 24.87  ? 110  LYS A C   1 
ATOM   743   O  O   . LYS A  1 110 ? 40.833  74.684  94.135  1.00 20.75  ? 110  LYS A O   1 
ATOM   744   C  CB  . LYS A  1 110 ? 40.357  73.762  90.984  1.00 28.63  ? 110  LYS A CB  1 
ATOM   745   C  CG  . LYS A  1 110 ? 40.485  74.316  89.583  1.00 33.01  ? 110  LYS A CG  1 
ATOM   746   C  CD  . LYS A  1 110 ? 39.155  74.263  88.859  1.00 37.99  ? 110  LYS A CD  1 
ATOM   747   C  CE  . LYS A  1 110 ? 39.220  74.983  87.523  1.00 40.13  ? 110  LYS A CE  1 
ATOM   748   N  NZ  . LYS A  1 110 ? 40.148  74.325  86.568  1.00 42.97  ? 110  LYS A NZ  1 
ATOM   749   N  N   . ILE A  1 111 ? 41.153  72.492  93.694  1.00 20.29  ? 111  ILE A N   1 
ATOM   750   C  CA  . ILE A  1 111 ? 40.797  72.068  95.043  1.00 23.10  ? 111  ILE A CA  1 
ATOM   751   C  C   . ILE A  1 111 ? 41.791  72.633  96.067  1.00 24.98  ? 111  ILE A C   1 
ATOM   752   O  O   . ILE A  1 111 ? 41.421  72.988  97.202  1.00 22.88  ? 111  ILE A O   1 
ATOM   753   C  CB  . ILE A  1 111 ? 40.737  70.523  95.136  1.00 18.96  ? 111  ILE A CB  1 
ATOM   754   C  CG1 . ILE A  1 111 ? 39.603  70.006  94.262  1.00 15.38  ? 111  ILE A CG1 1 
ATOM   755   C  CG2 . ILE A  1 111 ? 40.472  70.087  96.553  1.00 18.04  ? 111  ILE A CG2 1 
ATOM   756   C  CD1 . ILE A  1 111 ? 39.731  68.558  93.870  1.00 11.91  ? 111  ILE A CD1 1 
ATOM   757   N  N   . ALA A  1 112 ? 43.049  72.739  95.649  1.00 25.84  ? 112  ALA A N   1 
ATOM   758   C  CA  . ALA A  1 112 ? 44.102  73.277  96.510  1.00 27.40  ? 112  ALA A CA  1 
ATOM   759   C  C   . ALA A  1 112 ? 43.887  74.783  96.728  1.00 26.39  ? 112  ALA A C   1 
ATOM   760   O  O   . ALA A  1 112 ? 43.992  75.271  97.852  1.00 27.93  ? 112  ALA A O   1 
ATOM   761   C  CB  . ALA A  1 112 ? 45.482  73.003  95.891  1.00 22.70  ? 112  ALA A CB  1 
ATOM   762   N  N   . ASP A  1 113 ? 43.585  75.515  95.661  1.00 26.00  ? 113  ASP A N   1 
ATOM   763   C  CA  . ASP A  1 113 ? 43.340  76.945  95.787  1.00 31.39  ? 113  ASP A CA  1 
ATOM   764   C  C   . ASP A  1 113 ? 42.165  77.197  96.731  1.00 31.30  ? 113  ASP A C   1 
ATOM   765   O  O   . ASP A  1 113 ? 42.294  77.909  97.723  1.00 31.92  ? 113  ASP A O   1 
ATOM   766   C  CB  . ASP A  1 113 ? 42.994  77.570  94.433  1.00 39.42  ? 113  ASP A CB  1 
ATOM   767   C  CG  . ASP A  1 113 ? 44.118  77.462  93.415  1.00 44.82  ? 113  ASP A CG  1 
ATOM   768   O  OD1 . ASP A  1 113 ? 45.286  77.743  93.775  1.00 46.80  ? 113  ASP A OD1 1 
ATOM   769   O  OD2 . ASP A  1 113 ? 43.817  77.114  92.244  1.00 49.06  ? 113  ASP A OD2 1 
ATOM   770   N  N   . LEU A  1 114 ? 41.023  76.590  96.415  1.00 31.01  ? 114  LEU A N   1 
ATOM   771   C  CA  . LEU A  1 114 ? 39.801  76.755  97.200  1.00 28.98  ? 114  LEU A CA  1 
ATOM   772   C  C   . LEU A  1 114 ? 39.849  76.408  98.671  1.00 30.06  ? 114  LEU A C   1 
ATOM   773   O  O   . LEU A  1 114 ? 39.368  77.176  99.516  1.00 26.19  ? 114  LEU A O   1 
ATOM   774   C  CB  . LEU A  1 114 ? 38.663  75.966  96.566  1.00 24.26  ? 114  LEU A CB  1 
ATOM   775   C  CG  . LEU A  1 114 ? 38.217  76.596  95.253  1.00 26.33  ? 114  LEU A CG  1 
ATOM   776   C  CD1 . LEU A  1 114 ? 37.131  75.762  94.602  1.00 24.34  ? 114  LEU A CD1 1 
ATOM   777   C  CD2 . LEU A  1 114 ? 37.738  77.997  95.538  1.00 23.23  ? 114  LEU A CD2 1 
ATOM   778   N  N   . CYS A  1 115 ? 40.438  75.254  98.967  1.00 31.70  ? 115  CYS A N   1 
ATOM   779   C  CA  . CYS A  1 115 ? 40.508  74.745  100.325 1.00 27.34  ? 115  CYS A CA  1 
ATOM   780   C  C   . CYS A  1 115 ? 41.581  75.252  101.281 1.00 29.50  ? 115  CYS A C   1 
ATOM   781   O  O   . CYS A  1 115 ? 41.283  75.463  102.452 1.00 29.56  ? 115  CYS A O   1 
ATOM   782   C  CB  . CYS A  1 115 ? 40.579  73.233  100.278 1.00 24.92  ? 115  CYS A CB  1 
ATOM   783   S  SG  . CYS A  1 115 ? 40.529  72.482  101.902 1.00 36.15  ? 115  CYS A SG  1 
ATOM   784   N  N   . HIS A  1 116 ? 42.818  75.450  100.819 1.00 30.41  ? 116  HIS A N   1 
ATOM   785   C  CA  . HIS A  1 116 ? 43.871  75.882  101.738 1.00 30.51  ? 116  HIS A CA  1 
ATOM   786   C  C   . HIS A  1 116 ? 43.541  77.197  102.431 1.00 31.60  ? 116  HIS A C   1 
ATOM   787   O  O   . HIS A  1 116 ? 44.206  77.608  103.364 1.00 35.60  ? 116  HIS A O   1 
ATOM   788   C  CB  . HIS A  1 116 ? 45.203  76.032  101.011 1.00 30.68  ? 116  HIS A CB  1 
ATOM   789   C  CG  . HIS A  1 116 ? 45.408  77.387  100.409 1.00 33.78  ? 116  HIS A CG  1 
ATOM   790   N  ND1 . HIS A  1 116 ? 45.028  77.697  99.120  1.00 30.11  ? 116  HIS A ND1 1 
ATOM   791   C  CD2 . HIS A  1 116 ? 45.896  78.532  100.943 1.00 30.71  ? 116  HIS A CD2 1 
ATOM   792   C  CE1 . HIS A  1 116 ? 45.272  78.973  98.887  1.00 28.93  ? 116  HIS A CE1 1 
ATOM   793   N  NE2 . HIS A  1 116 ? 45.797  79.502  99.978  1.00 31.60  ? 116  HIS A NE2 1 
ATOM   794   N  N   . THR A  1 117 ? 42.501  77.859  101.970 1.00 35.30  ? 117  THR A N   1 
ATOM   795   C  CA  . THR A  1 117 ? 42.113  79.135  102.537 1.00 35.23  ? 117  THR A CA  1 
ATOM   796   C  C   . THR A  1 117 ? 41.363  78.989  103.868 1.00 34.18  ? 117  THR A C   1 
ATOM   797   O  O   . THR A  1 117 ? 41.332  79.910  104.675 1.00 34.87  ? 117  THR A O   1 
ATOM   798   C  CB  . THR A  1 117 ? 41.251  79.917  101.511 1.00 34.47  ? 117  THR A CB  1 
ATOM   799   O  OG1 . THR A  1 117 ? 41.159  81.280  101.917 1.00 41.90  ? 117  THR A OG1 1 
ATOM   800   C  CG2 . THR A  1 117 ? 39.845  79.333  101.410 1.00 30.00  ? 117  THR A CG2 1 
ATOM   801   N  N   . PHE A  1 118 ? 40.762  77.826  104.090 1.00 35.02  ? 118  PHE A N   1 
ATOM   802   C  CA  . PHE A  1 118 ? 40.000  77.554  105.315 1.00 34.94  ? 118  PHE A CA  1 
ATOM   803   C  C   . PHE A  1 118 ? 40.869  77.088  106.487 1.00 35.28  ? 118  PHE A C   1 
ATOM   804   O  O   . PHE A  1 118 ? 40.350  76.665  107.513 1.00 36.66  ? 118  PHE A O   1 
ATOM   805   C  CB  . PHE A  1 118 ? 38.930  76.484  105.044 1.00 33.08  ? 118  PHE A CB  1 
ATOM   806   C  CG  . PHE A  1 118 ? 37.742  76.995  104.298 1.00 35.28  ? 118  PHE A CG  1 
ATOM   807   C  CD1 . PHE A  1 118 ? 37.898  77.605  103.051 1.00 33.76  ? 118  PHE A CD1 1 
ATOM   808   C  CD2 . PHE A  1 118 ? 36.463  76.937  104.874 1.00 32.57  ? 118  PHE A CD2 1 
ATOM   809   C  CE1 . PHE A  1 118 ? 36.797  78.164  102.387 1.00 33.91  ? 118  PHE A CE1 1 
ATOM   810   C  CE2 . PHE A  1 118 ? 35.365  77.485  104.229 1.00 28.27  ? 118  PHE A CE2 1 
ATOM   811   C  CZ  . PHE A  1 118 ? 35.528  78.104  102.979 1.00 29.59  ? 118  PHE A CZ  1 
ATOM   812   N  N   . ILE A  1 119 ? 42.184  77.170  106.332 1.00 33.82  ? 119  ILE A N   1 
ATOM   813   C  CA  . ILE A  1 119 ? 43.101  76.728  107.371 1.00 31.56  ? 119  ILE A CA  1 
ATOM   814   C  C   . ILE A  1 119 ? 43.677  77.905  108.136 1.00 32.55  ? 119  ILE A C   1 
ATOM   815   O  O   . ILE A  1 119 ? 44.587  78.572  107.660 1.00 35.02  ? 119  ILE A O   1 
ATOM   816   C  CB  . ILE A  1 119 ? 44.246  75.925  106.747 1.00 28.52  ? 119  ILE A CB  1 
ATOM   817   C  CG1 . ILE A  1 119 ? 43.669  74.748  105.979 1.00 26.24  ? 119  ILE A CG1 1 
ATOM   818   C  CG2 . ILE A  1 119 ? 45.178  75.436  107.806 1.00 27.26  ? 119  ILE A CG2 1 
ATOM   819   C  CD1 . ILE A  1 119 ? 44.636  74.101  105.093 1.00 26.64  ? 119  ILE A CD1 1 
ATOM   820   N  N   . LYS A  1 120 ? 43.151  78.151  109.329 1.00 34.58  ? 120  LYS A N   1 
ATOM   821   C  CA  . LYS A  1 120 ? 43.624  79.258  110.139 1.00 36.05  ? 120  LYS A CA  1 
ATOM   822   C  C   . LYS A  1 120 ? 45.092  79.085  110.463 1.00 38.87  ? 120  LYS A C   1 
ATOM   823   O  O   . LYS A  1 120 ? 45.585  77.964  110.575 1.00 40.41  ? 120  LYS A O   1 
ATOM   824   C  CB  . LYS A  1 120 ? 42.810  79.353  111.422 1.00 37.74  ? 120  LYS A CB  1 
ATOM   825   C  CG  . LYS A  1 120 ? 41.875  80.551  111.450 1.00 44.68  ? 120  LYS A CG  1 
ATOM   826   C  CD  . LYS A  1 120 ? 40.432  80.192  111.851 1.00 46.96  ? 120  LYS A CD  1 
ATOM   827   C  CE  . LYS A  1 120 ? 39.621  79.608  110.681 1.00 48.18  ? 120  LYS A CE  1 
ATOM   828   N  NZ  . LYS A  1 120 ? 38.164  79.437  111.017 1.00 45.46  ? 120  LYS A NZ  1 
ATOM   829   N  N   . ASP A  1 121 ? 45.798  80.199  110.597 1.00 39.65  ? 121  ASP A N   1 
ATOM   830   C  CA  . ASP A  1 121 ? 47.212  80.151  110.913 1.00 41.43  ? 121  ASP A CA  1 
ATOM   831   C  C   . ASP A  1 121 ? 47.342  79.662  112.347 1.00 41.09  ? 121  ASP A C   1 
ATOM   832   O  O   . ASP A  1 121 ? 46.685  80.186  113.240 1.00 42.79  ? 121  ASP A O   1 
ATOM   833   C  CB  . ASP A  1 121 ? 47.822  81.541  110.760 1.00 46.29  ? 121  ASP A CB  1 
ATOM   834   C  CG  . ASP A  1 121 ? 49.324  81.541  110.931 1.00 52.31  ? 121  ASP A CG  1 
ATOM   835   O  OD1 . ASP A  1 121 ? 50.010  80.753  110.237 1.00 55.99  ? 121  ASP A OD1 1 
ATOM   836   O  OD2 . ASP A  1 121 ? 49.822  82.336  111.760 1.00 56.26  ? 121  ASP A OD2 1 
ATOM   837   N  N   . GLY A  1 122 ? 48.176  78.642  112.553 1.00 41.71  ? 122  GLY A N   1 
ATOM   838   C  CA  . GLY A  1 122 ? 48.374  78.076  113.878 1.00 39.50  ? 122  GLY A CA  1 
ATOM   839   C  C   . GLY A  1 122 ? 47.415  76.922  114.150 1.00 40.64  ? 122  GLY A C   1 
ATOM   840   O  O   . GLY A  1 122 ? 47.270  76.455  115.282 1.00 41.66  ? 122  GLY A O   1 
ATOM   841   N  N   . ALA A  1 123 ? 46.756  76.448  113.102 1.00 36.65  ? 123  ALA A N   1 
ATOM   842   C  CA  . ALA A  1 123 ? 45.813  75.362  113.254 1.00 34.55  ? 123  ALA A CA  1 
ATOM   843   C  C   . ALA A  1 123 ? 46.464  73.993  113.391 1.00 34.05  ? 123  ALA A C   1 
ATOM   844   O  O   . ALA A  1 123 ? 47.586  73.760  112.951 1.00 33.96  ? 123  ALA A O   1 
ATOM   845   C  CB  . ALA A  1 123 ? 44.849  75.353  112.079 1.00 32.42  ? 123  ALA A CB  1 
ATOM   846   N  N   . THR A  1 124 ? 45.732  73.098  114.035 1.00 32.76  ? 124  THR A N   1 
ATOM   847   C  CA  . THR A  1 124 ? 46.142  71.726  114.210 1.00 31.44  ? 124  THR A CA  1 
ATOM   848   C  C   . THR A  1 124 ? 45.114  70.951  113.398 1.00 33.14  ? 124  THR A C   1 
ATOM   849   O  O   . THR A  1 124 ? 43.912  70.985  113.691 1.00 32.83  ? 124  THR A O   1 
ATOM   850   C  CB  . THR A  1 124 ? 46.070  71.324  115.656 1.00 30.81  ? 124  THR A CB  1 
ATOM   851   O  OG1 . THR A  1 124 ? 47.203  71.869  116.327 1.00 31.25  ? 124  THR A OG1 1 
ATOM   852   C  CG2 . THR A  1 124 ? 46.076  69.813  115.796 1.00 30.92  ? 124  THR A CG2 1 
ATOM   853   N  N   . ILE A  1 125 ? 45.594  70.264  112.371 1.00 28.53  ? 125  ILE A N   1 
ATOM   854   C  CA  . ILE A  1 125 ? 44.729  69.529  111.471 1.00 25.70  ? 125  ILE A CA  1 
ATOM   855   C  C   . ILE A  1 125 ? 44.808  68.014  111.644 1.00 24.80  ? 125  ILE A C   1 
ATOM   856   O  O   . ILE A  1 125 ? 45.886  67.466  111.831 1.00 28.53  ? 125  ILE A O   1 
ATOM   857   C  CB  . ILE A  1 125 ? 45.098  69.894  110.010 1.00 25.76  ? 125  ILE A CB  1 
ATOM   858   C  CG1 . ILE A  1 125 ? 45.101  71.410  109.860 1.00 22.51  ? 125  ILE A CG1 1 
ATOM   859   C  CG2 . ILE A  1 125 ? 44.121  69.273  109.019 1.00 18.93  ? 125  ILE A CG2 1 
ATOM   860   C  CD1 . ILE A  1 125 ? 45.518  71.862  108.499 1.00 25.76  ? 125  ILE A CD1 1 
ATOM   861   N  N   . LEU A  1 126 ? 43.661  67.345  111.585 1.00 20.78  ? 126  LEU A N   1 
ATOM   862   C  CA  . LEU A  1 126 ? 43.614  65.889  111.689 1.00 23.78  ? 126  LEU A CA  1 
ATOM   863   C  C   . LEU A  1 126 ? 43.181  65.322  110.325 1.00 28.18  ? 126  LEU A C   1 
ATOM   864   O  O   . LEU A  1 126 ? 42.208  65.821  109.717 1.00 27.87  ? 126  LEU A O   1 
ATOM   865   C  CB  . LEU A  1 126 ? 42.602  65.463  112.753 1.00 25.81  ? 126  LEU A CB  1 
ATOM   866   C  CG  . LEU A  1 126 ? 42.374  63.963  112.896 1.00 26.47  ? 126  LEU A CG  1 
ATOM   867   C  CD1 . LEU A  1 126 ? 43.674  63.317  113.405 1.00 27.37  ? 126  LEU A CD1 1 
ATOM   868   C  CD2 . LEU A  1 126 ? 41.211  63.701  113.851 1.00 21.91  ? 126  LEU A CD2 1 
ATOM   869   N  N   . THR A  1 127 ? 43.904  64.302  109.847 1.00 24.77  ? 127  THR A N   1 
ATOM   870   C  CA  . THR A  1 127 ? 43.604  63.657  108.560 1.00 23.06  ? 127  THR A CA  1 
ATOM   871   C  C   . THR A  1 127 ? 43.689  62.143  108.725 1.00 21.47  ? 127  THR A C   1 
ATOM   872   O  O   . THR A  1 127 ? 44.166  61.668  109.748 1.00 20.30  ? 127  THR A O   1 
ATOM   873   C  CB  . THR A  1 127 ? 44.581  64.131  107.421 1.00 24.87  ? 127  THR A CB  1 
ATOM   874   O  OG1 . THR A  1 127 ? 44.073  63.709  106.145 1.00 23.01  ? 127  THR A OG1 1 
ATOM   875   C  CG2 . THR A  1 127 ? 45.990  63.561  107.620 1.00 26.26  ? 127  THR A CG2 1 
ATOM   876   N  N   . HIS A  1 128 ? 43.220  61.392  107.729 1.00 20.83  ? 128  HIS A N   1 
ATOM   877   C  CA  . HIS A  1 128 ? 43.217  59.933  107.796 1.00 20.76  ? 128  HIS A CA  1 
ATOM   878   C  C   . HIS A  1 128 ? 43.862  59.307  106.569 1.00 23.70  ? 128  HIS A C   1 
ATOM   879   O  O   . HIS A  1 128 ? 43.597  59.710  105.442 1.00 23.08  ? 128  HIS A O   1 
ATOM   880   C  CB  . HIS A  1 128 ? 41.782  59.450  107.932 1.00 21.68  ? 128  HIS A CB  1 
ATOM   881   C  CG  . HIS A  1 128 ? 41.625  57.960  107.901 1.00 25.75  ? 128  HIS A CG  1 
ATOM   882   N  ND1 . HIS A  1 128 ? 41.931  57.153  108.977 1.00 28.26  ? 128  HIS A ND1 1 
ATOM   883   C  CD2 . HIS A  1 128 ? 41.151  57.137  106.936 1.00 19.26  ? 128  HIS A CD2 1 
ATOM   884   C  CE1 . HIS A  1 128 ? 41.651  55.897  108.677 1.00 26.23  ? 128  HIS A CE1 1 
ATOM   885   N  NE2 . HIS A  1 128 ? 41.177  55.861  107.444 1.00 26.94  ? 128  HIS A NE2 1 
ATOM   886   N  N   . ALA A  1 129 ? 44.710  58.312  106.788 1.00 25.44  ? 129  ALA A N   1 
ATOM   887   C  CA  . ALA A  1 129 ? 45.389  57.653  105.681 1.00 27.45  ? 129  ALA A CA  1 
ATOM   888   C  C   . ALA A  1 129 ? 46.164  58.625  104.773 1.00 29.69  ? 129  ALA A C   1 
ATOM   889   O  O   . ALA A  1 129 ? 46.642  59.672  105.204 1.00 30.42  ? 129  ALA A O   1 
ATOM   890   C  CB  . ALA A  1 129 ? 44.387  56.878  104.864 1.00 28.74  ? 129  ALA A CB  1 
ATOM   891   N  N   . TYR A  1 130 ? 46.257  58.270  103.500 1.00 28.92  ? 130  TYR A N   1 
ATOM   892   C  CA  . TYR A  1 130 ? 46.994  59.045  102.520 1.00 28.32  ? 130  TYR A CA  1 
ATOM   893   C  C   . TYR A  1 130 ? 46.087  59.621  101.437 1.00 28.66  ? 130  TYR A C   1 
ATOM   894   O  O   . TYR A  1 130 ? 45.250  58.919  100.881 1.00 35.10  ? 130  TYR A O   1 
ATOM   895   C  CB  . TYR A  1 130 ? 48.047  58.129  101.867 1.00 30.99  ? 130  TYR A CB  1 
ATOM   896   C  CG  . TYR A  1 130 ? 48.850  58.791  100.786 1.00 32.16  ? 130  TYR A CG  1 
ATOM   897   C  CD1 . TYR A  1 130 ? 49.999  59.522  101.092 1.00 32.60  ? 130  TYR A CD1 1 
ATOM   898   C  CD2 . TYR A  1 130 ? 48.426  58.751  99.464  1.00 33.65  ? 130  TYR A CD2 1 
ATOM   899   C  CE1 . TYR A  1 130 ? 50.700  60.201  100.112 1.00 32.40  ? 130  TYR A CE1 1 
ATOM   900   C  CE2 . TYR A  1 130 ? 49.122  59.425  98.476  1.00 36.12  ? 130  TYR A CE2 1 
ATOM   901   C  CZ  . TYR A  1 130 ? 50.255  60.147  98.807  1.00 35.54  ? 130  TYR A CZ  1 
ATOM   902   O  OH  . TYR A  1 130 ? 50.939  60.815  97.820  1.00 43.49  ? 130  TYR A OH  1 
ATOM   903   N  N   . SER A  1 131 ? 46.246  60.894  101.126 1.00 24.29  ? 131  SER A N   1 
ATOM   904   C  CA  . SER A  1 131 ? 45.444  61.490  100.073 1.00 26.50  ? 131  SER A CA  1 
ATOM   905   C  C   . SER A  1 131 ? 46.252  62.456  99.231  1.00 27.07  ? 131  SER A C   1 
ATOM   906   O  O   . SER A  1 131 ? 46.786  63.437  99.730  1.00 30.86  ? 131  SER A O   1 
ATOM   907   C  CB  . SER A  1 131 ? 44.229  62.237  100.631 1.00 26.63  ? 131  SER A CB  1 
ATOM   908   O  OG  . SER A  1 131 ? 43.662  63.054  99.606  1.00 24.27  ? 131  SER A OG  1 
ATOM   909   N  N   . ARG A  1 132 ? 46.321  62.182  97.943  1.00 27.82  ? 132  ARG A N   1 
ATOM   910   C  CA  . ARG A  1 132 ? 47.049  63.035  97.022  1.00 29.88  ? 132  ARG A CA  1 
ATOM   911   C  C   . ARG A  1 132 ? 46.515  64.475  97.066  1.00 23.70  ? 132  ARG A C   1 
ATOM   912   O  O   . ARG A  1 132 ? 47.277  65.431  97.048  1.00 22.39  ? 132  ARG A O   1 
ATOM   913   C  CB  . ARG A  1 132 ? 46.910  62.468  95.607  1.00 36.78  ? 132  ARG A CB  1 
ATOM   914   C  CG  . ARG A  1 132 ? 47.233  60.957  95.480  1.00 47.10  ? 132  ARG A CG  1 
ATOM   915   C  CD  . ARG A  1 132 ? 46.151  60.229  94.646  1.00 51.42  ? 132  ARG A CD  1 
ATOM   916   N  NE  . ARG A  1 132 ? 46.457  58.827  94.354  1.00 56.61  ? 132  ARG A NE  1 
ATOM   917   C  CZ  . ARG A  1 132 ? 47.475  58.423  93.594  1.00 59.88  ? 132  ARG A CZ  1 
ATOM   918   N  NH1 . ARG A  1 132 ? 48.290  59.315  93.056  1.00 65.14  ? 132  ARG A NH1 1 
ATOM   919   N  NH2 . ARG A  1 132 ? 47.673  57.132  93.347  1.00 58.92  ? 132  ARG A NH2 1 
ATOM   920   N  N   . VAL A  1 133 ? 45.201  64.617  97.150  1.00 23.25  ? 133  VAL A N   1 
ATOM   921   C  CA  . VAL A  1 133 ? 44.566  65.924  97.162  1.00 21.07  ? 133  VAL A CA  1 
ATOM   922   C  C   . VAL A  1 133 ? 44.786  66.662  98.475  1.00 22.53  ? 133  VAL A C   1 
ATOM   923   O  O   . VAL A  1 133 ? 45.064  67.864  98.483  1.00 23.88  ? 133  VAL A O   1 
ATOM   924   C  CB  . VAL A  1 133 ? 43.052  65.796  96.877  1.00 21.55  ? 133  VAL A CB  1 
ATOM   925   C  CG1 . VAL A  1 133 ? 42.409  67.168  96.746  1.00 20.13  ? 133  VAL A CG1 1 
ATOM   926   C  CG2 . VAL A  1 133 ? 42.843  65.000  95.601  1.00 22.68  ? 133  VAL A CG2 1 
ATOM   927   N  N   . VAL A  1 134 ? 44.669  65.956  99.590  1.00 22.52  ? 134  VAL A N   1 
ATOM   928   C  CA  . VAL A  1 134 ? 44.887  66.603  100.872 1.00 23.80  ? 134  VAL A CA  1 
ATOM   929   C  C   . VAL A  1 134 ? 46.302  67.177  100.890 1.00 29.00  ? 134  VAL A C   1 
ATOM   930   O  O   . VAL A  1 134 ? 46.513  68.333  101.275 1.00 28.35  ? 134  VAL A O   1 
ATOM   931   C  CB  . VAL A  1 134 ? 44.709  65.608  102.039 1.00 22.23  ? 134  VAL A CB  1 
ATOM   932   C  CG1 . VAL A  1 134 ? 45.057  66.284  103.371 1.00 10.52  ? 134  VAL A CG1 1 
ATOM   933   C  CG2 . VAL A  1 134 ? 43.262  65.099  102.051 1.00 22.16  ? 134  VAL A CG2 1 
ATOM   934   N  N   . LEU A  1 135 ? 47.259  66.363  100.441 1.00 30.46  ? 135  LEU A N   1 
ATOM   935   C  CA  . LEU A  1 135 ? 48.656  66.752  100.399 1.00 30.77  ? 135  LEU A CA  1 
ATOM   936   C  C   . LEU A  1 135 ? 48.763  68.042  99.613  1.00 32.35  ? 135  LEU A C   1 
ATOM   937   O  O   . LEU A  1 135 ? 49.406  68.998  100.057 1.00 34.49  ? 135  LEU A O   1 
ATOM   938   C  CB  . LEU A  1 135 ? 49.490  65.657  99.726  1.00 32.86  ? 135  LEU A CB  1 
ATOM   939   C  CG  . LEU A  1 135 ? 50.866  65.310  100.311 1.00 30.85  ? 135  LEU A CG  1 
ATOM   940   C  CD1 . LEU A  1 135 ? 51.677  64.600  99.243  1.00 32.24  ? 135  LEU A CD1 1 
ATOM   941   C  CD2 . LEU A  1 135 ? 51.591  66.550  100.763 1.00 26.80  ? 135  LEU A CD2 1 
ATOM   942   N  N   . ARG A  1 136 ? 48.129  68.072  98.446  1.00 29.45  ? 136  ARG A N   1 
ATOM   943   C  CA  . ARG A  1 136 ? 48.151  69.271  97.618  1.00 30.76  ? 136  ARG A CA  1 
ATOM   944   C  C   . ARG A  1 136 ? 47.556  70.461  98.366  1.00 31.93  ? 136  ARG A C   1 
ATOM   945   O  O   . ARG A  1 136 ? 48.017  71.601  98.206  1.00 32.21  ? 136  ARG A O   1 
ATOM   946   C  CB  . ARG A  1 136 ? 47.377  69.035  96.322  1.00 33.20  ? 136  ARG A CB  1 
ATOM   947   C  CG  . ARG A  1 136 ? 48.155  68.250  95.289  1.00 36.39  ? 136  ARG A CG  1 
ATOM   948   C  CD  . ARG A  1 136 ? 49.371  69.041  94.871  1.00 39.22  ? 136  ARG A CD  1 
ATOM   949   N  NE  . ARG A  1 136 ? 48.989  70.396  94.481  1.00 45.11  ? 136  ARG A NE  1 
ATOM   950   C  CZ  . ARG A  1 136 ? 48.457  70.714  93.304  1.00 45.32  ? 136  ARG A CZ  1 
ATOM   951   N  NH1 . ARG A  1 136 ? 48.246  69.770  92.389  1.00 42.39  ? 136  ARG A NH1 1 
ATOM   952   N  NH2 . ARG A  1 136 ? 48.129  71.975  93.050  1.00 43.97  ? 136  ARG A NH2 1 
ATOM   953   N  N   . VAL A  1 137 ? 46.537  70.204  99.184  1.00 28.52  ? 137  VAL A N   1 
ATOM   954   C  CA  . VAL A  1 137 ? 45.940  71.287  99.944  1.00 30.02  ? 137  VAL A CA  1 
ATOM   955   C  C   . VAL A  1 137 ? 46.921  71.843  100.977 1.00 31.24  ? 137  VAL A C   1 
ATOM   956   O  O   . VAL A  1 137 ? 47.082  73.062  101.092 1.00 30.76  ? 137  VAL A O   1 
ATOM   957   C  CB  . VAL A  1 137 ? 44.620  70.864  100.642 1.00 26.67  ? 137  VAL A CB  1 
ATOM   958   C  CG1 . VAL A  1 137 ? 44.258  71.866  101.718 1.00 26.92  ? 137  VAL A CG1 1 
ATOM   959   C  CG2 . VAL A  1 137 ? 43.476  70.836  99.623  1.00 24.82  ? 137  VAL A CG2 1 
ATOM   960   N  N   . LEU A  1 138 ? 47.589  70.961  101.716 1.00 31.22  ? 138  LEU A N   1 
ATOM   961   C  CA  . LEU A  1 138 ? 48.547  71.408  102.718 1.00 28.42  ? 138  LEU A CA  1 
ATOM   962   C  C   . LEU A  1 138 ? 49.741  72.138  102.073 1.00 29.05  ? 138  LEU A C   1 
ATOM   963   O  O   . LEU A  1 138 ? 50.266  73.108  102.639 1.00 23.61  ? 138  LEU A O   1 
ATOM   964   C  CB  . LEU A  1 138 ? 48.996  70.225  103.580 1.00 26.65  ? 138  LEU A CB  1 
ATOM   965   C  CG  . LEU A  1 138 ? 47.853  69.545  104.361 1.00 27.35  ? 138  LEU A CG  1 
ATOM   966   C  CD1 . LEU A  1 138 ? 48.376  68.377  105.206 1.00 23.31  ? 138  LEU A CD1 1 
ATOM   967   C  CD2 . LEU A  1 138 ? 47.182  70.561  105.252 1.00 22.83  ? 138  LEU A CD2 1 
ATOM   968   N  N   . GLU A  1 139 ? 50.165  71.692  100.891 1.00 29.28  ? 139  GLU A N   1 
ATOM   969   C  CA  . GLU A  1 139 ? 51.260  72.375  100.192 1.00 32.28  ? 139  GLU A CA  1 
ATOM   970   C  C   . GLU A  1 139 ? 50.832  73.804  99.885  1.00 30.48  ? 139  GLU A C   1 
ATOM   971   O  O   . GLU A  1 139 ? 51.606  74.739  100.067 1.00 34.69  ? 139  GLU A O   1 
ATOM   972   C  CB  . GLU A  1 139 ? 51.616  71.669  98.885  1.00 34.95  ? 139  GLU A CB  1 
ATOM   973   C  CG  . GLU A  1 139 ? 52.787  70.731  99.015  1.00 42.65  ? 139  GLU A CG  1 
ATOM   974   C  CD  . GLU A  1 139 ? 52.743  69.600  98.003  1.00 48.15  ? 139  GLU A CD  1 
ATOM   975   O  OE1 . GLU A  1 139 ? 52.287  69.840  96.856  1.00 46.61  ? 139  GLU A OE1 1 
ATOM   976   O  OE2 . GLU A  1 139 ? 53.176  68.477  98.361  1.00 47.81  ? 139  GLU A OE2 1 
ATOM   977   N  N   . ALA A  1 140 ? 49.598  73.969  99.424  1.00 25.69  ? 140  ALA A N   1 
ATOM   978   C  CA  . ALA A  1 140 ? 49.071  75.292  99.123  1.00 26.10  ? 140  ALA A CA  1 
ATOM   979   C  C   . ALA A  1 140 ? 49.117  76.174  100.379 1.00 26.66  ? 140  ALA A C   1 
ATOM   980   O  O   . ALA A  1 140 ? 49.415  77.363  100.312 1.00 29.64  ? 140  ALA A O   1 
ATOM   981   C  CB  . ALA A  1 140 ? 47.631  75.173  98.606  1.00 21.13  ? 140  ALA A CB  1 
ATOM   982   N  N   . ALA A  1 141 ? 48.839  75.575  101.529 1.00 27.76  ? 141  ALA A N   1 
ATOM   983   C  CA  . ALA A  1 141 ? 48.841  76.298  102.794 1.00 27.78  ? 141  ALA A CA  1 
ATOM   984   C  C   . ALA A  1 141 ? 50.223  76.807  103.219 1.00 28.53  ? 141  ALA A C   1 
ATOM   985   O  O   . ALA A  1 141 ? 50.333  77.930  103.732 1.00 23.76  ? 141  ALA A O   1 
ATOM   986   C  CB  . ALA A  1 141 ? 48.243  75.420  103.894 1.00 21.82  ? 141  ALA A CB  1 
ATOM   987   N  N   . VAL A  1 142 ? 51.269  75.989  103.042 1.00 30.64  ? 142  VAL A N   1 
ATOM   988   C  CA  . VAL A  1 142 ? 52.615  76.427  103.408 1.00 30.39  ? 142  VAL A CA  1 
ATOM   989   C  C   . VAL A  1 142 ? 52.987  77.534  102.425 1.00 30.16  ? 142  VAL A C   1 
ATOM   990   O  O   . VAL A  1 142 ? 53.594  78.529  102.800 1.00 33.72  ? 142  VAL A O   1 
ATOM   991   C  CB  . VAL A  1 142 ? 53.684  75.284  103.337 1.00 30.74  ? 142  VAL A CB  1 
ATOM   992   C  CG1 . VAL A  1 142 ? 53.201  74.065  104.073 1.00 28.20  ? 142  VAL A CG1 1 
ATOM   993   C  CG2 . VAL A  1 142 ? 54.008  74.940  101.911 1.00 35.54  ? 142  VAL A CG2 1 
ATOM   994   N  N   . ALA A  1 143 ? 52.584  77.376  101.169 1.00 31.03  ? 143  ALA A N   1 
ATOM   995   C  CA  . ALA A  1 143 ? 52.871  78.381  100.146 1.00 32.86  ? 143  ALA A CA  1 
ATOM   996   C  C   . ALA A  1 143 ? 52.135  79.693  100.416 1.00 33.04  ? 143  ALA A C   1 
ATOM   997   O  O   . ALA A  1 143 ? 52.388  80.699  99.772  1.00 39.25  ? 143  ALA A O   1 
ATOM   998   C  CB  . ALA A  1 143 ? 52.499  77.842  98.768  1.00 31.61  ? 143  ALA A CB  1 
ATOM   999   N  N   . ALA A  1 144 ? 51.209  79.673  101.360 1.00 34.46  ? 144  ALA A N   1 
ATOM   1000  C  CA  . ALA A  1 144 ? 50.465  80.870  101.725 1.00 35.54  ? 144  ALA A CA  1 
ATOM   1001  C  C   . ALA A  1 144 ? 51.044  81.416  103.035 1.00 38.15  ? 144  ALA A C   1 
ATOM   1002  O  O   . ALA A  1 144 ? 50.498  82.343  103.637 1.00 39.10  ? 144  ALA A O   1 
ATOM   1003  C  CB  . ALA A  1 144 ? 49.001  80.535  101.900 1.00 31.31  ? 144  ALA A CB  1 
ATOM   1004  N  N   . LYS A  1 145 ? 52.142  80.814  103.477 1.00 39.33  ? 145  LYS A N   1 
ATOM   1005  C  CA  . LYS A  1 145 ? 52.808  81.230  104.700 1.00 44.48  ? 145  LYS A CA  1 
ATOM   1006  C  C   . LYS A  1 145 ? 52.059  80.846  105.963 1.00 44.54  ? 145  LYS A C   1 
ATOM   1007  O  O   . LYS A  1 145 ? 52.254  81.452  107.013 1.00 46.12  ? 145  LYS A O   1 
ATOM   1008  C  CB  . LYS A  1 145 ? 53.043  82.745  104.684 1.00 47.92  ? 145  LYS A CB  1 
ATOM   1009  C  CG  . LYS A  1 145 ? 54.385  83.156  104.084 1.00 53.62  ? 145  LYS A CG  1 
ATOM   1010  C  CD  . LYS A  1 145 ? 54.560  82.673  102.648 1.00 55.29  ? 145  LYS A CD  1 
ATOM   1011  C  CE  . LYS A  1 145 ? 55.929  83.048  102.103 1.00 55.00  ? 145  LYS A CE  1 
ATOM   1012  N  NZ  . LYS A  1 145 ? 56.102  82.576  100.703 1.00 59.46  ? 145  LYS A NZ  1 
ATOM   1013  N  N   . LYS A  1 146 ? 51.204  79.839  105.873 1.00 44.27  ? 146  LYS A N   1 
ATOM   1014  C  CA  . LYS A  1 146 ? 50.457  79.419  107.048 1.00 43.56  ? 146  LYS A CA  1 
ATOM   1015  C  C   . LYS A  1 146 ? 51.254  78.444  107.901 1.00 42.94  ? 146  LYS A C   1 
ATOM   1016  O  O   . LYS A  1 146 ? 51.910  77.555  107.388 1.00 42.60  ? 146  LYS A O   1 
ATOM   1017  C  CB  . LYS A  1 146 ? 49.129  78.789  106.631 1.00 43.73  ? 146  LYS A CB  1 
ATOM   1018  C  CG  . LYS A  1 146 ? 48.140  79.792  106.057 1.00 43.84  ? 146  LYS A CG  1 
ATOM   1019  C  CD  . LYS A  1 146 ? 46.893  79.116  105.534 1.00 40.49  ? 146  LYS A CD  1 
ATOM   1020  C  CE  . LYS A  1 146 ? 45.930  80.131  104.963 1.00 40.55  ? 146  LYS A CE  1 
ATOM   1021  N  NZ  . LYS A  1 146 ? 45.417  81.038  106.021 1.00 42.42  ? 146  LYS A NZ  1 
ATOM   1022  N  N   . ARG A  1 147 ? 51.208  78.630  109.213 1.00 44.39  ? 147  ARG A N   1 
ATOM   1023  C  CA  . ARG A  1 147 ? 51.914  77.750  110.126 1.00 44.18  ? 147  ARG A CA  1 
ATOM   1024  C  C   . ARG A  1 147 ? 50.886  76.795  110.724 1.00 43.34  ? 147  ARG A C   1 
ATOM   1025  O  O   . ARG A  1 147 ? 49.924  77.233  111.354 1.00 45.12  ? 147  ARG A O   1 
ATOM   1026  C  CB  . ARG A  1 147 ? 52.588  78.590  111.211 1.00 49.80  ? 147  ARG A CB  1 
ATOM   1027  C  CG  . ARG A  1 147 ? 53.542  79.649  110.639 1.00 55.87  ? 147  ARG A CG  1 
ATOM   1028  C  CD  . ARG A  1 147 ? 54.354  80.378  111.714 1.00 61.51  ? 147  ARG A CD  1 
ATOM   1029  N  NE  . ARG A  1 147 ? 53.536  81.193  112.614 1.00 67.28  ? 147  ARG A NE  1 
ATOM   1030  C  CZ  . ARG A  1 147 ? 52.797  82.233  112.233 1.00 70.35  ? 147  ARG A CZ  1 
ATOM   1031  N  NH1 . ARG A  1 147 ? 52.764  82.599  110.956 1.00 72.80  ? 147  ARG A NH1 1 
ATOM   1032  N  NH2 . ARG A  1 147 ? 52.092  82.910  113.131 1.00 68.03  ? 147  ARG A NH2 1 
ATOM   1033  N  N   . PHE A  1 148 ? 51.064  75.493  110.515 1.00 38.90  ? 148  PHE A N   1 
ATOM   1034  C  CA  . PHE A  1 148 ? 50.104  74.531  111.047 1.00 35.77  ? 148  PHE A CA  1 
ATOM   1035  C  C   . PHE A  1 148 ? 50.711  73.192  111.422 1.00 34.19  ? 148  PHE A C   1 
ATOM   1036  O  O   . PHE A  1 148 ? 51.797  72.859  110.981 1.00 36.59  ? 148  PHE A O   1 
ATOM   1037  C  CB  . PHE A  1 148 ? 48.999  74.306  110.031 1.00 33.33  ? 148  PHE A CB  1 
ATOM   1038  C  CG  . PHE A  1 148 ? 49.497  73.823  108.703 1.00 32.30  ? 148  PHE A CG  1 
ATOM   1039  C  CD1 . PHE A  1 148 ? 49.951  74.722  107.745 1.00 31.73  ? 148  PHE A CD1 1 
ATOM   1040  C  CD2 . PHE A  1 148 ? 49.495  72.469  108.397 1.00 30.97  ? 148  PHE A CD2 1 
ATOM   1041  C  CE1 . PHE A  1 148 ? 50.390  74.279  106.496 1.00 24.78  ? 148  PHE A CE1 1 
ATOM   1042  C  CE2 . PHE A  1 148 ? 49.933  72.014  107.147 1.00 29.50  ? 148  PHE A CE2 1 
ATOM   1043  C  CZ  . PHE A  1 148 ? 50.378  72.924  106.199 1.00 25.53  ? 148  PHE A CZ  1 
ATOM   1044  N  N   . SER A  1 149 ? 50.001  72.421  112.237 1.00 33.36  ? 149  SER A N   1 
ATOM   1045  C  CA  . SER A  1 149 ? 50.484  71.105  112.666 1.00 36.14  ? 149  SER A CA  1 
ATOM   1046  C  C   . SER A  1 149 ? 49.555  70.036  112.090 1.00 35.89  ? 149  SER A C   1 
ATOM   1047  O  O   . SER A  1 149 ? 48.422  70.338  111.730 1.00 37.65  ? 149  SER A O   1 
ATOM   1048  C  CB  . SER A  1 149 ? 50.464  70.987  114.191 1.00 34.58  ? 149  SER A CB  1 
ATOM   1049  O  OG  . SER A  1 149 ? 50.743  72.228  114.809 1.00 49.07  ? 149  SER A OG  1 
ATOM   1050  N  N   . VAL A  1 150 ? 50.021  68.789  112.021 1.00 33.19  ? 150  VAL A N   1 
ATOM   1051  C  CA  . VAL A  1 150 ? 49.196  67.715  111.496 1.00 29.10  ? 150  VAL A CA  1 
ATOM   1052  C  C   . VAL A  1 150 ? 49.273  66.398  112.245 1.00 30.59  ? 150  VAL A C   1 
ATOM   1053  O  O   . VAL A  1 150 ? 50.356  65.963  112.634 1.00 34.22  ? 150  VAL A O   1 
ATOM   1054  C  CB  . VAL A  1 150 ? 49.542  67.426  110.041 1.00 26.06  ? 150  VAL A CB  1 
ATOM   1055  C  CG1 . VAL A  1 150 ? 48.758  66.214  109.538 1.00 23.01  ? 150  VAL A CG1 1 
ATOM   1056  C  CG2 . VAL A  1 150 ? 49.236  68.631  109.215 1.00 26.54  ? 150  VAL A CG2 1 
ATOM   1057  N  N   . TYR A  1 151 ? 48.111  65.771  112.436 1.00 27.22  ? 151  TYR A N   1 
ATOM   1058  C  CA  . TYR A  1 151 ? 48.007  64.465  113.075 1.00 25.11  ? 151  TYR A CA  1 
ATOM   1059  C  C   . TYR A  1 151 ? 47.397  63.583  112.004 1.00 26.42  ? 151  TYR A C   1 
ATOM   1060  O  O   . TYR A  1 151 ? 46.423  63.978  111.365 1.00 27.68  ? 151  TYR A O   1 
ATOM   1061  C  CB  . TYR A  1 151 ? 47.056  64.498  114.271 1.00 27.31  ? 151  TYR A CB  1 
ATOM   1062  C  CG  . TYR A  1 151 ? 47.634  65.020  115.571 1.00 28.60  ? 151  TYR A CG  1 
ATOM   1063  C  CD1 . TYR A  1 151 ? 48.545  64.266  116.315 1.00 31.81  ? 151  TYR A CD1 1 
ATOM   1064  C  CD2 . TYR A  1 151 ? 47.249  66.259  116.071 1.00 31.24  ? 151  TYR A CD2 1 
ATOM   1065  C  CE1 . TYR A  1 151 ? 49.050  64.738  117.520 1.00 29.87  ? 151  TYR A CE1 1 
ATOM   1066  C  CE2 . TYR A  1 151 ? 47.745  66.739  117.268 1.00 31.25  ? 151  TYR A CE2 1 
ATOM   1067  C  CZ  . TYR A  1 151 ? 48.644  65.979  117.987 1.00 33.70  ? 151  TYR A CZ  1 
ATOM   1068  O  OH  . TYR A  1 151 ? 49.147  66.487  119.164 1.00 38.96  ? 151  TYR A OH  1 
ATOM   1069  N  N   . VAL A  1 152 ? 47.975  62.410  111.777 1.00 26.96  ? 152  VAL A N   1 
ATOM   1070  C  CA  . VAL A  1 152 ? 47.435  61.482  110.780 1.00 26.63  ? 152  VAL A CA  1 
ATOM   1071  C  C   . VAL A  1 152 ? 47.406  60.037  111.282 1.00 29.20  ? 152  VAL A C   1 
ATOM   1072  O  O   . VAL A  1 152 ? 48.369  59.561  111.898 1.00 28.61  ? 152  VAL A O   1 
ATOM   1073  C  CB  . VAL A  1 152 ? 48.234  61.514  109.456 1.00 23.00  ? 152  VAL A CB  1 
ATOM   1074  C  CG1 . VAL A  1 152 ? 49.714  61.272  109.710 1.00 16.93  ? 152  VAL A CG1 1 
ATOM   1075  C  CG2 . VAL A  1 152 ? 47.694  60.446  108.520 1.00 23.03  ? 152  VAL A CG2 1 
ATOM   1076  N  N   . THR A  1 153 ? 46.294  59.347  111.029 1.00 30.58  ? 153  THR A N   1 
ATOM   1077  C  CA  . THR A  1 153 ? 46.155  57.946  111.438 1.00 31.68  ? 153  THR A CA  1 
ATOM   1078  C  C   . THR A  1 153 ? 47.154  57.075  110.658 1.00 30.74  ? 153  THR A C   1 
ATOM   1079  O  O   . THR A  1 153 ? 47.484  57.383  109.513 1.00 27.88  ? 153  THR A O   1 
ATOM   1080  C  CB  . THR A  1 153 ? 44.733  57.461  111.180 1.00 31.86  ? 153  THR A CB  1 
ATOM   1081  O  OG1 . THR A  1 153 ? 44.375  57.756  109.824 1.00 37.08  ? 153  THR A OG1 1 
ATOM   1082  C  CG2 . THR A  1 153 ? 43.765  58.155  112.123 1.00 29.66  ? 153  THR A CG2 1 
ATOM   1083  N  N   . GLU A  1 154 ? 47.661  56.012  111.278 1.00 32.23  ? 154  GLU A N   1 
ATOM   1084  C  CA  . GLU A  1 154 ? 48.628  55.153  110.589 1.00 33.15  ? 154  GLU A CA  1 
ATOM   1085  C  C   . GLU A  1 154 ? 47.891  54.441  109.471 1.00 32.17  ? 154  GLU A C   1 
ATOM   1086  O  O   . GLU A  1 154 ? 48.446  54.180  108.411 1.00 31.88  ? 154  GLU A O   1 
ATOM   1087  C  CB  . GLU A  1 154 ? 49.246  54.146  111.549 1.00 33.40  ? 154  GLU A CB  1 
ATOM   1088  C  CG  . GLU A  1 154 ? 48.288  53.090  112.067 1.00 43.79  ? 154  GLU A CG  1 
ATOM   1089  C  CD  . GLU A  1 154 ? 48.986  52.084  112.973 1.00 48.81  ? 154  GLU A CD  1 
ATOM   1090  O  OE1 . GLU A  1 154 ? 50.216  51.901  112.807 1.00 50.29  ? 154  GLU A OE1 1 
ATOM   1091  O  OE2 . GLU A  1 154 ? 48.309  51.477  113.836 1.00 51.96  ? 154  GLU A OE2 1 
ATOM   1092  N  N   . SER A  1 155 ? 46.625  54.139  109.737 1.00 31.38  ? 155  SER A N   1 
ATOM   1093  C  CA  . SER A  1 155 ? 45.728  53.511  108.781 1.00 30.17  ? 155  SER A CA  1 
ATOM   1094  C  C   . SER A  1 155 ? 46.067  52.104  108.293 1.00 29.85  ? 155  SER A C   1 
ATOM   1095  O  O   . SER A  1 155 ? 46.668  51.902  107.228 1.00 26.67  ? 155  SER A O   1 
ATOM   1096  C  CB  . SER A  1 155 ? 45.519  54.450  107.576 1.00 30.95  ? 155  SER A CB  1 
ATOM   1097  O  OG  . SER A  1 155 ? 44.493  53.987  106.704 1.00 29.06  ? 155  SER A OG  1 
ATOM   1098  N  N   . GLN A  1 156 ? 45.647  51.131  109.087 1.00 28.22  ? 156  GLN A N   1 
ATOM   1099  C  CA  . GLN A  1 156 ? 45.833  49.736  108.754 1.00 26.25  ? 156  GLN A CA  1 
ATOM   1100  C  C   . GLN A  1 156 ? 44.929  49.442  107.536 1.00 28.13  ? 156  GLN A C   1 
ATOM   1101  O  O   . GLN A  1 156 ? 43.954  50.158  107.273 1.00 24.91  ? 156  GLN A O   1 
ATOM   1102  C  CB  . GLN A  1 156 ? 45.392  48.879  109.936 1.00 24.81  ? 156  GLN A CB  1 
ATOM   1103  C  CG  . GLN A  1 156 ? 46.230  49.002  111.197 1.00 27.17  ? 156  GLN A CG  1 
ATOM   1104  C  CD  . GLN A  1 156 ? 47.527  48.204  111.113 1.00 32.26  ? 156  GLN A CD  1 
ATOM   1105  O  OE1 . GLN A  1 156 ? 47.571  47.139  110.484 1.00 26.29  ? 156  GLN A OE1 1 
ATOM   1106  N  NE2 . GLN A  1 156 ? 48.588  48.710  111.755 1.00 30.15  ? 156  GLN A NE2 1 
ATOM   1107  N  N   . PRO A  1 157 ? 45.227  48.366  106.791 1.00 30.39  ? 157  PRO A N   1 
ATOM   1108  C  CA  . PRO A  1 157 ? 46.347  47.454  107.050 1.00 29.37  ? 157  PRO A CA  1 
ATOM   1109  C  C   . PRO A  1 157 ? 47.597  47.759  106.229 1.00 26.80  ? 157  PRO A C   1 
ATOM   1110  O  O   . PRO A  1 157 ? 48.608  47.090  106.389 1.00 28.92  ? 157  PRO A O   1 
ATOM   1111  C  CB  . PRO A  1 157 ? 45.751  46.096  106.698 1.00 26.66  ? 157  PRO A CB  1 
ATOM   1112  C  CG  . PRO A  1 157 ? 44.934  46.425  105.499 1.00 26.51  ? 157  PRO A CG  1 
ATOM   1113  C  CD  . PRO A  1 157 ? 44.230  47.714  105.917 1.00 29.02  ? 157  PRO A CD  1 
ATOM   1114  N  N   . ASP A  1 158 ? 47.526  48.767  105.365 1.00 27.36  ? 158  ASP A N   1 
ATOM   1115  C  CA  . ASP A  1 158 ? 48.653  49.138  104.500 1.00 28.99  ? 158  ASP A CA  1 
ATOM   1116  C  C   . ASP A  1 158 ? 49.569  50.249  105.032 1.00 29.82  ? 158  ASP A C   1 
ATOM   1117  O  O   . ASP A  1 158 ? 50.526  50.656  104.372 1.00 30.94  ? 158  ASP A O   1 
ATOM   1118  C  CB  . ASP A  1 158 ? 48.115  49.535  103.115 1.00 30.12  ? 158  ASP A CB  1 
ATOM   1119  C  CG  . ASP A  1 158 ? 47.134  50.705  103.169 1.00 32.40  ? 158  ASP A CG  1 
ATOM   1120  O  OD1 . ASP A  1 158 ? 46.837  51.221  104.271 1.00 32.04  ? 158  ASP A OD1 1 
ATOM   1121  O  OD2 . ASP A  1 158 ? 46.654  51.113  102.091 1.00 36.97  ? 158  ASP A OD2 1 
ATOM   1122  N  N   . LEU A  1 159 ? 49.259  50.746  106.221 1.00 31.50  ? 159  LEU A N   1 
ATOM   1123  C  CA  . LEU A  1 159 ? 50.031  51.810  106.843 1.00 31.82  ? 159  LEU A CA  1 
ATOM   1124  C  C   . LEU A  1 159 ? 50.284  53.019  105.943 1.00 32.29  ? 159  LEU A C   1 
ATOM   1125  O  O   . LEU A  1 159 ? 51.331  53.677  106.028 1.00 30.46  ? 159  LEU A O   1 
ATOM   1126  C  CB  . LEU A  1 159 ? 51.340  51.239  107.358 1.00 32.67  ? 159  LEU A CB  1 
ATOM   1127  C  CG  . LEU A  1 159 ? 51.122  50.369  108.595 1.00 37.90  ? 159  LEU A CG  1 
ATOM   1128  C  CD1 . LEU A  1 159 ? 52.374  49.563  108.906 1.00 35.11  ? 159  LEU A CD1 1 
ATOM   1129  C  CD2 . LEU A  1 159 ? 50.748  51.272  109.765 1.00 38.87  ? 159  LEU A CD2 1 
ATOM   1130  N  N   . SER A  1 160 ? 49.300  53.324  105.103 1.00 31.03  ? 160  SER A N   1 
ATOM   1131  C  CA  . SER A  1 160 ? 49.396  54.455  104.192 1.00 34.10  ? 160  SER A CA  1 
ATOM   1132  C  C   . SER A  1 160 ? 49.455  55.819  104.925 1.00 35.08  ? 160  SER A C   1 
ATOM   1133  O  O   . SER A  1 160 ? 49.831  56.836  104.328 1.00 32.66  ? 160  SER A O   1 
ATOM   1134  C  CB  . SER A  1 160 ? 48.224  54.417  103.217 1.00 30.68  ? 160  SER A CB  1 
ATOM   1135  O  OG  . SER A  1 160 ? 47.003  54.376  103.921 1.00 36.30  ? 160  SER A OG  1 
ATOM   1136  N  N   . GLY A  1 161 ? 49.081  55.835  106.208 1.00 33.96  ? 161  GLY A N   1 
ATOM   1137  C  CA  . GLY A  1 161 ? 49.142  57.060  106.993 1.00 30.54  ? 161  GLY A CA  1 
ATOM   1138  C  C   . GLY A  1 161 ? 50.596  57.379  107.319 1.00 32.62  ? 161  GLY A C   1 
ATOM   1139  O  O   . GLY A  1 161 ? 50.987  58.543  107.436 1.00 30.79  ? 161  GLY A O   1 
ATOM   1140  N  N   . LYS A  1 162 ? 51.405  56.334  107.491 1.00 32.23  ? 162  LYS A N   1 
ATOM   1141  C  CA  . LYS A  1 162 ? 52.828  56.525  107.746 1.00 30.38  ? 162  LYS A CA  1 
ATOM   1142  C  C   . LYS A  1 162 ? 53.445  57.096  106.462 1.00 26.02  ? 162  LYS A C   1 
ATOM   1143  O  O   . LYS A  1 162 ? 54.344  57.917  106.495 1.00 23.46  ? 162  LYS A O   1 
ATOM   1144  C  CB  . LYS A  1 162 ? 53.486  55.196  108.121 1.00 30.99  ? 162  LYS A CB  1 
ATOM   1145  C  CG  . LYS A  1 162 ? 53.413  54.917  109.603 1.00 33.96  ? 162  LYS A CG  1 
ATOM   1146  C  CD  . LYS A  1 162 ? 53.945  53.551  109.987 1.00 36.11  ? 162  LYS A CD  1 
ATOM   1147  C  CE  . LYS A  1 162 ? 53.844  53.372  111.512 1.00 44.67  ? 162  LYS A CE  1 
ATOM   1148  N  NZ  . LYS A  1 162 ? 54.179  51.994  112.016 1.00 47.46  ? 162  LYS A NZ  1 
ATOM   1149  N  N   . LYS A  1 163 ? 52.945  56.656  105.323 1.00 25.78  ? 163  LYS A N   1 
ATOM   1150  C  CA  . LYS A  1 163 ? 53.433  57.175  104.061 1.00 28.51  ? 163  LYS A CA  1 
ATOM   1151  C  C   . LYS A  1 163 ? 53.136  58.681  104.056 1.00 31.44  ? 163  LYS A C   1 
ATOM   1152  O  O   . LYS A  1 163 ? 54.036  59.512  103.842 1.00 28.54  ? 163  LYS A O   1 
ATOM   1153  C  CB  . LYS A  1 163 ? 52.721  56.461  102.917 1.00 25.67  ? 163  LYS A CB  1 
ATOM   1154  C  CG  . LYS A  1 163 ? 52.870  57.096  101.566 1.00 27.60  ? 163  LYS A CG  1 
ATOM   1155  C  CD  . LYS A  1 163 ? 52.152  56.264  100.502 1.00 30.06  ? 163  LYS A CD  1 
ATOM   1156  C  CE  . LYS A  1 163 ? 52.094  57.039  99.185  1.00 42.47  ? 163  LYS A CE  1 
ATOM   1157  N  NZ  . LYS A  1 163 ? 51.765  56.201  97.973  1.00 47.15  ? 163  LYS A NZ  1 
HETATM 1158  N  N   . MSE A  1 164 ? 51.874  59.021  104.339 1.00 31.87  ? 164  MSE A N   1 
HETATM 1159  C  CA  . MSE A  1 164 ? 51.429  60.409  104.385 1.00 28.41  ? 164  MSE A CA  1 
HETATM 1160  C  C   . MSE A  1 164 ? 52.309  61.239  105.307 1.00 27.54  ? 164  MSE A C   1 
HETATM 1161  O  O   . MSE A  1 164 ? 52.745  62.328  104.944 1.00 28.35  ? 164  MSE A O   1 
HETATM 1162  C  CB  . MSE A  1 164 ? 49.979  60.481  104.855 1.00 29.65  ? 164  MSE A CB  1 
HETATM 1163  C  CG  . MSE A  1 164 ? 49.361  61.861  104.778 1.00 33.00  ? 164  MSE A CG  1 
HETATM 1164  SE SE  . MSE A  1 164 ? 49.130  62.597  102.972 1.00 50.96  ? 164  MSE A SE  1 
HETATM 1165  C  CE  . MSE A  1 164 ? 48.067  64.170  103.449 1.00 34.86  ? 164  MSE A CE  1 
ATOM   1166  N  N   . ALA A  1 165 ? 52.571  60.731  106.505 1.00 25.98  ? 165  ALA A N   1 
ATOM   1167  C  CA  . ALA A  1 165 ? 53.416  61.459  107.440 1.00 27.00  ? 165  ALA A CA  1 
ATOM   1168  C  C   . ALA A  1 165 ? 54.797  61.732  106.829 1.00 27.83  ? 165  ALA A C   1 
ATOM   1169  O  O   . ALA A  1 165 ? 55.335  62.820  106.980 1.00 26.72  ? 165  ALA A O   1 
ATOM   1170  C  CB  . ALA A  1 165 ? 53.551  60.691  108.728 1.00 21.09  ? 165  ALA A CB  1 
ATOM   1171  N  N   . LYS A  1 166 ? 55.360  60.748  106.134 1.00 29.50  ? 166  LYS A N   1 
ATOM   1172  C  CA  . LYS A  1 166 ? 56.663  60.907  105.500 1.00 33.32  ? 166  LYS A CA  1 
ATOM   1173  C  C   . LYS A  1 166 ? 56.661  62.036  104.452 1.00 35.62  ? 166  LYS A C   1 
ATOM   1174  O  O   . LYS A  1 166 ? 57.577  62.875  104.416 1.00 35.05  ? 166  LYS A O   1 
ATOM   1175  C  CB  . LYS A  1 166 ? 57.089  59.584  104.853 1.00 35.74  ? 166  LYS A CB  1 
ATOM   1176  C  CG  . LYS A  1 166 ? 57.349  58.464  105.868 1.00 41.89  ? 166  LYS A CG  1 
ATOM   1177  C  CD  . LYS A  1 166 ? 57.802  57.177  105.196 1.00 43.09  ? 166  LYS A CD  1 
ATOM   1178  C  CE  . LYS A  1 166 ? 58.106  56.092  106.213 1.00 45.90  ? 166  LYS A CE  1 
ATOM   1179  N  NZ  . LYS A  1 166 ? 58.818  54.934  105.578 1.00 50.22  ? 166  LYS A NZ  1 
ATOM   1180  N  N   . ALA A  1 167 ? 55.632  62.060  103.605 1.00 33.94  ? 167  ALA A N   1 
ATOM   1181  C  CA  . ALA A  1 167 ? 55.512  63.082  102.570 1.00 30.98  ? 167  ALA A CA  1 
ATOM   1182  C  C   . ALA A  1 167 ? 55.421  64.475  103.177 1.00 30.67  ? 167  ALA A C   1 
ATOM   1183  O  O   . ALA A  1 167 ? 56.006  65.422  102.657 1.00 35.83  ? 167  ALA A O   1 
ATOM   1184  C  CB  . ALA A  1 167 ? 54.293  62.812  101.703 1.00 26.80  ? 167  ALA A CB  1 
ATOM   1185  N  N   . LEU A  1 168 ? 54.684  64.596  104.276 1.00 31.48  ? 168  LEU A N   1 
ATOM   1186  C  CA  . LEU A  1 168 ? 54.512  65.872  104.963 1.00 31.11  ? 168  LEU A CA  1 
ATOM   1187  C  C   . LEU A  1 168 ? 55.802  66.326  105.634 1.00 33.46  ? 168  LEU A C   1 
ATOM   1188  O  O   . LEU A  1 168 ? 56.104  67.519  105.695 1.00 32.16  ? 168  LEU A O   1 
ATOM   1189  C  CB  . LEU A  1 168 ? 53.416  65.743  106.015 1.00 28.88  ? 168  LEU A CB  1 
ATOM   1190  C  CG  . LEU A  1 168 ? 52.003  65.964  105.492 1.00 28.88  ? 168  LEU A CG  1 
ATOM   1191  C  CD1 . LEU A  1 168 ? 50.987  65.573  106.560 1.00 30.02  ? 168  LEU A CD1 1 
ATOM   1192  C  CD2 . LEU A  1 168 ? 51.850  67.421  105.084 1.00 21.95  ? 168  LEU A CD2 1 
ATOM   1193  N  N   . CYS A  1 169 ? 56.543  65.354  106.154 1.00 37.29  ? 169  CYS A N   1 
ATOM   1194  C  CA  . CYS A  1 169 ? 57.811  65.590  106.824 1.00 41.64  ? 169  CYS A CA  1 
ATOM   1195  C  C   . CYS A  1 169 ? 58.797  66.211  105.809 1.00 43.90  ? 169  CYS A C   1 
ATOM   1196  O  O   . CYS A  1 169 ? 59.637  67.042  106.159 1.00 45.52  ? 169  CYS A O   1 
ATOM   1197  C  CB  . CYS A  1 169 ? 58.326  64.254  107.384 1.00 39.49  ? 169  CYS A CB  1 
ATOM   1198  S  SG  . CYS A  1 169 ? 59.983  64.266  108.118 1.00 48.97  ? 169  CYS A SG  1 
ATOM   1199  N  N   . HIS A  1 170 ? 58.669  65.825  104.544 1.00 44.27  ? 170  HIS A N   1 
ATOM   1200  C  CA  . HIS A  1 170 ? 59.535  66.357  103.500 1.00 44.20  ? 170  HIS A CA  1 
ATOM   1201  C  C   . HIS A  1 170 ? 59.135  67.770  103.107 1.00 43.58  ? 170  HIS A C   1 
ATOM   1202  O  O   . HIS A  1 170 ? 59.910  68.490  102.493 1.00 47.52  ? 170  HIS A O   1 
ATOM   1203  C  CB  . HIS A  1 170 ? 59.514  65.433  102.284 1.00 42.66  ? 170  HIS A CB  1 
ATOM   1204  C  CG  . HIS A  1 170 ? 60.176  64.119  102.532 1.00 45.99  ? 170  HIS A CG  1 
ATOM   1205  N  ND1 . HIS A  1 170 ? 59.682  62.930  102.043 1.00 47.98  ? 170  HIS A ND1 1 
ATOM   1206  C  CD2 . HIS A  1 170 ? 61.296  63.804  103.228 1.00 47.01  ? 170  HIS A CD2 1 
ATOM   1207  C  CE1 . HIS A  1 170 ? 60.465  61.939  102.429 1.00 47.69  ? 170  HIS A CE1 1 
ATOM   1208  N  NE2 . HIS A  1 170 ? 61.452  62.443  103.148 1.00 48.03  ? 170  HIS A NE2 1 
ATOM   1209  N  N   . LEU A  1 171 ? 57.916  68.166  103.440 1.00 44.04  ? 171  LEU A N   1 
ATOM   1210  C  CA  . LEU A  1 171 ? 57.474  69.523  103.142 1.00 44.67  ? 171  LEU A CA  1 
ATOM   1211  C  C   . LEU A  1 171 ? 57.652  70.266  104.440 1.00 44.35  ? 171  LEU A C   1 
ATOM   1212  O  O   . LEU A  1 171 ? 57.032  71.302  104.660 1.00 44.19  ? 171  LEU A O   1 
ATOM   1213  C  CB  . LEU A  1 171 ? 56.007  69.556  102.731 1.00 42.07  ? 171  LEU A CB  1 
ATOM   1214  C  CG  . LEU A  1 171 ? 55.732  68.827  101.421 1.00 47.01  ? 171  LEU A CG  1 
ATOM   1215  C  CD1 . LEU A  1 171 ? 54.238  68.483  101.335 1.00 47.12  ? 171  LEU A CD1 1 
ATOM   1216  C  CD2 . LEU A  1 171 ? 56.200  69.700  100.242 1.00 42.77  ? 171  LEU A CD2 1 
ATOM   1217  N  N   . ASN A  1 172 ? 58.499  69.706  105.299 1.00 43.93  ? 172  ASN A N   1 
ATOM   1218  C  CA  . ASN A  1 172 ? 58.785  70.284  106.600 1.00 45.23  ? 172  ASN A CA  1 
ATOM   1219  C  C   . ASN A  1 172 ? 57.570  70.756  107.367 1.00 42.74  ? 172  ASN A C   1 
ATOM   1220  O  O   . ASN A  1 172 ? 57.521  71.891  107.833 1.00 41.75  ? 172  ASN A O   1 
ATOM   1221  C  CB  . ASN A  1 172 ? 59.768  71.429  106.450 1.00 52.41  ? 172  ASN A CB  1 
ATOM   1222  C  CG  . ASN A  1 172 ? 61.189  70.967  106.572 1.00 61.98  ? 172  ASN A CG  1 
ATOM   1223  O  OD1 . ASN A  1 172 ? 61.690  70.767  107.690 1.00 63.75  ? 172  ASN A OD1 1 
ATOM   1224  N  ND2 . ASN A  1 172 ? 61.853  70.758  105.426 1.00 64.68  ? 172  ASN A ND2 1 
ATOM   1225  N  N   . VAL A  1 173 ? 56.595  69.865  107.504 1.00 40.15  ? 173  VAL A N   1 
ATOM   1226  C  CA  . VAL A  1 173 ? 55.373  70.156  108.241 1.00 36.15  ? 173  VAL A CA  1 
ATOM   1227  C  C   . VAL A  1 173 ? 55.391  69.286  109.506 1.00 31.47  ? 173  VAL A C   1 
ATOM   1228  O  O   . VAL A  1 173 ? 55.486  68.069  109.413 1.00 32.29  ? 173  VAL A O   1 
ATOM   1229  C  CB  . VAL A  1 173 ? 54.119  69.783  107.396 1.00 38.35  ? 173  VAL A CB  1 
ATOM   1230  C  CG1 . VAL A  1 173 ? 52.840  70.298  108.072 1.00 34.47  ? 173  VAL A CG1 1 
ATOM   1231  C  CG2 . VAL A  1 173 ? 54.258  70.338  105.985 1.00 35.34  ? 173  VAL A CG2 1 
ATOM   1232  N  N   . PRO A  1 174 ? 55.336  69.892  110.702 1.00 28.08  ? 174  PRO A N   1 
ATOM   1233  C  CA  . PRO A  1 174 ? 55.349  68.989  111.862 1.00 28.59  ? 174  PRO A CA  1 
ATOM   1234  C  C   . PRO A  1 174 ? 54.111  68.099  111.816 1.00 30.57  ? 174  PRO A C   1 
ATOM   1235  O  O   . PRO A  1 174 ? 52.967  68.587  111.828 1.00 32.61  ? 174  PRO A O   1 
ATOM   1236  C  CB  . PRO A  1 174 ? 55.353  69.937  113.060 1.00 23.43  ? 174  PRO A CB  1 
ATOM   1237  C  CG  . PRO A  1 174 ? 54.720  71.186  112.528 1.00 29.44  ? 174  PRO A CG  1 
ATOM   1238  C  CD  . PRO A  1 174 ? 55.240  71.302  111.115 1.00 26.13  ? 174  PRO A CD  1 
ATOM   1239  N  N   . VAL A  1 175 ? 54.354  66.796  111.742 1.00 26.93  ? 175  VAL A N   1 
ATOM   1240  C  CA  . VAL A  1 175 ? 53.296  65.811  111.664 1.00 25.59  ? 175  VAL A CA  1 
ATOM   1241  C  C   . VAL A  1 175 ? 53.469  64.731  112.737 1.00 29.47  ? 175  VAL A C   1 
ATOM   1242  O  O   . VAL A  1 175 ? 54.595  64.402  113.108 1.00 33.34  ? 175  VAL A O   1 
ATOM   1243  C  CB  . VAL A  1 175 ? 53.328  65.162  110.287 1.00 25.17  ? 175  VAL A CB  1 
ATOM   1244  C  CG1 . VAL A  1 175 ? 54.775  64.722  109.964 1.00 11.57  ? 175  VAL A CG1 1 
ATOM   1245  C  CG2 . VAL A  1 175 ? 52.357  63.994  110.238 1.00 22.02  ? 175  VAL A CG2 1 
ATOM   1246  N  N   . THR A  1 176 ? 52.362  64.181  113.230 1.00 30.28  ? 176  THR A N   1 
ATOM   1247  C  CA  . THR A  1 176 ? 52.409  63.126  114.247 1.00 30.22  ? 176  THR A CA  1 
ATOM   1248  C  C   . THR A  1 176 ? 51.480  61.973  113.901 1.00 29.46  ? 176  THR A C   1 
ATOM   1249  O  O   . THR A  1 176 ? 50.287  62.173  113.696 1.00 32.52  ? 176  THR A O   1 
ATOM   1250  C  CB  . THR A  1 176 ? 51.996  63.637  115.632 1.00 33.04  ? 176  THR A CB  1 
ATOM   1251  O  OG1 . THR A  1 176 ? 52.876  64.692  116.038 1.00 37.21  ? 176  THR A OG1 1 
ATOM   1252  C  CG2 . THR A  1 176 ? 52.069  62.510  116.655 1.00 34.20  ? 176  THR A CG2 1 
ATOM   1253  N  N   . VAL A  1 177 ? 52.039  60.769  113.844 1.00 25.31  ? 177  VAL A N   1 
ATOM   1254  C  CA  . VAL A  1 177 ? 51.279  59.573  113.533 1.00 22.40  ? 177  VAL A CA  1 
ATOM   1255  C  C   . VAL A  1 177 ? 50.683  58.983  114.810 1.00 25.17  ? 177  VAL A C   1 
ATOM   1256  O  O   . VAL A  1 177 ? 51.377  58.854  115.827 1.00 26.24  ? 177  VAL A O   1 
ATOM   1257  C  CB  . VAL A  1 177 ? 52.190  58.486  112.894 1.00 23.55  ? 177  VAL A CB  1 
ATOM   1258  C  CG1 . VAL A  1 177 ? 51.371  57.223  112.541 1.00 17.20  ? 177  VAL A CG1 1 
ATOM   1259  C  CG2 . VAL A  1 177 ? 52.883  59.042  111.662 1.00 17.44  ? 177  VAL A CG2 1 
ATOM   1260  N  N   . VAL A  1 178 ? 49.398  58.636  114.763 1.00 23.27  ? 178  VAL A N   1 
ATOM   1261  C  CA  . VAL A  1 178 ? 48.739  58.022  115.913 1.00 21.02  ? 178  VAL A CA  1 
ATOM   1262  C  C   . VAL A  1 178 ? 48.051  56.767  115.425 1.00 22.29  ? 178  VAL A C   1 
ATOM   1263  O  O   . VAL A  1 178 ? 47.828  56.600  114.228 1.00 25.58  ? 178  VAL A O   1 
ATOM   1264  C  CB  . VAL A  1 178 ? 47.682  58.948  116.537 1.00 21.07  ? 178  VAL A CB  1 
ATOM   1265  C  CG1 . VAL A  1 178 ? 48.310  60.300  116.847 1.00 25.75  ? 178  VAL A CG1 1 
ATOM   1266  C  CG2 . VAL A  1 178 ? 46.491  59.104  115.607 1.00 12.89  ? 178  VAL A CG2 1 
ATOM   1267  N  N   . LEU A  1 179 ? 47.722  55.869  116.340 1.00 23.68  ? 179  LEU A N   1 
ATOM   1268  C  CA  . LEU A  1 179 ? 47.030  54.644  115.954 1.00 23.76  ? 179  LEU A CA  1 
ATOM   1269  C  C   . LEU A  1 179 ? 45.582  54.944  115.523 1.00 23.59  ? 179  LEU A C   1 
ATOM   1270  O  O   . LEU A  1 179 ? 44.972  55.926  115.987 1.00 18.10  ? 179  LEU A O   1 
ATOM   1271  C  CB  . LEU A  1 179 ? 47.008  53.673  117.132 1.00 25.33  ? 179  LEU A CB  1 
ATOM   1272  C  CG  . LEU A  1 179 ? 48.001  52.514  117.189 1.00 27.11  ? 179  LEU A CG  1 
ATOM   1273  C  CD1 . LEU A  1 179 ? 49.423  52.998  117.186 1.00 25.85  ? 179  LEU A CD1 1 
ATOM   1274  C  CD2 . LEU A  1 179 ? 47.728  51.742  118.465 1.00 31.71  ? 179  LEU A CD2 1 
ATOM   1275  N  N   . ASP A  1 180 ? 45.038  54.100  114.642 1.00 24.07  ? 180  ASP A N   1 
ATOM   1276  C  CA  . ASP A  1 180 ? 43.646  54.244  114.189 1.00 22.02  ? 180  ASP A CA  1 
ATOM   1277  C  C   . ASP A  1 180 ? 42.727  54.300  115.409 1.00 20.98  ? 180  ASP A C   1 
ATOM   1278  O  O   . ASP A  1 180 ? 41.770  55.064  115.440 1.00 23.11  ? 180  ASP A O   1 
ATOM   1279  C  CB  . ASP A  1 180 ? 43.227  53.066  113.305 1.00 25.24  ? 180  ASP A CB  1 
ATOM   1280  C  CG  . ASP A  1 180 ? 44.093  52.927  112.041 1.00 34.15  ? 180  ASP A CG  1 
ATOM   1281  O  OD1 . ASP A  1 180 ? 44.341  53.953  111.358 1.00 32.53  ? 180  ASP A OD1 1 
ATOM   1282  O  OD2 . ASP A  1 180 ? 44.511  51.784  111.726 1.00 34.98  ? 180  ASP A OD2 1 
ATOM   1283  N  N   . ALA A  1 181 ? 43.046  53.506  116.426 1.00 24.64  ? 181  ALA A N   1 
ATOM   1284  C  CA  . ALA A  1 181 ? 42.268  53.460  117.666 1.00 23.95  ? 181  ALA A CA  1 
ATOM   1285  C  C   . ALA A  1 181 ? 42.360  54.736  118.507 1.00 25.96  ? 181  ALA A C   1 
ATOM   1286  O  O   . ALA A  1 181 ? 41.577  54.923  119.440 1.00 28.09  ? 181  ALA A O   1 
ATOM   1287  C  CB  . ALA A  1 181 ? 42.704  52.278  118.497 1.00 18.41  ? 181  ALA A CB  1 
ATOM   1288  N  N   . ALA A  1 182 ? 43.290  55.627  118.174 1.00 25.92  ? 182  ALA A N   1 
ATOM   1289  C  CA  . ALA A  1 182 ? 43.446  56.857  118.945 1.00 25.70  ? 182  ALA A CA  1 
ATOM   1290  C  C   . ALA A  1 182 ? 42.753  58.125  118.408 1.00 25.57  ? 182  ALA A C   1 
ATOM   1291  O  O   . ALA A  1 182 ? 42.980  59.208  118.927 1.00 23.97  ? 182  ALA A O   1 
ATOM   1292  C  CB  . ALA A  1 182 ? 44.931  57.134  119.157 1.00 20.44  ? 182  ALA A CB  1 
ATOM   1293  N  N   . VAL A  1 183 ? 41.897  58.011  117.396 1.00 29.53  ? 183  VAL A N   1 
ATOM   1294  C  CA  . VAL A  1 183 ? 41.249  59.212  116.864 1.00 30.04  ? 183  VAL A CA  1 
ATOM   1295  C  C   . VAL A  1 183 ? 40.335  59.915  117.871 1.00 31.23  ? 183  VAL A C   1 
ATOM   1296  O  O   . VAL A  1 183 ? 40.458  61.127  118.080 1.00 29.27  ? 183  VAL A O   1 
ATOM   1297  C  CB  . VAL A  1 183 ? 40.430  58.919  115.577 1.00 28.93  ? 183  VAL A CB  1 
ATOM   1298  C  CG1 . VAL A  1 183 ? 39.536  60.114  115.252 1.00 27.65  ? 183  VAL A CG1 1 
ATOM   1299  C  CG2 . VAL A  1 183 ? 41.361  58.680  114.411 1.00 28.72  ? 183  VAL A CG2 1 
ATOM   1300  N  N   . GLY A  1 184 ? 39.425  59.162  118.486 1.00 29.99  ? 184  GLY A N   1 
ATOM   1301  C  CA  . GLY A  1 184 ? 38.514  59.757  119.451 1.00 32.09  ? 184  GLY A CA  1 
ATOM   1302  C  C   . GLY A  1 184 ? 39.273  60.458  120.560 1.00 31.90  ? 184  GLY A C   1 
ATOM   1303  O  O   . GLY A  1 184 ? 38.820  61.462  121.125 1.00 30.53  ? 184  GLY A O   1 
ATOM   1304  N  N   . TYR A  1 185 ? 40.450  59.915  120.849 1.00 31.69  ? 185  TYR A N   1 
ATOM   1305  C  CA  . TYR A  1 185 ? 41.346  60.420  121.881 1.00 31.02  ? 185  TYR A CA  1 
ATOM   1306  C  C   . TYR A  1 185 ? 42.095  61.699  121.498 1.00 31.69  ? 185  TYR A C   1 
ATOM   1307  O  O   . TYR A  1 185 ? 42.243  62.599  122.322 1.00 33.02  ? 185  TYR A O   1 
ATOM   1308  C  CB  . TYR A  1 185 ? 42.371  59.336  122.222 1.00 29.91  ? 185  TYR A CB  1 
ATOM   1309  C  CG  . TYR A  1 185 ? 43.616  59.855  122.902 1.00 29.22  ? 185  TYR A CG  1 
ATOM   1310  C  CD1 . TYR A  1 185 ? 43.756  59.802  124.285 1.00 28.10  ? 185  TYR A CD1 1 
ATOM   1311  C  CD2 . TYR A  1 185 ? 44.651  60.417  122.159 1.00 31.90  ? 185  TYR A CD2 1 
ATOM   1312  C  CE1 . TYR A  1 185 ? 44.892  60.288  124.905 1.00 29.16  ? 185  TYR A CE1 1 
ATOM   1313  C  CE2 . TYR A  1 185 ? 45.789  60.914  122.773 1.00 31.19  ? 185  TYR A CE2 1 
ATOM   1314  C  CZ  . TYR A  1 185 ? 45.903  60.843  124.139 1.00 31.25  ? 185  TYR A CZ  1 
ATOM   1315  O  OH  . TYR A  1 185 ? 47.040  61.314  124.735 1.00 37.26  ? 185  TYR A OH  1 
ATOM   1316  N  N   . ILE A  1 186 ? 42.584  61.762  120.259 1.00 30.59  ? 186  ILE A N   1 
ATOM   1317  C  CA  . ILE A  1 186 ? 43.363  62.906  119.788 1.00 31.16  ? 186  ILE A CA  1 
ATOM   1318  C  C   . ILE A  1 186 ? 42.524  64.062  119.251 1.00 32.06  ? 186  ILE A C   1 
ATOM   1319  O  O   . ILE A  1 186 ? 43.000  65.195  119.130 1.00 31.11  ? 186  ILE A O   1 
ATOM   1320  C  CB  . ILE A  1 186 ? 44.346  62.471  118.679 1.00 30.38  ? 186  ILE A CB  1 
ATOM   1321  C  CG1 . ILE A  1 186 ? 45.459  63.505  118.522 1.00 32.30  ? 186  ILE A CG1 1 
ATOM   1322  C  CG2 . ILE A  1 186 ? 43.615  62.343  117.357 1.00 29.06  ? 186  ILE A CG2 1 
ATOM   1323  C  CD1 . ILE A  1 186 ? 46.438  63.541  119.699 1.00 37.48  ? 186  ILE A CD1 1 
HETATM 1324  N  N   . MSE A  1 187 ? 41.276  63.752  118.924 1.00 31.71  ? 187  MSE A N   1 
HETATM 1325  C  CA  . MSE A  1 187 ? 40.339  64.717  118.380 1.00 30.15  ? 187  MSE A CA  1 
HETATM 1326  C  C   . MSE A  1 187 ? 40.297  66.055  119.103 1.00 30.40  ? 187  MSE A C   1 
HETATM 1327  O  O   . MSE A  1 187 ? 40.297  67.114  118.481 1.00 30.22  ? 187  MSE A O   1 
HETATM 1328  C  CB  . MSE A  1 187 ? 38.937  64.109  118.375 1.00 27.90  ? 187  MSE A CB  1 
HETATM 1329  C  CG  . MSE A  1 187 ? 37.897  64.946  117.656 1.00 33.51  ? 187  MSE A CG  1 
HETATM 1330  SE SE  . MSE A  1 187 ? 38.354  65.401  115.806 1.00 45.76  ? 187  MSE A SE  1 
HETATM 1331  C  CE  . MSE A  1 187 ? 37.921  63.771  114.884 1.00 30.67  ? 187  MSE A CE  1 
ATOM   1332  N  N   . GLU A  1 188 ? 40.268  66.010  120.421 1.00 31.57  ? 188  GLU A N   1 
ATOM   1333  C  CA  . GLU A  1 188 ? 40.161  67.232  121.189 1.00 32.79  ? 188  GLU A CA  1 
ATOM   1334  C  C   . GLU A  1 188 ? 41.235  68.252  120.934 1.00 33.03  ? 188  GLU A C   1 
ATOM   1335  O  O   . GLU A  1 188 ? 41.027  69.440  121.192 1.00 34.34  ? 188  GLU A O   1 
ATOM   1336  C  CB  . GLU A  1 188 ? 40.101  66.920  122.675 1.00 33.71  ? 188  GLU A CB  1 
ATOM   1337  C  CG  . GLU A  1 188 ? 41.286  66.171  123.213 1.00 32.76  ? 188  GLU A CG  1 
ATOM   1338  C  CD  . GLU A  1 188 ? 41.195  66.003  124.710 1.00 36.66  ? 188  GLU A CD  1 
ATOM   1339  O  OE1 . GLU A  1 188 ? 40.214  65.366  125.170 1.00 36.21  ? 188  GLU A OE1 1 
ATOM   1340  O  OE2 . GLU A  1 188 ? 42.095  66.519  125.423 1.00 36.93  ? 188  GLU A OE2 1 
ATOM   1341  N  N   . LYS A  1 189 ? 42.378  67.815  120.428 1.00 31.28  ? 189  LYS A N   1 
ATOM   1342  C  CA  . LYS A  1 189 ? 43.437  68.768  120.166 1.00 32.55  ? 189  LYS A CA  1 
ATOM   1343  C  C   . LYS A  1 189 ? 43.613  69.133  118.696 1.00 32.59  ? 189  LYS A C   1 
ATOM   1344  O  O   . LYS A  1 189 ? 44.691  69.537  118.264 1.00 36.46  ? 189  LYS A O   1 
ATOM   1345  C  CB  . LYS A  1 189 ? 44.749  68.259  120.744 1.00 33.98  ? 189  LYS A CB  1 
ATOM   1346  C  CG  . LYS A  1 189 ? 45.285  67.046  120.075 1.00 37.10  ? 189  LYS A CG  1 
ATOM   1347  C  CD  . LYS A  1 189 ? 46.678  66.748  120.589 1.00 40.06  ? 189  LYS A CD  1 
ATOM   1348  C  CE  . LYS A  1 189 ? 46.665  66.301  122.034 1.00 38.90  ? 189  LYS A CE  1 
ATOM   1349  N  NZ  . LYS A  1 189 ? 47.962  65.651  122.375 1.00 42.29  ? 189  LYS A NZ  1 
ATOM   1350  N  N   . ALA A  1 190 ? 42.549  68.995  117.925 1.00 32.94  ? 190  ALA A N   1 
ATOM   1351  C  CA  . ALA A  1 190 ? 42.591  69.342  116.512 1.00 34.52  ? 190  ALA A CA  1 
ATOM   1352  C  C   . ALA A  1 190 ? 41.570  70.461  116.295 1.00 33.33  ? 190  ALA A C   1 
ATOM   1353  O  O   . ALA A  1 190 ? 40.620  70.585  117.057 1.00 31.93  ? 190  ALA A O   1 
ATOM   1354  C  CB  . ALA A  1 190 ? 42.261  68.111  115.639 1.00 32.30  ? 190  ALA A CB  1 
ATOM   1355  N  N   . ASP A  1 191 ? 41.783  71.282  115.273 1.00 32.13  ? 191  ASP A N   1 
ATOM   1356  C  CA  . ASP A  1 191 ? 40.881  72.384  114.992 1.00 32.82  ? 191  ASP A CA  1 
ATOM   1357  C  C   . ASP A  1 191 ? 39.929  72.045  113.869 1.00 32.06  ? 191  ASP A C   1 
ATOM   1358  O  O   . ASP A  1 191 ? 38.848  72.627  113.779 1.00 33.33  ? 191  ASP A O   1 
ATOM   1359  C  CB  . ASP A  1 191 ? 41.669  73.625  114.591 1.00 38.84  ? 191  ASP A CB  1 
ATOM   1360  C  CG  . ASP A  1 191 ? 42.585  74.106  115.681 1.00 43.12  ? 191  ASP A CG  1 
ATOM   1361  O  OD1 . ASP A  1 191 ? 42.080  74.364  116.800 1.00 44.22  ? 191  ASP A OD1 1 
ATOM   1362  O  OD2 . ASP A  1 191 ? 43.805  74.225  115.413 1.00 46.76  ? 191  ASP A OD2 1 
ATOM   1363  N  N   . LEU A  1 192 ? 40.351  71.118  113.012 1.00 26.51  ? 192  LEU A N   1 
ATOM   1364  C  CA  . LEU A  1 192 ? 39.563  70.694  111.870 1.00 24.49  ? 192  LEU A CA  1 
ATOM   1365  C  C   . LEU A  1 192 ? 40.090  69.376  111.323 1.00 23.47  ? 192  LEU A C   1 
ATOM   1366  O  O   . LEU A  1 192 ? 41.198  68.958  111.641 1.00 24.59  ? 192  LEU A O   1 
ATOM   1367  C  CB  . LEU A  1 192 ? 39.614  71.750  110.761 1.00 28.18  ? 192  LEU A CB  1 
ATOM   1368  C  CG  . LEU A  1 192 ? 40.970  71.990  110.070 1.00 29.42  ? 192  LEU A CG  1 
ATOM   1369  C  CD1 . LEU A  1 192 ? 40.777  72.813  108.790 1.00 26.36  ? 192  LEU A CD1 1 
ATOM   1370  C  CD2 . LEU A  1 192 ? 41.901  72.711  111.029 1.00 28.70  ? 192  LEU A CD2 1 
ATOM   1371  N  N   . VAL A  1 193 ? 39.273  68.722  110.505 1.00 23.35  ? 193  VAL A N   1 
ATOM   1372  C  CA  . VAL A  1 193 ? 39.628  67.447  109.892 1.00 23.27  ? 193  VAL A CA  1 
ATOM   1373  C  C   . VAL A  1 193 ? 39.566  67.622  108.376 1.00 24.24  ? 193  VAL A C   1 
ATOM   1374  O  O   . VAL A  1 193 ? 38.614  68.206  107.860 1.00 27.09  ? 193  VAL A O   1 
ATOM   1375  C  CB  . VAL A  1 193 ? 38.633  66.314  110.291 1.00 19.45  ? 193  VAL A CB  1 
ATOM   1376  C  CG1 . VAL A  1 193 ? 39.029  65.008  109.587 1.00 12.61  ? 193  VAL A CG1 1 
ATOM   1377  C  CG2 . VAL A  1 193 ? 38.620  66.116  111.810 1.00 18.60  ? 193  VAL A CG2 1 
ATOM   1378  N  N   . ILE A  1 194 ? 40.580  67.132  107.667 1.00 19.92  ? 194  ILE A N   1 
ATOM   1379  C  CA  . ILE A  1 194 ? 40.595  67.234  106.211 1.00 19.20  ? 194  ILE A CA  1 
ATOM   1380  C  C   . ILE A  1 194 ? 40.960  65.868  105.670 1.00 17.69  ? 194  ILE A C   1 
ATOM   1381  O  O   . ILE A  1 194 ? 42.017  65.352  105.995 1.00 17.77  ? 194  ILE A O   1 
ATOM   1382  C  CB  . ILE A  1 194 ? 41.652  68.257  105.698 1.00 19.25  ? 194  ILE A CB  1 
ATOM   1383  C  CG1 . ILE A  1 194 ? 41.394  69.629  106.308 1.00 16.60  ? 194  ILE A CG1 1 
ATOM   1384  C  CG2 . ILE A  1 194 ? 41.611  68.341  104.177 1.00 12.20  ? 194  ILE A CG2 1 
ATOM   1385  C  CD1 . ILE A  1 194 ? 42.408  70.647  105.922 1.00 18.24  ? 194  ILE A CD1 1 
ATOM   1386  N  N   . VAL A  1 195 ? 40.082  65.288  104.856 1.00 11.38  ? 195  VAL A N   1 
ATOM   1387  C  CA  . VAL A  1 195 ? 40.331  63.989  104.281 1.00 11.49  ? 195  VAL A CA  1 
ATOM   1388  C  C   . VAL A  1 195 ? 39.901  64.036  102.840 1.00 15.38  ? 195  VAL A C   1 
ATOM   1389  O  O   . VAL A  1 195 ? 39.090  64.889  102.446 1.00 13.21  ? 195  VAL A O   1 
ATOM   1390  C  CB  . VAL A  1 195 ? 39.490  62.845  104.939 1.00 16.64  ? 195  VAL A CB  1 
ATOM   1391  C  CG1 . VAL A  1 195 ? 39.664  62.829  106.455 1.00 6.10   ? 195  VAL A CG1 1 
ATOM   1392  C  CG2 . VAL A  1 195 ? 38.019  62.981  104.527 1.00 10.34  ? 195  VAL A CG2 1 
ATOM   1393  N  N   . GLY A  1 196 ? 40.428  63.087  102.069 1.00 15.17  ? 196  GLY A N   1 
ATOM   1394  C  CA  . GLY A  1 196 ? 40.092  62.979  100.671 1.00 14.25  ? 196  GLY A CA  1 
ATOM   1395  C  C   . GLY A  1 196 ? 38.955  61.986  100.525 1.00 21.57  ? 196  GLY A C   1 
ATOM   1396  O  O   . GLY A  1 196 ? 38.342  61.586  101.528 1.00 21.25  ? 196  GLY A O   1 
ATOM   1397  N  N   . ALA A  1 197 ? 38.680  61.586  99.284  1.00 23.70  ? 197  ALA A N   1 
ATOM   1398  C  CA  . ALA A  1 197 ? 37.616  60.643  98.992  1.00 26.81  ? 197  ALA A CA  1 
ATOM   1399  C  C   . ALA A  1 197 ? 37.895  59.766  97.770  1.00 29.95  ? 197  ALA A C   1 
ATOM   1400  O  O   . ALA A  1 197 ? 38.654  60.128  96.871  1.00 28.45  ? 197  ALA A O   1 
ATOM   1401  C  CB  . ALA A  1 197 ? 36.330  61.391  98.790  1.00 25.35  ? 197  ALA A CB  1 
ATOM   1402  N  N   . GLU A  1 198 ? 37.265  58.599  97.772  1.00 33.23  ? 198  GLU A N   1 
ATOM   1403  C  CA  . GLU A  1 198 ? 37.362  57.625  96.697  1.00 34.25  ? 198  GLU A CA  1 
ATOM   1404  C  C   . GLU A  1 198 ? 36.252  58.017  95.754  1.00 34.34  ? 198  GLU A C   1 
ATOM   1405  O  O   . GLU A  1 198 ? 36.414  58.023  94.532  1.00 36.49  ? 198  GLU A O   1 
ATOM   1406  C  CB  . GLU A  1 198 ? 37.060  56.238  97.234  1.00 40.64  ? 198  GLU A CB  1 
ATOM   1407  C  CG  . GLU A  1 198 ? 38.031  55.757  98.258  1.00 49.83  ? 198  GLU A CG  1 
ATOM   1408  C  CD  . GLU A  1 198 ? 39.085  54.888  97.636  1.00 57.28  ? 198  GLU A CD  1 
ATOM   1409  O  OE1 . GLU A  1 198 ? 39.485  55.193  96.488  1.00 59.75  ? 198  GLU A OE1 1 
ATOM   1410  O  OE2 . GLU A  1 198 ? 39.513  53.910  98.293  1.00 62.41  ? 198  GLU A OE2 1 
ATOM   1411  N  N   . GLY A  1 199 ? 35.109  58.339  96.357  1.00 32.53  ? 199  GLY A N   1 
ATOM   1412  C  CA  . GLY A  1 199 ? 33.942  58.741  95.598  1.00 27.56  ? 199  GLY A CA  1 
ATOM   1413  C  C   . GLY A  1 199 ? 32.984  59.578  96.405  1.00 22.31  ? 199  GLY A C   1 
ATOM   1414  O  O   . GLY A  1 199 ? 32.902  59.470  97.615  1.00 24.12  ? 199  GLY A O   1 
ATOM   1415  N  N   . VAL A  1 200 ? 32.251  60.427  95.719  1.00 22.61  ? 200  VAL A N   1 
ATOM   1416  C  CA  . VAL A  1 200 ? 31.277  61.283  96.357  1.00 21.58  ? 200  VAL A CA  1 
ATOM   1417  C  C   . VAL A  1 200 ? 29.943  60.809  95.786  1.00 23.81  ? 200  VAL A C   1 
ATOM   1418  O  O   . VAL A  1 200 ? 29.739  60.810  94.571  1.00 25.14  ? 200  VAL A O   1 
ATOM   1419  C  CB  . VAL A  1 200 ? 31.561  62.768  96.000  1.00 23.01  ? 200  VAL A CB  1 
ATOM   1420  C  CG1 . VAL A  1 200 ? 30.489  63.684  96.556  1.00 19.30  ? 200  VAL A CG1 1 
ATOM   1421  C  CG2 . VAL A  1 200 ? 32.920  63.167  96.563  1.00 23.35  ? 200  VAL A CG2 1 
ATOM   1422  N  N   . VAL A  1 201 ? 29.047  60.376  96.664  1.00 23.51  ? 201  VAL A N   1 
ATOM   1423  C  CA  . VAL A  1 201 ? 27.741  59.876  96.238  1.00 24.31  ? 201  VAL A CA  1 
ATOM   1424  C  C   . VAL A  1 201 ? 26.712  60.990  96.052  1.00 24.73  ? 201  VAL A C   1 
ATOM   1425  O  O   . VAL A  1 201 ? 26.956  62.145  96.406  1.00 23.95  ? 201  VAL A O   1 
ATOM   1426  C  CB  . VAL A  1 201 ? 27.203  58.827  97.251  1.00 20.65  ? 201  VAL A CB  1 
ATOM   1427  C  CG1 . VAL A  1 201 ? 28.182  57.658  97.338  1.00 14.68  ? 201  VAL A CG1 1 
ATOM   1428  C  CG2 . VAL A  1 201 ? 27.021  59.465  98.624  1.00 11.69  ? 201  VAL A CG2 1 
ATOM   1429  N  N   . GLU A  1 202 ? 25.561  60.623  95.506  1.00 25.58  ? 202  GLU A N   1 
ATOM   1430  C  CA  . GLU A  1 202 ? 24.476  61.568  95.227  1.00 28.11  ? 202  GLU A CA  1 
ATOM   1431  C  C   . GLU A  1 202 ? 23.993  62.412  96.405  1.00 25.91  ? 202  GLU A C   1 
ATOM   1432  O  O   . GLU A  1 202 ? 23.593  63.558  96.224  1.00 24.01  ? 202  GLU A O   1 
ATOM   1433  C  CB  . GLU A  1 202 ? 23.306  60.805  94.591  1.00 28.75  ? 202  GLU A CB  1 
ATOM   1434  C  CG  . GLU A  1 202 ? 23.767  60.047  93.354  1.00 32.11  ? 202  GLU A CG  1 
ATOM   1435  C  CD  . GLU A  1 202 ? 22.789  59.011  92.839  1.00 35.98  ? 202  GLU A CD  1 
ATOM   1436  O  OE1 . GLU A  1 202 ? 22.222  58.233  93.638  1.00 37.65  ? 202  GLU A OE1 1 
ATOM   1437  O  OE2 . GLU A  1 202 ? 22.607  58.958  91.606  1.00 43.44  ? 202  GLU A OE2 1 
ATOM   1438  N  N   . ASN A  1 203 ? 24.037  61.863  97.611  1.00 26.64  ? 203  ASN A N   1 
ATOM   1439  C  CA  . ASN A  1 203 ? 23.592  62.624  98.768  1.00 26.65  ? 203  ASN A CA  1 
ATOM   1440  C  C   . ASN A  1 203 ? 24.684  63.496  99.388  1.00 27.86  ? 203  ASN A C   1 
ATOM   1441  O  O   . ASN A  1 203 ? 24.487  64.071  100.457 1.00 28.86  ? 203  ASN A O   1 
ATOM   1442  C  CB  . ASN A  1 203 ? 22.993  61.698  99.836  1.00 29.29  ? 203  ASN A CB  1 
ATOM   1443  C  CG  . ASN A  1 203 ? 23.954  60.595  100.282 1.00 29.06  ? 203  ASN A CG  1 
ATOM   1444  O  OD1 . ASN A  1 203 ? 25.115  60.858  100.596 1.00 27.27  ? 203  ASN A OD1 1 
ATOM   1445  N  ND2 . ASN A  1 203 ? 23.462  59.357  100.324 1.00 22.30  ? 203  ASN A ND2 1 
ATOM   1446  N  N   . GLY A  1 204 ? 25.831  63.610  98.723  1.00 27.41  ? 204  GLY A N   1 
ATOM   1447  C  CA  . GLY A  1 204 ? 26.896  64.444  99.260  1.00 26.17  ? 204  GLY A CA  1 
ATOM   1448  C  C   . GLY A  1 204 ? 27.765  63.764  100.305 1.00 28.07  ? 204  GLY A C   1 
ATOM   1449  O  O   . GLY A  1 204 ? 28.676  64.376  100.862 1.00 30.43  ? 204  GLY A O   1 
ATOM   1450  N  N   . GLY A  1 205 ? 27.473  62.504  100.599 1.00 25.87  ? 205  GLY A N   1 
ATOM   1451  C  CA  . GLY A  1 205 ? 28.289  61.774  101.546 1.00 27.92  ? 205  GLY A CA  1 
ATOM   1452  C  C   . GLY A  1 205 ? 29.470  61.234  100.756 1.00 28.75  ? 205  GLY A C   1 
ATOM   1453  O  O   . GLY A  1 205 ? 29.516  61.400  99.543  1.00 31.64  ? 205  GLY A O   1 
ATOM   1454  N  N   . ILE A  1 206 ? 30.421  60.584  101.414 1.00 27.11  ? 206  ILE A N   1 
ATOM   1455  C  CA  . ILE A  1 206 ? 31.579  60.061  100.698 1.00 24.56  ? 206  ILE A CA  1 
ATOM   1456  C  C   . ILE A  1 206 ? 31.905  58.621  101.032 1.00 27.11  ? 206  ILE A C   1 
ATOM   1457  O  O   . ILE A  1 206 ? 31.532  58.101  102.089 1.00 27.13  ? 206  ILE A O   1 
ATOM   1458  C  CB  . ILE A  1 206 ? 32.870  60.855  101.012 1.00 21.30  ? 206  ILE A CB  1 
ATOM   1459  C  CG1 . ILE A  1 206 ? 33.163  60.751  102.508 1.00 16.91  ? 206  ILE A CG1 1 
ATOM   1460  C  CG2 . ILE A  1 206 ? 32.764  62.281  100.504 1.00 21.46  ? 206  ILE A CG2 1 
ATOM   1461  C  CD1 . ILE A  1 206 ? 34.371  61.484  102.969 1.00 23.67  ? 206  ILE A CD1 1 
ATOM   1462  N  N   . ILE A  1 207 ? 32.622  57.998  100.106 1.00 26.24  ? 207  ILE A N   1 
ATOM   1463  C  CA  . ILE A  1 207 ? 33.109  56.640  100.254 1.00 27.69  ? 207  ILE A CA  1 
ATOM   1464  C  C   . ILE A  1 207 ? 34.623  56.852  100.361 1.00 30.41  ? 207  ILE A C   1 
ATOM   1465  O  O   . ILE A  1 207 ? 35.215  57.529  99.521  1.00 28.17  ? 207  ILE A O   1 
ATOM   1466  C  CB  . ILE A  1 207 ? 32.778  55.806  99.007  1.00 28.24  ? 207  ILE A CB  1 
ATOM   1467  C  CG1 . ILE A  1 207 ? 31.264  55.593  98.937  1.00 28.90  ? 207  ILE A CG1 1 
ATOM   1468  C  CG2 . ILE A  1 207 ? 33.557  54.490  99.020  1.00 21.04  ? 207  ILE A CG2 1 
ATOM   1469  C  CD1 . ILE A  1 207 ? 30.820  54.724  97.768  1.00 34.99  ? 207  ILE A CD1 1 
ATOM   1470  N  N   . ASN A  1 208 ? 35.245  56.300  101.398 1.00 30.80  ? 208  ASN A N   1 
ATOM   1471  C  CA  . ASN A  1 208 ? 36.678  56.479  101.576 1.00 30.67  ? 208  ASN A CA  1 
ATOM   1472  C  C   . ASN A  1 208 ? 37.276  55.323  102.353 1.00 32.90  ? 208  ASN A C   1 
ATOM   1473  O  O   . ASN A  1 208 ? 36.557  54.443  102.810 1.00 36.53  ? 208  ASN A O   1 
ATOM   1474  C  CB  . ASN A  1 208 ? 36.947  57.779  102.332 1.00 30.33  ? 208  ASN A CB  1 
ATOM   1475  C  CG  . ASN A  1 208 ? 38.368  58.293  102.134 1.00 29.73  ? 208  ASN A CG  1 
ATOM   1476  O  OD1 . ASN A  1 208 ? 38.924  58.973  103.007 1.00 27.16  ? 208  ASN A OD1 1 
ATOM   1477  N  ND2 . ASN A  1 208 ? 38.953  57.989  100.980 1.00 26.92  ? 208  ASN A ND2 1 
ATOM   1478  N  N   . LYS A  1 209 ? 38.601  55.343  102.498 1.00 31.26  ? 209  LYS A N   1 
ATOM   1479  C  CA  . LYS A  1 209 ? 39.348  54.326  103.235 1.00 25.80  ? 209  LYS A CA  1 
ATOM   1480  C  C   . LYS A  1 209 ? 38.800  54.055  104.650 1.00 25.13  ? 209  LYS A C   1 
ATOM   1481  O  O   . LYS A  1 209 ? 38.679  54.973  105.470 1.00 24.95  ? 209  LYS A O   1 
ATOM   1482  C  CB  . LYS A  1 209 ? 40.810  54.766  103.343 1.00 23.69  ? 209  LYS A CB  1 
ATOM   1483  C  CG  . LYS A  1 209 ? 41.709  53.848  104.167 1.00 21.03  ? 209  LYS A CG  1 
ATOM   1484  C  CD  . LYS A  1 209 ? 42.032  52.546  103.437 1.00 21.74  ? 209  LYS A CD  1 
ATOM   1485  C  CE  . LYS A  1 209 ? 43.181  51.801  104.145 1.00 25.69  ? 209  LYS A CE  1 
ATOM   1486  N  NZ  . LYS A  1 209 ? 44.455  52.614  104.159 1.00 22.54  ? 209  LYS A NZ  1 
ATOM   1487  N  N   . ILE A  1 210 ? 38.498  52.791  104.931 1.00 20.27  ? 210  ILE A N   1 
ATOM   1488  C  CA  . ILE A  1 210 ? 37.985  52.357  106.232 1.00 20.18  ? 210  ILE A CA  1 
ATOM   1489  C  C   . ILE A  1 210 ? 38.592  53.114  107.429 1.00 20.86  ? 210  ILE A C   1 
ATOM   1490  O  O   . ILE A  1 210 ? 39.801  53.085  107.664 1.00 23.40  ? 210  ILE A O   1 
ATOM   1491  C  CB  . ILE A  1 210 ? 38.225  50.827  106.408 1.00 20.91  ? 210  ILE A CB  1 
ATOM   1492  C  CG1 . ILE A  1 210 ? 37.453  50.298  107.614 1.00 17.49  ? 210  ILE A CG1 1 
ATOM   1493  C  CG2 . ILE A  1 210 ? 39.706  50.528  106.485 1.00 19.35  ? 210  ILE A CG2 1 
ATOM   1494  C  CD1 . ILE A  1 210 ? 35.984  50.054  107.303 1.00 19.79  ? 210  ILE A CD1 1 
ATOM   1495  N  N   . GLY A  1 211 ? 37.739  53.784  108.194 1.00 22.45  ? 211  GLY A N   1 
ATOM   1496  C  CA  . GLY A  1 211 ? 38.199  54.543  109.346 1.00 16.59  ? 211  GLY A CA  1 
ATOM   1497  C  C   . GLY A  1 211 ? 37.694  55.975  109.256 1.00 20.06  ? 211  GLY A C   1 
ATOM   1498  O  O   . GLY A  1 211 ? 37.545  56.671  110.276 1.00 21.22  ? 211  GLY A O   1 
ATOM   1499  N  N   . THR A  1 212 ? 37.412  56.415  108.029 1.00 18.34  ? 212  THR A N   1 
ATOM   1500  C  CA  . THR A  1 212 ? 36.930  57.769  107.791 1.00 20.15  ? 212  THR A CA  1 
ATOM   1501  C  C   . THR A  1 212 ? 35.675  58.075  108.591 1.00 23.21  ? 212  THR A C   1 
ATOM   1502  O  O   . THR A  1 212 ? 35.607  59.108  109.280 1.00 19.47  ? 212  THR A O   1 
ATOM   1503  C  CB  . THR A  1 212 ? 36.630  58.004  106.305 1.00 22.56  ? 212  THR A CB  1 
ATOM   1504  O  OG1 . THR A  1 212 ? 37.843  57.869  105.550 1.00 26.82  ? 212  THR A OG1 1 
ATOM   1505  C  CG2 . THR A  1 212 ? 36.026  59.406  106.087 1.00 15.07  ? 212  THR A CG2 1 
ATOM   1506  N  N   . ASN A  1 213 ? 34.701  57.164  108.504 1.00 22.88  ? 213  ASN A N   1 
ATOM   1507  C  CA  . ASN A  1 213 ? 33.433  57.300  109.203 1.00 23.55  ? 213  ASN A CA  1 
ATOM   1508  C  C   . ASN A  1 213 ? 33.595  57.609  110.702 1.00 26.10  ? 213  ASN A C   1 
ATOM   1509  O  O   . ASN A  1 213 ? 32.986  58.555  111.212 1.00 25.53  ? 213  ASN A O   1 
ATOM   1510  C  CB  . ASN A  1 213 ? 32.595  56.027  109.005 1.00 24.52  ? 213  ASN A CB  1 
ATOM   1511  C  CG  . ASN A  1 213 ? 31.197  56.138  109.616 1.00 26.52  ? 213  ASN A CG  1 
ATOM   1512  O  OD1 . ASN A  1 213 ? 30.995  55.845  110.793 1.00 29.45  ? 213  ASN A OD1 1 
ATOM   1513  N  ND2 . ASN A  1 213 ? 30.233  56.584  108.814 1.00 26.86  ? 213  ASN A ND2 1 
ATOM   1514  N  N   . GLN A  1 214 ? 34.410  56.816  111.397 1.00 26.04  ? 214  GLN A N   1 
ATOM   1515  C  CA  . GLN A  1 214 ? 34.642  56.997  112.827 1.00 25.98  ? 214  GLN A CA  1 
ATOM   1516  C  C   . GLN A  1 214 ? 35.212  58.369  113.109 1.00 26.83  ? 214  GLN A C   1 
ATOM   1517  O  O   . GLN A  1 214 ? 34.905  58.974  114.140 1.00 24.88  ? 214  GLN A O   1 
ATOM   1518  C  CB  . GLN A  1 214 ? 35.662  55.997  113.355 1.00 29.35  ? 214  GLN A CB  1 
ATOM   1519  C  CG  . GLN A  1 214 ? 35.204  54.595  113.514 1.00 39.57  ? 214  GLN A CG  1 
ATOM   1520  C  CD  . GLN A  1 214 ? 36.376  53.642  113.701 1.00 41.36  ? 214  GLN A CD  1 
ATOM   1521  O  OE1 . GLN A  1 214 ? 36.198  52.428  113.768 1.00 41.41  ? 214  GLN A OE1 1 
ATOM   1522  N  NE2 . GLN A  1 214 ? 37.582  54.192  113.783 1.00 43.72  ? 214  GLN A NE2 1 
HETATM 1523  N  N   . MSE A  1 215 ? 36.082  58.839  112.217 1.00 25.02  ? 215  MSE A N   1 
HETATM 1524  C  CA  . MSE A  1 215 ? 36.716  60.129  112.421 1.00 24.72  ? 215  MSE A CA  1 
HETATM 1525  C  C   . MSE A  1 215 ? 35.669  61.212  112.279 1.00 25.80  ? 215  MSE A C   1 
HETATM 1526  O  O   . MSE A  1 215 ? 35.647  62.161  113.058 1.00 24.80  ? 215  MSE A O   1 
HETATM 1527  C  CB  . MSE A  1 215 ? 37.846  60.332  111.421 1.00 26.17  ? 215  MSE A CB  1 
HETATM 1528  C  CG  . MSE A  1 215 ? 38.686  61.567  111.669 1.00 31.48  ? 215  MSE A CG  1 
HETATM 1529  SE SE  . MSE A  1 215 ? 40.136  61.767  110.375 1.00 42.76  ? 215  MSE A SE  1 
HETATM 1530  C  CE  . MSE A  1 215 ? 41.489  60.718  111.319 1.00 35.09  ? 215  MSE A CE  1 
ATOM   1531  N  N   . ALA A  1 216 ? 34.783  61.050  111.298 1.00 24.72  ? 216  ALA A N   1 
ATOM   1532  C  CA  . ALA A  1 216 ? 33.713  62.009  111.065 1.00 25.39  ? 216  ALA A CA  1 
ATOM   1533  C  C   . ALA A  1 216 ? 32.767  62.034  112.265 1.00 26.10  ? 216  ALA A C   1 
ATOM   1534  O  O   . ALA A  1 216 ? 32.416  63.095  112.761 1.00 28.65  ? 216  ALA A O   1 
ATOM   1535  C  CB  . ALA A  1 216 ? 32.943  61.643  109.782 1.00 28.01  ? 216  ALA A CB  1 
ATOM   1536  N  N   . VAL A  1 217 ? 32.365  60.859  112.733 1.00 25.65  ? 217  VAL A N   1 
ATOM   1537  C  CA  . VAL A  1 217 ? 31.465  60.764  113.873 1.00 26.96  ? 217  VAL A CA  1 
ATOM   1538  C  C   . VAL A  1 217 ? 32.130  61.453  115.077 1.00 28.51  ? 217  VAL A C   1 
ATOM   1539  O  O   . VAL A  1 217 ? 31.508  62.261  115.770 1.00 32.91  ? 217  VAL A O   1 
ATOM   1540  C  CB  . VAL A  1 217 ? 31.112  59.254  114.198 1.00 26.82  ? 217  VAL A CB  1 
ATOM   1541  C  CG1 . VAL A  1 217 ? 30.057  59.174  115.285 1.00 21.60  ? 217  VAL A CG1 1 
ATOM   1542  C  CG2 . VAL A  1 217 ? 30.598  58.543  112.946 1.00 21.60  ? 217  VAL A CG2 1 
ATOM   1543  N  N   . CYS A  1 218 ? 33.402  61.161  115.312 1.00 28.20  ? 218  CYS A N   1 
ATOM   1544  C  CA  . CYS A  1 218 ? 34.120  61.779  116.419 1.00 27.99  ? 218  CYS A CA  1 
ATOM   1545  C  C   . CYS A  1 218 ? 34.280  63.287  116.280 1.00 26.83  ? 218  CYS A C   1 
ATOM   1546  O  O   . CYS A  1 218 ? 34.265  64.005  117.287 1.00 27.90  ? 218  CYS A O   1 
ATOM   1547  C  CB  . CYS A  1 218 ? 35.493  61.150  116.576 1.00 29.69  ? 218  CYS A CB  1 
ATOM   1548  S  SG  . CYS A  1 218 ? 35.434  59.577  117.377 1.00 36.55  ? 218  CYS A SG  1 
ATOM   1549  N  N   . ALA A  1 219 ? 34.444  63.773  115.051 1.00 23.45  ? 219  ALA A N   1 
ATOM   1550  C  CA  . ALA A  1 219 ? 34.586  65.211  114.849 1.00 22.66  ? 219  ALA A CA  1 
ATOM   1551  C  C   . ALA A  1 219 ? 33.260  65.920  115.133 1.00 23.75  ? 219  ALA A C   1 
ATOM   1552  O  O   . ALA A  1 219 ? 33.228  66.984  115.769 1.00 23.23  ? 219  ALA A O   1 
ATOM   1553  C  CB  . ALA A  1 219 ? 35.046  65.512  113.438 1.00 17.72  ? 219  ALA A CB  1 
ATOM   1554  N  N   . LYS A  1 220 ? 32.160  65.336  114.685 1.00 20.46  ? 220  LYS A N   1 
ATOM   1555  C  CA  . LYS A  1 220 ? 30.900  65.986  114.937 1.00 27.50  ? 220  LYS A CA  1 
ATOM   1556  C  C   . LYS A  1 220 ? 30.604  66.048  116.428 1.00 29.25  ? 220  LYS A C   1 
ATOM   1557  O  O   . LYS A  1 220 ? 30.107  67.061  116.946 1.00 31.10  ? 220  LYS A O   1 
ATOM   1558  C  CB  . LYS A  1 220 ? 29.756  65.285  114.210 1.00 31.81  ? 220  LYS A CB  1 
ATOM   1559  C  CG  . LYS A  1 220 ? 28.432  65.950  114.505 1.00 32.04  ? 220  LYS A CG  1 
ATOM   1560  C  CD  . LYS A  1 220 ? 27.427  65.745  113.419 1.00 35.45  ? 220  LYS A CD  1 
ATOM   1561  C  CE  . LYS A  1 220 ? 26.678  67.052  113.202 1.00 38.65  ? 220  LYS A CE  1 
ATOM   1562  N  NZ  . LYS A  1 220 ? 25.647  66.943  112.141 1.00 40.04  ? 220  LYS A NZ  1 
ATOM   1563  N  N   . ALA A  1 221 ? 30.927  64.981  117.138 1.00 27.43  ? 221  ALA A N   1 
ATOM   1564  C  CA  . ALA A  1 221 ? 30.653  64.976  118.563 1.00 26.36  ? 221  ALA A CA  1 
ATOM   1565  C  C   . ALA A  1 221 ? 31.326  66.148  119.300 1.00 27.32  ? 221  ALA A C   1 
ATOM   1566  O  O   . ALA A  1 221 ? 30.793  66.658  120.284 1.00 28.40  ? 221  ALA A O   1 
ATOM   1567  C  CB  . ALA A  1 221 ? 31.080  63.643  119.160 1.00 25.15  ? 221  ALA A CB  1 
ATOM   1568  N  N   . GLN A  1 222 ? 32.492  66.578  118.831 1.00 27.71  ? 222  GLN A N   1 
ATOM   1569  C  CA  . GLN A  1 222 ? 33.195  67.674  119.483 1.00 27.32  ? 222  GLN A CA  1 
ATOM   1570  C  C   . GLN A  1 222 ? 33.073  68.955  118.687 1.00 29.13  ? 222  GLN A C   1 
ATOM   1571  O  O   . GLN A  1 222 ? 33.769  69.928  118.955 1.00 28.82  ? 222  GLN A O   1 
ATOM   1572  C  CB  . GLN A  1 222 ? 34.672  67.341  119.669 1.00 26.32  ? 222  GLN A CB  1 
ATOM   1573  C  CG  . GLN A  1 222 ? 34.946  66.044  120.385 1.00 27.03  ? 222  GLN A CG  1 
ATOM   1574  C  CD  . GLN A  1 222 ? 36.373  65.958  120.914 1.00 34.58  ? 222  GLN A CD  1 
ATOM   1575  O  OE1 . GLN A  1 222 ? 36.826  64.893  121.312 1.00 37.19  ? 222  GLN A OE1 1 
ATOM   1576  N  NE2 . GLN A  1 222 ? 37.083  67.089  120.933 1.00 39.57  ? 222  GLN A NE2 1 
ATOM   1577  N  N   . ASN A  1 223 ? 32.208  68.937  117.682 1.00 32.04  ? 223  ASN A N   1 
ATOM   1578  C  CA  . ASN A  1 223 ? 31.962  70.119  116.863 1.00 35.49  ? 223  ASN A CA  1 
ATOM   1579  C  C   . ASN A  1 223 ? 33.153  70.697  116.099 1.00 35.08  ? 223  ASN A C   1 
ATOM   1580  O  O   . ASN A  1 223 ? 33.372  71.908  116.098 1.00 33.29  ? 223  ASN A O   1 
ATOM   1581  C  CB  . ASN A  1 223 ? 31.354  71.209  117.732 1.00 37.79  ? 223  ASN A CB  1 
ATOM   1582  C  CG  . ASN A  1 223 ? 30.088  71.752  117.145 1.00 45.36  ? 223  ASN A CG  1 
ATOM   1583  O  OD1 . ASN A  1 223 ? 29.166  70.992  116.818 1.00 47.64  ? 223  ASN A OD1 1 
ATOM   1584  N  ND2 . ASN A  1 223 ? 30.024  73.073  116.999 1.00 47.19  ? 223  ASN A ND2 1 
ATOM   1585  N  N   . LYS A  1 224 ? 33.910  69.824  115.447 1.00 32.25  ? 224  LYS A N   1 
ATOM   1586  C  CA  . LYS A  1 224 ? 35.057  70.238  114.660 1.00 29.71  ? 224  LYS A CA  1 
ATOM   1587  C  C   . LYS A  1 224 ? 34.618  70.140  113.203 1.00 28.89  ? 224  LYS A C   1 
ATOM   1588  O  O   . LYS A  1 224 ? 33.974  69.171  112.803 1.00 27.01  ? 224  LYS A O   1 
ATOM   1589  C  CB  . LYS A  1 224 ? 36.233  69.302  114.908 1.00 29.47  ? 224  LYS A CB  1 
ATOM   1590  C  CG  . LYS A  1 224 ? 36.616  69.140  116.366 1.00 28.94  ? 224  LYS A CG  1 
ATOM   1591  C  CD  . LYS A  1 224 ? 37.230  70.376  116.949 1.00 27.58  ? 224  LYS A CD  1 
ATOM   1592  C  CE  . LYS A  1 224 ? 37.710  70.098  118.366 1.00 33.15  ? 224  LYS A CE  1 
ATOM   1593  N  NZ  . LYS A  1 224 ? 38.430  71.277  118.954 1.00 38.14  ? 224  LYS A NZ  1 
ATOM   1594  N  N   . PRO A  1 225 ? 34.941  71.155  112.393 1.00 27.51  ? 225  PRO A N   1 
ATOM   1595  C  CA  . PRO A  1 225 ? 34.530  71.090  110.992 1.00 27.47  ? 225  PRO A CA  1 
ATOM   1596  C  C   . PRO A  1 225 ? 35.230  69.936  110.283 1.00 27.62  ? 225  PRO A C   1 
ATOM   1597  O  O   . PRO A  1 225 ? 36.420  69.702  110.493 1.00 25.87  ? 225  PRO A O   1 
ATOM   1598  C  CB  . PRO A  1 225 ? 34.914  72.471  110.448 1.00 23.23  ? 225  PRO A CB  1 
ATOM   1599  C  CG  . PRO A  1 225 ? 36.038  72.892  111.314 1.00 22.94  ? 225  PRO A CG  1 
ATOM   1600  C  CD  . PRO A  1 225 ? 35.662  72.404  112.686 1.00 25.95  ? 225  PRO A CD  1 
ATOM   1601  N  N   . PHE A  1 226 ? 34.470  69.221  109.454 1.00 25.74  ? 226  PHE A N   1 
ATOM   1602  C  CA  . PHE A  1 226 ? 34.965  68.062  108.713 1.00 25.35  ? 226  PHE A CA  1 
ATOM   1603  C  C   . PHE A  1 226 ? 34.960  68.380  107.229 1.00 24.96  ? 226  PHE A C   1 
ATOM   1604  O  O   . PHE A  1 226 ? 33.884  68.470  106.620 1.00 28.43  ? 226  PHE A O   1 
ATOM   1605  C  CB  . PHE A  1 226 ? 34.044  66.872  108.970 1.00 23.49  ? 226  PHE A CB  1 
ATOM   1606  C  CG  . PHE A  1 226 ? 34.611  65.556  108.548 1.00 17.92  ? 226  PHE A CG  1 
ATOM   1607  C  CD1 . PHE A  1 226 ? 35.406  64.814  109.427 1.00 16.58  ? 226  PHE A CD1 1 
ATOM   1608  C  CD2 . PHE A  1 226 ? 34.334  65.039  107.287 1.00 14.24  ? 226  PHE A CD2 1 
ATOM   1609  C  CE1 . PHE A  1 226 ? 35.918  63.563  109.054 1.00 12.29  ? 226  PHE A CE1 1 
ATOM   1610  C  CE2 . PHE A  1 226 ? 34.838  63.792  106.904 1.00 13.69  ? 226  PHE A CE2 1 
ATOM   1611  C  CZ  . PHE A  1 226 ? 35.630  63.056  107.791 1.00 14.91  ? 226  PHE A CZ  1 
ATOM   1612  N  N   . TYR A  1 227 ? 36.146  68.543  106.650 1.00 21.07  ? 227  TYR A N   1 
ATOM   1613  C  CA  . TYR A  1 227 ? 36.255  68.874  105.228 1.00 20.40  ? 227  TYR A CA  1 
ATOM   1614  C  C   . TYR A  1 227 ? 36.707  67.732  104.338 1.00 19.27  ? 227  TYR A C   1 
ATOM   1615  O  O   . TYR A  1 227 ? 37.606  66.972  104.684 1.00 16.79  ? 227  TYR A O   1 
ATOM   1616  C  CB  . TYR A  1 227 ? 37.219  70.041  104.992 1.00 19.46  ? 227  TYR A CB  1 
ATOM   1617  C  CG  . TYR A  1 227 ? 36.850  71.305  105.690 1.00 20.35  ? 227  TYR A CG  1 
ATOM   1618  C  CD1 . TYR A  1 227 ? 35.529  71.738  105.738 1.00 22.11  ? 227  TYR A CD1 1 
ATOM   1619  C  CD2 . TYR A  1 227 ? 37.817  72.066  106.323 1.00 22.43  ? 227  TYR A CD2 1 
ATOM   1620  C  CE1 . TYR A  1 227 ? 35.182  72.896  106.407 1.00 23.30  ? 227  TYR A CE1 1 
ATOM   1621  C  CE2 . TYR A  1 227 ? 37.481  73.228  106.993 1.00 25.15  ? 227  TYR A CE2 1 
ATOM   1622  C  CZ  . TYR A  1 227 ? 36.164  73.635  107.032 1.00 22.42  ? 227  TYR A CZ  1 
ATOM   1623  O  OH  . TYR A  1 227 ? 35.842  74.778  107.711 1.00 24.49  ? 227  TYR A OH  1 
ATOM   1624  N  N   . VAL A  1 228 ? 36.078  67.669  103.166 1.00 19.83  ? 228  VAL A N   1 
ATOM   1625  C  CA  . VAL A  1 228 ? 36.359  66.682  102.144 1.00 18.32  ? 228  VAL A CA  1 
ATOM   1626  C  C   . VAL A  1 228 ? 36.907  67.400  100.905 1.00 23.15  ? 228  VAL A C   1 
ATOM   1627  O  O   . VAL A  1 228 ? 36.346  68.406  100.456 1.00 19.39  ? 228  VAL A O   1 
ATOM   1628  C  CB  . VAL A  1 228 ? 35.081  65.912  101.719 1.00 16.85  ? 228  VAL A CB  1 
ATOM   1629  C  CG1 . VAL A  1 228 ? 35.370  65.048  100.483 1.00 11.10  ? 228  VAL A CG1 1 
ATOM   1630  C  CG2 . VAL A  1 228 ? 34.586  65.032  102.863 1.00 16.07  ? 228  VAL A CG2 1 
ATOM   1631  N  N   . VAL A  1 229 ? 38.025  66.891  100.381 1.00 22.13  ? 229  VAL A N   1 
ATOM   1632  C  CA  . VAL A  1 229 ? 38.620  67.437  99.173  1.00 21.95  ? 229  VAL A CA  1 
ATOM   1633  C  C   . VAL A  1 229 ? 38.660  66.289  98.130  1.00 22.87  ? 229  VAL A C   1 
ATOM   1634  O  O   . VAL A  1 229 ? 39.230  65.217  98.371  1.00 20.93  ? 229  VAL A O   1 
ATOM   1635  C  CB  . VAL A  1 229 ? 40.052  68.052  99.459  1.00 22.58  ? 229  VAL A CB  1 
ATOM   1636  C  CG1 . VAL A  1 229 ? 39.933  69.164  100.492 1.00 15.66  ? 229  VAL A CG1 1 
ATOM   1637  C  CG2 . VAL A  1 229 ? 41.041  66.978  99.937  1.00 20.53  ? 229  VAL A CG2 1 
ATOM   1638  N  N   . ALA A  1 230 ? 38.044  66.504  96.972  1.00 20.90  ? 230  ALA A N   1 
ATOM   1639  C  CA  . ALA A  1 230 ? 38.012  65.452  95.968  1.00 23.56  ? 230  ALA A CA  1 
ATOM   1640  C  C   . ALA A  1 230 ? 37.632  65.985  94.599  1.00 26.04  ? 230  ALA A C   1 
ATOM   1641  O  O   . ALA A  1 230 ? 36.878  66.950  94.491  1.00 28.48  ? 230  ALA A O   1 
ATOM   1642  C  CB  . ALA A  1 230 ? 37.025  64.368  96.399  1.00 20.89  ? 230  ALA A CB  1 
ATOM   1643  N  N   . GLU A  1 231 ? 38.149  65.348  93.552  1.00 27.54  ? 231  GLU A N   1 
ATOM   1644  C  CA  . GLU A  1 231 ? 37.864  65.777  92.189  1.00 31.13  ? 231  GLU A CA  1 
ATOM   1645  C  C   . GLU A  1 231 ? 36.454  65.389  91.749  1.00 31.99  ? 231  GLU A C   1 
ATOM   1646  O  O   . GLU A  1 231 ? 35.875  64.414  92.241  1.00 33.48  ? 231  GLU A O   1 
ATOM   1647  C  CB  . GLU A  1 231 ? 38.905  65.197  91.233  1.00 33.57  ? 231  GLU A CB  1 
ATOM   1648  C  CG  . GLU A  1 231 ? 40.333  65.534  91.651  1.00 37.87  ? 231  GLU A CG  1 
ATOM   1649  C  CD  . GLU A  1 231 ? 41.004  64.411  92.427  1.00 38.89  ? 231  GLU A CD  1 
ATOM   1650  O  OE1 . GLU A  1 231 ? 40.362  63.841  93.340  1.00 37.67  ? 231  GLU A OE1 1 
ATOM   1651  O  OE2 . GLU A  1 231 ? 42.180  64.107  92.118  1.00 39.17  ? 231  GLU A OE2 1 
ATOM   1652  N  N   . SER A  1 232 ? 35.899  66.158  90.824  1.00 30.06  ? 232  SER A N   1 
ATOM   1653  C  CA  . SER A  1 232 ? 34.547  65.905  90.357  1.00 30.28  ? 232  SER A CA  1 
ATOM   1654  C  C   . SER A  1 232 ? 34.372  64.540  89.707  1.00 30.45  ? 232  SER A C   1 
ATOM   1655  O  O   . SER A  1 232 ? 33.273  63.976  89.738  1.00 29.87  ? 232  SER A O   1 
ATOM   1656  C  CB  . SER A  1 232 ? 34.111  66.997  89.380  1.00 28.93  ? 232  SER A CB  1 
ATOM   1657  O  OG  . SER A  1 232 ? 34.883  66.933  88.199  1.00 32.31  ? 232  SER A OG  1 
ATOM   1658  N  N   . PHE A  1 233 ? 35.437  63.988  89.132  1.00 27.58  ? 233  PHE A N   1 
ATOM   1659  C  CA  . PHE A  1 233 ? 35.280  62.695  88.486  1.00 27.65  ? 233  PHE A CA  1 
ATOM   1660  C  C   . PHE A  1 233 ? 35.011  61.524  89.441  1.00 29.26  ? 233  PHE A C   1 
ATOM   1661  O  O   . PHE A  1 233 ? 34.768  60.387  88.994  1.00 31.57  ? 233  PHE A O   1 
ATOM   1662  C  CB  . PHE A  1 233 ? 36.462  62.395  87.540  1.00 29.88  ? 233  PHE A CB  1 
ATOM   1663  C  CG  . PHE A  1 233 ? 37.801  62.299  88.214  1.00 30.65  ? 233  PHE A CG  1 
ATOM   1664  C  CD1 . PHE A  1 233 ? 38.073  61.280  89.122  1.00 26.51  ? 233  PHE A CD1 1 
ATOM   1665  C  CD2 . PHE A  1 233 ? 38.798  63.241  87.935  1.00 30.47  ? 233  PHE A CD2 1 
ATOM   1666  C  CE1 . PHE A  1 233 ? 39.311  61.205  89.745  1.00 28.47  ? 233  PHE A CE1 1 
ATOM   1667  C  CE2 . PHE A  1 233 ? 40.031  63.169  88.552  1.00 25.79  ? 233  PHE A CE2 1 
ATOM   1668  C  CZ  . PHE A  1 233 ? 40.289  62.150  89.462  1.00 24.11  ? 233  PHE A CZ  1 
ATOM   1669  N  N   . LYS A  1 234 ? 35.036  61.799  90.745  1.00 25.81  ? 234  LYS A N   1 
ATOM   1670  C  CA  . LYS A  1 234 ? 34.743  60.783  91.752  1.00 24.91  ? 234  LYS A CA  1 
ATOM   1671  C  C   . LYS A  1 234 ? 33.248  60.815  92.107  1.00 25.31  ? 234  LYS A C   1 
ATOM   1672  O  O   . LYS A  1 234 ? 32.785  60.051  92.964  1.00 24.11  ? 234  LYS A O   1 
ATOM   1673  C  CB  . LYS A  1 234 ? 35.567  61.015  93.019  1.00 25.48  ? 234  LYS A CB  1 
ATOM   1674  C  CG  . LYS A  1 234 ? 37.024  60.615  92.902  1.00 29.26  ? 234  LYS A CG  1 
ATOM   1675  C  CD  . LYS A  1 234 ? 37.822  61.184  94.057  1.00 26.04  ? 234  LYS A CD  1 
ATOM   1676  C  CE  . LYS A  1 234 ? 39.267  60.761  93.983  1.00 26.31  ? 234  LYS A CE  1 
ATOM   1677  N  NZ  . LYS A  1 234 ? 40.042  61.524  95.004  1.00 26.98  ? 234  LYS A NZ  1 
ATOM   1678  N  N   . PHE A  1 235 ? 32.496  61.712  91.468  1.00 25.44  ? 235  PHE A N   1 
ATOM   1679  C  CA  . PHE A  1 235 ? 31.060  61.799  91.729  1.00 26.19  ? 235  PHE A CA  1 
ATOM   1680  C  C   . PHE A  1 235 ? 30.481  60.525  91.157  1.00 26.01  ? 235  PHE A C   1 
ATOM   1681  O  O   . PHE A  1 235 ? 30.567  60.275  89.955  1.00 29.06  ? 235  PHE A O   1 
ATOM   1682  C  CB  . PHE A  1 235 ? 30.451  63.040  91.056  1.00 26.31  ? 235  PHE A CB  1 
ATOM   1683  C  CG  . PHE A  1 235 ? 30.642  64.323  91.846  1.00 23.77  ? 235  PHE A CG  1 
ATOM   1684  C  CD1 . PHE A  1 235 ? 31.770  64.507  92.659  1.00 25.60  ? 235  PHE A CD1 1 
ATOM   1685  C  CD2 . PHE A  1 235 ? 29.705  65.347  91.770  1.00 21.37  ? 235  PHE A CD2 1 
ATOM   1686  C  CE1 . PHE A  1 235 ? 31.956  65.704  93.393  1.00 26.14  ? 235  PHE A CE1 1 
ATOM   1687  C  CE2 . PHE A  1 235 ? 29.876  66.545  92.494  1.00 26.45  ? 235  PHE A CE2 1 
ATOM   1688  C  CZ  . PHE A  1 235 ? 31.009  66.724  93.311  1.00 25.75  ? 235  PHE A CZ  1 
ATOM   1689  N  N   . VAL A  1 236 ? 29.917  59.703  92.029  1.00 25.32  ? 236  VAL A N   1 
ATOM   1690  C  CA  . VAL A  1 236 ? 29.370  58.430  91.607  1.00 26.07  ? 236  VAL A CA  1 
ATOM   1691  C  C   . VAL A  1 236 ? 27.852  58.350  91.819  1.00 26.63  ? 236  VAL A C   1 
ATOM   1692  O  O   . VAL A  1 236 ? 27.320  58.941  92.745  1.00 29.15  ? 236  VAL A O   1 
ATOM   1693  C  CB  . VAL A  1 236 ? 30.094  57.294  92.346  1.00 26.72  ? 236  VAL A CB  1 
ATOM   1694  C  CG1 . VAL A  1 236 ? 29.839  57.391  93.853  1.00 24.03  ? 236  VAL A CG1 1 
ATOM   1695  C  CG2 . VAL A  1 236 ? 29.640  55.960  91.797  1.00 33.20  ? 236  VAL A CG2 1 
ATOM   1696  N  N   . ARG A  1 237 ? 27.161  57.629  90.943  1.00 28.88  ? 237  ARG A N   1 
ATOM   1697  C  CA  . ARG A  1 237 ? 25.702  57.508  91.024  1.00 29.16  ? 237  ARG A CA  1 
ATOM   1698  C  C   . ARG A  1 237 ? 25.215  56.415  91.990  1.00 29.04  ? 237  ARG A C   1 
ATOM   1699  O  O   . ARG A  1 237 ? 24.840  55.304  91.581  1.00 23.81  ? 237  ARG A O   1 
ATOM   1700  C  CB  . ARG A  1 237 ? 25.128  57.282  89.617  1.00 29.04  ? 237  ARG A CB  1 
ATOM   1701  C  CG  . ARG A  1 237 ? 25.398  58.449  88.664  1.00 37.34  ? 237  ARG A CG  1 
ATOM   1702  C  CD  . ARG A  1 237 ? 24.961  58.158  87.239  1.00 40.80  ? 237  ARG A CD  1 
ATOM   1703  N  NE  . ARG A  1 237 ? 23.532  57.883  87.139  1.00 49.24  ? 237  ARG A NE  1 
ATOM   1704  C  CZ  . ARG A  1 237 ? 22.922  57.551  86.006  1.00 52.00  ? 237  ARG A CZ  1 
ATOM   1705  N  NH1 . ARG A  1 237 ? 21.612  57.315  85.992  1.00 49.36  ? 237  ARG A NH1 1 
ATOM   1706  N  NH2 . ARG A  1 237 ? 23.630  57.457  84.886  1.00 54.26  ? 237  ARG A NH2 1 
ATOM   1707  N  N   . LEU A  1 238 ? 25.238  56.761  93.275  1.00 28.31  ? 238  LEU A N   1 
ATOM   1708  C  CA  . LEU A  1 238 ? 24.810  55.888  94.354  1.00 29.36  ? 238  LEU A CA  1 
ATOM   1709  C  C   . LEU A  1 238 ? 24.240  56.750  95.468  1.00 31.44  ? 238  LEU A C   1 
ATOM   1710  O  O   . LEU A  1 238 ? 24.711  57.866  95.712  1.00 31.66  ? 238  LEU A O   1 
ATOM   1711  C  CB  . LEU A  1 238 ? 25.991  55.096  94.913  1.00 28.23  ? 238  LEU A CB  1 
ATOM   1712  C  CG  . LEU A  1 238 ? 26.660  54.067  94.001  1.00 32.33  ? 238  LEU A CG  1 
ATOM   1713  C  CD1 . LEU A  1 238 ? 28.031  53.651  94.577  1.00 29.85  ? 238  LEU A CD1 1 
ATOM   1714  C  CD2 . LEU A  1 238 ? 25.728  52.867  93.844  1.00 26.64  ? 238  LEU A CD2 1 
ATOM   1715  N  N   . PHE A  1 239 ? 23.216  56.230  96.133  1.00 30.49  ? 239  PHE A N   1 
ATOM   1716  C  CA  . PHE A  1 239 ? 22.607  56.924  97.245  1.00 30.19  ? 239  PHE A CA  1 
ATOM   1717  C  C   . PHE A  1 239 ? 22.570  55.909  98.400  1.00 30.26  ? 239  PHE A C   1 
ATOM   1718  O  O   . PHE A  1 239 ? 21.599  55.200  98.586  1.00 31.55  ? 239  PHE A O   1 
ATOM   1719  C  CB  . PHE A  1 239 ? 21.197  57.401  96.864  1.00 24.72  ? 239  PHE A CB  1 
ATOM   1720  C  CG  . PHE A  1 239 ? 20.688  58.533  97.720  1.00 20.12  ? 239  PHE A CG  1 
ATOM   1721  C  CD1 . PHE A  1 239 ? 20.524  59.806  97.192  1.00 26.77  ? 239  PHE A CD1 1 
ATOM   1722  C  CD2 . PHE A  1 239 ? 20.415  58.337  99.061  1.00 19.28  ? 239  PHE A CD2 1 
ATOM   1723  C  CE1 . PHE A  1 239 ? 20.097  60.879  97.999  1.00 24.83  ? 239  PHE A CE1 1 
ATOM   1724  C  CE2 . PHE A  1 239 ? 19.991  59.389  99.871  1.00 20.95  ? 239  PHE A CE2 1 
ATOM   1725  C  CZ  . PHE A  1 239 ? 19.833  60.667  99.335  1.00 22.60  ? 239  PHE A CZ  1 
ATOM   1726  N  N   . PRO A  1 240 ? 23.661  55.809  99.170  1.00 32.62  ? 240  PRO A N   1 
ATOM   1727  C  CA  . PRO A  1 240 ? 23.703  54.855  100.294 1.00 31.88  ? 240  PRO A CA  1 
ATOM   1728  C  C   . PRO A  1 240 ? 22.925  55.328  101.525 1.00 32.06  ? 240  PRO A C   1 
ATOM   1729  O  O   . PRO A  1 240 ? 22.934  56.514  101.851 1.00 31.49  ? 240  PRO A O   1 
ATOM   1730  C  CB  . PRO A  1 240 ? 25.204  54.732  100.604 1.00 30.50  ? 240  PRO A CB  1 
ATOM   1731  C  CG  . PRO A  1 240 ? 25.892  55.243  99.346  1.00 32.10  ? 240  PRO A CG  1 
ATOM   1732  C  CD  . PRO A  1 240 ? 24.997  56.367  98.897  1.00 30.70  ? 240  PRO A CD  1 
ATOM   1733  N  N   . LEU A  1 241 ? 22.244  54.406  102.201 1.00 31.77  ? 241  LEU A N   1 
ATOM   1734  C  CA  . LEU A  1 241 ? 21.529  54.763  103.415 1.00 30.24  ? 241  LEU A CA  1 
ATOM   1735  C  C   . LEU A  1 241 ? 22.346  54.271  104.601 1.00 30.35  ? 241  LEU A C   1 
ATOM   1736  O  O   . LEU A  1 241 ? 22.177  54.725  105.730 1.00 33.44  ? 241  LEU A O   1 
ATOM   1737  C  CB  . LEU A  1 241 ? 20.123  54.171  103.433 1.00 31.01  ? 241  LEU A CB  1 
ATOM   1738  C  CG  . LEU A  1 241 ? 19.120  54.911  102.541 1.00 31.03  ? 241  LEU A CG  1 
ATOM   1739  C  CD1 . LEU A  1 241 ? 17.711  54.409  102.831 1.00 28.11  ? 241  LEU A CD1 1 
ATOM   1740  C  CD2 . LEU A  1 241 ? 19.200  56.410  102.800 1.00 29.93  ? 241  LEU A CD2 1 
ATOM   1741  N  N   . ASN A  1 242 ? 23.258  53.352  104.326 1.00 28.83  ? 242  ASN A N   1 
ATOM   1742  C  CA  . ASN A  1 242 ? 24.142  52.829  105.351 1.00 30.17  ? 242  ASN A CA  1 
ATOM   1743  C  C   . ASN A  1 242 ? 25.248  51.979  104.729 1.00 28.26  ? 242  ASN A C   1 
ATOM   1744  O  O   . ASN A  1 242 ? 25.255  51.727  103.526 1.00 24.76  ? 242  ASN A O   1 
ATOM   1745  C  CB  . ASN A  1 242 ? 23.355  52.011  106.378 1.00 34.00  ? 242  ASN A CB  1 
ATOM   1746  C  CG  . ASN A  1 242 ? 22.698  50.794  105.769 1.00 39.93  ? 242  ASN A CG  1 
ATOM   1747  O  OD1 . ASN A  1 242 ? 23.338  50.002  105.063 1.00 39.67  ? 242  ASN A OD1 1 
ATOM   1748  N  ND2 . ASN A  1 242 ? 21.414  50.629  106.044 1.00 45.80  ? 242  ASN A ND2 1 
ATOM   1749  N  N   . GLN A  1 243 ? 26.166  51.521  105.568 1.00 27.08  ? 243  GLN A N   1 
ATOM   1750  C  CA  . GLN A  1 243 ? 27.297  50.719  105.127 1.00 28.48  ? 243  GLN A CA  1 
ATOM   1751  C  C   . GLN A  1 243 ? 27.000  49.551  104.172 1.00 31.70  ? 243  GLN A C   1 
ATOM   1752  O  O   . GLN A  1 243 ? 27.873  49.129  103.415 1.00 32.66  ? 243  GLN A O   1 
ATOM   1753  C  CB  . GLN A  1 243 ? 28.031  50.197  106.357 1.00 26.19  ? 243  GLN A CB  1 
ATOM   1754  C  CG  . GLN A  1 243 ? 28.450  51.286  107.334 1.00 22.02  ? 243  GLN A CG  1 
ATOM   1755  C  CD  . GLN A  1 243 ? 29.345  52.321  106.681 1.00 25.36  ? 243  GLN A CD  1 
ATOM   1756  O  OE1 . GLN A  1 243 ? 30.137  52.002  105.794 1.00 27.56  ? 243  GLN A OE1 1 
ATOM   1757  N  NE2 . GLN A  1 243 ? 29.234  53.562  107.122 1.00 20.62  ? 243  GLN A NE2 1 
ATOM   1758  N  N   . GLN A  1 244 ? 25.780  49.028  104.173 1.00 35.65  ? 244  GLN A N   1 
ATOM   1759  C  CA  . GLN A  1 244 ? 25.495  47.895  103.296 1.00 36.23  ? 244  GLN A CA  1 
ATOM   1760  C  C   . GLN A  1 244 ? 25.127  48.248  101.869 1.00 33.99  ? 244  GLN A C   1 
ATOM   1761  O  O   . GLN A  1 244 ? 25.283  47.435  100.955 1.00 31.44  ? 244  GLN A O   1 
ATOM   1762  C  CB  . GLN A  1 244 ? 24.430  47.017  103.934 1.00 40.93  ? 244  GLN A CB  1 
ATOM   1763  C  CG  . GLN A  1 244 ? 24.832  46.619  105.335 1.00 56.16  ? 244  GLN A CG  1 
ATOM   1764  C  CD  . GLN A  1 244 ? 24.147  45.357  105.800 1.00 67.83  ? 244  GLN A CD  1 
ATOM   1765  O  OE1 . GLN A  1 244 ? 24.297  44.294  105.186 1.00 71.02  ? 244  GLN A OE1 1 
ATOM   1766  N  NE2 . GLN A  1 244 ? 23.391  45.460  106.897 1.00 72.71  ? 244  GLN A NE2 1 
ATOM   1767  N  N   . ASP A  1 245 ? 24.664  49.473  101.668 1.00 34.35  ? 245  ASP A N   1 
ATOM   1768  C  CA  . ASP A  1 245 ? 24.294  49.916  100.339 1.00 33.84  ? 245  ASP A CA  1 
ATOM   1769  C  C   . ASP A  1 245 ? 25.522  50.232  99.500  1.00 34.19  ? 245  ASP A C   1 
ATOM   1770  O  O   . ASP A  1 245 ? 25.401  50.617  98.340  1.00 36.71  ? 245  ASP A O   1 
ATOM   1771  C  CB  . ASP A  1 245 ? 23.399  51.142  100.429 1.00 37.98  ? 245  ASP A CB  1 
ATOM   1772  C  CG  . ASP A  1 245 ? 22.194  50.899  101.282 1.00 40.21  ? 245  ASP A CG  1 
ATOM   1773  O  OD1 . ASP A  1 245 ? 21.649  49.775  101.185 1.00 41.99  ? 245  ASP A OD1 1 
ATOM   1774  O  OD2 . ASP A  1 245 ? 21.803  51.821  102.037 1.00 39.10  ? 245  ASP A OD2 1 
ATOM   1775  N  N   . VAL A  1 246 ? 26.705  50.093  100.086 1.00 31.82  ? 246  VAL A N   1 
ATOM   1776  C  CA  . VAL A  1 246 ? 27.929  50.331  99.339  1.00 31.77  ? 246  VAL A CA  1 
ATOM   1777  C  C   . VAL A  1 246 ? 28.286  49.022  98.657  1.00 32.26  ? 246  VAL A C   1 
ATOM   1778  O  O   . VAL A  1 246 ? 28.562  48.033  99.319  1.00 34.50  ? 246  VAL A O   1 
ATOM   1779  C  CB  . VAL A  1 246 ? 29.062  50.747  100.258 1.00 30.91  ? 246  VAL A CB  1 
ATOM   1780  C  CG1 . VAL A  1 246 ? 30.372  50.794  99.488  1.00 29.49  ? 246  VAL A CG1 1 
ATOM   1781  C  CG2 . VAL A  1 246 ? 28.742  52.093  100.858 1.00 30.18  ? 246  VAL A CG2 1 
ATOM   1782  N  N   . PRO A  1 247 ? 28.289  49.003  97.320  1.00 33.59  ? 247  PRO A N   1 
ATOM   1783  C  CA  . PRO A  1 247 ? 28.609  47.799  96.536  1.00 33.94  ? 247  PRO A CA  1 
ATOM   1784  C  C   . PRO A  1 247 ? 29.871  47.079  97.003  1.00 33.66  ? 247  PRO A C   1 
ATOM   1785  O  O   . PRO A  1 247 ? 30.885  47.708  97.301  1.00 34.24  ? 247  PRO A O   1 
ATOM   1786  C  CB  . PRO A  1 247 ? 28.748  48.338  95.111  1.00 34.32  ? 247  PRO A CB  1 
ATOM   1787  C  CG  . PRO A  1 247 ? 27.838  49.557  95.118  1.00 35.00  ? 247  PRO A CG  1 
ATOM   1788  C  CD  . PRO A  1 247 ? 28.171  50.185  96.448  1.00 33.63  ? 247  PRO A CD  1 
ATOM   1789  N  N   . ASP A  1 248 ? 29.807  45.756  97.049  1.00 34.77  ? 248  ASP A N   1 
ATOM   1790  C  CA  . ASP A  1 248 ? 30.947  44.955  97.482  1.00 37.07  ? 248  ASP A CA  1 
ATOM   1791  C  C   . ASP A  1 248 ? 32.174  45.171  96.615  1.00 35.75  ? 248  ASP A C   1 
ATOM   1792  O  O   . ASP A  1 248 ? 33.293  45.282  97.125  1.00 29.40  ? 248  ASP A O   1 
ATOM   1793  C  CB  . ASP A  1 248 ? 30.589  43.466  97.494  1.00 39.85  ? 248  ASP A CB  1 
ATOM   1794  C  CG  . ASP A  1 248 ? 29.984  43.028  98.808  1.00 46.91  ? 248  ASP A CG  1 
ATOM   1795  O  OD1 . ASP A  1 248 ? 29.686  43.911  99.648  1.00 49.38  ? 248  ASP A OD1 1 
ATOM   1796  O  OD2 . ASP A  1 248 ? 29.799  41.806  99.002  1.00 51.72  ? 248  ASP A OD2 1 
ATOM   1797  N  N   . LYS A  1 249 ? 31.960  45.226  95.306  1.00 35.83  ? 249  LYS A N   1 
ATOM   1798  C  CA  . LYS A  1 249 ? 33.063  45.420  94.380  1.00 38.26  ? 249  LYS A CA  1 
ATOM   1799  C  C   . LYS A  1 249 ? 33.958  46.598  94.781  1.00 39.53  ? 249  LYS A C   1 
ATOM   1800  O  O   . LYS A  1 249 ? 35.155  46.609  94.483  1.00 36.35  ? 249  LYS A O   1 
ATOM   1801  C  CB  . LYS A  1 249 ? 32.528  45.615  92.962  1.00 35.61  ? 249  LYS A CB  1 
ATOM   1802  C  CG  . LYS A  1 249 ? 31.538  46.741  92.818  1.00 36.25  ? 249  LYS A CG  1 
ATOM   1803  C  CD  . LYS A  1 249 ? 31.204  46.982  91.362  1.00 34.41  ? 249  LYS A CD  1 
ATOM   1804  C  CE  . LYS A  1 249 ? 30.235  48.141  91.242  1.00 44.17  ? 249  LYS A CE  1 
ATOM   1805  N  NZ  . LYS A  1 249 ? 29.999  48.562  89.823  1.00 49.60  ? 249  LYS A NZ  1 
ATOM   1806  N  N   . PHE A  1 250 ? 33.381  47.577  95.472  1.00 41.93  ? 250  PHE A N   1 
ATOM   1807  C  CA  . PHE A  1 250 ? 34.152  48.735  95.897  1.00 45.44  ? 250  PHE A CA  1 
ATOM   1808  C  C   . PHE A  1 250 ? 34.898  48.578  97.211  1.00 46.84  ? 250  PHE A C   1 
ATOM   1809  O  O   . PHE A  1 250 ? 35.772  49.388  97.498  1.00 50.64  ? 250  PHE A O   1 
ATOM   1810  C  CB  . PHE A  1 250 ? 33.268  49.979  95.994  1.00 45.95  ? 250  PHE A CB  1 
ATOM   1811  C  CG  . PHE A  1 250 ? 32.749  50.456  94.671  1.00 48.29  ? 250  PHE A CG  1 
ATOM   1812  C  CD1 . PHE A  1 250 ? 33.598  50.549  93.573  1.00 44.81  ? 250  PHE A CD1 1 
ATOM   1813  C  CD2 . PHE A  1 250 ? 31.405  50.802  94.520  1.00 49.88  ? 250  PHE A CD2 1 
ATOM   1814  C  CE1 . PHE A  1 250 ? 33.127  50.972  92.341  1.00 48.71  ? 250  PHE A CE1 1 
ATOM   1815  C  CE2 . PHE A  1 250 ? 30.918  51.228  93.290  1.00 52.86  ? 250  PHE A CE2 1 
ATOM   1816  C  CZ  . PHE A  1 250 ? 31.785  51.313  92.191  1.00 52.38  ? 250  PHE A CZ  1 
ATOM   1817  N  N   . LYS A  1 251 ? 34.590  47.551  98.002  1.00 47.07  ? 251  LYS A N   1 
ATOM   1818  C  CA  . LYS A  1 251 ? 35.267  47.399  99.283  1.00 45.43  ? 251  LYS A CA  1 
ATOM   1819  C  C   . LYS A  1 251 ? 36.131  46.170  99.548  1.00 47.28  ? 251  LYS A C   1 
ATOM   1820  O  O   . LYS A  1 251 ? 36.815  46.105  100.577 1.00 45.75  ? 251  LYS A O   1 
ATOM   1821  C  CB  . LYS A  1 251 ? 34.258  47.583  100.426 1.00 48.21  ? 251  LYS A CB  1 
ATOM   1822  C  CG  . LYS A  1 251 ? 33.031  46.673  100.444 1.00 43.85  ? 251  LYS A CG  1 
ATOM   1823  C  CD  . LYS A  1 251 ? 31.892  47.379  101.198 1.00 42.89  ? 251  LYS A CD  1 
ATOM   1824  C  CE  . LYS A  1 251 ? 30.937  46.402  101.893 1.00 47.16  ? 251  LYS A CE  1 
ATOM   1825  N  NZ  . LYS A  1 251 ? 29.789  47.078  102.610 1.00 39.03  ? 251  LYS A NZ  1 
ATOM   1826  N  N   . TYR A  1 252 ? 36.139  45.211  98.630  1.00 48.95  ? 252  TYR A N   1 
ATOM   1827  C  CA  . TYR A  1 252 ? 36.953  44.016  98.827  1.00 49.77  ? 252  TYR A CA  1 
ATOM   1828  C  C   . TYR A  1 252 ? 37.975  43.820  97.715  1.00 52.97  ? 252  TYR A C   1 
ATOM   1829  O  O   . TYR A  1 252 ? 39.153  43.560  97.979  1.00 57.62  ? 252  TYR A O   1 
ATOM   1830  C  CB  . TYR A  1 252 ? 36.056  42.785  98.935  1.00 47.19  ? 252  TYR A CB  1 
ATOM   1831  C  CG  . TYR A  1 252 ? 35.034  42.879  100.048 1.00 45.88  ? 252  TYR A CG  1 
ATOM   1832  C  CD1 . TYR A  1 252 ? 33.674  42.921  99.762  1.00 47.29  ? 252  TYR A CD1 1 
ATOM   1833  C  CD2 . TYR A  1 252 ? 35.430  42.950  101.389 1.00 42.94  ? 252  TYR A CD2 1 
ATOM   1834  C  CE1 . TYR A  1 252 ? 32.730  43.036  100.782 1.00 48.99  ? 252  TYR A CE1 1 
ATOM   1835  C  CE2 . TYR A  1 252 ? 34.497  43.067  102.412 1.00 43.49  ? 252  TYR A CE2 1 
ATOM   1836  C  CZ  . TYR A  1 252 ? 33.146  43.113  102.102 1.00 47.02  ? 252  TYR A CZ  1 
ATOM   1837  O  OH  . TYR A  1 252 ? 32.203  43.268  103.095 1.00 48.89  ? 252  TYR A OH  1 
ATOM   1838  N  N   . LEU A  1 266 ? 32.483  33.883  109.620 1.00 68.03  ? 266  LEU A N   1 
ATOM   1839  C  CA  . LEU A  1 266 ? 32.214  34.733  110.774 1.00 69.58  ? 266  LEU A CA  1 
ATOM   1840  C  C   . LEU A  1 266 ? 33.473  34.804  111.655 1.00 69.58  ? 266  LEU A C   1 
ATOM   1841  O  O   . LEU A  1 266 ? 33.408  34.529  112.862 1.00 72.57  ? 266  LEU A O   1 
ATOM   1842  C  CB  . LEU A  1 266 ? 31.013  34.175  111.586 1.00 66.97  ? 266  LEU A CB  1 
ATOM   1843  C  CG  . LEU A  1 266 ? 29.869  35.085  112.094 1.00 65.63  ? 266  LEU A CG  1 
ATOM   1844  C  CD1 . LEU A  1 266 ? 28.726  34.204  112.588 1.00 62.36  ? 266  LEU A CD1 1 
ATOM   1845  C  CD2 . LEU A  1 266 ? 30.340  36.031  113.209 1.00 60.56  ? 266  LEU A CD2 1 
ATOM   1846  N  N   . LYS A  1 267 ? 34.615  35.161  111.056 1.00 66.21  ? 267  LYS A N   1 
ATOM   1847  C  CA  . LYS A  1 267 ? 35.866  35.267  111.815 1.00 63.25  ? 267  LYS A CA  1 
ATOM   1848  C  C   . LYS A  1 267 ? 36.719  36.507  111.549 1.00 60.79  ? 267  LYS A C   1 
ATOM   1849  O  O   . LYS A  1 267 ? 37.528  36.896  112.394 1.00 61.74  ? 267  LYS A O   1 
ATOM   1850  C  CB  . LYS A  1 267 ? 36.734  34.020  111.611 1.00 61.90  ? 267  LYS A CB  1 
ATOM   1851  C  CG  . LYS A  1 267 ? 36.251  32.792  112.371 1.00 60.33  ? 267  LYS A CG  1 
ATOM   1852  C  CD  . LYS A  1 267 ? 36.182  33.048  113.865 1.00 56.79  ? 267  LYS A CD  1 
ATOM   1853  C  CE  . LYS A  1 267 ? 35.523  31.876  114.578 1.00 57.20  ? 267  LYS A CE  1 
ATOM   1854  N  NZ  . LYS A  1 267 ? 34.129  31.617  114.115 1.00 51.45  ? 267  LYS A NZ  1 
ATOM   1855  N  N   . GLU A  1 268 ? 36.542  37.142  110.399 1.00 56.98  ? 268  GLU A N   1 
ATOM   1856  C  CA  . GLU A  1 268 ? 37.350  38.314  110.088 1.00 53.61  ? 268  GLU A CA  1 
ATOM   1857  C  C   . GLU A  1 268 ? 36.726  39.120  108.952 1.00 49.99  ? 268  GLU A C   1 
ATOM   1858  O  O   . GLU A  1 268 ? 36.279  38.556  107.964 1.00 49.39  ? 268  GLU A O   1 
ATOM   1859  C  CB  . GLU A  1 268 ? 38.745  37.831  109.713 1.00 54.55  ? 268  GLU A CB  1 
ATOM   1860  C  CG  . GLU A  1 268 ? 39.864  38.840  109.765 1.00 59.25  ? 268  GLU A CG  1 
ATOM   1861  C  CD  . GLU A  1 268 ? 41.230  38.145  109.707 1.00 64.11  ? 268  GLU A CD  1 
ATOM   1862  O  OE1 . GLU A  1 268 ? 41.621  37.513  110.714 1.00 62.64  ? 268  GLU A OE1 1 
ATOM   1863  O  OE2 . GLU A  1 268 ? 41.907  38.208  108.653 1.00 66.72  ? 268  GLU A OE2 1 
ATOM   1864  N  N   . GLU A  1 269 ? 36.660  40.435  109.112 1.00 48.58  ? 269  GLU A N   1 
ATOM   1865  C  CA  . GLU A  1 269 ? 36.099  41.299  108.076 1.00 47.48  ? 269  GLU A CA  1 
ATOM   1866  C  C   . GLU A  1 269 ? 37.155  42.289  107.624 1.00 47.74  ? 269  GLU A C   1 
ATOM   1867  O  O   . GLU A  1 269 ? 37.922  42.799  108.440 1.00 50.52  ? 269  GLU A O   1 
ATOM   1868  C  CB  . GLU A  1 269 ? 34.874  42.047  108.589 1.00 46.11  ? 269  GLU A CB  1 
ATOM   1869  C  CG  . GLU A  1 269 ? 33.661  41.170  108.709 1.00 45.34  ? 269  GLU A CG  1 
ATOM   1870  C  CD  . GLU A  1 269 ? 32.396  41.911  108.395 1.00 49.27  ? 269  GLU A CD  1 
ATOM   1871  O  OE1 . GLU A  1 269 ? 32.336  42.546  107.319 1.00 48.57  ? 269  GLU A OE1 1 
ATOM   1872  O  OE2 . GLU A  1 269 ? 31.455  41.857  109.217 1.00 54.95  ? 269  GLU A OE2 1 
ATOM   1873  N  N   . HIS A  1 270 ? 37.198  42.574  106.328 1.00 46.87  ? 270  HIS A N   1 
ATOM   1874  C  CA  . HIS A  1 270 ? 38.215  43.482  105.821 1.00 44.82  ? 270  HIS A CA  1 
ATOM   1875  C  C   . HIS A  1 270 ? 37.800  44.484  104.758 1.00 41.12  ? 270  HIS A C   1 
ATOM   1876  O  O   . HIS A  1 270 ? 38.326  44.465  103.649 1.00 42.77  ? 270  HIS A O   1 
ATOM   1877  C  CB  . HIS A  1 270 ? 39.393  42.661  105.309 1.00 47.80  ? 270  HIS A CB  1 
ATOM   1878  C  CG  . HIS A  1 270 ? 40.251  42.110  106.401 1.00 54.85  ? 270  HIS A CG  1 
ATOM   1879  N  ND1 . HIS A  1 270 ? 40.964  42.918  107.262 1.00 56.79  ? 270  HIS A ND1 1 
ATOM   1880  C  CD2 . HIS A  1 270 ? 40.486  40.836  106.798 1.00 56.72  ? 270  HIS A CD2 1 
ATOM   1881  C  CE1 . HIS A  1 270 ? 41.598  42.167  108.144 1.00 55.22  ? 270  HIS A CE1 1 
ATOM   1882  N  NE2 . HIS A  1 270 ? 41.325  40.900  107.885 1.00 57.32  ? 270  HIS A NE2 1 
ATOM   1883  N  N   . PRO A  1 271 ? 36.855  45.376  105.075 1.00 36.29  ? 271  PRO A N   1 
ATOM   1884  C  CA  . PRO A  1 271 ? 36.479  46.336  104.039 1.00 35.42  ? 271  PRO A CA  1 
ATOM   1885  C  C   . PRO A  1 271 ? 37.530  47.440  103.887 1.00 33.93  ? 271  PRO A C   1 
ATOM   1886  O  O   . PRO A  1 271 ? 38.102  47.914  104.868 1.00 31.77  ? 271  PRO A O   1 
ATOM   1887  C  CB  . PRO A  1 271 ? 35.130  46.861  104.528 1.00 33.40  ? 271  PRO A CB  1 
ATOM   1888  C  CG  . PRO A  1 271 ? 35.246  46.773  106.012 1.00 32.96  ? 271  PRO A CG  1 
ATOM   1889  C  CD  . PRO A  1 271 ? 35.921  45.433  106.211 1.00 36.70  ? 271  PRO A CD  1 
ATOM   1890  N  N   . TRP A  1 272 ? 37.800  47.837  102.652 1.00 32.90  ? 272  TRP A N   1 
ATOM   1891  C  CA  . TRP A  1 272 ? 38.777  48.885  102.429 1.00 30.68  ? 272  TRP A CA  1 
ATOM   1892  C  C   . TRP A  1 272 ? 38.215  50.283  102.535 1.00 25.75  ? 272  TRP A C   1 
ATOM   1893  O  O   . TRP A  1 272 ? 38.917  51.210  102.906 1.00 26.76  ? 272  TRP A O   1 
ATOM   1894  C  CB  . TRP A  1 272 ? 39.441  48.691  101.089 1.00 32.10  ? 272  TRP A CB  1 
ATOM   1895  C  CG  . TRP A  1 272 ? 40.452  47.631  101.189 1.00 39.87  ? 272  TRP A CG  1 
ATOM   1896  C  CD1 . TRP A  1 272 ? 40.243  46.276  101.127 1.00 42.57  ? 272  TRP A CD1 1 
ATOM   1897  C  CD2 . TRP A  1 272 ? 41.852  47.814  101.411 1.00 40.20  ? 272  TRP A CD2 1 
ATOM   1898  N  NE1 . TRP A  1 272 ? 41.433  45.606  101.293 1.00 43.27  ? 272  TRP A NE1 1 
ATOM   1899  C  CE2 . TRP A  1 272 ? 42.438  46.525  101.469 1.00 44.14  ? 272  TRP A CE2 1 
ATOM   1900  C  CE3 . TRP A  1 272 ? 42.669  48.939  101.569 1.00 37.62  ? 272  TRP A CE3 1 
ATOM   1901  C  CZ2 . TRP A  1 272 ? 43.806  46.335  101.676 1.00 40.42  ? 272  TRP A CZ2 1 
ATOM   1902  C  CZ3 . TRP A  1 272 ? 44.022  48.751  101.775 1.00 38.74  ? 272  TRP A CZ3 1 
ATOM   1903  C  CH2 . TRP A  1 272 ? 44.579  47.457  101.826 1.00 40.77  ? 272  TRP A CH2 1 
ATOM   1904  N  N   . VAL A  1 273 ? 36.937  50.417  102.229 1.00 22.41  ? 273  VAL A N   1 
ATOM   1905  C  CA  . VAL A  1 273 ? 36.258  51.694  102.296 1.00 22.23  ? 273  VAL A CA  1 
ATOM   1906  C  C   . VAL A  1 273 ? 35.066  51.587  103.233 1.00 22.03  ? 273  VAL A C   1 
ATOM   1907  O  O   . VAL A  1 273 ? 34.678  50.508  103.633 1.00 26.78  ? 273  VAL A O   1 
ATOM   1908  C  CB  . VAL A  1 273 ? 35.702  52.094  100.909 1.00 20.33  ? 273  VAL A CB  1 
ATOM   1909  C  CG1 . VAL A  1 273 ? 36.809  52.184  99.891  1.00 14.00  ? 273  VAL A CG1 1 
ATOM   1910  C  CG2 . VAL A  1 273 ? 34.674  51.065  100.466 1.00 19.71  ? 273  VAL A CG2 1 
ATOM   1911  N  N   . ASP A  1 274 ? 34.509  52.722  103.605 1.00 23.35  ? 274  ASP A N   1 
ATOM   1912  C  CA  . ASP A  1 274 ? 33.291  52.753  104.394 1.00 22.90  ? 274  ASP A CA  1 
ATOM   1913  C  C   . ASP A  1 274 ? 32.605  54.013  103.914 1.00 21.19  ? 274  ASP A C   1 
ATOM   1914  O  O   . ASP A  1 274 ? 33.180  54.777  103.144 1.00 21.17  ? 274  ASP A O   1 
ATOM   1915  C  CB  . ASP A  1 274 ? 33.518  52.751  105.927 1.00 28.12  ? 274  ASP A CB  1 
ATOM   1916  C  CG  . ASP A  1 274 ? 34.396  53.889  106.423 1.00 30.62  ? 274  ASP A CG  1 
ATOM   1917  O  OD1 . ASP A  1 274 ? 34.358  54.994  105.834 1.00 31.56  ? 274  ASP A OD1 1 
ATOM   1918  O  OD2 . ASP A  1 274 ? 35.108  53.670  107.433 1.00 28.23  ? 274  ASP A OD2 1 
ATOM   1919  N  N   . TYR A  1 275 ? 31.376  54.222  104.342 1.00 21.22  ? 275  TYR A N   1 
ATOM   1920  C  CA  . TYR A  1 275 ? 30.609  55.367  103.901 1.00 21.07  ? 275  TYR A CA  1 
ATOM   1921  C  C   . TYR A  1 275 ? 30.464  56.382  105.034 1.00 22.58  ? 275  TYR A C   1 
ATOM   1922  O  O   . TYR A  1 275 ? 30.363  56.006  106.198 1.00 25.22  ? 275  TYR A O   1 
ATOM   1923  C  CB  . TYR A  1 275 ? 29.248  54.858  103.404 1.00 18.03  ? 275  TYR A CB  1 
ATOM   1924  C  CG  . TYR A  1 275 ? 28.141  55.887  103.302 1.00 25.52  ? 275  TYR A CG  1 
ATOM   1925  C  CD1 . TYR A  1 275 ? 28.190  56.917  102.345 1.00 26.75  ? 275  TYR A CD1 1 
ATOM   1926  C  CD2 . TYR A  1 275 ? 27.034  55.828  104.154 1.00 22.24  ? 275  TYR A CD2 1 
ATOM   1927  C  CE1 . TYR A  1 275 ? 27.161  57.855  102.246 1.00 31.73  ? 275  TYR A CE1 1 
ATOM   1928  C  CE2 . TYR A  1 275 ? 26.003  56.759  104.068 1.00 27.40  ? 275  TYR A CE2 1 
ATOM   1929  C  CZ  . TYR A  1 275 ? 26.068  57.770  103.113 1.00 33.40  ? 275  TYR A CZ  1 
ATOM   1930  O  OH  . TYR A  1 275 ? 25.035  58.675  103.009 1.00 34.19  ? 275  TYR A OH  1 
ATOM   1931  N  N   . THR A  1 276 ? 30.494  57.665  104.689 1.00 20.39  ? 276  THR A N   1 
ATOM   1932  C  CA  . THR A  1 276 ? 30.328  58.738  105.663 1.00 21.80  ? 276  THR A CA  1 
ATOM   1933  C  C   . THR A  1 276 ? 29.154  59.574  105.181 1.00 24.15  ? 276  THR A C   1 
ATOM   1934  O  O   . THR A  1 276 ? 29.215  60.176  104.110 1.00 27.99  ? 276  THR A O   1 
ATOM   1935  C  CB  . THR A  1 276 ? 31.570  59.607  105.736 1.00 21.01  ? 276  THR A CB  1 
ATOM   1936  O  OG1 . THR A  1 276 ? 32.620  58.845  106.315 1.00 19.07  ? 276  THR A OG1 1 
ATOM   1937  C  CG2 . THR A  1 276 ? 31.317  60.845  106.588 1.00 25.70  ? 276  THR A CG2 1 
ATOM   1938  N  N   . ALA A  1 277 ? 28.085  59.602  105.969 1.00 25.72  ? 277  ALA A N   1 
ATOM   1939  C  CA  . ALA A  1 277 ? 26.857  60.320  105.606 1.00 21.92  ? 277  ALA A CA  1 
ATOM   1940  C  C   . ALA A  1 277 ? 27.012  61.826  105.508 1.00 20.96  ? 277  ALA A C   1 
ATOM   1941  O  O   . ALA A  1 277 ? 27.848  62.415  106.179 1.00 22.82  ? 277  ALA A O   1 
ATOM   1942  C  CB  . ALA A  1 277 ? 25.754  59.970  106.583 1.00 15.06  ? 277  ALA A CB  1 
ATOM   1943  N  N   . PRO A  1 278 ? 26.192  62.470  104.665 1.00 23.61  ? 278  PRO A N   1 
ATOM   1944  C  CA  . PRO A  1 278 ? 26.271  63.920  104.499 1.00 23.22  ? 278  PRO A CA  1 
ATOM   1945  C  C   . PRO A  1 278 ? 26.086  64.683  105.786 1.00 24.85  ? 278  PRO A C   1 
ATOM   1946  O  O   . PRO A  1 278 ? 26.644  65.760  105.946 1.00 29.32  ? 278  PRO A O   1 
ATOM   1947  C  CB  . PRO A  1 278 ? 25.174  64.214  103.483 1.00 21.16  ? 278  PRO A CB  1 
ATOM   1948  C  CG  . PRO A  1 278 ? 24.184  63.144  103.739 1.00 23.88  ? 278  PRO A CG  1 
ATOM   1949  C  CD  . PRO A  1 278 ? 25.057  61.928  103.897 1.00 25.22  ? 278  PRO A CD  1 
ATOM   1950  N  N   . SER A  1 279 ? 25.304  64.141  106.712 1.00 24.07  ? 279  SER A N   1 
ATOM   1951  C  CA  . SER A  1 279 ? 25.104  64.850  107.963 1.00 22.26  ? 279  SER A CA  1 
ATOM   1952  C  C   . SER A  1 279 ? 26.433  65.024  108.714 1.00 23.07  ? 279  SER A C   1 
ATOM   1953  O  O   . SER A  1 279 ? 26.593  65.950  109.515 1.00 23.42  ? 279  SER A O   1 
ATOM   1954  C  CB  . SER A  1 279 ? 24.060  64.127  108.836 1.00 20.45  ? 279  SER A CB  1 
ATOM   1955  O  OG  . SER A  1 279 ? 24.413  62.780  109.116 1.00 27.79  ? 279  SER A OG  1 
ATOM   1956  N  N   . LEU A  1 280 ? 27.402  64.158  108.432 1.00 22.71  ? 280  LEU A N   1 
ATOM   1957  C  CA  . LEU A  1 280 ? 28.693  64.227  109.113 1.00 22.98  ? 280  LEU A CA  1 
ATOM   1958  C  C   . LEU A  1 280 ? 29.742  65.063  108.376 1.00 25.90  ? 280  LEU A C   1 
ATOM   1959  O  O   . LEU A  1 280 ? 30.893  65.131  108.805 1.00 25.45  ? 280  LEU A O   1 
ATOM   1960  C  CB  . LEU A  1 280 ? 29.244  62.814  109.334 1.00 22.56  ? 280  LEU A CB  1 
ATOM   1961  C  CG  . LEU A  1 280 ? 28.432  61.814  110.188 1.00 25.83  ? 280  LEU A CG  1 
ATOM   1962  C  CD1 . LEU A  1 280 ? 29.068  60.410  110.138 1.00 22.37  ? 280  LEU A CD1 1 
ATOM   1963  C  CD2 . LEU A  1 280 ? 28.374  62.296  111.615 1.00 20.98  ? 280  LEU A CD2 1 
ATOM   1964  N  N   . ILE A  1 281 ? 29.351  65.716  107.284 1.00 26.39  ? 281  ILE A N   1 
ATOM   1965  C  CA  . ILE A  1 281 ? 30.305  66.497  106.499 1.00 26.14  ? 281  ILE A CA  1 
ATOM   1966  C  C   . ILE A  1 281 ? 29.982  67.981  106.460 1.00 24.16  ? 281  ILE A C   1 
ATOM   1967  O  O   . ILE A  1 281 ? 28.850  68.359  106.246 1.00 27.00  ? 281  ILE A O   1 
ATOM   1968  C  CB  . ILE A  1 281 ? 30.405  65.923  105.077 1.00 23.17  ? 281  ILE A CB  1 
ATOM   1969  C  CG1 . ILE A  1 281 ? 30.968  64.496  105.151 1.00 24.08  ? 281  ILE A CG1 1 
ATOM   1970  C  CG2 . ILE A  1 281 ? 31.298  66.793  104.229 1.00 25.56  ? 281  ILE A CG2 1 
ATOM   1971  C  CD1 . ILE A  1 281 ? 30.919  63.702  103.820 1.00 30.60  ? 281  ILE A CD1 1 
ATOM   1972  N  N   . THR A  1 282 ? 30.990  68.821  106.668 1.00 24.30  ? 282  THR A N   1 
ATOM   1973  C  CA  . THR A  1 282 ? 30.760  70.260  106.704 1.00 25.64  ? 282  THR A CA  1 
ATOM   1974  C  C   . THR A  1 282 ? 30.762  70.866  105.311 1.00 26.14  ? 282  THR A C   1 
ATOM   1975  O  O   . THR A  1 282 ? 29.821  71.555  104.928 1.00 26.55  ? 282  THR A O   1 
ATOM   1976  C  CB  . THR A  1 282 ? 31.824  70.992  107.581 1.00 26.55  ? 282  THR A CB  1 
ATOM   1977  O  OG1 . THR A  1 282 ? 31.906  70.361  108.861 1.00 28.84  ? 282  THR A OG1 1 
ATOM   1978  C  CG2 . THR A  1 282 ? 31.435  72.444  107.796 1.00 19.70  ? 282  THR A CG2 1 
ATOM   1979  N  N   . LEU A  1 283 ? 31.823  70.608  104.558 1.00 25.86  ? 283  LEU A N   1 
ATOM   1980  C  CA  . LEU A  1 283 ? 31.934  71.117  103.203 1.00 24.07  ? 283  LEU A CA  1 
ATOM   1981  C  C   . LEU A  1 283 ? 32.759  70.164  102.379 1.00 25.27  ? 283  LEU A C   1 
ATOM   1982  O  O   . LEU A  1 283 ? 33.552  69.387  102.928 1.00 25.08  ? 283  LEU A O   1 
ATOM   1983  C  CB  . LEU A  1 283 ? 32.625  72.475  103.193 1.00 22.30  ? 283  LEU A CB  1 
ATOM   1984  C  CG  . LEU A  1 283 ? 31.885  73.674  103.782 1.00 25.01  ? 283  LEU A CG  1 
ATOM   1985  C  CD1 . LEU A  1 283 ? 32.847  74.870  103.887 1.00 22.31  ? 283  LEU A CD1 1 
ATOM   1986  C  CD2 . LEU A  1 283 ? 30.687  73.999  102.895 1.00 12.80  ? 283  LEU A CD2 1 
ATOM   1987  N  N   . LEU A  1 284 ? 32.560  70.218  101.064 1.00 23.08  ? 284  LEU A N   1 
ATOM   1988  C  CA  . LEU A  1 284 ? 33.335  69.408  100.144 1.00 23.81  ? 284  LEU A CA  1 
ATOM   1989  C  C   . LEU A  1 284 ? 34.003  70.371  99.183  1.00 26.17  ? 284  LEU A C   1 
ATOM   1990  O  O   . LEU A  1 284 ? 33.335  71.118  98.461  1.00 26.87  ? 284  LEU A O   1 
ATOM   1991  C  CB  . LEU A  1 284 ? 32.470  68.445  99.335  1.00 25.11  ? 284  LEU A CB  1 
ATOM   1992  C  CG  . LEU A  1 284 ? 31.735  67.278  99.991  1.00 26.60  ? 284  LEU A CG  1 
ATOM   1993  C  CD1 . LEU A  1 284 ? 30.245  67.612  100.113 1.00 24.83  ? 284  LEU A CD1 1 
ATOM   1994  C  CD2 . LEU A  1 284 ? 31.919  66.039  99.129  1.00 22.94  ? 284  LEU A CD2 1 
ATOM   1995  N  N   . PHE A  1 285 ? 35.329  70.376  99.189  1.00 26.98  ? 285  PHE A N   1 
ATOM   1996  C  CA  . PHE A  1 285 ? 36.055  71.235  98.283  1.00 24.94  ? 285  PHE A CA  1 
ATOM   1997  C  C   . PHE A  1 285 ? 36.278  70.416  97.019  1.00 24.18  ? 285  PHE A C   1 
ATOM   1998  O  O   . PHE A  1 285 ? 36.963  69.404  97.012  1.00 23.41  ? 285  PHE A O   1 
ATOM   1999  C  CB  . PHE A  1 285 ? 37.351  71.705  98.944  1.00 23.16  ? 285  PHE A CB  1 
ATOM   2000  C  CG  . PHE A  1 285 ? 37.115  72.502  100.186 1.00 20.24  ? 285  PHE A CG  1 
ATOM   2001  C  CD1 . PHE A  1 285 ? 36.817  71.869  101.383 1.00 21.71  ? 285  PHE A CD1 1 
ATOM   2002  C  CD2 . PHE A  1 285 ? 37.123  73.893  100.148 1.00 25.66  ? 285  PHE A CD2 1 
ATOM   2003  C  CE1 . PHE A  1 285 ? 36.524  72.610  102.540 1.00 26.24  ? 285  PHE A CE1 1 
ATOM   2004  C  CE2 . PHE A  1 285 ? 36.833  74.650  101.292 1.00 28.59  ? 285  PHE A CE2 1 
ATOM   2005  C  CZ  . PHE A  1 285 ? 36.533  74.004  102.495 1.00 27.57  ? 285  PHE A CZ  1 
ATOM   2006  N  N   . THR A  1 286 ? 35.643  70.849  95.946  1.00 26.99  ? 286  THR A N   1 
ATOM   2007  C  CA  . THR A  1 286 ? 35.739  70.132  94.698  1.00 29.87  ? 286  THR A CA  1 
ATOM   2008  C  C   . THR A  1 286 ? 36.094  71.110  93.595  1.00 28.32  ? 286  THR A C   1 
ATOM   2009  O  O   . THR A  1 286 ? 36.069  72.312  93.821  1.00 26.06  ? 286  THR A O   1 
ATOM   2010  C  CB  . THR A  1 286 ? 34.400  69.463  94.376  1.00 32.13  ? 286  THR A CB  1 
ATOM   2011  O  OG1 . THR A  1 286 ? 34.594  68.501  93.331  1.00 42.91  ? 286  THR A OG1 1 
ATOM   2012  C  CG2 . THR A  1 286 ? 33.387  70.506  93.913  1.00 26.44  ? 286  THR A CG2 1 
ATOM   2013  N  N   . ASP A  1 287 ? 36.418  70.611  92.405  1.00 25.86  ? 287  ASP A N   1 
ATOM   2014  C  CA  . ASP A  1 287 ? 36.760  71.521  91.337  1.00 30.01  ? 287  ASP A CA  1 
ATOM   2015  C  C   . ASP A  1 287 ? 35.505  72.218  90.798  1.00 33.64  ? 287  ASP A C   1 
ATOM   2016  O  O   . ASP A  1 287 ? 35.593  73.148  89.985  1.00 37.48  ? 287  ASP A O   1 
ATOM   2017  C  CB  . ASP A  1 287 ? 37.540  70.811  90.231  1.00 29.61  ? 287  ASP A CB  1 
ATOM   2018  C  CG  . ASP A  1 287 ? 36.853  69.571  89.736  1.00 33.57  ? 287  ASP A CG  1 
ATOM   2019  O  OD1 . ASP A  1 287 ? 36.815  68.580  90.494  1.00 33.20  ? 287  ASP A OD1 1 
ATOM   2020  O  OD2 . ASP A  1 287 ? 36.357  69.590  88.585  1.00 34.16  ? 287  ASP A OD2 1 
ATOM   2021  N  N   . LEU A  1 288 ? 34.336  71.784  91.262  1.00 31.11  ? 288  LEU A N   1 
ATOM   2022  C  CA  . LEU A  1 288 ? 33.097  72.440  90.867  1.00 31.05  ? 288  LEU A CA  1 
ATOM   2023  C  C   . LEU A  1 288 ? 32.847  73.594  91.838  1.00 31.07  ? 288  LEU A C   1 
ATOM   2024  O  O   . LEU A  1 288 ? 31.984  74.429  91.610  1.00 32.75  ? 288  LEU A O   1 
ATOM   2025  C  CB  . LEU A  1 288 ? 31.925  71.455  90.893  1.00 29.27  ? 288  LEU A CB  1 
ATOM   2026  C  CG  . LEU A  1 288 ? 32.219  70.234  90.020  1.00 27.24  ? 288  LEU A CG  1 
ATOM   2027  C  CD1 . LEU A  1 288 ? 31.034  69.308  90.008  1.00 24.05  ? 288  LEU A CD1 1 
ATOM   2028  C  CD2 . LEU A  1 288 ? 32.556  70.696  88.626  1.00 21.76  ? 288  LEU A CD2 1 
ATOM   2029  N  N   . GLY A  1 289 ? 33.635  73.636  92.914  1.00 34.01  ? 289  GLY A N   1 
ATOM   2030  C  CA  . GLY A  1 289 ? 33.519  74.676  93.926  1.00 30.96  ? 289  GLY A CA  1 
ATOM   2031  C  C   . GLY A  1 289 ? 33.345  74.120  95.340  1.00 32.70  ? 289  GLY A C   1 
ATOM   2032  O  O   . GLY A  1 289 ? 33.334  72.902  95.546  1.00 29.71  ? 289  GLY A O   1 
ATOM   2033  N  N   . VAL A  1 290 ? 33.226  75.020  96.318  1.00 32.43  ? 290  VAL A N   1 
ATOM   2034  C  CA  . VAL A  1 290 ? 33.028  74.647  97.723  1.00 29.25  ? 290  VAL A CA  1 
ATOM   2035  C  C   . VAL A  1 290 ? 31.549  74.271  97.825  1.00 27.84  ? 290  VAL A C   1 
ATOM   2036  O  O   . VAL A  1 290 ? 30.695  75.042  97.416  1.00 28.28  ? 290  VAL A O   1 
ATOM   2037  C  CB  . VAL A  1 290 ? 33.327  75.854  98.658  1.00 27.88  ? 290  VAL A CB  1 
ATOM   2038  C  CG1 . VAL A  1 290 ? 33.168  75.453  100.098 1.00 35.32  ? 290  VAL A CG1 1 
ATOM   2039  C  CG2 . VAL A  1 290 ? 34.726  76.358  98.437  1.00 22.73  ? 290  VAL A CG2 1 
ATOM   2040  N  N   . LEU A  1 291 ? 31.234  73.098  98.355  1.00 27.72  ? 291  LEU A N   1 
ATOM   2041  C  CA  . LEU A  1 291 ? 29.833  72.682  98.424  1.00 28.61  ? 291  LEU A CA  1 
ATOM   2042  C  C   . LEU A  1 291 ? 29.419  72.066  99.752  1.00 30.86  ? 291  LEU A C   1 
ATOM   2043  O  O   . LEU A  1 291 ? 30.233  71.475  100.457 1.00 37.66  ? 291  LEU A O   1 
ATOM   2044  C  CB  . LEU A  1 291 ? 29.533  71.653  97.331  1.00 24.97  ? 291  LEU A CB  1 
ATOM   2045  C  CG  . LEU A  1 291 ? 30.060  71.838  95.903  1.00 29.47  ? 291  LEU A CG  1 
ATOM   2046  C  CD1 . LEU A  1 291 ? 29.876  70.528  95.126  1.00 25.56  ? 291  LEU A CD1 1 
ATOM   2047  C  CD2 . LEU A  1 291 ? 29.342  73.005  95.204  1.00 30.74  ? 291  LEU A CD2 1 
ATOM   2048  N  N   . THR A  1 292 ? 28.139  72.203  100.078 1.00 30.59  ? 292  THR A N   1 
ATOM   2049  C  CA  . THR A  1 292 ? 27.564  71.616  101.288 1.00 27.09  ? 292  THR A CA  1 
ATOM   2050  C  C   . THR A  1 292 ? 27.112  70.272  100.727 1.00 26.51  ? 292  THR A C   1 
ATOM   2051  O  O   . THR A  1 292 ? 26.840  70.176  99.531  1.00 25.48  ? 292  THR A O   1 
ATOM   2052  C  CB  . THR A  1 292 ? 26.304  72.417  101.789 1.00 28.65  ? 292  THR A CB  1 
ATOM   2053  O  OG1 . THR A  1 292 ? 25.272  72.388  100.785 1.00 21.17  ? 292  THR A OG1 1 
ATOM   2054  C  CG2 . THR A  1 292 ? 26.669  73.870  102.091 1.00 20.74  ? 292  THR A CG2 1 
ATOM   2055  N  N   . PRO A  1 293 ? 27.016  69.225  101.565 1.00 24.22  ? 293  PRO A N   1 
ATOM   2056  C  CA  . PRO A  1 293 ? 26.589  67.920  101.041 1.00 24.00  ? 293  PRO A CA  1 
ATOM   2057  C  C   . PRO A  1 293 ? 25.334  67.935  100.164 1.00 23.00  ? 293  PRO A C   1 
ATOM   2058  O  O   . PRO A  1 293 ? 25.306  67.301  99.108  1.00 23.30  ? 293  PRO A O   1 
ATOM   2059  C  CB  . PRO A  1 293 ? 26.407  67.079  102.306 1.00 23.82  ? 293  PRO A CB  1 
ATOM   2060  C  CG  . PRO A  1 293 ? 27.429  67.654  103.233 1.00 22.11  ? 293  PRO A CG  1 
ATOM   2061  C  CD  . PRO A  1 293 ? 27.264  69.154  103.014 1.00 22.72  ? 293  PRO A CD  1 
ATOM   2062  N  N   . SER A  1 294 ? 24.313  68.668  100.595 1.00 22.37  ? 294  SER A N   1 
ATOM   2063  C  CA  . SER A  1 294 ? 23.041  68.762  99.868  1.00 27.19  ? 294  SER A CA  1 
ATOM   2064  C  C   . SER A  1 294 ? 23.106  69.449  98.501  1.00 28.27  ? 294  SER A C   1 
ATOM   2065  O  O   . SER A  1 294 ? 22.272  69.198  97.631  1.00 33.32  ? 294  SER A O   1 
ATOM   2066  C  CB  . SER A  1 294 ? 22.029  69.492  100.726 1.00 28.91  ? 294  SER A CB  1 
ATOM   2067  O  OG  . SER A  1 294 ? 22.561  70.744  101.089 1.00 35.18  ? 294  SER A OG  1 
ATOM   2068  N  N   . ALA A  1 295 ? 24.088  70.323  98.318  1.00 27.56  ? 295  ALA A N   1 
ATOM   2069  C  CA  . ALA A  1 295 ? 24.268  71.017  97.058  1.00 23.24  ? 295  ALA A CA  1 
ATOM   2070  C  C   . ALA A  1 295 ? 24.904  70.066  96.051  1.00 25.03  ? 295  ALA A C   1 
ATOM   2071  O  O   . ALA A  1 295 ? 24.916  70.337  94.854  1.00 31.09  ? 295  ALA A O   1 
ATOM   2072  C  CB  . ALA A  1 295 ? 25.147  72.235  97.254  1.00 17.65  ? 295  ALA A CB  1 
ATOM   2073  N  N   . VAL A  1 296 ? 25.423  68.942  96.520  1.00 23.62  ? 296  VAL A N   1 
ATOM   2074  C  CA  . VAL A  1 296 ? 26.052  68.007  95.601  1.00 24.55  ? 296  VAL A CA  1 
ATOM   2075  C  C   . VAL A  1 296 ? 25.148  67.485  94.492  1.00 24.93  ? 296  VAL A C   1 
ATOM   2076  O  O   . VAL A  1 296 ? 25.552  67.479  93.330  1.00 25.87  ? 296  VAL A O   1 
ATOM   2077  C  CB  . VAL A  1 296 ? 26.682  66.823  96.363  1.00 23.55  ? 296  VAL A CB  1 
ATOM   2078  C  CG1 . VAL A  1 296 ? 27.093  65.702  95.391  1.00 13.18  ? 296  VAL A CG1 1 
ATOM   2079  C  CG2 . VAL A  1 296 ? 27.883  67.327  97.127  1.00 21.97  ? 296  VAL A CG2 1 
ATOM   2080  N  N   . SER A  1 297 ? 23.937  67.044  94.835  1.00 28.53  ? 297  SER A N   1 
ATOM   2081  C  CA  . SER A  1 297 ? 23.004  66.529  93.820  1.00 28.53  ? 297  SER A CA  1 
ATOM   2082  C  C   . SER A  1 297 ? 22.847  67.479  92.619  1.00 27.14  ? 297  SER A C   1 
ATOM   2083  O  O   . SER A  1 297 ? 22.861  67.030  91.483  1.00 27.76  ? 297  SER A O   1 
ATOM   2084  C  CB  . SER A  1 297 ? 21.630  66.201  94.442  1.00 27.50  ? 297  SER A CB  1 
ATOM   2085  O  OG  . SER A  1 297 ? 21.232  67.164  95.404  1.00 29.28  ? 297  SER A OG  1 
ATOM   2086  N  N   . ASP A  1 298 ? 22.717  68.782  92.858  1.00 26.79  ? 298  ASP A N   1 
ATOM   2087  C  CA  . ASP A  1 298 ? 22.599  69.722  91.749  1.00 30.01  ? 298  ASP A CA  1 
ATOM   2088  C  C   . ASP A  1 298 ? 23.857  69.696  90.859  1.00 28.37  ? 298  ASP A C   1 
ATOM   2089  O  O   . ASP A  1 298 ? 23.751  69.645  89.627  1.00 25.27  ? 298  ASP A O   1 
ATOM   2090  C  CB  . ASP A  1 298 ? 22.353  71.156  92.257  1.00 40.49  ? 298  ASP A CB  1 
ATOM   2091  C  CG  . ASP A  1 298 ? 20.983  71.327  92.942  1.00 48.23  ? 298  ASP A CG  1 
ATOM   2092  O  OD1 . ASP A  1 298 ? 19.957  70.893  92.360  1.00 48.26  ? 298  ASP A OD1 1 
ATOM   2093  O  OD2 . ASP A  1 298 ? 20.935  71.914  94.056  1.00 51.10  ? 298  ASP A OD2 1 
ATOM   2094  N  N   . GLU A  1 299 ? 25.042  69.725  91.473  1.00 28.17  ? 299  GLU A N   1 
ATOM   2095  C  CA  . GLU A  1 299 ? 26.295  69.687  90.712  1.00 26.67  ? 299  GLU A CA  1 
ATOM   2096  C  C   . GLU A  1 299 ? 26.481  68.373  89.969  1.00 25.54  ? 299  GLU A C   1 
ATOM   2097  O  O   . GLU A  1 299 ? 26.971  68.347  88.829  1.00 22.52  ? 299  GLU A O   1 
ATOM   2098  C  CB  . GLU A  1 299 ? 27.501  69.909  91.621  1.00 28.92  ? 299  GLU A CB  1 
ATOM   2099  C  CG  . GLU A  1 299 ? 27.638  71.322  92.140  1.00 36.81  ? 299  GLU A CG  1 
ATOM   2100  C  CD  . GLU A  1 299 ? 27.477  72.365  91.039  1.00 45.21  ? 299  GLU A CD  1 
ATOM   2101  O  OE1 . GLU A  1 299 ? 27.967  72.134  89.906  1.00 47.75  ? 299  GLU A OE1 1 
ATOM   2102  O  OE2 . GLU A  1 299 ? 26.862  73.421  91.314  1.00 50.09  ? 299  GLU A OE2 1 
ATOM   2103  N  N   . LEU A  1 300 ? 26.076  67.280  90.610  1.00 23.03  ? 300  LEU A N   1 
ATOM   2104  C  CA  . LEU A  1 300 ? 26.221  65.975  89.999  1.00 23.01  ? 300  LEU A CA  1 
ATOM   2105  C  C   . LEU A  1 300 ? 25.357  65.871  88.734  1.00 26.56  ? 300  LEU A C   1 
ATOM   2106  O  O   . LEU A  1 300 ? 25.745  65.219  87.755  1.00 29.05  ? 300  LEU A O   1 
ATOM   2107  C  CB  . LEU A  1 300 ? 25.871  64.896  91.014  1.00 21.55  ? 300  LEU A CB  1 
ATOM   2108  C  CG  . LEU A  1 300 ? 26.333  63.499  90.615  1.00 20.89  ? 300  LEU A CG  1 
ATOM   2109  C  CD1 . LEU A  1 300 ? 26.502  62.641  91.861  1.00 18.54  ? 300  LEU A CD1 1 
ATOM   2110  C  CD2 . LEU A  1 300 ? 25.332  62.886  89.651  1.00 23.62  ? 300  LEU A CD2 1 
ATOM   2111  N  N   . ILE A  1 301 ? 24.188  66.502  88.741  1.00 23.73  ? 301  ILE A N   1 
ATOM   2112  C  CA  . ILE A  1 301 ? 23.359  66.480  87.548  1.00 25.73  ? 301  ILE A CA  1 
ATOM   2113  C  C   . ILE A  1 301 ? 24.050  67.290  86.430  1.00 26.67  ? 301  ILE A C   1 
ATOM   2114  O  O   . ILE A  1 301 ? 24.230  66.782  85.325  1.00 26.50  ? 301  ILE A O   1 
ATOM   2115  C  CB  . ILE A  1 301 ? 21.960  67.056  87.824  1.00 26.13  ? 301  ILE A CB  1 
ATOM   2116  C  CG1 . ILE A  1 301 ? 21.157  66.078  88.680  1.00 23.70  ? 301  ILE A CG1 1 
ATOM   2117  C  CG2 . ILE A  1 301 ? 21.229  67.291  86.517  1.00 22.15  ? 301  ILE A CG2 1 
ATOM   2118  C  CD1 . ILE A  1 301 ? 19.900  66.707  89.282  1.00 24.66  ? 301  ILE A CD1 1 
ATOM   2119  N  N   . LYS A  1 302 ? 24.432  68.540  86.711  1.00 28.41  ? 302  LYS A N   1 
ATOM   2120  C  CA  . LYS A  1 302 ? 25.144  69.363  85.719  1.00 29.22  ? 302  LYS A CA  1 
ATOM   2121  C  C   . LYS A  1 302 ? 26.377  68.624  85.208  1.00 30.43  ? 302  LYS A C   1 
ATOM   2122  O  O   . LYS A  1 302 ? 26.685  68.686  84.028  1.00 32.01  ? 302  LYS A O   1 
ATOM   2123  C  CB  . LYS A  1 302 ? 25.610  70.687  86.314  1.00 25.65  ? 302  LYS A CB  1 
ATOM   2124  C  CG  . LYS A  1 302 ? 24.482  71.593  86.766  1.00 41.10  ? 302  LYS A CG  1 
ATOM   2125  C  CD  . LYS A  1 302 ? 24.999  72.760  87.590  1.00 45.75  ? 302  LYS A CD  1 
ATOM   2126  C  CE  . LYS A  1 302 ? 23.858  73.566  88.179  1.00 48.76  ? 302  LYS A CE  1 
ATOM   2127  N  NZ  . LYS A  1 302 ? 24.368  74.514  89.220  1.00 55.66  ? 302  LYS A NZ  1 
ATOM   2128  N  N   . LEU A  1 303 ? 27.081  67.921  86.090  1.00 29.45  ? 303  LEU A N   1 
ATOM   2129  C  CA  . LEU A  1 303 ? 28.268  67.192  85.672  1.00 31.87  ? 303  LEU A CA  1 
ATOM   2130  C  C   . LEU A  1 303 ? 27.926  66.067  84.669  1.00 32.71  ? 303  LEU A C   1 
ATOM   2131  O  O   . LEU A  1 303 ? 28.422  66.053  83.549  1.00 29.35  ? 303  LEU A O   1 
ATOM   2132  C  CB  . LEU A  1 303 ? 28.979  66.605  86.896  1.00 33.86  ? 303  LEU A CB  1 
ATOM   2133  C  CG  . LEU A  1 303 ? 30.466  66.215  86.814  1.00 37.58  ? 303  LEU A CG  1 
ATOM   2134  C  CD1 . LEU A  1 303 ? 30.704  65.049  87.766  1.00 36.53  ? 303  LEU A CD1 1 
ATOM   2135  C  CD2 . LEU A  1 303 ? 30.873  65.812  85.412  1.00 36.87  ? 303  LEU A CD2 1 
ATOM   2136  N  N   . TYR A  1 304 ? 27.081  65.124  85.066  1.00 34.07  ? 304  TYR A N   1 
ATOM   2137  C  CA  . TYR A  1 304 ? 26.725  64.026  84.172  1.00 37.07  ? 304  TYR A CA  1 
ATOM   2138  C  C   . TYR A  1 304 ? 26.029  64.432  82.879  1.00 38.38  ? 304  TYR A C   1 
ATOM   2139  O  O   . TYR A  1 304 ? 26.152  63.745  81.867  1.00 40.69  ? 304  TYR A O   1 
ATOM   2140  C  CB  . TYR A  1 304 ? 25.882  62.993  84.923  1.00 35.11  ? 304  TYR A CB  1 
ATOM   2141  C  CG  . TYR A  1 304 ? 26.724  62.037  85.724  1.00 31.44  ? 304  TYR A CG  1 
ATOM   2142  C  CD1 . TYR A  1 304 ? 27.033  60.777  85.228  1.00 28.36  ? 304  TYR A CD1 1 
ATOM   2143  C  CD2 . TYR A  1 304 ? 27.249  62.406  86.957  1.00 31.92  ? 304  TYR A CD2 1 
ATOM   2144  C  CE1 . TYR A  1 304 ? 27.846  59.902  85.939  1.00 31.55  ? 304  TYR A CE1 1 
ATOM   2145  C  CE2 . TYR A  1 304 ? 28.071  61.529  87.682  1.00 34.13  ? 304  TYR A CE2 1 
ATOM   2146  C  CZ  . TYR A  1 304 ? 28.362  60.277  87.168  1.00 32.52  ? 304  TYR A CZ  1 
ATOM   2147  O  OH  . TYR A  1 304 ? 29.129  59.378  87.890  1.00 32.96  ? 304  TYR A OH  1 
ATOM   2148  N  N   . LEU A  1 305 ? 25.302  65.539  82.897  1.00 39.20  ? 305  LEU A N   1 
ATOM   2149  C  CA  . LEU A  1 305 ? 24.641  65.992  81.683  1.00 42.32  ? 305  LEU A CA  1 
ATOM   2150  C  C   . LEU A  1 305 ? 25.447  67.080  80.990  1.00 43.07  ? 305  LEU A C   1 
ATOM   2151  O  O   . LEU A  1 305 ? 24.910  67.823  80.179  1.00 44.02  ? 305  LEU A O   1 
ATOM   2152  C  CB  . LEU A  1 305 ? 23.246  66.530  81.996  1.00 43.59  ? 305  LEU A CB  1 
ATOM   2153  C  CG  . LEU A  1 305 ? 22.250  65.520  82.554  1.00 43.06  ? 305  LEU A CG  1 
ATOM   2154  C  CD1 . LEU A  1 305 ? 20.923  66.213  82.782  1.00 37.90  ? 305  LEU A CD1 1 
ATOM   2155  C  CD2 . LEU A  1 305 ? 22.113  64.349  81.596  1.00 39.18  ? 305  LEU A CD2 1 
ATOM   2156  N  N   . ALA A  1 306 ? 26.732  67.171  81.320  1.00 46.19  ? 306  ALA A N   1 
ATOM   2157  C  CA  . ALA A  1 306 ? 27.631  68.165  80.732  1.00 49.61  ? 306  ALA A CA  1 
ATOM   2158  C  C   . ALA A  1 306 ? 27.208  68.517  79.312  1.00 53.14  ? 306  ALA A C   1 
ATOM   2159  O  O   . ALA A  1 306 ? 26.686  69.607  79.073  1.00 53.58  ? 306  ALA A O   1 
ATOM   2160  C  CB  . ALA A  1 306 ? 29.052  67.641  80.734  1.00 48.28  ? 306  ALA A CB  1 
ATOM   2161  N  N   . ALA A  1 307 ? 27.431  67.591  78.379  1.00 55.87  ? 307  ALA A N   1 
ATOM   2162  C  CA  . ALA A  1 307 ? 27.043  67.780  76.979  1.00 58.75  ? 307  ALA A CA  1 
ATOM   2163  C  C   . ALA A  1 307 ? 27.591  66.652  76.105  1.00 60.80  ? 307  ALA A C   1 
ATOM   2164  O  O   . ALA A  1 307 ? 27.069  65.518  76.212  1.00 62.83  ? 307  ALA A O   1 
ATOM   2165  C  CB  . ALA A  1 307 ? 27.542  69.129  76.461  1.00 58.76  ? 307  ALA A CB  1 
HETATM 2166  N  N   . MSE B  1 1   ? -4.470  37.255  107.204 1.00 112.58 ? 1    MSE B N   1 
HETATM 2167  C  CA  . MSE B  1 1   ? -5.398  37.356  106.040 1.00 112.15 ? 1    MSE B CA  1 
HETATM 2168  C  C   . MSE B  1 1   ? -5.032  36.388  104.917 1.00 109.88 ? 1    MSE B C   1 
HETATM 2169  O  O   . MSE B  1 1   ? -4.618  35.253  105.154 1.00 109.01 ? 1    MSE B O   1 
HETATM 2170  C  CB  . MSE B  1 1   ? -5.393  38.780  105.479 1.00 115.21 ? 1    MSE B CB  1 
HETATM 2171  C  CG  . MSE B  1 1   ? -5.951  39.845  106.404 1.00 118.74 ? 1    MSE B CG  1 
HETATM 2172  SE SE  . MSE B  1 1   ? -5.954  41.572  105.528 1.00 124.52 ? 1    MSE B SE  1 
HETATM 2173  C  CE  . MSE B  1 1   ? -7.400  41.260  104.280 1.00 120.58 ? 1    MSE B CE  1 
ATOM   2174  N  N   . ASP B  1 2   ? -5.192  36.862  103.687 1.00 106.84 ? 2    ASP B N   1 
ATOM   2175  C  CA  . ASP B  1 2   ? -4.895  36.076  102.506 1.00 103.85 ? 2    ASP B CA  1 
ATOM   2176  C  C   . ASP B  1 2   ? -4.745  37.007  101.311 1.00 102.40 ? 2    ASP B C   1 
ATOM   2177  O  O   . ASP B  1 2   ? -5.378  38.057  101.259 1.00 101.73 ? 2    ASP B O   1 
ATOM   2178  C  CB  . ASP B  1 2   ? -6.017  35.073  102.257 1.00 103.82 ? 2    ASP B CB  1 
ATOM   2179  C  CG  . ASP B  1 2   ? -5.898  34.399  100.915 1.00 105.20 ? 2    ASP B CG  1 
ATOM   2180  O  OD1 . ASP B  1 2   ? -6.382  34.973  99.915  1.00 104.51 ? 2    ASP B OD1 1 
ATOM   2181  O  OD2 . ASP B  1 2   ? -5.305  33.301  100.856 1.00 106.25 ? 2    ASP B OD2 1 
ATOM   2182  N  N   . ASP B  1 3   ? -3.908  36.614  100.355 1.00 101.32 ? 3    ASP B N   1 
ATOM   2183  C  CA  . ASP B  1 3   ? -3.648  37.409  99.152  1.00 100.07 ? 3    ASP B CA  1 
ATOM   2184  C  C   . ASP B  1 3   ? -4.866  38.080  98.519  1.00 98.14  ? 3    ASP B C   1 
ATOM   2185  O  O   . ASP B  1 3   ? -4.951  39.308  98.486  1.00 98.88  ? 3    ASP B O   1 
ATOM   2186  C  CB  . ASP B  1 3   ? -2.935  36.547  98.106  1.00 100.58 ? 3    ASP B CB  1 
ATOM   2187  C  CG  . ASP B  1 3   ? -1.443  36.434  98.366  1.00 101.44 ? 3    ASP B CG  1 
ATOM   2188  O  OD1 . ASP B  1 3   ? -1.049  36.342  99.550  1.00 101.33 ? 3    ASP B OD1 1 
ATOM   2189  O  OD2 . ASP B  1 3   ? -0.663  36.432  97.389  1.00 100.87 ? 3    ASP B OD2 1 
ATOM   2190  N  N   . LYS B  1 4   ? -5.798  37.282  98.010  1.00 95.27  ? 4    LYS B N   1 
ATOM   2191  C  CA  . LYS B  1 4   ? -6.997  37.824  97.383  1.00 92.43  ? 4    LYS B CA  1 
ATOM   2192  C  C   . LYS B  1 4   ? -7.843  38.651  98.355  1.00 90.52  ? 4    LYS B C   1 
ATOM   2193  O  O   . LYS B  1 4   ? -8.581  39.543  97.942  1.00 88.32  ? 4    LYS B O   1 
ATOM   2194  C  CB  . LYS B  1 4   ? -7.814  36.684  96.775  1.00 91.97  ? 4    LYS B CB  1 
ATOM   2195  C  CG  . LYS B  1 4   ? -7.115  36.038  95.584  1.00 92.17  ? 4    LYS B CG  1 
ATOM   2196  C  CD  . LYS B  1 4   ? -7.641  34.646  95.289  1.00 93.05  ? 4    LYS B CD  1 
ATOM   2197  C  CE  . LYS B  1 4   ? -9.126  34.654  94.978  1.00 94.58  ? 4    LYS B CE  1 
ATOM   2198  N  NZ  . LYS B  1 4   ? -9.633  33.267  94.765  1.00 94.05  ? 4    LYS B NZ  1 
ATOM   2199  N  N   . GLU B  1 5   ? -7.720  38.363  99.647  1.00 89.58  ? 5    GLU B N   1 
ATOM   2200  C  CA  . GLU B  1 5   ? -8.456  39.103  100.668 1.00 89.55  ? 5    GLU B CA  1 
ATOM   2201  C  C   . GLU B  1 5   ? -7.716  40.391  100.991 1.00 87.58  ? 5    GLU B C   1 
ATOM   2202  O  O   . GLU B  1 5   ? -8.332  41.414  101.295 1.00 88.54  ? 5    GLU B O   1 
ATOM   2203  C  CB  . GLU B  1 5   ? -8.607  38.270  101.942 1.00 92.27  ? 5    GLU B CB  1 
ATOM   2204  C  CG  . GLU B  1 5   ? -9.508  37.057  101.777 1.00 96.34  ? 5    GLU B CG  1 
ATOM   2205  C  CD  . GLU B  1 5   ? -9.749  36.326  103.082 1.00 96.65  ? 5    GLU B CD  1 
ATOM   2206  O  OE1 . GLU B  1 5   ? -8.755  35.903  103.715 1.00 97.73  ? 5    GLU B OE1 1 
ATOM   2207  O  OE2 . GLU B  1 5   ? -10.931 36.176  103.468 1.00 94.95  ? 5    GLU B OE2 1 
ATOM   2208  N  N   . LEU B  1 6   ? -6.388  40.325  100.939 1.00 84.22  ? 6    LEU B N   1 
ATOM   2209  C  CA  . LEU B  1 6   ? -5.541  41.481  101.195 1.00 78.96  ? 6    LEU B CA  1 
ATOM   2210  C  C   . LEU B  1 6   ? -5.826  42.456  100.074 1.00 77.03  ? 6    LEU B C   1 
ATOM   2211  O  O   . LEU B  1 6   ? -6.017  43.648  100.301 1.00 77.66  ? 6    LEU B O   1 
ATOM   2212  C  CB  . LEU B  1 6   ? -4.067  41.085  101.146 1.00 78.85  ? 6    LEU B CB  1 
ATOM   2213  C  CG  . LEU B  1 6   ? -3.032  42.216  101.136 1.00 78.65  ? 6    LEU B CG  1 
ATOM   2214  C  CD1 . LEU B  1 6   ? -2.854  42.774  102.542 1.00 78.60  ? 6    LEU B CD1 1 
ATOM   2215  C  CD2 . LEU B  1 6   ? -1.710  41.684  100.607 1.00 76.97  ? 6    LEU B CD2 1 
ATOM   2216  N  N   . ILE B  1 7   ? -5.858  41.927  98.857  1.00 73.96  ? 7    ILE B N   1 
ATOM   2217  C  CA  . ILE B  1 7   ? -6.120  42.729  97.676  1.00 71.94  ? 7    ILE B CA  1 
ATOM   2218  C  C   . ILE B  1 7   ? -7.528  43.305  97.694  1.00 72.35  ? 7    ILE B C   1 
ATOM   2219  O  O   . ILE B  1 7   ? -7.809  44.298  97.022  1.00 73.79  ? 7    ILE B O   1 
ATOM   2220  C  CB  . ILE B  1 7   ? -5.926  41.896  96.403  1.00 70.68  ? 7    ILE B CB  1 
ATOM   2221  C  CG1 . ILE B  1 7   ? -4.466  41.430  96.323  1.00 70.46  ? 7    ILE B CG1 1 
ATOM   2222  C  CG2 . ILE B  1 7   ? -6.323  42.714  95.183  1.00 69.08  ? 7    ILE B CG2 1 
ATOM   2223  C  CD1 . ILE B  1 7   ? -4.161  40.507  95.171  1.00 66.26  ? 7    ILE B CD1 1 
ATOM   2224  N  N   . GLU B  1 8   ? -8.415  42.677  98.457  1.00 72.11  ? 8    GLU B N   1 
ATOM   2225  C  CA  . GLU B  1 8   ? -9.790  43.155  98.566  1.00 72.34  ? 8    GLU B CA  1 
ATOM   2226  C  C   . GLU B  1 8   ? -9.840  44.350  99.504  1.00 68.91  ? 8    GLU B C   1 
ATOM   2227  O  O   . GLU B  1 8   ? -10.222 45.449  99.110  1.00 68.15  ? 8    GLU B O   1 
ATOM   2228  C  CB  . GLU B  1 8   ? -10.702 42.053  99.105  1.00 76.78  ? 8    GLU B CB  1 
ATOM   2229  C  CG  . GLU B  1 8   ? -11.050 40.976  98.092  1.00 83.85  ? 8    GLU B CG  1 
ATOM   2230  C  CD  . GLU B  1 8   ? -11.870 39.847  98.705  1.00 88.00  ? 8    GLU B CD  1 
ATOM   2231  O  OE1 . GLU B  1 8   ? -11.337 39.133  99.588  1.00 88.51  ? 8    GLU B OE1 1 
ATOM   2232  O  OE2 . GLU B  1 8   ? -13.046 39.679  98.305  1.00 89.57  ? 8    GLU B OE2 1 
ATOM   2233  N  N   . TYR B  1 9   ? -9.453  44.116  100.752 1.00 65.08  ? 9    TYR B N   1 
ATOM   2234  C  CA  . TYR B  1 9   ? -9.434  45.153  101.769 1.00 62.99  ? 9    TYR B CA  1 
ATOM   2235  C  C   . TYR B  1 9   ? -8.817  46.422  101.199 1.00 63.38  ? 9    TYR B C   1 
ATOM   2236  O  O   . TYR B  1 9   ? -9.262  47.531  101.499 1.00 62.96  ? 9    TYR B O   1 
ATOM   2237  C  CB  . TYR B  1 9   ? -8.598  44.681  102.953 1.00 62.25  ? 9    TYR B CB  1 
ATOM   2238  C  CG  . TYR B  1 9   ? -8.741  45.502  104.213 1.00 62.57  ? 9    TYR B CG  1 
ATOM   2239  C  CD1 . TYR B  1 9   ? -9.401  44.985  105.328 1.00 62.34  ? 9    TYR B CD1 1 
ATOM   2240  C  CD2 . TYR B  1 9   ? -8.190  46.778  104.310 1.00 61.64  ? 9    TYR B CD2 1 
ATOM   2241  C  CE1 . TYR B  1 9   ? -9.505  45.715  106.511 1.00 61.77  ? 9    TYR B CE1 1 
ATOM   2242  C  CE2 . TYR B  1 9   ? -8.290  47.518  105.492 1.00 62.15  ? 9    TYR B CE2 1 
ATOM   2243  C  CZ  . TYR B  1 9   ? -8.947  46.977  106.588 1.00 62.20  ? 9    TYR B CZ  1 
ATOM   2244  O  OH  . TYR B  1 9   ? -9.034  47.685  107.767 1.00 59.75  ? 9    TYR B OH  1 
ATOM   2245  N  N   . PHE B  1 10  ? -7.793  46.244  100.367 1.00 62.77  ? 10   PHE B N   1 
ATOM   2246  C  CA  . PHE B  1 10  ? -7.077  47.361  99.758  1.00 61.37  ? 10   PHE B CA  1 
ATOM   2247  C  C   . PHE B  1 10  ? -7.830  48.060  98.635  1.00 61.90  ? 10   PHE B C   1 
ATOM   2248  O  O   . PHE B  1 10  ? -7.634  49.251  98.410  1.00 62.27  ? 10   PHE B O   1 
ATOM   2249  C  CB  . PHE B  1 10  ? -5.713  46.897  99.242  1.00 57.57  ? 10   PHE B CB  1 
ATOM   2250  C  CG  . PHE B  1 10  ? -4.899  47.988  98.607  1.00 53.31  ? 10   PHE B CG  1 
ATOM   2251  C  CD1 . PHE B  1 10  ? -4.426  49.050  99.363  1.00 53.57  ? 10   PHE B CD1 1 
ATOM   2252  C  CD2 . PHE B  1 10  ? -4.594  47.946  97.255  1.00 51.59  ? 10   PHE B CD2 1 
ATOM   2253  C  CE1 . PHE B  1 10  ? -3.658  50.053  98.783  1.00 53.20  ? 10   PHE B CE1 1 
ATOM   2254  C  CE2 . PHE B  1 10  ? -3.826  48.944  96.663  1.00 53.49  ? 10   PHE B CE2 1 
ATOM   2255  C  CZ  . PHE B  1 10  ? -3.356  49.999  97.429  1.00 53.71  ? 10   PHE B CZ  1 
ATOM   2256  N  N   . LYS B  1 11  ? -8.669  47.331  97.911  1.00 63.45  ? 11   LYS B N   1 
ATOM   2257  C  CA  . LYS B  1 11  ? -9.431  47.963  96.841  1.00 65.51  ? 11   LYS B CA  1 
ATOM   2258  C  C   . LYS B  1 11  ? -10.628 48.692  97.443  1.00 65.83  ? 11   LYS B C   1 
ATOM   2259  O  O   . LYS B  1 11  ? -11.013 49.760  96.973  1.00 65.93  ? 11   LYS B O   1 
ATOM   2260  C  CB  . LYS B  1 11  ? -9.907  46.933  95.805  1.00 67.13  ? 11   LYS B CB  1 
ATOM   2261  C  CG  . LYS B  1 11  ? -8.858  46.557  94.753  1.00 71.34  ? 11   LYS B CG  1 
ATOM   2262  C  CD  . LYS B  1 11  ? -9.482  45.863  93.529  1.00 73.81  ? 11   LYS B CD  1 
ATOM   2263  C  CE  . LYS B  1 11  ? -10.388 46.811  92.722  1.00 75.37  ? 11   LYS B CE  1 
ATOM   2264  N  NZ  . LYS B  1 11  ? -11.161 46.132  91.623  1.00 72.87  ? 11   LYS B NZ  1 
ATOM   2265  N  N   . SER B  1 12  ? -11.211 48.122  98.492  1.00 66.58  ? 12   SER B N   1 
ATOM   2266  C  CA  . SER B  1 12  ? -12.357 48.753  99.127  1.00 68.91  ? 12   SER B CA  1 
ATOM   2267  C  C   . SER B  1 12  ? -11.894 49.956  99.938  1.00 69.27  ? 12   SER B C   1 
ATOM   2268  O  O   . SER B  1 12  ? -12.581 50.976  99.989  1.00 70.18  ? 12   SER B O   1 
ATOM   2269  C  CB  . SER B  1 12  ? -13.104 47.759  100.026 1.00 70.12  ? 12   SER B CB  1 
ATOM   2270  O  OG  . SER B  1 12  ? -12.272 47.251  101.056 1.00 73.90  ? 12   SER B OG  1 
ATOM   2271  N  N   . GLN B  1 13  ? -10.725 49.841  100.560 1.00 68.79  ? 13   GLN B N   1 
ATOM   2272  C  CA  . GLN B  1 13  ? -10.183 50.938  101.353 1.00 69.65  ? 13   GLN B CA  1 
ATOM   2273  C  C   . GLN B  1 13  ? -10.232 52.260  100.604 1.00 71.45  ? 13   GLN B C   1 
ATOM   2274  O  O   . GLN B  1 13  ? -10.517 53.311  101.183 1.00 71.10  ? 13   GLN B O   1 
ATOM   2275  C  CB  . GLN B  1 13  ? -8.742  50.644  101.754 1.00 67.76  ? 13   GLN B CB  1 
ATOM   2276  C  CG  . GLN B  1 13  ? -8.638  49.923  103.065 1.00 67.63  ? 13   GLN B CG  1 
ATOM   2277  C  CD  . GLN B  1 13  ? -9.378  50.654  104.161 1.00 66.33  ? 13   GLN B CD  1 
ATOM   2278  O  OE1 . GLN B  1 13  ? -9.045  51.791  104.497 1.00 62.11  ? 13   GLN B OE1 1 
ATOM   2279  N  NE2 . GLN B  1 13  ? -10.398 50.008  104.718 1.00 67.17  ? 13   GLN B NE2 1 
HETATM 2280  N  N   . MSE B  1 14  ? -9.956  52.205  99.310  1.00 73.49  ? 14   MSE B N   1 
HETATM 2281  C  CA  . MSE B  1 14  ? -9.973  53.406  98.502  1.00 77.34  ? 14   MSE B CA  1 
HETATM 2282  C  C   . MSE B  1 14  ? -11.361 53.698  97.939  1.00 78.22  ? 14   MSE B C   1 
HETATM 2283  O  O   . MSE B  1 14  ? -11.653 54.837  97.574  1.00 79.49  ? 14   MSE B O   1 
HETATM 2284  C  CB  . MSE B  1 14  ? -8.959  53.283  97.373  1.00 80.30  ? 14   MSE B CB  1 
HETATM 2285  C  CG  . MSE B  1 14  ? -7.540  53.123  97.863  1.00 84.58  ? 14   MSE B CG  1 
HETATM 2286  SE SE  . MSE B  1 14  ? -6.343  52.870  96.391  1.00 93.92  ? 14   MSE B SE  1 
HETATM 2287  C  CE  . MSE B  1 14  ? -6.004  54.725  95.966  1.00 91.51  ? 14   MSE B CE  1 
ATOM   2288  N  N   . LYS B  1 15  ? -12.215 52.678  97.854  1.00 76.84  ? 15   LYS B N   1 
ATOM   2289  C  CA  . LYS B  1 15  ? -13.562 52.905  97.352  1.00 75.46  ? 15   LYS B CA  1 
ATOM   2290  C  C   . LYS B  1 15  ? -14.315 53.748  98.370  1.00 74.34  ? 15   LYS B C   1 
ATOM   2291  O  O   . LYS B  1 15  ? -14.922 54.753  98.010  1.00 73.51  ? 15   LYS B O   1 
ATOM   2292  C  CB  . LYS B  1 15  ? -14.294 51.587  97.102  1.00 76.38  ? 15   LYS B CB  1 
ATOM   2293  C  CG  . LYS B  1 15  ? -14.142 51.071  95.678  1.00 76.69  ? 15   LYS B CG  1 
ATOM   2294  C  CD  . LYS B  1 15  ? -15.069 49.886  95.407  1.00 77.40  ? 15   LYS B CD  1 
ATOM   2295  C  CE  . LYS B  1 15  ? -16.545 50.301  95.327  1.00 76.63  ? 15   LYS B CE  1 
ATOM   2296  N  NZ  . LYS B  1 15  ? -16.884 51.051  94.077  1.00 72.84  ? 15   LYS B NZ  1 
ATOM   2297  N  N   . GLU B  1 16  ? -14.265 53.348  99.640  1.00 74.00  ? 16   GLU B N   1 
ATOM   2298  C  CA  . GLU B  1 16  ? -14.929 54.111  100.693 1.00 75.22  ? 16   GLU B CA  1 
ATOM   2299  C  C   . GLU B  1 16  ? -14.247 55.475  100.892 1.00 73.90  ? 16   GLU B C   1 
ATOM   2300  O  O   . GLU B  1 16  ? -14.664 56.267  101.737 1.00 75.72  ? 16   GLU B O   1 
ATOM   2301  C  CB  . GLU B  1 16  ? -14.922 53.351  102.028 1.00 78.37  ? 16   GLU B CB  1 
ATOM   2302  C  CG  . GLU B  1 16  ? -15.702 54.089  103.137 1.00 84.72  ? 16   GLU B CG  1 
ATOM   2303  C  CD  . GLU B  1 16  ? -15.512 53.512  104.542 1.00 87.41  ? 16   GLU B CD  1 
ATOM   2304  O  OE1 . GLU B  1 16  ? -14.370 53.547  105.062 1.00 87.90  ? 16   GLU B OE1 1 
ATOM   2305  O  OE2 . GLU B  1 16  ? -16.515 53.034  105.127 1.00 85.24  ? 16   GLU B OE2 1 
ATOM   2306  N  N   . ASP B  1 17  ? -13.194 55.748  100.124 1.00 69.81  ? 17   ASP B N   1 
ATOM   2307  C  CA  . ASP B  1 17  ? -12.498 57.025  100.235 1.00 65.49  ? 17   ASP B CA  1 
ATOM   2308  C  C   . ASP B  1 17  ? -11.568 57.272  99.052  1.00 63.60  ? 17   ASP B C   1 
ATOM   2309  O  O   . ASP B  1 17  ? -10.389 56.932  99.094  1.00 63.94  ? 17   ASP B O   1 
ATOM   2310  C  CB  . ASP B  1 17  ? -11.694 57.089  101.530 1.00 63.97  ? 17   ASP B CB  1 
ATOM   2311  C  CG  . ASP B  1 17  ? -11.090 58.460  101.765 1.00 64.12  ? 17   ASP B CG  1 
ATOM   2312  O  OD1 . ASP B  1 17  ? -11.021 59.247  100.788 1.00 61.32  ? 17   ASP B OD1 1 
ATOM   2313  O  OD2 . ASP B  1 17  ? -10.682 58.745  102.916 1.00 61.21  ? 17   ASP B OD2 1 
ATOM   2314  N  N   . PRO B  1 18  ? -12.091 57.892  97.987  1.00 62.13  ? 18   PRO B N   1 
ATOM   2315  C  CA  . PRO B  1 18  ? -11.345 58.204  96.762  1.00 60.89  ? 18   PRO B CA  1 
ATOM   2316  C  C   . PRO B  1 18  ? -10.175 59.183  96.921  1.00 60.72  ? 18   PRO B C   1 
ATOM   2317  O  O   . PRO B  1 18  ? -9.182  59.100  96.192  1.00 61.48  ? 18   PRO B O   1 
ATOM   2318  C  CB  . PRO B  1 18  ? -12.424 58.767  95.834  1.00 60.73  ? 18   PRO B CB  1 
ATOM   2319  C  CG  . PRO B  1 18  ? -13.699 58.167  96.365  1.00 61.28  ? 18   PRO B CG  1 
ATOM   2320  C  CD  . PRO B  1 18  ? -13.508 58.266  97.843  1.00 60.81  ? 18   PRO B CD  1 
ATOM   2321  N  N   . ASP B  1 19  ? -10.285 60.107  97.870  1.00 58.79  ? 19   ASP B N   1 
ATOM   2322  C  CA  . ASP B  1 19  ? -9.236  61.101  98.064  1.00 56.33  ? 19   ASP B CA  1 
ATOM   2323  C  C   . ASP B  1 19  ? -8.192  60.696  99.081  1.00 52.73  ? 19   ASP B C   1 
ATOM   2324  O  O   . ASP B  1 19  ? -7.475  61.529  99.608  1.00 51.42  ? 19   ASP B O   1 
ATOM   2325  C  CB  . ASP B  1 19  ? -9.863  62.438  98.448  1.00 57.58  ? 19   ASP B CB  1 
ATOM   2326  C  CG  . ASP B  1 19  ? -10.920 62.878  97.453  1.00 59.23  ? 19   ASP B CG  1 
ATOM   2327  O  OD1 . ASP B  1 19  ? -10.587 63.082  96.257  1.00 55.39  ? 19   ASP B OD1 1 
ATOM   2328  O  OD2 . ASP B  1 19  ? -12.093 63.008  97.867  1.00 63.45  ? 19   ASP B OD2 1 
HETATM 2329  N  N   . MSE B  1 20  ? -8.119  59.402  99.348  1.00 53.65  ? 20   MSE B N   1 
HETATM 2330  C  CA  . MSE B  1 20  ? -7.146  58.863  100.283 1.00 54.16  ? 20   MSE B CA  1 
HETATM 2331  C  C   . MSE B  1 20  ? -5.981  58.386  99.446  1.00 51.23  ? 20   MSE B C   1 
HETATM 2332  O  O   . MSE B  1 20  ? -6.167  57.557  98.555  1.00 51.09  ? 20   MSE B O   1 
HETATM 2333  C  CB  . MSE B  1 20  ? -7.729  57.672  101.049 1.00 56.93  ? 20   MSE B CB  1 
HETATM 2334  C  CG  . MSE B  1 20  ? -6.708  56.913  101.895 1.00 63.95  ? 20   MSE B CG  1 
HETATM 2335  SE SE  . MSE B  1 20  ? -7.415  55.357  102.856 1.00 74.53  ? 20   MSE B SE  1 
HETATM 2336  C  CE  . MSE B  1 20  ? -7.910  56.267  104.500 1.00 68.17  ? 20   MSE B CE  1 
ATOM   2337  N  N   . ALA B  1 21  ? -4.791  58.911  99.719  1.00 47.45  ? 21   ALA B N   1 
ATOM   2338  C  CA  . ALA B  1 21  ? -3.607  58.496  98.982  1.00 44.78  ? 21   ALA B CA  1 
ATOM   2339  C  C   . ALA B  1 21  ? -3.474  56.977  99.007  1.00 43.44  ? 21   ALA B C   1 
ATOM   2340  O  O   . ALA B  1 21  ? -3.693  56.341  100.039 1.00 41.32  ? 21   ALA B O   1 
ATOM   2341  C  CB  . ALA B  1 21  ? -2.368  59.125  99.582  1.00 43.55  ? 21   ALA B CB  1 
ATOM   2342  N  N   . SER B  1 22  ? -3.134  56.404  97.858  1.00 43.57  ? 22   SER B N   1 
ATOM   2343  C  CA  . SER B  1 22  ? -2.936  54.961  97.730  1.00 46.83  ? 22   SER B CA  1 
ATOM   2344  C  C   . SER B  1 22  ? -1.993  54.458  98.831  1.00 45.44  ? 22   SER B C   1 
ATOM   2345  O  O   . SER B  1 22  ? -2.246  53.439  99.473  1.00 45.62  ? 22   SER B O   1 
ATOM   2346  C  CB  . SER B  1 22  ? -2.329  54.648  96.360  1.00 49.97  ? 22   SER B CB  1 
ATOM   2347  O  OG  . SER B  1 22  ? -1.067  55.285  96.217  1.00 54.09  ? 22   SER B OG  1 
ATOM   2348  N  N   . ALA B  1 23  ? -0.896  55.177  99.035  1.00 43.16  ? 23   ALA B N   1 
ATOM   2349  C  CA  . ALA B  1 23  ? 0.058   54.808  100.065 1.00 43.36  ? 23   ALA B CA  1 
ATOM   2350  C  C   . ALA B  1 23  ? -0.650  54.583  101.395 1.00 42.39  ? 23   ALA B C   1 
ATOM   2351  O  O   . ALA B  1 23  ? -0.409  53.591  102.067 1.00 46.78  ? 23   ALA B O   1 
ATOM   2352  C  CB  . ALA B  1 23  ? 1.111   55.895  100.214 1.00 44.41  ? 23   ALA B CB  1 
ATOM   2353  N  N   . VAL B  1 24  ? -1.523  55.506  101.779 1.00 41.77  ? 24   VAL B N   1 
ATOM   2354  C  CA  . VAL B  1 24  ? -2.251  55.392  103.040 1.00 40.58  ? 24   VAL B CA  1 
ATOM   2355  C  C   . VAL B  1 24  ? -3.239  54.225  103.029 1.00 41.40  ? 24   VAL B C   1 
ATOM   2356  O  O   . VAL B  1 24  ? -3.473  53.600  104.062 1.00 40.84  ? 24   VAL B O   1 
ATOM   2357  C  CB  . VAL B  1 24  ? -3.001  56.699  103.358 1.00 42.26  ? 24   VAL B CB  1 
ATOM   2358  C  CG1 . VAL B  1 24  ? -3.762  56.570  104.677 1.00 37.72  ? 24   VAL B CG1 1 
ATOM   2359  C  CG2 . VAL B  1 24  ? -2.007  57.853  103.413 1.00 40.58  ? 24   VAL B CG2 1 
ATOM   2360  N  N   . ALA B  1 25  ? -3.827  53.933  101.870 1.00 40.11  ? 25   ALA B N   1 
ATOM   2361  C  CA  . ALA B  1 25  ? -4.746  52.804  101.780 1.00 41.09  ? 25   ALA B CA  1 
ATOM   2362  C  C   . ALA B  1 25  ? -3.918  51.539  101.991 1.00 42.37  ? 25   ALA B C   1 
ATOM   2363  O  O   . ALA B  1 25  ? -4.360  50.600  102.646 1.00 46.40  ? 25   ALA B O   1 
ATOM   2364  C  CB  . ALA B  1 25  ? -5.433  52.769  100.420 1.00 38.04  ? 25   ALA B CB  1 
ATOM   2365  N  N   . ALA B  1 26  ? -2.703  51.525  101.452 1.00 41.21  ? 26   ALA B N   1 
ATOM   2366  C  CA  . ALA B  1 26  ? -1.829  50.367  101.612 1.00 43.34  ? 26   ALA B CA  1 
ATOM   2367  C  C   . ALA B  1 26  ? -1.408  50.188  103.076 1.00 43.58  ? 26   ALA B C   1 
ATOM   2368  O  O   . ALA B  1 26  ? -1.496  49.098  103.634 1.00 43.13  ? 26   ALA B O   1 
ATOM   2369  C  CB  . ALA B  1 26  ? -0.599  50.518  100.728 1.00 42.42  ? 26   ALA B CB  1 
ATOM   2370  N  N   . ILE B  1 27  ? -0.951  51.266  103.698 1.00 44.32  ? 27   ILE B N   1 
ATOM   2371  C  CA  . ILE B  1 27  ? -0.516  51.200  105.080 1.00 44.70  ? 27   ILE B CA  1 
ATOM   2372  C  C   . ILE B  1 27  ? -1.650  50.689  105.959 1.00 46.53  ? 27   ILE B C   1 
ATOM   2373  O  O   . ILE B  1 27  ? -1.441  49.831  106.806 1.00 48.38  ? 27   ILE B O   1 
ATOM   2374  C  CB  . ILE B  1 27  ? -0.011  52.582  105.538 1.00 43.78  ? 27   ILE B CB  1 
ATOM   2375  C  CG1 . ILE B  1 27  ? 1.297   52.891  104.813 1.00 44.39  ? 27   ILE B CG1 1 
ATOM   2376  C  CG2 . ILE B  1 27  ? 0.225   52.610  107.029 1.00 42.86  ? 27   ILE B CG2 1 
ATOM   2377  C  CD1 . ILE B  1 27  ? 1.779   54.317  104.987 1.00 46.33  ? 27   ILE B CD1 1 
ATOM   2378  N  N   . ARG B  1 28  ? -2.857  51.194  105.748 1.00 48.61  ? 28   ARG B N   1 
ATOM   2379  C  CA  . ARG B  1 28  ? -4.002  50.738  106.535 1.00 51.65  ? 28   ARG B CA  1 
ATOM   2380  C  C   . ARG B  1 28  ? -4.236  49.238  106.340 1.00 52.69  ? 28   ARG B C   1 
ATOM   2381  O  O   . ARG B  1 28  ? -4.552  48.525  107.302 1.00 49.38  ? 28   ARG B O   1 
ATOM   2382  C  CB  . ARG B  1 28  ? -5.270  51.494  106.130 1.00 52.74  ? 28   ARG B CB  1 
ATOM   2383  C  CG  . ARG B  1 28  ? -5.264  52.956  106.494 1.00 56.06  ? 28   ARG B CG  1 
ATOM   2384  C  CD  . ARG B  1 28  ? -6.355  53.687  105.745 1.00 59.36  ? 28   ARG B CD  1 
ATOM   2385  N  NE  . ARG B  1 28  ? -7.669  53.507  106.347 1.00 64.52  ? 28   ARG B NE  1 
ATOM   2386  C  CZ  . ARG B  1 28  ? -8.090  54.177  107.415 1.00 67.82  ? 28   ARG B CZ  1 
ATOM   2387  N  NH1 . ARG B  1 28  ? -9.306  53.953  107.907 1.00 69.67  ? 28   ARG B NH1 1 
ATOM   2388  N  NH2 . ARG B  1 28  ? -7.294  55.079  107.982 1.00 66.65  ? 28   ARG B NH2 1 
ATOM   2389  N  N   . THR B  1 29  ? -4.084  48.773  105.096 1.00 53.67  ? 29   THR B N   1 
ATOM   2390  C  CA  . THR B  1 29  ? -4.282  47.363  104.768 1.00 56.79  ? 29   THR B CA  1 
ATOM   2391  C  C   . THR B  1 29  ? -3.168  46.484  105.326 1.00 57.71  ? 29   THR B C   1 
ATOM   2392  O  O   . THR B  1 29  ? -3.370  45.291  105.554 1.00 59.41  ? 29   THR B O   1 
ATOM   2393  C  CB  . THR B  1 29  ? -4.368  47.126  103.237 1.00 59.17  ? 29   THR B CB  1 
ATOM   2394  O  OG1 . THR B  1 29  ? -3.095  47.383  102.636 1.00 64.53  ? 29   THR B OG1 1 
ATOM   2395  C  CG2 . THR B  1 29  ? -5.409  48.035  102.605 1.00 56.99  ? 29   THR B CG2 1 
ATOM   2396  N  N   . LEU B  1 30  ? -1.991  47.070  105.533 1.00 58.22  ? 30   LEU B N   1 
ATOM   2397  C  CA  . LEU B  1 30  ? -0.862  46.332  106.090 1.00 58.40  ? 30   LEU B CA  1 
ATOM   2398  C  C   . LEU B  1 30  ? -1.046  46.262  107.594 1.00 59.46  ? 30   LEU B C   1 
ATOM   2399  O  O   . LEU B  1 30  ? -0.798  45.227  108.209 1.00 59.81  ? 30   LEU B O   1 
ATOM   2400  C  CB  . LEU B  1 30  ? 0.468   47.031  105.796 1.00 56.51  ? 30   LEU B CB  1 
ATOM   2401  C  CG  . LEU B  1 30  ? 0.984   47.071  104.361 1.00 56.76  ? 30   LEU B CG  1 
ATOM   2402  C  CD1 . LEU B  1 30  ? 2.297   47.834  104.307 1.00 56.03  ? 30   LEU B CD1 1 
ATOM   2403  C  CD2 . LEU B  1 30  ? 1.163   45.656  103.848 1.00 55.77  ? 30   LEU B CD2 1 
ATOM   2404  N  N   . LEU B  1 31  ? -1.481  47.371  108.184 1.00 61.53  ? 31   LEU B N   1 
ATOM   2405  C  CA  . LEU B  1 31  ? -1.685  47.422  109.625 1.00 65.50  ? 31   LEU B CA  1 
ATOM   2406  C  C   . LEU B  1 31  ? -2.783  46.443  109.990 1.00 68.75  ? 31   LEU B C   1 
ATOM   2407  O  O   . LEU B  1 31  ? -2.787  45.872  111.082 1.00 69.65  ? 31   LEU B O   1 
ATOM   2408  C  CB  . LEU B  1 31  ? -2.074  48.830  110.074 1.00 65.26  ? 31   LEU B CB  1 
ATOM   2409  C  CG  . LEU B  1 31  ? -1.431  49.279  111.392 1.00 65.26  ? 31   LEU B CG  1 
ATOM   2410  C  CD1 . LEU B  1 31  ? -2.108  50.543  111.887 1.00 65.62  ? 31   LEU B CD1 1 
ATOM   2411  C  CD2 . LEU B  1 31  ? -1.559  48.185  112.429 1.00 66.35  ? 31   LEU B CD2 1 
ATOM   2412  N  N   . GLU B  1 32  ? -3.720  46.254  109.069 1.00 72.56  ? 32   GLU B N   1 
ATOM   2413  C  CA  . GLU B  1 32  ? -4.809  45.317  109.293 1.00 76.52  ? 32   GLU B CA  1 
ATOM   2414  C  C   . GLU B  1 32  ? -4.226  43.920  109.127 1.00 77.74  ? 32   GLU B C   1 
ATOM   2415  O  O   . GLU B  1 32  ? -4.506  43.025  109.921 1.00 80.59  ? 32   GLU B O   1 
ATOM   2416  C  CB  . GLU B  1 32  ? -5.935  45.542  108.276 1.00 78.66  ? 32   GLU B CB  1 
ATOM   2417  C  CG  . GLU B  1 32  ? -7.062  44.511  108.336 1.00 82.49  ? 32   GLU B CG  1 
ATOM   2418  C  CD  . GLU B  1 32  ? -7.996  44.683  109.534 1.00 86.12  ? 32   GLU B CD  1 
ATOM   2419  O  OE1 . GLU B  1 32  ? -8.687  45.723  109.613 1.00 88.62  ? 32   GLU B OE1 1 
ATOM   2420  O  OE2 . GLU B  1 32  ? -8.049  43.775  110.393 1.00 86.54  ? 32   GLU B OE2 1 
ATOM   2421  N  N   . PHE B  1 33  ? -3.399  43.747  108.099 1.00 77.00  ? 33   PHE B N   1 
ATOM   2422  C  CA  . PHE B  1 33  ? -2.773  42.459  107.825 1.00 76.09  ? 33   PHE B CA  1 
ATOM   2423  C  C   . PHE B  1 33  ? -2.174  41.840  109.078 1.00 74.36  ? 33   PHE B C   1 
ATOM   2424  O  O   . PHE B  1 33  ? -2.411  40.670  109.369 1.00 72.28  ? 33   PHE B O   1 
ATOM   2425  C  CB  . PHE B  1 33  ? -1.677  42.619  106.777 1.00 78.34  ? 33   PHE B CB  1 
ATOM   2426  C  CG  . PHE B  1 33  ? -0.906  41.356  106.509 1.00 79.67  ? 33   PHE B CG  1 
ATOM   2427  C  CD1 . PHE B  1 33  ? -1.444  40.350  105.715 1.00 80.06  ? 33   PHE B CD1 1 
ATOM   2428  C  CD2 . PHE B  1 33  ? 0.362   41.171  107.058 1.00 80.04  ? 33   PHE B CD2 1 
ATOM   2429  C  CE1 . PHE B  1 33  ? -0.729  39.175  105.470 1.00 80.53  ? 33   PHE B CE1 1 
ATOM   2430  C  CE2 . PHE B  1 33  ? 1.082   40.001  106.819 1.00 78.96  ? 33   PHE B CE2 1 
ATOM   2431  C  CZ  . PHE B  1 33  ? 0.535   39.002  106.024 1.00 79.25  ? 33   PHE B CZ  1 
ATOM   2432  N  N   . LEU B  1 34  ? -1.393  42.629  109.811 1.00 74.04  ? 34   LEU B N   1 
ATOM   2433  C  CA  . LEU B  1 34  ? -0.754  42.151  111.032 1.00 76.74  ? 34   LEU B CA  1 
ATOM   2434  C  C   . LEU B  1 34  ? -1.759  41.633  112.050 1.00 80.28  ? 34   LEU B C   1 
ATOM   2435  O  O   . LEU B  1 34  ? -1.519  40.619  112.713 1.00 81.78  ? 34   LEU B O   1 
ATOM   2436  C  CB  . LEU B  1 34  ? 0.071   43.259  111.687 1.00 74.38  ? 34   LEU B CB  1 
ATOM   2437  C  CG  . LEU B  1 34  ? 1.283   43.835  110.958 1.00 73.33  ? 34   LEU B CG  1 
ATOM   2438  C  CD1 . LEU B  1 34  ? 2.129   44.599  111.975 1.00 71.71  ? 34   LEU B CD1 1 
ATOM   2439  C  CD2 . LEU B  1 34  ? 2.106   42.723  110.313 1.00 72.49  ? 34   LEU B CD2 1 
ATOM   2440  N  N   . LYS B  1 35  ? -2.878  42.341  112.180 1.00 83.08  ? 35   LYS B N   1 
ATOM   2441  C  CA  . LYS B  1 35  ? -3.931  41.960  113.119 1.00 84.55  ? 35   LYS B CA  1 
ATOM   2442  C  C   . LYS B  1 35  ? -4.509  40.575  112.807 1.00 85.56  ? 35   LYS B C   1 
ATOM   2443  O  O   . LYS B  1 35  ? -4.590  39.716  113.688 1.00 85.47  ? 35   LYS B O   1 
ATOM   2444  C  CB  . LYS B  1 35  ? -5.040  43.017  113.107 1.00 84.28  ? 35   LYS B CB  1 
ATOM   2445  C  CG  . LYS B  1 35  ? -4.588  44.391  113.604 1.00 81.62  ? 35   LYS B CG  1 
ATOM   2446  C  CD  . LYS B  1 35  ? -5.733  45.387  113.576 1.00 80.98  ? 35   LYS B CD  1 
ATOM   2447  C  CE  . LYS B  1 35  ? -5.406  46.632  114.374 1.00 78.55  ? 35   LYS B CE  1 
ATOM   2448  N  NZ  . LYS B  1 35  ? -4.187  47.292  113.862 1.00 80.20  ? 35   LYS B NZ  1 
ATOM   2449  N  N   . ARG B  1 36  ? -4.903  40.359  111.555 1.00 86.80  ? 36   ARG B N   1 
ATOM   2450  C  CA  . ARG B  1 36  ? -5.449  39.069  111.144 1.00 88.42  ? 36   ARG B CA  1 
ATOM   2451  C  C   . ARG B  1 36  ? -4.331  38.099  110.786 1.00 89.16  ? 36   ARG B C   1 
ATOM   2452  O  O   . ARG B  1 36  ? -4.513  37.240  109.924 1.00 88.03  ? 36   ARG B O   1 
ATOM   2453  C  CB  . ARG B  1 36  ? -6.356  39.217  109.921 1.00 88.66  ? 36   ARG B CB  1 
ATOM   2454  C  CG  . ARG B  1 36  ? -7.517  40.162  110.088 1.00 89.20  ? 36   ARG B CG  1 
ATOM   2455  C  CD  . ARG B  1 36  ? -8.594  39.826  109.080 1.00 90.32  ? 36   ARG B CD  1 
ATOM   2456  N  NE  . ARG B  1 36  ? -9.616  40.862  109.018 1.00 94.30  ? 36   ARG B NE  1 
ATOM   2457  C  CZ  . ARG B  1 36  ? -9.517  41.961  108.278 1.00 94.93  ? 36   ARG B CZ  1 
ATOM   2458  N  NH1 . ARG B  1 36  ? -8.441  42.158  107.533 1.00 95.08  ? 36   ARG B NH1 1 
ATOM   2459  N  NH2 . ARG B  1 36  ? -10.490 42.864  108.287 1.00 96.59  ? 36   ARG B NH2 1 
ATOM   2460  N  N   . ASP B  1 37  ? -3.178  38.236  111.436 1.00 91.41  ? 37   ASP B N   1 
ATOM   2461  C  CA  . ASP B  1 37  ? -2.047  37.356  111.153 1.00 94.10  ? 37   ASP B CA  1 
ATOM   2462  C  C   . ASP B  1 37  ? -1.435  36.733  112.409 1.00 95.38  ? 37   ASP B C   1 
ATOM   2463  O  O   . ASP B  1 37  ? -0.214  36.653  112.552 1.00 94.35  ? 37   ASP B O   1 
ATOM   2464  C  CB  . ASP B  1 37  ? -0.972  38.117  110.369 1.00 94.93  ? 37   ASP B CB  1 
ATOM   2465  C  CG  . ASP B  1 37  ? 0.176   37.224  109.937 1.00 96.04  ? 37   ASP B CG  1 
ATOM   2466  O  OD1 . ASP B  1 37  ? -0.097  36.146  109.364 1.00 98.49  ? 37   ASP B OD1 1 
ATOM   2467  O  OD2 . ASP B  1 37  ? 1.348   37.599  110.164 1.00 94.00  ? 37   ASP B OD2 1 
ATOM   2468  N  N   . LYS B  1 38  ? -2.297  36.286  113.317 1.00 97.05  ? 38   LYS B N   1 
ATOM   2469  C  CA  . LYS B  1 38  ? -1.852  35.654  114.553 1.00 97.45  ? 38   LYS B CA  1 
ATOM   2470  C  C   . LYS B  1 38  ? -1.283  34.264  114.271 1.00 97.36  ? 38   LYS B C   1 
ATOM   2471  O  O   . LYS B  1 38  ? -0.253  34.122  113.609 1.00 96.35  ? 38   LYS B O   1 
ATOM   2472  C  CB  . LYS B  1 38  ? -3.021  35.550  115.538 1.00 96.86  ? 38   LYS B CB  1 
ATOM   2473  C  CG  . LYS B  1 38  ? -3.312  36.830  116.308 1.00 96.70  ? 38   LYS B CG  1 
ATOM   2474  C  CD  . LYS B  1 38  ? -2.208  37.115  117.317 1.00 96.31  ? 38   LYS B CD  1 
ATOM   2475  C  CE  . LYS B  1 38  ? -2.582  38.249  118.259 1.00 95.58  ? 38   LYS B CE  1 
ATOM   2476  N  NZ  . LYS B  1 38  ? -1.546  38.445  119.314 1.00 94.11  ? 38   LYS B NZ  1 
ATOM   2477  N  N   . GLN B  1 43  ? 4.375   32.005  115.807 1.00 116.30 ? 43   GLN B N   1 
ATOM   2478  C  CA  . GLN B  1 43  ? 5.719   32.182  115.273 1.00 117.03 ? 43   GLN B CA  1 
ATOM   2479  C  C   . GLN B  1 43  ? 6.257   33.573  115.615 1.00 117.15 ? 43   GLN B C   1 
ATOM   2480  O  O   . GLN B  1 43  ? 5.512   34.436  116.081 1.00 117.68 ? 43   GLN B O   1 
ATOM   2481  C  CB  . GLN B  1 43  ? 5.702   31.989  113.755 1.00 117.32 ? 43   GLN B CB  1 
ATOM   2482  C  CG  . GLN B  1 43  ? 7.059   32.154  113.090 1.00 118.45 ? 43   GLN B CG  1 
ATOM   2483  C  CD  . GLN B  1 43  ? 6.983   32.080  111.576 1.00 118.95 ? 43   GLN B CD  1 
ATOM   2484  O  OE1 . GLN B  1 43  ? 6.195   32.789  110.947 1.00 118.63 ? 43   GLN B OE1 1 
ATOM   2485  N  NE2 . GLN B  1 43  ? 7.812   31.226  110.982 1.00 118.55 ? 43   GLN B NE2 1 
ATOM   2486  N  N   . GLY B  1 44  ? 7.554   33.777  115.392 1.00 116.73 ? 44   GLY B N   1 
ATOM   2487  C  CA  . GLY B  1 44  ? 8.171   35.065  115.665 1.00 116.21 ? 44   GLY B CA  1 
ATOM   2488  C  C   . GLY B  1 44  ? 8.712   35.687  114.390 1.00 115.66 ? 44   GLY B C   1 
ATOM   2489  O  O   . GLY B  1 44  ? 9.522   36.615  114.423 1.00 114.44 ? 44   GLY B O   1 
ATOM   2490  N  N   . LEU B  1 45  ? 8.250   35.165  113.258 1.00 115.97 ? 45   LEU B N   1 
ATOM   2491  C  CA  . LEU B  1 45  ? 8.676   35.636  111.947 1.00 116.29 ? 45   LEU B CA  1 
ATOM   2492  C  C   . LEU B  1 45  ? 7.505   35.958  111.014 1.00 116.80 ? 45   LEU B C   1 
ATOM   2493  O  O   . LEU B  1 45  ? 7.448   35.454  109.890 1.00 116.90 ? 45   LEU B O   1 
ATOM   2494  C  CB  . LEU B  1 45  ? 9.565   34.583  111.280 1.00 116.39 ? 45   LEU B CB  1 
ATOM   2495  C  CG  . LEU B  1 45  ? 10.978  34.308  111.801 1.00 116.05 ? 45   LEU B CG  1 
ATOM   2496  C  CD1 . LEU B  1 45  ? 10.950  33.906  113.267 1.00 115.56 ? 45   LEU B CD1 1 
ATOM   2497  C  CD2 . LEU B  1 45  ? 11.594  33.201  110.959 1.00 115.77 ? 45   LEU B CD2 1 
ATOM   2498  N  N   . ARG B  1 46  ? 6.567   36.781  111.477 1.00 116.77 ? 46   ARG B N   1 
ATOM   2499  C  CA  . ARG B  1 46  ? 5.428   37.171  110.646 1.00 115.44 ? 46   ARG B CA  1 
ATOM   2500  C  C   . ARG B  1 46  ? 5.875   38.368  109.824 1.00 113.40 ? 46   ARG B C   1 
ATOM   2501  O  O   . ARG B  1 46  ? 5.239   38.744  108.837 1.00 112.21 ? 46   ARG B O   1 
ATOM   2502  C  CB  . ARG B  1 46  ? 4.217   37.544  111.508 1.00 116.83 ? 46   ARG B CB  1 
ATOM   2503  C  CG  . ARG B  1 46  ? 3.539   36.357  112.199 1.00 119.16 ? 46   ARG B CG  1 
ATOM   2504  C  CD  . ARG B  1 46  ? 3.031   35.317  111.197 1.00 119.88 ? 46   ARG B CD  1 
ATOM   2505  N  NE  . ARG B  1 46  ? 2.177   34.311  111.828 1.00 120.30 ? 46   ARG B NE  1 
ATOM   2506  C  CZ  . ARG B  1 46  ? 1.627   33.285  111.185 1.00 120.73 ? 46   ARG B CZ  1 
ATOM   2507  N  NH1 . ARG B  1 46  ? 1.842   33.122  109.887 1.00 120.80 ? 46   ARG B NH1 1 
ATOM   2508  N  NH2 . ARG B  1 46  ? 0.854   32.424  111.836 1.00 119.63 ? 46   ARG B NH2 1 
ATOM   2509  N  N   . ALA B  1 47  ? 6.987   38.958  110.255 1.00 111.43 ? 47   ALA B N   1 
ATOM   2510  C  CA  . ALA B  1 47  ? 7.584   40.096  109.572 1.00 110.10 ? 47   ALA B CA  1 
ATOM   2511  C  C   . ALA B  1 47  ? 8.125   39.558  108.258 1.00 108.40 ? 47   ALA B C   1 
ATOM   2512  O  O   . ALA B  1 47  ? 8.623   40.299  107.410 1.00 108.47 ? 47   ALA B O   1 
ATOM   2513  C  CB  . ALA B  1 47  ? 8.717   40.675  110.406 1.00 109.97 ? 47   ALA B CB  1 
ATOM   2514  N  N   . ASN B  1 48  ? 8.031   38.245  108.111 1.00 105.94 ? 48   ASN B N   1 
ATOM   2515  C  CA  . ASN B  1 48  ? 8.489   37.578  106.912 1.00 103.71 ? 48   ASN B CA  1 
ATOM   2516  C  C   . ASN B  1 48  ? 7.330   37.657  105.929 1.00 101.34 ? 48   ASN B C   1 
ATOM   2517  O  O   . ASN B  1 48  ? 7.478   38.144  104.807 1.00 100.24 ? 48   ASN B O   1 
ATOM   2518  C  CB  . ASN B  1 48  ? 8.833   36.118  107.227 1.00 105.60 ? 48   ASN B CB  1 
ATOM   2519  C  CG  . ASN B  1 48  ? 9.854   35.980  108.364 1.00 106.82 ? 48   ASN B CG  1 
ATOM   2520  O  OD1 . ASN B  1 48  ? 10.333  34.880  108.652 1.00 106.10 ? 48   ASN B OD1 1 
ATOM   2521  N  ND2 . ASN B  1 48  ? 10.182  37.095  109.012 1.00 107.32 ? 48   ASN B ND2 1 
ATOM   2522  N  N   . LEU B  1 49  ? 6.169   37.192  106.376 1.00 98.56  ? 49   LEU B N   1 
ATOM   2523  C  CA  . LEU B  1 49  ? 4.967   37.210  105.556 1.00 95.85  ? 49   LEU B CA  1 
ATOM   2524  C  C   . LEU B  1 49  ? 4.616   38.638  105.156 1.00 93.87  ? 49   LEU B C   1 
ATOM   2525  O  O   . LEU B  1 49  ? 4.164   38.882  104.036 1.00 93.85  ? 49   LEU B O   1 
ATOM   2526  C  CB  . LEU B  1 49  ? 3.803   36.588  106.326 1.00 95.04  ? 49   LEU B CB  1 
ATOM   2527  C  CG  . LEU B  1 49  ? 3.979   35.112  106.679 1.00 94.39  ? 49   LEU B CG  1 
ATOM   2528  C  CD1 . LEU B  1 49  ? 2.877   34.676  107.621 1.00 94.26  ? 49   LEU B CD1 1 
ATOM   2529  C  CD2 . LEU B  1 49  ? 3.963   34.282  105.409 1.00 93.84  ? 49   LEU B CD2 1 
ATOM   2530  N  N   . THR B  1 50  ? 4.832   39.576  106.073 1.00 90.80  ? 50   THR B N   1 
ATOM   2531  C  CA  . THR B  1 50  ? 4.535   40.980  105.812 1.00 88.07  ? 50   THR B CA  1 
ATOM   2532  C  C   . THR B  1 50  ? 5.244   41.438  104.533 1.00 87.65  ? 50   THR B C   1 
ATOM   2533  O  O   . THR B  1 50  ? 4.791   42.356  103.851 1.00 87.51  ? 50   THR B O   1 
ATOM   2534  C  CB  . THR B  1 50  ? 4.972   41.871  107.007 1.00 86.71  ? 50   THR B CB  1 
ATOM   2535  O  OG1 . THR B  1 50  ? 4.087   42.992  107.123 1.00 84.22  ? 50   THR B OG1 1 
ATOM   2536  C  CG2 . THR B  1 50  ? 6.387   42.385  106.809 1.00 86.66  ? 50   THR B CG2 1 
ATOM   2537  N  N   . SER B  1 51  ? 6.357   40.785  104.211 1.00 87.04  ? 51   SER B N   1 
ATOM   2538  C  CA  . SER B  1 51  ? 7.124   41.108  103.012 1.00 84.97  ? 51   SER B CA  1 
ATOM   2539  C  C   . SER B  1 51  ? 6.403   40.585  101.777 1.00 83.91  ? 51   SER B C   1 
ATOM   2540  O  O   . SER B  1 51  ? 6.119   41.335  100.845 1.00 81.84  ? 51   SER B O   1 
ATOM   2541  C  CB  . SER B  1 51  ? 8.516   40.473  103.084 1.00 84.78  ? 51   SER B CB  1 
ATOM   2542  O  OG  . SER B  1 51  ? 9.225   40.920  104.225 1.00 82.08  ? 51   SER B OG  1 
ATOM   2543  N  N   . ALA B  1 52  ? 6.107   39.288  101.791 1.00 84.51  ? 52   ALA B N   1 
ATOM   2544  C  CA  . ALA B  1 52  ? 5.430   38.623  100.683 1.00 85.56  ? 52   ALA B CA  1 
ATOM   2545  C  C   . ALA B  1 52  ? 4.038   39.193  100.443 1.00 85.68  ? 52   ALA B C   1 
ATOM   2546  O  O   . ALA B  1 52  ? 3.319   38.745  99.548  1.00 87.54  ? 52   ALA B O   1 
ATOM   2547  C  CB  . ALA B  1 52  ? 5.340   37.122  100.954 1.00 84.87  ? 52   ALA B CB  1 
ATOM   2548  N  N   . ILE B  1 53  ? 3.666   40.182  101.248 1.00 83.89  ? 53   ILE B N   1 
ATOM   2549  C  CA  . ILE B  1 53  ? 2.359   40.818  101.134 1.00 82.08  ? 53   ILE B CA  1 
ATOM   2550  C  C   . ILE B  1 53  ? 2.511   42.266  100.686 1.00 80.69  ? 53   ILE B C   1 
ATOM   2551  O  O   . ILE B  1 53  ? 1.718   42.783  99.894  1.00 77.58  ? 53   ILE B O   1 
ATOM   2552  C  CB  . ILE B  1 53  ? 1.613   40.759  102.487 1.00 81.84  ? 53   ILE B CB  1 
ATOM   2553  C  CG1 . ILE B  1 53  ? 0.627   39.588  102.476 1.00 82.23  ? 53   ILE B CG1 1 
ATOM   2554  C  CG2 . ILE B  1 53  ? 0.903   42.071  102.763 1.00 81.89  ? 53   ILE B CG2 1 
ATOM   2555  C  CD1 . ILE B  1 53  ? 1.271   38.237  102.201 1.00 81.86  ? 53   ILE B CD1 1 
ATOM   2556  N  N   . GLU B  1 54  ? 3.541   42.914  101.209 1.00 79.61  ? 54   GLU B N   1 
ATOM   2557  C  CA  . GLU B  1 54  ? 3.830   44.289  100.867 1.00 78.04  ? 54   GLU B CA  1 
ATOM   2558  C  C   . GLU B  1 54  ? 4.159   44.341  99.375  1.00 77.05  ? 54   GLU B C   1 
ATOM   2559  O  O   . GLU B  1 54  ? 4.190   45.409  98.771  1.00 76.73  ? 54   GLU B O   1 
ATOM   2560  C  CB  . GLU B  1 54  ? 5.017   44.766  101.693 1.00 79.10  ? 54   GLU B CB  1 
ATOM   2561  C  CG  . GLU B  1 54  ? 5.222   46.259  101.710 1.00 83.48  ? 54   GLU B CG  1 
ATOM   2562  C  CD  . GLU B  1 54  ? 6.277   46.669  102.721 1.00 87.24  ? 54   GLU B CD  1 
ATOM   2563  O  OE1 . GLU B  1 54  ? 6.144   46.269  103.901 1.00 88.18  ? 54   GLU B OE1 1 
ATOM   2564  O  OE2 . GLU B  1 54  ? 7.235   47.386  102.344 1.00 88.03  ? 54   GLU B OE2 1 
ATOM   2565  N  N   . THR B  1 55  ? 4.400   43.171  98.788  1.00 76.40  ? 55   THR B N   1 
ATOM   2566  C  CA  . THR B  1 55  ? 4.733   43.069  97.370  1.00 73.17  ? 55   THR B CA  1 
ATOM   2567  C  C   . THR B  1 55  ? 3.481   42.914  96.520  1.00 69.78  ? 55   THR B C   1 
ATOM   2568  O  O   . THR B  1 55  ? 3.418   43.416  95.405  1.00 68.95  ? 55   THR B O   1 
ATOM   2569  C  CB  . THR B  1 55  ? 5.690   41.875  97.100  1.00 76.24  ? 55   THR B CB  1 
ATOM   2570  O  OG1 . THR B  1 55  ? 6.975   42.144  97.682  1.00 75.06  ? 55   THR B OG1 1 
ATOM   2571  C  CG2 . THR B  1 55  ? 5.865   41.649  95.598  1.00 78.37  ? 55   THR B CG2 1 
ATOM   2572  N  N   . LEU B  1 56  ? 2.484   42.213  97.042  1.00 68.97  ? 56   LEU B N   1 
ATOM   2573  C  CA  . LEU B  1 56  ? 1.241   42.032  96.303  1.00 67.00  ? 56   LEU B CA  1 
ATOM   2574  C  C   . LEU B  1 56  ? 0.625   43.400  96.030  1.00 64.43  ? 56   LEU B C   1 
ATOM   2575  O  O   . LEU B  1 56  ? 0.176   43.674  94.924  1.00 63.18  ? 56   LEU B O   1 
ATOM   2576  C  CB  . LEU B  1 56  ? 0.284   41.154  97.100  1.00 69.25  ? 56   LEU B CB  1 
ATOM   2577  C  CG  . LEU B  1 56  ? 0.893   39.777  97.371  1.00 72.16  ? 56   LEU B CG  1 
ATOM   2578  C  CD1 . LEU B  1 56  ? 0.115   39.085  98.475  1.00 74.72  ? 56   LEU B CD1 1 
ATOM   2579  C  CD2 . LEU B  1 56  ? 0.905   38.950  96.082  1.00 73.17  ? 56   LEU B CD2 1 
ATOM   2580  N  N   . CYS B  1 57  ? 0.600   44.262  97.038  1.00 61.61  ? 57   CYS B N   1 
ATOM   2581  C  CA  . CYS B  1 57  ? 0.071   45.595  96.831  1.00 60.79  ? 57   CYS B CA  1 
ATOM   2582  C  C   . CYS B  1 57  ? 1.063   46.294  95.908  1.00 62.23  ? 57   CYS B C   1 
ATOM   2583  O  O   . CYS B  1 57  ? 0.682   46.858  94.883  1.00 60.26  ? 57   CYS B O   1 
ATOM   2584  C  CB  . CYS B  1 57  ? -0.027  46.361  98.153  1.00 59.24  ? 57   CYS B CB  1 
ATOM   2585  S  SG  . CYS B  1 57  ? -1.338  45.834  99.271  1.00 61.83  ? 57   CYS B SG  1 
ATOM   2586  N  N   . GLY B  1 58  ? 2.339   46.233  96.288  1.00 64.93  ? 58   GLY B N   1 
ATOM   2587  C  CA  . GLY B  1 58  ? 3.403   46.853  95.518  1.00 69.31  ? 58   GLY B CA  1 
ATOM   2588  C  C   . GLY B  1 58  ? 3.154   46.813  94.024  1.00 73.72  ? 58   GLY B C   1 
ATOM   2589  O  O   . GLY B  1 58  ? 3.468   47.772  93.318  1.00 74.45  ? 58   GLY B O   1 
ATOM   2590  N  N   . VAL B  1 59  ? 2.596   45.708  93.532  1.00 76.86  ? 59   VAL B N   1 
ATOM   2591  C  CA  . VAL B  1 59  ? 2.306   45.602  92.111  1.00 80.59  ? 59   VAL B CA  1 
ATOM   2592  C  C   . VAL B  1 59  ? 1.052   46.416  91.810  1.00 82.70  ? 59   VAL B C   1 
ATOM   2593  O  O   . VAL B  1 59  ? -0.006  45.876  91.449  1.00 82.43  ? 59   VAL B O   1 
ATOM   2594  C  CB  . VAL B  1 59  ? 2.114   44.124  91.649  1.00 83.77  ? 59   VAL B CB  1 
ATOM   2595  C  CG1 . VAL B  1 59  ? 0.923   43.487  92.349  1.00 84.86  ? 59   VAL B CG1 1 
ATOM   2596  C  CG2 . VAL B  1 59  ? 1.934   44.072  90.130  1.00 84.39  ? 59   VAL B CG2 1 
ATOM   2597  N  N   . ASP B  1 60  ? 1.195   47.729  92.000  1.00 83.84  ? 60   ASP B N   1 
ATOM   2598  C  CA  . ASP B  1 60  ? 0.144   48.718  91.743  1.00 82.24  ? 60   ASP B CA  1 
ATOM   2599  C  C   . ASP B  1 60  ? 0.830   50.027  91.363  1.00 79.07  ? 60   ASP B C   1 
ATOM   2600  O  O   . ASP B  1 60  ? 1.411   50.692  92.218  1.00 79.40  ? 60   ASP B O   1 
ATOM   2601  C  CB  . ASP B  1 60  ? -0.720  48.951  92.980  1.00 82.62  ? 60   ASP B CB  1 
ATOM   2602  C  CG  . ASP B  1 60  ? -1.819  49.957  92.722  1.00 85.02  ? 60   ASP B CG  1 
ATOM   2603  O  OD1 . ASP B  1 60  ? -2.682  49.662  91.864  1.00 86.02  ? 60   ASP B OD1 1 
ATOM   2604  O  OD2 . ASP B  1 60  ? -1.814  51.037  93.360  1.00 83.62  ? 60   ASP B OD2 1 
ATOM   2605  N  N   . SER B  1 61  ? 0.760   50.379  90.083  1.00 75.56  ? 61   SER B N   1 
ATOM   2606  C  CA  . SER B  1 61  ? 1.380   51.589  89.541  1.00 73.59  ? 61   SER B CA  1 
ATOM   2607  C  C   . SER B  1 61  ? 1.860   52.626  90.574  1.00 71.21  ? 61   SER B C   1 
ATOM   2608  O  O   . SER B  1 61  ? 3.042   52.973  90.603  1.00 71.46  ? 61   SER B O   1 
ATOM   2609  C  CB  . SER B  1 61  ? 0.423   52.251  88.542  1.00 73.60  ? 61   SER B CB  1 
ATOM   2610  O  OG  . SER B  1 61  ? 1.086   53.240  87.771  1.00 74.96  ? 61   SER B OG  1 
ATOM   2611  N  N   . SER B  1 62  ? 0.943   53.103  91.417  1.00 68.56  ? 62   SER B N   1 
ATOM   2612  C  CA  . SER B  1 62  ? 1.221   54.108  92.458  1.00 63.36  ? 62   SER B CA  1 
ATOM   2613  C  C   . SER B  1 62  ? 2.661   54.124  92.987  1.00 59.09  ? 62   SER B C   1 
ATOM   2614  O  O   . SER B  1 62  ? 3.088   53.202  93.683  1.00 59.25  ? 62   SER B O   1 
ATOM   2615  C  CB  . SER B  1 62  ? 0.262   53.911  93.646  1.00 65.84  ? 62   SER B CB  1 
ATOM   2616  O  OG  . SER B  1 62  ? -1.069  53.606  93.232  1.00 69.31  ? 62   SER B OG  1 
ATOM   2617  N  N   . VAL B  1 63  ? 3.401   55.182  92.665  1.00 52.96  ? 63   VAL B N   1 
ATOM   2618  C  CA  . VAL B  1 63  ? 4.782   55.313  93.118  1.00 47.07  ? 63   VAL B CA  1 
ATOM   2619  C  C   . VAL B  1 63  ? 4.849   55.319  94.642  1.00 45.83  ? 63   VAL B C   1 
ATOM   2620  O  O   . VAL B  1 63  ? 5.775   54.769  95.230  1.00 48.34  ? 63   VAL B O   1 
ATOM   2621  C  CB  . VAL B  1 63  ? 5.423   56.632  92.619  1.00 47.08  ? 63   VAL B CB  1 
ATOM   2622  C  CG1 . VAL B  1 63  ? 6.829   56.764  93.156  1.00 43.28  ? 63   VAL B CG1 1 
ATOM   2623  C  CG2 . VAL B  1 63  ? 5.429   56.679  91.110  1.00 46.42  ? 63   VAL B CG2 1 
ATOM   2624  N  N   . ALA B  1 64  ? 3.866   55.950  95.276  1.00 42.68  ? 64   ALA B N   1 
ATOM   2625  C  CA  . ALA B  1 64  ? 3.834   56.042  96.728  1.00 40.38  ? 64   ALA B CA  1 
ATOM   2626  C  C   . ALA B  1 64  ? 3.529   54.723  97.429  1.00 41.48  ? 64   ALA B C   1 
ATOM   2627  O  O   . ALA B  1 64  ? 3.805   54.583  98.621  1.00 42.37  ? 64   ALA B O   1 
ATOM   2628  C  CB  . ALA B  1 64  ? 2.832   57.103  97.164  1.00 39.59  ? 64   ALA B CB  1 
ATOM   2629  N  N   . VAL B  1 65  ? 2.964   53.751  96.719  1.00 40.85  ? 65   VAL B N   1 
ATOM   2630  C  CA  . VAL B  1 65  ? 2.675   52.481  97.373  1.00 42.02  ? 65   VAL B CA  1 
ATOM   2631  C  C   . VAL B  1 65  ? 3.984   51.810  97.786  1.00 45.32  ? 65   VAL B C   1 
ATOM   2632  O  O   . VAL B  1 65  ? 4.067   51.197  98.848  1.00 46.04  ? 65   VAL B O   1 
ATOM   2633  C  CB  . VAL B  1 65  ? 1.856   51.531  96.462  1.00 42.42  ? 65   VAL B CB  1 
ATOM   2634  C  CG1 . VAL B  1 65  ? 1.749   50.136  97.100  1.00 35.12  ? 65   VAL B CG1 1 
ATOM   2635  C  CG2 . VAL B  1 65  ? 0.458   52.109  96.247  1.00 37.72  ? 65   VAL B CG2 1 
ATOM   2636  N  N   . SER B  1 66  ? 5.019   51.960  96.967  1.00 49.28  ? 66   SER B N   1 
ATOM   2637  C  CA  . SER B  1 66  ? 6.317   51.350  97.263  1.00 50.47  ? 66   SER B CA  1 
ATOM   2638  C  C   . SER B  1 66  ? 7.104   52.084  98.351  1.00 48.28  ? 66   SER B C   1 
ATOM   2639  O  O   . SER B  1 66  ? 7.509   51.482  99.344  1.00 48.26  ? 66   SER B O   1 
ATOM   2640  C  CB  . SER B  1 66  ? 7.161   51.262  95.984  1.00 53.44  ? 66   SER B CB  1 
ATOM   2641  O  OG  . SER B  1 66  ? 8.342   50.513  96.212  1.00 55.64  ? 66   SER B OG  1 
ATOM   2642  N  N   . SER B  1 67  ? 7.331   53.379  98.166  1.00 47.46  ? 67   SER B N   1 
ATOM   2643  C  CA  . SER B  1 67  ? 8.071   54.154  99.160  1.00 47.28  ? 67   SER B CA  1 
ATOM   2644  C  C   . SER B  1 67  ? 7.326   54.195  100.500 1.00 45.39  ? 67   SER B C   1 
ATOM   2645  O  O   . SER B  1 67  ? 7.935   54.063  101.567 1.00 44.59  ? 67   SER B O   1 
ATOM   2646  C  CB  . SER B  1 67  ? 8.340   55.582  98.641  1.00 48.31  ? 67   SER B CB  1 
ATOM   2647  O  OG  . SER B  1 67  ? 7.167   56.227  98.162  1.00 47.70  ? 67   SER B OG  1 
ATOM   2648  N  N   . GLY B  1 68  ? 6.008   54.367  100.437 1.00 43.95  ? 68   GLY B N   1 
ATOM   2649  C  CA  . GLY B  1 68  ? 5.204   54.409  101.645 1.00 40.96  ? 68   GLY B CA  1 
ATOM   2650  C  C   . GLY B  1 68  ? 5.251   53.077  102.365 1.00 40.12  ? 68   GLY B C   1 
ATOM   2651  O  O   . GLY B  1 68  ? 5.410   53.028  103.584 1.00 37.04  ? 68   GLY B O   1 
ATOM   2652  N  N   . GLY B  1 69  ? 5.093   51.996  101.605 1.00 41.21  ? 69   GLY B N   1 
ATOM   2653  C  CA  . GLY B  1 69  ? 5.149   50.665  102.178 1.00 43.72  ? 69   GLY B CA  1 
ATOM   2654  C  C   . GLY B  1 69  ? 6.536   50.432  102.746 1.00 46.40  ? 69   GLY B C   1 
ATOM   2655  O  O   . GLY B  1 69  ? 6.686   49.992  103.895 1.00 44.60  ? 69   GLY B O   1 
ATOM   2656  N  N   . GLU B  1 70  ? 7.556   50.745  101.946 1.00 48.07  ? 70   GLU B N   1 
ATOM   2657  C  CA  . GLU B  1 70  ? 8.940   50.578  102.380 1.00 51.53  ? 70   GLU B CA  1 
ATOM   2658  C  C   . GLU B  1 70  ? 9.144   51.349  103.678 1.00 47.73  ? 70   GLU B C   1 
ATOM   2659  O  O   . GLU B  1 70  ? 9.684   50.820  104.643 1.00 46.08  ? 70   GLU B O   1 
ATOM   2660  C  CB  . GLU B  1 70  ? 9.922   51.075  101.299 1.00 58.22  ? 70   GLU B CB  1 
ATOM   2661  C  CG  . GLU B  1 70  ? 11.409  51.028  101.719 1.00 67.10  ? 70   GLU B CG  1 
ATOM   2662  C  CD  . GLU B  1 70  ? 12.386  51.299  100.568 1.00 72.77  ? 70   GLU B CD  1 
ATOM   2663  O  OE1 . GLU B  1 70  ? 12.166  52.265  99.802  1.00 75.34  ? 70   GLU B OE1 1 
ATOM   2664  O  OE2 . GLU B  1 70  ? 13.385  50.553  100.439 1.00 73.40  ? 70   GLU B OE2 1 
ATOM   2665  N  N   . LEU B  1 71  ? 8.694   52.597  103.702 1.00 46.29  ? 71   LEU B N   1 
ATOM   2666  C  CA  . LEU B  1 71  ? 8.831   53.423  104.897 1.00 48.14  ? 71   LEU B CA  1 
ATOM   2667  C  C   . LEU B  1 71  ? 8.111   52.838  106.095 1.00 48.63  ? 71   LEU B C   1 
ATOM   2668  O  O   . LEU B  1 71  ? 8.590   52.926  107.220 1.00 47.72  ? 71   LEU B O   1 
ATOM   2669  C  CB  . LEU B  1 71  ? 8.291   54.827  104.640 1.00 48.16  ? 71   LEU B CB  1 
ATOM   2670  C  CG  . LEU B  1 71  ? 9.176   55.712  103.773 1.00 48.45  ? 71   LEU B CG  1 
ATOM   2671  C  CD1 . LEU B  1 71  ? 8.474   57.032  103.503 1.00 49.33  ? 71   LEU B CD1 1 
ATOM   2672  C  CD2 . LEU B  1 71  ? 10.498  55.923  104.482 1.00 43.69  ? 71   LEU B CD2 1 
ATOM   2673  N  N   . PHE B  1 72  ? 6.945   52.253  105.839 1.00 52.11  ? 72   PHE B N   1 
ATOM   2674  C  CA  . PHE B  1 72  ? 6.127   51.654  106.877 1.00 53.20  ? 72   PHE B CA  1 
ATOM   2675  C  C   . PHE B  1 72  ? 6.826   50.463  107.519 1.00 56.20  ? 72   PHE B C   1 
ATOM   2676  O  O   . PHE B  1 72  ? 6.877   50.361  108.747 1.00 56.55  ? 72   PHE B O   1 
ATOM   2677  C  CB  . PHE B  1 72  ? 4.784   51.208  106.285 1.00 53.89  ? 72   PHE B CB  1 
ATOM   2678  C  CG  . PHE B  1 72  ? 3.932   50.412  107.240 1.00 49.72  ? 72   PHE B CG  1 
ATOM   2679  C  CD1 . PHE B  1 72  ? 3.389   51.006  108.368 1.00 46.90  ? 72   PHE B CD1 1 
ATOM   2680  C  CD2 . PHE B  1 72  ? 3.705   49.058  107.021 1.00 46.44  ? 72   PHE B CD2 1 
ATOM   2681  C  CE1 . PHE B  1 72  ? 2.639   50.265  109.262 1.00 47.79  ? 72   PHE B CE1 1 
ATOM   2682  C  CE2 . PHE B  1 72  ? 2.954   48.312  107.915 1.00 45.42  ? 72   PHE B CE2 1 
ATOM   2683  C  CZ  . PHE B  1 72  ? 2.422   48.913  109.033 1.00 44.24  ? 72   PHE B CZ  1 
ATOM   2684  N  N   . LEU B  1 73  ? 7.360   49.567  106.682 1.00 58.43  ? 73   LEU B N   1 
ATOM   2685  C  CA  . LEU B  1 73  ? 8.044   48.365  107.161 1.00 57.91  ? 73   LEU B CA  1 
ATOM   2686  C  C   . LEU B  1 73  ? 9.374   48.663  107.841 1.00 58.48  ? 73   LEU B C   1 
ATOM   2687  O  O   . LEU B  1 73  ? 9.794   47.917  108.722 1.00 60.67  ? 73   LEU B O   1 
ATOM   2688  C  CB  . LEU B  1 73  ? 8.244   47.371  106.012 1.00 56.48  ? 73   LEU B CB  1 
ATOM   2689  C  CG  . LEU B  1 73  ? 8.937   46.018  106.268 1.00 59.38  ? 73   LEU B CG  1 
ATOM   2690  C  CD1 . LEU B  1 73  ? 10.443  46.190  106.141 1.00 59.01  ? 73   LEU B CD1 1 
ATOM   2691  C  CD2 . LEU B  1 73  ? 8.549   45.439  107.636 1.00 55.19  ? 73   LEU B CD2 1 
ATOM   2692  N  N   . ARG B  1 74  ? 10.044  49.742  107.444 1.00 58.20  ? 74   ARG B N   1 
ATOM   2693  C  CA  . ARG B  1 74  ? 11.308  50.088  108.090 1.00 57.08  ? 74   ARG B CA  1 
ATOM   2694  C  C   . ARG B  1 74  ? 10.984  50.532  109.508 1.00 56.31  ? 74   ARG B C   1 
ATOM   2695  O  O   . ARG B  1 74  ? 11.552  50.023  110.474 1.00 56.15  ? 74   ARG B O   1 
ATOM   2696  C  CB  . ARG B  1 74  ? 12.032  51.235  107.367 1.00 53.98  ? 74   ARG B CB  1 
ATOM   2697  C  CG  . ARG B  1 74  ? 12.469  50.928  105.944 1.00 52.46  ? 74   ARG B CG  1 
ATOM   2698  C  CD  . ARG B  1 74  ? 13.197  52.118  105.326 1.00 51.89  ? 74   ARG B CD  1 
ATOM   2699  N  NE  . ARG B  1 74  ? 14.652  52.063  105.495 1.00 51.41  ? 74   ARG B NE  1 
ATOM   2700  C  CZ  . ARG B  1 74  ? 15.490  51.487  104.633 1.00 51.14  ? 74   ARG B CZ  1 
ATOM   2701  N  NH1 . ARG B  1 74  ? 15.033  50.912  103.527 1.00 53.40  ? 74   ARG B NH1 1 
ATOM   2702  N  NH2 . ARG B  1 74  ? 16.789  51.481  104.877 1.00 51.93  ? 74   ARG B NH2 1 
ATOM   2703  N  N   . PHE B  1 75  ? 10.043  51.463  109.619 1.00 55.92  ? 75   PHE B N   1 
ATOM   2704  C  CA  . PHE B  1 75  ? 9.641   52.022  110.903 1.00 60.15  ? 75   PHE B CA  1 
ATOM   2705  C  C   . PHE B  1 75  ? 9.177   50.995  111.941 1.00 64.30  ? 75   PHE B C   1 
ATOM   2706  O  O   . PHE B  1 75  ? 8.844   51.350  113.075 1.00 64.06  ? 75   PHE B O   1 
ATOM   2707  C  CB  . PHE B  1 75  ? 8.549   53.067  110.680 1.00 57.73  ? 75   PHE B CB  1 
ATOM   2708  C  CG  . PHE B  1 75  ? 8.162   53.805  111.923 1.00 57.27  ? 75   PHE B CG  1 
ATOM   2709  C  CD1 . PHE B  1 75  ? 9.074   54.633  112.563 1.00 58.03  ? 75   PHE B CD1 1 
ATOM   2710  C  CD2 . PHE B  1 75  ? 6.894   53.647  112.474 1.00 57.34  ? 75   PHE B CD2 1 
ATOM   2711  C  CE1 . PHE B  1 75  ? 8.729   55.294  113.739 1.00 59.88  ? 75   PHE B CE1 1 
ATOM   2712  C  CE2 . PHE B  1 75  ? 6.538   54.297  113.641 1.00 56.61  ? 75   PHE B CE2 1 
ATOM   2713  C  CZ  . PHE B  1 75  ? 7.456   55.125  114.280 1.00 59.32  ? 75   PHE B CZ  1 
ATOM   2714  N  N   . ILE B  1 76  ? 9.163   49.722  111.557 1.00 69.11  ? 76   ILE B N   1 
ATOM   2715  C  CA  . ILE B  1 76  ? 8.742   48.658  112.464 1.00 71.74  ? 76   ILE B CA  1 
ATOM   2716  C  C   . ILE B  1 76  ? 9.839   47.599  112.684 1.00 72.72  ? 76   ILE B C   1 
ATOM   2717  O  O   . ILE B  1 76  ? 10.054  46.707  111.852 1.00 69.11  ? 76   ILE B O   1 
ATOM   2718  C  CB  . ILE B  1 76  ? 7.447   47.999  111.944 1.00 71.96  ? 76   ILE B CB  1 
ATOM   2719  C  CG1 . ILE B  1 76  ? 6.355   49.063  111.806 1.00 71.15  ? 76   ILE B CG1 1 
ATOM   2720  C  CG2 . ILE B  1 76  ? 6.984   46.929  112.902 1.00 72.78  ? 76   ILE B CG2 1 
ATOM   2721  C  CD1 . ILE B  1 76  ? 5.027   48.522  111.322 1.00 71.04  ? 76   ILE B CD1 1 
ATOM   2722  N  N   . SER B  1 77  ? 10.521  47.737  113.823 1.00 75.53  ? 77   SER B N   1 
ATOM   2723  C  CA  . SER B  1 77  ? 11.623  46.872  114.277 1.00 78.14  ? 77   SER B CA  1 
ATOM   2724  C  C   . SER B  1 77  ? 11.907  45.604  113.469 1.00 79.56  ? 77   SER B C   1 
ATOM   2725  O  O   . SER B  1 77  ? 12.733  44.772  113.876 1.00 79.58  ? 77   SER B O   1 
ATOM   2726  C  CB  . SER B  1 77  ? 11.398  46.481  115.744 1.00 77.58  ? 77   SER B CB  1 
ATOM   2727  O  OG  . SER B  1 77  ? 11.314  47.628  116.575 1.00 76.61  ? 77   SER B OG  1 
ATOM   2728  N  N   . SER B  1 87  ? 6.958   34.237  120.269 1.00 118.22 ? 87   SER B N   1 
ATOM   2729  C  CA  . SER B  1 87  ? 7.273   35.637  120.518 1.00 117.60 ? 87   SER B CA  1 
ATOM   2730  C  C   . SER B  1 87  ? 6.248   36.574  119.881 1.00 117.15 ? 87   SER B C   1 
ATOM   2731  O  O   . SER B  1 87  ? 6.609   37.594  119.293 1.00 116.67 ? 87   SER B O   1 
ATOM   2732  C  CB  . SER B  1 87  ? 8.676   35.967  119.991 1.00 118.08 ? 87   SER B CB  1 
ATOM   2733  O  OG  . SER B  1 87  ? 8.770   35.743  118.594 1.00 117.63 ? 87   SER B OG  1 
ATOM   2734  N  N   . LYS B  1 88  ? 4.969   36.219  119.991 1.00 116.60 ? 88   LYS B N   1 
ATOM   2735  C  CA  . LYS B  1 88  ? 3.894   37.048  119.453 1.00 115.55 ? 88   LYS B CA  1 
ATOM   2736  C  C   . LYS B  1 88  ? 3.740   38.268  120.351 1.00 115.58 ? 88   LYS B C   1 
ATOM   2737  O  O   . LYS B  1 88  ? 2.714   38.949  120.328 1.00 115.27 ? 88   LYS B O   1 
ATOM   2738  C  CB  . LYS B  1 88  ? 2.577   36.271  119.412 1.00 114.99 ? 88   LYS B CB  1 
ATOM   2739  C  CG  . LYS B  1 88  ? 2.454   35.307  118.246 1.00 115.12 ? 88   LYS B CG  1 
ATOM   2740  C  CD  . LYS B  1 88  ? 2.299   36.045  116.926 1.00 113.54 ? 88   LYS B CD  1 
ATOM   2741  C  CE  . LYS B  1 88  ? 2.121   35.068  115.778 1.00 113.61 ? 88   LYS B CE  1 
ATOM   2742  N  NZ  . LYS B  1 88  ? 0.975   34.146  116.013 1.00 112.19 ? 88   LYS B NZ  1 
ATOM   2743  N  N   . CYS B  1 89  ? 4.770   38.518  121.156 1.00 116.02 ? 89   CYS B N   1 
ATOM   2744  C  CA  . CYS B  1 89  ? 4.811   39.655  122.067 1.00 116.17 ? 89   CYS B CA  1 
ATOM   2745  C  C   . CYS B  1 89  ? 5.234   40.865  121.249 1.00 115.93 ? 89   CYS B C   1 
ATOM   2746  O  O   . CYS B  1 89  ? 5.208   42.004  121.723 1.00 115.96 ? 89   CYS B O   1 
ATOM   2747  C  CB  . CYS B  1 89  ? 5.820   39.393  123.191 1.00 117.51 ? 89   CYS B CB  1 
ATOM   2748  S  SG  . CYS B  1 89  ? 7.424   38.734  122.642 1.00 119.53 ? 89   CYS B SG  1 
ATOM   2749  N  N   . LYS B  1 90  ? 5.633   40.588  120.011 1.00 115.55 ? 90   LYS B N   1 
ATOM   2750  C  CA  . LYS B  1 90  ? 6.053   41.615  119.071 1.00 113.94 ? 90   LYS B CA  1 
ATOM   2751  C  C   . LYS B  1 90  ? 4.786   42.171  118.436 1.00 113.40 ? 90   LYS B C   1 
ATOM   2752  O  O   . LYS B  1 90  ? 4.591   42.097  117.225 1.00 111.96 ? 90   LYS B O   1 
ATOM   2753  C  CB  . LYS B  1 90  ? 6.953   41.010  117.992 1.00 113.28 ? 90   LYS B CB  1 
ATOM   2754  C  CG  . LYS B  1 90  ? 8.160   40.262  118.529 1.00 113.36 ? 90   LYS B CG  1 
ATOM   2755  C  CD  . LYS B  1 90  ? 8.841   39.474  117.419 1.00 114.09 ? 90   LYS B CD  1 
ATOM   2756  C  CE  . LYS B  1 90  ? 10.017  38.658  117.937 1.00 114.47 ? 90   LYS B CE  1 
ATOM   2757  N  NZ  . LYS B  1 90  ? 10.656  37.873  116.842 1.00 113.66 ? 90   LYS B NZ  1 
ATOM   2758  N  N   . LYS B  1 91  ? 3.905   42.689  119.283 1.00 113.24 ? 91   LYS B N   1 
ATOM   2759  C  CA  . LYS B  1 91  ? 2.662   43.286  118.832 1.00 113.08 ? 91   LYS B CA  1 
ATOM   2760  C  C   . LYS B  1 91  ? 2.807   44.772  119.110 1.00 113.94 ? 91   LYS B C   1 
ATOM   2761  O  O   . LYS B  1 91  ? 1.859   45.547  118.993 1.00 113.15 ? 91   LYS B O   1 
ATOM   2762  C  CB  . LYS B  1 91  ? 1.479   42.694  119.591 1.00 112.49 ? 91   LYS B CB  1 
ATOM   2763  C  CG  . LYS B  1 91  ? 1.190   41.242  119.222 1.00 111.51 ? 91   LYS B CG  1 
ATOM   2764  C  CD  . LYS B  1 91  ? 0.844   41.105  117.742 1.00 110.35 ? 91   LYS B CD  1 
ATOM   2765  C  CE  . LYS B  1 91  ? 0.447   39.680  117.382 1.00 109.32 ? 91   LYS B CE  1 
ATOM   2766  N  NZ  . LYS B  1 91  ? -0.041  39.564  115.977 1.00 106.78 ? 91   LYS B NZ  1 
ATOM   2767  N  N   . ILE B  1 92  ? 4.023   45.145  119.498 1.00 115.30 ? 92   ILE B N   1 
ATOM   2768  C  CA  . ILE B  1 92  ? 4.365   46.532  119.761 1.00 116.22 ? 92   ILE B CA  1 
ATOM   2769  C  C   . ILE B  1 92  ? 4.390   47.145  118.370 1.00 116.32 ? 92   ILE B C   1 
ATOM   2770  O  O   . ILE B  1 92  ? 4.344   48.365  118.208 1.00 116.34 ? 92   ILE B O   1 
ATOM   2771  C  CB  . ILE B  1 92  ? 5.770   46.661  120.392 1.00 117.39 ? 92   ILE B CB  1 
ATOM   2772  C  CG1 . ILE B  1 92  ? 5.831   45.879  121.707 1.00 118.29 ? 92   ILE B CG1 1 
ATOM   2773  C  CG2 . ILE B  1 92  ? 6.100   48.125  120.636 1.00 116.91 ? 92   ILE B CG2 1 
ATOM   2774  C  CD1 . ILE B  1 92  ? 4.884   46.389  122.778 1.00 118.66 ? 92   ILE B CD1 1 
HETATM 2775  N  N   . MSE B  1 93  ? 4.474   46.270  117.368 1.00 115.80 ? 93   MSE B N   1 
HETATM 2776  C  CA  . MSE B  1 93  ? 4.480   46.685  115.971 1.00 115.35 ? 93   MSE B CA  1 
HETATM 2777  C  C   . MSE B  1 93  ? 3.235   47.536  115.825 1.00 112.58 ? 93   MSE B C   1 
HETATM 2778  O  O   . MSE B  1 93  ? 3.308   48.757  115.695 1.00 113.04 ? 93   MSE B O   1 
HETATM 2779  C  CB  . MSE B  1 93  ? 4.342   45.480  115.034 1.00 119.42 ? 93   MSE B CB  1 
HETATM 2780  C  CG  . MSE B  1 93  ? 5.123   44.239  115.434 1.00 125.73 ? 93   MSE B CG  1 
HETATM 2781  SE SE  . MSE B  1 93  ? 7.025   44.320  115.122 1.00 134.12 ? 93   MSE B SE  1 
HETATM 2782  C  CE  . MSE B  1 93  ? 7.597   44.882  116.893 1.00 132.30 ? 93   MSE B CE  1 
ATOM   2783  N  N   . ILE B  1 94  ? 2.090   46.861  115.861 1.00 108.78 ? 94   ILE B N   1 
ATOM   2784  C  CA  . ILE B  1 94  ? 0.792   47.505  115.747 1.00 104.40 ? 94   ILE B CA  1 
ATOM   2785  C  C   . ILE B  1 94  ? 0.833   48.871  116.418 1.00 102.79 ? 94   ILE B C   1 
ATOM   2786  O  O   . ILE B  1 94  ? 0.389   49.861  115.846 1.00 102.31 ? 94   ILE B O   1 
ATOM   2787  C  CB  . ILE B  1 94  ? -0.297  46.651  116.417 1.00 102.98 ? 94   ILE B CB  1 
ATOM   2788  C  CG1 . ILE B  1 94  ? -0.263  45.224  115.859 1.00 101.89 ? 94   ILE B CG1 1 
ATOM   2789  C  CG2 . ILE B  1 94  ? -1.654  47.285  116.203 1.00 101.64 ? 94   ILE B CG2 1 
ATOM   2790  C  CD1 . ILE B  1 94  ? -0.527  45.122  114.376 1.00 100.49 ? 94   ILE B CD1 1 
ATOM   2791  N  N   . GLU B  1 95  ? 1.387   48.919  117.625 1.00 101.35 ? 95   GLU B N   1 
ATOM   2792  C  CA  . GLU B  1 95  ? 1.488   50.168  118.374 1.00 101.23 ? 95   GLU B CA  1 
ATOM   2793  C  C   . GLU B  1 95  ? 2.092   51.294  117.533 1.00 99.31  ? 95   GLU B C   1 
ATOM   2794  O  O   . GLU B  1 95  ? 1.499   52.371  117.408 1.00 97.67  ? 95   GLU B O   1 
ATOM   2795  C  CB  . GLU B  1 95  ? 2.325   49.954  119.644 1.00 103.59 ? 95   GLU B CB  1 
ATOM   2796  C  CG  . GLU B  1 95  ? 2.584   51.228  120.451 1.00 108.04 ? 95   GLU B CG  1 
ATOM   2797  C  CD  . GLU B  1 95  ? 3.228   50.956  121.806 1.00 110.81 ? 95   GLU B CD  1 
ATOM   2798  O  OE1 . GLU B  1 95  ? 4.253   50.240  121.849 1.00 112.86 ? 95   GLU B OE1 1 
ATOM   2799  O  OE2 . GLU B  1 95  ? 2.713   51.465  122.829 1.00 110.40 ? 95   GLU B OE2 1 
ATOM   2800  N  N   . ARG B  1 96  ? 3.266   51.038  116.960 1.00 97.25  ? 96   ARG B N   1 
ATOM   2801  C  CA  . ARG B  1 96  ? 3.956   52.023  116.131 1.00 94.33  ? 96   ARG B CA  1 
ATOM   2802  C  C   . ARG B  1 96  ? 3.440   52.043  114.698 1.00 90.97  ? 96   ARG B C   1 
ATOM   2803  O  O   . ARG B  1 96  ? 3.649   53.011  113.969 1.00 89.73  ? 96   ARG B O   1 
ATOM   2804  C  CB  . ARG B  1 96  ? 5.462   51.759  116.128 1.00 96.67  ? 96   ARG B CB  1 
ATOM   2805  C  CG  . ARG B  1 96  ? 6.150   52.050  117.453 1.00 99.26  ? 96   ARG B CG  1 
ATOM   2806  C  CD  . ARG B  1 96  ? 7.646   51.916  117.292 1.00 100.75 ? 96   ARG B CD  1 
ATOM   2807  N  NE  . ARG B  1 96  ? 7.975   50.662  116.628 1.00 102.83 ? 96   ARG B NE  1 
ATOM   2808  C  CZ  . ARG B  1 96  ? 9.199   50.310  116.253 1.00 105.05 ? 96   ARG B CZ  1 
ATOM   2809  N  NH1 . ARG B  1 96  ? 10.226  51.122  116.476 1.00 104.72 ? 96   ARG B NH1 1 
ATOM   2810  N  NH2 . ARG B  1 96  ? 9.390   49.145  115.649 1.00 104.85 ? 96   ARG B NH2 1 
ATOM   2811  N  N   . GLY B  1 97  ? 2.780   50.966  114.292 1.00 87.31  ? 97   GLY B N   1 
ATOM   2812  C  CA  . GLY B  1 97  ? 2.224   50.920  112.958 1.00 84.08  ? 97   GLY B CA  1 
ATOM   2813  C  C   . GLY B  1 97  ? 1.009   51.823  112.972 1.00 82.50  ? 97   GLY B C   1 
ATOM   2814  O  O   . GLY B  1 97  ? 0.553   52.312  111.939 1.00 83.08  ? 97   GLY B O   1 
ATOM   2815  N  N   . GLU B  1 98  ? 0.485   52.046  114.171 1.00 80.14  ? 98   GLU B N   1 
ATOM   2816  C  CA  . GLU B  1 98  ? -0.677  52.896  114.354 1.00 77.44  ? 98   GLU B CA  1 
ATOM   2817  C  C   . GLU B  1 98  ? -0.220  54.323  114.593 1.00 74.79  ? 98   GLU B C   1 
ATOM   2818  O  O   . GLU B  1 98  ? -1.000  55.267  114.466 1.00 74.42  ? 98   GLU B O   1 
ATOM   2819  C  CB  . GLU B  1 98  ? -1.508  52.400  115.536 1.00 79.77  ? 98   GLU B CB  1 
ATOM   2820  C  CG  . GLU B  1 98  ? -2.095  51.017  115.309 1.00 84.33  ? 98   GLU B CG  1 
ATOM   2821  C  CD  . GLU B  1 98  ? -2.871  50.496  116.506 1.00 86.95  ? 98   GLU B CD  1 
ATOM   2822  O  OE1 . GLU B  1 98  ? -2.302  50.468  117.621 1.00 89.55  ? 98   GLU B OE1 1 
ATOM   2823  O  OE2 . GLU B  1 98  ? -4.046  50.106  116.328 1.00 86.94  ? 98   GLU B OE2 1 
ATOM   2824  N  N   . LEU B  1 99  ? 1.050   54.478  114.949 1.00 71.64  ? 99   LEU B N   1 
ATOM   2825  C  CA  . LEU B  1 99  ? 1.598   55.806  115.175 1.00 67.40  ? 99   LEU B CA  1 
ATOM   2826  C  C   . LEU B  1 99  ? 2.020   56.354  113.822 1.00 66.45  ? 99   LEU B C   1 
ATOM   2827  O  O   . LEU B  1 99  ? 1.841   57.538  113.534 1.00 66.63  ? 99   LEU B O   1 
ATOM   2828  C  CB  . LEU B  1 99  ? 2.810   55.747  116.100 1.00 65.04  ? 99   LEU B CB  1 
ATOM   2829  C  CG  . LEU B  1 99  ? 3.288   57.124  116.564 1.00 65.14  ? 99   LEU B CG  1 
ATOM   2830  C  CD1 . LEU B  1 99  ? 2.143   57.857  117.268 1.00 64.64  ? 99   LEU B CD1 1 
ATOM   2831  C  CD2 . LEU B  1 99  ? 4.475   56.970  117.490 1.00 62.71  ? 99   LEU B CD2 1 
ATOM   2832  N  N   . PHE B  1 100 ? 2.565   55.468  112.991 1.00 64.04  ? 100  PHE B N   1 
ATOM   2833  C  CA  . PHE B  1 100 ? 3.030   55.822  111.656 1.00 59.23  ? 100  PHE B CA  1 
ATOM   2834  C  C   . PHE B  1 100 ? 1.871   56.219  110.747 1.00 57.90  ? 100  PHE B C   1 
ATOM   2835  O  O   . PHE B  1 100 ? 2.057   57.009  109.827 1.00 59.12  ? 100  PHE B O   1 
ATOM   2836  C  CB  . PHE B  1 100 ? 3.826   54.649  111.047 1.00 56.93  ? 100  PHE B CB  1 
ATOM   2837  C  CG  . PHE B  1 100 ? 4.443   54.951  109.700 1.00 55.38  ? 100  PHE B CG  1 
ATOM   2838  C  CD1 . PHE B  1 100 ? 3.862   54.477  108.527 1.00 53.34  ? 100  PHE B CD1 1 
ATOM   2839  C  CD2 . PHE B  1 100 ? 5.605   55.717  109.605 1.00 54.35  ? 100  PHE B CD2 1 
ATOM   2840  C  CE1 . PHE B  1 100 ? 4.428   54.760  107.278 1.00 52.42  ? 100  PHE B CE1 1 
ATOM   2841  C  CE2 . PHE B  1 100 ? 6.177   56.006  108.360 1.00 51.12  ? 100  PHE B CE2 1 
ATOM   2842  C  CZ  . PHE B  1 100 ? 5.587   55.526  107.196 1.00 51.32  ? 100  PHE B CZ  1 
ATOM   2843  N  N   . LEU B  1 101 ? 0.676   55.693  111.012 1.00 57.21  ? 101  LEU B N   1 
ATOM   2844  C  CA  . LEU B  1 101 ? -0.495  56.016  110.193 1.00 55.45  ? 101  LEU B CA  1 
ATOM   2845  C  C   . LEU B  1 101 ? -1.141  57.325  110.637 1.00 54.79  ? 101  LEU B C   1 
ATOM   2846  O  O   . LEU B  1 101 ? -1.722  58.039  109.829 1.00 55.19  ? 101  LEU B O   1 
ATOM   2847  C  CB  . LEU B  1 101 ? -1.524  54.876  110.255 1.00 56.65  ? 101  LEU B CB  1 
ATOM   2848  C  CG  . LEU B  1 101 ? -2.550  54.717  109.119 1.00 55.84  ? 101  LEU B CG  1 
ATOM   2849  C  CD1 . LEU B  1 101 ? -3.248  53.389  109.264 1.00 57.38  ? 101  LEU B CD1 1 
ATOM   2850  C  CD2 . LEU B  1 101 ? -3.564  55.825  109.137 1.00 56.55  ? 101  LEU B CD2 1 
ATOM   2851  N  N   . ARG B  1 102 ? -1.030  57.645  111.921 1.00 57.25  ? 102  ARG B N   1 
ATOM   2852  C  CA  . ARG B  1 102 ? -1.614  58.875  112.445 1.00 59.57  ? 102  ARG B CA  1 
ATOM   2853  C  C   . ARG B  1 102 ? -0.742  60.060  112.059 1.00 58.74  ? 102  ARG B C   1 
ATOM   2854  O  O   . ARG B  1 102 ? -1.236  61.160  111.794 1.00 60.43  ? 102  ARG B O   1 
ATOM   2855  C  CB  . ARG B  1 102 ? -1.726  58.811  113.970 1.00 62.80  ? 102  ARG B CB  1 
ATOM   2856  C  CG  . ARG B  1 102 ? -2.608  59.909  114.564 1.00 69.90  ? 102  ARG B CG  1 
ATOM   2857  C  CD  . ARG B  1 102 ? -2.486  59.972  116.083 1.00 74.92  ? 102  ARG B CD  1 
ATOM   2858  N  NE  . ARG B  1 102 ? -2.443  58.644  116.696 1.00 79.91  ? 102  ARG B NE  1 
ATOM   2859  C  CZ  . ARG B  1 102 ? -3.394  57.720  116.574 1.00 81.73  ? 102  ARG B CZ  1 
ATOM   2860  N  NH1 . ARG B  1 102 ? -4.485  57.967  115.858 1.00 82.88  ? 102  ARG B NH1 1 
ATOM   2861  N  NH2 . ARG B  1 102 ? -3.245  56.538  117.161 1.00 80.48  ? 102  ARG B NH2 1 
ATOM   2862  N  N   . ARG B  1 103 ? 0.562   59.823  112.038 1.00 57.26  ? 103  ARG B N   1 
ATOM   2863  C  CA  . ARG B  1 103 ? 1.529   60.852  111.690 1.00 57.71  ? 103  ARG B CA  1 
ATOM   2864  C  C   . ARG B  1 103 ? 1.357   61.290  110.237 1.00 56.21  ? 103  ARG B C   1 
ATOM   2865  O  O   . ARG B  1 103 ? 1.214   62.486  109.960 1.00 54.73  ? 103  ARG B O   1 
ATOM   2866  C  CB  . ARG B  1 103 ? 2.945   60.319  111.951 1.00 61.72  ? 103  ARG B CB  1 
ATOM   2867  C  CG  . ARG B  1 103 ? 4.091   61.117  111.365 1.00 65.19  ? 103  ARG B CG  1 
ATOM   2868  C  CD  . ARG B  1 103 ? 4.416   60.616  109.969 1.00 72.94  ? 103  ARG B CD  1 
ATOM   2869  N  NE  . ARG B  1 103 ? 5.778   60.955  109.572 1.00 79.54  ? 103  ARG B NE  1 
ATOM   2870  C  CZ  . ARG B  1 103 ? 6.221   62.195  109.394 1.00 82.39  ? 103  ARG B CZ  1 
ATOM   2871  N  NH1 . ARG B  1 103 ? 5.407   63.233  109.572 1.00 82.33  ? 103  ARG B NH1 1 
ATOM   2872  N  NH2 . ARG B  1 103 ? 7.488   62.397  109.053 1.00 82.53  ? 103  ARG B NH2 1 
ATOM   2873  N  N   . ILE B  1 104 ? 1.344   60.321  109.321 1.00 53.62  ? 104  ILE B N   1 
ATOM   2874  C  CA  . ILE B  1 104 ? 1.195   60.618  107.899 1.00 50.20  ? 104  ILE B CA  1 
ATOM   2875  C  C   . ILE B  1 104 ? -0.223  60.985  107.509 1.00 48.76  ? 104  ILE B C   1 
ATOM   2876  O  O   . ILE B  1 104 ? -0.512  61.137  106.334 1.00 48.52  ? 104  ILE B O   1 
ATOM   2877  C  CB  . ILE B  1 104 ? 1.596   59.434  106.992 1.00 47.16  ? 104  ILE B CB  1 
ATOM   2878  C  CG1 . ILE B  1 104 ? 0.511   58.374  107.028 1.00 44.35  ? 104  ILE B CG1 1 
ATOM   2879  C  CG2 . ILE B  1 104 ? 2.930   58.850  107.427 1.00 47.61  ? 104  ILE B CG2 1 
ATOM   2880  C  CD1 . ILE B  1 104 ? 0.766   57.255  106.074 1.00 48.48  ? 104  ILE B CD1 1 
ATOM   2881  N  N   . SER B  1 105 ? -1.116  61.109  108.476 1.00 47.77  ? 105  SER B N   1 
ATOM   2882  C  CA  . SER B  1 105 ? -2.485  61.460  108.142 1.00 49.28  ? 105  SER B CA  1 
ATOM   2883  C  C   . SER B  1 105 ? -2.662  62.947  108.417 1.00 48.48  ? 105  SER B C   1 
ATOM   2884  O  O   . SER B  1 105 ? -3.713  63.540  108.145 1.00 47.36  ? 105  SER B O   1 
ATOM   2885  C  CB  . SER B  1 105 ? -3.466  60.619  108.971 1.00 51.07  ? 105  SER B CB  1 
ATOM   2886  O  OG  . SER B  1 105 ? -3.286  60.846  110.356 1.00 57.45  ? 105  SER B OG  1 
ATOM   2887  N  N   . LEU B  1 106 ? -1.602  63.540  108.947 1.00 45.43  ? 106  LEU B N   1 
ATOM   2888  C  CA  . LEU B  1 106 ? -1.579  64.949  109.273 1.00 44.30  ? 106  LEU B CA  1 
ATOM   2889  C  C   . LEU B  1 106 ? -0.794  65.727  108.223 1.00 44.48  ? 106  LEU B C   1 
ATOM   2890  O  O   . LEU B  1 106 ? -0.760  66.962  108.230 1.00 44.52  ? 106  LEU B O   1 
ATOM   2891  C  CB  . LEU B  1 106 ? -0.924  65.119  110.636 1.00 47.15  ? 106  LEU B CB  1 
ATOM   2892  C  CG  . LEU B  1 106 ? -1.795  64.612  111.785 1.00 49.83  ? 106  LEU B CG  1 
ATOM   2893  C  CD1 . LEU B  1 106 ? -0.938  63.956  112.850 1.00 49.12  ? 106  LEU B CD1 1 
ATOM   2894  C  CD2 . LEU B  1 106 ? -2.592  65.788  112.352 1.00 44.62  ? 106  LEU B CD2 1 
ATOM   2895  N  N   . SER B  1 107 ? -0.170  64.986  107.317 1.00 42.63  ? 107  SER B N   1 
ATOM   2896  C  CA  . SER B  1 107 ? 0.657   65.567  106.279 1.00 40.60  ? 107  SER B CA  1 
ATOM   2897  C  C   . SER B  1 107 ? -0.048  66.609  105.449 1.00 40.91  ? 107  SER B C   1 
ATOM   2898  O  O   . SER B  1 107 ? 0.370   67.768  105.417 1.00 40.68  ? 107  SER B O   1 
ATOM   2899  C  CB  . SER B  1 107 ? 1.204   64.468  105.374 1.00 37.78  ? 107  SER B CB  1 
ATOM   2900  O  OG  . SER B  1 107 ? 2.087   63.638  106.104 1.00 38.44  ? 107  SER B OG  1 
ATOM   2901  N  N   . ARG B  1 108 ? -1.116  66.206  104.772 1.00 39.70  ? 108  ARG B N   1 
ATOM   2902  C  CA  . ARG B  1 108 ? -1.835  67.145  103.938 1.00 39.79  ? 108  ARG B CA  1 
ATOM   2903  C  C   . ARG B  1 108 ? -2.203  68.417  104.675 1.00 40.27  ? 108  ARG B C   1 
ATOM   2904  O  O   . ARG B  1 108 ? -2.046  69.510  104.132 1.00 41.54  ? 108  ARG B O   1 
ATOM   2905  C  CB  . ARG B  1 108 ? -3.079  66.500  103.342 1.00 38.15  ? 108  ARG B CB  1 
ATOM   2906  C  CG  . ARG B  1 108 ? -2.765  65.626  102.152 1.00 38.47  ? 108  ARG B CG  1 
ATOM   2907  C  CD  . ARG B  1 108 ? -4.027  65.098  101.540 1.00 39.13  ? 108  ARG B CD  1 
ATOM   2908  N  NE  . ARG B  1 108 ? -3.753  64.177  100.448 1.00 40.92  ? 108  ARG B NE  1 
ATOM   2909  C  CZ  . ARG B  1 108 ? -4.583  63.203  100.091 1.00 41.17  ? 108  ARG B CZ  1 
ATOM   2910  N  NH1 . ARG B  1 108 ? -5.717  63.045  100.752 1.00 37.51  ? 108  ARG B NH1 1 
ATOM   2911  N  NH2 . ARG B  1 108 ? -4.283  62.395  99.077  1.00 42.98  ? 108  ARG B NH2 1 
ATOM   2912  N  N   . ASN B  1 109 ? -2.668  68.296  105.913 1.00 39.92  ? 109  ASN B N   1 
ATOM   2913  C  CA  . ASN B  1 109 ? -3.033  69.498  106.657 1.00 41.49  ? 109  ASN B CA  1 
ATOM   2914  C  C   . ASN B  1 109 ? -1.814  70.336  106.987 1.00 39.74  ? 109  ASN B C   1 
ATOM   2915  O  O   . ASN B  1 109 ? -1.888  71.570  106.961 1.00 38.49  ? 109  ASN B O   1 
ATOM   2916  C  CB  . ASN B  1 109 ? -3.810  69.154  107.941 1.00 46.55  ? 109  ASN B CB  1 
ATOM   2917  C  CG  . ASN B  1 109 ? -5.334  69.264  107.754 1.00 50.97  ? 109  ASN B CG  1 
ATOM   2918  O  OD1 . ASN B  1 109 ? -5.953  68.467  107.037 1.00 50.72  ? 109  ASN B OD1 1 
ATOM   2919  N  ND2 . ASN B  1 109 ? -5.935  70.268  108.393 1.00 52.51  ? 109  ASN B ND2 1 
ATOM   2920  N  N   . LYS B  1 110 ? -0.694  69.673  107.283 1.00 37.36  ? 110  LYS B N   1 
ATOM   2921  C  CA  . LYS B  1 110 ? 0.535   70.384  107.609 1.00 37.96  ? 110  LYS B CA  1 
ATOM   2922  C  C   . LYS B  1 110 ? 1.051   71.108  106.372 1.00 36.69  ? 110  LYS B C   1 
ATOM   2923  O  O   . LYS B  1 110 ? 1.607   72.206  106.456 1.00 35.98  ? 110  LYS B O   1 
ATOM   2924  C  CB  . LYS B  1 110 ? 1.587   69.417  108.161 1.00 43.52  ? 110  LYS B CB  1 
ATOM   2925  C  CG  . LYS B  1 110 ? 1.621   69.344  109.693 1.00 49.60  ? 110  LYS B CG  1 
ATOM   2926  C  CD  . LYS B  1 110 ? 2.431   68.143  110.209 1.00 55.71  ? 110  LYS B CD  1 
ATOM   2927  C  CE  . LYS B  1 110 ? 3.083   68.392  111.591 1.00 59.96  ? 110  LYS B CE  1 
ATOM   2928  N  NZ  . LYS B  1 110 ? 2.133   68.744  112.701 1.00 63.31  ? 110  LYS B NZ  1 
ATOM   2929  N  N   . ILE B  1 111 ? 0.846   70.496  105.216 1.00 35.86  ? 111  ILE B N   1 
ATOM   2930  C  CA  . ILE B  1 111 ? 1.263   71.101  103.958 1.00 33.73  ? 111  ILE B CA  1 
ATOM   2931  C  C   . ILE B  1 111 ? 0.410   72.328  103.639 1.00 33.44  ? 111  ILE B C   1 
ATOM   2932  O  O   . ILE B  1 111 ? 0.930   73.408  103.367 1.00 32.27  ? 111  ILE B O   1 
ATOM   2933  C  CB  . ILE B  1 111 ? 1.153   70.093  102.803 1.00 31.11  ? 111  ILE B CB  1 
ATOM   2934  C  CG1 . ILE B  1 111 ? 2.160   68.958  103.024 1.00 27.00  ? 111  ILE B CG1 1 
ATOM   2935  C  CG2 . ILE B  1 111 ? 1.375   70.807  101.472 1.00 28.65  ? 111  ILE B CG2 1 
ATOM   2936  C  CD1 . ILE B  1 111 ? 2.037   67.829  102.059 1.00 23.00  ? 111  ILE B CD1 1 
ATOM   2937  N  N   . ALA B  1 112 ? -0.906  72.161  103.676 1.00 36.85  ? 112  ALA B N   1 
ATOM   2938  C  CA  . ALA B  1 112 ? -1.815  73.267  103.383 1.00 39.49  ? 112  ALA B CA  1 
ATOM   2939  C  C   . ALA B  1 112 ? -1.403  74.488  104.203 1.00 41.02  ? 112  ALA B C   1 
ATOM   2940  O  O   . ALA B  1 112 ? -1.254  75.604  103.676 1.00 39.99  ? 112  ALA B O   1 
ATOM   2941  C  CB  . ALA B  1 112 ? -3.249  72.861  103.707 1.00 36.87  ? 112  ALA B CB  1 
ATOM   2942  N  N   . ASP B  1 113 ? -1.197  74.251  105.495 1.00 41.52  ? 113  ASP B N   1 
ATOM   2943  C  CA  . ASP B  1 113 ? -0.787  75.286  106.429 1.00 42.13  ? 113  ASP B CA  1 
ATOM   2944  C  C   . ASP B  1 113 ? 0.531   75.978  106.067 1.00 39.26  ? 113  ASP B C   1 
ATOM   2945  O  O   . ASP B  1 113 ? 0.700   77.164  106.310 1.00 38.16  ? 113  ASP B O   1 
ATOM   2946  C  CB  . ASP B  1 113 ? -0.673  74.680  107.823 1.00 45.92  ? 113  ASP B CB  1 
ATOM   2947  C  CG  . ASP B  1 113 ? -1.702  75.229  108.771 1.00 52.58  ? 113  ASP B CG  1 
ATOM   2948  O  OD1 . ASP B  1 113 ? -2.919  75.062  108.514 1.00 57.08  ? 113  ASP B OD1 1 
ATOM   2949  O  OD2 . ASP B  1 113 ? -1.289  75.835  109.775 1.00 56.29  ? 113  ASP B OD2 1 
ATOM   2950  N  N   . LEU B  1 114 ? 1.468   75.227  105.501 1.00 39.94  ? 114  LEU B N   1 
ATOM   2951  C  CA  . LEU B  1 114 ? 2.764   75.770  105.123 1.00 38.85  ? 114  LEU B CA  1 
ATOM   2952  C  C   . LEU B  1 114 ? 2.722   76.551  103.822 1.00 41.17  ? 114  LEU B C   1 
ATOM   2953  O  O   . LEU B  1 114 ? 3.328   77.615  103.703 1.00 38.57  ? 114  LEU B O   1 
ATOM   2954  C  CB  . LEU B  1 114 ? 3.778   74.640  104.973 1.00 37.46  ? 114  LEU B CB  1 
ATOM   2955  C  CG  . LEU B  1 114 ? 4.461   74.114  106.229 1.00 38.06  ? 114  LEU B CG  1 
ATOM   2956  C  CD1 . LEU B  1 114 ? 5.035   72.720  105.981 1.00 31.98  ? 114  LEU B CD1 1 
ATOM   2957  C  CD2 . LEU B  1 114 ? 5.546   75.103  106.623 1.00 35.23  ? 114  LEU B CD2 1 
ATOM   2958  N  N   . CYS B  1 115 ? 1.988   76.022  102.850 1.00 43.30  ? 115  CYS B N   1 
ATOM   2959  C  CA  . CYS B  1 115 ? 1.916   76.636  101.534 1.00 45.63  ? 115  CYS B CA  1 
ATOM   2960  C  C   . CYS B  1 115 ? 0.886   77.758  101.298 1.00 47.62  ? 115  CYS B C   1 
ATOM   2961  O  O   . CYS B  1 115 ? 1.144   78.682  100.518 1.00 45.43  ? 115  CYS B O   1 
ATOM   2962  C  CB  . CYS B  1 115 ? 1.727   75.532  100.491 1.00 43.29  ? 115  CYS B CB  1 
ATOM   2963  S  SG  . CYS B  1 115 ? 1.937   76.110  98.817  1.00 44.81  ? 115  CYS B SG  1 
ATOM   2964  N  N   . HIS B  1 116 ? -0.261  77.694  101.970 1.00 50.22  ? 116  HIS B N   1 
ATOM   2965  C  CA  . HIS B  1 116 ? -1.308  78.701  101.776 1.00 53.43  ? 116  HIS B CA  1 
ATOM   2966  C  C   . HIS B  1 116 ? -0.849  80.143  102.007 1.00 53.50  ? 116  HIS B C   1 
ATOM   2967  O  O   . HIS B  1 116 ? -1.366  81.065  101.379 1.00 55.53  ? 116  HIS B O   1 
ATOM   2968  C  CB  . HIS B  1 116 ? -2.514  78.408  102.681 1.00 55.06  ? 116  HIS B CB  1 
ATOM   2969  C  CG  . HIS B  1 116 ? -2.367  78.946  104.071 1.00 57.36  ? 116  HIS B CG  1 
ATOM   2970  N  ND1 . HIS B  1 116 ? -2.390  80.295  104.351 1.00 55.36  ? 116  HIS B ND1 1 
ATOM   2971  C  CD2 . HIS B  1 116 ? -2.141  78.321  105.251 1.00 57.35  ? 116  HIS B CD2 1 
ATOM   2972  C  CE1 . HIS B  1 116 ? -2.183  80.479  105.641 1.00 56.54  ? 116  HIS B CE1 1 
ATOM   2973  N  NE2 . HIS B  1 116 ? -2.027  79.297  106.210 1.00 57.94  ? 116  HIS B NE2 1 
ATOM   2974  N  N   . THR B  1 117 ? 0.115   80.348  102.897 1.00 53.82  ? 117  THR B N   1 
ATOM   2975  C  CA  . THR B  1 117 ? 0.583   81.705  103.185 1.00 53.86  ? 117  THR B CA  1 
ATOM   2976  C  C   . THR B  1 117 ? 1.395   82.343  102.056 1.00 52.65  ? 117  THR B C   1 
ATOM   2977  O  O   . THR B  1 117 ? 1.781   83.506  102.152 1.00 53.21  ? 117  THR B O   1 
ATOM   2978  C  CB  . THR B  1 117 ? 1.436   81.744  104.476 1.00 54.09  ? 117  THR B CB  1 
ATOM   2979  O  OG1 . THR B  1 117 ? 0.750   81.056  105.527 1.00 55.00  ? 117  THR B OG1 1 
ATOM   2980  C  CG2 . THR B  1 117 ? 1.655   83.179  104.924 1.00 55.07  ? 117  THR B CG2 1 
ATOM   2981  N  N   . PHE B  1 118 ? 1.648   81.598  100.983 1.00 51.91  ? 118  PHE B N   1 
ATOM   2982  C  CA  . PHE B  1 118 ? 2.436   82.130  99.869  1.00 50.72  ? 118  PHE B CA  1 
ATOM   2983  C  C   . PHE B  1 118 ? 1.596   82.607  98.698  1.00 48.60  ? 118  PHE B C   1 
ATOM   2984  O  O   . PHE B  1 118 ? 2.120   83.065  97.682  1.00 48.27  ? 118  PHE B O   1 
ATOM   2985  C  CB  . PHE B  1 118 ? 3.433   81.089  99.368  1.00 51.80  ? 118  PHE B CB  1 
ATOM   2986  C  CG  . PHE B  1 118 ? 4.610   80.896  100.267 1.00 49.37  ? 118  PHE B CG  1 
ATOM   2987  C  CD1 . PHE B  1 118 ? 4.437   80.444  101.571 1.00 49.78  ? 118  PHE B CD1 1 
ATOM   2988  C  CD2 . PHE B  1 118 ? 5.899   81.146  99.797  1.00 50.53  ? 118  PHE B CD2 1 
ATOM   2989  C  CE1 . PHE B  1 118 ? 5.531   80.239  102.398 1.00 52.77  ? 118  PHE B CE1 1 
ATOM   2990  C  CE2 . PHE B  1 118 ? 7.008   80.947  100.611 1.00 51.76  ? 118  PHE B CE2 1 
ATOM   2991  C  CZ  . PHE B  1 118 ? 6.825   80.491  101.917 1.00 54.47  ? 118  PHE B CZ  1 
ATOM   2992  N  N   . ILE B  1 119 ? 0.288   82.480  98.846  1.00 47.81  ? 119  ILE B N   1 
ATOM   2993  C  CA  . ILE B  1 119 ? -0.654  82.903  97.826  1.00 45.09  ? 119  ILE B CA  1 
ATOM   2994  C  C   . ILE B  1 119 ? -1.044  84.331  98.205  1.00 45.73  ? 119  ILE B C   1 
ATOM   2995  O  O   . ILE B  1 119 ? -1.839  84.535  99.117  1.00 42.88  ? 119  ILE B O   1 
ATOM   2996  C  CB  . ILE B  1 119 ? -1.904  81.975  97.832  1.00 42.13  ? 119  ILE B CB  1 
ATOM   2997  C  CG1 . ILE B  1 119 ? -1.458  80.516  97.665  1.00 36.07  ? 119  ILE B CG1 1 
ATOM   2998  C  CG2 . ILE B  1 119 ? -2.869  82.369  96.731  1.00 40.94  ? 119  ILE B CG2 1 
ATOM   2999  C  CD1 . ILE B  1 119 ? -2.584  79.521  97.594  1.00 29.77  ? 119  ILE B CD1 1 
ATOM   3000  N  N   . LYS B  1 120 ? -0.456  85.316  97.531  1.00 47.43  ? 120  LYS B N   1 
ATOM   3001  C  CA  . LYS B  1 120 ? -0.768  86.712  97.818  1.00 50.90  ? 120  LYS B CA  1 
ATOM   3002  C  C   . LYS B  1 120 ? -2.170  87.051  97.330  1.00 51.79  ? 120  LYS B C   1 
ATOM   3003  O  O   . LYS B  1 120 ? -2.655  86.450  96.380  1.00 52.15  ? 120  LYS B O   1 
ATOM   3004  C  CB  . LYS B  1 120 ? 0.263   87.644  97.165  1.00 53.11  ? 120  LYS B CB  1 
ATOM   3005  C  CG  . LYS B  1 120 ? 1.565   87.793  97.970  1.00 57.94  ? 120  LYS B CG  1 
ATOM   3006  C  CD  . LYS B  1 120 ? 1.887   89.268  98.336  1.00 62.55  ? 120  LYS B CD  1 
ATOM   3007  C  CE  . LYS B  1 120 ? 0.775   89.967  99.160  1.00 62.77  ? 120  LYS B CE  1 
ATOM   3008  N  NZ  . LYS B  1 120 ? 0.567   89.431  100.546 1.00 62.77  ? 120  LYS B NZ  1 
ATOM   3009  N  N   . ASP B  1 121 ? -2.821  88.010  97.979  1.00 53.94  ? 121  ASP B N   1 
ATOM   3010  C  CA  . ASP B  1 121 ? -4.177  88.392  97.602  1.00 55.47  ? 121  ASP B CA  1 
ATOM   3011  C  C   . ASP B  1 121 ? -4.262  88.769  96.125  1.00 54.79  ? 121  ASP B C   1 
ATOM   3012  O  O   . ASP B  1 121 ? -3.365  89.424  95.587  1.00 53.50  ? 121  ASP B O   1 
ATOM   3013  C  CB  . ASP B  1 121 ? -4.660  89.557  98.471  1.00 59.43  ? 121  ASP B CB  1 
ATOM   3014  C  CG  . ASP B  1 121 ? -6.182  89.674  98.499  1.00 65.43  ? 121  ASP B CG  1 
ATOM   3015  O  OD1 . ASP B  1 121 ? -6.844  88.661  98.830  1.00 68.16  ? 121  ASP B OD1 1 
ATOM   3016  O  OD2 . ASP B  1 121 ? -6.715  90.772  98.198  1.00 66.52  ? 121  ASP B OD2 1 
ATOM   3017  N  N   . GLY B  1 122 ? -5.343  88.331  95.478  1.00 53.39  ? 122  GLY B N   1 
ATOM   3018  C  CA  . GLY B  1 122 ? -5.556  88.608  94.063  1.00 50.86  ? 122  GLY B CA  1 
ATOM   3019  C  C   . GLY B  1 122 ? -4.690  87.799  93.106  1.00 48.98  ? 122  GLY B C   1 
ATOM   3020  O  O   . GLY B  1 122 ? -4.719  88.017  91.895  1.00 50.24  ? 122  GLY B O   1 
ATOM   3021  N  N   . ALA B  1 123 ? -3.920  86.865  93.647  1.00 47.00  ? 123  ALA B N   1 
ATOM   3022  C  CA  . ALA B  1 123 ? -3.032  86.035  92.846  1.00 46.34  ? 123  ALA B CA  1 
ATOM   3023  C  C   . ALA B  1 123 ? -3.800  85.136  91.901  1.00 45.06  ? 123  ALA B C   1 
ATOM   3024  O  O   . ALA B  1 123 ? -4.974  84.857  92.129  1.00 46.89  ? 123  ALA B O   1 
ATOM   3025  C  CB  . ALA B  1 123 ? -2.163  85.186  93.753  1.00 46.55  ? 123  ALA B CB  1 
ATOM   3026  N  N   . THR B  1 124 ? -3.126  84.704  90.835  1.00 42.31  ? 124  THR B N   1 
ATOM   3027  C  CA  . THR B  1 124 ? -3.693  83.788  89.848  1.00 39.37  ? 124  THR B CA  1 
ATOM   3028  C  C   . THR B  1 124 ? -2.767  82.581  89.863  1.00 37.63  ? 124  THR B C   1 
ATOM   3029  O  O   . THR B  1 124 ? -1.572  82.684  89.572  1.00 34.74  ? 124  THR B O   1 
ATOM   3030  C  CB  . THR B  1 124 ? -3.711  84.373  88.422  1.00 42.47  ? 124  THR B CB  1 
ATOM   3031  O  OG1 . THR B  1 124 ? -4.648  85.452  88.347  1.00 40.60  ? 124  THR B OG1 1 
ATOM   3032  C  CG2 . THR B  1 124 ? -4.111  83.300  87.418  1.00 40.51  ? 124  THR B CG2 1 
ATOM   3033  N  N   . ILE B  1 125 ? -3.332  81.434  90.211  1.00 35.01  ? 125  ILE B N   1 
ATOM   3034  C  CA  . ILE B  1 125 ? -2.567  80.215  90.310  1.00 33.14  ? 125  ILE B CA  1 
ATOM   3035  C  C   . ILE B  1 125 ? -2.774  79.266  89.150  1.00 33.48  ? 125  ILE B C   1 
ATOM   3036  O  O   . ILE B  1 125 ? -3.907  78.977  88.777  1.00 34.94  ? 125  ILE B O   1 
ATOM   3037  C  CB  . ILE B  1 125 ? -2.929  79.483  91.588  1.00 33.79  ? 125  ILE B CB  1 
ATOM   3038  C  CG1 . ILE B  1 125 ? -2.749  80.421  92.779  1.00 35.19  ? 125  ILE B CG1 1 
ATOM   3039  C  CG2 . ILE B  1 125 ? -2.082  78.237  91.720  1.00 36.15  ? 125  ILE B CG2 1 
ATOM   3040  C  CD1 . ILE B  1 125 ? -3.195  79.834  94.100  1.00 37.98  ? 125  ILE B CD1 1 
ATOM   3041  N  N   . LEU B  1 126 ? -1.671  78.775  88.591  1.00 33.45  ? 126  LEU B N   1 
ATOM   3042  C  CA  . LEU B  1 126 ? -1.729  77.825  87.486  1.00 31.00  ? 126  LEU B CA  1 
ATOM   3043  C  C   . LEU B  1 126 ? -1.419  76.455  88.070  1.00 33.82  ? 126  LEU B C   1 
ATOM   3044  O  O   . LEU B  1 126 ? -0.452  76.296  88.823  1.00 35.97  ? 126  LEU B O   1 
ATOM   3045  C  CB  . LEU B  1 126 ? -0.677  78.147  86.439  1.00 29.01  ? 126  LEU B CB  1 
ATOM   3046  C  CG  . LEU B  1 126 ? -0.849  77.674  84.997  1.00 31.33  ? 126  LEU B CG  1 
ATOM   3047  C  CD1 . LEU B  1 126 ? 0.521   77.343  84.477  1.00 33.90  ? 126  LEU B CD1 1 
ATOM   3048  C  CD2 . LEU B  1 126 ? -1.729  76.458  84.879  1.00 33.65  ? 126  LEU B CD2 1 
ATOM   3049  N  N   . THR B  1 127 ? -2.239  75.465  87.745  1.00 31.64  ? 127  THR B N   1 
ATOM   3050  C  CA  . THR B  1 127 ? -1.990  74.130  88.248  1.00 30.25  ? 127  THR B CA  1 
ATOM   3051  C  C   . THR B  1 127 ? -2.210  73.130  87.123  1.00 31.19  ? 127  THR B C   1 
ATOM   3052  O  O   . THR B  1 127 ? -2.781  73.468  86.081  1.00 31.71  ? 127  THR B O   1 
ATOM   3053  C  CB  . THR B  1 127 ? -2.885  73.794  89.476  1.00 30.09  ? 127  THR B CB  1 
ATOM   3054  O  OG1 . THR B  1 127 ? -2.379  72.609  90.107  1.00 35.09  ? 127  THR B OG1 1 
ATOM   3055  C  CG2 . THR B  1 127 ? -4.336  73.562  89.062  1.00 27.62  ? 127  THR B CG2 1 
ATOM   3056  N  N   . HIS B  1 128 ? -1.753  71.903  87.345  1.00 29.25  ? 128  HIS B N   1 
ATOM   3057  C  CA  . HIS B  1 128 ? -1.839  70.848  86.350  1.00 28.45  ? 128  HIS B CA  1 
ATOM   3058  C  C   . HIS B  1 128 ? -2.623  69.638  86.846  1.00 30.36  ? 128  HIS B C   1 
ATOM   3059  O  O   . HIS B  1 128 ? -2.459  69.216  87.987  1.00 34.77  ? 128  HIS B O   1 
ATOM   3060  C  CB  . HIS B  1 128 ? -0.412  70.423  85.990  1.00 23.75  ? 128  HIS B CB  1 
ATOM   3061  C  CG  . HIS B  1 128 ? -0.326  69.308  84.994  1.00 21.59  ? 128  HIS B CG  1 
ATOM   3062  N  ND1 . HIS B  1 128 ? -0.820  69.410  83.712  1.00 26.23  ? 128  HIS B ND1 1 
ATOM   3063  C  CD2 . HIS B  1 128 ? 0.249   68.087  85.076  1.00 20.46  ? 128  HIS B CD2 1 
ATOM   3064  C  CE1 . HIS B  1 128 ? -0.552  68.301  83.046  1.00 22.40  ? 128  HIS B CE1 1 
ATOM   3065  N  NE2 . HIS B  1 128 ? 0.096   67.481  83.851  1.00 21.15  ? 128  HIS B NE2 1 
ATOM   3066  N  N   . ALA B  1 129 ? -3.472  69.083  85.985  1.00 29.70  ? 129  ALA B N   1 
ATOM   3067  C  CA  . ALA B  1 129 ? -4.241  67.886  86.321  1.00 29.33  ? 129  ALA B CA  1 
ATOM   3068  C  C   . ALA B  1 129 ? -5.020  67.960  87.635  1.00 30.28  ? 129  ALA B C   1 
ATOM   3069  O  O   . ALA B  1 129 ? -5.530  69.010  88.026  1.00 32.58  ? 129  ALA B O   1 
ATOM   3070  C  CB  . ALA B  1 129 ? -3.310  66.689  86.347  1.00 25.09  ? 129  ALA B CB  1 
ATOM   3071  N  N   . TYR B  1 130 ? -5.123  66.825  88.312  1.00 30.34  ? 130  TYR B N   1 
ATOM   3072  C  CA  . TYR B  1 130 ? -5.835  66.769  89.579  1.00 30.57  ? 130  TYR B CA  1 
ATOM   3073  C  C   . TYR B  1 130 ? -4.898  66.388  90.729  1.00 29.35  ? 130  TYR B C   1 
ATOM   3074  O  O   . TYR B  1 130 ? -4.234  65.371  90.666  1.00 30.99  ? 130  TYR B O   1 
ATOM   3075  C  CB  . TYR B  1 130 ? -6.954  65.734  89.492  1.00 32.52  ? 130  TYR B CB  1 
ATOM   3076  C  CG  . TYR B  1 130 ? -7.906  65.778  90.658  1.00 35.37  ? 130  TYR B CG  1 
ATOM   3077  C  CD1 . TYR B  1 130 ? -9.117  66.465  90.560  1.00 34.80  ? 130  TYR B CD1 1 
ATOM   3078  C  CD2 . TYR B  1 130 ? -7.576  65.180  91.879  1.00 35.70  ? 130  TYR B CD2 1 
ATOM   3079  C  CE1 . TYR B  1 130 ? -9.978  66.562  91.637  1.00 34.04  ? 130  TYR B CE1 1 
ATOM   3080  C  CE2 . TYR B  1 130 ? -8.427  65.273  92.970  1.00 38.78  ? 130  TYR B CE2 1 
ATOM   3081  C  CZ  . TYR B  1 130 ? -9.634  65.967  92.840  1.00 38.57  ? 130  TYR B CZ  1 
ATOM   3082  O  OH  . TYR B  1 130 ? -10.506 66.052  93.905  1.00 40.57  ? 130  TYR B OH  1 
ATOM   3083  N  N   . SER B  1 131 ? -4.847  67.195  91.778  1.00 27.53  ? 131  SER B N   1 
ATOM   3084  C  CA  . SER B  1 131 ? -4.009  66.876  92.921  1.00 26.14  ? 131  SER B CA  1 
ATOM   3085  C  C   . SER B  1 131 ? -4.809  67.125  94.185  1.00 31.28  ? 131  SER B C   1 
ATOM   3086  O  O   . SER B  1 131 ? -5.240  68.260  94.437  1.00 28.42  ? 131  SER B O   1 
ATOM   3087  C  CB  . SER B  1 131 ? -2.766  67.766  92.950  1.00 29.13  ? 131  SER B CB  1 
ATOM   3088  O  OG  . SER B  1 131 ? -2.218  67.841  94.264  1.00 25.67  ? 131  SER B OG  1 
ATOM   3089  N  N   . ARG B  1 132 ? -5.003  66.091  95.002  1.00 32.34  ? 132  ARG B N   1 
ATOM   3090  C  CA  . ARG B  1 132 ? -5.775  66.309  96.220  1.00 33.04  ? 132  ARG B CA  1 
ATOM   3091  C  C   . ARG B  1 132 ? -5.037  67.256  97.151  1.00 29.89  ? 132  ARG B C   1 
ATOM   3092  O  O   . ARG B  1 132 ? -5.652  68.086  97.816  1.00 28.67  ? 132  ARG B O   1 
ATOM   3093  C  CB  . ARG B  1 132 ? -6.073  64.999  96.937  1.00 34.57  ? 132  ARG B CB  1 
ATOM   3094  C  CG  . ARG B  1 132 ? -5.413  63.794  96.355  1.00 39.88  ? 132  ARG B CG  1 
ATOM   3095  C  CD  . ARG B  1 132 ? -6.366  63.035  95.465  1.00 46.59  ? 132  ARG B CD  1 
ATOM   3096  N  NE  . ARG B  1 132 ? -6.441  61.619  95.835  1.00 50.05  ? 132  ARG B NE  1 
ATOM   3097  C  CZ  . ARG B  1 132 ? -5.405  60.782  95.856  1.00 49.35  ? 132  ARG B CZ  1 
ATOM   3098  N  NH1 . ARG B  1 132 ? -4.189  61.204  95.528  1.00 45.45  ? 132  ARG B NH1 1 
ATOM   3099  N  NH2 . ARG B  1 132 ? -5.591  59.516  96.206  1.00 51.95  ? 132  ARG B NH2 1 
ATOM   3100  N  N   . VAL B  1 133 ? -3.715  67.149  97.185  1.00 28.82  ? 133  VAL B N   1 
ATOM   3101  C  CA  . VAL B  1 133 ? -2.935  68.029  98.042  1.00 27.55  ? 133  VAL B CA  1 
ATOM   3102  C  C   . VAL B  1 133 ? -3.065  69.491  97.590  1.00 27.56  ? 133  VAL B C   1 
ATOM   3103  O  O   . VAL B  1 133 ? -3.150  70.389  98.427  1.00 29.33  ? 133  VAL B O   1 
ATOM   3104  C  CB  . VAL B  1 133 ? -1.439  67.626  98.066  1.00 26.81  ? 133  VAL B CB  1 
ATOM   3105  C  CG1 . VAL B  1 133 ? -0.701  68.425  99.113  1.00 21.65  ? 133  VAL B CG1 1 
ATOM   3106  C  CG2 . VAL B  1 133 ? -1.308  66.156  98.348  1.00 24.51  ? 133  VAL B CG2 1 
ATOM   3107  N  N   . VAL B  1 134 ? -3.070  69.746  96.282  1.00 27.07  ? 134  VAL B N   1 
ATOM   3108  C  CA  . VAL B  1 134 ? -3.229  71.124  95.828  1.00 28.65  ? 134  VAL B CA  1 
ATOM   3109  C  C   . VAL B  1 134 ? -4.603  71.661  96.268  1.00 31.01  ? 134  VAL B C   1 
ATOM   3110  O  O   . VAL B  1 134 ? -4.743  72.830  96.631  1.00 31.62  ? 134  VAL B O   1 
ATOM   3111  C  CB  . VAL B  1 134 ? -3.138  71.252  94.300  1.00 28.47  ? 134  VAL B CB  1 
ATOM   3112  C  CG1 . VAL B  1 134 ? -3.479  72.685  93.900  1.00 27.43  ? 134  VAL B CG1 1 
ATOM   3113  C  CG2 . VAL B  1 134 ? -1.740  70.907  93.822  1.00 29.19  ? 134  VAL B CG2 1 
ATOM   3114  N  N   . LEU B  1 135 ? -5.608  70.788  96.229  1.00 31.19  ? 135  LEU B N   1 
ATOM   3115  C  CA  . LEU B  1 135 ? -6.963  71.129  96.611  1.00 31.50  ? 135  LEU B CA  1 
ATOM   3116  C  C   . LEU B  1 135 ? -6.987  71.602  98.071  1.00 34.89  ? 135  LEU B C   1 
ATOM   3117  O  O   . LEU B  1 135 ? -7.506  72.686  98.361  1.00 34.25  ? 135  LEU B O   1 
ATOM   3118  C  CB  . LEU B  1 135 ? -7.869  69.909  96.378  1.00 33.00  ? 135  LEU B CB  1 
ATOM   3119  C  CG  . LEU B  1 135 ? -9.378  70.089  96.137  1.00 33.85  ? 135  LEU B CG  1 
ATOM   3120  C  CD1 . LEU B  1 135 ? -10.105 70.072  97.456  1.00 36.60  ? 135  LEU B CD1 1 
ATOM   3121  C  CD2 . LEU B  1 135 ? -9.658  71.388  95.377  1.00 30.27  ? 135  LEU B CD2 1 
ATOM   3122  N  N   . ARG B  1 136 ? -6.406  70.822  98.986  1.00 34.08  ? 136  ARG B N   1 
ATOM   3123  C  CA  . ARG B  1 136 ? -6.376  71.233  100.395 1.00 36.62  ? 136  ARG B CA  1 
ATOM   3124  C  C   . ARG B  1 136 ? -5.669  72.593  100.565 1.00 36.16  ? 136  ARG B C   1 
ATOM   3125  O  O   . ARG B  1 136 ? -6.186  73.493  101.244 1.00 32.39  ? 136  ARG B O   1 
ATOM   3126  C  CB  . ARG B  1 136 ? -5.677  70.175  101.278 1.00 37.36  ? 136  ARG B CB  1 
ATOM   3127  C  CG  . ARG B  1 136 ? -6.430  68.824  101.433 1.00 44.30  ? 136  ARG B CG  1 
ATOM   3128  C  CD  . ARG B  1 136 ? -7.605  68.848  102.433 1.00 43.75  ? 136  ARG B CD  1 
ATOM   3129  N  NE  . ARG B  1 136 ? -7.368  68.006  103.616 1.00 50.85  ? 136  ARG B NE  1 
ATOM   3130  C  CZ  . ARG B  1 136 ? -7.192  66.678  103.596 1.00 50.01  ? 136  ARG B CZ  1 
ATOM   3131  N  NH1 . ARG B  1 136 ? -7.228  66.016  102.445 1.00 50.34  ? 136  ARG B NH1 1 
ATOM   3132  N  NH2 . ARG B  1 136 ? -6.971  66.006  104.727 1.00 39.16  ? 136  ARG B NH2 1 
ATOM   3133  N  N   . VAL B  1 137 ? -4.496  72.736  99.944  1.00 34.64  ? 137  VAL B N   1 
ATOM   3134  C  CA  . VAL B  1 137 ? -3.729  73.974  100.034 1.00 32.27  ? 137  VAL B CA  1 
ATOM   3135  C  C   . VAL B  1 137 ? -4.612  75.137  99.668  1.00 33.12  ? 137  VAL B C   1 
ATOM   3136  O  O   . VAL B  1 137 ? -4.627  76.154  100.349 1.00 33.15  ? 137  VAL B O   1 
ATOM   3137  C  CB  . VAL B  1 137 ? -2.538  74.002  99.067  1.00 32.90  ? 137  VAL B CB  1 
ATOM   3138  C  CG1 . VAL B  1 137 ? -1.767  75.285  99.252  1.00 30.82  ? 137  VAL B CG1 1 
ATOM   3139  C  CG2 . VAL B  1 137 ? -1.640  72.808  99.293  1.00 34.33  ? 137  VAL B CG2 1 
ATOM   3140  N  N   . LEU B  1 138 ? -5.359  74.979  98.582  1.00 35.44  ? 138  LEU B N   1 
ATOM   3141  C  CA  . LEU B  1 138 ? -6.248  76.035  98.112  1.00 33.94  ? 138  LEU B CA  1 
ATOM   3142  C  C   . LEU B  1 138 ? -7.451  76.271  99.023  1.00 34.71  ? 138  LEU B C   1 
ATOM   3143  O  O   . LEU B  1 138 ? -7.911  77.408  99.163  1.00 34.79  ? 138  LEU B O   1 
ATOM   3144  C  CB  . LEU B  1 138 ? -6.711  75.730  96.686  1.00 31.31  ? 138  LEU B CB  1 
ATOM   3145  C  CG  . LEU B  1 138 ? -5.618  75.743  95.615  1.00 27.50  ? 138  LEU B CG  1 
ATOM   3146  C  CD1 . LEU B  1 138 ? -6.242  75.525  94.239  1.00 25.34  ? 138  LEU B CD1 1 
ATOM   3147  C  CD2 . LEU B  1 138 ? -4.872  77.068  95.664  1.00 24.81  ? 138  LEU B CD2 1 
ATOM   3148  N  N   . GLU B  1 139 ? -7.964  75.209  99.637  1.00 34.40  ? 139  GLU B N   1 
ATOM   3149  C  CA  . GLU B  1 139 ? -9.092  75.362  100.544 1.00 34.86  ? 139  GLU B CA  1 
ATOM   3150  C  C   . GLU B  1 139 ? -8.614  76.211  101.718 1.00 34.91  ? 139  GLU B C   1 
ATOM   3151  O  O   . GLU B  1 139 ? -9.304  77.114  102.173 1.00 35.70  ? 139  GLU B O   1 
ATOM   3152  C  CB  . GLU B  1 139 ? -9.592  73.994  101.019 1.00 33.20  ? 139  GLU B CB  1 
ATOM   3153  C  CG  . GLU B  1 139 ? -10.045 73.092  99.868  1.00 45.48  ? 139  GLU B CG  1 
ATOM   3154  C  CD  . GLU B  1 139 ? -10.452 71.680  100.302 1.00 50.89  ? 139  GLU B CD  1 
ATOM   3155  O  OE1 . GLU B  1 139 ? -9.756  71.070  101.143 1.00 54.67  ? 139  GLU B OE1 1 
ATOM   3156  O  OE2 . GLU B  1 139 ? -11.463 71.166  99.781  1.00 53.74  ? 139  GLU B OE2 1 
ATOM   3157  N  N   . ALA B  1 140 ? -7.410  75.934  102.188 1.00 38.22  ? 140  ALA B N   1 
ATOM   3158  C  CA  . ALA B  1 140 ? -6.832  76.684  103.293 1.00 42.44  ? 140  ALA B CA  1 
ATOM   3159  C  C   . ALA B  1 140 ? -6.574  78.152  102.905 1.00 47.74  ? 140  ALA B C   1 
ATOM   3160  O  O   . ALA B  1 140 ? -6.448  79.020  103.776 1.00 50.77  ? 140  ALA B O   1 
ATOM   3161  C  CB  . ALA B  1 140 ? -5.524  76.023  103.733 1.00 39.88  ? 140  ALA B CB  1 
ATOM   3162  N  N   . ALA B  1 141 ? -6.473  78.432  101.606 1.00 48.40  ? 141  ALA B N   1 
ATOM   3163  C  CA  . ALA B  1 141 ? -6.228  79.799  101.157 1.00 49.31  ? 141  ALA B CA  1 
ATOM   3164  C  C   . ALA B  1 141 ? -7.533  80.593  101.230 1.00 50.82  ? 141  ALA B C   1 
ATOM   3165  O  O   . ALA B  1 141 ? -7.522  81.800  101.479 1.00 48.78  ? 141  ALA B O   1 
ATOM   3166  C  CB  . ALA B  1 141 ? -5.685  79.801  99.736  1.00 46.94  ? 141  ALA B CB  1 
ATOM   3167  N  N   . VAL B  1 142 ? -8.652  79.907  101.007 1.00 51.48  ? 142  VAL B N   1 
ATOM   3168  C  CA  . VAL B  1 142 ? -9.971  80.536  101.073 1.00 54.63  ? 142  VAL B CA  1 
ATOM   3169  C  C   . VAL B  1 142 ? -10.318 80.835  102.529 1.00 56.01  ? 142  VAL B C   1 
ATOM   3170  O  O   . VAL B  1 142 ? -10.541 81.989  102.917 1.00 54.79  ? 142  VAL B O   1 
ATOM   3171  C  CB  . VAL B  1 142 ? -11.077 79.614  100.513 1.00 53.55  ? 142  VAL B CB  1 
ATOM   3172  C  CG1 . VAL B  1 142 ? -12.436 80.112  100.972 1.00 53.98  ? 142  VAL B CG1 1 
ATOM   3173  C  CG2 . VAL B  1 142 ? -11.018 79.581  98.992  1.00 54.25  ? 142  VAL B CG2 1 
ATOM   3174  N  N   . ALA B  1 143 ? -10.358 79.770  103.321 1.00 57.72  ? 143  ALA B N   1 
ATOM   3175  C  CA  . ALA B  1 143 ? -10.672 79.853  104.734 1.00 57.73  ? 143  ALA B CA  1 
ATOM   3176  C  C   . ALA B  1 143 ? -9.951  81.014  105.410 1.00 58.31  ? 143  ALA B C   1 
ATOM   3177  O  O   . ALA B  1 143 ? -10.402 81.508  106.446 1.00 57.31  ? 143  ALA B O   1 
ATOM   3178  C  CB  . ALA B  1 143 ? -10.312 78.552  105.402 1.00 57.59  ? 143  ALA B CB  1 
ATOM   3179  N  N   . ALA B  1 144 ? -8.840  81.450  104.816 1.00 59.92  ? 144  ALA B N   1 
ATOM   3180  C  CA  . ALA B  1 144 ? -8.047  82.563  105.353 1.00 60.66  ? 144  ALA B CA  1 
ATOM   3181  C  C   . ALA B  1 144 ? -8.424  83.903  104.722 1.00 61.64  ? 144  ALA B C   1 
ATOM   3182  O  O   . ALA B  1 144 ? -7.652  84.869  104.781 1.00 59.44  ? 144  ALA B O   1 
ATOM   3183  C  CB  . ALA B  1 144 ? -6.541  82.299  105.158 1.00 60.74  ? 144  ALA B CB  1 
ATOM   3184  N  N   . LYS B  1 145 ? -9.599  83.948  104.100 1.00 62.20  ? 145  LYS B N   1 
ATOM   3185  C  CA  . LYS B  1 145 ? -10.095 85.177  103.498 1.00 64.43  ? 145  LYS B CA  1 
ATOM   3186  C  C   . LYS B  1 145 ? -9.272  85.667  102.297 1.00 65.64  ? 145  LYS B C   1 
ATOM   3187  O  O   . LYS B  1 145 ? -9.395  86.833  101.898 1.00 67.71  ? 145  LYS B O   1 
ATOM   3188  C  CB  . LYS B  1 145 ? -10.132 86.275  104.567 1.00 63.44  ? 145  LYS B CB  1 
ATOM   3189  C  CG  . LYS B  1 145 ? -10.682 85.818  105.915 1.00 65.49  ? 145  LYS B CG  1 
ATOM   3190  C  CD  . LYS B  1 145 ? -10.139 86.684  107.055 1.00 67.65  ? 145  LYS B CD  1 
ATOM   3191  C  CE  . LYS B  1 145 ? -10.672 86.242  108.411 1.00 68.58  ? 145  LYS B CE  1 
ATOM   3192  N  NZ  . LYS B  1 145 ? -10.298 84.837  108.736 1.00 72.13  ? 145  LYS B NZ  1 
ATOM   3193  N  N   . LYS B  1 146 ? -8.435  84.800  101.725 1.00 63.09  ? 146  LYS B N   1 
ATOM   3194  C  CA  . LYS B  1 146 ? -7.619  85.184  100.568 1.00 60.73  ? 146  LYS B CA  1 
ATOM   3195  C  C   . LYS B  1 146 ? -8.387  84.991  99.260  1.00 58.02  ? 146  LYS B C   1 
ATOM   3196  O  O   . LYS B  1 146 ? -8.958  83.929  99.026  1.00 57.89  ? 146  LYS B O   1 
ATOM   3197  C  CB  . LYS B  1 146 ? -6.313  84.375  100.539 1.00 60.99  ? 146  LYS B CB  1 
ATOM   3198  C  CG  . LYS B  1 146 ? -5.244  84.885  101.508 1.00 63.59  ? 146  LYS B CG  1 
ATOM   3199  C  CD  . LYS B  1 146 ? -4.035  83.956  101.582 1.00 66.58  ? 146  LYS B CD  1 
ATOM   3200  C  CE  . LYS B  1 146 ? -2.918  84.556  102.431 1.00 66.88  ? 146  LYS B CE  1 
ATOM   3201  N  NZ  . LYS B  1 146 ? -2.485  85.890  101.913 1.00 69.58  ? 146  LYS B NZ  1 
ATOM   3202  N  N   . ARG B  1 147 ? -8.414  86.029  98.424  1.00 56.54  ? 147  ARG B N   1 
ATOM   3203  C  CA  . ARG B  1 147 ? -9.116  85.984  97.134  1.00 54.75  ? 147  ARG B CA  1 
ATOM   3204  C  C   . ARG B  1 147 ? -8.130  85.721  96.002  1.00 49.94  ? 147  ARG B C   1 
ATOM   3205  O  O   . ARG B  1 147 ? -7.148  86.450  95.844  1.00 48.68  ? 147  ARG B O   1 
ATOM   3206  C  CB  . ARG B  1 147 ? -9.856  87.305  96.884  1.00 60.81  ? 147  ARG B CB  1 
ATOM   3207  C  CG  . ARG B  1 147 ? -11.062 87.518  97.803  1.00 70.67  ? 147  ARG B CG  1 
ATOM   3208  C  CD  . ARG B  1 147 ? -11.733 88.881  97.594  1.00 76.80  ? 147  ARG B CD  1 
ATOM   3209  N  NE  . ARG B  1 147 ? -10.922 89.995  98.088  1.00 81.79  ? 147  ARG B NE  1 
ATOM   3210  C  CZ  . ARG B  1 147 ? -10.574 90.169  99.362  1.00 84.96  ? 147  ARG B CZ  1 
ATOM   3211  N  NH1 . ARG B  1 147 ? -10.963 89.302  100.290 1.00 85.73  ? 147  ARG B NH1 1 
ATOM   3212  N  NH2 . ARG B  1 147 ? -9.836  91.217  99.711  1.00 86.28  ? 147  ARG B NH2 1 
ATOM   3213  N  N   . PHE B  1 148 ? -8.398  84.684  95.211  1.00 43.49  ? 148  PHE B N   1 
ATOM   3214  C  CA  . PHE B  1 148 ? -7.512  84.307  94.113  1.00 38.32  ? 148  PHE B CA  1 
ATOM   3215  C  C   . PHE B  1 148 ? -8.292  83.562  93.034  1.00 35.87  ? 148  PHE B C   1 
ATOM   3216  O  O   . PHE B  1 148 ? -9.416  83.131  93.274  1.00 35.72  ? 148  PHE B O   1 
ATOM   3217  C  CB  . PHE B  1 148 ? -6.424  83.377  94.642  1.00 36.63  ? 148  PHE B CB  1 
ATOM   3218  C  CG  . PHE B  1 148 ? -6.966  82.075  95.203  1.00 36.87  ? 148  PHE B CG  1 
ATOM   3219  C  CD1 . PHE B  1 148 ? -7.445  82.005  96.511  1.00 35.87  ? 148  PHE B CD1 1 
ATOM   3220  C  CD2 . PHE B  1 148 ? -7.045  80.935  94.403  1.00 31.01  ? 148  PHE B CD2 1 
ATOM   3221  C  CE1 . PHE B  1 148 ? -7.997  80.818  97.013  1.00 38.69  ? 148  PHE B CE1 1 
ATOM   3222  C  CE2 . PHE B  1 148 ? -7.593  79.748  94.891  1.00 35.16  ? 148  PHE B CE2 1 
ATOM   3223  C  CZ  . PHE B  1 148 ? -8.071  79.687  96.200  1.00 37.43  ? 148  PHE B CZ  1 
ATOM   3224  N  N   . SER B  1 149 ? -7.704  83.408  91.848  1.00 32.72  ? 149  SER B N   1 
ATOM   3225  C  CA  . SER B  1 149 ? -8.369  82.655  90.774  1.00 32.26  ? 149  SER B CA  1 
ATOM   3226  C  C   . SER B  1 149 ? -7.379  81.622  90.247  1.00 30.14  ? 149  SER B C   1 
ATOM   3227  O  O   . SER B  1 149 ? -6.170  81.805  90.368  1.00 29.36  ? 149  SER B O   1 
ATOM   3228  C  CB  . SER B  1 149 ? -8.854  83.576  89.648  1.00 31.70  ? 149  SER B CB  1 
ATOM   3229  O  OG  . SER B  1 149 ? -7.790  84.244  89.001  1.00 33.80  ? 149  SER B OG  1 
ATOM   3230  N  N   . VAL B  1 150 ? -7.891  80.538  89.673  1.00 29.07  ? 150  VAL B N   1 
ATOM   3231  C  CA  . VAL B  1 150 ? -7.041  79.451  89.192  1.00 28.71  ? 150  VAL B CA  1 
ATOM   3232  C  C   . VAL B  1 150 ? -7.194  79.087  87.724  1.00 29.08  ? 150  VAL B C   1 
ATOM   3233  O  O   . VAL B  1 150 ? -8.256  79.265  87.122  1.00 30.38  ? 150  VAL B O   1 
ATOM   3234  C  CB  . VAL B  1 150 ? -7.286  78.141  90.031  1.00 29.44  ? 150  VAL B CB  1 
ATOM   3235  C  CG1 . VAL B  1 150 ? -6.454  76.967  89.497  1.00 22.20  ? 150  VAL B CG1 1 
ATOM   3236  C  CG2 . VAL B  1 150 ? -6.948  78.402  91.480  1.00 28.46  ? 150  VAL B CG2 1 
ATOM   3237  N  N   . TYR B  1 151 ? -6.101  78.570  87.168  1.00 27.88  ? 151  TYR B N   1 
ATOM   3238  C  CA  . TYR B  1 151 ? -6.041  78.093  85.799  1.00 23.56  ? 151  TYR B CA  1 
ATOM   3239  C  C   . TYR B  1 151 ? -5.554  76.674  85.932  1.00 24.48  ? 151  TYR B C   1 
ATOM   3240  O  O   . TYR B  1 151 ? -4.541  76.429  86.589  1.00 22.80  ? 151  TYR B O   1 
ATOM   3241  C  CB  . TYR B  1 151 ? -5.023  78.883  84.987  1.00 26.49  ? 151  TYR B CB  1 
ATOM   3242  C  CG  . TYR B  1 151 ? -5.589  80.112  84.317  1.00 34.56  ? 151  TYR B CG  1 
ATOM   3243  C  CD1 . TYR B  1 151 ? -6.603  80.004  83.371  1.00 38.46  ? 151  TYR B CD1 1 
ATOM   3244  C  CD2 . TYR B  1 151 ? -5.117  81.381  84.625  1.00 36.43  ? 151  TYR B CD2 1 
ATOM   3245  C  CE1 . TYR B  1 151 ? -7.132  81.124  82.751  1.00 39.78  ? 151  TYR B CE1 1 
ATOM   3246  C  CE2 . TYR B  1 151 ? -5.640  82.508  84.009  1.00 39.71  ? 151  TYR B CE2 1 
ATOM   3247  C  CZ  . TYR B  1 151 ? -6.648  82.373  83.074  1.00 39.38  ? 151  TYR B CZ  1 
ATOM   3248  O  OH  . TYR B  1 151 ? -7.185  83.481  82.463  1.00 38.74  ? 151  TYR B OH  1 
ATOM   3249  N  N   . VAL B  1 152 ? -6.285  75.723  85.366  1.00 22.00  ? 152  VAL B N   1 
ATOM   3250  C  CA  . VAL B  1 152 ? -5.817  74.349  85.432  1.00 21.64  ? 152  VAL B CA  1 
ATOM   3251  C  C   . VAL B  1 152 ? -5.921  73.683  84.067  1.00 22.05  ? 152  VAL B C   1 
ATOM   3252  O  O   . VAL B  1 152 ? -6.856  73.957  83.304  1.00 24.85  ? 152  VAL B O   1 
ATOM   3253  C  CB  . VAL B  1 152 ? -6.585  73.525  86.518  1.00 22.11  ? 152  VAL B CB  1 
ATOM   3254  C  CG1 . VAL B  1 152 ? -8.104  73.526  86.257  1.00 22.43  ? 152  VAL B CG1 1 
ATOM   3255  C  CG2 . VAL B  1 152 ? -6.050  72.112  86.547  1.00 18.73  ? 152  VAL B CG2 1 
ATOM   3256  N  N   . THR B  1 153 ? -4.942  72.842  83.741  1.00 20.09  ? 153  THR B N   1 
ATOM   3257  C  CA  . THR B  1 153 ? -4.939  72.135  82.464  1.00 21.27  ? 153  THR B CA  1 
ATOM   3258  C  C   . THR B  1 153 ? -6.001  71.038  82.510  1.00 26.06  ? 153  THR B C   1 
ATOM   3259  O  O   . THR B  1 153 ? -6.259  70.458  83.573  1.00 23.56  ? 153  THR B O   1 
ATOM   3260  C  CB  . THR B  1 153 ? -3.560  71.484  82.184  1.00 23.22  ? 153  THR B CB  1 
ATOM   3261  O  OG1 . THR B  1 153 ? -3.190  70.645  83.287  1.00 23.91  ? 153  THR B OG1 1 
ATOM   3262  C  CG2 . THR B  1 153 ? -2.490  72.543  81.993  1.00 19.08  ? 153  THR B CG2 1 
ATOM   3263  N  N   . GLU B  1 154 ? -6.634  70.757  81.372  1.00 31.72  ? 154  GLU B N   1 
ATOM   3264  C  CA  . GLU B  1 154 ? -7.656  69.704  81.334  1.00 33.27  ? 154  GLU B CA  1 
ATOM   3265  C  C   . GLU B  1 154 ? -6.985  68.384  81.651  1.00 32.89  ? 154  GLU B C   1 
ATOM   3266  O  O   . GLU B  1 154 ? -7.569  67.524  82.299  1.00 34.31  ? 154  GLU B O   1 
ATOM   3267  C  CB  . GLU B  1 154 ? -8.332  69.626  79.965  1.00 35.47  ? 154  GLU B CB  1 
ATOM   3268  C  CG  . GLU B  1 154 ? -7.418  69.400  78.774  1.00 38.47  ? 154  GLU B CG  1 
ATOM   3269  C  CD  . GLU B  1 154 ? -8.223  69.193  77.501  1.00 42.51  ? 154  GLU B CD  1 
ATOM   3270  O  OE1 . GLU B  1 154 ? -9.298  69.827  77.389  1.00 43.94  ? 154  GLU B OE1 1 
ATOM   3271  O  OE2 . GLU B  1 154 ? -7.791  68.416  76.619  1.00 43.32  ? 154  GLU B OE2 1 
ATOM   3272  N  N   . SER B  1 155 ? -5.746  68.254  81.178  1.00 34.07  ? 155  SER B N   1 
ATOM   3273  C  CA  . SER B  1 155 ? -4.902  67.089  81.406  1.00 30.82  ? 155  SER B CA  1 
ATOM   3274  C  C   . SER B  1 155 ? -5.347  65.792  80.732  1.00 31.52  ? 155  SER B C   1 
ATOM   3275  O  O   . SER B  1 155 ? -5.970  64.942  81.357  1.00 28.76  ? 155  SER B O   1 
ATOM   3276  C  CB  . SER B  1 155 ? -4.742  66.866  82.921  1.00 31.04  ? 155  SER B CB  1 
ATOM   3277  O  OG  . SER B  1 155 ? -3.662  65.995  83.210  1.00 30.17  ? 155  SER B OG  1 
ATOM   3278  N  N   . GLN B  1 156 ? -5.021  65.642  79.452  1.00 34.52  ? 156  GLN B N   1 
ATOM   3279  C  CA  . GLN B  1 156 ? -5.342  64.416  78.719  1.00 35.29  ? 156  GLN B CA  1 
ATOM   3280  C  C   . GLN B  1 156 ? -4.521  63.317  79.393  1.00 34.66  ? 156  GLN B C   1 
ATOM   3281  O  O   . GLN B  1 156 ? -3.583  63.607  80.117  1.00 40.41  ? 156  GLN B O   1 
ATOM   3282  C  CB  . GLN B  1 156 ? -4.892  64.532  77.263  1.00 34.93  ? 156  GLN B CB  1 
ATOM   3283  C  CG  . GLN B  1 156 ? -5.627  65.561  76.448  1.00 35.61  ? 156  GLN B CG  1 
ATOM   3284  C  CD  . GLN B  1 156 ? -7.018  65.112  76.103  1.00 39.08  ? 156  GLN B CD  1 
ATOM   3285  O  OE1 . GLN B  1 156 ? -7.347  63.925  76.225  1.00 36.84  ? 156  GLN B OE1 1 
ATOM   3286  N  NE2 . GLN B  1 156 ? -7.851  66.051  75.655  1.00 37.78  ? 156  GLN B NE2 1 
ATOM   3287  N  N   . PRO B  1 157 ? -4.868  62.047  79.180  1.00 34.50  ? 157  PRO B N   1 
ATOM   3288  C  CA  . PRO B  1 157 ? -5.996  61.650  78.342  1.00 35.41  ? 157  PRO B CA  1 
ATOM   3289  C  C   . PRO B  1 157 ? -7.272  61.540  79.166  1.00 35.37  ? 157  PRO B C   1 
ATOM   3290  O  O   . PRO B  1 157 ? -8.364  61.741  78.643  1.00 40.85  ? 157  PRO B O   1 
ATOM   3291  C  CB  . PRO B  1 157 ? -5.542  60.309  77.778  1.00 32.05  ? 157  PRO B CB  1 
ATOM   3292  C  CG  . PRO B  1 157 ? -4.757  59.739  78.918  1.00 32.26  ? 157  PRO B CG  1 
ATOM   3293  C  CD  . PRO B  1 157 ? -3.944  60.915  79.389  1.00 31.23  ? 157  PRO B CD  1 
ATOM   3294  N  N   . ASP B  1 158 ? -7.127  61.255  80.457  1.00 32.49  ? 158  ASP B N   1 
ATOM   3295  C  CA  . ASP B  1 158 ? -8.274  61.081  81.341  1.00 35.73  ? 158  ASP B CA  1 
ATOM   3296  C  C   . ASP B  1 158 ? -9.077  62.340  81.708  1.00 38.80  ? 158  ASP B C   1 
ATOM   3297  O  O   . ASP B  1 158 ? -10.183 62.239  82.229  1.00 39.82  ? 158  ASP B O   1 
ATOM   3298  C  CB  . ASP B  1 158 ? -7.823  60.376  82.616  1.00 38.31  ? 158  ASP B CB  1 
ATOM   3299  C  CG  . ASP B  1 158 ? -6.835  61.194  83.408  1.00 44.35  ? 158  ASP B CG  1 
ATOM   3300  O  OD1 . ASP B  1 158 ? -6.379  62.235  82.886  1.00 48.99  ? 158  ASP B OD1 1 
ATOM   3301  O  OD2 . ASP B  1 158 ? -6.507  60.800  84.548  1.00 45.85  ? 158  ASP B OD2 1 
ATOM   3302  N  N   . LEU B  1 159 ? -8.522  63.520  81.466  1.00 38.45  ? 159  LEU B N   1 
ATOM   3303  C  CA  . LEU B  1 159 ? -9.228  64.768  81.756  1.00 37.43  ? 159  LEU B CA  1 
ATOM   3304  C  C   . LEU B  1 159 ? -9.391  65.126  83.233  1.00 35.66  ? 159  LEU B C   1 
ATOM   3305  O  O   . LEU B  1 159 ? -10.358 65.794  83.615  1.00 37.43  ? 159  LEU B O   1 
ATOM   3306  C  CB  . LEU B  1 159 ? -10.604 64.746  81.085  1.00 35.39  ? 159  LEU B CB  1 
ATOM   3307  C  CG  . LEU B  1 159 ? -10.589 64.652  79.559  1.00 37.27  ? 159  LEU B CG  1 
ATOM   3308  C  CD1 . LEU B  1 159 ? -12.015 64.642  79.024  1.00 39.12  ? 159  LEU B CD1 1 
ATOM   3309  C  CD2 . LEU B  1 159 ? -9.826  65.833  78.990  1.00 39.38  ? 159  LEU B CD2 1 
ATOM   3310  N  N   . SER B  1 160 ? -8.434  64.720  84.058  1.00 33.80  ? 160  SER B N   1 
ATOM   3311  C  CA  . SER B  1 160 ? -8.513  64.998  85.491  1.00 32.25  ? 160  SER B CA  1 
ATOM   3312  C  C   . SER B  1 160 ? -8.556  66.491  85.833  1.00 28.97  ? 160  SER B C   1 
ATOM   3313  O  O   . SER B  1 160 ? -8.997  66.875  86.912  1.00 24.23  ? 160  SER B O   1 
ATOM   3314  C  CB  . SER B  1 160 ? -7.344  64.319  86.214  1.00 32.82  ? 160  SER B CB  1 
ATOM   3315  O  OG  . SER B  1 160 ? -6.100  64.745  85.686  1.00 43.48  ? 160  SER B OG  1 
ATOM   3316  N  N   . GLY B  1 161 ? -8.096  67.332  84.919  1.00 27.20  ? 161  GLY B N   1 
ATOM   3317  C  CA  . GLY B  1 161 ? -8.118  68.750  85.192  1.00 27.98  ? 161  GLY B CA  1 
ATOM   3318  C  C   . GLY B  1 161 ? -9.551  69.227  85.340  1.00 30.65  ? 161  GLY B C   1 
ATOM   3319  O  O   . GLY B  1 161 ? -9.860  70.136  86.112  1.00 29.70  ? 161  GLY B O   1 
ATOM   3320  N  N   . LYS B  1 162 ? -10.447 68.610  84.589  1.00 33.81  ? 162  LYS B N   1 
ATOM   3321  C  CA  . LYS B  1 162 ? -11.845 68.987  84.658  1.00 35.71  ? 162  LYS B CA  1 
ATOM   3322  C  C   . LYS B  1 162 ? -12.445 68.659  86.019  1.00 36.30  ? 162  LYS B C   1 
ATOM   3323  O  O   . LYS B  1 162 ? -13.220 69.450  86.573  1.00 34.34  ? 162  LYS B O   1 
ATOM   3324  C  CB  . LYS B  1 162 ? -12.611 68.304  83.532  1.00 37.26  ? 162  LYS B CB  1 
ATOM   3325  C  CG  . LYS B  1 162 ? -12.191 68.846  82.169  1.00 43.39  ? 162  LYS B CG  1 
ATOM   3326  C  CD  . LYS B  1 162 ? -13.039 68.316  81.051  1.00 45.50  ? 162  LYS B CD  1 
ATOM   3327  C  CE  . LYS B  1 162 ? -12.923 69.216  79.833  1.00 49.86  ? 162  LYS B CE  1 
ATOM   3328  N  NZ  . LYS B  1 162 ? -13.778 68.729  78.708  1.00 47.44  ? 162  LYS B NZ  1 
ATOM   3329  N  N   . LYS B  1 163 ? -12.075 67.500  86.563  1.00 36.31  ? 163  LYS B N   1 
ATOM   3330  C  CA  . LYS B  1 163 ? -12.571 67.088  87.870  1.00 35.81  ? 163  LYS B CA  1 
ATOM   3331  C  C   . LYS B  1 163 ? -12.094 68.117  88.880  1.00 36.08  ? 163  LYS B C   1 
ATOM   3332  O  O   . LYS B  1 163 ? -12.830 68.494  89.795  1.00 33.54  ? 163  LYS B O   1 
ATOM   3333  C  CB  . LYS B  1 163 ? -12.029 65.705  88.230  1.00 38.18  ? 163  LYS B CB  1 
ATOM   3334  C  CG  . LYS B  1 163 ? -12.499 64.605  87.292  1.00 46.87  ? 163  LYS B CG  1 
ATOM   3335  C  CD  . LYS B  1 163 ? -11.988 63.205  87.682  1.00 53.12  ? 163  LYS B CD  1 
ATOM   3336  C  CE  . LYS B  1 163 ? -12.472 62.736  89.069  1.00 55.43  ? 163  LYS B CE  1 
ATOM   3337  N  NZ  . LYS B  1 163 ? -11.633 63.231  90.210  1.00 55.70  ? 163  LYS B NZ  1 
HETATM 3338  N  N   . MSE B  1 164 ? -10.853 68.572  88.681  1.00 37.30  ? 164  MSE B N   1 
HETATM 3339  C  CA  . MSE B  1 164 ? -10.221 69.570  89.537  1.00 35.87  ? 164  MSE B CA  1 
HETATM 3340  C  C   . MSE B  1 164 ? -11.012 70.858  89.450  1.00 33.09  ? 164  MSE B C   1 
HETATM 3341  O  O   . MSE B  1 164 ? -11.304 71.470  90.468  1.00 34.50  ? 164  MSE B O   1 
HETATM 3342  C  CB  . MSE B  1 164 ? -8.772  69.827  89.101  1.00 41.04  ? 164  MSE B CB  1 
HETATM 3343  C  CG  . MSE B  1 164 ? -7.974  70.756  90.030  1.00 47.57  ? 164  MSE B CG  1 
HETATM 3344  SE SE  . MSE B  1 164 ? -7.641  70.026  91.840  1.00 65.44  ? 164  MSE B SE  1 
HETATM 3345  C  CE  . MSE B  1 164 ? -6.755  71.564  92.641  1.00 54.13  ? 164  MSE B CE  1 
ATOM   3346  N  N   . ALA B  1 165 ? -11.356 71.261  88.229  1.00 30.54  ? 165  ALA B N   1 
ATOM   3347  C  CA  . ALA B  1 165 ? -12.138 72.477  88.006  1.00 29.33  ? 165  ALA B CA  1 
ATOM   3348  C  C   . ALA B  1 165 ? -13.476 72.413  88.753  1.00 27.46  ? 165  ALA B C   1 
ATOM   3349  O  O   . ALA B  1 165 ? -13.865 73.393  89.371  1.00 24.10  ? 165  ALA B O   1 
ATOM   3350  C  CB  . ALA B  1 165 ? -12.367 72.689  86.505  1.00 25.79  ? 165  ALA B CB  1 
ATOM   3351  N  N   . LYS B  1 166 ? -14.159 71.260  88.702  1.00 27.37  ? 166  LYS B N   1 
ATOM   3352  C  CA  . LYS B  1 166 ? -15.438 71.058  89.405  1.00 29.64  ? 166  LYS B CA  1 
ATOM   3353  C  C   . LYS B  1 166 ? -15.250 71.198  90.921  1.00 30.24  ? 166  LYS B C   1 
ATOM   3354  O  O   . LYS B  1 166 ? -16.040 71.878  91.597  1.00 29.89  ? 166  LYS B O   1 
ATOM   3355  C  CB  . LYS B  1 166 ? -16.011 69.665  89.115  1.00 31.68  ? 166  LYS B CB  1 
ATOM   3356  C  CG  . LYS B  1 166 ? -16.212 69.389  87.657  1.00 38.52  ? 166  LYS B CG  1 
ATOM   3357  C  CD  . LYS B  1 166 ? -16.549 67.933  87.408  1.00 46.89  ? 166  LYS B CD  1 
ATOM   3358  C  CE  . LYS B  1 166 ? -16.538 67.607  85.905  1.00 49.57  ? 166  LYS B CE  1 
ATOM   3359  N  NZ  . LYS B  1 166 ? -16.448 66.134  85.656  1.00 53.57  ? 166  LYS B NZ  1 
ATOM   3360  N  N   . ALA B  1 167 ? -14.219 70.538  91.453  1.00 24.39  ? 167  ALA B N   1 
ATOM   3361  C  CA  . ALA B  1 167 ? -13.921 70.619  92.873  1.00 23.56  ? 167  ALA B CA  1 
ATOM   3362  C  C   . ALA B  1 167 ? -13.780 72.095  93.264  1.00 25.76  ? 167  ALA B C   1 
ATOM   3363  O  O   . ALA B  1 167 ? -14.459 72.589  94.153  1.00 28.06  ? 167  ALA B O   1 
ATOM   3364  C  CB  . ALA B  1 167 ? -12.646 69.878  93.162  1.00 23.17  ? 167  ALA B CB  1 
ATOM   3365  N  N   . LEU B  1 168 ? -12.900 72.804  92.576  1.00 30.39  ? 168  LEU B N   1 
ATOM   3366  C  CA  . LEU B  1 168 ? -12.690 74.214  92.841  1.00 34.42  ? 168  LEU B CA  1 
ATOM   3367  C  C   . LEU B  1 168 ? -13.998 74.986  92.685  1.00 39.88  ? 168  LEU B C   1 
ATOM   3368  O  O   . LEU B  1 168 ? -14.313 75.893  93.467  1.00 40.00  ? 168  LEU B O   1 
ATOM   3369  C  CB  . LEU B  1 168 ? -11.640 74.765  91.878  1.00 32.61  ? 168  LEU B CB  1 
ATOM   3370  C  CG  . LEU B  1 168 ? -10.223 74.315  92.232  1.00 31.04  ? 168  LEU B CG  1 
ATOM   3371  C  CD1 . LEU B  1 168 ? -9.225  74.861  91.217  1.00 31.00  ? 168  LEU B CD1 1 
ATOM   3372  C  CD2 . LEU B  1 168 ? -9.902  74.809  93.630  1.00 29.04  ? 168  LEU B CD2 1 
ATOM   3373  N  N   . CYS B  1 169 ? -14.753 74.614  91.663  1.00 41.72  ? 169  CYS B N   1 
ATOM   3374  C  CA  . CYS B  1 169 ? -16.020 75.248  91.379  1.00 44.71  ? 169  CYS B CA  1 
ATOM   3375  C  C   . CYS B  1 169 ? -17.002 75.078  92.551  1.00 44.40  ? 169  CYS B C   1 
ATOM   3376  O  O   . CYS B  1 169 ? -17.744 76.007  92.887  1.00 43.45  ? 169  CYS B O   1 
ATOM   3377  C  CB  . CYS B  1 169 ? -16.594 74.655  90.085  1.00 46.78  ? 169  CYS B CB  1 
ATOM   3378  S  SG  . CYS B  1 169 ? -18.253 75.215  89.651  1.00 57.37  ? 169  CYS B SG  1 
ATOM   3379  N  N   . HIS B  1 170 ? -16.996 73.909  93.188  1.00 43.93  ? 170  HIS B N   1 
ATOM   3380  C  CA  . HIS B  1 170 ? -17.914 73.665  94.307  1.00 43.38  ? 170  HIS B CA  1 
ATOM   3381  C  C   . HIS B  1 170 ? -17.616 74.571  95.480  1.00 42.71  ? 170  HIS B C   1 
ATOM   3382  O  O   . HIS B  1 170 ? -18.519 74.967  96.219  1.00 41.20  ? 170  HIS B O   1 
ATOM   3383  C  CB  . HIS B  1 170 ? -17.838 72.212  94.751  1.00 42.27  ? 170  HIS B CB  1 
ATOM   3384  C  CG  . HIS B  1 170 ? -18.301 71.250  93.709  1.00 42.28  ? 170  HIS B CG  1 
ATOM   3385  N  ND1 . HIS B  1 170 ? -18.063 69.895  93.791  1.00 46.53  ? 170  HIS B ND1 1 
ATOM   3386  C  CD2 . HIS B  1 170 ? -18.976 71.448  92.552  1.00 41.57  ? 170  HIS B CD2 1 
ATOM   3387  C  CE1 . HIS B  1 170 ? -18.567 69.299  92.724  1.00 47.99  ? 170  HIS B CE1 1 
ATOM   3388  N  NE2 . HIS B  1 170 ? -19.125 70.219  91.957  1.00 45.72  ? 170  HIS B NE2 1 
ATOM   3389  N  N   . LEU B  1 171 ? -16.337 74.893  95.638  1.00 41.61  ? 171  LEU B N   1 
ATOM   3390  C  CA  . LEU B  1 171 ? -15.890 75.769  96.703  1.00 40.10  ? 171  LEU B CA  1 
ATOM   3391  C  C   . LEU B  1 171 ? -16.001 77.223  96.258  1.00 40.36  ? 171  LEU B C   1 
ATOM   3392  O  O   . LEU B  1 171 ? -15.520 78.131  96.934  1.00 37.08  ? 171  LEU B O   1 
ATOM   3393  C  CB  . LEU B  1 171 ? -14.450 75.436  97.076  1.00 40.08  ? 171  LEU B CB  1 
ATOM   3394  C  CG  . LEU B  1 171 ? -14.312 74.032  97.656  1.00 41.03  ? 171  LEU B CG  1 
ATOM   3395  C  CD1 . LEU B  1 171 ? -12.847 73.728  97.920  1.00 41.30  ? 171  LEU B CD1 1 
ATOM   3396  C  CD2 . LEU B  1 171 ? -15.141 73.926  98.930  1.00 38.67  ? 171  LEU B CD2 1 
ATOM   3397  N  N   . ASN B  1 172 ? -16.630 77.443  95.109  1.00 40.87  ? 172  ASN B N   1 
ATOM   3398  C  CA  . ASN B  1 172 ? -16.817 78.801  94.613  1.00 44.77  ? 172  ASN B CA  1 
ATOM   3399  C  C   . ASN B  1 172 ? -15.479 79.519  94.362  1.00 44.13  ? 172  ASN B C   1 
ATOM   3400  O  O   . ASN B  1 172 ? -15.285 80.664  94.773  1.00 43.31  ? 172  ASN B O   1 
ATOM   3401  C  CB  . ASN B  1 172 ? -17.640 79.592  95.638  1.00 49.55  ? 172  ASN B CB  1 
ATOM   3402  C  CG  . ASN B  1 172 ? -18.316 80.800  95.045  1.00 50.08  ? 172  ASN B CG  1 
ATOM   3403  O  OD1 . ASN B  1 172 ? -18.498 81.802  95.726  1.00 54.75  ? 172  ASN B OD1 1 
ATOM   3404  N  ND2 . ASN B  1 172 ? -18.708 80.710  93.777  1.00 50.60  ? 172  ASN B ND2 1 
ATOM   3405  N  N   . VAL B  1 173 ? -14.561 78.835  93.689  1.00 43.41  ? 173  VAL B N   1 
ATOM   3406  C  CA  . VAL B  1 173 ? -13.252 79.400  93.381  1.00 40.92  ? 173  VAL B CA  1 
ATOM   3407  C  C   . VAL B  1 173 ? -13.207 79.706  91.887  1.00 38.25  ? 173  VAL B C   1 
ATOM   3408  O  O   . VAL B  1 173 ? -13.513 78.844  91.064  1.00 43.29  ? 173  VAL B O   1 
ATOM   3409  C  CB  . VAL B  1 173 ? -12.103 78.382  93.696  1.00 42.33  ? 173  VAL B CB  1 
ATOM   3410  C  CG1 . VAL B  1 173 ? -10.745 79.045  93.530  1.00 40.56  ? 173  VAL B CG1 1 
ATOM   3411  C  CG2 . VAL B  1 173 ? -12.257 77.825  95.099  1.00 43.16  ? 173  VAL B CG2 1 
ATOM   3412  N  N   . PRO B  1 174 ? -12.845 80.938  91.513  1.00 32.86  ? 174  PRO B N   1 
ATOM   3413  C  CA  . PRO B  1 174 ? -12.777 81.266  90.081  1.00 30.68  ? 174  PRO B CA  1 
ATOM   3414  C  C   . PRO B  1 174 ? -11.736 80.351  89.401  1.00 31.58  ? 174  PRO B C   1 
ATOM   3415  O  O   . PRO B  1 174 ? -10.545 80.392  89.720  1.00 31.43  ? 174  PRO B O   1 
ATOM   3416  C  CB  . PRO B  1 174 ? -12.341 82.729  90.082  1.00 30.95  ? 174  PRO B CB  1 
ATOM   3417  C  CG  . PRO B  1 174 ? -12.855 83.240  91.418  1.00 30.68  ? 174  PRO B CG  1 
ATOM   3418  C  CD  . PRO B  1 174 ? -12.574 82.114  92.353  1.00 30.53  ? 174  PRO B CD  1 
ATOM   3419  N  N   . VAL B  1 175 ? -12.183 79.525  88.469  1.00 31.04  ? 175  VAL B N   1 
ATOM   3420  C  CA  . VAL B  1 175 ? -11.279 78.608  87.793  1.00 34.45  ? 175  VAL B CA  1 
ATOM   3421  C  C   . VAL B  1 175 ? -11.604 78.402  86.311  1.00 37.43  ? 175  VAL B C   1 
ATOM   3422  O  O   . VAL B  1 175 ? -12.737 78.072  85.956  1.00 42.51  ? 175  VAL B O   1 
ATOM   3423  C  CB  . VAL B  1 175 ? -11.308 77.234  88.490  1.00 32.66  ? 175  VAL B CB  1 
ATOM   3424  C  CG1 . VAL B  1 175 ? -12.737 76.800  88.696  1.00 29.92  ? 175  VAL B CG1 1 
ATOM   3425  C  CG2 . VAL B  1 175 ? -10.583 76.211  87.662  1.00 30.14  ? 175  VAL B CG2 1 
ATOM   3426  N  N   . THR B  1 176 ? -10.613 78.584  85.449  1.00 35.44  ? 176  THR B N   1 
ATOM   3427  C  CA  . THR B  1 176 ? -10.812 78.379  84.015  1.00 35.31  ? 176  THR B CA  1 
ATOM   3428  C  C   . THR B  1 176 ? -10.045 77.129  83.572  1.00 33.63  ? 176  THR B C   1 
ATOM   3429  O  O   . THR B  1 176 ? -8.878  76.966  83.922  1.00 36.45  ? 176  THR B O   1 
ATOM   3430  C  CB  . THR B  1 176 ? -10.258 79.559  83.185  1.00 37.30  ? 176  THR B CB  1 
ATOM   3431  O  OG1 . THR B  1 176 ? -10.800 80.794  83.661  1.00 40.38  ? 176  THR B OG1 1 
ATOM   3432  C  CG2 . THR B  1 176 ? -10.602 79.383  81.722  1.00 35.31  ? 176  THR B CG2 1 
ATOM   3433  N  N   . VAL B  1 177 ? -10.688 76.242  82.818  1.00 32.49  ? 177  VAL B N   1 
ATOM   3434  C  CA  . VAL B  1 177 ? -9.990  75.062  82.324  1.00 28.37  ? 177  VAL B CA  1 
ATOM   3435  C  C   . VAL B  1 177 ? -9.256  75.470  81.064  1.00 32.46  ? 177  VAL B C   1 
ATOM   3436  O  O   . VAL B  1 177 ? -9.781  76.208  80.226  1.00 32.60  ? 177  VAL B O   1 
ATOM   3437  C  CB  . VAL B  1 177 ? -10.914 73.912  81.945  1.00 23.00  ? 177  VAL B CB  1 
ATOM   3438  C  CG1 . VAL B  1 177 ? -10.084 72.794  81.332  1.00 26.07  ? 177  VAL B CG1 1 
ATOM   3439  C  CG2 . VAL B  1 177 ? -11.630 73.390  83.165  1.00 27.72  ? 177  VAL B CG2 1 
ATOM   3440  N  N   . VAL B  1 178 ? -8.037  74.972  80.927  1.00 33.59  ? 178  VAL B N   1 
ATOM   3441  C  CA  . VAL B  1 178 ? -7.219  75.302  79.786  1.00 30.98  ? 178  VAL B CA  1 
ATOM   3442  C  C   . VAL B  1 178 ? -6.709  74.046  79.078  1.00 31.52  ? 178  VAL B C   1 
ATOM   3443  O  O   . VAL B  1 178 ? -6.648  72.955  79.650  1.00 32.35  ? 178  VAL B O   1 
ATOM   3444  C  CB  . VAL B  1 178 ? -6.060  76.227  80.259  1.00 33.73  ? 178  VAL B CB  1 
ATOM   3445  C  CG1 . VAL B  1 178 ? -4.841  76.085  79.380  1.00 35.38  ? 178  VAL B CG1 1 
ATOM   3446  C  CG2 . VAL B  1 178 ? -6.545  77.671  80.250  1.00 32.00  ? 178  VAL B CG2 1 
ATOM   3447  N  N   . LEU B  1 179 ? -6.375  74.221  77.809  1.00 32.54  ? 179  LEU B N   1 
ATOM   3448  C  CA  . LEU B  1 179 ? -5.858  73.167  76.951  1.00 30.40  ? 179  LEU B CA  1 
ATOM   3449  C  C   . LEU B  1 179 ? -4.413  72.892  77.360  1.00 28.83  ? 179  LEU B C   1 
ATOM   3450  O  O   . LEU B  1 179 ? -3.697  73.824  77.706  1.00 27.68  ? 179  LEU B O   1 
ATOM   3451  C  CB  . LEU B  1 179 ? -5.896  73.680  75.515  1.00 30.66  ? 179  LEU B CB  1 
ATOM   3452  C  CG  . LEU B  1 179 ? -6.657  72.941  74.421  1.00 36.15  ? 179  LEU B CG  1 
ATOM   3453  C  CD1 . LEU B  1 179 ? -7.857  72.223  74.987  1.00 32.21  ? 179  LEU B CD1 1 
ATOM   3454  C  CD2 . LEU B  1 179 ? -7.053  73.959  73.345  1.00 36.51  ? 179  LEU B CD2 1 
ATOM   3455  N  N   . ASP B  1 180 ? -3.979  71.633  77.314  1.00 30.42  ? 180  ASP B N   1 
ATOM   3456  C  CA  . ASP B  1 180 ? -2.594  71.290  77.670  1.00 29.10  ? 180  ASP B CA  1 
ATOM   3457  C  C   . ASP B  1 180 ? -1.611  72.053  76.793  1.00 27.58  ? 180  ASP B C   1 
ATOM   3458  O  O   . ASP B  1 180 ? -0.530  72.435  77.238  1.00 28.76  ? 180  ASP B O   1 
ATOM   3459  C  CB  . ASP B  1 180 ? -2.320  69.790  77.508  1.00 30.27  ? 180  ASP B CB  1 
ATOM   3460  C  CG  . ASP B  1 180 ? -3.180  68.928  78.416  1.00 36.95  ? 180  ASP B CG  1 
ATOM   3461  O  OD1 . ASP B  1 180 ? -3.400  69.329  79.586  1.00 40.25  ? 180  ASP B OD1 1 
ATOM   3462  O  OD2 . ASP B  1 180 ? -3.623  67.840  77.964  1.00 36.14  ? 180  ASP B OD2 1 
ATOM   3463  N  N   . ALA B  1 181 ? -1.997  72.260  75.540  1.00 27.74  ? 181  ALA B N   1 
ATOM   3464  C  CA  . ALA B  1 181 ? -1.182  72.987  74.573  1.00 23.33  ? 181  ALA B CA  1 
ATOM   3465  C  C   . ALA B  1 181 ? -1.135  74.477  74.877  1.00 22.40  ? 181  ALA B C   1 
ATOM   3466  O  O   . ALA B  1 181 ? -0.368  75.216  74.261  1.00 22.68  ? 181  ALA B O   1 
ATOM   3467  C  CB  . ALA B  1 181 ? -1.737  72.779  73.185  1.00 20.89  ? 181  ALA B CB  1 
ATOM   3468  N  N   . ALA B  1 182 ? -1.935  74.917  75.845  1.00 24.34  ? 182  ALA B N   1 
ATOM   3469  C  CA  . ALA B  1 182 ? -2.012  76.337  76.171  1.00 25.10  ? 182  ALA B CA  1 
ATOM   3470  C  C   . ALA B  1 182 ? -1.261  76.797  77.419  1.00 25.65  ? 182  ALA B C   1 
ATOM   3471  O  O   . ALA B  1 182 ? -1.453  77.919  77.890  1.00 25.83  ? 182  ALA B O   1 
ATOM   3472  C  CB  . ALA B  1 182 ? -3.482  76.756  76.247  1.00 17.11  ? 182  ALA B CB  1 
ATOM   3473  N  N   . VAL B  1 183 ? -0.394  75.945  77.951  1.00 27.80  ? 183  VAL B N   1 
ATOM   3474  C  CA  . VAL B  1 183 ? 0.352   76.333  79.134  1.00 30.34  ? 183  VAL B CA  1 
ATOM   3475  C  C   . VAL B  1 183 ? 1.296   77.467  78.804  1.00 28.84  ? 183  VAL B C   1 
ATOM   3476  O  O   . VAL B  1 183 ? 1.347   78.448  79.527  1.00 31.70  ? 183  VAL B O   1 
ATOM   3477  C  CB  . VAL B  1 183 ? 1.156   75.167  79.736  1.00 31.44  ? 183  VAL B CB  1 
ATOM   3478  C  CG1 . VAL B  1 183 ? 2.069   75.685  80.833  1.00 32.70  ? 183  VAL B CG1 1 
ATOM   3479  C  CG2 . VAL B  1 183 ? 0.214   74.136  80.320  1.00 32.60  ? 183  VAL B CG2 1 
ATOM   3480  N  N   . GLY B  1 184 ? 2.032   77.350  77.707  1.00 29.79  ? 184  GLY B N   1 
ATOM   3481  C  CA  . GLY B  1 184 ? 2.954   78.418  77.344  1.00 31.22  ? 184  GLY B CA  1 
ATOM   3482  C  C   . GLY B  1 184 ? 2.236   79.742  77.166  1.00 29.62  ? 184  GLY B C   1 
ATOM   3483  O  O   . GLY B  1 184 ? 2.691   80.788  77.622  1.00 27.35  ? 184  GLY B O   1 
ATOM   3484  N  N   . TYR B  1 185 ? 1.099   79.671  76.483  1.00 29.86  ? 185  TYR B N   1 
ATOM   3485  C  CA  . TYR B  1 185 ? 0.239   80.809  76.204  1.00 26.38  ? 185  TYR B CA  1 
ATOM   3486  C  C   . TYR B  1 185 ? -0.232  81.487  77.490  1.00 28.74  ? 185  TYR B C   1 
ATOM   3487  O  O   . TYR B  1 185 ? -0.077  82.694  77.672  1.00 29.06  ? 185  TYR B O   1 
ATOM   3488  C  CB  . TYR B  1 185 ? -0.969  80.306  75.438  1.00 23.89  ? 185  TYR B CB  1 
ATOM   3489  C  CG  . TYR B  1 185 ? -2.086  81.305  75.298  1.00 28.23  ? 185  TYR B CG  1 
ATOM   3490  C  CD1 . TYR B  1 185 ? -2.039  82.309  74.329  1.00 22.85  ? 185  TYR B CD1 1 
ATOM   3491  C  CD2 . TYR B  1 185 ? -3.203  81.251  76.142  1.00 29.78  ? 185  TYR B CD2 1 
ATOM   3492  C  CE1 . TYR B  1 185 ? -3.073  83.229  74.199  1.00 22.51  ? 185  TYR B CE1 1 
ATOM   3493  C  CE2 . TYR B  1 185 ? -4.243  82.165  76.018  1.00 25.20  ? 185  TYR B CE2 1 
ATOM   3494  C  CZ  . TYR B  1 185 ? -4.174  83.148  75.041  1.00 26.03  ? 185  TYR B CZ  1 
ATOM   3495  O  OH  . TYR B  1 185 ? -5.236  84.011  74.881  1.00 30.74  ? 185  TYR B OH  1 
ATOM   3496  N  N   . ILE B  1 186 ? -0.809  80.676  78.371  1.00 30.08  ? 186  ILE B N   1 
ATOM   3497  C  CA  . ILE B  1 186 ? -1.362  81.098  79.650  1.00 26.07  ? 186  ILE B CA  1 
ATOM   3498  C  C   . ILE B  1 186 ? -0.363  81.558  80.723  1.00 27.62  ? 186  ILE B C   1 
ATOM   3499  O  O   . ILE B  1 186 ? -0.694  82.404  81.561  1.00 25.43  ? 186  ILE B O   1 
ATOM   3500  C  CB  . ILE B  1 186 ? -2.287  79.952  80.192  1.00 27.07  ? 186  ILE B CB  1 
ATOM   3501  C  CG1 . ILE B  1 186 ? -3.750  80.414  80.130  1.00 31.83  ? 186  ILE B CG1 1 
ATOM   3502  C  CG2 . ILE B  1 186 ? -1.864  79.472  81.582  1.00 25.22  ? 186  ILE B CG2 1 
ATOM   3503  C  CD1 . ILE B  1 186 ? -4.059  81.749  80.795  1.00 23.70  ? 186  ILE B CD1 1 
HETATM 3504  N  N   . MSE B  1 187 ? 0.863   81.043  80.682  1.00 27.75  ? 187  MSE B N   1 
HETATM 3505  C  CA  . MSE B  1 187 ? 1.865   81.398  81.686  1.00 28.98  ? 187  MSE B CA  1 
HETATM 3506  C  C   . MSE B  1 187 ? 1.938   82.864  82.055  1.00 28.77  ? 187  MSE B C   1 
HETATM 3507  O  O   . MSE B  1 187 ? 2.006   83.200  83.234  1.00 32.22  ? 187  MSE B O   1 
HETATM 3508  C  CB  . MSE B  1 187 ? 3.268   80.946  81.258  1.00 32.28  ? 187  MSE B CB  1 
HETATM 3509  C  CG  . MSE B  1 187 ? 4.290   80.950  82.411  1.00 40.28  ? 187  MSE B CG  1 
HETATM 3510  SE SE  . MSE B  1 187 ? 3.794   79.682  83.864  1.00 53.39  ? 187  MSE B SE  1 
HETATM 3511  C  CE  . MSE B  1 187 ? 2.924   80.943  85.038  1.00 58.84  ? 187  MSE B CE  1 
ATOM   3512  N  N   . GLU B  1 188 ? 1.927   83.744  81.062  1.00 31.90  ? 188  GLU B N   1 
ATOM   3513  C  CA  . GLU B  1 188 ? 2.042   85.164  81.356  1.00 32.73  ? 188  GLU B CA  1 
ATOM   3514  C  C   . GLU B  1 188 ? 0.997   85.762  82.272  1.00 32.20  ? 188  GLU B C   1 
ATOM   3515  O  O   . GLU B  1 188 ? 1.217   86.828  82.823  1.00 29.00  ? 188  GLU B O   1 
ATOM   3516  C  CB  . GLU B  1 188 ? 2.119   85.998  80.081  1.00 31.53  ? 188  GLU B CB  1 
ATOM   3517  C  CG  . GLU B  1 188 ? 0.948   85.919  79.160  1.00 33.94  ? 188  GLU B CG  1 
ATOM   3518  C  CD  . GLU B  1 188 ? 1.094   86.910  78.005  1.00 39.27  ? 188  GLU B CD  1 
ATOM   3519  O  OE1 . GLU B  1 188 ? 2.150   86.886  77.329  1.00 36.37  ? 188  GLU B OE1 1 
ATOM   3520  O  OE2 . GLU B  1 188 ? 0.156   87.713  77.774  1.00 41.41  ? 188  GLU B OE2 1 
ATOM   3521  N  N   . LYS B  1 189 ? -0.135  85.101  82.457  1.00 33.22  ? 189  LYS B N   1 
ATOM   3522  C  CA  . LYS B  1 189 ? -1.116  85.687  83.349  1.00 36.18  ? 189  LYS B CA  1 
ATOM   3523  C  C   . LYS B  1 189 ? -1.260  84.954  84.658  1.00 36.10  ? 189  LYS B C   1 
ATOM   3524  O  O   . LYS B  1 189 ? -2.298  85.025  85.302  1.00 41.72  ? 189  LYS B O   1 
ATOM   3525  C  CB  . LYS B  1 189 ? -2.478  85.828  82.667  1.00 35.18  ? 189  LYS B CB  1 
ATOM   3526  C  CG  . LYS B  1 189 ? -3.060  84.577  82.115  1.00 38.55  ? 189  LYS B CG  1 
ATOM   3527  C  CD  . LYS B  1 189 ? -4.461  84.857  81.602  1.00 43.05  ? 189  LYS B CD  1 
ATOM   3528  C  CE  . LYS B  1 189 ? -4.504  86.055  80.658  1.00 40.50  ? 189  LYS B CE  1 
ATOM   3529  N  NZ  . LYS B  1 189 ? -5.914  86.366  80.277  1.00 41.86  ? 189  LYS B NZ  1 
ATOM   3530  N  N   . ALA B  1 190 ? -0.202  84.264  85.061  1.00 34.66  ? 190  ALA B N   1 
ATOM   3531  C  CA  . ALA B  1 190 ? -0.212  83.524  86.311  1.00 33.43  ? 190  ALA B CA  1 
ATOM   3532  C  C   . ALA B  1 190 ? 0.886   84.090  87.194  1.00 33.77  ? 190  ALA B C   1 
ATOM   3533  O  O   . ALA B  1 190 ? 1.923   84.518  86.686  1.00 36.33  ? 190  ALA B O   1 
ATOM   3534  C  CB  . ALA B  1 190 ? 0.028   82.044  86.045  1.00 29.36  ? 190  ALA B CB  1 
ATOM   3535  N  N   . ASP B  1 191 ? 0.657   84.097  88.505  1.00 31.63  ? 191  ASP B N   1 
ATOM   3536  C  CA  . ASP B  1 191 ? 1.639   84.614  89.453  1.00 33.65  ? 191  ASP B CA  1 
ATOM   3537  C  C   . ASP B  1 191 ? 2.606   83.539  89.934  1.00 34.57  ? 191  ASP B C   1 
ATOM   3538  O  O   . ASP B  1 191 ? 3.750   83.819  90.318  1.00 34.71  ? 191  ASP B O   1 
ATOM   3539  C  CB  . ASP B  1 191 ? 0.930   85.218  90.653  1.00 34.70  ? 191  ASP B CB  1 
ATOM   3540  C  CG  . ASP B  1 191 ? 0.067   86.396  90.271  1.00 39.24  ? 191  ASP B CG  1 
ATOM   3541  O  OD1 . ASP B  1 191 ? 0.621   87.341  89.672  1.00 39.66  ? 191  ASP B OD1 1 
ATOM   3542  O  OD2 . ASP B  1 191 ? -1.152  86.382  90.563  1.00 39.52  ? 191  ASP B OD2 1 
ATOM   3543  N  N   . LEU B  1 192 ? 2.131   82.303  89.904  1.00 33.69  ? 192  LEU B N   1 
ATOM   3544  C  CA  . LEU B  1 192 ? 2.916   81.171  90.339  1.00 31.04  ? 192  LEU B CA  1 
ATOM   3545  C  C   . LEU B  1 192 ? 2.155   79.917  89.991  1.00 30.64  ? 192  LEU B C   1 
ATOM   3546  O  O   . LEU B  1 192 ? 0.943   79.953  89.726  1.00 27.49  ? 192  LEU B O   1 
ATOM   3547  C  CB  . LEU B  1 192 ? 3.127   81.222  91.854  1.00 33.74  ? 192  LEU B CB  1 
ATOM   3548  C  CG  . LEU B  1 192 ? 1.866   81.180  92.719  1.00 35.23  ? 192  LEU B CG  1 
ATOM   3549  C  CD1 . LEU B  1 192 ? 2.233   80.880  94.168  1.00 36.33  ? 192  LEU B CD1 1 
ATOM   3550  C  CD2 . LEU B  1 192 ? 1.133   82.509  92.604  1.00 36.30  ? 192  LEU B CD2 1 
ATOM   3551  N  N   . VAL B  1 193 ? 2.864   78.798  89.966  1.00 28.23  ? 193  VAL B N   1 
ATOM   3552  C  CA  . VAL B  1 193 ? 2.174   77.563  89.683  1.00 29.74  ? 193  VAL B CA  1 
ATOM   3553  C  C   . VAL B  1 193 ? 2.401   76.636  90.865  1.00 30.16  ? 193  VAL B C   1 
ATOM   3554  O  O   . VAL B  1 193 ? 3.482   76.623  91.464  1.00 29.48  ? 193  VAL B O   1 
ATOM   3555  C  CB  . VAL B  1 193 ? 2.614   76.933  88.308  1.00 25.97  ? 193  VAL B CB  1 
ATOM   3556  C  CG1 . VAL B  1 193 ? 3.435   77.927  87.521  1.00 18.79  ? 193  VAL B CG1 1 
ATOM   3557  C  CG2 . VAL B  1 193 ? 3.318   75.607  88.511  1.00 24.03  ? 193  VAL B CG2 1 
ATOM   3558  N  N   . ILE B  1 194 ? 1.341   75.924  91.239  1.00 30.41  ? 194  ILE B N   1 
ATOM   3559  C  CA  . ILE B  1 194 ? 1.389   74.975  92.344  1.00 28.76  ? 194  ILE B CA  1 
ATOM   3560  C  C   . ILE B  1 194 ? 1.002   73.660  91.721  1.00 28.83  ? 194  ILE B C   1 
ATOM   3561  O  O   . ILE B  1 194 ? 0.015   73.560  91.016  1.00 29.21  ? 194  ILE B O   1 
ATOM   3562  C  CB  . ILE B  1 194 ? 0.389   75.318  93.469  1.00 24.96  ? 194  ILE B CB  1 
ATOM   3563  C  CG1 . ILE B  1 194 ? 0.682   76.718  94.013  1.00 27.13  ? 194  ILE B CG1 1 
ATOM   3564  C  CG2 . ILE B  1 194 ? 0.515   74.303  94.608  1.00 18.66  ? 194  ILE B CG2 1 
ATOM   3565  C  CD1 . ILE B  1 194 ? -0.212  77.154  95.185  1.00 25.88  ? 194  ILE B CD1 1 
ATOM   3566  N  N   . VAL B  1 195 ? 1.792   72.644  91.991  1.00 28.27  ? 195  VAL B N   1 
ATOM   3567  C  CA  . VAL B  1 195 ? 1.543   71.351  91.421  1.00 26.52  ? 195  VAL B CA  1 
ATOM   3568  C  C   . VAL B  1 195 ? 1.822   70.301  92.477  1.00 28.07  ? 195  VAL B C   1 
ATOM   3569  O  O   . VAL B  1 195 ? 2.598   70.544  93.400  1.00 31.69  ? 195  VAL B O   1 
ATOM   3570  C  CB  . VAL B  1 195 ? 2.463   71.153  90.210  1.00 27.61  ? 195  VAL B CB  1 
ATOM   3571  C  CG1 . VAL B  1 195 ? 2.831   69.702  90.053  1.00 31.66  ? 195  VAL B CG1 1 
ATOM   3572  C  CG2 . VAL B  1 195 ? 1.774   71.659  88.961  1.00 27.15  ? 195  VAL B CG2 1 
ATOM   3573  N  N   . GLY B  1 196 ? 1.171   69.147  92.348  1.00 25.95  ? 196  GLY B N   1 
ATOM   3574  C  CA  . GLY B  1 196 ? 1.389   68.061  93.278  1.00 21.40  ? 196  GLY B CA  1 
ATOM   3575  C  C   . GLY B  1 196 ? 2.483   67.150  92.749  1.00 25.13  ? 196  GLY B C   1 
ATOM   3576  O  O   . GLY B  1 196 ? 3.130   67.452  91.751  1.00 27.61  ? 196  GLY B O   1 
ATOM   3577  N  N   . ALA B  1 197 ? 2.699   66.023  93.410  1.00 25.29  ? 197  ALA B N   1 
ATOM   3578  C  CA  . ALA B  1 197 ? 3.721   65.105  92.972  1.00 24.40  ? 197  ALA B CA  1 
ATOM   3579  C  C   . ALA B  1 197 ? 3.293   63.686  93.263  1.00 26.92  ? 197  ALA B C   1 
ATOM   3580  O  O   . ALA B  1 197 ? 2.551   63.435  94.210  1.00 26.61  ? 197  ALA B O   1 
ATOM   3581  C  CB  . ALA B  1 197 ? 5.031   65.406  93.686  1.00 20.00  ? 197  ALA B CB  1 
ATOM   3582  N  N   . GLU B  1 198 ? 3.761   62.765  92.432  1.00 26.98  ? 198  GLU B N   1 
ATOM   3583  C  CA  . GLU B  1 198 ? 3.481   61.355  92.603  1.00 29.87  ? 198  GLU B CA  1 
ATOM   3584  C  C   . GLU B  1 198 ? 4.626   60.826  93.460  1.00 33.81  ? 198  GLU B C   1 
ATOM   3585  O  O   . GLU B  1 198 ? 4.463   59.892  94.253  1.00 35.01  ? 198  GLU B O   1 
ATOM   3586  C  CB  . GLU B  1 198 ? 3.519   60.645  91.266  1.00 30.47  ? 198  GLU B CB  1 
ATOM   3587  C  CG  . GLU B  1 198 ? 2.537   61.137  90.250  1.00 42.17  ? 198  GLU B CG  1 
ATOM   3588  C  CD  . GLU B  1 198 ? 1.443   60.125  89.999  1.00 47.18  ? 198  GLU B CD  1 
ATOM   3589  O  OE1 . GLU B  1 198 ? 0.970   60.031  88.835  1.00 50.35  ? 198  GLU B OE1 1 
ATOM   3590  O  OE2 . GLU B  1 198 ? 1.065   59.430  90.971  1.00 44.94  ? 198  GLU B OE2 1 
ATOM   3591  N  N   . GLY B  1 199 ? 5.797   61.432  93.274  1.00 32.77  ? 199  GLY B N   1 
ATOM   3592  C  CA  . GLY B  1 199 ? 6.965   61.028  94.023  1.00 30.26  ? 199  GLY B CA  1 
ATOM   3593  C  C   . GLY B  1 199 ? 7.994   62.128  93.992  1.00 31.89  ? 199  GLY B C   1 
ATOM   3594  O  O   . GLY B  1 199 ? 8.066   62.895  93.029  1.00 36.12  ? 199  GLY B O   1 
ATOM   3595  N  N   . VAL B  1 200 ? 8.765   62.236  95.067  1.00 27.03  ? 200  VAL B N   1 
ATOM   3596  C  CA  . VAL B  1 200 ? 9.830   63.223  95.155  1.00 23.85  ? 200  VAL B CA  1 
ATOM   3597  C  C   . VAL B  1 200 ? 11.120  62.384  95.097  1.00 25.78  ? 200  VAL B C   1 
ATOM   3598  O  O   . VAL B  1 200 ? 11.368  61.560  95.975  1.00 28.41  ? 200  VAL B O   1 
ATOM   3599  C  CB  . VAL B  1 200 ? 9.742   64.001  96.488  1.00 21.41  ? 200  VAL B CB  1 
ATOM   3600  C  CG1 . VAL B  1 200 ? 10.890  65.009  96.583  1.00 19.90  ? 200  VAL B CG1 1 
ATOM   3601  C  CG2 . VAL B  1 200 ? 8.403   64.717  96.583  1.00 15.93  ? 200  VAL B CG2 1 
ATOM   3602  N  N   . VAL B  1 201 ? 11.932  62.555  94.063  1.00 25.16  ? 201  VAL B N   1 
ATOM   3603  C  CA  . VAL B  1 201 ? 13.144  61.738  93.963  1.00 24.55  ? 201  VAL B CA  1 
ATOM   3604  C  C   . VAL B  1 201 ? 14.283  62.311  94.806  1.00 26.33  ? 201  VAL B C   1 
ATOM   3605  O  O   . VAL B  1 201 ? 14.168  63.416  95.332  1.00 28.27  ? 201  VAL B O   1 
ATOM   3606  C  CB  . VAL B  1 201 ? 13.561  61.539  92.479  1.00 20.39  ? 201  VAL B CB  1 
ATOM   3607  C  CG1 . VAL B  1 201 ? 12.453  60.784  91.734  1.00 16.72  ? 201  VAL B CG1 1 
ATOM   3608  C  CG2 . VAL B  1 201 ? 13.791  62.879  91.801  1.00 21.04  ? 201  VAL B CG2 1 
ATOM   3609  N  N   . GLU B  1 202 ? 15.367  61.550  94.943  1.00 27.83  ? 202  GLU B N   1 
ATOM   3610  C  CA  . GLU B  1 202 ? 16.505  61.944  95.770  1.00 27.70  ? 202  GLU B CA  1 
ATOM   3611  C  C   . GLU B  1 202 ? 17.121  63.304  95.437  1.00 27.63  ? 202  GLU B C   1 
ATOM   3612  O  O   . GLU B  1 202 ? 17.510  64.029  96.342  1.00 26.51  ? 202  GLU B O   1 
ATOM   3613  C  CB  . GLU B  1 202 ? 17.572  60.845  95.732  1.00 32.31  ? 202  GLU B CB  1 
ATOM   3614  C  CG  . GLU B  1 202 ? 17.066  59.468  96.168  1.00 35.11  ? 202  GLU B CG  1 
ATOM   3615  C  CD  . GLU B  1 202 ? 17.958  58.323  95.679  1.00 41.72  ? 202  GLU B CD  1 
ATOM   3616  O  OE1 . GLU B  1 202 ? 18.469  58.415  94.541  1.00 44.98  ? 202  GLU B OE1 1 
ATOM   3617  O  OE2 . GLU B  1 202 ? 18.136  57.321  96.411  1.00 40.71  ? 202  GLU B OE2 1 
ATOM   3618  N  N   . ASN B  1 203 ? 17.213  63.665  94.160  1.00 26.08  ? 203  ASN B N   1 
ATOM   3619  C  CA  . ASN B  1 203 ? 17.765  64.973  93.817  1.00 27.21  ? 203  ASN B CA  1 
ATOM   3620  C  C   . ASN B  1 203 ? 16.743  66.105  93.987  1.00 28.67  ? 203  ASN B C   1 
ATOM   3621  O  O   . ASN B  1 203 ? 17.023  67.270  93.669  1.00 27.78  ? 203  ASN B O   1 
ATOM   3622  C  CB  . ASN B  1 203 ? 18.318  64.994  92.387  1.00 26.97  ? 203  ASN B CB  1 
ATOM   3623  C  CG  . ASN B  1 203 ? 17.311  64.543  91.364  1.00 26.74  ? 203  ASN B CG  1 
ATOM   3624  O  OD1 . ASN B  1 203 ? 16.180  65.039  91.314  1.00 30.94  ? 203  ASN B OD1 1 
ATOM   3625  N  ND2 . ASN B  1 203 ? 17.713  63.599  90.533  1.00 26.62  ? 203  ASN B ND2 1 
ATOM   3626  N  N   . GLY B  1 204 ? 15.550  65.764  94.466  1.00 25.95  ? 204  GLY B N   1 
ATOM   3627  C  CA  . GLY B  1 204 ? 14.557  66.798  94.694  1.00 26.38  ? 204  GLY B CA  1 
ATOM   3628  C  C   . GLY B  1 204 ? 13.634  67.147  93.543  1.00 25.05  ? 204  GLY B C   1 
ATOM   3629  O  O   . GLY B  1 204 ? 12.821  68.058  93.666  1.00 23.68  ? 204  GLY B O   1 
ATOM   3630  N  N   . GLY B  1 205 ? 13.793  66.452  92.420  1.00 25.15  ? 205  GLY B N   1 
ATOM   3631  C  CA  . GLY B  1 205 ? 12.919  66.658  91.286  1.00 19.42  ? 205  GLY B CA  1 
ATOM   3632  C  C   . GLY B  1 205 ? 11.680  65.855  91.631  1.00 16.56  ? 205  GLY B C   1 
ATOM   3633  O  O   . GLY B  1 205 ? 11.545  65.406  92.761  1.00 14.01  ? 205  GLY B O   1 
ATOM   3634  N  N   . ILE B  1 206 ? 10.786  65.645  90.678  1.00 17.68  ? 206  ILE B N   1 
ATOM   3635  C  CA  . ILE B  1 206 ? 9.554   64.924  90.978  1.00 17.40  ? 206  ILE B CA  1 
ATOM   3636  C  C   . ILE B  1 206 ? 9.041   64.153  89.776  1.00 21.13  ? 206  ILE B C   1 
ATOM   3637  O  O   . ILE B  1 206 ? 9.357   64.474  88.627  1.00 21.68  ? 206  ILE B O   1 
ATOM   3638  C  CB  . ILE B  1 206 ? 8.394   65.903  91.409  1.00 14.76  ? 206  ILE B CB  1 
ATOM   3639  C  CG1 . ILE B  1 206 ? 8.043   66.846  90.246  1.00 15.18  ? 206  ILE B CG1 1 
ATOM   3640  C  CG2 . ILE B  1 206 ? 8.794   66.751  92.602  1.00 11.71  ? 206  ILE B CG2 1 
ATOM   3641  C  CD1 . ILE B  1 206 ? 6.816   67.731  90.494  1.00 14.05  ? 206  ILE B CD1 1 
ATOM   3642  N  N   . ILE B  1 207 ? 8.244   63.131  90.058  1.00 22.10  ? 207  ILE B N   1 
ATOM   3643  C  CA  . ILE B  1 207 ? 7.603   62.343  89.020  1.00 26.16  ? 207  ILE B CA  1 
ATOM   3644  C  C   . ILE B  1 207 ? 6.128   62.690  89.168  1.00 26.52  ? 207  ILE B C   1 
ATOM   3645  O  O   . ILE B  1 207 ? 5.589   62.609  90.265  1.00 29.62  ? 207  ILE B O   1 
ATOM   3646  C  CB  . ILE B  1 207 ? 7.791   60.835  89.235  1.00 24.57  ? 207  ILE B CB  1 
ATOM   3647  C  CG1 . ILE B  1 207 ? 9.266   60.480  89.113  1.00 23.73  ? 207  ILE B CG1 1 
ATOM   3648  C  CG2 . ILE B  1 207 ? 7.018   60.058  88.175  1.00 23.95  ? 207  ILE B CG2 1 
ATOM   3649  C  CD1 . ILE B  1 207 ? 9.550   59.023  89.460  1.00 28.86  ? 207  ILE B CD1 1 
ATOM   3650  N  N   . ASN B  1 208 ? 5.474   63.092  88.083  1.00 27.75  ? 208  ASN B N   1 
ATOM   3651  C  CA  . ASN B  1 208 ? 4.066   63.470  88.170  1.00 27.81  ? 208  ASN B CA  1 
ATOM   3652  C  C   . ASN B  1 208 ? 3.378   63.249  86.828  1.00 30.24  ? 208  ASN B C   1 
ATOM   3653  O  O   . ASN B  1 208 ? 4.008   62.768  85.885  1.00 33.90  ? 208  ASN B O   1 
ATOM   3654  C  CB  . ASN B  1 208 ? 3.972   64.940  88.581  1.00 28.85  ? 208  ASN B CB  1 
ATOM   3655  C  CG  . ASN B  1 208 ? 2.630   65.307  89.150  1.00 29.40  ? 208  ASN B CG  1 
ATOM   3656  O  OD1 . ASN B  1 208 ? 2.028   66.306  88.751  1.00 28.46  ? 208  ASN B OD1 1 
ATOM   3657  N  ND2 . ASN B  1 208 ? 2.156   64.515  90.099  1.00 30.95  ? 208  ASN B ND2 1 
ATOM   3658  N  N   . LYS B  1 209 ? 2.093   63.597  86.746  1.00 29.54  ? 209  LYS B N   1 
ATOM   3659  C  CA  . LYS B  1 209 ? 1.303   63.425  85.523  1.00 29.37  ? 209  LYS B CA  1 
ATOM   3660  C  C   . LYS B  1 209 ? 1.955   64.063  84.284  1.00 31.37  ? 209  LYS B C   1 
ATOM   3661  O  O   . LYS B  1 209 ? 2.417   65.208  84.338  1.00 25.73  ? 209  LYS B O   1 
ATOM   3662  C  CB  . LYS B  1 209 ? -0.093  64.019  85.733  1.00 30.21  ? 209  LYS B CB  1 
ATOM   3663  C  CG  . LYS B  1 209 ? -1.034  63.950  84.534  1.00 28.81  ? 209  LYS B CG  1 
ATOM   3664  C  CD  . LYS B  1 209 ? -1.435  62.521  84.190  1.00 29.67  ? 209  LYS B CD  1 
ATOM   3665  C  CE  . LYS B  1 209 ? -2.642  62.520  83.258  1.00 31.06  ? 209  LYS B CE  1 
ATOM   3666  N  NZ  . LYS B  1 209 ? -3.806  63.223  83.897  1.00 32.72  ? 209  LYS B NZ  1 
ATOM   3667  N  N   . ILE B  1 210 ? 1.979   63.319  83.175  1.00 29.22  ? 210  ILE B N   1 
ATOM   3668  C  CA  . ILE B  1 210 ? 2.576   63.810  81.940  1.00 31.26  ? 210  ILE B CA  1 
ATOM   3669  C  C   . ILE B  1 210 ? 2.105   65.247  81.643  1.00 32.19  ? 210  ILE B C   1 
ATOM   3670  O  O   . ILE B  1 210 ? 0.908   65.565  81.703  1.00 29.10  ? 210  ILE B O   1 
ATOM   3671  C  CB  . ILE B  1 210 ? 2.273   62.845  80.726  1.00 32.13  ? 210  ILE B CB  1 
ATOM   3672  C  CG1 . ILE B  1 210 ? 3.019   63.323  79.480  1.00 29.34  ? 210  ILE B CG1 1 
ATOM   3673  C  CG2 . ILE B  1 210 ? 0.792   62.765  80.447  1.00 30.20  ? 210  ILE B CG2 1 
ATOM   3674  C  CD1 . ILE B  1 210 ? 4.522   63.344  79.670  1.00 32.38  ? 210  ILE B CD1 1 
ATOM   3675  N  N   . GLY B  1 211 ? 3.071   66.113  81.353  1.00 29.50  ? 211  GLY B N   1 
ATOM   3676  C  CA  . GLY B  1 211 ? 2.764   67.502  81.088  1.00 28.28  ? 211  GLY B CA  1 
ATOM   3677  C  C   . GLY B  1 211 ? 3.332   68.415  82.167  1.00 27.99  ? 211  GLY B C   1 
ATOM   3678  O  O   . GLY B  1 211 ? 3.471   69.617  81.944  1.00 31.00  ? 211  GLY B O   1 
ATOM   3679  N  N   . THR B  1 212 ? 3.680   67.852  83.323  1.00 23.71  ? 212  THR B N   1 
ATOM   3680  C  CA  . THR B  1 212 ? 4.211   68.636  84.432  1.00 23.00  ? 212  THR B CA  1 
ATOM   3681  C  C   . THR B  1 212 ? 5.532   69.288  84.075  1.00 25.70  ? 212  THR B C   1 
ATOM   3682  O  O   . THR B  1 212 ? 5.768   70.444  84.415  1.00 21.86  ? 212  THR B O   1 
ATOM   3683  C  CB  . THR B  1 212 ? 4.435   67.770  85.691  1.00 23.18  ? 212  THR B CB  1 
ATOM   3684  O  OG1 . THR B  1 212 ? 3.176   67.291  86.162  1.00 26.52  ? 212  THR B OG1 1 
ATOM   3685  C  CG2 . THR B  1 212 ? 5.095   68.577  86.804  1.00 15.53  ? 212  THR B CG2 1 
ATOM   3686  N  N   . ASN B  1 213 ? 6.387   68.540  83.386  1.00 26.75  ? 213  ASN B N   1 
ATOM   3687  C  CA  . ASN B  1 213 ? 7.688   69.051  82.991  1.00 27.43  ? 213  ASN B CA  1 
ATOM   3688  C  C   . ASN B  1 213 ? 7.626   70.309  82.107  1.00 25.13  ? 213  ASN B C   1 
ATOM   3689  O  O   . ASN B  1 213 ? 8.245   71.329  82.428  1.00 25.71  ? 213  ASN B O   1 
ATOM   3690  C  CB  . ASN B  1 213 ? 8.491   67.951  82.295  1.00 29.45  ? 213  ASN B CB  1 
ATOM   3691  C  CG  . ASN B  1 213 ? 9.806   68.457  81.762  1.00 31.65  ? 213  ASN B CG  1 
ATOM   3692  O  OD1 . ASN B  1 213 ? 9.855   69.151  80.743  1.00 34.02  ? 213  ASN B OD1 1 
ATOM   3693  N  ND2 . ASN B  1 213 ? 10.880  68.135  82.458  1.00 33.84  ? 213  ASN B ND2 1 
ATOM   3694  N  N   . GLN B  1 214 ? 6.898   70.249  80.998  1.00 22.94  ? 214  GLN B N   1 
ATOM   3695  C  CA  . GLN B  1 214 ? 6.798   71.425  80.143  1.00 24.46  ? 214  GLN B CA  1 
ATOM   3696  C  C   . GLN B  1 214 ? 6.180   72.626  80.879  1.00 24.77  ? 214  GLN B C   1 
ATOM   3697  O  O   . GLN B  1 214 ? 6.492   73.777  80.570  1.00 25.89  ? 214  GLN B O   1 
ATOM   3698  C  CB  . GLN B  1 214 ? 6.040   71.111  78.846  1.00 21.92  ? 214  GLN B CB  1 
ATOM   3699  C  CG  . GLN B  1 214 ? 4.770   70.282  78.985  1.00 27.69  ? 214  GLN B CG  1 
ATOM   3700  C  CD  . GLN B  1 214 ? 4.202   69.873  77.618  1.00 30.87  ? 214  GLN B CD  1 
ATOM   3701  O  OE1 . GLN B  1 214 ? 4.899   69.264  76.787  1.00 26.98  ? 214  GLN B OE1 1 
ATOM   3702  N  NE2 . GLN B  1 214 ? 2.935   70.215  77.378  1.00 28.65  ? 214  GLN B NE2 1 
HETATM 3703  N  N   . MSE B  1 215 ? 5.324   72.380  81.863  1.00 24.62  ? 215  MSE B N   1 
HETATM 3704  C  CA  . MSE B  1 215 ? 4.777   73.496  82.614  1.00 25.04  ? 215  MSE B CA  1 
HETATM 3705  C  C   . MSE B  1 215 ? 5.937   74.142  83.385  1.00 23.54  ? 215  MSE B C   1 
HETATM 3706  O  O   . MSE B  1 215 ? 6.125   75.357  83.359  1.00 20.32  ? 215  MSE B O   1 
HETATM 3707  C  CB  . MSE B  1 215 ? 3.713   73.025  83.604  1.00 27.56  ? 215  MSE B CB  1 
HETATM 3708  C  CG  . MSE B  1 215 ? 3.105   74.177  84.411  1.00 35.09  ? 215  MSE B CG  1 
HETATM 3709  SE SE  . MSE B  1 215 ? 1.495   73.700  85.383  1.00 45.25  ? 215  MSE B SE  1 
HETATM 3710  C  CE  . MSE B  1 215 ? 0.271   73.597  83.869  1.00 44.14  ? 215  MSE B CE  1 
ATOM   3711  N  N   . ALA B  1 216 ? 6.722   73.307  84.054  1.00 22.07  ? 216  ALA B N   1 
ATOM   3712  C  CA  . ALA B  1 216 ? 7.853   73.768  84.840  1.00 21.43  ? 216  ALA B CA  1 
ATOM   3713  C  C   . ALA B  1 216 ? 8.849   74.524  83.974  1.00 22.30  ? 216  ALA B C   1 
ATOM   3714  O  O   . ALA B  1 216 ? 9.439   75.506  84.408  1.00 24.04  ? 216  ALA B O   1 
ATOM   3715  C  CB  . ALA B  1 216 ? 8.522   72.586  85.519  1.00 22.22  ? 216  ALA B CB  1 
ATOM   3716  N  N   . VAL B  1 217 ? 9.023   74.079  82.738  1.00 24.32  ? 217  VAL B N   1 
ATOM   3717  C  CA  . VAL B  1 217 ? 9.943   74.749  81.822  1.00 27.46  ? 217  VAL B CA  1 
ATOM   3718  C  C   . VAL B  1 217 ? 9.441   76.108  81.354  1.00 26.79  ? 217  VAL B C   1 
ATOM   3719  O  O   . VAL B  1 217 ? 10.233  77.014  81.132  1.00 29.00  ? 217  VAL B O   1 
ATOM   3720  C  CB  . VAL B  1 217 ? 10.244  73.883  80.578  1.00 29.15  ? 217  VAL B CB  1 
ATOM   3721  C  CG1 . VAL B  1 217 ? 11.241  74.614  79.668  1.00 23.28  ? 217  VAL B CG1 1 
ATOM   3722  C  CG2 . VAL B  1 217 ? 10.808  72.530  81.019  1.00 24.99  ? 217  VAL B CG2 1 
ATOM   3723  N  N   . CYS B  1 218 ? 8.130   76.253  81.201  1.00 28.76  ? 218  CYS B N   1 
ATOM   3724  C  CA  . CYS B  1 218 ? 7.566   77.531  80.772  1.00 27.71  ? 218  CYS B CA  1 
ATOM   3725  C  C   . CYS B  1 218 ? 7.548   78.520  81.932  1.00 25.98  ? 218  CYS B C   1 
ATOM   3726  O  O   . CYS B  1 218 ? 7.693   79.719  81.733  1.00 28.44  ? 218  CYS B O   1 
ATOM   3727  C  CB  . CYS B  1 218 ? 6.148   77.339  80.221  1.00 28.46  ? 218  CYS B CB  1 
ATOM   3728  S  SG  . CYS B  1 218 ? 6.068   76.470  78.610  1.00 29.47  ? 218  CYS B SG  1 
ATOM   3729  N  N   . ALA B  1 219 ? 7.379   78.009  83.145  1.00 23.20  ? 219  ALA B N   1 
ATOM   3730  C  CA  . ALA B  1 219 ? 7.359   78.855  84.325  1.00 20.86  ? 219  ALA B CA  1 
ATOM   3731  C  C   . ALA B  1 219 ? 8.754   79.449  84.519  1.00 27.90  ? 219  ALA B C   1 
ATOM   3732  O  O   . ALA B  1 219 ? 8.896   80.628  84.888  1.00 24.68  ? 219  ALA B O   1 
ATOM   3733  C  CB  . ALA B  1 219 ? 6.963   78.037  85.544  1.00 14.19  ? 219  ALA B CB  1 
ATOM   3734  N  N   . LYS B  1 220 ? 9.775   78.621  84.271  1.00 26.12  ? 220  LYS B N   1 
ATOM   3735  C  CA  . LYS B  1 220 ? 11.167  79.032  84.407  1.00 27.29  ? 220  LYS B CA  1 
ATOM   3736  C  C   . LYS B  1 220 ? 11.515  80.185  83.470  1.00 26.83  ? 220  LYS B C   1 
ATOM   3737  O  O   . LYS B  1 220 ? 12.030  81.216  83.894  1.00 27.69  ? 220  LYS B O   1 
ATOM   3738  C  CB  . LYS B  1 220 ? 12.100  77.864  84.084  1.00 32.31  ? 220  LYS B CB  1 
ATOM   3739  C  CG  . LYS B  1 220 ? 13.129  77.535  85.142  1.00 32.75  ? 220  LYS B CG  1 
ATOM   3740  C  CD  . LYS B  1 220 ? 13.968  78.718  85.501  1.00 36.93  ? 220  LYS B CD  1 
ATOM   3741  C  CE  . LYS B  1 220 ? 14.892  78.370  86.661  1.00 42.92  ? 220  LYS B CE  1 
ATOM   3742  N  NZ  . LYS B  1 220 ? 15.881  77.306  86.295  1.00 39.66  ? 220  LYS B NZ  1 
ATOM   3743  N  N   . ALA B  1 221 ? 11.237  80.005  82.187  1.00 24.09  ? 221  ALA B N   1 
ATOM   3744  C  CA  . ALA B  1 221 ? 11.558  81.029  81.213  1.00 21.40  ? 221  ALA B CA  1 
ATOM   3745  C  C   . ALA B  1 221 ? 10.896  82.350  81.570  1.00 24.18  ? 221  ALA B C   1 
ATOM   3746  O  O   . ALA B  1 221 ? 11.393  83.407  81.199  1.00 26.31  ? 221  ALA B O   1 
ATOM   3747  C  CB  . ALA B  1 221 ? 11.146  80.576  79.823  1.00 10.68  ? 221  ALA B CB  1 
ATOM   3748  N  N   . GLN B  1 222 ? 9.788   82.305  82.300  1.00 24.52  ? 222  GLN B N   1 
ATOM   3749  C  CA  . GLN B  1 222 ? 9.110   83.545  82.665  1.00 27.40  ? 222  GLN B CA  1 
ATOM   3750  C  C   . GLN B  1 222 ? 9.304   83.955  84.119  1.00 27.45  ? 222  GLN B C   1 
ATOM   3751  O  O   . GLN B  1 222 ? 8.510   84.717  84.672  1.00 24.83  ? 222  GLN B O   1 
ATOM   3752  C  CB  . GLN B  1 222 ? 7.620   83.447  82.348  1.00 28.53  ? 222  GLN B CB  1 
ATOM   3753  C  CG  . GLN B  1 222 ? 7.185   84.316  81.193  1.00 27.73  ? 222  GLN B CG  1 
ATOM   3754  C  CD  . GLN B  1 222 ? 5.774   83.997  80.723  1.00 32.56  ? 222  GLN B CD  1 
ATOM   3755  O  OE1 . GLN B  1 222 ? 5.549   83.014  80.012  1.00 27.82  ? 222  GLN B OE1 1 
ATOM   3756  N  NE2 . GLN B  1 222 ? 4.813   84.825  81.127  1.00 30.50  ? 222  GLN B NE2 1 
ATOM   3757  N  N   . ASN B  1 223 ? 10.368  83.442  84.730  1.00 29.56  ? 223  ASN B N   1 
ATOM   3758  C  CA  . ASN B  1 223 ? 10.702  83.740  86.116  1.00 29.12  ? 223  ASN B CA  1 
ATOM   3759  C  C   . ASN B  1 223 ? 9.496   83.641  87.071  1.00 28.94  ? 223  ASN B C   1 
ATOM   3760  O  O   . ASN B  1 223 ? 9.289   84.484  87.944  1.00 31.59  ? 223  ASN B O   1 
ATOM   3761  C  CB  . ASN B  1 223 ? 11.358  85.126  86.178  1.00 31.17  ? 223  ASN B CB  1 
ATOM   3762  C  CG  . ASN B  1 223 ? 12.019  85.401  87.519  1.00 39.07  ? 223  ASN B CG  1 
ATOM   3763  O  OD1 . ASN B  1 223 ? 12.551  84.490  88.162  1.00 38.78  ? 223  ASN B OD1 1 
ATOM   3764  N  ND2 . ASN B  1 223 ? 12.000  86.663  87.943  1.00 44.24  ? 223  ASN B ND2 1 
ATOM   3765  N  N   . LYS B  1 224 ? 8.713   82.586  86.908  1.00 27.36  ? 224  LYS B N   1 
ATOM   3766  C  CA  . LYS B  1 224 ? 7.535   82.359  87.735  1.00 27.81  ? 224  LYS B CA  1 
ATOM   3767  C  C   . LYS B  1 224 ? 7.802   81.253  88.772  1.00 28.29  ? 224  LYS B C   1 
ATOM   3768  O  O   . LYS B  1 224 ? 8.259   80.158  88.433  1.00 25.88  ? 224  LYS B O   1 
ATOM   3769  C  CB  . LYS B  1 224 ? 6.358   81.943  86.851  1.00 25.60  ? 224  LYS B CB  1 
ATOM   3770  C  CG  . LYS B  1 224 ? 6.025   82.909  85.736  1.00 26.81  ? 224  LYS B CG  1 
ATOM   3771  C  CD  . LYS B  1 224 ? 5.161   84.079  86.190  1.00 25.06  ? 224  LYS B CD  1 
ATOM   3772  C  CE  . LYS B  1 224 ? 4.576   84.773  84.972  1.00 28.62  ? 224  LYS B CE  1 
ATOM   3773  N  NZ  . LYS B  1 224 ? 4.132   86.152  85.247  1.00 24.70  ? 224  LYS B NZ  1 
ATOM   3774  N  N   . PRO B  1 225 ? 7.519   81.527  90.049  1.00 28.89  ? 225  PRO B N   1 
ATOM   3775  C  CA  . PRO B  1 225 ? 7.762   80.493  91.063  1.00 30.43  ? 225  PRO B CA  1 
ATOM   3776  C  C   . PRO B  1 225 ? 6.911   79.234  90.838  1.00 28.01  ? 225  PRO B C   1 
ATOM   3777  O  O   . PRO B  1 225 ? 5.696   79.308  90.655  1.00 26.44  ? 225  PRO B O   1 
ATOM   3778  C  CB  . PRO B  1 225 ? 7.472   81.216  92.384  1.00 28.72  ? 225  PRO B CB  1 
ATOM   3779  C  CG  . PRO B  1 225 ? 6.540   82.312  91.988  1.00 31.66  ? 225  PRO B CG  1 
ATOM   3780  C  CD  . PRO B  1 225 ? 7.050   82.780  90.659  1.00 29.29  ? 225  PRO B CD  1 
ATOM   3781  N  N   . PHE B  1 226 ? 7.593   78.090  90.835  1.00 24.86  ? 226  PHE B N   1 
ATOM   3782  C  CA  . PHE B  1 226 ? 7.001   76.789  90.597  1.00 24.72  ? 226  PHE B CA  1 
ATOM   3783  C  C   . PHE B  1 226 ? 7.092   76.040  91.920  1.00 28.94  ? 226  PHE B C   1 
ATOM   3784  O  O   . PHE B  1 226 ? 8.181   75.676  92.368  1.00 30.71  ? 226  PHE B O   1 
ATOM   3785  C  CB  . PHE B  1 226 ? 7.819   76.073  89.512  1.00 22.20  ? 226  PHE B CB  1 
ATOM   3786  C  CG  . PHE B  1 226 ? 7.253   74.749  89.069  1.00 21.92  ? 226  PHE B CG  1 
ATOM   3787  C  CD1 . PHE B  1 226 ? 6.318   74.682  88.044  1.00 25.18  ? 226  PHE B CD1 1 
ATOM   3788  C  CD2 . PHE B  1 226 ? 7.666   73.565  89.665  1.00 24.74  ? 226  PHE B CD2 1 
ATOM   3789  C  CE1 . PHE B  1 226 ? 5.795   73.452  87.613  1.00 25.64  ? 226  PHE B CE1 1 
ATOM   3790  C  CE2 . PHE B  1 226 ? 7.152   72.330  89.241  1.00 27.81  ? 226  PHE B CE2 1 
ATOM   3791  C  CZ  . PHE B  1 226 ? 6.213   72.274  88.211  1.00 25.98  ? 226  PHE B CZ  1 
ATOM   3792  N  N   . TYR B  1 227 ? 5.956   75.825  92.566  1.00 28.31  ? 227  TYR B N   1 
ATOM   3793  C  CA  . TYR B  1 227 ? 5.987   75.117  93.834  1.00 27.62  ? 227  TYR B CA  1 
ATOM   3794  C  C   . TYR B  1 227 ? 5.343   73.747  93.725  1.00 26.74  ? 227  TYR B C   1 
ATOM   3795  O  O   . TYR B  1 227 ? 4.346   73.565  93.018  1.00 27.97  ? 227  TYR B O   1 
ATOM   3796  C  CB  . TYR B  1 227 ? 5.260   75.901  94.938  1.00 27.57  ? 227  TYR B CB  1 
ATOM   3797  C  CG  . TYR B  1 227 ? 5.714   77.333  95.163  1.00 27.99  ? 227  TYR B CG  1 
ATOM   3798  C  CD1 . TYR B  1 227 ? 7.062   77.655  95.320  1.00 26.30  ? 227  TYR B CD1 1 
ATOM   3799  C  CD2 . TYR B  1 227 ? 4.775   78.359  95.288  1.00 29.11  ? 227  TYR B CD2 1 
ATOM   3800  C  CE1 . TYR B  1 227 ? 7.462   78.961  95.598  1.00 21.35  ? 227  TYR B CE1 1 
ATOM   3801  C  CE2 . TYR B  1 227 ? 5.163   79.656  95.571  1.00 28.50  ? 227  TYR B CE2 1 
ATOM   3802  C  CZ  . TYR B  1 227 ? 6.506   79.948  95.726  1.00 26.31  ? 227  TYR B CZ  1 
ATOM   3803  O  OH  . TYR B  1 227 ? 6.860   81.234  96.033  1.00 31.31  ? 227  TYR B OH  1 
ATOM   3804  N  N   . VAL B  1 228 ? 5.932   72.797  94.443  1.00 24.54  ? 228  VAL B N   1 
ATOM   3805  C  CA  . VAL B  1 228 ? 5.464   71.419  94.519  1.00 22.16  ? 228  VAL B CA  1 
ATOM   3806  C  C   . VAL B  1 228 ? 4.929   71.256  95.935  1.00 24.53  ? 228  VAL B C   1 
ATOM   3807  O  O   . VAL B  1 228 ? 5.473   71.802  96.887  1.00 26.31  ? 228  VAL B O   1 
ATOM   3808  C  CB  . VAL B  1 228 ? 6.606   70.408  94.296  1.00 18.18  ? 228  VAL B CB  1 
ATOM   3809  C  CG1 . VAL B  1 228 ? 6.127   69.010  94.630  1.00 10.08  ? 228  VAL B CG1 1 
ATOM   3810  C  CG2 . VAL B  1 228 ? 7.094   70.490  92.859  1.00 10.62  ? 228  VAL B CG2 1 
ATOM   3811  N  N   . VAL B  1 229 ? 3.874   70.477  96.064  1.00 24.01  ? 229  VAL B N   1 
ATOM   3812  C  CA  . VAL B  1 229 ? 3.218   70.279  97.334  1.00 21.87  ? 229  VAL B CA  1 
ATOM   3813  C  C   . VAL B  1 229 ? 3.067   68.755  97.465  1.00 22.98  ? 229  VAL B C   1 
ATOM   3814  O  O   . VAL B  1 229 ? 2.406   68.129  96.643  1.00 25.65  ? 229  VAL B O   1 
ATOM   3815  C  CB  . VAL B  1 229 ? 1.865   71.094  97.248  1.00 24.62  ? 229  VAL B CB  1 
ATOM   3816  C  CG1 . VAL B  1 229 ? 0.641   70.179  96.989  1.00 16.61  ? 229  VAL B CG1 1 
ATOM   3817  C  CG2 . VAL B  1 229 ? 1.727   71.976  98.444  1.00 26.17  ? 229  VAL B CG2 1 
ATOM   3818  N  N   . ALA B  1 230 ? 3.717   68.138  98.451  1.00 23.85  ? 230  ALA B N   1 
ATOM   3819  C  CA  . ALA B  1 230 ? 3.635   66.670  98.595  1.00 28.34  ? 230  ALA B CA  1 
ATOM   3820  C  C   . ALA B  1 230 ? 4.062   66.077  99.946  1.00 32.00  ? 230  ALA B C   1 
ATOM   3821  O  O   . ALA B  1 230 ? 4.941   66.602  100.634 1.00 32.66  ? 230  ALA B O   1 
ATOM   3822  C  CB  . ALA B  1 230 ? 4.415   65.984  97.464  1.00 17.35  ? 230  ALA B CB  1 
ATOM   3823  N  N   . GLU B  1 231 ? 3.424   64.964  100.300 1.00 35.86  ? 231  GLU B N   1 
ATOM   3824  C  CA  . GLU B  1 231 ? 3.677   64.258  101.556 1.00 40.27  ? 231  GLU B CA  1 
ATOM   3825  C  C   . GLU B  1 231 ? 5.019   63.523  101.541 1.00 42.23  ? 231  GLU B C   1 
ATOM   3826  O  O   . GLU B  1 231 ? 5.467   63.031  100.498 1.00 42.67  ? 231  GLU B O   1 
ATOM   3827  C  CB  . GLU B  1 231 ? 2.547   63.254  101.831 1.00 39.83  ? 231  GLU B CB  1 
ATOM   3828  C  CG  . GLU B  1 231 ? 1.141   63.840  101.702 1.00 45.32  ? 231  GLU B CG  1 
ATOM   3829  C  CD  . GLU B  1 231 ? 0.508   63.598  100.332 1.00 50.14  ? 231  GLU B CD  1 
ATOM   3830  O  OE1 . GLU B  1 231 ? 1.210   63.802  99.314  1.00 53.10  ? 231  GLU B OE1 1 
ATOM   3831  O  OE2 . GLU B  1 231 ? -0.692  63.214  100.271 1.00 51.46  ? 231  GLU B OE2 1 
ATOM   3832  N  N   . SER B  1 232 ? 5.653   63.427  102.704 1.00 41.40  ? 232  SER B N   1 
ATOM   3833  C  CA  . SER B  1 232 ? 6.945   62.769  102.785 1.00 39.19  ? 232  SER B CA  1 
ATOM   3834  C  C   . SER B  1 232 ? 6.950   61.312  102.320 1.00 38.67  ? 232  SER B C   1 
ATOM   3835  O  O   . SER B  1 232 ? 7.928   60.878  101.711 1.00 40.50  ? 232  SER B O   1 
ATOM   3836  C  CB  . SER B  1 232 ? 7.509   62.873  104.207 1.00 37.72  ? 232  SER B CB  1 
ATOM   3837  O  OG  . SER B  1 232 ? 6.588   62.403  105.173 1.00 36.21  ? 232  SER B OG  1 
ATOM   3838  N  N   . PHE B  1 233 ? 5.880   60.558  102.581 1.00 34.97  ? 233  PHE B N   1 
ATOM   3839  C  CA  . PHE B  1 233 ? 5.863   59.150  102.163 1.00 33.57  ? 233  PHE B CA  1 
ATOM   3840  C  C   . PHE B  1 233 ? 5.994   58.983  100.653 1.00 32.03  ? 233  PHE B C   1 
ATOM   3841  O  O   . PHE B  1 233 ? 6.064   57.862  100.134 1.00 28.06  ? 233  PHE B O   1 
ATOM   3842  C  CB  . PHE B  1 233 ? 4.610   58.408  102.697 1.00 34.67  ? 233  PHE B CB  1 
ATOM   3843  C  CG  . PHE B  1 233 ? 3.303   58.969  102.223 1.00 32.14  ? 233  PHE B CG  1 
ATOM   3844  C  CD1 . PHE B  1 233 ? 2.848   58.718  100.930 1.00 33.73  ? 233  PHE B CD1 1 
ATOM   3845  C  CD2 . PHE B  1 233 ? 2.531   59.766  103.068 1.00 34.45  ? 233  PHE B CD2 1 
ATOM   3846  C  CE1 . PHE B  1 233 ? 1.632   59.259  100.476 1.00 37.15  ? 233  PHE B CE1 1 
ATOM   3847  C  CE2 . PHE B  1 233 ? 1.316   60.314  102.636 1.00 36.79  ? 233  PHE B CE2 1 
ATOM   3848  C  CZ  . PHE B  1 233 ? 0.865   60.061  101.332 1.00 38.46  ? 233  PHE B CZ  1 
ATOM   3849  N  N   . LYS B  1 234 ? 6.033   60.113  99.951  1.00 33.30  ? 234  LYS B N   1 
ATOM   3850  C  CA  . LYS B  1 234 ? 6.195   60.104  98.503  1.00 33.22  ? 234  LYS B CA  1 
ATOM   3851  C  C   . LYS B  1 234 ? 7.682   60.143  98.097  1.00 33.58  ? 234  LYS B C   1 
ATOM   3852  O  O   . LYS B  1 234 ? 8.009   60.055  96.906  1.00 31.23  ? 234  LYS B O   1 
ATOM   3853  C  CB  . LYS B  1 234 ? 5.424   61.269  97.885  1.00 32.41  ? 234  LYS B CB  1 
ATOM   3854  C  CG  . LYS B  1 234 ? 4.034   60.877  97.451  1.00 33.07  ? 234  LYS B CG  1 
ATOM   3855  C  CD  . LYS B  1 234 ? 3.153   62.072  97.221  1.00 34.69  ? 234  LYS B CD  1 
ATOM   3856  C  CE  . LYS B  1 234 ? 1.736   61.622  96.901  1.00 36.72  ? 234  LYS B CE  1 
ATOM   3857  N  NZ  . LYS B  1 234 ? 0.803   62.780  96.786  1.00 34.12  ? 234  LYS B NZ  1 
ATOM   3858  N  N   . PHE B  1 235 ? 8.566   60.270  99.094  1.00 31.53  ? 235  PHE B N   1 
ATOM   3859  C  CA  . PHE B  1 235 ? 10.015  60.280  98.875  1.00 30.89  ? 235  PHE B CA  1 
ATOM   3860  C  C   . PHE B  1 235 ? 10.433  58.873  98.445  1.00 29.34  ? 235  PHE B C   1 
ATOM   3861  O  O   . PHE B  1 235 ? 10.351  57.936  99.234  1.00 28.87  ? 235  PHE B O   1 
ATOM   3862  C  CB  . PHE B  1 235 ? 10.761  60.643  100.167 1.00 31.15  ? 235  PHE B CB  1 
ATOM   3863  C  CG  . PHE B  1 235 ? 10.757  62.112  100.498 1.00 28.45  ? 235  PHE B CG  1 
ATOM   3864  C  CD1 . PHE B  1 235 ? 9.687   62.928  100.145 1.00 29.27  ? 235  PHE B CD1 1 
ATOM   3865  C  CD2 . PHE B  1 235 ? 11.811  62.671  101.212 1.00 28.29  ? 235  PHE B CD2 1 
ATOM   3866  C  CE1 . PHE B  1 235 ? 9.669   64.283  100.500 1.00 28.79  ? 235  PHE B CE1 1 
ATOM   3867  C  CE2 . PHE B  1 235 ? 11.806  64.026  101.577 1.00 28.04  ? 235  PHE B CE2 1 
ATOM   3868  C  CZ  . PHE B  1 235 ? 10.730  64.832  101.219 1.00 30.23  ? 235  PHE B CZ  1 
ATOM   3869  N  N   . VAL B  1 236 ? 10.887  58.747  97.202  1.00 26.37  ? 236  VAL B N   1 
ATOM   3870  C  CA  . VAL B  1 236 ? 11.299  57.475  96.637  1.00 28.10  ? 236  VAL B CA  1 
ATOM   3871  C  C   . VAL B  1 236 ? 12.819  57.404  96.360  1.00 29.69  ? 236  VAL B C   1 
ATOM   3872  O  O   . VAL B  1 236 ? 13.432  58.402  95.970  1.00 25.57  ? 236  VAL B O   1 
ATOM   3873  C  CB  . VAL B  1 236 ? 10.523  57.222  95.318  1.00 31.48  ? 236  VAL B CB  1 
ATOM   3874  C  CG1 . VAL B  1 236 ? 10.993  58.213  94.223  1.00 30.35  ? 236  VAL B CG1 1 
ATOM   3875  C  CG2 . VAL B  1 236 ? 10.708  55.785  94.867  1.00 30.69  ? 236  VAL B CG2 1 
ATOM   3876  N  N   . ARG B  1 237 ? 13.414  56.222  96.558  1.00 31.52  ? 237  ARG B N   1 
ATOM   3877  C  CA  . ARG B  1 237 ? 14.858  56.015  96.325  1.00 34.29  ? 237  ARG B CA  1 
ATOM   3878  C  C   . ARG B  1 237 ? 15.157  55.941  94.825  1.00 33.36  ? 237  ARG B C   1 
ATOM   3879  O  O   . ARG B  1 237 ? 15.339  54.862  94.261  1.00 33.36  ? 237  ARG B O   1 
ATOM   3880  C  CB  . ARG B  1 237 ? 15.347  54.714  96.978  1.00 33.78  ? 237  ARG B CB  1 
ATOM   3881  C  CG  . ARG B  1 237 ? 14.779  54.451  98.367  1.00 40.62  ? 237  ARG B CG  1 
ATOM   3882  C  CD  . ARG B  1 237 ? 15.690  54.895  99.490  1.00 37.10  ? 237  ARG B CD  1 
ATOM   3883  N  NE  . ARG B  1 237 ? 16.904  54.085  99.597  1.00 46.90  ? 237  ARG B NE  1 
ATOM   3884  C  CZ  . ARG B  1 237 ? 16.936  52.755  99.713  1.00 48.57  ? 237  ARG B CZ  1 
ATOM   3885  N  NH1 . ARG B  1 237 ? 15.804  52.049  99.734  1.00 50.51  ? 237  ARG B NH1 1 
ATOM   3886  N  NH2 . ARG B  1 237 ? 18.109  52.128  99.823  1.00 43.97  ? 237  ARG B NH2 1 
ATOM   3887  N  N   . LEU B  1 238 ? 15.196  57.099  94.182  1.00 33.09  ? 238  LEU B N   1 
ATOM   3888  C  CA  . LEU B  1 238 ? 15.473  57.176  92.758  1.00 30.53  ? 238  LEU B CA  1 
ATOM   3889  C  C   . LEU B  1 238 ? 16.230  58.442  92.409  1.00 29.18  ? 238  LEU B C   1 
ATOM   3890  O  O   . LEU B  1 238 ? 15.973  59.517  92.958  1.00 25.90  ? 238  LEU B O   1 
ATOM   3891  C  CB  . LEU B  1 238 ? 14.178  57.153  91.968  1.00 30.47  ? 238  LEU B CB  1 
ATOM   3892  C  CG  . LEU B  1 238 ? 13.531  55.792  91.833  1.00 31.36  ? 238  LEU B CG  1 
ATOM   3893  C  CD1 . LEU B  1 238 ? 12.178  55.949  91.174  1.00 34.79  ? 238  LEU B CD1 1 
ATOM   3894  C  CD2 . LEU B  1 238 ? 14.426  54.901  91.006  1.00 31.76  ? 238  LEU B CD2 1 
ATOM   3895  N  N   . PHE B  1 239 ? 17.172  58.304  91.490  1.00 29.16  ? 239  PHE B N   1 
ATOM   3896  C  CA  . PHE B  1 239 ? 17.948  59.443  91.065  1.00 29.24  ? 239  PHE B CA  1 
ATOM   3897  C  C   . PHE B  1 239 ? 17.991  59.525  89.548  1.00 30.47  ? 239  PHE B C   1 
ATOM   3898  O  O   . PHE B  1 239 ? 18.991  59.161  88.933  1.00 34.10  ? 239  PHE B O   1 
ATOM   3899  C  CB  . PHE B  1 239 ? 19.361  59.345  91.616  1.00 26.35  ? 239  PHE B CB  1 
ATOM   3900  C  CG  . PHE B  1 239 ? 20.071  60.660  91.647  1.00 26.39  ? 239  PHE B CG  1 
ATOM   3901  C  CD1 . PHE B  1 239 ? 20.185  61.367  92.832  1.00 20.42  ? 239  PHE B CD1 1 
ATOM   3902  C  CD2 . PHE B  1 239 ? 20.583  61.217  90.473  1.00 22.04  ? 239  PHE B CD2 1 
ATOM   3903  C  CE1 . PHE B  1 239 ? 20.801  62.614  92.848  1.00 22.93  ? 239  PHE B CE1 1 
ATOM   3904  C  CE2 . PHE B  1 239 ? 21.191  62.455  90.486  1.00 22.14  ? 239  PHE B CE2 1 
ATOM   3905  C  CZ  . PHE B  1 239 ? 21.300  63.156  91.682  1.00 21.69  ? 239  PHE B CZ  1 
ATOM   3906  N  N   . PRO B  1 240 ? 16.901  59.999  88.921  1.00 30.65  ? 240  PRO B N   1 
ATOM   3907  C  CA  . PRO B  1 240 ? 16.858  60.108  87.459  1.00 31.59  ? 240  PRO B CA  1 
ATOM   3908  C  C   . PRO B  1 240 ? 17.698  61.269  86.881  1.00 33.25  ? 240  PRO B C   1 
ATOM   3909  O  O   . PRO B  1 240 ? 17.838  62.316  87.513  1.00 34.29  ? 240  PRO B O   1 
ATOM   3910  C  CB  . PRO B  1 240 ? 15.363  60.261  87.181  1.00 28.02  ? 240  PRO B CB  1 
ATOM   3911  C  CG  . PRO B  1 240 ? 14.886  61.022  88.377  1.00 24.60  ? 240  PRO B CG  1 
ATOM   3912  C  CD  . PRO B  1 240 ? 15.598  60.357  89.515  1.00 27.91  ? 240  PRO B CD  1 
ATOM   3913  N  N   . LEU B  1 241 ? 18.276  61.069  85.697  1.00 33.51  ? 241  LEU B N   1 
ATOM   3914  C  CA  . LEU B  1 241 ? 19.055  62.128  85.045  1.00 34.46  ? 241  LEU B CA  1 
ATOM   3915  C  C   . LEU B  1 241 ? 18.207  62.748  83.932  1.00 35.48  ? 241  LEU B C   1 
ATOM   3916  O  O   . LEU B  1 241 ? 18.273  63.960  83.707  1.00 34.20  ? 241  LEU B O   1 
ATOM   3917  C  CB  . LEU B  1 241 ? 20.366  61.578  84.483  1.00 31.30  ? 241  LEU B CB  1 
ATOM   3918  C  CG  . LEU B  1 241 ? 21.383  61.243  85.576  1.00 29.46  ? 241  LEU B CG  1 
ATOM   3919  C  CD1 . LEU B  1 241 ? 22.647  60.612  84.969  1.00 26.38  ? 241  LEU B CD1 1 
ATOM   3920  C  CD2 . LEU B  1 241 ? 21.717  62.517  86.326  1.00 20.39  ? 241  LEU B CD2 1 
ATOM   3921  N  N   . ASN B  1 242 ? 17.417  61.899  83.260  1.00 32.44  ? 242  ASN B N   1 
ATOM   3922  C  CA  . ASN B  1 242 ? 16.489  62.298  82.202  1.00 32.72  ? 242  ASN B CA  1 
ATOM   3923  C  C   . ASN B  1 242 ? 15.257  61.377  82.207  1.00 32.63  ? 242  ASN B C   1 
ATOM   3924  O  O   . ASN B  1 242 ? 15.176  60.463  83.028  1.00 34.32  ? 242  ASN B O   1 
ATOM   3925  C  CB  . ASN B  1 242 ? 17.164  62.283  80.827  1.00 36.31  ? 242  ASN B CB  1 
ATOM   3926  C  CG  . ASN B  1 242 ? 17.977  61.030  80.584  1.00 41.67  ? 242  ASN B CG  1 
ATOM   3927  O  OD1 . ASN B  1 242 ? 17.524  59.915  80.858  1.00 41.27  ? 242  ASN B OD1 1 
ATOM   3928  N  ND2 . ASN B  1 242 ? 19.191  61.207  80.056  1.00 41.60  ? 242  ASN B ND2 1 
ATOM   3929  N  N   . GLN B  1 243 ? 14.309  61.613  81.299  1.00 28.99  ? 243  GLN B N   1 
ATOM   3930  C  CA  . GLN B  1 243 ? 13.075  60.822  81.234  1.00 30.11  ? 243  GLN B CA  1 
ATOM   3931  C  C   . GLN B  1 243 ? 13.215  59.294  81.153  1.00 32.98  ? 243  GLN B C   1 
ATOM   3932  O  O   . GLN B  1 243 ? 12.409  58.565  81.750  1.00 31.47  ? 243  GLN B O   1 
ATOM   3933  C  CB  . GLN B  1 243 ? 12.197  61.284  80.063  1.00 30.51  ? 243  GLN B CB  1 
ATOM   3934  C  CG  . GLN B  1 243 ? 11.934  62.786  79.960  1.00 28.62  ? 243  GLN B CG  1 
ATOM   3935  C  CD  . GLN B  1 243 ? 11.319  63.389  81.208  1.00 27.06  ? 243  GLN B CD  1 
ATOM   3936  O  OE1 . GLN B  1 243 ? 10.469  62.784  81.859  1.00 24.43  ? 243  GLN B OE1 1 
ATOM   3937  N  NE2 . GLN B  1 243 ? 11.737  64.604  81.534  1.00 26.92  ? 243  GLN B NE2 1 
ATOM   3938  N  N   . GLN B  1 244 ? 14.212  58.791  80.423  1.00 35.88  ? 244  GLN B N   1 
ATOM   3939  C  CA  . GLN B  1 244 ? 14.372  57.335  80.323  1.00 40.24  ? 244  GLN B CA  1 
ATOM   3940  C  C   . GLN B  1 244 ? 14.656  56.671  81.672  1.00 38.75  ? 244  GLN B C   1 
ATOM   3941  O  O   . GLN B  1 244 ? 14.353  55.495  81.883  1.00 37.01  ? 244  GLN B O   1 
ATOM   3942  C  CB  . GLN B  1 244 ? 15.474  56.969  79.327  1.00 43.82  ? 244  GLN B CB  1 
ATOM   3943  C  CG  . GLN B  1 244 ? 14.992  56.833  77.884  1.00 54.94  ? 244  GLN B CG  1 
ATOM   3944  C  CD  . GLN B  1 244 ? 16.035  56.184  76.967  1.00 62.37  ? 244  GLN B CD  1 
ATOM   3945  O  OE1 . GLN B  1 244 ? 15.771  55.924  75.783  1.00 61.74  ? 244  GLN B OE1 1 
ATOM   3946  N  NE2 . GLN B  1 244 ? 17.226  55.918  77.515  1.00 63.21  ? 244  GLN B NE2 1 
ATOM   3947  N  N   . ASP B  1 245 ? 15.227  57.436  82.590  1.00 38.10  ? 245  ASP B N   1 
ATOM   3948  C  CA  . ASP B  1 245 ? 15.539  56.914  83.903  1.00 39.73  ? 245  ASP B CA  1 
ATOM   3949  C  C   . ASP B  1 245 ? 14.324  56.712  84.816  1.00 40.08  ? 245  ASP B C   1 
ATOM   3950  O  O   . ASP B  1 245 ? 14.458  56.171  85.911  1.00 39.93  ? 245  ASP B O   1 
ATOM   3951  C  CB  . ASP B  1 245 ? 16.573  57.819  84.571  1.00 45.21  ? 245  ASP B CB  1 
ATOM   3952  C  CG  . ASP B  1 245 ? 17.929  57.751  83.882  1.00 51.92  ? 245  ASP B CG  1 
ATOM   3953  O  OD1 . ASP B  1 245 ? 18.431  56.617  83.707  1.00 53.97  ? 245  ASP B OD1 1 
ATOM   3954  O  OD2 . ASP B  1 245 ? 18.489  58.814  83.516  1.00 55.68  ? 245  ASP B OD2 1 
ATOM   3955  N  N   . VAL B  1 246 ? 13.139  57.147  84.391  1.00 38.96  ? 246  VAL B N   1 
ATOM   3956  C  CA  . VAL B  1 246 ? 11.951  56.936  85.222  1.00 36.71  ? 246  VAL B CA  1 
ATOM   3957  C  C   . VAL B  1 246 ? 11.438  55.530  84.924  1.00 36.87  ? 246  VAL B C   1 
ATOM   3958  O  O   . VAL B  1 246 ? 11.194  55.193  83.771  1.00 40.51  ? 246  VAL B O   1 
ATOM   3959  C  CB  . VAL B  1 246 ? 10.816  57.957  84.905  1.00 35.70  ? 246  VAL B CB  1 
ATOM   3960  C  CG1 . VAL B  1 246 ? 9.579   57.644  85.739  1.00 25.76  ? 246  VAL B CG1 1 
ATOM   3961  C  CG2 . VAL B  1 246 ? 11.290  59.370  85.183  1.00 32.02  ? 246  VAL B CG2 1 
ATOM   3962  N  N   . PRO B  1 247 ? 11.290  54.686  85.952  1.00 37.27  ? 247  PRO B N   1 
ATOM   3963  C  CA  . PRO B  1 247 ? 10.802  53.311  85.779  1.00 39.87  ? 247  PRO B CA  1 
ATOM   3964  C  C   . PRO B  1 247 ? 9.540   53.197  84.934  1.00 40.87  ? 247  PRO B C   1 
ATOM   3965  O  O   . PRO B  1 247 ? 8.578   53.932  85.146  1.00 40.65  ? 247  PRO B O   1 
ATOM   3966  C  CB  . PRO B  1 247 ? 10.566  52.847  87.213  1.00 36.79  ? 247  PRO B CB  1 
ATOM   3967  C  CG  . PRO B  1 247 ? 11.696  53.487  87.924  1.00 38.81  ? 247  PRO B CG  1 
ATOM   3968  C  CD  . PRO B  1 247 ? 11.739  54.903  87.337  1.00 39.49  ? 247  PRO B CD  1 
ATOM   3969  N  N   . ASP B  1 248 ? 9.547   52.262  83.988  1.00 42.89  ? 248  ASP B N   1 
ATOM   3970  C  CA  . ASP B  1 248 ? 8.399   52.047  83.125  1.00 46.62  ? 248  ASP B CA  1 
ATOM   3971  C  C   . ASP B  1 248 ? 7.126   51.773  83.932  1.00 47.79  ? 248  ASP B C   1 
ATOM   3972  O  O   . ASP B  1 248 ? 6.047   52.223  83.549  1.00 49.24  ? 248  ASP B O   1 
ATOM   3973  C  CB  . ASP B  1 248 ? 8.678   50.883  82.179  1.00 51.42  ? 248  ASP B CB  1 
ATOM   3974  C  CG  . ASP B  1 248 ? 9.853   51.153  81.251  1.00 56.32  ? 248  ASP B CG  1 
ATOM   3975  O  OD1 . ASP B  1 248 ? 9.699   51.975  80.320  1.00 55.97  ? 248  ASP B OD1 1 
ATOM   3976  O  OD2 . ASP B  1 248 ? 10.931  50.547  81.457  1.00 58.99  ? 248  ASP B OD2 1 
ATOM   3977  N  N   . LYS B  1 249 ? 7.266   51.051  85.047  1.00 47.99  ? 249  LYS B N   1 
ATOM   3978  C  CA  . LYS B  1 249 ? 6.143   50.704  85.928  1.00 48.96  ? 249  LYS B CA  1 
ATOM   3979  C  C   . LYS B  1 249 ? 5.242   51.892  86.246  1.00 48.93  ? 249  LYS B C   1 
ATOM   3980  O  O   . LYS B  1 249 ? 4.053   51.730  86.528  1.00 49.54  ? 249  LYS B O   1 
ATOM   3981  C  CB  . LYS B  1 249 ? 6.645   50.136  87.260  1.00 53.76  ? 249  LYS B CB  1 
ATOM   3982  C  CG  . LYS B  1 249 ? 8.137   49.833  87.322  1.00 62.79  ? 249  LYS B CG  1 
ATOM   3983  C  CD  . LYS B  1 249 ? 8.580   49.622  88.771  1.00 65.68  ? 249  LYS B CD  1 
ATOM   3984  C  CE  . LYS B  1 249 ? 10.068  49.299  88.863  1.00 69.56  ? 249  LYS B CE  1 
ATOM   3985  N  NZ  . LYS B  1 249 ? 10.404  48.003  88.205  1.00 71.84  ? 249  LYS B NZ  1 
ATOM   3986  N  N   . PHE B  1 250 ? 5.813   53.090  86.226  1.00 45.96  ? 250  PHE B N   1 
ATOM   3987  C  CA  . PHE B  1 250 ? 5.040   54.279  86.521  1.00 40.91  ? 250  PHE B CA  1 
ATOM   3988  C  C   . PHE B  1 250 ? 4.513   54.911  85.249  1.00 40.60  ? 250  PHE B C   1 
ATOM   3989  O  O   . PHE B  1 250 ? 3.527   55.643  85.279  1.00 43.15  ? 250  PHE B O   1 
ATOM   3990  C  CB  . PHE B  1 250 ? 5.905   55.290  87.271  1.00 38.68  ? 250  PHE B CB  1 
ATOM   3991  C  CG  . PHE B  1 250 ? 6.548   54.739  88.518  1.00 37.68  ? 250  PHE B CG  1 
ATOM   3992  C  CD1 . PHE B  1 250 ? 5.860   53.840  89.340  1.00 34.44  ? 250  PHE B CD1 1 
ATOM   3993  C  CD2 . PHE B  1 250 ? 7.830   55.145  88.894  1.00 36.61  ? 250  PHE B CD2 1 
ATOM   3994  C  CE1 . PHE B  1 250 ? 6.431   53.356  90.512  1.00 29.84  ? 250  PHE B CE1 1 
ATOM   3995  C  CE2 . PHE B  1 250 ? 8.415   54.665  90.073  1.00 32.59  ? 250  PHE B CE2 1 
ATOM   3996  C  CZ  . PHE B  1 250 ? 7.708   53.769  90.882  1.00 32.25  ? 250  PHE B CZ  1 
ATOM   3997  N  N   . LYS B  1 251 ? 5.162   54.602  84.131  1.00 40.17  ? 251  LYS B N   1 
ATOM   3998  C  CA  . LYS B  1 251 ? 4.810   55.171  82.836  1.00 38.94  ? 251  LYS B CA  1 
ATOM   3999  C  C   . LYS B  1 251 ? 3.673   54.523  82.057  1.00 38.88  ? 251  LYS B C   1 
ATOM   4000  O  O   . LYS B  1 251 ? 2.879   55.224  81.430  1.00 39.30  ? 251  LYS B O   1 
ATOM   4001  C  CB  . LYS B  1 251 ? 6.043   55.203  81.930  1.00 37.15  ? 251  LYS B CB  1 
ATOM   4002  C  CG  . LYS B  1 251 ? 7.141   56.173  82.320  1.00 34.45  ? 251  LYS B CG  1 
ATOM   4003  C  CD  . LYS B  1 251 ? 8.294   56.019  81.332  1.00 40.40  ? 251  LYS B CD  1 
ATOM   4004  C  CE  . LYS B  1 251 ? 9.487   56.922  81.620  1.00 39.48  ? 251  LYS B CE  1 
ATOM   4005  N  NZ  . LYS B  1 251 ? 10.659  56.529  80.773  1.00 36.68  ? 251  LYS B NZ  1 
ATOM   4006  N  N   . TYR B  1 252 ? 3.592   53.199  82.067  1.00 37.91  ? 252  TYR B N   1 
ATOM   4007  C  CA  . TYR B  1 252 ? 2.540   52.543  81.297  1.00 38.88  ? 252  TYR B CA  1 
ATOM   4008  C  C   . TYR B  1 252 ? 1.818   51.448  82.072  1.00 40.83  ? 252  TYR B C   1 
ATOM   4009  O  O   . TYR B  1 252 ? 1.410   51.657  83.215  1.00 45.98  ? 252  TYR B O   1 
ATOM   4010  C  CB  . TYR B  1 252 ? 3.126   51.960  80.008  1.00 36.15  ? 252  TYR B CB  1 
ATOM   4011  C  CG  . TYR B  1 252 ? 4.282   52.750  79.427  1.00 34.27  ? 252  TYR B CG  1 
ATOM   4012  C  CD1 . TYR B  1 252 ? 5.599   52.460  79.781  1.00 32.45  ? 252  TYR B CD1 1 
ATOM   4013  C  CD2 . TYR B  1 252 ? 4.055   53.788  78.520  1.00 36.80  ? 252  TYR B CD2 1 
ATOM   4014  C  CE1 . TYR B  1 252 ? 6.667   53.180  79.242  1.00 35.70  ? 252  TYR B CE1 1 
ATOM   4015  C  CE2 . TYR B  1 252 ? 5.106   54.518  77.975  1.00 38.43  ? 252  TYR B CE2 1 
ATOM   4016  C  CZ  . TYR B  1 252 ? 6.416   54.211  78.338  1.00 39.77  ? 252  TYR B CZ  1 
ATOM   4017  O  OH  . TYR B  1 252 ? 7.459   54.947  77.800  1.00 39.14  ? 252  TYR B OH  1 
ATOM   4018  N  N   . LEU B  1 266 ? 1.115   55.922  62.489  1.00 61.22  ? 266  LEU B N   1 
ATOM   4019  C  CA  . LEU B  1 266 ? 2.051   54.803  62.615  1.00 61.81  ? 266  LEU B CA  1 
ATOM   4020  C  C   . LEU B  1 266 ? 2.129   54.347  64.087  1.00 62.77  ? 266  LEU B C   1 
ATOM   4021  O  O   . LEU B  1 266 ? 1.267   53.594  64.554  1.00 63.73  ? 266  LEU B O   1 
ATOM   4022  C  CB  . LEU B  1 266 ? 3.436   55.221  62.088  1.00 60.26  ? 266  LEU B CB  1 
ATOM   4023  C  CG  . LEU B  1 266 ? 4.532   54.185  61.796  1.00 58.67  ? 266  LEU B CG  1 
ATOM   4024  C  CD1 . LEU B  1 266 ? 4.107   53.221  60.682  1.00 57.46  ? 266  LEU B CD1 1 
ATOM   4025  C  CD2 . LEU B  1 266 ? 5.792   54.929  61.392  1.00 55.88  ? 266  LEU B CD2 1 
ATOM   4026  N  N   . LYS B  1 267 ? 3.145   54.793  64.823  1.00 62.39  ? 267  LYS B N   1 
ATOM   4027  C  CA  . LYS B  1 267 ? 3.268   54.404  66.227  1.00 61.68  ? 267  LYS B CA  1 
ATOM   4028  C  C   . LYS B  1 267 ? 2.704   55.501  67.125  1.00 60.77  ? 267  LYS B C   1 
ATOM   4029  O  O   . LYS B  1 267 ? 2.308   56.555  66.643  1.00 60.21  ? 267  LYS B O   1 
ATOM   4030  C  CB  . LYS B  1 267 ? 4.733   54.150  66.593  1.00 63.20  ? 267  LYS B CB  1 
ATOM   4031  C  CG  . LYS B  1 267 ? 4.916   53.727  68.045  1.00 67.27  ? 267  LYS B CG  1 
ATOM   4032  C  CD  . LYS B  1 267 ? 6.372   53.596  68.464  1.00 67.83  ? 267  LYS B CD  1 
ATOM   4033  C  CE  . LYS B  1 267 ? 6.454   53.272  69.953  1.00 68.66  ? 267  LYS B CE  1 
ATOM   4034  N  NZ  . LYS B  1 267 ? 7.854   53.138  70.436  1.00 71.86  ? 267  LYS B NZ  1 
ATOM   4035  N  N   . GLU B  1 268 ? 2.650   55.244  68.429  1.00 61.63  ? 268  GLU B N   1 
ATOM   4036  C  CA  . GLU B  1 268 ? 2.150   56.228  69.394  1.00 61.74  ? 268  GLU B CA  1 
ATOM   4037  C  C   . GLU B  1 268 ? 2.850   56.045  70.731  1.00 59.55  ? 268  GLU B C   1 
ATOM   4038  O  O   . GLU B  1 268 ? 3.258   54.940  71.084  1.00 60.13  ? 268  GLU B O   1 
ATOM   4039  C  CB  . GLU B  1 268 ? 0.641   56.085  69.619  1.00 61.52  ? 268  GLU B CB  1 
ATOM   4040  C  CG  . GLU B  1 268 ? -0.189  56.006  68.357  1.00 67.48  ? 268  GLU B CG  1 
ATOM   4041  C  CD  . GLU B  1 268 ? -1.679  56.058  68.643  1.00 71.26  ? 268  GLU B CD  1 
ATOM   4042  O  OE1 . GLU B  1 268 ? -2.482  55.649  67.764  1.00 72.87  ? 268  GLU B OE1 1 
ATOM   4043  O  OE2 . GLU B  1 268 ? -2.043  56.519  69.747  1.00 72.29  ? 268  GLU B OE2 1 
ATOM   4044  N  N   . GLU B  1 269 ? 2.994   57.136  71.470  1.00 58.15  ? 269  GLU B N   1 
ATOM   4045  C  CA  . GLU B  1 269 ? 3.625   57.089  72.778  1.00 55.99  ? 269  GLU B CA  1 
ATOM   4046  C  C   . GLU B  1 269 ? 2.639   57.583  73.810  1.00 53.79  ? 269  GLU B C   1 
ATOM   4047  O  O   . GLU B  1 269 ? 2.024   58.637  73.629  1.00 53.99  ? 269  GLU B O   1 
ATOM   4048  C  CB  . GLU B  1 269 ? 4.879   57.955  72.804  1.00 56.80  ? 269  GLU B CB  1 
ATOM   4049  C  CG  . GLU B  1 269 ? 6.063   57.274  72.170  1.00 61.71  ? 269  GLU B CG  1 
ATOM   4050  C  CD  . GLU B  1 269 ? 7.245   57.201  73.111  1.00 66.54  ? 269  GLU B CD  1 
ATOM   4051  O  OE1 . GLU B  1 269 ? 7.018   57.015  74.333  1.00 68.50  ? 269  GLU B OE1 1 
ATOM   4052  O  OE2 . GLU B  1 269 ? 8.396   57.315  72.628  1.00 66.38  ? 269  GLU B OE2 1 
ATOM   4053  N  N   . HIS B  1 270 ? 2.492   56.825  74.893  1.00 51.46  ? 270  HIS B N   1 
ATOM   4054  C  CA  . HIS B  1 270 ? 1.557   57.206  75.940  1.00 48.89  ? 270  HIS B CA  1 
ATOM   4055  C  C   . HIS B  1 270 ? 2.075   57.154  77.371  1.00 44.63  ? 270  HIS B C   1 
ATOM   4056  O  O   . HIS B  1 270 ? 1.561   56.400  78.193  1.00 43.88  ? 270  HIS B O   1 
ATOM   4057  C  CB  . HIS B  1 270 ? 0.294   56.356  75.816  1.00 52.27  ? 270  HIS B CB  1 
ATOM   4058  C  CG  . HIS B  1 270 ? -0.562  56.732  74.649  1.00 55.71  ? 270  HIS B CG  1 
ATOM   4059  N  ND1 . HIS B  1 270 ? -1.209  57.946  74.566  1.00 58.32  ? 270  HIS B ND1 1 
ATOM   4060  C  CD2 . HIS B  1 270 ? -0.830  56.082  73.492  1.00 58.22  ? 270  HIS B CD2 1 
ATOM   4061  C  CE1 . HIS B  1 270 ? -1.836  58.030  73.406  1.00 59.33  ? 270  HIS B CE1 1 
ATOM   4062  N  NE2 . HIS B  1 270 ? -1.622  56.913  72.736  1.00 60.11  ? 270  HIS B NE2 1 
ATOM   4063  N  N   . PRO B  1 271 ? 3.093   57.969  77.697  1.00 41.20  ? 271  PRO B N   1 
ATOM   4064  C  CA  . PRO B  1 271 ? 3.596   57.933  79.071  1.00 36.83  ? 271  PRO B CA  1 
ATOM   4065  C  C   . PRO B  1 271 ? 2.622   58.684  80.004  1.00 35.84  ? 271  PRO B C   1 
ATOM   4066  O  O   . PRO B  1 271 ? 2.082   59.748  79.650  1.00 33.48  ? 271  PRO B O   1 
ATOM   4067  C  CB  . PRO B  1 271 ? 4.953   58.609  78.943  1.00 33.53  ? 271  PRO B CB  1 
ATOM   4068  C  CG  . PRO B  1 271 ? 4.677   59.675  77.939  1.00 33.74  ? 271  PRO B CG  1 
ATOM   4069  C  CD  . PRO B  1 271 ? 3.825   58.970  76.897  1.00 37.97  ? 271  PRO B CD  1 
ATOM   4070  N  N   . TRP B  1 272 ? 2.393   58.114  81.184  1.00 33.60  ? 272  TRP B N   1 
ATOM   4071  C  CA  . TRP B  1 272 ? 1.490   58.693  82.176  1.00 31.84  ? 272  TRP B CA  1 
ATOM   4072  C  C   . TRP B  1 272 ? 2.110   59.744  83.114  1.00 29.83  ? 272  TRP B C   1 
ATOM   4073  O  O   . TRP B  1 272 ? 1.397   60.559  83.718  1.00 26.27  ? 272  TRP B O   1 
ATOM   4074  C  CB  . TRP B  1 272 ? 0.844   57.563  82.991  1.00 34.04  ? 272  TRP B CB  1 
ATOM   4075  C  CG  . TRP B  1 272 ? -0.355  56.989  82.284  1.00 36.38  ? 272  TRP B CG  1 
ATOM   4076  C  CD1 . TRP B  1 272 ? -0.360  56.023  81.311  1.00 35.43  ? 272  TRP B CD1 1 
ATOM   4077  C  CD2 . TRP B  1 272 ? -1.707  57.462  82.386  1.00 32.87  ? 272  TRP B CD2 1 
ATOM   4078  N  NE1 . TRP B  1 272 ? -1.629  55.878  80.796  1.00 32.38  ? 272  TRP B NE1 1 
ATOM   4079  C  CE2 . TRP B  1 272 ? -2.473  56.748  81.440  1.00 32.96  ? 272  TRP B CE2 1 
ATOM   4080  C  CE3 . TRP B  1 272 ? -2.342  58.427  83.184  1.00 32.74  ? 272  TRP B CE3 1 
ATOM   4081  C  CZ2 . TRP B  1 272 ? -3.847  56.969  81.270  1.00 31.21  ? 272  TRP B CZ2 1 
ATOM   4082  C  CZ3 . TRP B  1 272 ? -3.707  58.648  83.015  1.00 30.78  ? 272  TRP B CZ3 1 
ATOM   4083  C  CH2 . TRP B  1 272 ? -4.442  57.921  82.063  1.00 32.90  ? 272  TRP B CH2 1 
ATOM   4084  N  N   . VAL B  1 273 ? 3.435   59.732  83.217  1.00 25.05  ? 273  VAL B N   1 
ATOM   4085  C  CA  . VAL B  1 273 ? 4.141   60.676  84.062  1.00 24.81  ? 273  VAL B CA  1 
ATOM   4086  C  C   . VAL B  1 273 ? 5.428   61.159  83.384  1.00 27.42  ? 273  VAL B C   1 
ATOM   4087  O  O   . VAL B  1 273 ? 5.893   60.565  82.403  1.00 27.42  ? 273  VAL B O   1 
ATOM   4088  C  CB  . VAL B  1 273 ? 4.565   60.005  85.373  1.00 25.63  ? 273  VAL B CB  1 
ATOM   4089  C  CG1 . VAL B  1 273 ? 3.382   59.415  86.066  1.00 28.95  ? 273  VAL B CG1 1 
ATOM   4090  C  CG2 . VAL B  1 273 ? 5.587   58.912  85.080  1.00 22.86  ? 273  VAL B CG2 1 
ATOM   4091  N  N   . ASP B  1 274 ? 5.985   62.259  83.880  1.00 25.27  ? 274  ASP B N   1 
ATOM   4092  C  CA  . ASP B  1 274 ? 7.281   62.713  83.387  1.00 23.70  ? 274  ASP B CA  1 
ATOM   4093  C  C   . ASP B  1 274 ? 8.068   63.097  84.626  1.00 24.85  ? 274  ASP B C   1 
ATOM   4094  O  O   . ASP B  1 274 ? 7.531   63.111  85.728  1.00 25.17  ? 274  ASP B O   1 
ATOM   4095  C  CB  . ASP B  1 274 ? 7.214   63.884  82.374  1.00 22.71  ? 274  ASP B CB  1 
ATOM   4096  C  CG  . ASP B  1 274 ? 6.366   65.069  82.846  1.00 29.17  ? 274  ASP B CG  1 
ATOM   4097  O  OD1 . ASP B  1 274 ? 6.419   65.431  84.050  1.00 24.43  ? 274  ASP B OD1 1 
ATOM   4098  O  OD2 . ASP B  1 274 ? 5.658   65.660  81.979  1.00 26.00  ? 274  ASP B OD2 1 
ATOM   4099  N  N   . TYR B  1 275 ? 9.352   63.362  84.450  1.00 25.19  ? 275  TYR B N   1 
ATOM   4100  C  CA  . TYR B  1 275 ? 10.208  63.746  85.551  1.00 24.05  ? 275  TYR B CA  1 
ATOM   4101  C  C   . TYR B  1 275 ? 10.511  65.231  85.367  1.00 22.77  ? 275  TYR B C   1 
ATOM   4102  O  O   . TYR B  1 275 ? 10.563  65.714  84.243  1.00 22.52  ? 275  TYR B O   1 
ATOM   4103  C  CB  . TYR B  1 275 ? 11.491  62.901  85.516  1.00 24.91  ? 275  TYR B CB  1 
ATOM   4104  C  CG  . TYR B  1 275 ? 12.678  63.519  86.224  1.00 26.97  ? 275  TYR B CG  1 
ATOM   4105  C  CD1 . TYR B  1 275 ? 12.775  63.523  87.618  1.00 26.15  ? 275  TYR B CD1 1 
ATOM   4106  C  CD2 . TYR B  1 275 ? 13.711  64.102  85.492  1.00 28.30  ? 275  TYR B CD2 1 
ATOM   4107  C  CE1 . TYR B  1 275 ? 13.876  64.094  88.251  1.00 28.82  ? 275  TYR B CE1 1 
ATOM   4108  C  CE2 . TYR B  1 275 ? 14.808  64.669  86.117  1.00 25.92  ? 275  TYR B CE2 1 
ATOM   4109  C  CZ  . TYR B  1 275 ? 14.889  64.664  87.484  1.00 26.15  ? 275  TYR B CZ  1 
ATOM   4110  O  OH  . TYR B  1 275 ? 15.987  65.235  88.073  1.00 34.56  ? 275  TYR B OH  1 
ATOM   4111  N  N   . THR B  1 276 ? 10.680  65.945  86.474  1.00 21.65  ? 276  THR B N   1 
ATOM   4112  C  CA  . THR B  1 276 ? 10.977  67.371  86.453  1.00 21.94  ? 276  THR B CA  1 
ATOM   4113  C  C   . THR B  1 276 ? 12.202  67.622  87.340  1.00 23.80  ? 276  THR B C   1 
ATOM   4114  O  O   . THR B  1 276 ? 12.146  67.480  88.561  1.00 24.47  ? 276  THR B O   1 
ATOM   4115  C  CB  . THR B  1 276 ? 9.758   68.179  86.948  1.00 18.69  ? 276  THR B CB  1 
ATOM   4116  O  OG1 . THR B  1 276 ? 8.670   67.965  86.052  1.00 18.60  ? 276  THR B OG1 1 
ATOM   4117  C  CG2 . THR B  1 276 ? 10.054  69.653  86.997  1.00 16.81  ? 276  THR B CG2 1 
ATOM   4118  N  N   . ALA B  1 277 ? 13.310  67.977  86.702  1.00 26.24  ? 277  ALA B N   1 
ATOM   4119  C  CA  . ALA B  1 277 ? 14.581  68.219  87.371  1.00 26.01  ? 277  ALA B CA  1 
ATOM   4120  C  C   . ALA B  1 277 ? 14.536  69.250  88.486  1.00 27.75  ? 277  ALA B C   1 
ATOM   4121  O  O   . ALA B  1 277 ? 13.781  70.215  88.434  1.00 29.79  ? 277  ALA B O   1 
ATOM   4122  C  CB  . ALA B  1 277 ? 15.591  68.629  86.357  1.00 30.71  ? 277  ALA B CB  1 
ATOM   4123  N  N   . PRO B  1 278 ? 15.375  69.073  89.510  1.00 27.54  ? 278  PRO B N   1 
ATOM   4124  C  CA  . PRO B  1 278 ? 15.331  70.061  90.584  1.00 26.20  ? 278  PRO B CA  1 
ATOM   4125  C  C   . PRO B  1 278 ? 15.571  71.510  90.159  1.00 26.33  ? 278  PRO B C   1 
ATOM   4126  O  O   . PRO B  1 278 ? 15.041  72.425  90.788  1.00 30.90  ? 278  PRO B O   1 
ATOM   4127  C  CB  . PRO B  1 278 ? 16.351  69.528  91.605  1.00 24.26  ? 278  PRO B CB  1 
ATOM   4128  C  CG  . PRO B  1 278 ? 17.265  68.672  90.805  1.00 25.76  ? 278  PRO B CG  1 
ATOM   4129  C  CD  . PRO B  1 278 ? 16.350  68.005  89.793  1.00 28.72  ? 278  PRO B CD  1 
ATOM   4130  N  N   . SER B  1 279 ? 16.339  71.742  89.101  1.00 22.71  ? 279  SER B N   1 
ATOM   4131  C  CA  . SER B  1 279 ? 16.571  73.124  88.667  1.00 22.62  ? 279  SER B CA  1 
ATOM   4132  C  C   . SER B  1 279 ? 15.280  73.851  88.285  1.00 25.02  ? 279  SER B C   1 
ATOM   4133  O  O   . SER B  1 279 ? 15.214  75.080  88.340  1.00 28.69  ? 279  SER B O   1 
ATOM   4134  C  CB  . SER B  1 279 ? 17.541  73.175  87.485  1.00 17.79  ? 279  SER B CB  1 
ATOM   4135  O  OG  . SER B  1 279 ? 17.144  72.293  86.452  1.00 28.75  ? 279  SER B OG  1 
ATOM   4136  N  N   . LEU B  1 280 ? 14.254  73.090  87.915  1.00 24.73  ? 280  LEU B N   1 
ATOM   4137  C  CA  . LEU B  1 280 ? 12.971  73.653  87.516  1.00 24.57  ? 280  LEU B CA  1 
ATOM   4138  C  C   . LEU B  1 280 ? 12.002  73.867  88.683  1.00 27.55  ? 280  LEU B C   1 
ATOM   4139  O  O   . LEU B  1 280 ? 10.905  74.387  88.489  1.00 26.79  ? 280  LEU B O   1 
ATOM   4140  C  CB  . LEU B  1 280 ? 12.308  72.739  86.478  1.00 20.80  ? 280  LEU B CB  1 
ATOM   4141  C  CG  . LEU B  1 280 ? 13.096  72.533  85.184  1.00 21.29  ? 280  LEU B CG  1 
ATOM   4142  C  CD1 . LEU B  1 280 ? 12.408  71.498  84.362  1.00 16.07  ? 280  LEU B CD1 1 
ATOM   4143  C  CD2 . LEU B  1 280 ? 13.244  73.860  84.412  1.00 16.06  ? 280  LEU B CD2 1 
ATOM   4144  N  N   . ILE B  1 281 ? 12.401  73.477  89.890  1.00 27.80  ? 281  ILE B N   1 
ATOM   4145  C  CA  . ILE B  1 281 ? 11.519  73.616  91.044  1.00 27.62  ? 281  ILE B CA  1 
ATOM   4146  C  C   . ILE B  1 281 ? 12.010  74.671  92.025  1.00 29.59  ? 281  ILE B C   1 
ATOM   4147  O  O   . ILE B  1 281 ? 13.170  74.676  92.441  1.00 26.68  ? 281  ILE B O   1 
ATOM   4148  C  CB  . ILE B  1 281 ? 11.353  72.238  91.771  1.00 26.29  ? 281  ILE B CB  1 
ATOM   4149  C  CG1 . ILE B  1 281 ? 10.685  71.238  90.829  1.00 18.83  ? 281  ILE B CG1 1 
ATOM   4150  C  CG2 . ILE B  1 281 ? 10.525  72.383  93.041  1.00 22.15  ? 281  ILE B CG2 1 
ATOM   4151  C  CD1 . ILE B  1 281 ? 10.704  69.836  91.355  1.00 19.58  ? 281  ILE B CD1 1 
ATOM   4152  N  N   . THR B  1 282 ? 11.102  75.561  92.409  1.00 32.43  ? 282  THR B N   1 
ATOM   4153  C  CA  . THR B  1 282 ? 11.435  76.635  93.336  1.00 29.19  ? 282  THR B CA  1 
ATOM   4154  C  C   . THR B  1 282 ? 11.461  76.193  94.788  1.00 30.79  ? 282  THR B C   1 
ATOM   4155  O  O   . THR B  1 282 ? 12.412  76.497  95.506  1.00 30.85  ? 282  THR B O   1 
ATOM   4156  C  CB  . THR B  1 282 ? 10.455  77.784  93.206  1.00 30.25  ? 282  THR B CB  1 
ATOM   4157  O  OG1 . THR B  1 282 ? 10.427  78.240  91.842  1.00 28.29  ? 282  THR B OG1 1 
ATOM   4158  C  CG2 . THR B  1 282 ? 10.865  78.912  94.130  1.00 25.60  ? 282  THR B CG2 1 
ATOM   4159  N  N   . LEU B  1 283 ? 10.420  75.486  95.224  1.00 28.59  ? 283  LEU B N   1 
ATOM   4160  C  CA  . LEU B  1 283 ? 10.351  75.003  96.603  1.00 28.57  ? 283  LEU B CA  1 
ATOM   4161  C  C   . LEU B  1 283 ? 9.394   73.842  96.687  1.00 29.16  ? 283  LEU B C   1 
ATOM   4162  O  O   . LEU B  1 283 ? 8.504   73.716  95.868  1.00 29.18  ? 283  LEU B O   1 
ATOM   4163  C  CB  . LEU B  1 283 ? 9.836   76.084  97.558  1.00 27.66  ? 283  LEU B CB  1 
ATOM   4164  C  CG  . LEU B  1 283 ? 10.603  77.367  97.900  1.00 30.32  ? 283  LEU B CG  1 
ATOM   4165  C  CD1 . LEU B  1 283 ? 9.687   78.265  98.717  1.00 30.18  ? 283  LEU B CD1 1 
ATOM   4166  C  CD2 . LEU B  1 283 ? 11.872  77.063  98.686  1.00 23.83  ? 283  LEU B CD2 1 
ATOM   4167  N  N   . LEU B  1 284 ? 9.584   72.982  97.677  1.00 30.40  ? 284  LEU B N   1 
ATOM   4168  C  CA  . LEU B  1 284 ? 8.668   71.871  97.878  1.00 28.15  ? 284  LEU B CA  1 
ATOM   4169  C  C   . LEU B  1 284 ? 8.088   72.074  99.270  1.00 30.25  ? 284  LEU B C   1 
ATOM   4170  O  O   . LEU B  1 284 ? 8.825   72.346  100.231 1.00 29.51  ? 284  LEU B O   1 
ATOM   4171  C  CB  . LEU B  1 284 ? 9.371   70.512  97.815  1.00 24.35  ? 284  LEU B CB  1 
ATOM   4172  C  CG  . LEU B  1 284 ? 10.042  70.080  96.513  1.00 30.58  ? 284  LEU B CG  1 
ATOM   4173  C  CD1 . LEU B  1 284 ? 11.461  70.691  96.413  1.00 26.82  ? 284  LEU B CD1 1 
ATOM   4174  C  CD2 . LEU B  1 284 ? 10.119  68.567  96.481  1.00 25.54  ? 284  LEU B CD2 1 
ATOM   4175  N  N   . PHE B  1 285 ? 6.764   71.977  99.366  1.00 28.65  ? 285  PHE B N   1 
ATOM   4176  C  CA  . PHE B  1 285 ? 6.083   72.116  100.636 1.00 27.99  ? 285  PHE B CA  1 
ATOM   4177  C  C   . PHE B  1 285 ? 5.706   70.719  101.082 1.00 29.53  ? 285  PHE B C   1 
ATOM   4178  O  O   . PHE B  1 285 ? 4.912   70.056  100.438 1.00 30.99  ? 285  PHE B O   1 
ATOM   4179  C  CB  . PHE B  1 285 ? 4.859   73.012  100.477 1.00 25.18  ? 285  PHE B CB  1 
ATOM   4180  C  CG  . PHE B  1 285 ? 5.212   74.420  100.123 1.00 26.54  ? 285  PHE B CG  1 
ATOM   4181  C  CD1 . PHE B  1 285 ? 5.655   74.735  98.841  1.00 23.96  ? 285  PHE B CD1 1 
ATOM   4182  C  CD2 . PHE B  1 285 ? 5.176   75.422  101.090 1.00 24.49  ? 285  PHE B CD2 1 
ATOM   4183  C  CE1 . PHE B  1 285 ? 6.060   76.027  98.529  1.00 30.59  ? 285  PHE B CE1 1 
ATOM   4184  C  CE2 . PHE B  1 285 ? 5.579   76.718  100.795 1.00 26.54  ? 285  PHE B CE2 1 
ATOM   4185  C  CZ  . PHE B  1 285 ? 6.022   77.028  99.517  1.00 30.77  ? 285  PHE B CZ  1 
ATOM   4186  N  N   . THR B  1 286 ? 6.299   70.266  102.181 1.00 31.94  ? 286  THR B N   1 
ATOM   4187  C  CA  . THR B  1 286 ? 6.042   68.921  102.680 1.00 33.29  ? 286  THR B CA  1 
ATOM   4188  C  C   . THR B  1 286 ? 5.724   68.952  104.163 1.00 33.16  ? 286  THR B C   1 
ATOM   4189  O  O   . THR B  1 286 ? 5.808   70.001  104.796 1.00 31.09  ? 286  THR B O   1 
ATOM   4190  C  CB  . THR B  1 286 ? 7.289   68.024  102.483 1.00 33.30  ? 286  THR B CB  1 
ATOM   4191  O  OG1 . THR B  1 286 ? 8.315   68.438  103.391 1.00 35.55  ? 286  THR B OG1 1 
ATOM   4192  C  CG2 . THR B  1 286 ? 7.827   68.157  101.083 1.00 27.76  ? 286  THR B CG2 1 
ATOM   4193  N  N   . ASP B  1 287 ? 5.364   67.799  104.715 1.00 36.37  ? 287  ASP B N   1 
ATOM   4194  C  CA  . ASP B  1 287 ? 5.077   67.715  106.146 1.00 41.32  ? 287  ASP B CA  1 
ATOM   4195  C  C   . ASP B  1 287 ? 6.393   67.910  106.909 1.00 43.10  ? 287  ASP B C   1 
ATOM   4196  O  O   . ASP B  1 287 ? 6.393   68.279  108.086 1.00 43.01  ? 287  ASP B O   1 
ATOM   4197  C  CB  . ASP B  1 287 ? 4.450   66.362  106.506 1.00 39.29  ? 287  ASP B CB  1 
ATOM   4198  C  CG  . ASP B  1 287 ? 5.149   65.189  105.833 1.00 43.56  ? 287  ASP B CG  1 
ATOM   4199  O  OD1 . ASP B  1 287 ? 4.975   65.008  104.609 1.00 41.88  ? 287  ASP B OD1 1 
ATOM   4200  O  OD2 . ASP B  1 287 ? 5.874   64.446  106.529 1.00 44.98  ? 287  ASP B OD2 1 
ATOM   4201  N  N   . LEU B  1 288 ? 7.512   67.668  106.226 1.00 42.68  ? 288  LEU B N   1 
ATOM   4202  C  CA  . LEU B  1 288 ? 8.828   67.838  106.832 1.00 40.89  ? 288  LEU B CA  1 
ATOM   4203  C  C   . LEU B  1 288 ? 9.227   69.306  106.762 1.00 39.29  ? 288  LEU B C   1 
ATOM   4204  O  O   . LEU B  1 288 ? 10.297  69.689  107.214 1.00 39.94  ? 288  LEU B O   1 
ATOM   4205  C  CB  . LEU B  1 288 ? 9.880   67.003  106.095 1.00 42.38  ? 288  LEU B CB  1 
ATOM   4206  C  CG  . LEU B  1 288 ? 9.615   65.504  105.895 1.00 44.37  ? 288  LEU B CG  1 
ATOM   4207  C  CD1 . LEU B  1 288 ? 10.747  64.916  105.063 1.00 40.02  ? 288  LEU B CD1 1 
ATOM   4208  C  CD2 . LEU B  1 288 ? 9.482   64.791  107.248 1.00 38.56  ? 288  LEU B CD2 1 
ATOM   4209  N  N   . GLY B  1 289 ? 8.367   70.135  106.187 1.00 38.49  ? 289  GLY B N   1 
ATOM   4210  C  CA  . GLY B  1 289 ? 8.693   71.548  106.086 1.00 35.52  ? 289  GLY B CA  1 
ATOM   4211  C  C   . GLY B  1 289 ? 8.997   71.980  104.666 1.00 31.94  ? 289  GLY B C   1 
ATOM   4212  O  O   . GLY B  1 289 ? 9.046   71.146  103.762 1.00 33.16  ? 289  GLY B O   1 
ATOM   4213  N  N   . VAL B  1 290 ? 9.205   73.283  104.483 1.00 29.42  ? 290  VAL B N   1 
ATOM   4214  C  CA  . VAL B  1 290 ? 9.489   73.886  103.179 1.00 28.91  ? 290  VAL B CA  1 
ATOM   4215  C  C   . VAL B  1 290 ? 10.941  73.660  102.717 1.00 27.73  ? 290  VAL B C   1 
ATOM   4216  O  O   . VAL B  1 290 ? 11.855  74.313  103.205 1.00 28.14  ? 290  VAL B O   1 
ATOM   4217  C  CB  . VAL B  1 290 ? 9.207   75.405  103.232 1.00 28.91  ? 290  VAL B CB  1 
ATOM   4218  C  CG1 . VAL B  1 290 ? 9.219   75.990  101.829 1.00 32.55  ? 290  VAL B CG1 1 
ATOM   4219  C  CG2 . VAL B  1 290 ? 7.882   75.660  103.934 1.00 27.20  ? 290  VAL B CG2 1 
ATOM   4220  N  N   . LEU B  1 291 ? 11.139  72.771  101.747 1.00 24.41  ? 291  LEU B N   1 
ATOM   4221  C  CA  . LEU B  1 291 ? 12.478  72.448  101.277 1.00 24.70  ? 291  LEU B CA  1 
ATOM   4222  C  C   . LEU B  1 291 ? 12.878  72.978  99.900  1.00 28.99  ? 291  LEU B C   1 
ATOM   4223  O  O   . LEU B  1 291 ? 12.031  73.174  99.020  1.00 31.44  ? 291  LEU B O   1 
ATOM   4224  C  CB  . LEU B  1 291 ? 12.653  70.934  101.230 1.00 20.54  ? 291  LEU B CB  1 
ATOM   4225  C  CG  . LEU B  1 291 ? 11.935  70.059  102.249 1.00 19.26  ? 291  LEU B CG  1 
ATOM   4226  C  CD1 . LEU B  1 291 ? 12.150  68.595  101.914 1.00 12.93  ? 291  LEU B CD1 1 
ATOM   4227  C  CD2 . LEU B  1 291 ? 12.451  70.372  103.627 1.00 21.18  ? 291  LEU B CD2 1 
ATOM   4228  N  N   . THR B  1 292 ? 14.174  73.214  99.716  1.00 27.41  ? 292  THR B N   1 
ATOM   4229  C  CA  . THR B  1 292 ? 14.653  73.610  98.404  1.00 29.63  ? 292  THR B CA  1 
ATOM   4230  C  C   . THR B  1 292 ? 14.922  72.210  97.858  1.00 30.44  ? 292  THR B C   1 
ATOM   4231  O  O   . THR B  1 292 ? 15.157  71.288  98.642  1.00 29.04  ? 292  THR B O   1 
ATOM   4232  C  CB  . THR B  1 292 ? 15.989  74.373  98.440  1.00 31.64  ? 292  THR B CB  1 
ATOM   4233  O  OG1 . THR B  1 292 ? 17.027  73.495  98.917  1.00 34.78  ? 292  THR B OG1 1 
ATOM   4234  C  CG2 . THR B  1 292 ? 15.875  75.617  99.319  1.00 23.16  ? 292  THR B CG2 1 
ATOM   4235  N  N   . PRO B  1 293 ? 14.876  72.024  96.525  1.00 28.86  ? 293  PRO B N   1 
ATOM   4236  C  CA  . PRO B  1 293 ? 15.126  70.687  95.974  1.00 29.27  ? 293  PRO B CA  1 
ATOM   4237  C  C   . PRO B  1 293 ? 16.387  70.008  96.528  1.00 29.30  ? 293  PRO B C   1 
ATOM   4238  O  O   . PRO B  1 293 ? 16.326  68.885  97.019  1.00 28.09  ? 293  PRO B O   1 
ATOM   4239  C  CB  . PRO B  1 293 ? 15.197  70.944  94.460  1.00 27.58  ? 293  PRO B CB  1 
ATOM   4240  C  CG  . PRO B  1 293 ? 14.184  72.043  94.279  1.00 27.72  ? 293  PRO B CG  1 
ATOM   4241  C  CD  . PRO B  1 293 ? 14.493  72.973  95.462  1.00 25.29  ? 293  PRO B CD  1 
ATOM   4242  N  N   . SER B  1 294 ? 17.517  70.702  96.457  1.00 28.21  ? 294  SER B N   1 
ATOM   4243  C  CA  . SER B  1 294 ? 18.785  70.169  96.934  1.00 28.50  ? 294  SER B CA  1 
ATOM   4244  C  C   . SER B  1 294 ? 18.739  69.643  98.378  1.00 28.87  ? 294  SER B C   1 
ATOM   4245  O  O   . SER B  1 294 ? 19.459  68.703  98.735  1.00 27.06  ? 294  SER B O   1 
ATOM   4246  C  CB  . SER B  1 294 ? 19.852  71.250  96.823  1.00 29.33  ? 294  SER B CB  1 
ATOM   4247  O  OG  . SER B  1 294 ? 19.534  72.327  97.683  1.00 33.09  ? 294  SER B OG  1 
ATOM   4248  N  N   . ALA B  1 295 ? 17.894  70.255  99.200  1.00 26.65  ? 295  ALA B N   1 
ATOM   4249  C  CA  . ALA B  1 295 ? 17.751  69.866  100.598 1.00 28.02  ? 295  ALA B CA  1 
ATOM   4250  C  C   . ALA B  1 295 ? 16.974  68.543  100.803 1.00 30.07  ? 295  ALA B C   1 
ATOM   4251  O  O   . ALA B  1 295 ? 17.024  67.937  101.876 1.00 31.95  ? 295  ALA B O   1 
ATOM   4252  C  CB  . ALA B  1 295 ? 17.070  70.991  101.364 1.00 23.75  ? 295  ALA B CB  1 
ATOM   4253  N  N   . VAL B  1 296 ? 16.266  68.090  99.779  1.00 26.38  ? 296  VAL B N   1 
ATOM   4254  C  CA  . VAL B  1 296 ? 15.506  66.858  99.891  1.00 27.13  ? 296  VAL B CA  1 
ATOM   4255  C  C   . VAL B  1 296 ? 16.343  65.618  100.201 1.00 26.46  ? 296  VAL B C   1 
ATOM   4256  O  O   . VAL B  1 296 ? 15.892  64.726  100.927 1.00 27.58  ? 296  VAL B O   1 
ATOM   4257  C  CB  . VAL B  1 296 ? 14.686  66.609  98.605  1.00 27.75  ? 296  VAL B CB  1 
ATOM   4258  C  CG1 . VAL B  1 296 ? 14.366  65.118  98.445  1.00 24.43  ? 296  VAL B CG1 1 
ATOM   4259  C  CG2 . VAL B  1 296 ? 13.415  67.430  98.657  1.00 26.75  ? 296  VAL B CG2 1 
ATOM   4260  N  N   . SER B  1 297 ? 17.551  65.544  99.658  1.00 25.00  ? 297  SER B N   1 
ATOM   4261  C  CA  . SER B  1 297 ? 18.394  64.381  99.909  1.00 26.54  ? 297  SER B CA  1 
ATOM   4262  C  C   . SER B  1 297 ? 18.664  64.210  101.404 1.00 29.41  ? 297  SER B C   1 
ATOM   4263  O  O   . SER B  1 297 ? 18.709  63.074  101.905 1.00 29.30  ? 297  SER B O   1 
ATOM   4264  C  CB  . SER B  1 297 ? 19.708  64.509  99.158  1.00 26.72  ? 297  SER B CB  1 
ATOM   4265  O  OG  . SER B  1 297 ? 20.375  65.690  99.548  1.00 32.00  ? 297  SER B OG  1 
ATOM   4266  N  N   . ASP B  1 298 ? 18.845  65.321  102.122 1.00 28.18  ? 298  ASP B N   1 
ATOM   4267  C  CA  . ASP B  1 298 ? 19.078  65.218  103.555 1.00 31.33  ? 298  ASP B CA  1 
ATOM   4268  C  C   . ASP B  1 298 ? 17.809  64.802  104.270 1.00 34.51  ? 298  ASP B C   1 
ATOM   4269  O  O   . ASP B  1 298 ? 17.849  63.916  105.128 1.00 35.69  ? 298  ASP B O   1 
ATOM   4270  C  CB  . ASP B  1 298 ? 19.570  66.530  104.149 1.00 35.91  ? 298  ASP B CB  1 
ATOM   4271  C  CG  . ASP B  1 298 ? 20.880  66.974  103.554 1.00 44.81  ? 298  ASP B CG  1 
ATOM   4272  O  OD1 . ASP B  1 298 ? 20.857  67.598  102.468 1.00 48.75  ? 298  ASP B OD1 1 
ATOM   4273  O  OD2 . ASP B  1 298 ? 21.932  66.682  104.162 1.00 47.92  ? 298  ASP B OD2 1 
ATOM   4274  N  N   . GLU B  1 299 ? 16.680  65.428  103.928 1.00 34.67  ? 299  GLU B N   1 
ATOM   4275  C  CA  . GLU B  1 299 ? 15.421  65.067  104.572 1.00 34.21  ? 299  GLU B CA  1 
ATOM   4276  C  C   . GLU B  1 299 ? 15.069  63.608  104.322 1.00 32.50  ? 299  GLU B C   1 
ATOM   4277  O  O   . GLU B  1 299 ? 14.521  62.939  105.204 1.00 33.10  ? 299  GLU B O   1 
ATOM   4278  C  CB  . GLU B  1 299 ? 14.272  65.942  104.079 1.00 38.13  ? 299  GLU B CB  1 
ATOM   4279  C  CG  . GLU B  1 299 ? 14.358  67.390  104.496 1.00 41.92  ? 299  GLU B CG  1 
ATOM   4280  C  CD  . GLU B  1 299 ? 14.687  67.556  105.963 1.00 45.03  ? 299  GLU B CD  1 
ATOM   4281  O  OE1 . GLU B  1 299 ? 13.997  66.963  106.822 1.00 48.79  ? 299  GLU B OE1 1 
ATOM   4282  O  OE2 . GLU B  1 299 ? 15.647  68.291  106.255 1.00 48.35  ? 299  GLU B OE2 1 
ATOM   4283  N  N   . LEU B  1 300 ? 15.403  63.117  103.128 1.00 29.06  ? 300  LEU B N   1 
ATOM   4284  C  CA  . LEU B  1 300 ? 15.103  61.742  102.753 1.00 29.53  ? 300  LEU B CA  1 
ATOM   4285  C  C   . LEU B  1 300 ? 15.868  60.696  103.563 1.00 32.67  ? 300  LEU B C   1 
ATOM   4286  O  O   . LEU B  1 300 ? 15.340  59.616  103.831 1.00 37.53  ? 300  LEU B O   1 
ATOM   4287  C  CB  . LEU B  1 300 ? 15.336  61.540  101.253 1.00 26.25  ? 300  LEU B CB  1 
ATOM   4288  C  CG  . LEU B  1 300 ? 14.782  60.218  100.717 1.00 26.45  ? 300  LEU B CG  1 
ATOM   4289  C  CD1 . LEU B  1 300 ? 14.489  60.352  99.234  1.00 26.87  ? 300  LEU B CD1 1 
ATOM   4290  C  CD2 . LEU B  1 300 ? 15.759  59.094  100.990 1.00 22.11  ? 300  LEU B CD2 1 
ATOM   4291  N  N   . ILE B  1 301 ? 17.103  61.000  103.953 1.00 31.43  ? 301  ILE B N   1 
ATOM   4292  C  CA  . ILE B  1 301 ? 17.887  60.064  104.766 1.00 30.64  ? 301  ILE B CA  1 
ATOM   4293  C  C   . ILE B  1 301 ? 17.252  59.977  106.174 1.00 30.16  ? 301  ILE B C   1 
ATOM   4294  O  O   . ILE B  1 301 ? 17.003  58.882  106.682 1.00 27.87  ? 301  ILE B O   1 
ATOM   4295  C  CB  . ILE B  1 301 ? 19.383  60.525  104.886 1.00 29.57  ? 301  ILE B CB  1 
ATOM   4296  C  CG1 . ILE B  1 301 ? 20.034  60.577  103.516 1.00 26.96  ? 301  ILE B CG1 1 
ATOM   4297  C  CG2 . ILE B  1 301 ? 20.176  59.558  105.720 1.00 24.38  ? 301  ILE B CG2 1 
ATOM   4298  C  CD1 . ILE B  1 301 ? 21.339  61.310  103.524 1.00 33.31  ? 301  ILE B CD1 1 
ATOM   4299  N  N   . LYS B  1 302 ? 17.007  61.133  106.799 1.00 31.50  ? 302  LYS B N   1 
ATOM   4300  C  CA  . LYS B  1 302 ? 16.371  61.187  108.127 1.00 35.49  ? 302  LYS B CA  1 
ATOM   4301  C  C   . LYS B  1 302 ? 15.071  60.430  108.029 1.00 35.29  ? 302  LYS B C   1 
ATOM   4302  O  O   . LYS B  1 302 ? 14.765  59.565  108.835 1.00 34.03  ? 302  LYS B O   1 
ATOM   4303  C  CB  . LYS B  1 302 ? 16.013  62.617  108.533 1.00 34.43  ? 302  LYS B CB  1 
ATOM   4304  C  CG  . LYS B  1 302 ? 17.138  63.442  109.072 1.00 38.86  ? 302  LYS B CG  1 
ATOM   4305  C  CD  . LYS B  1 302 ? 16.678  64.877  109.263 1.00 46.30  ? 302  LYS B CD  1 
ATOM   4306  C  CE  . LYS B  1 302 ? 17.614  65.632  110.203 1.00 53.19  ? 302  LYS B CE  1 
ATOM   4307  N  NZ  . LYS B  1 302 ? 17.657  65.018  111.582 1.00 53.38  ? 302  LYS B NZ  1 
ATOM   4308  N  N   . LEU B  1 303 ? 14.299  60.794  107.019 1.00 37.21  ? 303  LEU B N   1 
ATOM   4309  C  CA  . LEU B  1 303 ? 13.027  60.161  106.790 1.00 37.04  ? 303  LEU B CA  1 
ATOM   4310  C  C   . LEU B  1 303 ? 13.214  58.644  106.864 1.00 36.71  ? 303  LEU B C   1 
ATOM   4311  O  O   . LEU B  1 303 ? 12.667  58.020  107.766 1.00 36.35  ? 303  LEU B O   1 
ATOM   4312  C  CB  . LEU B  1 303 ? 12.492  60.620  105.433 1.00 38.33  ? 303  LEU B CB  1 
ATOM   4313  C  CG  . LEU B  1 303 ? 11.037  60.393  105.026 1.00 38.11  ? 303  LEU B CG  1 
ATOM   4314  C  CD1 . LEU B  1 303 ? 10.866  58.965  104.584 1.00 37.26  ? 303  LEU B CD1 1 
ATOM   4315  C  CD2 . LEU B  1 303 ? 10.105  60.750  106.174 1.00 35.58  ? 303  LEU B CD2 1 
ATOM   4316  N  N   . TYR B  1 304 ? 14.017  58.071  105.958 1.00 35.45  ? 304  TYR B N   1 
ATOM   4317  C  CA  . TYR B  1 304 ? 14.272  56.617  105.900 1.00 34.37  ? 304  TYR B CA  1 
ATOM   4318  C  C   . TYR B  1 304 ? 15.078  55.963  107.039 1.00 38.02  ? 304  TYR B C   1 
ATOM   4319  O  O   . TYR B  1 304 ? 15.183  54.730  107.101 1.00 36.37  ? 304  TYR B O   1 
ATOM   4320  C  CB  . TYR B  1 304 ? 14.950  56.260  104.577 1.00 30.41  ? 304  TYR B CB  1 
ATOM   4321  C  CG  . TYR B  1 304 ? 14.007  56.103  103.415 1.00 32.76  ? 304  TYR B CG  1 
ATOM   4322  C  CD1 . TYR B  1 304 ? 13.613  54.841  102.987 1.00 33.67  ? 304  TYR B CD1 1 
ATOM   4323  C  CD2 . TYR B  1 304 ? 13.489  57.216  102.747 1.00 33.76  ? 304  TYR B CD2 1 
ATOM   4324  C  CE1 . TYR B  1 304 ? 12.727  54.680  101.923 1.00 35.50  ? 304  TYR B CE1 1 
ATOM   4325  C  CE2 . TYR B  1 304 ? 12.599  57.069  101.684 1.00 31.39  ? 304  TYR B CE2 1 
ATOM   4326  C  CZ  . TYR B  1 304 ? 12.222  55.796  101.273 1.00 35.27  ? 304  TYR B CZ  1 
ATOM   4327  O  OH  . TYR B  1 304 ? 11.352  55.624  100.208 1.00 36.01  ? 304  TYR B OH  1 
ATOM   4328  N  N   . LEU B  1 305 ? 15.654  56.766  107.928 1.00 40.44  ? 305  LEU B N   1 
ATOM   4329  C  CA  . LEU B  1 305 ? 16.431  56.214  109.032 1.00 44.55  ? 305  LEU B CA  1 
ATOM   4330  C  C   . LEU B  1 305 ? 15.841  56.489  110.414 1.00 50.60  ? 305  LEU B C   1 
ATOM   4331  O  O   . LEU B  1 305 ? 16.317  55.936  111.409 1.00 53.95  ? 305  LEU B O   1 
ATOM   4332  C  CB  . LEU B  1 305 ? 17.864  56.744  108.995 1.00 39.04  ? 305  LEU B CB  1 
ATOM   4333  C  CG  . LEU B  1 305 ? 18.753  56.305  107.837 1.00 36.87  ? 305  LEU B CG  1 
ATOM   4334  C  CD1 . LEU B  1 305 ? 20.168  56.808  108.075 1.00 29.33  ? 305  LEU B CD1 1 
ATOM   4335  C  CD2 . LEU B  1 305 ? 18.731  54.788  107.718 1.00 30.57  ? 305  LEU B CD2 1 
ATOM   4336  N  N   . ALA B  1 306 ? 14.815  57.337  110.482 1.00 55.12  ? 306  ALA B N   1 
ATOM   4337  C  CA  . ALA B  1 306 ? 14.182  57.680  111.757 1.00 58.63  ? 306  ALA B CA  1 
ATOM   4338  C  C   . ALA B  1 306 ? 13.837  56.413  112.543 1.00 60.58  ? 306  ALA B C   1 
ATOM   4339  O  O   . ALA B  1 306 ? 13.218  55.485  112.009 1.00 61.09  ? 306  ALA B O   1 
ATOM   4340  C  CB  . ALA B  1 306 ? 12.926  58.517  111.511 1.00 57.83  ? 306  ALA B CB  1 
ATOM   4341  N  N   . ALA B  1 307 ? 14.250  56.382  113.808 1.00 61.68  ? 307  ALA B N   1 
ATOM   4342  C  CA  . ALA B  1 307 ? 14.021  55.227  114.674 1.00 64.04  ? 307  ALA B CA  1 
ATOM   4343  C  C   . ALA B  1 307 ? 14.467  53.937  113.981 1.00 63.80  ? 307  ALA B C   1 
ATOM   4344  O  O   . ALA B  1 307 ? 13.681  53.433  113.148 1.00 63.85  ? 307  ALA B O   1 
ATOM   4345  C  CB  . ALA B  1 307 ? 12.541  55.136  115.065 1.00 64.12  ? 307  ALA B CB  1 
HETATM 4346  N  N   . MSE C  1 1   ? 61.688  42.385  151.892 1.00 92.26  ? 1    MSE C N   1 
HETATM 4347  C  CA  . MSE C  1 1   ? 61.574  42.187  150.416 1.00 93.18  ? 1    MSE C CA  1 
HETATM 4348  C  C   . MSE C  1 1   ? 62.077  43.423  149.670 1.00 93.14  ? 1    MSE C C   1 
HETATM 4349  O  O   . MSE C  1 1   ? 61.814  44.559  150.075 1.00 92.79  ? 1    MSE C O   1 
HETATM 4350  C  CB  . MSE C  1 1   ? 60.115  41.881  150.036 1.00 93.92  ? 1    MSE C CB  1 
HETATM 4351  C  CG  . MSE C  1 1   ? 59.890  41.564  148.558 1.00 94.54  ? 1    MSE C CG  1 
HETATM 4352  SE SE  . MSE C  1 1   ? 58.185  40.694  148.181 1.00 96.73  ? 1    MSE C SE  1 
HETATM 4353  C  CE  . MSE C  1 1   ? 58.785  39.388  146.890 1.00 95.38  ? 1    MSE C CE  1 
ATOM   4354  N  N   . ASP C  1 2   ? 62.803  43.192  148.579 1.00 93.06  ? 2    ASP C N   1 
ATOM   4355  C  CA  . ASP C  1 2   ? 63.370  44.275  147.786 1.00 92.54  ? 2    ASP C CA  1 
ATOM   4356  C  C   . ASP C  1 2   ? 62.682  44.487  146.437 1.00 91.76  ? 2    ASP C C   1 
ATOM   4357  O  O   . ASP C  1 2   ? 62.141  43.548  145.846 1.00 92.40  ? 2    ASP C O   1 
ATOM   4358  C  CB  . ASP C  1 2   ? 64.861  44.021  147.565 1.00 93.15  ? 2    ASP C CB  1 
ATOM   4359  C  CG  . ASP C  1 2   ? 65.519  45.105  146.740 1.00 95.13  ? 2    ASP C CG  1 
ATOM   4360  O  OD1 . ASP C  1 2   ? 65.176  45.236  145.546 1.00 95.63  ? 2    ASP C OD1 1 
ATOM   4361  O  OD2 . ASP C  1 2   ? 66.376  45.830  147.286 1.00 96.50  ? 2    ASP C OD2 1 
ATOM   4362  N  N   . ASP C  1 3   ? 62.722  45.732  145.963 1.00 89.03  ? 3    ASP C N   1 
ATOM   4363  C  CA  . ASP C  1 3   ? 62.119  46.124  144.692 1.00 85.90  ? 3    ASP C CA  1 
ATOM   4364  C  C   . ASP C  1 3   ? 62.157  45.053  143.622 1.00 85.12  ? 3    ASP C C   1 
ATOM   4365  O  O   . ASP C  1 3   ? 61.124  44.493  143.262 1.00 86.16  ? 3    ASP C O   1 
ATOM   4366  C  CB  . ASP C  1 3   ? 62.801  47.376  144.153 1.00 84.72  ? 3    ASP C CB  1 
ATOM   4367  C  CG  . ASP C  1 3   ? 62.165  48.642  144.663 1.00 84.32  ? 3    ASP C CG  1 
ATOM   4368  O  OD1 . ASP C  1 3   ? 61.864  48.710  145.873 1.00 84.29  ? 3    ASP C OD1 1 
ATOM   4369  O  OD2 . ASP C  1 3   ? 61.971  49.572  143.855 1.00 82.39  ? 3    ASP C OD2 1 
ATOM   4370  N  N   . LYS C  1 4   ? 63.350  44.777  143.108 1.00 83.53  ? 4    LYS C N   1 
ATOM   4371  C  CA  . LYS C  1 4   ? 63.506  43.778  142.059 1.00 81.81  ? 4    LYS C CA  1 
ATOM   4372  C  C   . LYS C  1 4   ? 62.771  42.479  142.371 1.00 80.22  ? 4    LYS C C   1 
ATOM   4373  O  O   . LYS C  1 4   ? 62.110  41.915  141.496 1.00 80.20  ? 4    LYS C O   1 
ATOM   4374  C  CB  . LYS C  1 4   ? 64.991  43.493  141.805 1.00 83.35  ? 4    LYS C CB  1 
ATOM   4375  C  CG  . LYS C  1 4   ? 65.740  44.616  141.078 1.00 83.90  ? 4    LYS C CG  1 
ATOM   4376  C  CD  . LYS C  1 4   ? 65.859  45.886  141.919 1.00 85.22  ? 4    LYS C CD  1 
ATOM   4377  C  CE  . LYS C  1 4   ? 66.752  45.675  143.133 1.00 84.06  ? 4    LYS C CE  1 
ATOM   4378  N  NZ  . LYS C  1 4   ? 66.807  46.881  144.007 1.00 84.89  ? 4    LYS C NZ  1 
ATOM   4379  N  N   . GLU C  1 5   ? 62.871  42.012  143.614 1.00 77.42  ? 5    GLU C N   1 
ATOM   4380  C  CA  . GLU C  1 5   ? 62.207  40.775  144.009 1.00 74.87  ? 5    GLU C CA  1 
ATOM   4381  C  C   . GLU C  1 5   ? 60.699  40.956  143.965 1.00 72.48  ? 5    GLU C C   1 
ATOM   4382  O  O   . GLU C  1 5   ? 59.956  40.018  143.660 1.00 71.22  ? 5    GLU C O   1 
ATOM   4383  C  CB  . GLU C  1 5   ? 62.670  40.355  145.399 1.00 77.24  ? 5    GLU C CB  1 
ATOM   4384  C  CG  . GLU C  1 5   ? 64.179  40.236  145.477 1.00 81.24  ? 5    GLU C CG  1 
ATOM   4385  C  CD  . GLU C  1 5   ? 64.664  39.610  146.762 1.00 83.78  ? 5    GLU C CD  1 
ATOM   4386  O  OE1 . GLU C  1 5   ? 64.277  40.099  147.844 1.00 85.73  ? 5    GLU C OE1 1 
ATOM   4387  O  OE2 . GLU C  1 5   ? 65.442  38.635  146.686 1.00 83.71  ? 5    GLU C OE2 1 
ATOM   4388  N  N   . LEU C  1 6   ? 60.250  42.168  144.270 1.00 70.42  ? 6    LEU C N   1 
ATOM   4389  C  CA  . LEU C  1 6   ? 58.828  42.480  144.211 1.00 68.22  ? 6    LEU C CA  1 
ATOM   4390  C  C   . LEU C  1 6   ? 58.407  42.242  142.775 1.00 67.30  ? 6    LEU C C   1 
ATOM   4391  O  O   . LEU C  1 6   ? 57.597  41.361  142.483 1.00 67.93  ? 6    LEU C O   1 
ATOM   4392  C  CB  . LEU C  1 6   ? 58.574  43.951  144.509 1.00 66.24  ? 6    LEU C CB  1 
ATOM   4393  C  CG  . LEU C  1 6   ? 58.943  44.510  145.863 1.00 67.74  ? 6    LEU C CG  1 
ATOM   4394  C  CD1 . LEU C  1 6   ? 58.785  46.016  145.830 1.00 67.55  ? 6    LEU C CD1 1 
ATOM   4395  C  CD2 . LEU C  1 6   ? 58.061  43.881  146.909 1.00 68.65  ? 6    LEU C CD2 1 
ATOM   4396  N  N   . ILE C  1 7   ? 58.987  43.051  141.888 1.00 64.75  ? 7    ILE C N   1 
ATOM   4397  C  CA  . ILE C  1 7   ? 58.704  43.010  140.462 1.00 62.45  ? 7    ILE C CA  1 
ATOM   4398  C  C   . ILE C  1 7   ? 58.718  41.611  139.885 1.00 62.99  ? 7    ILE C C   1 
ATOM   4399  O  O   . ILE C  1 7   ? 57.886  41.278  139.039 1.00 63.07  ? 7    ILE C O   1 
ATOM   4400  C  CB  . ILE C  1 7   ? 59.693  43.898  139.678 1.00 59.85  ? 7    ILE C CB  1 
ATOM   4401  C  CG1 . ILE C  1 7   ? 59.571  45.342  140.169 1.00 56.59  ? 7    ILE C CG1 1 
ATOM   4402  C  CG2 . ILE C  1 7   ? 59.394  43.831  138.186 1.00 56.26  ? 7    ILE C CG2 1 
ATOM   4403  C  CD1 . ILE C  1 7   ? 60.535  46.307  139.528 1.00 57.35  ? 7    ILE C CD1 1 
ATOM   4404  N  N   . GLU C  1 8   ? 59.654  40.785  140.337 1.00 63.65  ? 8    GLU C N   1 
ATOM   4405  C  CA  . GLU C  1 8   ? 59.727  39.418  139.836 1.00 65.58  ? 8    GLU C CA  1 
ATOM   4406  C  C   . GLU C  1 8   ? 58.570  38.618  140.422 1.00 62.56  ? 8    GLU C C   1 
ATOM   4407  O  O   . GLU C  1 8   ? 57.873  37.891  139.714 1.00 61.70  ? 8    GLU C O   1 
ATOM   4408  C  CB  . GLU C  1 8   ? 61.056  38.776  140.232 1.00 70.03  ? 8    GLU C CB  1 
ATOM   4409  C  CG  . GLU C  1 8   ? 62.273  39.602  139.860 1.00 77.20  ? 8    GLU C CG  1 
ATOM   4410  C  CD  . GLU C  1 8   ? 63.536  39.116  140.553 1.00 81.72  ? 8    GLU C CD  1 
ATOM   4411  O  OE1 . GLU C  1 8   ? 63.491  38.912  141.787 1.00 82.98  ? 8    GLU C OE1 1 
ATOM   4412  O  OE2 . GLU C  1 8   ? 64.570  38.946  139.868 1.00 83.26  ? 8    GLU C OE2 1 
ATOM   4413  N  N   . TYR C  1 9   ? 58.366  38.768  141.724 1.00 60.98  ? 9    TYR C N   1 
ATOM   4414  C  CA  . TYR C  1 9   ? 57.297  38.053  142.400 1.00 59.72  ? 9    TYR C CA  1 
ATOM   4415  C  C   . TYR C  1 9   ? 55.966  38.414  141.764 1.00 57.86  ? 9    TYR C C   1 
ATOM   4416  O  O   . TYR C  1 9   ? 55.062  37.584  141.670 1.00 58.53  ? 9    TYR C O   1 
ATOM   4417  C  CB  . TYR C  1 9   ? 57.267  38.409  143.888 1.00 57.78  ? 9    TYR C CB  1 
ATOM   4418  C  CG  . TYR C  1 9   ? 56.182  37.668  144.619 1.00 57.12  ? 9    TYR C CG  1 
ATOM   4419  C  CD1 . TYR C  1 9   ? 56.327  36.323  144.942 1.00 56.26  ? 9    TYR C CD1 1 
ATOM   4420  C  CD2 . TYR C  1 9   ? 54.980  38.294  144.935 1.00 59.13  ? 9    TYR C CD2 1 
ATOM   4421  C  CE1 . TYR C  1 9   ? 55.298  35.619  145.562 1.00 56.34  ? 9    TYR C CE1 1 
ATOM   4422  C  CE2 . TYR C  1 9   ? 53.942  37.600  145.552 1.00 56.81  ? 9    TYR C CE2 1 
ATOM   4423  C  CZ  . TYR C  1 9   ? 54.110  36.265  145.862 1.00 56.74  ? 9    TYR C CZ  1 
ATOM   4424  O  OH  . TYR C  1 9   ? 53.089  35.581  146.474 1.00 57.69  ? 9    TYR C OH  1 
ATOM   4425  N  N   . PHE C  1 10  ? 55.867  39.663  141.321 1.00 56.29  ? 10   PHE C N   1 
ATOM   4426  C  CA  . PHE C  1 10  ? 54.661  40.183  140.690 1.00 54.17  ? 10   PHE C CA  1 
ATOM   4427  C  C   . PHE C  1 10  ? 54.425  39.558  139.324 1.00 54.35  ? 10   PHE C C   1 
ATOM   4428  O  O   . PHE C  1 10  ? 53.352  39.009  139.063 1.00 54.88  ? 10   PHE C O   1 
ATOM   4429  C  CB  . PHE C  1 10  ? 54.765  41.702  140.556 1.00 51.96  ? 10   PHE C CB  1 
ATOM   4430  C  CG  . PHE C  1 10  ? 53.544  42.347  139.974 1.00 53.67  ? 10   PHE C CG  1 
ATOM   4431  C  CD1 . PHE C  1 10  ? 52.274  42.046  140.468 1.00 55.00  ? 10   PHE C CD1 1 
ATOM   4432  C  CD2 . PHE C  1 10  ? 53.659  43.287  138.952 1.00 51.32  ? 10   PHE C CD2 1 
ATOM   4433  C  CE1 . PHE C  1 10  ? 51.138  42.678  139.951 1.00 51.06  ? 10   PHE C CE1 1 
ATOM   4434  C  CE2 . PHE C  1 10  ? 52.530  43.922  138.434 1.00 49.84  ? 10   PHE C CE2 1 
ATOM   4435  C  CZ  . PHE C  1 10  ? 51.270  43.617  138.935 1.00 49.29  ? 10   PHE C CZ  1 
ATOM   4436  N  N   . LYS C  1 11  ? 55.428  39.633  138.454 1.00 52.90  ? 11   LYS C N   1 
ATOM   4437  C  CA  . LYS C  1 11  ? 55.294  39.070  137.116 1.00 50.93  ? 11   LYS C CA  1 
ATOM   4438  C  C   . LYS C  1 11  ? 55.013  37.582  137.156 1.00 50.09  ? 11   LYS C C   1 
ATOM   4439  O  O   . LYS C  1 11  ? 54.226  37.069  136.363 1.00 46.17  ? 11   LYS C O   1 
ATOM   4440  C  CB  . LYS C  1 11  ? 56.549  39.339  136.301 1.00 51.26  ? 11   LYS C CB  1 
ATOM   4441  C  CG  . LYS C  1 11  ? 56.851  40.810  136.180 1.00 54.44  ? 11   LYS C CG  1 
ATOM   4442  C  CD  . LYS C  1 11  ? 57.947  41.066  135.171 1.00 57.36  ? 11   LYS C CD  1 
ATOM   4443  C  CE  . LYS C  1 11  ? 58.186  42.554  135.019 1.00 59.20  ? 11   LYS C CE  1 
ATOM   4444  N  NZ  . LYS C  1 11  ? 59.092  42.854  133.882 1.00 60.89  ? 11   LYS C NZ  1 
ATOM   4445  N  N   . SER C  1 12  ? 55.652  36.888  138.090 1.00 52.03  ? 12   SER C N   1 
ATOM   4446  C  CA  . SER C  1 12  ? 55.452  35.450  138.216 1.00 53.32  ? 12   SER C CA  1 
ATOM   4447  C  C   . SER C  1 12  ? 53.990  35.184  138.514 1.00 52.33  ? 12   SER C C   1 
ATOM   4448  O  O   . SER C  1 12  ? 53.418  34.226  138.005 1.00 49.10  ? 12   SER C O   1 
ATOM   4449  C  CB  . SER C  1 12  ? 56.322  34.879  139.341 1.00 53.90  ? 12   SER C CB  1 
ATOM   4450  O  OG  . SER C  1 12  ? 57.692  35.080  139.053 1.00 55.80  ? 12   SER C OG  1 
ATOM   4451  N  N   . GLN C  1 13  ? 53.399  36.045  139.341 1.00 53.63  ? 13   GLN C N   1 
ATOM   4452  C  CA  . GLN C  1 13  ? 51.993  35.926  139.719 1.00 54.77  ? 13   GLN C CA  1 
ATOM   4453  C  C   . GLN C  1 13  ? 51.106  35.834  138.489 1.00 56.04  ? 13   GLN C C   1 
ATOM   4454  O  O   . GLN C  1 13  ? 50.228  34.970  138.395 1.00 54.90  ? 13   GLN C O   1 
ATOM   4455  C  CB  . GLN C  1 13  ? 51.549  37.141  140.541 1.00 54.90  ? 13   GLN C CB  1 
ATOM   4456  C  CG  . GLN C  1 13  ? 51.919  37.099  142.005 1.00 57.23  ? 13   GLN C CG  1 
ATOM   4457  C  CD  . GLN C  1 13  ? 51.423  35.833  142.678 1.00 59.31  ? 13   GLN C CD  1 
ATOM   4458  O  OE1 . GLN C  1 13  ? 50.256  35.457  142.546 1.00 59.27  ? 13   GLN C OE1 1 
ATOM   4459  N  NE2 . GLN C  1 13  ? 52.310  35.169  143.405 1.00 59.00  ? 13   GLN C NE2 1 
HETATM 4460  N  N   . MSE C  1 14  ? 51.357  36.732  137.542 1.00 56.43  ? 14   MSE C N   1 
HETATM 4461  C  CA  . MSE C  1 14  ? 50.569  36.805  136.329 1.00 57.69  ? 14   MSE C CA  1 
HETATM 4462  C  C   . MSE C  1 14  ? 50.928  35.805  135.255 1.00 58.25  ? 14   MSE C C   1 
HETATM 4463  O  O   . MSE C  1 14  ? 50.093  35.474  134.413 1.00 58.81  ? 14   MSE C O   1 
HETATM 4464  C  CB  . MSE C  1 14  ? 50.645  38.216  135.792 1.00 59.26  ? 14   MSE C CB  1 
HETATM 4465  C  CG  . MSE C  1 14  ? 50.285  39.222  136.851 1.00 62.40  ? 14   MSE C CG  1 
HETATM 4466  SE SE  . MSE C  1 14  ? 50.082  40.961  136.120 1.00 75.70  ? 14   MSE C SE  1 
HETATM 4467  C  CE  . MSE C  1 14  ? 51.945  41.435  135.851 1.00 67.22  ? 14   MSE C CE  1 
ATOM   4468  N  N   . LYS C  1 15  ? 52.167  35.326  135.285 1.00 58.66  ? 15   LYS C N   1 
ATOM   4469  C  CA  . LYS C  1 15  ? 52.631  34.340  134.322 1.00 59.64  ? 15   LYS C CA  1 
ATOM   4470  C  C   . LYS C  1 15  ? 51.964  33.001  134.620 1.00 60.98  ? 15   LYS C C   1 
ATOM   4471  O  O   . LYS C  1 15  ? 51.556  32.285  133.706 1.00 59.05  ? 15   LYS C O   1 
ATOM   4472  C  CB  . LYS C  1 15  ? 54.143  34.176  134.426 1.00 62.32  ? 15   LYS C CB  1 
ATOM   4473  C  CG  . LYS C  1 15  ? 54.940  35.425  134.106 1.00 65.90  ? 15   LYS C CG  1 
ATOM   4474  C  CD  . LYS C  1 15  ? 56.296  35.394  134.805 1.00 69.33  ? 15   LYS C CD  1 
ATOM   4475  C  CE  . LYS C  1 15  ? 57.089  34.137  134.472 1.00 70.83  ? 15   LYS C CE  1 
ATOM   4476  N  NZ  . LYS C  1 15  ? 58.352  34.064  135.261 1.00 70.87  ? 15   LYS C NZ  1 
ATOM   4477  N  N   . GLU C  1 16  ? 51.852  32.672  135.904 1.00 62.16  ? 16   GLU C N   1 
ATOM   4478  C  CA  . GLU C  1 16  ? 51.252  31.406  136.324 1.00 67.91  ? 16   GLU C CA  1 
ATOM   4479  C  C   . GLU C  1 16  ? 49.718  31.403  136.335 1.00 66.65  ? 16   GLU C C   1 
ATOM   4480  O  O   . GLU C  1 16  ? 49.085  30.348  136.390 1.00 67.23  ? 16   GLU C O   1 
ATOM   4481  C  CB  . GLU C  1 16  ? 51.815  30.994  137.699 1.00 74.21  ? 16   GLU C CB  1 
ATOM   4482  C  CG  . GLU C  1 16  ? 51.806  32.108  138.755 1.00 83.17  ? 16   GLU C CG  1 
ATOM   4483  C  CD  . GLU C  1 16  ? 52.907  31.952  139.810 1.00 87.43  ? 16   GLU C CD  1 
ATOM   4484  O  OE1 . GLU C  1 16  ? 54.070  31.686  139.423 1.00 89.83  ? 16   GLU C OE1 1 
ATOM   4485  O  OE2 . GLU C  1 16  ? 52.613  32.113  141.019 1.00 87.82  ? 16   GLU C OE2 1 
ATOM   4486  N  N   . ASP C  1 17  ? 49.120  32.584  136.285 1.00 65.29  ? 17   ASP C N   1 
ATOM   4487  C  CA  . ASP C  1 17  ? 47.670  32.689  136.252 1.00 63.26  ? 17   ASP C CA  1 
ATOM   4488  C  C   . ASP C  1 17  ? 47.343  33.972  135.509 1.00 61.87  ? 17   ASP C C   1 
ATOM   4489  O  O   . ASP C  1 17  ? 47.029  35.001  136.104 1.00 61.28  ? 17   ASP C O   1 
ATOM   4490  C  CB  . ASP C  1 17  ? 47.086  32.704  137.669 1.00 64.04  ? 17   ASP C CB  1 
ATOM   4491  C  CG  . ASP C  1 17  ? 45.560  32.692  137.676 1.00 65.92  ? 17   ASP C CG  1 
ATOM   4492  O  OD1 . ASP C  1 17  ? 44.958  31.953  136.864 1.00 65.97  ? 17   ASP C OD1 1 
ATOM   4493  O  OD2 . ASP C  1 17  ? 44.958  33.410  138.506 1.00 64.21  ? 17   ASP C OD2 1 
ATOM   4494  N  N   . PRO C  1 18  ? 47.447  33.924  134.178 1.00 61.73  ? 18   PRO C N   1 
ATOM   4495  C  CA  . PRO C  1 18  ? 47.174  35.051  133.283 1.00 61.56  ? 18   PRO C CA  1 
ATOM   4496  C  C   . PRO C  1 18  ? 45.728  35.555  133.394 1.00 62.12  ? 18   PRO C C   1 
ATOM   4497  O  O   . PRO C  1 18  ? 45.426  36.704  133.043 1.00 62.84  ? 18   PRO C O   1 
ATOM   4498  C  CB  . PRO C  1 18  ? 47.495  34.471  131.907 1.00 58.69  ? 18   PRO C CB  1 
ATOM   4499  C  CG  . PRO C  1 18  ? 47.136  33.035  132.063 1.00 57.65  ? 18   PRO C CG  1 
ATOM   4500  C  CD  . PRO C  1 18  ? 47.745  32.707  133.403 1.00 59.95  ? 18   PRO C CD  1 
ATOM   4501  N  N   . ASP C  1 19  ? 44.838  34.698  133.884 1.00 60.79  ? 19   ASP C N   1 
ATOM   4502  C  CA  . ASP C  1 19  ? 43.447  35.086  134.043 1.00 61.42  ? 19   ASP C CA  1 
ATOM   4503  C  C   . ASP C  1 19  ? 43.260  35.864  135.358 1.00 60.94  ? 19   ASP C C   1 
ATOM   4504  O  O   . ASP C  1 19  ? 42.136  36.134  135.796 1.00 59.30  ? 19   ASP C O   1 
ATOM   4505  C  CB  . ASP C  1 19  ? 42.562  33.843  134.031 1.00 63.37  ? 19   ASP C CB  1 
ATOM   4506  C  CG  . ASP C  1 19  ? 41.098  34.181  133.851 1.00 67.72  ? 19   ASP C CG  1 
ATOM   4507  O  OD1 . ASP C  1 19  ? 40.773  34.806  132.811 1.00 70.89  ? 19   ASP C OD1 1 
ATOM   4508  O  OD2 . ASP C  1 19  ? 40.281  33.830  134.738 1.00 65.21  ? 19   ASP C OD2 1 
HETATM 4509  N  N   . MSE C  1 20  ? 44.378  36.226  135.978 1.00 59.83  ? 20   MSE C N   1 
HETATM 4510  C  CA  . MSE C  1 20  ? 44.361  36.961  137.231 1.00 57.76  ? 20   MSE C CA  1 
HETATM 4511  C  C   . MSE C  1 20  ? 44.395  38.455  136.977 1.00 54.32  ? 20   MSE C C   1 
HETATM 4512  O  O   . MSE C  1 20  ? 45.209  38.945  136.201 1.00 52.31  ? 20   MSE C O   1 
HETATM 4513  C  CB  . MSE C  1 20  ? 45.565  36.568  138.104 1.00 62.51  ? 20   MSE C CB  1 
HETATM 4514  C  CG  . MSE C  1 20  ? 45.633  37.280  139.471 1.00 69.26  ? 20   MSE C CG  1 
HETATM 4515  SE SE  . MSE C  1 20  ? 47.145  36.764  140.622 1.00 78.46  ? 20   MSE C SE  1 
HETATM 4516  C  CE  . MSE C  1 20  ? 46.390  35.129  141.346 1.00 70.55  ? 20   MSE C CE  1 
ATOM   4517  N  N   . ALA C  1 21  ? 43.491  39.172  137.632 1.00 52.26  ? 21   ALA C N   1 
ATOM   4518  C  CA  . ALA C  1 21  ? 43.438  40.612  137.522 1.00 49.70  ? 21   ALA C CA  1 
ATOM   4519  C  C   . ALA C  1 21  ? 44.803  41.104  138.006 1.00 51.18  ? 21   ALA C C   1 
ATOM   4520  O  O   . ALA C  1 21  ? 45.331  40.608  139.005 1.00 52.86  ? 21   ALA C O   1 
ATOM   4521  C  CB  . ALA C  1 21  ? 42.338  41.147  138.406 1.00 49.10  ? 21   ALA C CB  1 
ATOM   4522  N  N   . SER C  1 22  ? 45.380  42.065  137.297 1.00 50.31  ? 22   SER C N   1 
ATOM   4523  C  CA  . SER C  1 22  ? 46.683  42.588  137.663 1.00 50.50  ? 22   SER C CA  1 
ATOM   4524  C  C   . SER C  1 22  ? 46.667  43.118  139.095 1.00 50.46  ? 22   SER C C   1 
ATOM   4525  O  O   . SER C  1 22  ? 47.583  42.863  139.875 1.00 51.48  ? 22   SER C O   1 
ATOM   4526  C  CB  . SER C  1 22  ? 47.090  43.712  136.704 1.00 53.93  ? 22   SER C CB  1 
ATOM   4527  O  OG  . SER C  1 22  ? 46.480  44.943  137.072 1.00 58.14  ? 22   SER C OG  1 
ATOM   4528  N  N   . ALA C  1 23  ? 45.623  43.860  139.440 1.00 49.56  ? 23   ALA C N   1 
ATOM   4529  C  CA  . ALA C  1 23  ? 45.514  44.414  140.782 1.00 48.79  ? 23   ALA C CA  1 
ATOM   4530  C  C   . ALA C  1 23  ? 45.595  43.302  141.821 1.00 46.64  ? 23   ALA C C   1 
ATOM   4531  O  O   . ALA C  1 23  ? 46.270  43.441  142.831 1.00 48.35  ? 23   ALA C O   1 
ATOM   4532  C  CB  . ALA C  1 23  ? 44.201  45.200  140.933 1.00 49.02  ? 23   ALA C CB  1 
ATOM   4533  N  N   . VAL C  1 24  ? 44.906  42.197  141.579 1.00 46.21  ? 24   VAL C N   1 
ATOM   4534  C  CA  . VAL C  1 24  ? 44.959  41.091  142.519 1.00 47.87  ? 24   VAL C CA  1 
ATOM   4535  C  C   . VAL C  1 24  ? 46.384  40.533  142.571 1.00 49.42  ? 24   VAL C C   1 
ATOM   4536  O  O   . VAL C  1 24  ? 46.846  40.098  143.619 1.00 48.01  ? 24   VAL C O   1 
ATOM   4537  C  CB  . VAL C  1 24  ? 43.961  39.980  142.123 1.00 48.28  ? 24   VAL C CB  1 
ATOM   4538  C  CG1 . VAL C  1 24  ? 44.328  38.662  142.799 1.00 48.20  ? 24   VAL C CG1 1 
ATOM   4539  C  CG2 . VAL C  1 24  ? 42.554  40.396  142.530 1.00 45.06  ? 24   VAL C CG2 1 
ATOM   4540  N  N   . ALA C  1 25  ? 47.084  40.545  141.442 1.00 52.19  ? 25   ALA C N   1 
ATOM   4541  C  CA  . ALA C  1 25  ? 48.456  40.048  141.426 1.00 55.59  ? 25   ALA C CA  1 
ATOM   4542  C  C   . ALA C  1 25  ? 49.280  41.037  142.226 1.00 55.59  ? 25   ALA C C   1 
ATOM   4543  O  O   . ALA C  1 25  ? 50.226  40.667  142.922 1.00 56.49  ? 25   ALA C O   1 
ATOM   4544  C  CB  . ALA C  1 25  ? 48.984  39.959  139.997 1.00 56.12  ? 25   ALA C CB  1 
ATOM   4545  N  N   . ALA C  1 26  ? 48.889  42.303  142.130 1.00 54.90  ? 26   ALA C N   1 
ATOM   4546  C  CA  . ALA C  1 26  ? 49.567  43.382  142.831 1.00 54.58  ? 26   ALA C CA  1 
ATOM   4547  C  C   . ALA C  1 26  ? 49.420  43.276  144.345 1.00 56.30  ? 26   ALA C C   1 
ATOM   4548  O  O   . ALA C  1 26  ? 50.415  43.367  145.065 1.00 58.72  ? 26   ALA C O   1 
ATOM   4549  C  CB  . ALA C  1 26  ? 49.044  44.727  142.348 1.00 51.21  ? 26   ALA C CB  1 
ATOM   4550  N  N   . ILE C  1 27  ? 48.198  43.084  144.843 1.00 55.35  ? 27   ILE C N   1 
ATOM   4551  C  CA  . ILE C  1 27  ? 48.035  42.986  146.288 1.00 54.89  ? 27   ILE C CA  1 
ATOM   4552  C  C   . ILE C  1 27  ? 48.530  41.643  146.849 1.00 53.92  ? 27   ILE C C   1 
ATOM   4553  O  O   . ILE C  1 27  ? 48.761  41.530  148.052 1.00 54.35  ? 27   ILE C O   1 
ATOM   4554  C  CB  . ILE C  1 27  ? 46.563  43.245  146.762 1.00 55.11  ? 27   ILE C CB  1 
ATOM   4555  C  CG1 . ILE C  1 27  ? 45.759  41.957  146.733 1.00 55.07  ? 27   ILE C CG1 1 
ATOM   4556  C  CG2 . ILE C  1 27  ? 45.901  44.313  145.901 1.00 53.07  ? 27   ILE C CG2 1 
ATOM   4557  C  CD1 . ILE C  1 27  ? 44.538  42.027  147.597 1.00 58.75  ? 27   ILE C CD1 1 
ATOM   4558  N  N   . ARG C  1 28  ? 48.695  40.630  145.997 1.00 51.26  ? 28   ARG C N   1 
ATOM   4559  C  CA  . ARG C  1 28  ? 49.211  39.349  146.469 1.00 49.10  ? 28   ARG C CA  1 
ATOM   4560  C  C   . ARG C  1 28  ? 50.691  39.516  146.791 1.00 50.44  ? 28   ARG C C   1 
ATOM   4561  O  O   . ARG C  1 28  ? 51.224  38.826  147.662 1.00 52.67  ? 28   ARG C O   1 
ATOM   4562  C  CB  . ARG C  1 28  ? 49.079  38.256  145.419 1.00 49.44  ? 28   ARG C CB  1 
ATOM   4563  C  CG  . ARG C  1 28  ? 47.725  37.616  145.314 1.00 50.46  ? 28   ARG C CG  1 
ATOM   4564  C  CD  . ARG C  1 28  ? 47.870  36.298  144.571 1.00 54.30  ? 28   ARG C CD  1 
ATOM   4565  N  NE  . ARG C  1 28  ? 46.596  35.639  144.302 1.00 61.71  ? 28   ARG C NE  1 
ATOM   4566  C  CZ  . ARG C  1 28  ? 45.646  35.419  145.209 1.00 66.25  ? 28   ARG C CZ  1 
ATOM   4567  N  NH1 . ARG C  1 28  ? 45.812  35.812  146.468 1.00 67.89  ? 28   ARG C NH1 1 
ATOM   4568  N  NH2 . ARG C  1 28  ? 44.526  34.795  144.856 1.00 65.21  ? 28   ARG C NH2 1 
ATOM   4569  N  N   . THR C  1 29  ? 51.366  40.425  146.088 1.00 49.76  ? 29   THR C N   1 
ATOM   4570  C  CA  . THR C  1 29  ? 52.782  40.638  146.357 1.00 48.88  ? 29   THR C CA  1 
ATOM   4571  C  C   . THR C  1 29  ? 52.935  41.553  147.563 1.00 48.68  ? 29   THR C C   1 
ATOM   4572  O  O   . THR C  1 29  ? 53.905  41.442  148.304 1.00 50.50  ? 29   THR C O   1 
ATOM   4573  C  CB  . THR C  1 29  ? 53.540  41.236  145.144 1.00 46.39  ? 29   THR C CB  1 
ATOM   4574  O  OG1 . THR C  1 29  ? 53.413  42.658  145.141 1.00 50.01  ? 29   THR C OG1 1 
ATOM   4575  C  CG2 . THR C  1 29  ? 52.992  40.678  143.854 1.00 44.81  ? 29   THR C CG2 1 
ATOM   4576  N  N   . LEU C  1 30  ? 51.980  42.457  147.762 1.00 49.00  ? 30   LEU C N   1 
ATOM   4577  C  CA  . LEU C  1 30  ? 52.015  43.341  148.924 1.00 48.88  ? 30   LEU C CA  1 
ATOM   4578  C  C   . LEU C  1 30  ? 51.932  42.436  150.154 1.00 50.65  ? 30   LEU C C   1 
ATOM   4579  O  O   . LEU C  1 30  ? 52.647  42.636  151.131 1.00 51.31  ? 30   LEU C O   1 
ATOM   4580  C  CB  . LEU C  1 30  ? 50.821  44.309  148.915 1.00 47.00  ? 30   LEU C CB  1 
ATOM   4581  C  CG  . LEU C  1 30  ? 50.955  45.644  148.180 1.00 46.32  ? 30   LEU C CG  1 
ATOM   4582  C  CD1 . LEU C  1 30  ? 51.907  46.534  148.938 1.00 51.04  ? 30   LEU C CD1 1 
ATOM   4583  C  CD2 . LEU C  1 30  ? 51.456  45.433  146.765 1.00 47.76  ? 30   LEU C CD2 1 
ATOM   4584  N  N   . LEU C  1 31  ? 51.053  41.437  150.102 1.00 51.18  ? 31   LEU C N   1 
ATOM   4585  C  CA  . LEU C  1 31  ? 50.912  40.508  151.213 1.00 53.80  ? 31   LEU C CA  1 
ATOM   4586  C  C   . LEU C  1 31  ? 52.220  39.766  151.460 1.00 57.10  ? 31   LEU C C   1 
ATOM   4587  O  O   . LEU C  1 31  ? 52.607  39.576  152.611 1.00 60.11  ? 31   LEU C O   1 
ATOM   4588  C  CB  . LEU C  1 31  ? 49.785  39.503  150.957 1.00 51.86  ? 31   LEU C CB  1 
ATOM   4589  C  CG  . LEU C  1 31  ? 48.383  39.904  151.413 1.00 50.17  ? 31   LEU C CG  1 
ATOM   4590  C  CD1 . LEU C  1 31  ? 47.456  38.742  151.180 1.00 52.73  ? 31   LEU C CD1 1 
ATOM   4591  C  CD2 . LEU C  1 31  ? 48.375  40.278  152.885 1.00 50.90  ? 31   LEU C CD2 1 
ATOM   4592  N  N   . GLU C  1 32  ? 52.896  39.325  150.399 1.00 58.84  ? 32   GLU C N   1 
ATOM   4593  C  CA  . GLU C  1 32  ? 54.179  38.652  150.584 1.00 60.86  ? 32   GLU C CA  1 
ATOM   4594  C  C   . GLU C  1 32  ? 55.159  39.676  151.147 1.00 61.16  ? 32   GLU C C   1 
ATOM   4595  O  O   . GLU C  1 32  ? 55.895  39.392  152.084 1.00 62.98  ? 32   GLU C O   1 
ATOM   4596  C  CB  . GLU C  1 32  ? 54.736  38.112  149.269 1.00 62.45  ? 32   GLU C CB  1 
ATOM   4597  C  CG  . GLU C  1 32  ? 54.515  36.625  149.046 1.00 67.54  ? 32   GLU C CG  1 
ATOM   4598  C  CD  . GLU C  1 32  ? 54.878  35.766  150.253 1.00 70.32  ? 32   GLU C CD  1 
ATOM   4599  O  OE1 . GLU C  1 32  ? 54.002  35.593  151.129 1.00 72.94  ? 32   GLU C OE1 1 
ATOM   4600  O  OE2 . GLU C  1 32  ? 56.029  35.270  150.328 1.00 69.68  ? 32   GLU C OE2 1 
ATOM   4601  N  N   . PHE C  1 33  ? 55.163  40.872  150.570 1.00 60.00  ? 33   PHE C N   1 
ATOM   4602  C  CA  . PHE C  1 33  ? 56.051  41.919  151.039 1.00 61.16  ? 33   PHE C CA  1 
ATOM   4603  C  C   . PHE C  1 33  ? 55.743  42.239  152.495 1.00 61.72  ? 33   PHE C C   1 
ATOM   4604  O  O   . PHE C  1 33  ? 56.638  42.534  153.275 1.00 62.60  ? 33   PHE C O   1 
ATOM   4605  C  CB  . PHE C  1 33  ? 55.883  43.191  150.207 1.00 62.51  ? 33   PHE C CB  1 
ATOM   4606  C  CG  . PHE C  1 33  ? 56.653  44.368  150.744 1.00 63.99  ? 33   PHE C CG  1 
ATOM   4607  C  CD1 . PHE C  1 33  ? 57.891  44.712  150.206 1.00 64.78  ? 33   PHE C CD1 1 
ATOM   4608  C  CD2 . PHE C  1 33  ? 56.163  45.104  151.822 1.00 62.93  ? 33   PHE C CD2 1 
ATOM   4609  C  CE1 . PHE C  1 33  ? 58.631  45.770  150.734 1.00 63.93  ? 33   PHE C CE1 1 
ATOM   4610  C  CE2 . PHE C  1 33  ? 56.893  46.158  152.356 1.00 64.49  ? 33   PHE C CE2 1 
ATOM   4611  C  CZ  . PHE C  1 33  ? 58.131  46.493  151.810 1.00 64.44  ? 33   PHE C CZ  1 
ATOM   4612  N  N   . LEU C  1 34  ? 54.469  42.202  152.856 1.00 61.86  ? 34   LEU C N   1 
ATOM   4613  C  CA  . LEU C  1 34  ? 54.086  42.507  154.223 1.00 62.35  ? 34   LEU C CA  1 
ATOM   4614  C  C   . LEU C  1 34  ? 54.686  41.444  155.120 1.00 63.40  ? 34   LEU C C   1 
ATOM   4615  O  O   . LEU C  1 34  ? 55.157  41.734  156.213 1.00 64.75  ? 34   LEU C O   1 
ATOM   4616  C  CB  . LEU C  1 34  ? 52.566  42.505  154.366 1.00 60.12  ? 34   LEU C CB  1 
ATOM   4617  C  CG  . LEU C  1 34  ? 51.975  43.553  155.306 1.00 56.74  ? 34   LEU C CG  1 
ATOM   4618  C  CD1 . LEU C  1 34  ? 50.534  43.177  155.619 1.00 58.56  ? 34   LEU C CD1 1 
ATOM   4619  C  CD2 . LEU C  1 34  ? 52.784  43.634  156.578 1.00 54.53  ? 34   LEU C CD2 1 
ATOM   4620  N  N   . LYS C  1 35  ? 54.675  40.207  154.643 1.00 63.86  ? 35   LYS C N   1 
ATOM   4621  C  CA  . LYS C  1 35  ? 55.224  39.104  155.404 1.00 66.48  ? 35   LYS C CA  1 
ATOM   4622  C  C   . LYS C  1 35  ? 56.750  39.135  155.386 1.00 70.61  ? 35   LYS C C   1 
ATOM   4623  O  O   . LYS C  1 35  ? 57.368  39.356  156.423 1.00 73.84  ? 35   LYS C O   1 
ATOM   4624  C  CB  . LYS C  1 35  ? 54.702  37.789  154.846 1.00 64.40  ? 35   LYS C CB  1 
ATOM   4625  C  CG  . LYS C  1 35  ? 53.193  37.695  154.915 1.00 64.68  ? 35   LYS C CG  1 
ATOM   4626  C  CD  . LYS C  1 35  ? 52.681  36.479  154.189 1.00 63.93  ? 35   LYS C CD  1 
ATOM   4627  C  CE  . LYS C  1 35  ? 51.175  36.437  154.223 1.00 64.66  ? 35   LYS C CE  1 
ATOM   4628  N  NZ  . LYS C  1 35  ? 50.663  35.186  153.603 1.00 67.95  ? 35   LYS C NZ  1 
ATOM   4629  N  N   . ARG C  1 36  ? 57.360  38.934  154.220 1.00 72.62  ? 36   ARG C N   1 
ATOM   4630  C  CA  . ARG C  1 36  ? 58.818  38.950  154.111 1.00 74.90  ? 36   ARG C CA  1 
ATOM   4631  C  C   . ARG C  1 36  ? 59.440  40.215  154.688 1.00 77.40  ? 36   ARG C C   1 
ATOM   4632  O  O   . ARG C  1 36  ? 60.651  40.273  154.903 1.00 75.57  ? 36   ARG C O   1 
ATOM   4633  C  CB  . ARG C  1 36  ? 59.254  38.805  152.655 1.00 75.31  ? 36   ARG C CB  1 
ATOM   4634  C  CG  . ARG C  1 36  ? 58.897  37.477  152.030 1.00 75.97  ? 36   ARG C CG  1 
ATOM   4635  C  CD  . ARG C  1 36  ? 59.540  37.353  150.664 1.00 78.71  ? 36   ARG C CD  1 
ATOM   4636  N  NE  . ARG C  1 36  ? 59.030  36.204  149.924 1.00 79.52  ? 36   ARG C NE  1 
ATOM   4637  C  CZ  . ARG C  1 36  ? 59.447  35.850  148.713 1.00 78.91  ? 36   ARG C CZ  1 
ATOM   4638  N  NH1 . ARG C  1 36  ? 60.390  36.557  148.098 1.00 77.60  ? 36   ARG C NH1 1 
ATOM   4639  N  NH2 . ARG C  1 36  ? 58.915  34.791  148.116 1.00 79.88  ? 36   ARG C NH2 1 
ATOM   4640  N  N   . ASP C  1 37  ? 58.617  41.232  154.923 1.00 82.28  ? 37   ASP C N   1 
ATOM   4641  C  CA  . ASP C  1 37  ? 59.106  42.484  155.497 1.00 87.27  ? 37   ASP C CA  1 
ATOM   4642  C  C   . ASP C  1 37  ? 58.917  42.383  157.003 1.00 88.02  ? 37   ASP C C   1 
ATOM   4643  O  O   . ASP C  1 37  ? 58.576  43.361  157.676 1.00 85.89  ? 37   ASP C O   1 
ATOM   4644  C  CB  . ASP C  1 37  ? 58.315  43.679  154.962 1.00 91.43  ? 37   ASP C CB  1 
ATOM   4645  C  CG  . ASP C  1 37  ? 59.081  44.986  155.077 1.00 94.18  ? 37   ASP C CG  1 
ATOM   4646  O  OD1 . ASP C  1 37  ? 60.056  45.167  154.310 1.00 94.92  ? 37   ASP C OD1 1 
ATOM   4647  O  OD2 . ASP C  1 37  ? 58.712  45.825  155.932 1.00 93.95  ? 37   ASP C OD2 1 
ATOM   4648  N  N   . LYS C  1 38  ? 59.134  41.173  157.511 1.00 90.54  ? 38   LYS C N   1 
ATOM   4649  C  CA  . LYS C  1 38  ? 59.003  40.876  158.930 1.00 91.66  ? 38   LYS C CA  1 
ATOM   4650  C  C   . LYS C  1 38  ? 60.065  41.621  159.731 1.00 92.68  ? 38   LYS C C   1 
ATOM   4651  O  O   . LYS C  1 38  ? 59.769  42.190  160.785 1.00 92.83  ? 38   LYS C O   1 
ATOM   4652  C  CB  . LYS C  1 38  ? 59.117  39.355  159.171 1.00 90.25  ? 38   LYS C CB  1 
ATOM   4653  C  CG  . LYS C  1 38  ? 59.158  38.944  160.648 1.00 88.88  ? 38   LYS C CG  1 
ATOM   4654  C  CD  . LYS C  1 38  ? 58.046  39.626  161.439 1.00 86.01  ? 38   LYS C CD  1 
ATOM   4655  C  CE  . LYS C  1 38  ? 58.442  39.852  162.887 1.00 82.83  ? 38   LYS C CE  1 
ATOM   4656  N  NZ  . LYS C  1 38  ? 57.627  40.941  163.501 1.00 79.08  ? 38   LYS C NZ  1 
ATOM   4657  N  N   . GLY C  1 39  ? 61.296  41.627  159.230 1.00 91.90  ? 39   GLY C N   1 
ATOM   4658  C  CA  . GLY C  1 39  ? 62.355  42.313  159.941 1.00 93.34  ? 39   GLY C CA  1 
ATOM   4659  C  C   . GLY C  1 39  ? 62.259  43.828  159.880 1.00 94.91  ? 39   GLY C C   1 
ATOM   4660  O  O   . GLY C  1 39  ? 63.283  44.506  159.824 1.00 94.59  ? 39   GLY C O   1 
ATOM   4661  N  N   . GLU C  1 40  ? 61.044  44.370  159.908 1.00 97.15  ? 40   GLU C N   1 
ATOM   4662  C  CA  . GLU C  1 40  ? 60.868  45.820  159.845 1.00 100.01 ? 40   GLU C CA  1 
ATOM   4663  C  C   . GLU C  1 40  ? 60.900  46.521  161.205 1.00 98.99  ? 40   GLU C C   1 
ATOM   4664  O  O   . GLU C  1 40  ? 60.649  45.910  162.243 1.00 97.49  ? 40   GLU C O   1 
ATOM   4665  C  CB  . GLU C  1 40  ? 59.567  46.168  159.116 1.00 105.71 ? 40   GLU C CB  1 
ATOM   4666  C  CG  . GLU C  1 40  ? 59.404  47.666  158.836 1.00 112.67 ? 40   GLU C CG  1 
ATOM   4667  C  CD  . GLU C  1 40  ? 60.610  48.272  158.117 1.00 115.72 ? 40   GLU C CD  1 
ATOM   4668  O  OE1 . GLU C  1 40  ? 60.924  47.833  156.987 1.00 116.49 ? 40   GLU C OE1 1 
ATOM   4669  O  OE2 . GLU C  1 40  ? 61.246  49.191  158.684 1.00 116.79 ? 40   GLU C OE2 1 
ATOM   4670  N  N   . THR C  1 41  ? 61.198  47.818  161.175 1.00 99.48  ? 41   THR C N   1 
ATOM   4671  C  CA  . THR C  1 41  ? 61.304  48.637  162.379 1.00 99.36  ? 41   THR C CA  1 
ATOM   4672  C  C   . THR C  1 41  ? 59.982  49.021  163.058 1.00 98.57  ? 41   THR C C   1 
ATOM   4673  O  O   . THR C  1 41  ? 59.582  48.379  164.032 1.00 97.59  ? 41   THR C O   1 
ATOM   4674  C  CB  . THR C  1 41  ? 62.145  49.921  162.087 1.00 100.36 ? 41   THR C CB  1 
ATOM   4675  O  OG1 . THR C  1 41  ? 62.206  50.738  163.259 1.00 101.20 ? 41   THR C OG1 1 
ATOM   4676  C  CG2 . THR C  1 41  ? 61.547  50.721  160.949 1.00 98.96  ? 41   THR C CG2 1 
ATOM   4677  N  N   . ILE C  1 42  ? 59.303  50.053  162.559 1.00 97.45  ? 42   ILE C N   1 
ATOM   4678  C  CA  . ILE C  1 42  ? 58.050  50.487  163.176 1.00 96.95  ? 42   ILE C CA  1 
ATOM   4679  C  C   . ILE C  1 42  ? 56.909  50.635  162.175 1.00 97.77  ? 42   ILE C C   1 
ATOM   4680  O  O   . ILE C  1 42  ? 57.037  50.254  161.015 1.00 98.59  ? 42   ILE C O   1 
ATOM   4681  C  CB  . ILE C  1 42  ? 58.235  51.839  163.908 1.00 95.93  ? 42   ILE C CB  1 
ATOM   4682  C  CG1 . ILE C  1 42  ? 57.093  52.058  164.909 1.00 95.97  ? 42   ILE C CG1 1 
ATOM   4683  C  CG2 . ILE C  1 42  ? 58.291  52.974  162.891 1.00 94.85  ? 42   ILE C CG2 1 
ATOM   4684  C  CD1 . ILE C  1 42  ? 57.218  53.326  165.743 1.00 94.80  ? 42   ILE C CD1 1 
ATOM   4685  N  N   . GLN C  1 43  ? 55.790  51.179  162.652 1.00 98.66  ? 43   GLN C N   1 
ATOM   4686  C  CA  . GLN C  1 43  ? 54.599  51.420  161.840 1.00 99.11  ? 43   GLN C CA  1 
ATOM   4687  C  C   . GLN C  1 43  ? 54.904  52.440  160.761 1.00 98.92  ? 43   GLN C C   1 
ATOM   4688  O  O   . GLN C  1 43  ? 54.685  52.195  159.576 1.00 98.90  ? 43   GLN C O   1 
ATOM   4689  C  CB  . GLN C  1 43  ? 53.475  51.973  162.711 1.00 101.60 ? 43   GLN C CB  1 
ATOM   4690  C  CG  . GLN C  1 43  ? 52.800  50.959  163.592 1.00 104.83 ? 43   GLN C CG  1 
ATOM   4691  C  CD  . GLN C  1 43  ? 52.042  49.942  162.783 1.00 106.20 ? 43   GLN C CD  1 
ATOM   4692  O  OE1 . GLN C  1 43  ? 52.639  49.135  162.071 1.00 107.23 ? 43   GLN C OE1 1 
ATOM   4693  N  NE2 . GLN C  1 43  ? 50.715  49.981  162.873 1.00 107.33 ? 43   GLN C NE2 1 
ATOM   4694  N  N   . GLY C  1 44  ? 55.384  53.602  161.194 1.00 98.44  ? 44   GLY C N   1 
ATOM   4695  C  CA  . GLY C  1 44  ? 55.725  54.653  160.260 1.00 97.21  ? 44   GLY C CA  1 
ATOM   4696  C  C   . GLY C  1 44  ? 56.666  54.082  159.228 1.00 97.18  ? 44   GLY C C   1 
ATOM   4697  O  O   . GLY C  1 44  ? 56.308  53.960  158.060 1.00 97.12  ? 44   GLY C O   1 
ATOM   4698  N  N   . LEU C  1 45  ? 57.865  53.711  159.666 1.00 97.65  ? 45   LEU C N   1 
ATOM   4699  C  CA  . LEU C  1 45  ? 58.871  53.140  158.774 1.00 97.83  ? 45   LEU C CA  1 
ATOM   4700  C  C   . LEU C  1 45  ? 58.463  51.742  158.317 1.00 96.78  ? 45   LEU C C   1 
ATOM   4701  O  O   . LEU C  1 45  ? 59.108  50.748  158.661 1.00 97.21  ? 45   LEU C O   1 
ATOM   4702  C  CB  . LEU C  1 45  ? 60.236  53.073  159.474 1.00 98.32  ? 45   LEU C CB  1 
ATOM   4703  C  CG  . LEU C  1 45  ? 60.925  54.364  159.925 1.00 97.47  ? 45   LEU C CG  1 
ATOM   4704  C  CD1 . LEU C  1 45  ? 62.241  54.014  160.606 1.00 96.06  ? 45   LEU C CD1 1 
ATOM   4705  C  CD2 . LEU C  1 45  ? 61.162  55.278  158.730 1.00 95.98  ? 45   LEU C CD2 1 
ATOM   4706  N  N   . ARG C  1 46  ? 57.383  51.681  157.545 1.00 94.87  ? 46   ARG C N   1 
ATOM   4707  C  CA  . ARG C  1 46  ? 56.855  50.430  157.016 1.00 92.57  ? 46   ARG C CA  1 
ATOM   4708  C  C   . ARG C  1 46  ? 55.522  50.739  156.345 1.00 90.80  ? 46   ARG C C   1 
ATOM   4709  O  O   . ARG C  1 46  ? 55.161  50.131  155.340 1.00 91.28  ? 46   ARG C O   1 
ATOM   4710  C  CB  . ARG C  1 46  ? 56.642  49.415  158.134 1.00 92.76  ? 46   ARG C CB  1 
ATOM   4711  C  CG  . ARG C  1 46  ? 55.342  49.581  158.895 1.00 93.33  ? 46   ARG C CG  1 
ATOM   4712  C  CD  . ARG C  1 46  ? 54.990  48.283  159.587 1.00 95.32  ? 46   ARG C CD  1 
ATOM   4713  N  NE  . ARG C  1 46  ? 55.314  47.146  158.728 1.00 95.64  ? 46   ARG C NE  1 
ATOM   4714  C  CZ  . ARG C  1 46  ? 54.912  47.021  157.468 1.00 94.52  ? 46   ARG C CZ  1 
ATOM   4715  N  NH1 . ARG C  1 46  ? 55.261  45.955  156.761 1.00 94.64  ? 46   ARG C NH1 1 
ATOM   4716  N  NH2 . ARG C  1 46  ? 54.162  47.963  156.914 1.00 95.60  ? 46   ARG C NH2 1 
ATOM   4717  N  N   . ALA C  1 47  ? 54.787  51.681  156.922 1.00 88.23  ? 47   ALA C N   1 
ATOM   4718  C  CA  . ALA C  1 47  ? 53.514  52.099  156.361 1.00 84.43  ? 47   ALA C CA  1 
ATOM   4719  C  C   . ALA C  1 47  ? 53.889  52.907  155.129 1.00 82.35  ? 47   ALA C C   1 
ATOM   4720  O  O   . ALA C  1 47  ? 53.100  53.063  154.205 1.00 82.80  ? 47   ALA C O   1 
ATOM   4721  C  CB  . ALA C  1 47  ? 52.772  52.966  157.351 1.00 82.53  ? 47   ALA C CB  1 
ATOM   4722  N  N   . ASN C  1 48  ? 55.118  53.415  155.128 1.00 81.07  ? 48   ASN C N   1 
ATOM   4723  C  CA  . ASN C  1 48  ? 55.630  54.207  154.018 1.00 80.01  ? 48   ASN C CA  1 
ATOM   4724  C  C   . ASN C  1 48  ? 56.337  53.279  153.039 1.00 78.29  ? 48   ASN C C   1 
ATOM   4725  O  O   . ASN C  1 48  ? 56.280  53.471  151.821 1.00 78.22  ? 48   ASN C O   1 
ATOM   4726  C  CB  . ASN C  1 48  ? 56.625  55.263  154.520 1.00 81.47  ? 48   ASN C CB  1 
ATOM   4727  C  CG  . ASN C  1 48  ? 56.179  55.929  155.817 1.00 84.35  ? 48   ASN C CG  1 
ATOM   4728  O  OD1 . ASN C  1 48  ? 54.990  56.195  156.026 1.00 86.08  ? 48   ASN C OD1 1 
ATOM   4729  N  ND2 . ASN C  1 48  ? 57.142  56.219  156.689 1.00 83.17  ? 48   ASN C ND2 1 
ATOM   4730  N  N   . LEU C  1 49  ? 57.012  52.275  153.587 1.00 74.75  ? 49   LEU C N   1 
ATOM   4731  C  CA  . LEU C  1 49  ? 57.733  51.306  152.783 1.00 71.97  ? 49   LEU C CA  1 
ATOM   4732  C  C   . LEU C  1 49  ? 56.751  50.532  151.902 1.00 70.84  ? 49   LEU C C   1 
ATOM   4733  O  O   . LEU C  1 49  ? 57.005  50.304  150.717 1.00 68.86  ? 49   LEU C O   1 
ATOM   4734  C  CB  . LEU C  1 49  ? 58.503  50.357  153.703 1.00 71.95  ? 49   LEU C CB  1 
ATOM   4735  C  CG  . LEU C  1 49  ? 59.453  49.351  153.057 1.00 72.82  ? 49   LEU C CG  1 
ATOM   4736  C  CD1 . LEU C  1 49  ? 60.434  50.058  152.143 1.00 73.86  ? 49   LEU C CD1 1 
ATOM   4737  C  CD2 . LEU C  1 49  ? 60.195  48.613  154.149 1.00 75.81  ? 49   LEU C CD2 1 
ATOM   4738  N  N   . THR C  1 50  ? 55.622  50.135  152.482 1.00 69.45  ? 50   THR C N   1 
ATOM   4739  C  CA  . THR C  1 50  ? 54.598  49.403  151.738 1.00 68.19  ? 50   THR C CA  1 
ATOM   4740  C  C   . THR C  1 50  ? 53.907  50.382  150.774 1.00 65.97  ? 50   THR C C   1 
ATOM   4741  O  O   . THR C  1 50  ? 53.225  49.988  149.830 1.00 64.67  ? 50   THR C O   1 
ATOM   4742  C  CB  . THR C  1 50  ? 53.554  48.742  152.715 1.00 69.27  ? 50   THR C CB  1 
ATOM   4743  O  OG1 . THR C  1 50  ? 52.584  47.991  151.972 1.00 67.68  ? 50   THR C OG1 1 
ATOM   4744  C  CG2 . THR C  1 50  ? 52.842  49.797  153.544 1.00 70.12  ? 50   THR C CG2 1 
ATOM   4745  N  N   . SER C  1 51  ? 54.104  51.671  151.012 1.00 64.51  ? 51   SER C N   1 
ATOM   4746  C  CA  . SER C  1 51  ? 53.518  52.687  150.157 1.00 61.60  ? 51   SER C CA  1 
ATOM   4747  C  C   . SER C  1 51  ? 54.441  52.870  148.948 1.00 61.78  ? 51   SER C C   1 
ATOM   4748  O  O   . SER C  1 51  ? 53.980  52.948  147.811 1.00 60.99  ? 51   SER C O   1 
ATOM   4749  C  CB  . SER C  1 51  ? 53.372  53.997  150.936 1.00 60.18  ? 51   SER C CB  1 
ATOM   4750  O  OG  . SER C  1 51  ? 52.650  54.954  150.189 1.00 55.47  ? 51   SER C OG  1 
ATOM   4751  N  N   . ALA C  1 52  ? 55.749  52.921  149.198 1.00 62.34  ? 52   ALA C N   1 
ATOM   4752  C  CA  . ALA C  1 52  ? 56.730  53.079  148.122 1.00 62.01  ? 52   ALA C CA  1 
ATOM   4753  C  C   . ALA C  1 52  ? 56.639  51.906  147.146 1.00 62.26  ? 52   ALA C C   1 
ATOM   4754  O  O   . ALA C  1 52  ? 56.883  52.062  145.948 1.00 61.80  ? 52   ALA C O   1 
ATOM   4755  C  CB  . ALA C  1 52  ? 58.144  53.172  148.704 1.00 56.89  ? 52   ALA C CB  1 
ATOM   4756  N  N   . ILE C  1 53  ? 56.275  50.736  147.667 1.00 63.67  ? 53   ILE C N   1 
ATOM   4757  C  CA  . ILE C  1 53  ? 56.150  49.525  146.861 1.00 64.87  ? 53   ILE C CA  1 
ATOM   4758  C  C   . ILE C  1 53  ? 54.935  49.606  145.932 1.00 65.45  ? 53   ILE C C   1 
ATOM   4759  O  O   . ILE C  1 53  ? 54.842  48.881  144.933 1.00 61.08  ? 53   ILE C O   1 
ATOM   4760  C  CB  . ILE C  1 53  ? 56.027  48.284  147.762 1.00 66.64  ? 53   ILE C CB  1 
ATOM   4761  C  CG1 . ILE C  1 53  ? 56.084  47.013  146.919 1.00 70.93  ? 53   ILE C CG1 1 
ATOM   4762  C  CG2 . ILE C  1 53  ? 54.721  48.315  148.511 1.00 66.54  ? 53   ILE C CG2 1 
ATOM   4763  C  CD1 . ILE C  1 53  ? 55.806  45.738  147.706 1.00 73.61  ? 53   ILE C CD1 1 
ATOM   4764  N  N   . GLU C  1 54  ? 54.001  50.487  146.278 1.00 67.32  ? 54   GLU C N   1 
ATOM   4765  C  CA  . GLU C  1 54  ? 52.803  50.699  145.474 1.00 69.39  ? 54   GLU C CA  1 
ATOM   4766  C  C   . GLU C  1 54  ? 53.251  51.371  144.195 1.00 70.16  ? 54   GLU C C   1 
ATOM   4767  O  O   . GLU C  1 54  ? 53.043  50.859  143.099 1.00 68.95  ? 54   GLU C O   1 
ATOM   4768  C  CB  . GLU C  1 54  ? 51.833  51.635  146.186 1.00 71.16  ? 54   GLU C CB  1 
ATOM   4769  C  CG  . GLU C  1 54  ? 51.264  51.098  147.474 1.00 75.42  ? 54   GLU C CG  1 
ATOM   4770  C  CD  . GLU C  1 54  ? 50.327  49.947  147.234 1.00 76.81  ? 54   GLU C CD  1 
ATOM   4771  O  OE1 . GLU C  1 54  ? 49.561  50.028  146.253 1.00 79.33  ? 54   GLU C OE1 1 
ATOM   4772  O  OE2 . GLU C  1 54  ? 50.344  48.975  148.020 1.00 79.40  ? 54   GLU C OE2 1 
ATOM   4773  N  N   . THR C  1 55  ? 53.866  52.538  144.353 1.00 73.46  ? 55   THR C N   1 
ATOM   4774  C  CA  . THR C  1 55  ? 54.352  53.299  143.215 1.00 76.35  ? 55   THR C CA  1 
ATOM   4775  C  C   . THR C  1 55  ? 55.218  52.386  142.351 1.00 75.87  ? 55   THR C C   1 
ATOM   4776  O  O   . THR C  1 55  ? 55.240  52.522  141.125 1.00 76.60  ? 55   THR C O   1 
ATOM   4777  C  CB  . THR C  1 55  ? 55.160  54.556  143.670 1.00 77.69  ? 55   THR C CB  1 
ATOM   4778  O  OG1 . THR C  1 55  ? 56.164  54.171  144.616 1.00 81.31  ? 55   THR C OG1 1 
ATOM   4779  C  CG2 . THR C  1 55  ? 54.237  55.588  144.317 1.00 78.16  ? 55   THR C CG2 1 
ATOM   4780  N  N   . LEU C  1 56  ? 55.912  51.443  142.987 1.00 73.96  ? 56   LEU C N   1 
ATOM   4781  C  CA  . LEU C  1 56  ? 56.756  50.510  142.249 1.00 73.78  ? 56   LEU C CA  1 
ATOM   4782  C  C   . LEU C  1 56  ? 55.897  49.657  141.322 1.00 73.48  ? 56   LEU C C   1 
ATOM   4783  O  O   . LEU C  1 56  ? 56.065  49.713  140.107 1.00 71.60  ? 56   LEU C O   1 
ATOM   4784  C  CB  . LEU C  1 56  ? 57.545  49.621  143.210 1.00 74.59  ? 56   LEU C CB  1 
ATOM   4785  C  CG  . LEU C  1 56  ? 58.508  50.393  144.113 1.00 76.26  ? 56   LEU C CG  1 
ATOM   4786  C  CD1 . LEU C  1 56  ? 59.147  49.447  145.118 1.00 76.67  ? 56   LEU C CD1 1 
ATOM   4787  C  CD2 . LEU C  1 56  ? 59.557  51.088  143.259 1.00 76.21  ? 56   LEU C CD2 1 
ATOM   4788  N  N   . CYS C  1 57  ? 54.972  48.880  141.894 1.00 74.17  ? 57   CYS C N   1 
ATOM   4789  C  CA  . CYS C  1 57  ? 54.076  48.030  141.103 1.00 73.60  ? 57   CYS C CA  1 
ATOM   4790  C  C   . CYS C  1 57  ? 53.346  48.859  140.051 1.00 73.97  ? 57   CYS C C   1 
ATOM   4791  O  O   . CYS C  1 57  ? 52.843  48.321  139.063 1.00 73.72  ? 57   CYS C O   1 
ATOM   4792  C  CB  . CYS C  1 57  ? 53.051  47.325  142.000 1.00 73.03  ? 57   CYS C CB  1 
ATOM   4793  S  SG  . CYS C  1 57  ? 53.608  45.768  142.738 1.00 73.44  ? 57   CYS C SG  1 
ATOM   4794  N  N   . GLY C  1 58  ? 53.286  50.168  140.279 1.00 74.56  ? 58   GLY C N   1 
ATOM   4795  C  CA  . GLY C  1 58  ? 52.651  51.062  139.331 1.00 74.06  ? 58   GLY C CA  1 
ATOM   4796  C  C   . GLY C  1 58  ? 53.278  50.875  137.959 1.00 75.46  ? 58   GLY C C   1 
ATOM   4797  O  O   . GLY C  1 58  ? 52.564  50.963  136.958 1.00 75.12  ? 58   GLY C O   1 
ATOM   4798  N  N   . VAL C  1 59  ? 54.594  50.616  137.905 1.00 75.57  ? 59   VAL C N   1 
ATOM   4799  C  CA  . VAL C  1 59  ? 55.297  50.397  136.627 1.00 75.37  ? 59   VAL C CA  1 
ATOM   4800  C  C   . VAL C  1 59  ? 54.751  49.147  135.940 1.00 74.75  ? 59   VAL C C   1 
ATOM   4801  O  O   . VAL C  1 59  ? 55.342  48.059  135.947 1.00 71.36  ? 59   VAL C O   1 
ATOM   4802  C  CB  . VAL C  1 59  ? 56.842  50.268  136.793 1.00 77.01  ? 59   VAL C CB  1 
ATOM   4803  C  CG1 . VAL C  1 59  ? 57.410  51.559  137.364 1.00 77.56  ? 59   VAL C CG1 1 
ATOM   4804  C  CG2 . VAL C  1 59  ? 57.198  49.078  137.675 1.00 77.93  ? 59   VAL C CG2 1 
ATOM   4805  N  N   . ASP C  1 60  ? 53.580  49.362  135.357 1.00 75.96  ? 60   ASP C N   1 
ATOM   4806  C  CA  . ASP C  1 60  ? 52.785  48.385  134.631 1.00 73.67  ? 60   ASP C CA  1 
ATOM   4807  C  C   . ASP C  1 60  ? 51.806  49.362  133.989 1.00 70.33  ? 60   ASP C C   1 
ATOM   4808  O  O   . ASP C  1 60  ? 51.002  49.015  133.125 1.00 68.80  ? 60   ASP C O   1 
ATOM   4809  C  CB  . ASP C  1 60  ? 52.053  47.472  135.623 1.00 75.18  ? 60   ASP C CB  1 
ATOM   4810  C  CG  . ASP C  1 60  ? 51.398  46.279  134.956 1.00 78.17  ? 60   ASP C CG  1 
ATOM   4811  O  OD1 . ASP C  1 60  ? 52.123  45.478  134.322 1.00 78.95  ? 60   ASP C OD1 1 
ATOM   4812  O  OD2 . ASP C  1 60  ? 50.159  46.141  135.072 1.00 79.52  ? 60   ASP C OD2 1 
ATOM   4813  N  N   . SER C  1 61  ? 51.921  50.608  134.449 1.00 66.15  ? 61   SER C N   1 
ATOM   4814  C  CA  . SER C  1 61  ? 51.098  51.725  134.009 1.00 61.90  ? 61   SER C CA  1 
ATOM   4815  C  C   . SER C  1 61  ? 49.656  51.479  134.391 1.00 57.79  ? 61   SER C C   1 
ATOM   4816  O  O   . SER C  1 61  ? 48.824  52.377  134.303 1.00 57.43  ? 61   SER C O   1 
ATOM   4817  C  CB  . SER C  1 61  ? 51.228  51.940  132.495 1.00 61.68  ? 61   SER C CB  1 
ATOM   4818  O  OG  . SER C  1 61  ? 52.461  52.566  132.167 1.00 56.85  ? 61   SER C OG  1 
ATOM   4819  N  N   . SER C  1 62  ? 49.386  50.256  134.844 1.00 54.97  ? 62   SER C N   1 
ATOM   4820  C  CA  . SER C  1 62  ? 48.050  49.820  135.250 1.00 50.89  ? 62   SER C CA  1 
ATOM   4821  C  C   . SER C  1 62  ? 47.432  50.643  136.370 1.00 45.11  ? 62   SER C C   1 
ATOM   4822  O  O   . SER C  1 62  ? 47.895  50.605  137.504 1.00 43.02  ? 62   SER C O   1 
ATOM   4823  C  CB  . SER C  1 62  ? 48.096  48.356  135.675 1.00 52.58  ? 62   SER C CB  1 
ATOM   4824  O  OG  . SER C  1 62  ? 47.010  48.063  136.535 1.00 60.32  ? 62   SER C OG  1 
ATOM   4825  N  N   . VAL C  1 63  ? 46.363  51.361  136.040 1.00 42.23  ? 63   VAL C N   1 
ATOM   4826  C  CA  . VAL C  1 63  ? 45.657  52.214  136.991 1.00 40.75  ? 63   VAL C CA  1 
ATOM   4827  C  C   . VAL C  1 63  ? 45.069  51.434  138.173 1.00 41.11  ? 63   VAL C C   1 
ATOM   4828  O  O   . VAL C  1 63  ? 45.045  51.935  139.298 1.00 38.99  ? 63   VAL C O   1 
ATOM   4829  C  CB  . VAL C  1 63  ? 44.505  52.986  136.296 1.00 39.90  ? 63   VAL C CB  1 
ATOM   4830  C  CG1 . VAL C  1 63  ? 44.011  54.118  137.190 1.00 38.71  ? 63   VAL C CG1 1 
ATOM   4831  C  CG2 . VAL C  1 63  ? 44.971  53.513  134.959 1.00 40.24  ? 63   VAL C CG2 1 
ATOM   4832  N  N   . ALA C  1 64  ? 44.591  50.217  137.922 1.00 42.04  ? 64   ALA C N   1 
ATOM   4833  C  CA  . ALA C  1 64  ? 44.010  49.409  138.993 1.00 43.72  ? 64   ALA C CA  1 
ATOM   4834  C  C   . ALA C  1 64  ? 45.039  49.100  140.082 1.00 44.00  ? 64   ALA C C   1 
ATOM   4835  O  O   . ALA C  1 64  ? 44.691  49.020  141.268 1.00 43.34  ? 64   ALA C O   1 
ATOM   4836  C  CB  . ALA C  1 64  ? 43.437  48.119  138.430 1.00 45.43  ? 64   ALA C CB  1 
ATOM   4837  N  N   . VAL C  1 65  ? 46.298  48.917  139.680 1.00 40.84  ? 65   VAL C N   1 
ATOM   4838  C  CA  . VAL C  1 65  ? 47.346  48.643  140.646 1.00 39.23  ? 65   VAL C CA  1 
ATOM   4839  C  C   . VAL C  1 65  ? 47.295  49.774  141.659 1.00 38.46  ? 65   VAL C C   1 
ATOM   4840  O  O   . VAL C  1 65  ? 47.388  49.562  142.869 1.00 41.73  ? 65   VAL C O   1 
ATOM   4841  C  CB  . VAL C  1 65  ? 48.750  48.640  140.004 1.00 39.72  ? 65   VAL C CB  1 
ATOM   4842  C  CG1 . VAL C  1 65  ? 49.810  48.564  141.089 1.00 38.72  ? 65   VAL C CG1 1 
ATOM   4843  C  CG2 . VAL C  1 65  ? 48.902  47.458  139.071 1.00 38.65  ? 65   VAL C CG2 1 
ATOM   4844  N  N   . SER C  1 66  ? 47.109  50.978  141.150 1.00 35.05  ? 66   SER C N   1 
ATOM   4845  C  CA  . SER C  1 66  ? 47.063  52.164  141.989 1.00 35.27  ? 66   SER C CA  1 
ATOM   4846  C  C   . SER C  1 66  ? 45.824  52.312  142.870 1.00 32.05  ? 66   SER C C   1 
ATOM   4847  O  O   . SER C  1 66  ? 45.927  52.705  144.021 1.00 31.34  ? 66   SER C O   1 
ATOM   4848  C  CB  . SER C  1 66  ? 47.222  53.414  141.118 1.00 35.50  ? 66   SER C CB  1 
ATOM   4849  O  OG  . SER C  1 66  ? 47.597  54.516  141.916 1.00 40.46  ? 66   SER C OG  1 
ATOM   4850  N  N   . SER C  1 67  ? 44.649  52.015  142.341 1.00 33.46  ? 67   SER C N   1 
ATOM   4851  C  CA  . SER C  1 67  ? 43.437  52.151  143.146 1.00 35.97  ? 67   SER C CA  1 
ATOM   4852  C  C   . SER C  1 67  ? 43.260  50.953  144.093 1.00 35.62  ? 67   SER C C   1 
ATOM   4853  O  O   . SER C  1 67  ? 42.885  51.110  145.265 1.00 31.77  ? 67   SER C O   1 
ATOM   4854  C  CB  . SER C  1 67  ? 42.225  52.284  142.228 1.00 34.62  ? 67   SER C CB  1 
ATOM   4855  O  OG  . SER C  1 67  ? 42.157  51.169  141.360 1.00 38.27  ? 67   SER C OG  1 
ATOM   4856  N  N   . GLY C  1 68  ? 43.528  49.761  143.566 1.00 35.07  ? 68   GLY C N   1 
ATOM   4857  C  CA  . GLY C  1 68  ? 43.413  48.558  144.367 1.00 37.50  ? 68   GLY C CA  1 
ATOM   4858  C  C   . GLY C  1 68  ? 44.409  48.650  145.503 1.00 38.60  ? 68   GLY C C   1 
ATOM   4859  O  O   . GLY C  1 68  ? 44.103  48.296  146.646 1.00 36.08  ? 68   GLY C O   1 
ATOM   4860  N  N   . GLY C  1 69  ? 45.606  49.138  145.175 1.00 37.46  ? 69   GLY C N   1 
ATOM   4861  C  CA  . GLY C  1 69  ? 46.640  49.299  146.174 1.00 38.14  ? 69   GLY C CA  1 
ATOM   4862  C  C   . GLY C  1 69  ? 46.207  50.243  147.287 1.00 41.69  ? 69   GLY C C   1 
ATOM   4863  O  O   . GLY C  1 69  ? 46.371  49.922  148.464 1.00 43.45  ? 69   GLY C O   1 
ATOM   4864  N  N   . GLU C  1 70  ? 45.646  51.398  146.928 1.00 41.41  ? 70   GLU C N   1 
ATOM   4865  C  CA  . GLU C  1 70  ? 45.207  52.367  147.930 1.00 40.91  ? 70   GLU C CA  1 
ATOM   4866  C  C   . GLU C  1 70  ? 44.082  51.818  148.803 1.00 40.42  ? 70   GLU C C   1 
ATOM   4867  O  O   . GLU C  1 70  ? 44.057  52.064  150.009 1.00 42.25  ? 70   GLU C O   1 
ATOM   4868  C  CB  . GLU C  1 70  ? 44.722  53.676  147.284 1.00 39.38  ? 70   GLU C CB  1 
ATOM   4869  C  CG  . GLU C  1 70  ? 44.661  54.795  148.304 1.00 42.43  ? 70   GLU C CG  1 
ATOM   4870  C  CD  . GLU C  1 70  ? 43.656  55.877  147.989 1.00 45.34  ? 70   GLU C CD  1 
ATOM   4871  O  OE1 . GLU C  1 70  ? 43.677  56.430  146.871 1.00 46.57  ? 70   GLU C OE1 1 
ATOM   4872  O  OE2 . GLU C  1 70  ? 42.848  56.188  148.885 1.00 47.47  ? 70   GLU C OE2 1 
ATOM   4873  N  N   . LEU C  1 71  ? 43.141  51.101  148.196 1.00 37.66  ? 71   LEU C N   1 
ATOM   4874  C  CA  . LEU C  1 71  ? 42.032  50.533  148.952 1.00 37.15  ? 71   LEU C CA  1 
ATOM   4875  C  C   . LEU C  1 71  ? 42.563  49.480  149.918 1.00 39.13  ? 71   LEU C C   1 
ATOM   4876  O  O   . LEU C  1 71  ? 42.189  49.449  151.096 1.00 36.19  ? 71   LEU C O   1 
ATOM   4877  C  CB  . LEU C  1 71  ? 41.007  49.910  148.006 1.00 32.34  ? 71   LEU C CB  1 
ATOM   4878  C  CG  . LEU C  1 71  ? 40.155  50.948  147.287 1.00 32.61  ? 71   LEU C CG  1 
ATOM   4879  C  CD1 . LEU C  1 71  ? 39.372  50.277  146.177 1.00 34.62  ? 71   LEU C CD1 1 
ATOM   4880  C  CD2 . LEU C  1 71  ? 39.228  51.639  148.284 1.00 24.49  ? 71   LEU C CD2 1 
ATOM   4881  N  N   . PHE C  1 72  ? 43.441  48.625  149.399 1.00 40.45  ? 72   PHE C N   1 
ATOM   4882  C  CA  . PHE C  1 72  ? 44.063  47.568  150.178 1.00 42.53  ? 72   PHE C CA  1 
ATOM   4883  C  C   . PHE C  1 72  ? 44.817  48.162  151.365 1.00 44.83  ? 72   PHE C C   1 
ATOM   4884  O  O   . PHE C  1 72  ? 44.783  47.621  152.472 1.00 45.72  ? 72   PHE C O   1 
ATOM   4885  C  CB  . PHE C  1 72  ? 45.049  46.790  149.302 1.00 44.05  ? 72   PHE C CB  1 
ATOM   4886  C  CG  . PHE C  1 72  ? 45.961  45.867  150.074 1.00 44.46  ? 72   PHE C CG  1 
ATOM   4887  C  CD1 . PHE C  1 72  ? 45.506  44.636  150.535 1.00 46.70  ? 72   PHE C CD1 1 
ATOM   4888  C  CD2 . PHE C  1 72  ? 47.274  46.236  150.344 1.00 43.59  ? 72   PHE C CD2 1 
ATOM   4889  C  CE1 . PHE C  1 72  ? 46.348  43.791  151.250 1.00 47.89  ? 72   PHE C CE1 1 
ATOM   4890  C  CE2 . PHE C  1 72  ? 48.116  45.399  151.055 1.00 44.18  ? 72   PHE C CE2 1 
ATOM   4891  C  CZ  . PHE C  1 72  ? 47.655  44.176  151.509 1.00 45.43  ? 72   PHE C CZ  1 
ATOM   4892  N  N   . LEU C  1 73  ? 45.498  49.275  151.116 1.00 44.97  ? 73   LEU C N   1 
ATOM   4893  C  CA  . LEU C  1 73  ? 46.295  49.953  152.128 1.00 44.89  ? 73   LEU C CA  1 
ATOM   4894  C  C   . LEU C  1 73  ? 45.444  50.542  153.237 1.00 44.47  ? 73   LEU C C   1 
ATOM   4895  O  O   . LEU C  1 73  ? 45.731  50.369  154.415 1.00 45.32  ? 73   LEU C O   1 
ATOM   4896  C  CB  . LEU C  1 73  ? 47.096  51.075  151.477 1.00 48.50  ? 73   LEU C CB  1 
ATOM   4897  C  CG  . LEU C  1 73  ? 48.448  51.434  152.080 1.00 54.24  ? 73   LEU C CG  1 
ATOM   4898  C  CD1 . LEU C  1 73  ? 48.317  51.716  153.583 1.00 56.66  ? 73   LEU C CD1 1 
ATOM   4899  C  CD2 . LEU C  1 73  ? 49.399  50.275  151.821 1.00 56.07  ? 73   LEU C CD2 1 
ATOM   4900  N  N   . ARG C  1 74  ? 44.392  51.245  152.860 1.00 44.76  ? 74   ARG C N   1 
ATOM   4901  C  CA  . ARG C  1 74  ? 43.550  51.878  153.851 1.00 46.32  ? 74   ARG C CA  1 
ATOM   4902  C  C   . ARG C  1 74  ? 42.793  50.843  154.664 1.00 46.88  ? 74   ARG C C   1 
ATOM   4903  O  O   . ARG C  1 74  ? 42.656  50.969  155.879 1.00 46.88  ? 74   ARG C O   1 
ATOM   4904  C  CB  . ARG C  1 74  ? 42.598  52.856  153.160 1.00 47.36  ? 74   ARG C CB  1 
ATOM   4905  C  CG  . ARG C  1 74  ? 43.311  53.747  152.137 1.00 45.72  ? 74   ARG C CG  1 
ATOM   4906  C  CD  . ARG C  1 74  ? 42.424  54.892  151.675 1.00 47.07  ? 74   ARG C CD  1 
ATOM   4907  N  NE  . ARG C  1 74  ? 42.446  55.985  152.636 1.00 46.44  ? 74   ARG C NE  1 
ATOM   4908  C  CZ  . ARG C  1 74  ? 43.319  56.986  152.605 1.00 47.97  ? 74   ARG C CZ  1 
ATOM   4909  N  NH1 . ARG C  1 74  ? 44.240  57.049  151.653 1.00 48.63  ? 74   ARG C NH1 1 
ATOM   4910  N  NH2 . ARG C  1 74  ? 43.292  57.913  153.547 1.00 51.34  ? 74   ARG C NH2 1 
ATOM   4911  N  N   . PHE C  1 75  ? 42.311  49.809  153.995 1.00 48.45  ? 75   PHE C N   1 
ATOM   4912  C  CA  . PHE C  1 75  ? 41.577  48.756  154.681 1.00 49.05  ? 75   PHE C CA  1 
ATOM   4913  C  C   . PHE C  1 75  ? 42.497  48.055  155.666 1.00 49.81  ? 75   PHE C C   1 
ATOM   4914  O  O   . PHE C  1 75  ? 42.101  47.729  156.786 1.00 48.68  ? 75   PHE C O   1 
ATOM   4915  C  CB  . PHE C  1 75  ? 41.058  47.732  153.671 1.00 47.88  ? 75   PHE C CB  1 
ATOM   4916  C  CG  . PHE C  1 75  ? 40.338  46.578  154.301 1.00 46.64  ? 75   PHE C CG  1 
ATOM   4917  C  CD1 . PHE C  1 75  ? 39.026  46.715  154.733 1.00 44.65  ? 75   PHE C CD1 1 
ATOM   4918  C  CD2 . PHE C  1 75  ? 40.982  45.353  154.478 1.00 46.08  ? 75   PHE C CD2 1 
ATOM   4919  C  CE1 . PHE C  1 75  ? 38.357  45.647  155.334 1.00 44.37  ? 75   PHE C CE1 1 
ATOM   4920  C  CE2 . PHE C  1 75  ? 40.327  44.283  155.074 1.00 46.30  ? 75   PHE C CE2 1 
ATOM   4921  C  CZ  . PHE C  1 75  ? 39.010  44.428  155.504 1.00 45.17  ? 75   PHE C CZ  1 
ATOM   4922  N  N   . ILE C  1 76  ? 43.728  47.832  155.220 1.00 51.24  ? 76   ILE C N   1 
ATOM   4923  C  CA  . ILE C  1 76  ? 44.752  47.141  155.989 1.00 53.07  ? 76   ILE C CA  1 
ATOM   4924  C  C   . ILE C  1 76  ? 45.154  47.895  157.250 1.00 56.06  ? 76   ILE C C   1 
ATOM   4925  O  O   . ILE C  1 76  ? 45.169  47.331  158.341 1.00 56.62  ? 76   ILE C O   1 
ATOM   4926  C  CB  . ILE C  1 76  ? 46.017  46.890  155.097 1.00 53.41  ? 76   ILE C CB  1 
ATOM   4927  C  CG1 . ILE C  1 76  ? 46.635  45.540  155.414 1.00 54.45  ? 76   ILE C CG1 1 
ATOM   4928  C  CG2 . ILE C  1 76  ? 47.086  47.949  155.332 1.00 49.10  ? 76   ILE C CG2 1 
ATOM   4929  C  CD1 . ILE C  1 76  ? 47.949  45.316  154.684 1.00 54.16  ? 76   ILE C CD1 1 
ATOM   4930  N  N   . SER C  1 77  ? 45.458  49.176  157.112 1.00 58.60  ? 77   SER C N   1 
ATOM   4931  C  CA  . SER C  1 77  ? 45.893  49.948  158.263 1.00 63.59  ? 77   SER C CA  1 
ATOM   4932  C  C   . SER C  1 77  ? 44.827  50.136  159.340 1.00 65.65  ? 77   SER C C   1 
ATOM   4933  O  O   . SER C  1 77  ? 43.726  50.614  159.082 1.00 64.37  ? 77   SER C O   1 
ATOM   4934  C  CB  . SER C  1 77  ? 46.426  51.315  157.819 1.00 64.01  ? 77   SER C CB  1 
ATOM   4935  O  OG  . SER C  1 77  ? 45.361  52.209  157.557 1.00 63.93  ? 77   SER C OG  1 
ATOM   4936  N  N   . LEU C  1 78  ? 45.184  49.736  160.552 1.00 70.61  ? 78   LEU C N   1 
ATOM   4937  C  CA  . LEU C  1 78  ? 44.328  49.856  161.715 1.00 75.37  ? 78   LEU C CA  1 
ATOM   4938  C  C   . LEU C  1 78  ? 45.204  49.826  162.957 1.00 79.66  ? 78   LEU C C   1 
ATOM   4939  O  O   . LEU C  1 78  ? 45.177  48.872  163.747 1.00 80.14  ? 78   LEU C O   1 
ATOM   4940  C  CB  . LEU C  1 78  ? 43.304  48.728  161.776 1.00 75.65  ? 78   LEU C CB  1 
ATOM   4941  C  CG  . LEU C  1 78  ? 42.124  48.826  160.809 1.00 79.59  ? 78   LEU C CG  1 
ATOM   4942  C  CD1 . LEU C  1 78  ? 41.093  47.786  161.213 1.00 80.63  ? 78   LEU C CD1 1 
ATOM   4943  C  CD2 . LEU C  1 78  ? 41.498  50.220  160.852 1.00 79.66  ? 78   LEU C CD2 1 
ATOM   4944  N  N   . ALA C  1 79  ? 46.006  50.875  163.103 1.00 82.49  ? 79   ALA C N   1 
ATOM   4945  C  CA  . ALA C  1 79  ? 46.878  51.016  164.251 1.00 84.85  ? 79   ALA C CA  1 
ATOM   4946  C  C   . ALA C  1 79  ? 45.947  51.328  165.417 1.00 86.11  ? 79   ALA C C   1 
ATOM   4947  O  O   . ALA C  1 79  ? 46.343  51.958  166.395 1.00 86.59  ? 79   ALA C O   1 
ATOM   4948  C  CB  . ALA C  1 79  ? 47.863  52.163  164.027 1.00 84.79  ? 79   ALA C CB  1 
ATOM   4949  N  N   . SER C  1 80  ? 44.700  50.883  165.290 1.00 87.13  ? 80   SER C N   1 
ATOM   4950  C  CA  . SER C  1 80  ? 43.681  51.097  166.307 1.00 88.56  ? 80   SER C CA  1 
ATOM   4951  C  C   . SER C  1 80  ? 43.434  49.839  167.136 1.00 89.36  ? 80   SER C C   1 
ATOM   4952  O  O   . SER C  1 80  ? 42.440  49.747  167.853 1.00 88.29  ? 80   SER C O   1 
ATOM   4953  C  CB  . SER C  1 80  ? 42.373  51.551  165.654 1.00 88.70  ? 80   SER C CB  1 
ATOM   4954  O  OG  . SER C  1 80  ? 42.554  52.761  164.937 1.00 89.33  ? 80   SER C OG  1 
ATOM   4955  N  N   . LEU C  1 81  ? 44.334  48.867  167.024 1.00 91.11  ? 81   LEU C N   1 
ATOM   4956  C  CA  . LEU C  1 81  ? 44.215  47.638  167.798 1.00 92.85  ? 81   LEU C CA  1 
ATOM   4957  C  C   . LEU C  1 81  ? 45.568  47.291  168.429 1.00 93.19  ? 81   LEU C C   1 
ATOM   4958  O  O   . LEU C  1 81  ? 46.223  46.318  168.038 1.00 92.22  ? 81   LEU C O   1 
ATOM   4959  C  CB  . LEU C  1 81  ? 43.709  46.488  166.913 1.00 95.06  ? 81   LEU C CB  1 
ATOM   4960  C  CG  . LEU C  1 81  ? 43.392  45.146  167.602 1.00 97.35  ? 81   LEU C CG  1 
ATOM   4961  C  CD1 . LEU C  1 81  ? 42.598  45.378  168.888 1.00 98.64  ? 81   LEU C CD1 1 
ATOM   4962  C  CD2 . LEU C  1 81  ? 42.604  44.247  166.651 1.00 96.40  ? 81   LEU C CD2 1 
ATOM   4963  N  N   . GLU C  1 82  ? 45.968  48.112  169.406 1.00 93.65  ? 82   GLU C N   1 
ATOM   4964  C  CA  . GLU C  1 82  ? 47.231  47.963  170.147 1.00 91.84  ? 82   GLU C CA  1 
ATOM   4965  C  C   . GLU C  1 82  ? 46.943  47.567  171.608 1.00 89.58  ? 82   GLU C C   1 
ATOM   4966  O  O   . GLU C  1 82  ? 47.820  47.083  172.331 1.00 85.68  ? 82   GLU C O   1 
ATOM   4967  C  CB  . GLU C  1 82  ? 48.017  49.288  170.117 1.00 90.59  ? 82   GLU C CB  1 
ATOM   4968  C  CG  . GLU C  1 82  ? 49.421  49.242  170.743 1.00 88.65  ? 82   GLU C CG  1 
ATOM   4969  C  CD  . GLU C  1 82  ? 50.485  48.692  169.798 1.00 86.58  ? 82   GLU C CD  1 
ATOM   4970  O  OE1 . GLU C  1 82  ? 50.692  49.296  168.728 1.00 86.06  ? 82   GLU C OE1 1 
ATOM   4971  O  OE2 . GLU C  1 82  ? 51.117  47.664  170.124 1.00 83.48  ? 82   GLU C OE2 1 
ATOM   4972  N  N   . TYR C  1 86  ? 57.621  49.311  166.391 1.00 87.79  ? 86   TYR C N   1 
ATOM   4973  C  CA  . TYR C  1 86  ? 56.182  49.060  166.458 1.00 87.51  ? 86   TYR C CA  1 
ATOM   4974  C  C   . TYR C  1 86  ? 55.816  47.887  167.368 1.00 87.20  ? 86   TYR C C   1 
ATOM   4975  O  O   . TYR C  1 86  ? 56.416  47.682  168.433 1.00 87.94  ? 86   TYR C O   1 
ATOM   4976  C  CB  . TYR C  1 86  ? 55.602  48.801  165.047 1.00 86.95  ? 86   TYR C CB  1 
ATOM   4977  C  CG  . TYR C  1 86  ? 56.139  47.587  164.269 1.00 83.27  ? 86   TYR C CG  1 
ATOM   4978  C  CD1 . TYR C  1 86  ? 56.383  46.359  164.894 1.00 79.16  ? 86   TYR C CD1 1 
ATOM   4979  C  CD2 . TYR C  1 86  ? 56.330  47.660  162.886 1.00 82.29  ? 86   TYR C CD2 1 
ATOM   4980  C  CE1 . TYR C  1 86  ? 56.795  45.247  164.165 1.00 78.19  ? 86   TYR C CE1 1 
ATOM   4981  C  CE2 . TYR C  1 86  ? 56.742  46.553  162.149 1.00 79.65  ? 86   TYR C CE2 1 
ATOM   4982  C  CZ  . TYR C  1 86  ? 56.971  45.351  162.792 1.00 78.61  ? 86   TYR C CZ  1 
ATOM   4983  O  OH  . TYR C  1 86  ? 57.356  44.256  162.052 1.00 76.61  ? 86   TYR C OH  1 
ATOM   4984  N  N   . SER C  1 87  ? 54.809  47.136  166.930 1.00 83.89  ? 87   SER C N   1 
ATOM   4985  C  CA  . SER C  1 87  ? 54.330  45.959  167.628 1.00 80.97  ? 87   SER C CA  1 
ATOM   4986  C  C   . SER C  1 87  ? 54.133  44.897  166.550 1.00 79.49  ? 87   SER C C   1 
ATOM   4987  O  O   . SER C  1 87  ? 53.610  45.182  165.479 1.00 77.29  ? 87   SER C O   1 
ATOM   4988  C  CB  . SER C  1 87  ? 53.004  46.258  168.327 1.00 79.44  ? 87   SER C CB  1 
ATOM   4989  O  OG  . SER C  1 87  ? 52.661  45.215  169.220 1.00 79.52  ? 87   SER C OG  1 
ATOM   4990  N  N   . LYS C  1 88  ? 54.586  43.681  166.816 1.00 79.60  ? 88   LYS C N   1 
ATOM   4991  C  CA  . LYS C  1 88  ? 54.425  42.610  165.847 1.00 78.59  ? 88   LYS C CA  1 
ATOM   4992  C  C   . LYS C  1 88  ? 52.939  42.296  165.719 1.00 77.33  ? 88   LYS C C   1 
ATOM   4993  O  O   . LYS C  1 88  ? 52.476  41.815  164.688 1.00 78.39  ? 88   LYS C O   1 
ATOM   4994  C  CB  . LYS C  1 88  ? 55.163  41.351  166.307 1.00 77.55  ? 88   LYS C CB  1 
ATOM   4995  C  CG  . LYS C  1 88  ? 56.671  41.474  166.364 1.00 79.50  ? 88   LYS C CG  1 
ATOM   4996  C  CD  . LYS C  1 88  ? 57.287  40.122  166.712 1.00 81.94  ? 88   LYS C CD  1 
ATOM   4997  C  CE  . LYS C  1 88  ? 58.804  40.142  166.659 1.00 80.12  ? 88   LYS C CE  1 
ATOM   4998  N  NZ  . LYS C  1 88  ? 59.363  38.777  166.875 1.00 78.11  ? 88   LYS C NZ  1 
ATOM   4999  N  N   . CYS C  1 89  ? 52.193  42.579  166.776 1.00 74.64  ? 89   CYS C N   1 
ATOM   5000  C  CA  . CYS C  1 89  ? 50.773  42.298  166.784 1.00 72.48  ? 89   CYS C CA  1 
ATOM   5001  C  C   . CYS C  1 89  ? 49.996  43.154  165.788 1.00 69.04  ? 89   CYS C C   1 
ATOM   5002  O  O   . CYS C  1 89  ? 48.983  42.719  165.260 1.00 66.15  ? 89   CYS C O   1 
ATOM   5003  C  CB  . CYS C  1 89  ? 50.220  42.489  168.199 1.00 75.89  ? 89   CYS C CB  1 
ATOM   5004  S  SG  . CYS C  1 89  ? 48.907  41.314  168.666 1.00 84.63  ? 89   CYS C SG  1 
ATOM   5005  N  N   . LYS C  1 90  ? 50.463  44.367  165.519 1.00 68.38  ? 90   LYS C N   1 
ATOM   5006  C  CA  . LYS C  1 90  ? 49.747  45.214  164.579 1.00 67.63  ? 90   LYS C CA  1 
ATOM   5007  C  C   . LYS C  1 90  ? 49.664  44.540  163.224 1.00 67.99  ? 90   LYS C C   1 
ATOM   5008  O  O   . LYS C  1 90  ? 48.910  44.979  162.353 1.00 67.99  ? 90   LYS C O   1 
ATOM   5009  C  CB  . LYS C  1 90  ? 50.406  46.576  164.424 1.00 68.41  ? 90   LYS C CB  1 
ATOM   5010  C  CG  . LYS C  1 90  ? 49.459  47.613  163.842 1.00 68.95  ? 90   LYS C CG  1 
ATOM   5011  C  CD  . LYS C  1 90  ? 48.317  47.921  164.812 1.00 72.53  ? 90   LYS C CD  1 
ATOM   5012  C  CE  . LYS C  1 90  ? 48.853  48.485  166.137 1.00 74.62  ? 90   LYS C CE  1 
ATOM   5013  N  NZ  . LYS C  1 90  ? 47.788  48.895  167.104 1.00 73.36  ? 90   LYS C NZ  1 
ATOM   5014  N  N   . LYS C  1 91  ? 50.453  43.487  163.032 1.00 67.33  ? 91   LYS C N   1 
ATOM   5015  C  CA  . LYS C  1 91  ? 50.377  42.742  161.788 1.00 65.93  ? 91   LYS C CA  1 
ATOM   5016  C  C   . LYS C  1 91  ? 49.127  41.847  161.850 1.00 67.26  ? 91   LYS C C   1 
ATOM   5017  O  O   . LYS C  1 91  ? 49.180  40.614  161.826 1.00 65.51  ? 91   LYS C O   1 
ATOM   5018  C  CB  . LYS C  1 91  ? 51.633  41.922  161.557 1.00 63.99  ? 91   LYS C CB  1 
ATOM   5019  C  CG  . LYS C  1 91  ? 52.833  42.770  161.176 1.00 64.18  ? 91   LYS C CG  1 
ATOM   5020  C  CD  . LYS C  1 91  ? 53.943  41.881  160.625 1.00 64.20  ? 91   LYS C CD  1 
ATOM   5021  C  CE  . LYS C  1 91  ? 55.160  42.667  160.186 1.00 62.08  ? 91   LYS C CE  1 
ATOM   5022  N  NZ  . LYS C  1 91  ? 56.164  41.744  159.590 1.00 59.51  ? 91   LYS C NZ  1 
ATOM   5023  N  N   . ILE C  1 92  ? 48.006  42.544  162.004 1.00 66.74  ? 92   ILE C N   1 
ATOM   5024  C  CA  . ILE C  1 92  ? 46.653  42.019  162.019 1.00 63.56  ? 92   ILE C CA  1 
ATOM   5025  C  C   . ILE C  1 92  ? 46.311  42.512  160.613 1.00 64.04  ? 92   ILE C C   1 
ATOM   5026  O  O   . ILE C  1 92  ? 45.276  42.194  160.033 1.00 63.64  ? 92   ILE C O   1 
ATOM   5027  C  CB  . ILE C  1 92  ? 45.786  42.768  163.058 1.00 62.49  ? 92   ILE C CB  1 
ATOM   5028  C  CG1 . ILE C  1 92  ? 46.027  42.182  164.447 1.00 64.36  ? 92   ILE C CG1 1 
ATOM   5029  C  CG2 . ILE C  1 92  ? 44.326  42.692  162.691 1.00 62.05  ? 92   ILE C CG2 1 
ATOM   5030  C  CD1 . ILE C  1 92  ? 45.428  42.990  165.565 1.00 62.73  ? 92   ILE C CD1 1 
HETATM 5031  N  N   . MSE C  1 93  ? 47.242  43.310  160.091 1.00 62.51  ? 93   MSE C N   1 
HETATM 5032  C  CA  . MSE C  1 93  ? 47.170  43.891  158.765 1.00 59.62  ? 93   MSE C CA  1 
HETATM 5033  C  C   . MSE C  1 93  ? 47.206  42.761  157.761 1.00 55.87  ? 93   MSE C C   1 
HETATM 5034  O  O   . MSE C  1 93  ? 46.568  42.829  156.712 1.00 55.55  ? 93   MSE C O   1 
HETATM 5035  C  CB  . MSE C  1 93  ? 48.370  44.818  158.537 1.00 63.49  ? 93   MSE C CB  1 
HETATM 5036  C  CG  . MSE C  1 93  ? 48.364  46.093  159.381 1.00 67.87  ? 93   MSE C CG  1 
HETATM 5037  SE SE  . MSE C  1 93  ? 50.068  47.038  159.354 1.00 77.24  ? 93   MSE C SE  1 
HETATM 5038  C  CE  . MSE C  1 93  ? 49.906  48.017  157.692 1.00 73.08  ? 93   MSE C CE  1 
ATOM   5039  N  N   . ILE C  1 94  ? 47.967  41.721  158.087 1.00 52.21  ? 94   ILE C N   1 
ATOM   5040  C  CA  . ILE C  1 94  ? 48.088  40.569  157.210 1.00 48.54  ? 94   ILE C CA  1 
ATOM   5041  C  C   . ILE C  1 94  ? 46.771  39.792  157.151 1.00 48.46  ? 94   ILE C C   1 
ATOM   5042  O  O   . ILE C  1 94  ? 46.315  39.421  156.069 1.00 49.33  ? 94   ILE C O   1 
ATOM   5043  C  CB  . ILE C  1 94  ? 49.240  39.640  157.664 1.00 45.18  ? 94   ILE C CB  1 
ATOM   5044  C  CG1 . ILE C  1 94  ? 50.577  40.360  157.476 1.00 44.19  ? 94   ILE C CG1 1 
ATOM   5045  C  CG2 . ILE C  1 94  ? 49.229  38.342  156.858 1.00 42.56  ? 94   ILE C CG2 1 
ATOM   5046  C  CD1 . ILE C  1 94  ? 51.783  39.518  157.803 1.00 40.55  ? 94   ILE C CD1 1 
ATOM   5047  N  N   . GLU C  1 95  ? 46.152  39.552  158.302 1.00 47.10  ? 95   GLU C N   1 
ATOM   5048  C  CA  . GLU C  1 95  ? 44.890  38.827  158.312 1.00 47.79  ? 95   GLU C CA  1 
ATOM   5049  C  C   . GLU C  1 95  ? 43.813  39.683  157.637 1.00 46.71  ? 95   GLU C C   1 
ATOM   5050  O  O   . GLU C  1 95  ? 42.969  39.164  156.898 1.00 46.06  ? 95   GLU C O   1 
ATOM   5051  C  CB  . GLU C  1 95  ? 44.484  38.442  159.750 1.00 49.14  ? 95   GLU C CB  1 
ATOM   5052  C  CG  . GLU C  1 95  ? 45.342  37.316  160.358 1.00 53.57  ? 95   GLU C CG  1 
ATOM   5053  C  CD  . GLU C  1 95  ? 44.835  36.804  161.717 1.00 57.73  ? 95   GLU C CD  1 
ATOM   5054  O  OE1 . GLU C  1 95  ? 43.673  36.336  161.792 1.00 57.36  ? 95   GLU C OE1 1 
ATOM   5055  O  OE2 . GLU C  1 95  ? 45.608  36.858  162.705 1.00 53.02  ? 95   GLU C OE2 1 
ATOM   5056  N  N   . ARG C  1 96  ? 43.847  40.991  157.876 1.00 44.10  ? 96   ARG C N   1 
ATOM   5057  C  CA  . ARG C  1 96  ? 42.884  41.891  157.245 1.00 43.94  ? 96   ARG C CA  1 
ATOM   5058  C  C   . ARG C  1 96  ? 43.193  41.937  155.749 1.00 41.13  ? 96   ARG C C   1 
ATOM   5059  O  O   . ARG C  1 96  ? 42.293  41.932  154.913 1.00 41.23  ? 96   ARG C O   1 
ATOM   5060  C  CB  . ARG C  1 96  ? 42.969  43.296  157.857 1.00 44.90  ? 96   ARG C CB  1 
ATOM   5061  C  CG  . ARG C  1 96  ? 42.539  43.351  159.326 1.00 50.79  ? 96   ARG C CG  1 
ATOM   5062  C  CD  . ARG C  1 96  ? 42.588  44.771  159.878 1.00 56.63  ? 96   ARG C CD  1 
ATOM   5063  N  NE  . ARG C  1 96  ? 41.642  45.636  159.182 1.00 64.37  ? 96   ARG C NE  1 
ATOM   5064  C  CZ  . ARG C  1 96  ? 40.320  45.529  159.280 1.00 65.57  ? 96   ARG C CZ  1 
ATOM   5065  N  NH1 . ARG C  1 96  ? 39.782  44.597  160.057 1.00 66.15  ? 96   ARG C NH1 1 
ATOM   5066  N  NH2 . ARG C  1 96  ? 39.535  46.345  158.588 1.00 66.26  ? 96   ARG C NH2 1 
ATOM   5067  N  N   . GLY C  1 97  ? 44.479  41.968  155.424 1.00 38.82  ? 97   GLY C N   1 
ATOM   5068  C  CA  . GLY C  1 97  ? 44.888  41.983  154.037 1.00 39.99  ? 97   GLY C CA  1 
ATOM   5069  C  C   . GLY C  1 97  ? 44.388  40.743  153.317 1.00 41.12  ? 97   GLY C C   1 
ATOM   5070  O  O   . GLY C  1 97  ? 44.071  40.798  152.131 1.00 44.37  ? 97   GLY C O   1 
ATOM   5071  N  N   . GLU C  1 98  ? 44.320  39.619  154.024 1.00 40.86  ? 98   GLU C N   1 
ATOM   5072  C  CA  . GLU C  1 98  ? 43.835  38.380  153.422 1.00 40.45  ? 98   GLU C CA  1 
ATOM   5073  C  C   . GLU C  1 98  ? 42.321  38.375  153.284 1.00 37.04  ? 98   GLU C C   1 
ATOM   5074  O  O   . GLU C  1 98  ? 41.796  37.801  152.331 1.00 35.71  ? 98   GLU C O   1 
ATOM   5075  C  CB  . GLU C  1 98  ? 44.291  37.172  154.232 1.00 42.39  ? 98   GLU C CB  1 
ATOM   5076  C  CG  . GLU C  1 98  ? 45.653  36.676  153.828 1.00 47.49  ? 98   GLU C CG  1 
ATOM   5077  C  CD  . GLU C  1 98  ? 46.388  36.020  154.975 1.00 54.04  ? 98   GLU C CD  1 
ATOM   5078  O  OE1 . GLU C  1 98  ? 45.794  35.921  156.081 1.00 54.84  ? 98   GLU C OE1 1 
ATOM   5079  O  OE2 . GLU C  1 98  ? 47.558  35.612  154.770 1.00 55.61  ? 98   GLU C OE2 1 
ATOM   5080  N  N   . LEU C  1 99  ? 41.633  39.010  154.235 1.00 34.52  ? 99   LEU C N   1 
ATOM   5081  C  CA  . LEU C  1 99  ? 40.183  39.120  154.200 1.00 34.07  ? 99   LEU C CA  1 
ATOM   5082  C  C   . LEU C  1 99  ? 39.839  39.917  152.953 1.00 38.16  ? 99   LEU C C   1 
ATOM   5083  O  O   . LEU C  1 99  ? 38.882  39.614  152.239 1.00 38.52  ? 99   LEU C O   1 
ATOM   5084  C  CB  . LEU C  1 99  ? 39.668  39.888  155.409 1.00 37.37  ? 99   LEU C CB  1 
ATOM   5085  C  CG  . LEU C  1 99  ? 38.211  40.352  155.260 1.00 40.73  ? 99   LEU C CG  1 
ATOM   5086  C  CD1 . LEU C  1 99  ? 37.307  39.149  155.199 1.00 40.72  ? 99   LEU C CD1 1 
ATOM   5087  C  CD2 . LEU C  1 99  ? 37.812  41.237  156.420 1.00 43.20  ? 99   LEU C CD2 1 
ATOM   5088  N  N   . PHE C  1 100 ? 40.644  40.944  152.707 1.00 35.59  ? 100  PHE C N   1 
ATOM   5089  C  CA  . PHE C  1 100 ? 40.478  41.821  151.568 1.00 30.85  ? 100  PHE C CA  1 
ATOM   5090  C  C   . PHE C  1 100 ? 40.629  41.065  150.249 1.00 31.52  ? 100  PHE C C   1 
ATOM   5091  O  O   . PHE C  1 100 ? 39.775  41.164  149.362 1.00 29.84  ? 100  PHE C O   1 
ATOM   5092  C  CB  . PHE C  1 100 ? 41.500  42.976  151.668 1.00 29.08  ? 100  PHE C CB  1 
ATOM   5093  C  CG  . PHE C  1 100 ? 41.376  44.014  150.574 1.00 30.65  ? 100  PHE C CG  1 
ATOM   5094  C  CD1 . PHE C  1 100 ? 42.119  43.905  149.396 1.00 27.66  ? 100  PHE C CD1 1 
ATOM   5095  C  CD2 . PHE C  1 100 ? 40.512  45.112  150.724 1.00 28.66  ? 100  PHE C CD2 1 
ATOM   5096  C  CE1 . PHE C  1 100 ? 42.003  44.884  148.374 1.00 29.95  ? 100  PHE C CE1 1 
ATOM   5097  C  CE2 . PHE C  1 100 ? 40.392  46.086  149.717 1.00 25.09  ? 100  PHE C CE2 1 
ATOM   5098  C  CZ  . PHE C  1 100 ? 41.137  45.974  148.543 1.00 23.48  ? 100  PHE C CZ  1 
ATOM   5099  N  N   . LEU C  1 101 ? 41.705  40.299  150.114 1.00 34.53  ? 101  LEU C N   1 
ATOM   5100  C  CA  . LEU C  1 101 ? 41.934  39.575  148.870 1.00 36.22  ? 101  LEU C CA  1 
ATOM   5101  C  C   . LEU C  1 101 ? 40.811  38.568  148.624 1.00 38.63  ? 101  LEU C C   1 
ATOM   5102  O  O   . LEU C  1 101 ? 40.308  38.410  147.510 1.00 40.54  ? 101  LEU C O   1 
ATOM   5103  C  CB  . LEU C  1 101 ? 43.286  38.883  148.921 1.00 33.06  ? 101  LEU C CB  1 
ATOM   5104  C  CG  . LEU C  1 101 ? 43.912  38.579  147.560 1.00 42.69  ? 101  LEU C CG  1 
ATOM   5105  C  CD1 . LEU C  1 101 ? 45.409  38.456  147.741 1.00 49.66  ? 101  LEU C CD1 1 
ATOM   5106  C  CD2 . LEU C  1 101 ? 43.333  37.299  146.947 1.00 44.35  ? 101  LEU C CD2 1 
ATOM   5107  N  N   . ARG C  1 102 ? 40.395  37.903  149.686 1.00 41.63  ? 102  ARG C N   1 
ATOM   5108  C  CA  . ARG C  1 102 ? 39.331  36.925  149.589 1.00 41.61  ? 102  ARG C CA  1 
ATOM   5109  C  C   . ARG C  1 102 ? 38.028  37.601  149.135 1.00 40.55  ? 102  ARG C C   1 
ATOM   5110  O  O   . ARG C  1 102 ? 37.266  37.027  148.355 1.00 40.62  ? 102  ARG C O   1 
ATOM   5111  C  CB  . ARG C  1 102 ? 39.167  36.246  150.950 1.00 42.76  ? 102  ARG C CB  1 
ATOM   5112  C  CG  . ARG C  1 102 ? 38.842  34.770  150.890 1.00 45.69  ? 102  ARG C CG  1 
ATOM   5113  C  CD  . ARG C  1 102 ? 39.395  34.042  152.120 1.00 47.43  ? 102  ARG C CD  1 
ATOM   5114  N  NE  . ARG C  1 102 ? 39.095  34.745  153.366 1.00 45.62  ? 102  ARG C NE  1 
ATOM   5115  C  CZ  . ARG C  1 102 ? 40.014  35.099  154.262 1.00 46.71  ? 102  ARG C CZ  1 
ATOM   5116  N  NH1 . ARG C  1 102 ? 41.298  34.811  154.052 1.00 50.06  ? 102  ARG C NH1 1 
ATOM   5117  N  NH2 . ARG C  1 102 ? 39.656  35.754  155.358 1.00 44.16  ? 102  ARG C NH2 1 
ATOM   5118  N  N   . ARG C  1 103 ? 37.777  38.820  149.607 1.00 40.35  ? 103  ARG C N   1 
ATOM   5119  C  CA  . ARG C  1 103 ? 36.563  39.530  149.215 1.00 43.01  ? 103  ARG C CA  1 
ATOM   5120  C  C   . ARG C  1 103 ? 36.630  39.992  147.752 1.00 42.61  ? 103  ARG C C   1 
ATOM   5121  O  O   . ARG C  1 103 ? 35.635  39.879  147.020 1.00 39.41  ? 103  ARG C O   1 
ATOM   5122  C  CB  . ARG C  1 103 ? 36.298  40.739  150.123 1.00 48.16  ? 103  ARG C CB  1 
ATOM   5123  C  CG  . ARG C  1 103 ? 34.897  41.342  149.947 1.00 57.07  ? 103  ARG C CG  1 
ATOM   5124  C  CD  . ARG C  1 103 ? 34.730  42.670  150.695 1.00 65.68  ? 103  ARG C CD  1 
ATOM   5125  N  NE  . ARG C  1 103 ? 33.357  43.190  150.621 1.00 72.86  ? 103  ARG C NE  1 
ATOM   5126  C  CZ  . ARG C  1 103 ? 32.996  44.440  150.928 1.00 74.90  ? 103  ARG C CZ  1 
ATOM   5127  N  NH1 . ARG C  1 103 ? 33.906  45.321  151.330 1.00 75.95  ? 103  ARG C NH1 1 
ATOM   5128  N  NH2 . ARG C  1 103 ? 31.721  44.814  150.840 1.00 73.34  ? 103  ARG C NH2 1 
ATOM   5129  N  N   . ILE C  1 104 ? 37.786  40.494  147.313 1.00 39.15  ? 104  ILE C N   1 
ATOM   5130  C  CA  . ILE C  1 104 ? 37.880  40.939  145.927 1.00 38.59  ? 104  ILE C CA  1 
ATOM   5131  C  C   . ILE C  1 104 ? 38.065  39.785  144.941 1.00 41.80  ? 104  ILE C C   1 
ATOM   5132  O  O   . ILE C  1 104 ? 38.378  40.013  143.769 1.00 43.10  ? 104  ILE C O   1 
ATOM   5133  C  CB  . ILE C  1 104 ? 39.020  41.975  145.682 1.00 36.58  ? 104  ILE C CB  1 
ATOM   5134  C  CG1 . ILE C  1 104 ? 40.373  41.282  145.678 1.00 32.19  ? 104  ILE C CG1 1 
ATOM   5135  C  CG2 . ILE C  1 104 ? 38.963  43.094  146.714 1.00 29.23  ? 104  ILE C CG2 1 
ATOM   5136  C  CD1 . ILE C  1 104 ? 41.424  42.118  145.054 1.00 29.93  ? 104  ILE C CD1 1 
ATOM   5137  N  N   . SER C  1 105 ? 37.875  38.552  145.418 1.00 43.25  ? 105  SER C N   1 
ATOM   5138  C  CA  . SER C  1 105 ? 37.967  37.357  144.564 1.00 43.76  ? 105  SER C CA  1 
ATOM   5139  C  C   . SER C  1 105 ? 36.556  36.936  144.134 1.00 41.70  ? 105  SER C C   1 
ATOM   5140  O  O   . SER C  1 105 ? 36.376  36.054  143.300 1.00 40.17  ? 105  SER C O   1 
ATOM   5141  C  CB  . SER C  1 105 ? 38.634  36.198  145.314 1.00 45.35  ? 105  SER C CB  1 
ATOM   5142  O  OG  . SER C  1 105 ? 40.025  36.429  145.485 1.00 51.14  ? 105  SER C OG  1 
ATOM   5143  N  N   . LEU C  1 106 ? 35.558  37.592  144.715 1.00 42.40  ? 106  LEU C N   1 
ATOM   5144  C  CA  . LEU C  1 106 ? 34.155  37.318  144.421 1.00 43.75  ? 106  LEU C CA  1 
ATOM   5145  C  C   . LEU C  1 106 ? 33.580  38.329  143.403 1.00 43.81  ? 106  LEU C C   1 
ATOM   5146  O  O   . LEU C  1 106 ? 32.550  38.079  142.774 1.00 42.94  ? 106  LEU C O   1 
ATOM   5147  C  CB  . LEU C  1 106 ? 33.347  37.352  145.734 1.00 43.02  ? 106  LEU C CB  1 
ATOM   5148  C  CG  . LEU C  1 106 ? 33.489  36.225  146.790 1.00 45.62  ? 106  LEU C CG  1 
ATOM   5149  C  CD1 . LEU C  1 106 ? 34.883  35.585  146.763 1.00 45.33  ? 106  LEU C CD1 1 
ATOM   5150  C  CD2 . LEU C  1 106 ? 33.192  36.800  148.178 1.00 38.10  ? 106  LEU C CD2 1 
ATOM   5151  N  N   . SER C  1 107 ? 34.272  39.456  143.236 1.00 44.70  ? 107  SER C N   1 
ATOM   5152  C  CA  . SER C  1 107 ? 33.855  40.525  142.324 1.00 42.58  ? 107  SER C CA  1 
ATOM   5153  C  C   . SER C  1 107 ? 33.519  40.070  140.917 1.00 40.53  ? 107  SER C C   1 
ATOM   5154  O  O   . SER C  1 107 ? 32.422  40.302  140.429 1.00 41.08  ? 107  SER C O   1 
ATOM   5155  C  CB  . SER C  1 107 ? 34.940  41.596  142.237 1.00 42.67  ? 107  SER C CB  1 
ATOM   5156  O  OG  . SER C  1 107 ? 35.117  42.249  143.476 1.00 48.03  ? 107  SER C OG  1 
ATOM   5157  N  N   . ARG C  1 108 ? 34.466  39.428  140.257 1.00 39.35  ? 108  ARG C N   1 
ATOM   5158  C  CA  . ARG C  1 108 ? 34.240  38.982  138.897 1.00 41.60  ? 108  ARG C CA  1 
ATOM   5159  C  C   . ARG C  1 108 ? 32.977  38.155  138.728 1.00 43.50  ? 108  ARG C C   1 
ATOM   5160  O  O   . ARG C  1 108 ? 32.145  38.472  137.875 1.00 45.52  ? 108  ARG C O   1 
ATOM   5161  C  CB  . ARG C  1 108 ? 35.439  38.200  138.399 1.00 42.29  ? 108  ARG C CB  1 
ATOM   5162  C  CG  . ARG C  1 108 ? 35.427  37.956  136.925 1.00 47.08  ? 108  ARG C CG  1 
ATOM   5163  C  CD  . ARG C  1 108 ? 36.749  37.351  136.498 1.00 52.29  ? 108  ARG C CD  1 
ATOM   5164  N  NE  . ARG C  1 108 ? 37.841  38.313  136.569 1.00 53.04  ? 108  ARG C NE  1 
ATOM   5165  C  CZ  . ARG C  1 108 ? 39.125  37.987  136.470 1.00 53.92  ? 108  ARG C CZ  1 
ATOM   5166  N  NH1 . ARG C  1 108 ? 39.480  36.718  136.304 1.00 53.11  ? 108  ARG C NH1 1 
ATOM   5167  N  NH2 . ARG C  1 108 ? 40.053  38.933  136.521 1.00 54.20  ? 108  ARG C NH2 1 
ATOM   5168  N  N   . ASN C  1 109 ? 32.809  37.103  139.528 1.00 43.76  ? 109  ASN C N   1 
ATOM   5169  C  CA  . ASN C  1 109 ? 31.606  36.284  139.382 1.00 41.39  ? 109  ASN C CA  1 
ATOM   5170  C  C   . ASN C  1 109 ? 30.378  37.029  139.858 1.00 38.38  ? 109  ASN C C   1 
ATOM   5171  O  O   . ASN C  1 109 ? 29.286  36.789  139.371 1.00 36.54  ? 109  ASN C O   1 
ATOM   5172  C  CB  . ASN C  1 109 ? 31.755  34.935  140.099 1.00 43.97  ? 109  ASN C CB  1 
ATOM   5173  C  CG  . ASN C  1 109 ? 32.779  34.024  139.413 1.00 49.29  ? 109  ASN C CG  1 
ATOM   5174  O  OD1 . ASN C  1 109 ? 32.748  33.847  138.192 1.00 51.56  ? 109  ASN C OD1 1 
ATOM   5175  N  ND2 . ASN C  1 109 ? 33.686  33.445  140.194 1.00 50.64  ? 109  ASN C ND2 1 
ATOM   5176  N  N   . LYS C  1 110 ? 30.551  37.959  140.788 1.00 40.21  ? 110  LYS C N   1 
ATOM   5177  C  CA  . LYS C  1 110 ? 29.412  38.737  141.261 1.00 43.31  ? 110  LYS C CA  1 
ATOM   5178  C  C   . LYS C  1 110 ? 28.918  39.665  140.136 1.00 43.52  ? 110  LYS C C   1 
ATOM   5179  O  O   . LYS C  1 110 ? 27.751  40.082  140.113 1.00 43.96  ? 110  LYS C O   1 
ATOM   5180  C  CB  . LYS C  1 110 ? 29.783  39.565  142.502 1.00 44.46  ? 110  LYS C CB  1 
ATOM   5181  C  CG  . LYS C  1 110 ? 28.616  40.442  142.994 1.00 54.39  ? 110  LYS C CG  1 
ATOM   5182  C  CD  . LYS C  1 110 ? 28.835  41.029  144.394 1.00 56.98  ? 110  LYS C CD  1 
ATOM   5183  C  CE  . LYS C  1 110 ? 27.569  41.750  144.886 1.00 57.79  ? 110  LYS C CE  1 
ATOM   5184  N  NZ  . LYS C  1 110 ? 27.679  42.178  146.320 1.00 57.24  ? 110  LYS C NZ  1 
ATOM   5185  N  N   . ILE C  1 111 ? 29.811  39.968  139.196 1.00 41.19  ? 111  ILE C N   1 
ATOM   5186  C  CA  . ILE C  1 111 ? 29.482  40.843  138.082 1.00 40.40  ? 111  ILE C CA  1 
ATOM   5187  C  C   . ILE C  1 111 ? 28.751  40.117  136.953 1.00 42.30  ? 111  ILE C C   1 
ATOM   5188  O  O   . ILE C  1 111 ? 27.842  40.678  136.345 1.00 40.66  ? 111  ILE C O   1 
ATOM   5189  C  CB  . ILE C  1 111 ? 30.758  41.542  137.548 1.00 37.01  ? 111  ILE C CB  1 
ATOM   5190  C  CG1 . ILE C  1 111 ? 31.174  42.634  138.530 1.00 37.14  ? 111  ILE C CG1 1 
ATOM   5191  C  CG2 . ILE C  1 111 ? 30.510  42.161  136.186 1.00 35.38  ? 111  ILE C CG2 1 
ATOM   5192  C  CD1 . ILE C  1 111 ? 32.528  43.225  138.247 1.00 38.08  ? 111  ILE C CD1 1 
ATOM   5193  N  N   . ALA C  1 112 ? 29.137  38.873  136.674 1.00 42.89  ? 112  ALA C N   1 
ATOM   5194  C  CA  . ALA C  1 112 ? 28.479  38.105  135.622 1.00 42.75  ? 112  ALA C CA  1 
ATOM   5195  C  C   . ALA C  1 112 ? 27.019  37.866  136.000 1.00 45.72  ? 112  ALA C C   1 
ATOM   5196  O  O   . ALA C  1 112 ? 26.152  37.748  135.143 1.00 45.45  ? 112  ALA C O   1 
ATOM   5197  C  CB  . ALA C  1 112 ? 29.181  36.786  135.430 1.00 37.36  ? 112  ALA C CB  1 
ATOM   5198  N  N   . ASP C  1 113 ? 26.761  37.797  137.298 1.00 50.59  ? 113  ASP C N   1 
ATOM   5199  C  CA  . ASP C  1 113 ? 25.421  37.564  137.811 1.00 54.12  ? 113  ASP C CA  1 
ATOM   5200  C  C   . ASP C  1 113 ? 24.508  38.735  137.474 1.00 54.39  ? 113  ASP C C   1 
ATOM   5201  O  O   . ASP C  1 113 ? 23.380  38.550  137.011 1.00 54.25  ? 113  ASP C O   1 
ATOM   5202  C  CB  . ASP C  1 113 ? 25.471  37.378  139.329 1.00 59.24  ? 113  ASP C CB  1 
ATOM   5203  C  CG  . ASP C  1 113 ? 24.638  36.201  139.804 1.00 64.46  ? 113  ASP C CG  1 
ATOM   5204  O  OD1 . ASP C  1 113 ? 23.395  36.202  139.608 1.00 65.05  ? 113  ASP C OD1 1 
ATOM   5205  O  OD2 . ASP C  1 113 ? 25.243  35.269  140.378 1.00 68.35  ? 113  ASP C OD2 1 
ATOM   5206  N  N   . LEU C  1 114 ? 25.000  39.943  137.716 1.00 52.54  ? 114  LEU C N   1 
ATOM   5207  C  CA  . LEU C  1 114 ? 24.225  41.146  137.441 1.00 51.28  ? 114  LEU C CA  1 
ATOM   5208  C  C   . LEU C  1 114 ? 24.100  41.447  135.944 1.00 49.66  ? 114  LEU C C   1 
ATOM   5209  O  O   . LEU C  1 114 ? 23.447  42.407  135.550 1.00 48.61  ? 114  LEU C O   1 
ATOM   5210  C  CB  . LEU C  1 114 ? 24.883  42.332  138.141 1.00 50.87  ? 114  LEU C CB  1 
ATOM   5211  C  CG  . LEU C  1 114 ? 24.982  42.227  139.662 1.00 51.63  ? 114  LEU C CG  1 
ATOM   5212  C  CD1 . LEU C  1 114 ? 25.785  43.393  140.211 1.00 49.07  ? 114  LEU C CD1 1 
ATOM   5213  C  CD2 . LEU C  1 114 ? 23.585  42.208  140.253 1.00 49.59  ? 114  LEU C CD2 1 
ATOM   5214  N  N   . CYS C  1 115 ? 24.701  40.606  135.115 1.00 49.93  ? 115  CYS C N   1 
ATOM   5215  C  CA  . CYS C  1 115 ? 24.710  40.823  133.673 1.00 52.44  ? 115  CYS C CA  1 
ATOM   5216  C  C   . CYS C  1 115 ? 23.852  39.972  132.740 1.00 53.53  ? 115  CYS C C   1 
ATOM   5217  O  O   . CYS C  1 115 ? 23.496  40.443  131.664 1.00 53.36  ? 115  CYS C O   1 
ATOM   5218  C  CB  . CYS C  1 115 ? 26.146  40.731  133.164 1.00 52.16  ? 115  CYS C CB  1 
ATOM   5219  S  SG  . CYS C  1 115 ? 26.956  42.286  132.924 1.00 51.59  ? 115  CYS C SG  1 
ATOM   5220  N  N   . HIS C  1 116 ? 23.527  38.739  133.121 1.00 55.42  ? 116  HIS C N   1 
ATOM   5221  C  CA  . HIS C  1 116 ? 22.767  37.868  132.222 1.00 57.12  ? 116  HIS C CA  1 
ATOM   5222  C  C   . HIS C  1 116 ? 21.510  38.490  131.635 1.00 54.58  ? 116  HIS C C   1 
ATOM   5223  O  O   . HIS C  1 116 ? 21.257  38.345  130.442 1.00 56.16  ? 116  HIS C O   1 
ATOM   5224  C  CB  . HIS C  1 116 ? 22.421  36.526  132.895 1.00 59.23  ? 116  HIS C CB  1 
ATOM   5225  C  CG  . HIS C  1 116 ? 21.521  36.655  134.081 1.00 63.75  ? 116  HIS C CG  1 
ATOM   5226  N  ND1 . HIS C  1 116 ? 21.936  37.204  135.275 1.00 65.86  ? 116  HIS C ND1 1 
ATOM   5227  C  CD2 . HIS C  1 116 ? 20.218  36.325  134.252 1.00 66.10  ? 116  HIS C CD2 1 
ATOM   5228  C  CE1 . HIS C  1 116 ? 20.928  37.207  136.131 1.00 65.65  ? 116  HIS C CE1 1 
ATOM   5229  N  NE2 . HIS C  1 116 ? 19.874  36.680  135.535 1.00 65.56  ? 116  HIS C NE2 1 
ATOM   5230  N  N   . THR C  1 117 ? 20.732  39.186  132.453 1.00 50.38  ? 117  THR C N   1 
ATOM   5231  C  CA  . THR C  1 117 ? 19.505  39.796  131.963 1.00 50.28  ? 117  THR C CA  1 
ATOM   5232  C  C   . THR C  1 117 ? 19.754  40.666  130.742 1.00 49.66  ? 117  THR C C   1 
ATOM   5233  O  O   . THR C  1 117 ? 18.904  40.751  129.858 1.00 51.91  ? 117  THR C O   1 
ATOM   5234  C  CB  . THR C  1 117 ? 18.823  40.665  133.054 1.00 52.60  ? 117  THR C CB  1 
ATOM   5235  O  OG1 . THR C  1 117 ? 18.175  39.811  134.002 1.00 56.79  ? 117  THR C OG1 1 
ATOM   5236  C  CG2 . THR C  1 117 ? 17.786  41.604  132.447 1.00 50.97  ? 117  THR C CG2 1 
ATOM   5237  N  N   . PHE C  1 118 ? 20.917  41.305  130.680 1.00 46.62  ? 118  PHE C N   1 
ATOM   5238  C  CA  . PHE C  1 118 ? 21.214  42.180  129.557 1.00 43.34  ? 118  PHE C CA  1 
ATOM   5239  C  C   . PHE C  1 118 ? 21.717  41.529  128.287 1.00 44.01  ? 118  PHE C C   1 
ATOM   5240  O  O   . PHE C  1 118 ? 21.736  42.172  127.243 1.00 43.86  ? 118  PHE C O   1 
ATOM   5241  C  CB  . PHE C  1 118 ? 22.157  43.293  129.993 1.00 39.73  ? 118  PHE C CB  1 
ATOM   5242  C  CG  . PHE C  1 118 ? 21.506  44.283  130.904 1.00 39.17  ? 118  PHE C CG  1 
ATOM   5243  C  CD1 . PHE C  1 118 ? 21.320  43.987  132.256 1.00 36.05  ? 118  PHE C CD1 1 
ATOM   5244  C  CD2 . PHE C  1 118 ? 21.004  45.483  130.401 1.00 33.25  ? 118  PHE C CD2 1 
ATOM   5245  C  CE1 . PHE C  1 118 ? 20.642  44.864  133.101 1.00 30.44  ? 118  PHE C CE1 1 
ATOM   5246  C  CE2 . PHE C  1 118 ? 20.321  46.369  131.240 1.00 34.98  ? 118  PHE C CE2 1 
ATOM   5247  C  CZ  . PHE C  1 118 ? 20.140  46.056  132.597 1.00 33.90  ? 118  PHE C CZ  1 
ATOM   5248  N  N   . ILE C  1 119 ? 22.116  40.265  128.361 1.00 44.77  ? 119  ILE C N   1 
ATOM   5249  C  CA  . ILE C  1 119 ? 22.570  39.560  127.165 1.00 47.20  ? 119  ILE C CA  1 
ATOM   5250  C  C   . ILE C  1 119 ? 21.432  38.676  126.660 1.00 50.66  ? 119  ILE C C   1 
ATOM   5251  O  O   . ILE C  1 119 ? 21.243  37.545  127.126 1.00 52.84  ? 119  ILE C O   1 
ATOM   5252  C  CB  . ILE C  1 119 ? 23.799  38.689  127.451 1.00 45.04  ? 119  ILE C CB  1 
ATOM   5253  C  CG1 . ILE C  1 119 ? 24.985  39.588  127.804 1.00 41.70  ? 119  ILE C CG1 1 
ATOM   5254  C  CG2 . ILE C  1 119 ? 24.099  37.806  126.247 1.00 40.90  ? 119  ILE C CG2 1 
ATOM   5255  C  CD1 . ILE C  1 119 ? 26.252  38.830  128.101 1.00 44.55  ? 119  ILE C CD1 1 
ATOM   5256  N  N   . LYS C  1 120 ? 20.671  39.203  125.707 1.00 50.71  ? 120  LYS C N   1 
ATOM   5257  C  CA  . LYS C  1 120 ? 19.535  38.478  125.156 1.00 49.01  ? 120  LYS C CA  1 
ATOM   5258  C  C   . LYS C  1 120 ? 19.961  37.486  124.078 1.00 46.81  ? 120  LYS C C   1 
ATOM   5259  O  O   . LYS C  1 120 ? 20.872  37.741  123.298 1.00 45.34  ? 120  LYS C O   1 
ATOM   5260  C  CB  . LYS C  1 120 ? 18.526  39.459  124.555 1.00 48.53  ? 120  LYS C CB  1 
ATOM   5261  C  CG  . LYS C  1 120 ? 18.394  40.785  125.290 1.00 51.25  ? 120  LYS C CG  1 
ATOM   5262  C  CD  . LYS C  1 120 ? 17.372  40.761  126.413 1.00 54.80  ? 120  LYS C CD  1 
ATOM   5263  C  CE  . LYS C  1 120 ? 17.186  42.167  127.002 1.00 56.85  ? 120  LYS C CE  1 
ATOM   5264  N  NZ  . LYS C  1 120 ? 16.116  42.245  128.059 1.00 59.95  ? 120  LYS C NZ  1 
ATOM   5265  N  N   . ASP C  1 121 ? 19.289  36.346  124.051 1.00 46.93  ? 121  ASP C N   1 
ATOM   5266  C  CA  . ASP C  1 121 ? 19.552  35.314  123.054 1.00 44.68  ? 121  ASP C CA  1 
ATOM   5267  C  C   . ASP C  1 121 ? 19.344  36.015  121.703 1.00 40.90  ? 121  ASP C C   1 
ATOM   5268  O  O   . ASP C  1 121 ? 18.443  36.841  121.569 1.00 39.97  ? 121  ASP C O   1 
ATOM   5269  C  CB  . ASP C  1 121 ? 18.545  34.171  123.258 1.00 45.61  ? 121  ASP C CB  1 
ATOM   5270  C  CG  . ASP C  1 121 ? 18.818  32.979  122.381 1.00 47.97  ? 121  ASP C CG  1 
ATOM   5271  O  OD1 . ASP C  1 121 ? 19.922  32.412  122.485 1.00 51.26  ? 121  ASP C OD1 1 
ATOM   5272  O  OD2 . ASP C  1 121 ? 17.924  32.603  121.591 1.00 48.18  ? 121  ASP C OD2 1 
ATOM   5273  N  N   . GLY C  1 122 ? 20.182  35.713  120.717 1.00 37.20  ? 122  GLY C N   1 
ATOM   5274  C  CA  . GLY C  1 122 ? 20.045  36.351  119.413 1.00 36.60  ? 122  GLY C CA  1 
ATOM   5275  C  C   . GLY C  1 122 ? 20.761  37.691  119.252 1.00 35.76  ? 122  GLY C C   1 
ATOM   5276  O  O   . GLY C  1 122 ? 20.793  38.266  118.166 1.00 33.88  ? 122  GLY C O   1 
ATOM   5277  N  N   . ALA C  1 123 ? 21.358  38.188  120.329 1.00 36.56  ? 123  ALA C N   1 
ATOM   5278  C  CA  . ALA C  1 123 ? 22.059  39.464  120.291 1.00 36.29  ? 123  ALA C CA  1 
ATOM   5279  C  C   . ALA C  1 123 ? 23.395  39.399  119.563 1.00 36.18  ? 123  ALA C C   1 
ATOM   5280  O  O   . ALA C  1 123 ? 23.986  38.327  119.419 1.00 34.62  ? 123  ALA C O   1 
ATOM   5281  C  CB  . ALA C  1 123 ? 22.282  39.972  121.709 1.00 35.78  ? 123  ALA C CB  1 
ATOM   5282  N  N   . THR C  1 124 ? 23.844  40.561  119.088 1.00 37.03  ? 124  THR C N   1 
ATOM   5283  C  CA  . THR C  1 124 ? 25.136  40.701  118.416 1.00 35.96  ? 124  THR C CA  1 
ATOM   5284  C  C   . THR C  1 124 ? 25.892  41.706  119.272 1.00 34.92  ? 124  THR C C   1 
ATOM   5285  O  O   . THR C  1 124 ? 25.580  42.896  119.281 1.00 34.62  ? 124  THR C O   1 
ATOM   5286  C  CB  . THR C  1 124 ? 25.032  41.273  116.994 1.00 35.04  ? 124  THR C CB  1 
ATOM   5287  O  OG1 . THR C  1 124 ? 24.244  40.413  116.171 1.00 34.68  ? 124  THR C OG1 1 
ATOM   5288  C  CG2 . THR C  1 124 ? 26.419  41.371  116.382 1.00 36.18  ? 124  THR C CG2 1 
ATOM   5289  N  N   . ILE C  1 125 ? 26.875  41.206  120.004 1.00 34.11  ? 125  ILE C N   1 
ATOM   5290  C  CA  . ILE C  1 125 ? 27.670  42.029  120.900 1.00 33.53  ? 125  ILE C CA  1 
ATOM   5291  C  C   . ILE C  1 125 ? 28.969  42.517  120.262 1.00 33.12  ? 125  ILE C C   1 
ATOM   5292  O  O   . ILE C  1 125 ? 29.664  41.764  119.586 1.00 33.49  ? 125  ILE C O   1 
ATOM   5293  C  CB  . ILE C  1 125 ? 27.975  41.227  122.169 1.00 32.34  ? 125  ILE C CB  1 
ATOM   5294  C  CG1 . ILE C  1 125 ? 26.653  40.870  122.844 1.00 28.16  ? 125  ILE C CG1 1 
ATOM   5295  C  CG2 . ILE C  1 125 ? 28.894  42.009  123.091 1.00 29.02  ? 125  ILE C CG2 1 
ATOM   5296  C  CD1 . ILE C  1 125 ? 26.762  39.749  123.834 1.00 33.97  ? 125  ILE C CD1 1 
ATOM   5297  N  N   . LEU C  1 126 ? 29.276  43.791  120.465 1.00 32.20  ? 126  LEU C N   1 
ATOM   5298  C  CA  . LEU C  1 126 ? 30.494  44.372  119.922 1.00 31.27  ? 126  LEU C CA  1 
ATOM   5299  C  C   . LEU C  1 126 ? 31.353  44.720  121.121 1.00 30.92  ? 126  LEU C C   1 
ATOM   5300  O  O   . LEU C  1 126 ? 30.891  45.392  122.040 1.00 31.94  ? 126  LEU C O   1 
ATOM   5301  C  CB  . LEU C  1 126 ? 30.146  45.624  119.104 1.00 31.86  ? 126  LEU C CB  1 
ATOM   5302  C  CG  . LEU C  1 126 ? 31.152  46.516  118.352 1.00 32.64  ? 126  LEU C CG  1 
ATOM   5303  C  CD1 . LEU C  1 126 ? 31.407  47.719  119.192 1.00 31.50  ? 126  LEU C CD1 1 
ATOM   5304  C  CD2 . LEU C  1 126 ? 32.456  45.791  117.994 1.00 28.14  ? 126  LEU C CD2 1 
ATOM   5305  N  N   . THR C  1 127 ? 32.585  44.223  121.143 1.00 29.01  ? 127  THR C N   1 
ATOM   5306  C  CA  . THR C  1 127 ? 33.478  44.518  122.259 1.00 29.12  ? 127  THR C CA  1 
ATOM   5307  C  C   . THR C  1 127 ? 34.842  44.979  121.724 1.00 27.21  ? 127  THR C C   1 
ATOM   5308  O  O   . THR C  1 127 ? 35.088  44.928  120.523 1.00 27.33  ? 127  THR C O   1 
ATOM   5309  C  CB  . THR C  1 127 ? 33.595  43.285  123.250 1.00 28.02  ? 127  THR C CB  1 
ATOM   5310  O  OG1 . THR C  1 127 ? 34.254  43.690  124.459 1.00 27.66  ? 127  THR C OG1 1 
ATOM   5311  C  CG2 . THR C  1 127 ? 34.370  42.144  122.626 1.00 27.89  ? 127  THR C CG2 1 
ATOM   5312  N  N   . HIS C  1 128 ? 35.715  45.433  122.618 1.00 27.35  ? 128  HIS C N   1 
ATOM   5313  C  CA  . HIS C  1 128 ? 37.027  45.962  122.239 1.00 28.93  ? 128  HIS C CA  1 
ATOM   5314  C  C   . HIS C  1 128 ? 38.184  45.337  123.019 1.00 29.86  ? 128  HIS C C   1 
ATOM   5315  O  O   . HIS C  1 128 ? 38.123  45.185  124.233 1.00 30.41  ? 128  HIS C O   1 
ATOM   5316  C  CB  . HIS C  1 128 ? 37.002  47.490  122.449 1.00 28.58  ? 128  HIS C CB  1 
ATOM   5317  C  CG  . HIS C  1 128 ? 38.324  48.177  122.271 1.00 29.58  ? 128  HIS C CG  1 
ATOM   5318  N  ND1 . HIS C  1 128 ? 38.998  48.211  121.070 1.00 31.26  ? 128  HIS C ND1 1 
ATOM   5319  C  CD2 . HIS C  1 128 ? 39.068  48.905  123.136 1.00 28.48  ? 128  HIS C CD2 1 
ATOM   5320  C  CE1 . HIS C  1 128 ? 40.099  48.931  121.201 1.00 28.12  ? 128  HIS C CE1 1 
ATOM   5321  N  NE2 . HIS C  1 128 ? 40.163  49.364  122.447 1.00 24.12  ? 128  HIS C NE2 1 
ATOM   5322  N  N   . ALA C  1 129 ? 39.243  44.977  122.306 1.00 31.76  ? 129  ALA C N   1 
ATOM   5323  C  CA  . ALA C  1 129 ? 40.423  44.393  122.930 1.00 32.61  ? 129  ALA C CA  1 
ATOM   5324  C  C   . ALA C  1 129 ? 40.091  43.217  123.832 1.00 32.66  ? 129  ALA C C   1 
ATOM   5325  O  O   . ALA C  1 129 ? 39.034  42.607  123.709 1.00 34.37  ? 129  ALA C O   1 
ATOM   5326  C  CB  . ALA C  1 129 ? 41.176  45.454  123.716 1.00 31.10  ? 129  ALA C CB  1 
ATOM   5327  N  N   . TYR C  1 130 ? 40.998  42.908  124.749 1.00 32.18  ? 130  TYR C N   1 
ATOM   5328  C  CA  . TYR C  1 130 ? 40.810  41.776  125.648 1.00 33.68  ? 130  TYR C CA  1 
ATOM   5329  C  C   . TYR C  1 130 ? 40.321  42.225  127.020 1.00 33.40  ? 130  TYR C C   1 
ATOM   5330  O  O   . TYR C  1 130 ? 40.741  43.266  127.528 1.00 34.76  ? 130  TYR C O   1 
ATOM   5331  C  CB  . TYR C  1 130 ? 42.138  41.008  125.809 1.00 33.08  ? 130  TYR C CB  1 
ATOM   5332  C  CG  . TYR C  1 130 ? 42.007  39.641  126.472 1.00 34.20  ? 130  TYR C CG  1 
ATOM   5333  C  CD1 . TYR C  1 130 ? 41.956  38.470  125.702 1.00 31.56  ? 130  TYR C CD1 1 
ATOM   5334  C  CD2 . TYR C  1 130 ? 41.876  39.518  127.862 1.00 31.80  ? 130  TYR C CD2 1 
ATOM   5335  C  CE1 . TYR C  1 130 ? 41.771  37.215  126.298 1.00 32.18  ? 130  TYR C CE1 1 
ATOM   5336  C  CE2 . TYR C  1 130 ? 41.685  38.265  128.465 1.00 32.99  ? 130  TYR C CE2 1 
ATOM   5337  C  CZ  . TYR C  1 130 ? 41.634  37.120  127.675 1.00 34.08  ? 130  TYR C CZ  1 
ATOM   5338  O  OH  . TYR C  1 130 ? 41.441  35.883  128.258 1.00 37.48  ? 130  TYR C OH  1 
ATOM   5339  N  N   . SER C  1 131 ? 39.435  41.440  127.618 1.00 30.41  ? 131  SER C N   1 
ATOM   5340  C  CA  . SER C  1 131 ? 38.937  41.757  128.946 1.00 29.66  ? 131  SER C CA  1 
ATOM   5341  C  C   . SER C  1 131 ? 38.537  40.490  129.659 1.00 28.92  ? 131  SER C C   1 
ATOM   5342  O  O   . SER C  1 131 ? 37.686  39.744  129.174 1.00 28.99  ? 131  SER C O   1 
ATOM   5343  C  CB  . SER C  1 131 ? 37.737  42.701  128.883 1.00 30.23  ? 131  SER C CB  1 
ATOM   5344  O  OG  . SER C  1 131 ? 37.095  42.757  130.147 1.00 28.99  ? 131  SER C OG  1 
ATOM   5345  N  N   . ARG C  1 132 ? 39.148  40.255  130.816 1.00 29.02  ? 132  ARG C N   1 
ATOM   5346  C  CA  . ARG C  1 132 ? 38.860  39.067  131.611 1.00 29.84  ? 132  ARG C CA  1 
ATOM   5347  C  C   . ARG C  1 132 ? 37.429  39.070  132.137 1.00 30.29  ? 132  ARG C C   1 
ATOM   5348  O  O   . ARG C  1 132 ? 36.747  38.044  132.120 1.00 29.29  ? 132  ARG C O   1 
ATOM   5349  C  CB  . ARG C  1 132 ? 39.859  38.966  132.762 1.00 30.94  ? 132  ARG C CB  1 
ATOM   5350  C  CG  . ARG C  1 132 ? 41.252  38.539  132.298 1.00 38.59  ? 132  ARG C CG  1 
ATOM   5351  C  CD  . ARG C  1 132 ? 42.260  38.541  133.431 1.00 41.65  ? 132  ARG C CD  1 
ATOM   5352  N  NE  . ARG C  1 132 ? 42.929  39.830  133.558 1.00 49.62  ? 132  ARG C NE  1 
ATOM   5353  C  CZ  . ARG C  1 132 ? 44.046  40.151  132.914 1.00 52.83  ? 132  ARG C CZ  1 
ATOM   5354  N  NH1 . ARG C  1 132 ? 44.616  39.266  132.101 1.00 55.23  ? 132  ARG C NH1 1 
ATOM   5355  N  NH2 . ARG C  1 132 ? 44.592  41.351  133.084 1.00 52.07  ? 132  ARG C NH2 1 
ATOM   5356  N  N   . VAL C  1 133 ? 36.967  40.233  132.582 1.00 29.86  ? 133  VAL C N   1 
ATOM   5357  C  CA  . VAL C  1 133 ? 35.611  40.351  133.096 1.00 27.91  ? 133  VAL C CA  1 
ATOM   5358  C  C   . VAL C  1 133 ? 34.585  40.190  131.983 1.00 29.68  ? 133  VAL C C   1 
ATOM   5359  O  O   . VAL C  1 133 ? 33.526  39.600  132.201 1.00 29.53  ? 133  VAL C O   1 
ATOM   5360  C  CB  . VAL C  1 133 ? 35.392  41.713  133.758 1.00 27.42  ? 133  VAL C CB  1 
ATOM   5361  C  CG1 . VAL C  1 133 ? 33.977  41.822  134.245 1.00 22.34  ? 133  VAL C CG1 1 
ATOM   5362  C  CG2 . VAL C  1 133 ? 36.373  41.893  134.892 1.00 23.74  ? 133  VAL C CG2 1 
ATOM   5363  N  N   . VAL C  1 134 ? 34.889  40.729  130.798 1.00 29.29  ? 134  VAL C N   1 
ATOM   5364  C  CA  . VAL C  1 134 ? 33.969  40.613  129.675 1.00 27.46  ? 134  VAL C CA  1 
ATOM   5365  C  C   . VAL C  1 134 ? 33.879  39.145  129.302 1.00 28.79  ? 134  VAL C C   1 
ATOM   5366  O  O   . VAL C  1 134 ? 32.786  38.606  129.179 1.00 28.65  ? 134  VAL C O   1 
ATOM   5367  C  CB  . VAL C  1 134 ? 34.436  41.433  128.436 1.00 28.57  ? 134  VAL C CB  1 
ATOM   5368  C  CG1 . VAL C  1 134 ? 33.508  41.173  127.252 1.00 23.66  ? 134  VAL C CG1 1 
ATOM   5369  C  CG2 . VAL C  1 134 ? 34.429  42.913  128.753 1.00 26.42  ? 134  VAL C CG2 1 
ATOM   5370  N  N   . LEU C  1 135 ? 35.036  38.508  129.139 1.00 29.60  ? 135  LEU C N   1 
ATOM   5371  C  CA  . LEU C  1 135 ? 35.113  37.085  128.800 1.00 33.83  ? 135  LEU C CA  1 
ATOM   5372  C  C   . LEU C  1 135 ? 34.256  36.213  129.742 1.00 36.66  ? 135  LEU C C   1 
ATOM   5373  O  O   . LEU C  1 135 ? 33.558  35.296  129.279 1.00 35.85  ? 135  LEU C O   1 
ATOM   5374  C  CB  . LEU C  1 135 ? 36.570  36.602  128.863 1.00 33.74  ? 135  LEU C CB  1 
ATOM   5375  C  CG  . LEU C  1 135 ? 37.039  35.537  127.864 1.00 36.56  ? 135  LEU C CG  1 
ATOM   5376  C  CD1 . LEU C  1 135 ? 38.070  34.640  128.532 1.00 31.35  ? 135  LEU C CD1 1 
ATOM   5377  C  CD2 . LEU C  1 135 ? 35.866  34.700  127.382 1.00 40.19  ? 135  LEU C CD2 1 
ATOM   5378  N  N   . ARG C  1 136 ? 34.322  36.487  131.051 1.00 34.87  ? 136  ARG C N   1 
ATOM   5379  C  CA  . ARG C  1 136 ? 33.545  35.736  132.038 1.00 38.98  ? 136  ARG C CA  1 
ATOM   5380  C  C   . ARG C  1 136 ? 32.050  35.969  131.859 1.00 39.76  ? 136  ARG C C   1 
ATOM   5381  O  O   . ARG C  1 136 ? 31.256  35.031  131.902 1.00 41.27  ? 136  ARG C O   1 
ATOM   5382  C  CB  . ARG C  1 136 ? 33.937  36.132  133.465 1.00 42.30  ? 136  ARG C CB  1 
ATOM   5383  C  CG  . ARG C  1 136 ? 35.119  35.376  134.057 1.00 49.61  ? 136  ARG C CG  1 
ATOM   5384  C  CD  . ARG C  1 136 ? 34.690  34.148  134.889 1.00 52.71  ? 136  ARG C CD  1 
ATOM   5385  N  NE  . ARG C  1 136 ? 35.258  34.173  136.244 1.00 54.17  ? 136  ARG C NE  1 
ATOM   5386  C  CZ  . ARG C  1 136 ? 36.559  34.290  136.523 1.00 55.19  ? 136  ARG C CZ  1 
ATOM   5387  N  NH1 . ARG C  1 136 ? 37.445  34.392  135.538 1.00 51.30  ? 136  ARG C NH1 1 
ATOM   5388  N  NH2 . ARG C  1 136 ? 36.976  34.325  137.791 1.00 53.08  ? 136  ARG C NH2 1 
ATOM   5389  N  N   . VAL C  1 137 ? 31.660  37.223  131.682 1.00 38.33  ? 137  VAL C N   1 
ATOM   5390  C  CA  . VAL C  1 137 ? 30.255  37.540  131.485 1.00 38.51  ? 137  VAL C CA  1 
ATOM   5391  C  C   . VAL C  1 137 ? 29.672  36.789  130.285 1.00 38.76  ? 137  VAL C C   1 
ATOM   5392  O  O   . VAL C  1 137 ? 28.532  36.342  130.334 1.00 41.24  ? 137  VAL C O   1 
ATOM   5393  C  CB  . VAL C  1 137 ? 30.067  39.057  131.300 1.00 37.21  ? 137  VAL C CB  1 
ATOM   5394  C  CG1 . VAL C  1 137 ? 28.698  39.371  130.724 1.00 30.37  ? 137  VAL C CG1 1 
ATOM   5395  C  CG2 . VAL C  1 137 ? 30.253  39.742  132.642 1.00 36.46  ? 137  VAL C CG2 1 
ATOM   5396  N  N   . LEU C  1 138 ? 30.449  36.636  129.217 1.00 38.49  ? 138  LEU C N   1 
ATOM   5397  C  CA  . LEU C  1 138 ? 29.973  35.921  128.031 1.00 37.63  ? 138  LEU C CA  1 
ATOM   5398  C  C   . LEU C  1 138 ? 29.996  34.415  128.263 1.00 39.35  ? 138  LEU C C   1 
ATOM   5399  O  O   . LEU C  1 138 ? 29.197  33.681  127.682 1.00 40.11  ? 138  LEU C O   1 
ATOM   5400  C  CB  . LEU C  1 138 ? 30.826  36.259  126.803 1.00 34.47  ? 138  LEU C CB  1 
ATOM   5401  C  CG  . LEU C  1 138 ? 30.927  37.732  126.394 1.00 33.79  ? 138  LEU C CG  1 
ATOM   5402  C  CD1 . LEU C  1 138 ? 31.739  37.864  125.107 1.00 28.09  ? 138  LEU C CD1 1 
ATOM   5403  C  CD2 . LEU C  1 138 ? 29.527  38.310  126.223 1.00 33.86  ? 138  LEU C CD2 1 
ATOM   5404  N  N   . GLU C  1 139 ? 30.927  33.948  129.091 1.00 41.14  ? 139  GLU C N   1 
ATOM   5405  C  CA  . GLU C  1 139 ? 30.995  32.523  129.405 1.00 43.49  ? 139  GLU C CA  1 
ATOM   5406  C  C   . GLU C  1 139 ? 29.697  32.214  130.142 1.00 41.89  ? 139  GLU C C   1 
ATOM   5407  O  O   . GLU C  1 139 ? 29.028  31.225  129.873 1.00 41.34  ? 139  GLU C O   1 
ATOM   5408  C  CB  . GLU C  1 139 ? 32.157  32.216  130.352 1.00 47.97  ? 139  GLU C CB  1 
ATOM   5409  C  CG  . GLU C  1 139 ? 33.551  32.300  129.773 1.00 58.16  ? 139  GLU C CG  1 
ATOM   5410  C  CD  . GLU C  1 139 ? 34.622  32.136  130.854 1.00 64.62  ? 139  GLU C CD  1 
ATOM   5411  O  OE1 . GLU C  1 139 ? 34.474  31.223  131.703 1.00 66.46  ? 139  GLU C OE1 1 
ATOM   5412  O  OE2 . GLU C  1 139 ? 35.610  32.914  130.855 1.00 67.22  ? 139  GLU C OE2 1 
ATOM   5413  N  N   . ALA C  1 140 ? 29.366  33.086  131.088 1.00 41.43  ? 140  ALA C N   1 
ATOM   5414  C  CA  . ALA C  1 140 ? 28.170  32.953  131.896 1.00 41.58  ? 140  ALA C CA  1 
ATOM   5415  C  C   . ALA C  1 140 ? 26.922  33.006  131.025 1.00 42.89  ? 140  ALA C C   1 
ATOM   5416  O  O   . ALA C  1 140 ? 25.847  32.582  131.447 1.00 45.91  ? 140  ALA C O   1 
ATOM   5417  C  CB  . ALA C  1 140 ? 28.128  34.057  132.945 1.00 39.00  ? 140  ALA C CB  1 
ATOM   5418  N  N   . ALA C  1 141 ? 27.063  33.527  129.810 1.00 42.16  ? 141  ALA C N   1 
ATOM   5419  C  CA  . ALA C  1 141 ? 25.935  33.619  128.892 1.00 40.00  ? 141  ALA C CA  1 
ATOM   5420  C  C   . ALA C  1 141 ? 25.800  32.329  128.079 1.00 42.17  ? 141  ALA C C   1 
ATOM   5421  O  O   . ALA C  1 141 ? 24.692  31.842  127.857 1.00 43.33  ? 141  ALA C O   1 
ATOM   5422  C  CB  . ALA C  1 141 ? 26.115  34.796  127.975 1.00 37.67  ? 141  ALA C CB  1 
ATOM   5423  N  N   . VAL C  1 142 ? 26.917  31.766  127.635 1.00 42.30  ? 142  VAL C N   1 
ATOM   5424  C  CA  . VAL C  1 142 ? 26.848  30.532  126.867 1.00 46.46  ? 142  VAL C CA  1 
ATOM   5425  C  C   . VAL C  1 142 ? 26.334  29.397  127.757 1.00 48.83  ? 142  VAL C C   1 
ATOM   5426  O  O   . VAL C  1 142 ? 25.475  28.614  127.348 1.00 51.89  ? 142  VAL C O   1 
ATOM   5427  C  CB  . VAL C  1 142 ? 28.229  30.143  126.286 1.00 48.30  ? 142  VAL C CB  1 
ATOM   5428  C  CG1 . VAL C  1 142 ? 28.828  31.321  125.538 1.00 48.81  ? 142  VAL C CG1 1 
ATOM   5429  C  CG2 . VAL C  1 142 ? 29.159  29.693  127.386 1.00 50.55  ? 142  VAL C CG2 1 
ATOM   5430  N  N   . ALA C  1 143 ? 26.847  29.327  128.981 1.00 50.39  ? 143  ALA C N   1 
ATOM   5431  C  CA  . ALA C  1 143 ? 26.450  28.298  129.935 1.00 52.64  ? 143  ALA C CA  1 
ATOM   5432  C  C   . ALA C  1 143 ? 24.955  28.382  130.246 1.00 54.56  ? 143  ALA C C   1 
ATOM   5433  O  O   . ALA C  1 143 ? 24.347  27.413  130.699 1.00 55.79  ? 143  ALA C O   1 
ATOM   5434  C  CB  . ALA C  1 143 ? 27.267  28.439  131.214 1.00 51.47  ? 143  ALA C CB  1 
ATOM   5435  N  N   . ALA C  1 144 ? 24.371  29.551  130.014 1.00 55.70  ? 144  ALA C N   1 
ATOM   5436  C  CA  . ALA C  1 144 ? 22.945  29.741  130.237 1.00 57.60  ? 144  ALA C CA  1 
ATOM   5437  C  C   . ALA C  1 144 ? 22.242  29.337  128.945 1.00 60.74  ? 144  ALA C C   1 
ATOM   5438  O  O   . ALA C  1 144 ? 21.062  29.637  128.730 1.00 60.90  ? 144  ALA C O   1 
ATOM   5439  C  CB  . ALA C  1 144 ? 22.649  31.191  130.571 1.00 55.48  ? 144  ALA C CB  1 
ATOM   5440  N  N   . LYS C  1 145 ? 22.996  28.659  128.082 1.00 63.11  ? 145  LYS C N   1 
ATOM   5441  C  CA  . LYS C  1 145 ? 22.493  28.172  126.801 1.00 64.09  ? 145  LYS C CA  1 
ATOM   5442  C  C   . LYS C  1 145 ? 22.112  29.294  125.823 1.00 62.79  ? 145  LYS C C   1 
ATOM   5443  O  O   . LYS C  1 145 ? 21.617  29.017  124.729 1.00 64.10  ? 145  LYS C O   1 
ATOM   5444  C  CB  . LYS C  1 145 ? 21.281  27.259  127.032 1.00 65.13  ? 145  LYS C CB  1 
ATOM   5445  C  CG  . LYS C  1 145 ? 21.424  26.269  128.195 1.00 67.80  ? 145  LYS C CG  1 
ATOM   5446  C  CD  . LYS C  1 145 ? 22.379  25.110  127.906 1.00 69.70  ? 145  LYS C CD  1 
ATOM   5447  C  CE  . LYS C  1 145 ? 22.367  24.114  129.075 1.00 72.30  ? 145  LYS C CE  1 
ATOM   5448  N  NZ  . LYS C  1 145 ? 23.208  22.891  128.883 1.00 72.21  ? 145  LYS C NZ  1 
ATOM   5449  N  N   . LYS C  1 146 ? 22.330  30.550  126.208 1.00 59.51  ? 146  LYS C N   1 
ATOM   5450  C  CA  . LYS C  1 146 ? 22.010  31.675  125.327 1.00 57.45  ? 146  LYS C CA  1 
ATOM   5451  C  C   . LYS C  1 146 ? 22.829  31.613  124.028 1.00 57.60  ? 146  LYS C C   1 
ATOM   5452  O  O   . LYS C  1 146 ? 23.978  31.157  124.019 1.00 58.33  ? 146  LYS C O   1 
ATOM   5453  C  CB  . LYS C  1 146 ? 22.305  33.014  126.016 1.00 55.49  ? 146  LYS C CB  1 
ATOM   5454  C  CG  . LYS C  1 146 ? 21.493  33.333  127.261 1.00 55.33  ? 146  LYS C CG  1 
ATOM   5455  C  CD  . LYS C  1 146 ? 21.924  34.689  127.794 1.00 59.39  ? 146  LYS C CD  1 
ATOM   5456  C  CE  . LYS C  1 146 ? 21.383  34.990  129.186 1.00 63.35  ? 146  LYS C CE  1 
ATOM   5457  N  NZ  . LYS C  1 146 ? 19.918  35.245  129.214 1.00 65.20  ? 146  LYS C NZ  1 
ATOM   5458  N  N   . ARG C  1 147 ? 22.236  32.070  122.930 1.00 55.30  ? 147  ARG C N   1 
ATOM   5459  C  CA  . ARG C  1 147 ? 22.929  32.090  121.653 1.00 53.83  ? 147  ARG C CA  1 
ATOM   5460  C  C   . ARG C  1 147 ? 23.115  33.535  121.225 1.00 51.35  ? 147  ARG C C   1 
ATOM   5461  O  O   . ARG C  1 147 ? 22.147  34.291  121.165 1.00 50.30  ? 147  ARG C O   1 
ATOM   5462  C  CB  . ARG C  1 147 ? 22.137  31.348  120.577 1.00 56.82  ? 147  ARG C CB  1 
ATOM   5463  C  CG  . ARG C  1 147 ? 22.061  29.846  120.763 1.00 62.84  ? 147  ARG C CG  1 
ATOM   5464  C  CD  . ARG C  1 147 ? 20.632  29.422  121.054 1.00 68.24  ? 147  ARG C CD  1 
ATOM   5465  N  NE  . ARG C  1 147 ? 19.705  30.005  120.086 1.00 72.37  ? 147  ARG C NE  1 
ATOM   5466  C  CZ  . ARG C  1 147 ? 18.381  29.976  120.202 1.00 74.41  ? 147  ARG C CZ  1 
ATOM   5467  N  NH1 . ARG C  1 147 ? 17.820  29.383  121.251 1.00 74.88  ? 147  ARG C NH1 1 
ATOM   5468  N  NH2 . ARG C  1 147 ? 17.620  30.555  119.275 1.00 72.31  ? 147  ARG C NH2 1 
ATOM   5469  N  N   . PHE C  1 148 ? 24.366  33.908  120.946 1.00 48.59  ? 148  PHE C N   1 
ATOM   5470  C  CA  . PHE C  1 148 ? 24.716  35.257  120.507 1.00 43.86  ? 148  PHE C CA  1 
ATOM   5471  C  C   . PHE C  1 148 ? 26.008  35.187  119.706 1.00 41.96  ? 148  PHE C C   1 
ATOM   5472  O  O   . PHE C  1 148 ? 26.688  34.166  119.704 1.00 45.23  ? 148  PHE C O   1 
ATOM   5473  C  CB  . PHE C  1 148 ? 24.923  36.177  121.711 1.00 46.01  ? 148  PHE C CB  1 
ATOM   5474  C  CG  . PHE C  1 148 ? 26.035  35.737  122.623 1.00 48.15  ? 148  PHE C CG  1 
ATOM   5475  C  CD1 . PHE C  1 148 ? 25.859  34.665  123.495 1.00 46.83  ? 148  PHE C CD1 1 
ATOM   5476  C  CD2 . PHE C  1 148 ? 27.278  36.367  122.580 1.00 47.90  ? 148  PHE C CD2 1 
ATOM   5477  C  CE1 . PHE C  1 148 ? 26.900  34.229  124.303 1.00 43.69  ? 148  PHE C CE1 1 
ATOM   5478  C  CE2 . PHE C  1 148 ? 28.324  35.935  123.385 1.00 44.56  ? 148  PHE C CE2 1 
ATOM   5479  C  CZ  . PHE C  1 148 ? 28.134  34.866  124.246 1.00 45.35  ? 148  PHE C CZ  1 
ATOM   5480  N  N   . SER C  1 149 ? 26.338  36.265  119.005 1.00 38.66  ? 149  SER C N   1 
ATOM   5481  C  CA  . SER C  1 149 ? 27.572  36.308  118.225 1.00 36.85  ? 149  SER C CA  1 
ATOM   5482  C  C   . SER C  1 149 ? 28.294  37.597  118.589 1.00 31.77  ? 149  SER C C   1 
ATOM   5483  O  O   . SER C  1 149 ? 27.656  38.551  119.034 1.00 30.08  ? 149  SER C O   1 
ATOM   5484  C  CB  . SER C  1 149 ? 27.290  36.223  116.718 1.00 31.20  ? 149  SER C CB  1 
ATOM   5485  O  OG  . SER C  1 149 ? 26.276  37.121  116.335 1.00 31.21  ? 149  SER C OG  1 
ATOM   5486  N  N   . VAL C  1 150 ? 29.614  37.612  118.404 1.00 27.32  ? 150  VAL C N   1 
ATOM   5487  C  CA  . VAL C  1 150 ? 30.440  38.757  118.781 1.00 26.77  ? 150  VAL C CA  1 
ATOM   5488  C  C   . VAL C  1 150 ? 31.343  39.390  117.712 1.00 25.96  ? 150  VAL C C   1 
ATOM   5489  O  O   . VAL C  1 150 ? 31.797  38.739  116.763 1.00 24.75  ? 150  VAL C O   1 
ATOM   5490  C  CB  . VAL C  1 150 ? 31.356  38.370  119.988 1.00 29.46  ? 150  VAL C CB  1 
ATOM   5491  C  CG1 . VAL C  1 150 ? 32.181  39.572  120.451 1.00 31.36  ? 150  VAL C CG1 1 
ATOM   5492  C  CG2 . VAL C  1 150 ? 30.519  37.840  121.140 1.00 29.52  ? 150  VAL C CG2 1 
ATOM   5493  N  N   . TYR C  1 151 ? 31.591  40.682  117.894 1.00 24.81  ? 151  TYR C N   1 
ATOM   5494  C  CA  . TYR C  1 151 ? 32.473  41.464  117.039 1.00 24.74  ? 151  TYR C CA  1 
ATOM   5495  C  C   . TYR C  1 151 ? 33.499  42.073  117.975 1.00 24.86  ? 151  TYR C C   1 
ATOM   5496  O  O   . TYR C  1 151 ? 33.149  42.680  118.995 1.00 22.22  ? 151  TYR C O   1 
ATOM   5497  C  CB  . TYR C  1 151 ? 31.732  42.606  116.346 1.00 29.34  ? 151  TYR C CB  1 
ATOM   5498  C  CG  . TYR C  1 151 ? 31.058  42.226  115.065 1.00 30.94  ? 151  TYR C CG  1 
ATOM   5499  C  CD1 . TYR C  1 151 ? 31.804  41.947  113.927 1.00 32.59  ? 151  TYR C CD1 1 
ATOM   5500  C  CD2 . TYR C  1 151 ? 29.671  42.132  114.987 1.00 34.53  ? 151  TYR C CD2 1 
ATOM   5501  C  CE1 . TYR C  1 151 ? 31.190  41.582  112.741 1.00 34.88  ? 151  TYR C CE1 1 
ATOM   5502  C  CE2 . TYR C  1 151 ? 29.040  41.764  113.790 1.00 36.09  ? 151  TYR C CE2 1 
ATOM   5503  C  CZ  . TYR C  1 151 ? 29.808  41.491  112.674 1.00 34.44  ? 151  TYR C CZ  1 
ATOM   5504  O  OH  . TYR C  1 151 ? 29.202  41.138  111.485 1.00 35.13  ? 151  TYR C OH  1 
ATOM   5505  N  N   . VAL C  1 152 ? 34.767  41.903  117.634 1.00 24.29  ? 152  VAL C N   1 
ATOM   5506  C  CA  . VAL C  1 152 ? 35.833  42.455  118.444 1.00 23.00  ? 152  VAL C CA  1 
ATOM   5507  C  C   . VAL C  1 152 ? 36.932  43.059  117.559 1.00 25.48  ? 152  VAL C C   1 
ATOM   5508  O  O   . VAL C  1 152 ? 37.366  42.459  116.552 1.00 23.94  ? 152  VAL C O   1 
ATOM   5509  C  CB  . VAL C  1 152 ? 36.462  41.364  119.368 1.00 23.97  ? 152  VAL C CB  1 
ATOM   5510  C  CG1 . VAL C  1 152 ? 37.152  40.275  118.530 1.00 17.45  ? 152  VAL C CG1 1 
ATOM   5511  C  CG2 . VAL C  1 152 ? 37.470  42.008  120.311 1.00 20.87  ? 152  VAL C CG2 1 
ATOM   5512  N  N   . THR C  1 153 ? 37.360  44.257  117.942 1.00 24.87  ? 153  THR C N   1 
ATOM   5513  C  CA  . THR C  1 153 ? 38.434  44.978  117.255 1.00 27.79  ? 153  THR C CA  1 
ATOM   5514  C  C   . THR C  1 153 ? 39.723  44.223  117.558 1.00 29.07  ? 153  THR C C   1 
ATOM   5515  O  O   . THR C  1 153 ? 39.881  43.719  118.664 1.00 27.94  ? 153  THR C O   1 
ATOM   5516  C  CB  . THR C  1 153 ? 38.593  46.379  117.841 1.00 29.82  ? 153  THR C CB  1 
ATOM   5517  O  OG1 . THR C  1 153 ? 38.686  46.264  119.273 1.00 24.45  ? 153  THR C OG1 1 
ATOM   5518  C  CG2 . THR C  1 153 ? 37.421  47.284  117.437 1.00 17.19  ? 153  THR C CG2 1 
ATOM   5519  N  N   . GLU C  1 154 ? 40.646  44.150  116.603 1.00 32.37  ? 154  GLU C N   1 
ATOM   5520  C  CA  . GLU C  1 154 ? 41.894  43.433  116.856 1.00 36.51  ? 154  GLU C CA  1 
ATOM   5521  C  C   . GLU C  1 154 ? 42.713  44.137  117.938 1.00 37.50  ? 154  GLU C C   1 
ATOM   5522  O  O   . GLU C  1 154 ? 43.515  43.518  118.635 1.00 39.30  ? 154  GLU C O   1 
ATOM   5523  C  CB  . GLU C  1 154 ? 42.711  43.277  115.572 1.00 38.55  ? 154  GLU C CB  1 
ATOM   5524  C  CG  . GLU C  1 154 ? 43.063  44.560  114.858 1.00 38.98  ? 154  GLU C CG  1 
ATOM   5525  C  CD  . GLU C  1 154 ? 44.135  44.333  113.800 1.00 43.27  ? 154  GLU C CD  1 
ATOM   5526  O  OE1 . GLU C  1 154 ? 44.049  43.310  113.069 1.00 41.40  ? 154  GLU C OE1 1 
ATOM   5527  O  OE2 . GLU C  1 154 ? 45.057  45.178  113.700 1.00 42.40  ? 154  GLU C OE2 1 
ATOM   5528  N  N   . SER C  1 155 ? 42.488  45.436  118.073 1.00 37.37  ? 155  SER C N   1 
ATOM   5529  C  CA  . SER C  1 155 ? 43.135  46.264  119.091 1.00 37.03  ? 155  SER C CA  1 
ATOM   5530  C  C   . SER C  1 155 ? 44.665  46.464  119.067 1.00 36.45  ? 155  SER C C   1 
ATOM   5531  O  O   . SER C  1 155 ? 45.388  45.914  119.912 1.00 33.81  ? 155  SER C O   1 
ATOM   5532  C  CB  . SER C  1 155 ? 42.714  45.778  120.480 1.00 33.98  ? 155  SER C CB  1 
ATOM   5533  O  OG  . SER C  1 155 ? 42.912  46.794  121.446 1.00 33.14  ? 155  SER C OG  1 
ATOM   5534  N  N   . GLN C  1 156 ? 45.141  47.270  118.113 1.00 32.26  ? 156  GLN C N   1 
ATOM   5535  C  CA  . GLN C  1 156 ? 46.562  47.588  118.011 1.00 30.59  ? 156  GLN C CA  1 
ATOM   5536  C  C   . GLN C  1 156 ? 46.969  48.223  119.342 1.00 32.76  ? 156  GLN C C   1 
ATOM   5537  O  O   . GLN C  1 156 ? 46.146  48.846  120.025 1.00 31.00  ? 156  GLN C O   1 
ATOM   5538  C  CB  . GLN C  1 156 ? 46.830  48.592  116.881 1.00 23.62  ? 156  GLN C CB  1 
ATOM   5539  C  CG  . GLN C  1 156 ? 46.650  48.061  115.457 1.00 22.46  ? 156  GLN C CG  1 
ATOM   5540  C  CD  . GLN C  1 156 ? 47.729  47.057  115.018 1.00 23.48  ? 156  GLN C CD  1 
ATOM   5541  O  OE1 . GLN C  1 156 ? 48.788  46.944  115.641 1.00 27.93  ? 156  GLN C OE1 1 
ATOM   5542  N  NE2 . GLN C  1 156 ? 47.463  46.341  113.932 1.00 17.45  ? 156  GLN C NE2 1 
ATOM   5543  N  N   . PRO C  1 157 ? 48.262  48.130  119.698 1.00 34.39  ? 157  PRO C N   1 
ATOM   5544  C  CA  . PRO C  1 157 ? 49.337  47.481  118.939 1.00 34.50  ? 157  PRO C CA  1 
ATOM   5545  C  C   . PRO C  1 157 ? 49.624  46.010  119.307 1.00 37.61  ? 157  PRO C C   1 
ATOM   5546  O  O   . PRO C  1 157 ? 50.269  45.274  118.545 1.00 36.93  ? 157  PRO C O   1 
ATOM   5547  C  CB  . PRO C  1 157 ? 50.514  48.384  119.241 1.00 28.24  ? 157  PRO C CB  1 
ATOM   5548  C  CG  . PRO C  1 157 ? 50.304  48.654  120.698 1.00 28.30  ? 157  PRO C CG  1 
ATOM   5549  C  CD  . PRO C  1 157 ? 48.824  48.939  120.797 1.00 31.26  ? 157  PRO C CD  1 
ATOM   5550  N  N   . ASP C  1 158 ? 49.149  45.585  120.472 1.00 36.63  ? 158  ASP C N   1 
ATOM   5551  C  CA  . ASP C  1 158 ? 49.386  44.219  120.936 1.00 35.92  ? 158  ASP C CA  1 
ATOM   5552  C  C   . ASP C  1 158 ? 48.420  43.149  120.404 1.00 32.87  ? 158  ASP C C   1 
ATOM   5553  O  O   . ASP C  1 158 ? 48.617  41.964  120.675 1.00 29.25  ? 158  ASP C O   1 
ATOM   5554  C  CB  . ASP C  1 158 ? 49.381  44.196  122.466 1.00 36.22  ? 158  ASP C CB  1 
ATOM   5555  C  CG  . ASP C  1 158 ? 48.088  44.744  123.054 1.00 42.14  ? 158  ASP C CG  1 
ATOM   5556  O  OD1 . ASP C  1 158 ? 47.239  45.232  122.276 1.00 42.56  ? 158  ASP C OD1 1 
ATOM   5557  O  OD2 . ASP C  1 158 ? 47.920  44.693  124.295 1.00 46.84  ? 158  ASP C OD2 1 
ATOM   5558  N  N   . LEU C  1 159 ? 47.392  43.566  119.661 1.00 28.46  ? 159  LEU C N   1 
ATOM   5559  C  CA  . LEU C  1 159 ? 46.394  42.652  119.101 1.00 28.78  ? 159  LEU C CA  1 
ATOM   5560  C  C   . LEU C  1 159 ? 45.670  41.782  120.145 1.00 28.43  ? 159  LEU C C   1 
ATOM   5561  O  O   . LEU C  1 159 ? 45.328  40.635  119.880 1.00 28.40  ? 159  LEU C O   1 
ATOM   5562  C  CB  . LEU C  1 159 ? 47.042  41.750  118.044 1.00 29.33  ? 159  LEU C CB  1 
ATOM   5563  C  CG  . LEU C  1 159 ? 47.808  42.478  116.926 1.00 36.05  ? 159  LEU C CG  1 
ATOM   5564  C  CD1 . LEU C  1 159 ? 48.587  41.471  116.086 1.00 31.09  ? 159  LEU C CD1 1 
ATOM   5565  C  CD2 . LEU C  1 159 ? 46.842  43.295  116.056 1.00 33.94  ? 159  LEU C CD2 1 
ATOM   5566  N  N   . SER C  1 160 ? 45.429  42.336  121.326 1.00 30.42  ? 160  SER C N   1 
ATOM   5567  C  CA  . SER C  1 160 ? 44.751  41.608  122.396 1.00 31.37  ? 160  SER C CA  1 
ATOM   5568  C  C   . SER C  1 160 ? 43.326  41.220  122.006 1.00 32.83  ? 160  SER C C   1 
ATOM   5569  O  O   . SER C  1 160 ? 42.752  40.300  122.589 1.00 32.03  ? 160  SER C O   1 
ATOM   5570  C  CB  . SER C  1 160 ? 44.716  42.451  123.672 1.00 31.07  ? 160  SER C CB  1 
ATOM   5571  O  OG  . SER C  1 160 ? 44.026  43.671  123.466 1.00 34.57  ? 160  SER C OG  1 
ATOM   5572  N  N   . GLY C  1 161 ? 42.755  41.938  121.034 1.00 31.72  ? 161  GLY C N   1 
ATOM   5573  C  CA  . GLY C  1 161 ? 41.417  41.623  120.570 1.00 27.20  ? 161  GLY C CA  1 
ATOM   5574  C  C   . GLY C  1 161 ? 41.454  40.270  119.877 1.00 28.70  ? 161  GLY C C   1 
ATOM   5575  O  O   . GLY C  1 161 ? 40.528  39.469  120.000 1.00 29.20  ? 161  GLY C O   1 
ATOM   5576  N  N   . LYS C  1 162 ? 42.529  40.005  119.139 1.00 27.55  ? 162  LYS C N   1 
ATOM   5577  C  CA  . LYS C  1 162 ? 42.663  38.726  118.456 1.00 29.05  ? 162  LYS C CA  1 
ATOM   5578  C  C   . LYS C  1 162 ? 42.778  37.583  119.461 1.00 30.25  ? 162  LYS C C   1 
ATOM   5579  O  O   . LYS C  1 162 ? 42.363  36.451  119.170 1.00 25.27  ? 162  LYS C O   1 
ATOM   5580  C  CB  . LYS C  1 162 ? 43.890  38.710  117.544 1.00 31.75  ? 162  LYS C CB  1 
ATOM   5581  C  CG  . LYS C  1 162 ? 43.679  39.345  116.181 1.00 41.04  ? 162  LYS C CG  1 
ATOM   5582  C  CD  . LYS C  1 162 ? 44.838  39.007  115.246 1.00 42.99  ? 162  LYS C CD  1 
ATOM   5583  C  CE  . LYS C  1 162 ? 44.577  39.494  113.829 1.00 46.20  ? 162  LYS C CE  1 
ATOM   5584  N  NZ  . LYS C  1 162 ? 45.670  39.106  112.886 1.00 45.68  ? 162  LYS C NZ  1 
ATOM   5585  N  N   . LYS C  1 163 ? 43.335  37.870  120.641 1.00 26.90  ? 163  LYS C N   1 
ATOM   5586  C  CA  . LYS C  1 163 ? 43.468  36.826  121.644 1.00 31.18  ? 163  LYS C CA  1 
ATOM   5587  C  C   . LYS C  1 163 ? 42.097  36.566  122.223 1.00 34.03  ? 163  LYS C C   1 
ATOM   5588  O  O   . LYS C  1 163 ? 41.760  35.414  122.544 1.00 32.75  ? 163  LYS C O   1 
ATOM   5589  C  CB  . LYS C  1 163 ? 44.416  37.227  122.772 1.00 33.65  ? 163  LYS C CB  1 
ATOM   5590  C  CG  . LYS C  1 163 ? 44.557  36.137  123.836 1.00 35.90  ? 163  LYS C CG  1 
ATOM   5591  C  CD  . LYS C  1 163 ? 45.138  36.680  125.139 1.00 38.82  ? 163  LYS C CD  1 
ATOM   5592  C  CE  . LYS C  1 163 ? 46.569  37.161  124.971 1.00 38.11  ? 163  LYS C CE  1 
ATOM   5593  N  NZ  . LYS C  1 163 ? 46.991  37.986  126.135 1.00 40.70  ? 163  LYS C NZ  1 
HETATM 5594  N  N   . MSE C  1 164 ? 41.319  37.646  122.364 1.00 33.92  ? 164  MSE C N   1 
HETATM 5595  C  CA  . MSE C  1 164 ? 39.956  37.568  122.886 1.00 34.55  ? 164  MSE C CA  1 
HETATM 5596  C  C   . MSE C  1 164 ? 39.156  36.670  121.942 1.00 36.76  ? 164  MSE C C   1 
HETATM 5597  O  O   . MSE C  1 164 ? 38.417  35.770  122.380 1.00 33.16  ? 164  MSE C O   1 
HETATM 5598  C  CB  . MSE C  1 164 ? 39.322  38.959  122.926 1.00 38.06  ? 164  MSE C CB  1 
HETATM 5599  C  CG  . MSE C  1 164 ? 37.917  38.997  123.527 1.00 44.64  ? 164  MSE C CG  1 
HETATM 5600  SE SE  . MSE C  1 164 ? 37.860  38.802  125.472 1.00 57.78  ? 164  MSE C SE  1 
HETATM 5601  C  CE  . MSE C  1 164 ? 36.070  39.498  125.793 1.00 50.51  ? 164  MSE C CE  1 
ATOM   5602  N  N   . ALA C  1 165 ? 39.328  36.920  120.642 1.00 35.09  ? 165  ALA C N   1 
ATOM   5603  C  CA  . ALA C  1 165 ? 38.655  36.155  119.603 1.00 36.35  ? 165  ALA C CA  1 
ATOM   5604  C  C   . ALA C  1 165 ? 38.888  34.649  119.754 1.00 35.91  ? 165  ALA C C   1 
ATOM   5605  O  O   . ALA C  1 165 ? 37.922  33.885  119.772 1.00 34.90  ? 165  ALA C O   1 
ATOM   5606  C  CB  . ALA C  1 165 ? 39.116  36.624  118.232 1.00 37.35  ? 165  ALA C CB  1 
ATOM   5607  N  N   . LYS C  1 166 ? 40.154  34.229  119.875 1.00 34.48  ? 166  LYS C N   1 
ATOM   5608  C  CA  . LYS C  1 166 ? 40.489  32.803  120.028 1.00 33.47  ? 166  LYS C CA  1 
ATOM   5609  C  C   . LYS C  1 166 ? 39.812  32.163  121.242 1.00 30.53  ? 166  LYS C C   1 
ATOM   5610  O  O   . LYS C  1 166 ? 39.380  31.015  121.187 1.00 27.20  ? 166  LYS C O   1 
ATOM   5611  C  CB  . LYS C  1 166 ? 42.006  32.612  120.129 1.00 35.03  ? 166  LYS C CB  1 
ATOM   5612  C  CG  . LYS C  1 166 ? 42.755  32.864  118.815 1.00 41.45  ? 166  LYS C CG  1 
ATOM   5613  C  CD  . LYS C  1 166 ? 44.242  33.222  119.024 1.00 43.76  ? 166  LYS C CD  1 
ATOM   5614  C  CE  . LYS C  1 166 ? 44.902  33.672  117.708 1.00 46.18  ? 166  LYS C CE  1 
ATOM   5615  N  NZ  . LYS C  1 166 ? 46.192  34.422  117.907 1.00 45.57  ? 166  LYS C NZ  1 
ATOM   5616  N  N   . ALA C  1 167 ? 39.697  32.920  122.326 1.00 27.25  ? 167  ALA C N   1 
ATOM   5617  C  CA  . ALA C  1 167 ? 39.077  32.411  123.532 1.00 27.21  ? 167  ALA C CA  1 
ATOM   5618  C  C   . ALA C  1 167 ? 37.550  32.280  123.408 1.00 32.07  ? 167  ALA C C   1 
ATOM   5619  O  O   . ALA C  1 167 ? 36.952  31.336  123.941 1.00 34.28  ? 167  ALA C O   1 
ATOM   5620  C  CB  . ALA C  1 167 ? 39.442  33.290  124.700 1.00 21.04  ? 167  ALA C CB  1 
ATOM   5621  N  N   . LEU C  1 168 ? 36.906  33.223  122.728 1.00 32.26  ? 168  LEU C N   1 
ATOM   5622  C  CA  . LEU C  1 168 ? 35.467  33.110  122.557 1.00 31.38  ? 168  LEU C CA  1 
ATOM   5623  C  C   . LEU C  1 168 ? 35.253  32.002  121.519 1.00 32.90  ? 168  LEU C C   1 
ATOM   5624  O  O   . LEU C  1 168 ? 34.253  31.275  121.536 1.00 28.50  ? 168  LEU C O   1 
ATOM   5625  C  CB  . LEU C  1 168 ? 34.875  34.434  122.068 1.00 30.11  ? 168  LEU C CB  1 
ATOM   5626  C  CG  . LEU C  1 168 ? 34.864  35.596  123.064 1.00 29.75  ? 168  LEU C CG  1 
ATOM   5627  C  CD1 . LEU C  1 168 ? 34.450  36.867  122.363 1.00 25.63  ? 168  LEU C CD1 1 
ATOM   5628  C  CD2 . LEU C  1 168 ? 33.930  35.281  124.214 1.00 24.86  ? 168  LEU C CD2 1 
ATOM   5629  N  N   . CYS C  1 169 ? 36.218  31.868  120.621 1.00 33.86  ? 169  CYS C N   1 
ATOM   5630  C  CA  . CYS C  1 169 ? 36.131  30.847  119.597 1.00 37.71  ? 169  CYS C CA  1 
ATOM   5631  C  C   . CYS C  1 169 ? 36.158  29.472  120.250 1.00 41.18  ? 169  CYS C C   1 
ATOM   5632  O  O   . CYS C  1 169 ? 35.506  28.537  119.770 1.00 42.38  ? 169  CYS C O   1 
ATOM   5633  C  CB  . CYS C  1 169 ? 37.287  30.970  118.617 1.00 36.46  ? 169  CYS C CB  1 
ATOM   5634  S  SG  . CYS C  1 169 ? 37.166  29.763  117.292 1.00 49.85  ? 169  CYS C SG  1 
ATOM   5635  N  N   . HIS C  1 170 ? 36.915  29.351  121.344 1.00 40.79  ? 170  HIS C N   1 
ATOM   5636  C  CA  . HIS C  1 170 ? 37.013  28.090  122.068 1.00 39.96  ? 170  HIS C CA  1 
ATOM   5637  C  C   . HIS C  1 170 ? 35.759  27.788  122.890 1.00 38.75  ? 170  HIS C C   1 
ATOM   5638  O  O   . HIS C  1 170 ? 35.587  26.683  123.390 1.00 37.69  ? 170  HIS C O   1 
ATOM   5639  C  CB  . HIS C  1 170 ? 38.270  28.077  122.950 1.00 40.54  ? 170  HIS C CB  1 
ATOM   5640  C  CG  . HIS C  1 170 ? 39.524  27.793  122.185 1.00 46.26  ? 170  HIS C CG  1 
ATOM   5641  N  ND1 . HIS C  1 170 ? 40.524  28.727  122.015 1.00 50.04  ? 170  HIS C ND1 1 
ATOM   5642  C  CD2 . HIS C  1 170 ? 39.902  26.704  121.473 1.00 47.14  ? 170  HIS C CD2 1 
ATOM   5643  C  CE1 . HIS C  1 170 ? 41.461  28.229  121.227 1.00 51.33  ? 170  HIS C CE1 1 
ATOM   5644  N  NE2 . HIS C  1 170 ? 41.107  27.002  120.884 1.00 49.95  ? 170  HIS C NE2 1 
ATOM   5645  N  N   . LEU C  1 171 ? 34.892  28.782  123.039 1.00 39.27  ? 171  LEU C N   1 
ATOM   5646  C  CA  . LEU C  1 171 ? 33.623  28.605  123.748 1.00 39.76  ? 171  LEU C CA  1 
ATOM   5647  C  C   . LEU C  1 171 ? 32.632  28.463  122.596 1.00 39.48  ? 171  LEU C C   1 
ATOM   5648  O  O   . LEU C  1 171 ? 31.428  28.409  122.793 1.00 35.79  ? 171  LEU C O   1 
ATOM   5649  C  CB  . LEU C  1 171 ? 33.270  29.870  124.539 1.00 36.57  ? 171  LEU C CB  1 
ATOM   5650  C  CG  . LEU C  1 171 ? 34.249  30.401  125.590 1.00 38.20  ? 171  LEU C CG  1 
ATOM   5651  C  CD1 . LEU C  1 171 ? 33.824  31.786  126.032 1.00 35.06  ? 171  LEU C CD1 1 
ATOM   5652  C  CD2 . LEU C  1 171 ? 34.290  29.453  126.785 1.00 38.77  ? 171  LEU C CD2 1 
ATOM   5653  N  N   . ASN C  1 172 ? 33.195  28.357  121.395 1.00 41.66  ? 172  ASN C N   1 
ATOM   5654  C  CA  . ASN C  1 172 ? 32.457  28.348  120.142 1.00 42.64  ? 172  ASN C CA  1 
ATOM   5655  C  C   . ASN C  1 172 ? 31.245  29.272  120.167 1.00 39.34  ? 172  ASN C C   1 
ATOM   5656  O  O   . ASN C  1 172 ? 30.089  28.875  120.084 1.00 40.08  ? 172  ASN C O   1 
ATOM   5657  C  CB  . ASN C  1 172 ? 32.121  26.938  119.598 1.00 47.55  ? 172  ASN C CB  1 
ATOM   5658  C  CG  . ASN C  1 172 ? 31.559  26.013  120.624 1.00 53.07  ? 172  ASN C CG  1 
ATOM   5659  O  OD1 . ASN C  1 172 ? 30.821  26.423  121.521 1.00 59.07  ? 172  ASN C OD1 1 
ATOM   5660  N  ND2 . ASN C  1 172 ? 31.880  24.728  120.483 1.00 52.50  ? 172  ASN C ND2 1 
ATOM   5661  N  N   . VAL C  1 173 ? 31.587  30.541  120.318 1.00 37.66  ? 173  VAL C N   1 
ATOM   5662  C  CA  . VAL C  1 173 ? 30.676  31.659  120.281 1.00 37.29  ? 173  VAL C CA  1 
ATOM   5663  C  C   . VAL C  1 173 ? 31.075  32.245  118.913 1.00 34.90  ? 173  VAL C C   1 
ATOM   5664  O  O   . VAL C  1 173 ? 32.237  32.556  118.684 1.00 37.23  ? 173  VAL C O   1 
ATOM   5665  C  CB  . VAL C  1 173 ? 31.008  32.703  121.384 1.00 36.74  ? 173  VAL C CB  1 
ATOM   5666  C  CG1 . VAL C  1 173 ? 30.218  33.993  121.150 1.00 39.62  ? 173  VAL C CG1 1 
ATOM   5667  C  CG2 . VAL C  1 173 ? 30.677  32.143  122.738 1.00 35.33  ? 173  VAL C CG2 1 
ATOM   5668  N  N   . PRO C  1 174 ? 30.131  32.377  117.982 1.00 32.74  ? 174  PRO C N   1 
ATOM   5669  C  CA  . PRO C  1 174 ? 30.509  32.939  116.675 1.00 30.59  ? 174  PRO C CA  1 
ATOM   5670  C  C   . PRO C  1 174 ? 31.137  34.324  116.858 1.00 29.64  ? 174  PRO C C   1 
ATOM   5671  O  O   . PRO C  1 174 ? 30.472  35.243  117.353 1.00 28.56  ? 174  PRO C O   1 
ATOM   5672  C  CB  . PRO C  1 174 ? 29.176  33.023  115.938 1.00 28.50  ? 174  PRO C CB  1 
ATOM   5673  C  CG  . PRO C  1 174 ? 28.306  31.977  116.661 1.00 28.76  ? 174  PRO C CG  1 
ATOM   5674  C  CD  . PRO C  1 174 ? 28.675  32.179  118.083 1.00 31.70  ? 174  PRO C CD  1 
ATOM   5675  N  N   . VAL C  1 175 ? 32.402  34.481  116.469 1.00 27.54  ? 175  VAL C N   1 
ATOM   5676  C  CA  . VAL C  1 175 ? 33.067  35.776  116.623 1.00 28.23  ? 175  VAL C CA  1 
ATOM   5677  C  C   . VAL C  1 175 ? 33.863  36.227  115.415 1.00 28.62  ? 175  VAL C C   1 
ATOM   5678  O  O   . VAL C  1 175 ? 34.604  35.451  114.829 1.00 29.65  ? 175  VAL C O   1 
ATOM   5679  C  CB  . VAL C  1 175 ? 34.016  35.792  117.845 1.00 30.38  ? 175  VAL C CB  1 
ATOM   5680  C  CG1 . VAL C  1 175 ? 35.106  34.742  117.680 1.00 26.87  ? 175  VAL C CG1 1 
ATOM   5681  C  CG2 . VAL C  1 175 ? 34.633  37.177  118.003 1.00 27.80  ? 175  VAL C CG2 1 
ATOM   5682  N  N   . THR C  1 176 ? 33.688  37.488  115.035 1.00 31.60  ? 176  THR C N   1 
ATOM   5683  C  CA  . THR C  1 176 ? 34.419  38.056  113.905 1.00 34.37  ? 176  THR C CA  1 
ATOM   5684  C  C   . THR C  1 176 ? 35.336  39.146  114.442 1.00 32.97  ? 176  THR C C   1 
ATOM   5685  O  O   . THR C  1 176 ? 34.951  39.910  115.332 1.00 36.82  ? 176  THR C O   1 
ATOM   5686  C  CB  . THR C  1 176 ? 33.482  38.728  112.832 1.00 39.53  ? 176  THR C CB  1 
ATOM   5687  O  OG1 . THR C  1 176 ? 32.655  37.748  112.185 1.00 39.05  ? 176  THR C OG1 1 
ATOM   5688  C  CG2 . THR C  1 176 ? 34.332  39.416  111.758 1.00 42.62  ? 176  THR C CG2 1 
ATOM   5689  N  N   . VAL C  1 177 ? 36.550  39.209  113.917 1.00 28.12  ? 177  VAL C N   1 
ATOM   5690  C  CA  . VAL C  1 177 ? 37.489  40.245  114.321 1.00 27.00  ? 177  VAL C CA  1 
ATOM   5691  C  C   . VAL C  1 177 ? 37.435  41.347  113.255 1.00 28.25  ? 177  VAL C C   1 
ATOM   5692  O  O   . VAL C  1 177 ? 37.229  41.069  112.057 1.00 29.14  ? 177  VAL C O   1 
ATOM   5693  C  CB  . VAL C  1 177 ? 38.921  39.687  114.422 1.00 25.79  ? 177  VAL C CB  1 
ATOM   5694  C  CG1 . VAL C  1 177 ? 39.891  40.790  114.789 1.00 27.64  ? 177  VAL C CG1 1 
ATOM   5695  C  CG2 . VAL C  1 177 ? 38.966  38.588  115.466 1.00 23.53  ? 177  VAL C CG2 1 
ATOM   5696  N  N   . VAL C  1 178 ? 37.586  42.596  113.682 1.00 24.67  ? 178  VAL C N   1 
ATOM   5697  C  CA  . VAL C  1 178 ? 37.549  43.720  112.742 1.00 24.13  ? 178  VAL C CA  1 
ATOM   5698  C  C   . VAL C  1 178 ? 38.678  44.710  113.047 1.00 23.94  ? 178  VAL C C   1 
ATOM   5699  O  O   . VAL C  1 178 ? 39.234  44.698  114.141 1.00 24.08  ? 178  VAL C O   1 
ATOM   5700  C  CB  . VAL C  1 178 ? 36.156  44.448  112.805 1.00 23.80  ? 178  VAL C CB  1 
ATOM   5701  C  CG1 . VAL C  1 178 ? 35.036  43.457  112.508 1.00 24.64  ? 178  VAL C CG1 1 
ATOM   5702  C  CG2 . VAL C  1 178 ? 35.922  45.047  114.182 1.00 24.84  ? 178  VAL C CG2 1 
ATOM   5703  N  N   . LEU C  1 179 ? 39.028  45.557  112.088 1.00 27.39  ? 179  LEU C N   1 
ATOM   5704  C  CA  . LEU C  1 179 ? 40.089  46.555  112.306 1.00 29.23  ? 179  LEU C CA  1 
ATOM   5705  C  C   . LEU C  1 179 ? 39.616  47.621  113.283 1.00 32.28  ? 179  LEU C C   1 
ATOM   5706  O  O   . LEU C  1 179 ? 38.411  47.856  113.423 1.00 32.91  ? 179  LEU C O   1 
ATOM   5707  C  CB  . LEU C  1 179 ? 40.456  47.244  110.991 1.00 28.09  ? 179  LEU C CB  1 
ATOM   5708  C  CG  . LEU C  1 179 ? 41.630  46.705  110.178 1.00 27.78  ? 179  LEU C CG  1 
ATOM   5709  C  CD1 . LEU C  1 179 ? 41.623  45.185  110.120 1.00 26.31  ? 179  LEU C CD1 1 
ATOM   5710  C  CD2 . LEU C  1 179 ? 41.560  47.320  108.794 1.00 25.34  ? 179  LEU C CD2 1 
ATOM   5711  N  N   . ASP C  1 180 ? 40.558  48.271  113.959 1.00 35.32  ? 180  ASP C N   1 
ATOM   5712  C  CA  . ASP C  1 180 ? 40.195  49.324  114.901 1.00 35.34  ? 180  ASP C CA  1 
ATOM   5713  C  C   . ASP C  1 180 ? 39.521  50.448  114.125 1.00 35.07  ? 180  ASP C C   1 
ATOM   5714  O  O   . ASP C  1 180 ? 38.738  51.213  114.674 1.00 40.15  ? 180  ASP C O   1 
ATOM   5715  C  CB  . ASP C  1 180 ? 41.432  49.882  115.603 1.00 38.40  ? 180  ASP C CB  1 
ATOM   5716  C  CG  . ASP C  1 180 ? 42.183  48.827  116.405 1.00 42.47  ? 180  ASP C CG  1 
ATOM   5717  O  OD1 . ASP C  1 180 ? 41.514  47.938  116.976 1.00 41.47  ? 180  ASP C OD1 1 
ATOM   5718  O  OD2 . ASP C  1 180 ? 43.434  48.904  116.480 1.00 38.40  ? 180  ASP C OD2 1 
ATOM   5719  N  N   . ALA C  1 181 ? 39.828  50.537  112.839 1.00 32.96  ? 181  ALA C N   1 
ATOM   5720  C  CA  . ALA C  1 181 ? 39.269  51.570  111.977 1.00 30.67  ? 181  ALA C CA  1 
ATOM   5721  C  C   . ALA C  1 181 ? 37.863  51.220  111.491 1.00 28.24  ? 181  ALA C C   1 
ATOM   5722  O  O   . ALA C  1 181 ? 37.201  52.054  110.866 1.00 28.61  ? 181  ALA C O   1 
ATOM   5723  C  CB  . ALA C  1 181 ? 40.202  51.802  110.760 1.00 24.69  ? 181  ALA C CB  1 
ATOM   5724  N  N   . ALA C  1 182 ? 37.408  50.005  111.799 1.00 25.52  ? 182  ALA C N   1 
ATOM   5725  C  CA  . ALA C  1 182 ? 36.103  49.527  111.341 1.00 24.25  ? 182  ALA C CA  1 
ATOM   5726  C  C   . ALA C  1 182 ? 34.961  49.492  112.365 1.00 23.68  ? 182  ALA C C   1 
ATOM   5727  O  O   . ALA C  1 182 ? 33.926  48.848  112.134 1.00 23.66  ? 182  ALA C O   1 
ATOM   5728  C  CB  . ALA C  1 182 ? 36.270  48.138  110.689 1.00 20.83  ? 182  ALA C CB  1 
ATOM   5729  N  N   . VAL C  1 183 ? 35.142  50.192  113.478 1.00 21.89  ? 183  VAL C N   1 
ATOM   5730  C  CA  . VAL C  1 183 ? 34.137  50.252  114.535 1.00 22.81  ? 183  VAL C CA  1 
ATOM   5731  C  C   . VAL C  1 183 ? 32.908  51.065  114.104 1.00 24.92  ? 183  VAL C C   1 
ATOM   5732  O  O   . VAL C  1 183 ? 31.769  50.647  114.334 1.00 26.54  ? 183  VAL C O   1 
ATOM   5733  C  CB  . VAL C  1 183 ? 34.765  50.840  115.839 1.00 24.65  ? 183  VAL C CB  1 
ATOM   5734  C  CG1 . VAL C  1 183 ? 33.717  51.527  116.715 1.00 18.63  ? 183  VAL C CG1 1 
ATOM   5735  C  CG2 . VAL C  1 183 ? 35.428  49.724  116.608 1.00 24.70  ? 183  VAL C CG2 1 
ATOM   5736  N  N   . GLY C  1 184 ? 33.135  52.210  113.467 1.00 24.12  ? 184  GLY C N   1 
ATOM   5737  C  CA  . GLY C  1 184 ? 32.023  53.031  113.024 1.00 25.48  ? 184  GLY C CA  1 
ATOM   5738  C  C   . GLY C  1 184 ? 31.290  52.360  111.874 1.00 27.05  ? 184  GLY C C   1 
ATOM   5739  O  O   . GLY C  1 184 ? 30.094  52.563  111.634 1.00 28.33  ? 184  GLY C O   1 
ATOM   5740  N  N   . TYR C  1 185 ? 32.030  51.542  111.154 1.00 23.41  ? 185  TYR C N   1 
ATOM   5741  C  CA  . TYR C  1 185 ? 31.493  50.823  110.025 1.00 23.88  ? 185  TYR C CA  1 
ATOM   5742  C  C   . TYR C  1 185 ? 30.615  49.634  110.452 1.00 26.64  ? 185  TYR C C   1 
ATOM   5743  O  O   . TYR C  1 185 ? 29.547  49.392  109.890 1.00 23.87  ? 185  TYR C O   1 
ATOM   5744  C  CB  . TYR C  1 185 ? 32.671  50.328  109.199 1.00 21.14  ? 185  TYR C CB  1 
ATOM   5745  C  CG  . TYR C  1 185 ? 32.331  49.252  108.221 1.00 22.80  ? 185  TYR C CG  1 
ATOM   5746  C  CD1 . TYR C  1 185 ? 31.868  49.559  106.945 1.00 24.66  ? 185  TYR C CD1 1 
ATOM   5747  C  CD2 . TYR C  1 185 ? 32.496  47.917  108.558 1.00 23.36  ? 185  TYR C CD2 1 
ATOM   5748  C  CE1 . TYR C  1 185 ? 31.590  48.550  106.026 1.00 27.12  ? 185  TYR C CE1 1 
ATOM   5749  C  CE2 . TYR C  1 185 ? 32.214  46.905  107.651 1.00 25.40  ? 185  TYR C CE2 1 
ATOM   5750  C  CZ  . TYR C  1 185 ? 31.772  47.225  106.392 1.00 24.62  ? 185  TYR C CZ  1 
ATOM   5751  O  OH  . TYR C  1 185 ? 31.568  46.219  105.489 1.00 29.69  ? 185  TYR C OH  1 
ATOM   5752  N  N   . ILE C  1 186 ? 31.080  48.905  111.462 1.00 27.94  ? 186  ILE C N   1 
ATOM   5753  C  CA  . ILE C  1 186 ? 30.403  47.710  111.936 1.00 29.28  ? 186  ILE C CA  1 
ATOM   5754  C  C   . ILE C  1 186 ? 29.314  47.976  112.973 1.00 32.86  ? 186  ILE C C   1 
ATOM   5755  O  O   . ILE C  1 186 ? 28.488  47.097  113.258 1.00 34.37  ? 186  ILE C O   1 
ATOM   5756  C  CB  . ILE C  1 186 ? 31.463  46.704  112.521 1.00 27.11  ? 186  ILE C CB  1 
ATOM   5757  C  CG1 . ILE C  1 186 ? 31.023  45.262  112.248 1.00 23.53  ? 186  ILE C CG1 1 
ATOM   5758  C  CG2 . ILE C  1 186 ? 31.673  46.940  114.020 1.00 20.26  ? 186  ILE C CG2 1 
ATOM   5759  C  CD1 . ILE C  1 186 ? 31.157  44.832  110.799 1.00 19.41  ? 186  ILE C CD1 1 
HETATM 5760  N  N   . MSE C  1 187 ? 29.308  49.190  113.521 1.00 32.37  ? 187  MSE C N   1 
HETATM 5761  C  CA  . MSE C  1 187 ? 28.358  49.571  114.559 1.00 31.88  ? 187  MSE C CA  1 
HETATM 5762  C  C   . MSE C  1 187 ? 26.889  49.235  114.284 1.00 35.02  ? 187  MSE C C   1 
HETATM 5763  O  O   . MSE C  1 187 ? 26.181  48.760  115.175 1.00 36.17  ? 187  MSE C O   1 
HETATM 5764  C  CB  . MSE C  1 187 ? 28.507  51.067  114.872 1.00 29.51  ? 187  MSE C CB  1 
HETATM 5765  C  CG  . MSE C  1 187 ? 27.753  51.524  116.130 1.00 33.90  ? 187  MSE C CG  1 
HETATM 5766  SE SE  . MSE C  1 187 ? 28.154  50.511  117.802 1.00 46.83  ? 187  MSE C SE  1 
HETATM 5767  C  CE  . MSE C  1 187 ? 29.862  51.332  118.260 1.00 39.11  ? 187  MSE C CE  1 
ATOM   5768  N  N   . GLU C  1 188 ? 26.434  49.470  113.054 1.00 38.30  ? 188  GLU C N   1 
ATOM   5769  C  CA  . GLU C  1 188 ? 25.042  49.220  112.679 1.00 38.81  ? 188  GLU C CA  1 
ATOM   5770  C  C   . GLU C  1 188 ? 24.570  47.763  112.846 1.00 38.25  ? 188  GLU C C   1 
ATOM   5771  O  O   . GLU C  1 188 ? 23.375  47.509  113.037 1.00 35.95  ? 188  GLU C O   1 
ATOM   5772  C  CB  . GLU C  1 188 ? 24.791  49.702  111.239 1.00 37.62  ? 188  GLU C CB  1 
ATOM   5773  C  CG  . GLU C  1 188 ? 25.701  49.090  110.178 1.00 40.65  ? 188  GLU C CG  1 
ATOM   5774  C  CD  . GLU C  1 188 ? 25.428  49.642  108.782 1.00 43.46  ? 188  GLU C CD  1 
ATOM   5775  O  OE1 . GLU C  1 188 ? 25.405  50.881  108.632 1.00 48.12  ? 188  GLU C OE1 1 
ATOM   5776  O  OE2 . GLU C  1 188 ? 25.243  48.846  107.832 1.00 43.74  ? 188  GLU C OE2 1 
ATOM   5777  N  N   . LYS C  1 189 ? 25.505  46.819  112.794 1.00 36.12  ? 189  LYS C N   1 
ATOM   5778  C  CA  . LYS C  1 189 ? 25.172  45.414  112.926 1.00 36.11  ? 189  LYS C CA  1 
ATOM   5779  C  C   . LYS C  1 189 ? 25.090  44.953  114.376 1.00 35.67  ? 189  LYS C C   1 
ATOM   5780  O  O   . LYS C  1 189 ? 24.597  43.862  114.656 1.00 36.35  ? 189  LYS C O   1 
ATOM   5781  C  CB  . LYS C  1 189 ? 26.191  44.561  112.164 1.00 39.75  ? 189  LYS C CB  1 
ATOM   5782  C  CG  . LYS C  1 189 ? 25.932  44.491  110.655 1.00 47.36  ? 189  LYS C CG  1 
ATOM   5783  C  CD  . LYS C  1 189 ? 27.139  43.924  109.894 1.00 54.70  ? 189  LYS C CD  1 
ATOM   5784  C  CE  . LYS C  1 189 ? 26.917  43.930  108.365 1.00 58.94  ? 189  LYS C CE  1 
ATOM   5785  N  NZ  . LYS C  1 189 ? 28.190  43.729  107.577 1.00 57.19  ? 189  LYS C NZ  1 
ATOM   5786  N  N   . ALA C  1 190 ? 25.547  45.790  115.298 1.00 32.50  ? 190  ALA C N   1 
ATOM   5787  C  CA  . ALA C  1 190 ? 25.541  45.435  116.712 1.00 31.10  ? 190  ALA C CA  1 
ATOM   5788  C  C   . ALA C  1 190 ? 24.294  45.887  117.468 1.00 34.50  ? 190  ALA C C   1 
ATOM   5789  O  O   . ALA C  1 190 ? 23.627  46.856  117.091 1.00 35.78  ? 190  ALA C O   1 
ATOM   5790  C  CB  . ALA C  1 190 ? 26.789  46.007  117.389 1.00 25.81  ? 190  ALA C CB  1 
ATOM   5791  N  N   . ASP C  1 191 ? 23.988  45.185  118.554 1.00 33.75  ? 191  ASP C N   1 
ATOM   5792  C  CA  . ASP C  1 191 ? 22.834  45.542  119.357 1.00 35.17  ? 191  ASP C CA  1 
ATOM   5793  C  C   . ASP C  1 191 ? 23.296  46.310  120.567 1.00 35.21  ? 191  ASP C C   1 
ATOM   5794  O  O   . ASP C  1 191 ? 22.605  47.218  121.048 1.00 37.70  ? 191  ASP C O   1 
ATOM   5795  C  CB  . ASP C  1 191 ? 22.066  44.295  119.773 1.00 37.61  ? 191  ASP C CB  1 
ATOM   5796  C  CG  . ASP C  1 191 ? 21.640  43.479  118.584 1.00 45.84  ? 191  ASP C CG  1 
ATOM   5797  O  OD1 . ASP C  1 191 ? 21.115  44.099  117.627 1.00 47.12  ? 191  ASP C OD1 1 
ATOM   5798  O  OD2 . ASP C  1 191 ? 21.834  42.237  118.595 1.00 47.56  ? 191  ASP C OD2 1 
ATOM   5799  N  N   . LEU C  1 192 ? 24.474  45.955  121.057 1.00 30.30  ? 192  LEU C N   1 
ATOM   5800  C  CA  . LEU C  1 192 ? 25.024  46.640  122.205 1.00 27.97  ? 192  LEU C CA  1 
ATOM   5801  C  C   . LEU C  1 192 ? 26.503  46.383  122.248 1.00 27.44  ? 192  LEU C C   1 
ATOM   5802  O  O   . LEU C  1 192 ? 26.988  45.422  121.645 1.00 27.15  ? 192  LEU C O   1 
ATOM   5803  C  CB  . LEU C  1 192 ? 24.418  46.107  123.494 1.00 31.43  ? 192  LEU C CB  1 
ATOM   5804  C  CG  . LEU C  1 192 ? 24.884  44.694  123.843 1.00 30.03  ? 192  LEU C CG  1 
ATOM   5805  C  CD1 . LEU C  1 192 ? 24.627  44.400  125.290 1.00 30.34  ? 192  LEU C CD1 1 
ATOM   5806  C  CD2 . LEU C  1 192 ? 24.160  43.709  122.954 1.00 31.31  ? 192  LEU C CD2 1 
ATOM   5807  N  N   . VAL C  1 193 ? 27.226  47.244  122.951 1.00 22.16  ? 193  VAL C N   1 
ATOM   5808  C  CA  . VAL C  1 193 ? 28.643  47.014  123.078 1.00 23.54  ? 193  VAL C CA  1 
ATOM   5809  C  C   . VAL C  1 193 ? 28.944  46.897  124.557 1.00 23.48  ? 193  VAL C C   1 
ATOM   5810  O  O   . VAL C  1 193 ? 28.305  47.552  125.387 1.00 21.39  ? 193  VAL C O   1 
ATOM   5811  C  CB  . VAL C  1 193 ? 29.507  48.127  122.384 1.00 22.83  ? 193  VAL C CB  1 
ATOM   5812  C  CG1 . VAL C  1 193 ? 28.615  49.069  121.590 1.00 18.25  ? 193  VAL C CG1 1 
ATOM   5813  C  CG2 . VAL C  1 193 ? 30.373  48.831  123.388 1.00 11.61  ? 193  VAL C CG2 1 
ATOM   5814  N  N   . ILE C  1 194 ? 29.913  46.037  124.859 1.00 21.74  ? 194  ILE C N   1 
ATOM   5815  C  CA  . ILE C  1 194 ? 30.342  45.741  126.212 1.00 20.71  ? 194  ILE C CA  1 
ATOM   5816  C  C   . ILE C  1 194 ? 31.868  45.815  126.342 1.00 23.21  ? 194  ILE C C   1 
ATOM   5817  O  O   . ILE C  1 194 ? 32.610  45.177  125.597 1.00 20.33  ? 194  ILE C O   1 
ATOM   5818  C  CB  . ILE C  1 194 ? 29.887  44.307  126.623 1.00 18.65  ? 194  ILE C CB  1 
ATOM   5819  C  CG1 . ILE C  1 194 ? 28.361  44.253  126.748 1.00 27.19  ? 194  ILE C CG1 1 
ATOM   5820  C  CG2 . ILE C  1 194 ? 30.509  43.916  127.953 1.00 22.29  ? 194  ILE C CG2 1 
ATOM   5821  C  CD1 . ILE C  1 194 ? 27.759  42.839  126.882 1.00 27.29  ? 194  ILE C CD1 1 
ATOM   5822  N  N   . VAL C  1 195 ? 32.341  46.581  127.309 1.00 24.22  ? 195  VAL C N   1 
ATOM   5823  C  CA  . VAL C  1 195 ? 33.764  46.674  127.509 1.00 28.03  ? 195  VAL C CA  1 
ATOM   5824  C  C   . VAL C  1 195 ? 34.054  46.599  128.995 1.00 31.98  ? 195  VAL C C   1 
ATOM   5825  O  O   . VAL C  1 195 ? 33.149  46.735  129.819 1.00 31.70  ? 195  VAL C O   1 
ATOM   5826  C  CB  . VAL C  1 195 ? 34.343  48.007  126.947 1.00 28.05  ? 195  VAL C CB  1 
ATOM   5827  C  CG1 . VAL C  1 195 ? 34.080  48.103  125.458 1.00 22.80  ? 195  VAL C CG1 1 
ATOM   5828  C  CG2 . VAL C  1 195 ? 33.739  49.203  127.681 1.00 27.23  ? 195  VAL C CG2 1 
ATOM   5829  N  N   . GLY C  1 196 ? 35.322  46.350  129.317 1.00 34.62  ? 196  GLY C N   1 
ATOM   5830  C  CA  . GLY C  1 196 ? 35.760  46.311  130.697 1.00 36.53  ? 196  GLY C CA  1 
ATOM   5831  C  C   . GLY C  1 196 ? 36.425  47.654  130.948 1.00 36.78  ? 196  GLY C C   1 
ATOM   5832  O  O   . GLY C  1 196 ? 36.302  48.548  130.114 1.00 35.91  ? 196  GLY C O   1 
ATOM   5833  N  N   . ALA C  1 197 ? 37.126  47.809  132.072 1.00 37.74  ? 197  ALA C N   1 
ATOM   5834  C  CA  . ALA C  1 197 ? 37.794  49.074  132.375 1.00 35.84  ? 197  ALA C CA  1 
ATOM   5835  C  C   . ALA C  1 197 ? 39.088  48.900  133.139 1.00 36.21  ? 197  ALA C C   1 
ATOM   5836  O  O   . ALA C  1 197 ? 39.230  47.977  133.931 1.00 34.32  ? 197  ALA C O   1 
ATOM   5837  C  CB  . ALA C  1 197 ? 36.864  49.983  133.170 1.00 36.38  ? 197  ALA C CB  1 
ATOM   5838  N  N   . GLU C  1 198 ? 40.040  49.793  132.884 1.00 38.18  ? 198  GLU C N   1 
ATOM   5839  C  CA  . GLU C  1 198 ? 41.312  49.765  133.591 1.00 34.65  ? 198  GLU C CA  1 
ATOM   5840  C  C   . GLU C  1 198 ? 40.974  50.464  134.896 1.00 31.81  ? 198  GLU C C   1 
ATOM   5841  O  O   . GLU C  1 198 ? 41.423  50.074  135.963 1.00 32.90  ? 198  GLU C O   1 
ATOM   5842  C  CB  . GLU C  1 198 ? 42.366  50.586  132.862 1.00 40.78  ? 198  GLU C CB  1 
ATOM   5843  C  CG  . GLU C  1 198 ? 42.673  50.147  131.448 1.00 51.99  ? 198  GLU C CG  1 
ATOM   5844  C  CD  . GLU C  1 198 ? 43.792  49.126  131.370 1.00 56.39  ? 198  GLU C CD  1 
ATOM   5845  O  OE1 . GLU C  1 198 ? 44.542  48.990  132.368 1.00 59.00  ? 198  GLU C OE1 1 
ATOM   5846  O  OE2 . GLU C  1 198 ? 43.928  48.477  130.299 1.00 58.02  ? 198  GLU C OE2 1 
ATOM   5847  N  N   . GLY C  1 199 ? 40.170  51.512  134.786 1.00 28.85  ? 199  GLY C N   1 
ATOM   5848  C  CA  . GLY C  1 199 ? 39.772  52.255  135.955 1.00 26.69  ? 199  GLY C CA  1 
ATOM   5849  C  C   . GLY C  1 199 ? 38.500  53.045  135.758 1.00 28.33  ? 199  GLY C C   1 
ATOM   5850  O  O   . GLY C  1 199 ? 38.223  53.535  134.666 1.00 32.72  ? 199  GLY C O   1 
ATOM   5851  N  N   . VAL C  1 200 ? 37.718  53.142  136.825 1.00 28.76  ? 200  VAL C N   1 
ATOM   5852  C  CA  . VAL C  1 200 ? 36.476  53.896  136.844 1.00 28.82  ? 200  VAL C CA  1 
ATOM   5853  C  C   . VAL C  1 200 ? 36.760  55.154  137.677 1.00 31.71  ? 200  VAL C C   1 
ATOM   5854  O  O   . VAL C  1 200 ? 37.083  55.089  138.870 1.00 32.72  ? 200  VAL C O   1 
ATOM   5855  C  CB  . VAL C  1 200 ? 35.333  53.092  137.487 1.00 29.67  ? 200  VAL C CB  1 
ATOM   5856  C  CG1 . VAL C  1 200 ? 34.080  53.961  137.567 1.00 28.34  ? 200  VAL C CG1 1 
ATOM   5857  C  CG2 . VAL C  1 200 ? 35.065  51.838  136.676 1.00 25.33  ? 200  VAL C CG2 1 
ATOM   5858  N  N   . VAL C  1 201 ? 36.629  56.294  137.015 1.00 32.39  ? 201  VAL C N   1 
ATOM   5859  C  CA  . VAL C  1 201 ? 36.910  57.604  137.568 1.00 29.21  ? 201  VAL C CA  1 
ATOM   5860  C  C   . VAL C  1 201 ? 35.738  58.222  138.341 1.00 28.63  ? 201  VAL C C   1 
ATOM   5861  O  O   . VAL C  1 201 ? 34.608  57.772  138.228 1.00 28.19  ? 201  VAL C O   1 
ATOM   5862  C  CB  . VAL C  1 201 ? 37.444  58.449  136.393 1.00 30.48  ? 201  VAL C CB  1 
ATOM   5863  C  CG1 . VAL C  1 201 ? 37.042  59.907  136.490 1.00 36.38  ? 201  VAL C CG1 1 
ATOM   5864  C  CG2 . VAL C  1 201 ? 38.953  58.264  136.341 1.00 25.76  ? 201  VAL C CG2 1 
ATOM   5865  N  N   . GLU C  1 202 ? 36.014  59.254  139.131 1.00 29.03  ? 202  GLU C N   1 
ATOM   5866  C  CA  . GLU C  1 202 ? 35.002  59.862  139.989 1.00 30.53  ? 202  GLU C CA  1 
ATOM   5867  C  C   . GLU C  1 202 ? 33.715  60.440  139.398 1.00 33.63  ? 202  GLU C C   1 
ATOM   5868  O  O   . GLU C  1 202 ? 32.790  60.748  140.149 1.00 38.04  ? 202  GLU C O   1 
ATOM   5869  C  CB  . GLU C  1 202 ? 35.672  60.893  140.906 1.00 29.26  ? 202  GLU C CB  1 
ATOM   5870  C  CG  . GLU C  1 202 ? 36.851  60.315  141.702 1.00 33.38  ? 202  GLU C CG  1 
ATOM   5871  C  CD  . GLU C  1 202 ? 37.391  61.271  142.770 1.00 39.43  ? 202  GLU C CD  1 
ATOM   5872  O  OE1 . GLU C  1 202 ? 37.569  62.468  142.473 1.00 39.78  ? 202  GLU C OE1 1 
ATOM   5873  O  OE2 . GLU C  1 202 ? 37.648  60.826  143.913 1.00 42.35  ? 202  GLU C OE2 1 
ATOM   5874  N  N   . ASN C  1 203 ? 33.628  60.604  138.081 1.00 33.14  ? 203  ASN C N   1 
ATOM   5875  C  CA  . ASN C  1 203 ? 32.383  61.112  137.481 1.00 31.69  ? 203  ASN C CA  1 
ATOM   5876  C  C   . ASN C  1 203 ? 31.621  59.950  136.818 1.00 30.38  ? 203  ASN C C   1 
ATOM   5877  O  O   . ASN C  1 203 ? 30.621  60.151  136.136 1.00 29.47  ? 203  ASN C O   1 
ATOM   5878  C  CB  . ASN C  1 203 ? 32.691  62.182  136.433 1.00 29.63  ? 203  ASN C CB  1 
ATOM   5879  C  CG  . ASN C  1 203 ? 33.574  61.662  135.333 1.00 33.92  ? 203  ASN C CG  1 
ATOM   5880  O  OD1 . ASN C  1 203 ? 33.940  60.485  135.332 1.00 36.06  ? 203  ASN C OD1 1 
ATOM   5881  N  ND2 . ASN C  1 203 ? 33.926  62.526  134.385 1.00 34.56  ? 203  ASN C ND2 1 
ATOM   5882  N  N   . GLY C  1 204 ? 32.115  58.731  137.015 1.00 27.43  ? 204  GLY C N   1 
ATOM   5883  C  CA  . GLY C  1 204 ? 31.470  57.584  136.424 1.00 26.16  ? 204  GLY C CA  1 
ATOM   5884  C  C   . GLY C  1 204 ? 32.022  57.253  135.054 1.00 26.68  ? 204  GLY C C   1 
ATOM   5885  O  O   . GLY C  1 204 ? 31.526  56.342  134.398 1.00 26.34  ? 204  GLY C O   1 
ATOM   5886  N  N   . GLY C  1 205 ? 33.034  57.996  134.611 1.00 25.02  ? 205  GLY C N   1 
ATOM   5887  C  CA  . GLY C  1 205 ? 33.632  57.726  133.314 1.00 24.53  ? 205  GLY C CA  1 
ATOM   5888  C  C   . GLY C  1 205 ? 34.680  56.637  133.478 1.00 24.70  ? 205  GLY C C   1 
ATOM   5889  O  O   . GLY C  1 205 ? 34.961  56.220  134.595 1.00 26.19  ? 205  GLY C O   1 
ATOM   5890  N  N   . ILE C  1 206 ? 35.264  56.153  132.394 1.00 24.17  ? 206  ILE C N   1 
ATOM   5891  C  CA  . ILE C  1 206 ? 36.284  55.113  132.548 1.00 24.73  ? 206  ILE C CA  1 
ATOM   5892  C  C   . ILE C  1 206 ? 37.561  55.357  131.765 1.00 25.31  ? 206  ILE C C   1 
ATOM   5893  O  O   . ILE C  1 206 ? 37.581  56.100  130.762 1.00 22.27  ? 206  ILE C O   1 
ATOM   5894  C  CB  . ILE C  1 206 ? 35.765  53.712  132.125 1.00 21.82  ? 206  ILE C CB  1 
ATOM   5895  C  CG1 . ILE C  1 206 ? 35.554  53.666  130.618 1.00 18.72  ? 206  ILE C CG1 1 
ATOM   5896  C  CG2 . ILE C  1 206 ? 34.443  53.405  132.824 1.00 28.70  ? 206  ILE C CG2 1 
ATOM   5897  C  CD1 . ILE C  1 206 ? 35.332  52.305  130.098 1.00 21.19  ? 206  ILE C CD1 1 
ATOM   5898  N  N   . ILE C  1 207 ? 38.629  54.736  132.252 1.00 25.36  ? 207  ILE C N   1 
ATOM   5899  C  CA  . ILE C  1 207 ? 39.927  54.785  131.582 1.00 27.03  ? 207  ILE C CA  1 
ATOM   5900  C  C   . ILE C  1 207 ? 40.022  53.364  131.048 1.00 28.33  ? 207  ILE C C   1 
ATOM   5901  O  O   . ILE C  1 207 ? 39.744  52.395  131.770 1.00 29.89  ? 207  ILE C O   1 
ATOM   5902  C  CB  . ILE C  1 207 ? 41.090  55.051  132.560 1.00 27.20  ? 207  ILE C CB  1 
ATOM   5903  C  CG1 . ILE C  1 207 ? 41.021  56.479  133.079 1.00 23.82  ? 207  ILE C CG1 1 
ATOM   5904  C  CG2 . ILE C  1 207 ? 42.433  54.818  131.872 1.00 25.84  ? 207  ILE C CG2 1 
ATOM   5905  C  CD1 . ILE C  1 207 ? 41.935  56.702  134.256 1.00 27.06  ? 207  ILE C CD1 1 
ATOM   5906  N  N   . ASN C  1 208 ? 40.378  53.232  129.780 1.00 28.50  ? 208  ASN C N   1 
ATOM   5907  C  CA  . ASN C  1 208 ? 40.452  51.912  129.180 1.00 26.84  ? 208  ASN C CA  1 
ATOM   5908  C  C   . ASN C  1 208 ? 41.368  51.897  127.987 1.00 23.00  ? 208  ASN C C   1 
ATOM   5909  O  O   . ASN C  1 208 ? 41.819  52.944  127.541 1.00 25.45  ? 208  ASN C O   1 
ATOM   5910  C  CB  . ASN C  1 208 ? 39.060  51.464  128.747 1.00 28.00  ? 208  ASN C CB  1 
ATOM   5911  C  CG  . ASN C  1 208 ? 38.976  49.978  128.561 1.00 30.77  ? 208  ASN C CG  1 
ATOM   5912  O  OD1 . ASN C  1 208 ? 38.546  49.488  127.515 1.00 32.63  ? 208  ASN C OD1 1 
ATOM   5913  N  ND2 . ASN C  1 208 ? 39.390  49.239  129.583 1.00 30.59  ? 208  ASN C ND2 1 
ATOM   5914  N  N   . LYS C  1 209 ? 41.632  50.700  127.477 1.00 19.08  ? 209  LYS C N   1 
ATOM   5915  C  CA  . LYS C  1 209 ? 42.495  50.508  126.325 1.00 18.45  ? 209  LYS C CA  1 
ATOM   5916  C  C   . LYS C  1 209 ? 42.174  51.550  125.251 1.00 21.06  ? 209  LYS C C   1 
ATOM   5917  O  O   . LYS C  1 209 ? 41.008  51.750  124.916 1.00 21.15  ? 209  LYS C O   1 
ATOM   5918  C  CB  . LYS C  1 209 ? 42.287  49.092  125.761 1.00 16.73  ? 209  LYS C CB  1 
ATOM   5919  C  CG  . LYS C  1 209 ? 43.214  48.693  124.622 1.00 14.63  ? 209  LYS C CG  1 
ATOM   5920  C  CD  . LYS C  1 209 ? 44.667  48.628  125.101 1.00 24.33  ? 209  LYS C CD  1 
ATOM   5921  C  CE  . LYS C  1 209 ? 45.638  48.313  123.965 1.00 26.48  ? 209  LYS C CE  1 
ATOM   5922  N  NZ  . LYS C  1 209 ? 45.408  46.956  123.392 1.00 27.93  ? 209  LYS C NZ  1 
ATOM   5923  N  N   . ILE C  1 210 ? 43.204  52.218  124.729 1.00 22.43  ? 210  ILE C N   1 
ATOM   5924  C  CA  . ILE C  1 210 ? 43.034  53.222  123.677 1.00 23.39  ? 210  ILE C CA  1 
ATOM   5925  C  C   . ILE C  1 210 ? 42.117  52.633  122.598 1.00 24.04  ? 210  ILE C C   1 
ATOM   5926  O  O   . ILE C  1 210 ? 42.276  51.475  122.198 1.00 26.56  ? 210  ILE C O   1 
ATOM   5927  C  CB  . ILE C  1 210 ? 44.397  53.599  123.023 1.00 25.19  ? 210  ILE C CB  1 
ATOM   5928  C  CG1 . ILE C  1 210 ? 44.193  54.732  122.015 1.00 21.45  ? 210  ILE C CG1 1 
ATOM   5929  C  CG2 . ILE C  1 210 ? 45.042  52.369  122.368 1.00 23.60  ? 210  ILE C CG2 1 
ATOM   5930  C  CD1 . ILE C  1 210 ? 43.889  56.045  122.698 1.00 23.22  ? 210  ILE C CD1 1 
ATOM   5931  N  N   . GLY C  1 211 ? 41.162  53.424  122.133 1.00 21.00  ? 211  GLY C N   1 
ATOM   5932  C  CA  . GLY C  1 211 ? 40.235  52.933  121.137 1.00 22.60  ? 211  GLY C CA  1 
ATOM   5933  C  C   . GLY C  1 211 ? 38.844  52.849  121.739 1.00 27.44  ? 211  GLY C C   1 
ATOM   5934  O  O   . GLY C  1 211 ? 37.844  52.944  121.022 1.00 30.02  ? 211  GLY C O   1 
ATOM   5935  N  N   . THR C  1 212 ? 38.783  52.688  123.060 1.00 25.84  ? 212  THR C N   1 
ATOM   5936  C  CA  . THR C  1 212 ? 37.522  52.587  123.780 1.00 28.05  ? 212  THR C CA  1 
ATOM   5937  C  C   . THR C  1 212 ? 36.658  53.844  123.683 1.00 29.71  ? 212  THR C C   1 
ATOM   5938  O  O   . THR C  1 212 ? 35.426  53.766  123.655 1.00 26.17  ? 212  THR C O   1 
ATOM   5939  C  CB  . THR C  1 212 ? 37.776  52.319  125.251 1.00 27.58  ? 212  THR C CB  1 
ATOM   5940  O  OG1 . THR C  1 212 ? 38.599  51.161  125.364 1.00 33.03  ? 212  THR C OG1 1 
ATOM   5941  C  CG2 . THR C  1 212 ? 36.458  52.093  125.999 1.00 24.39  ? 212  THR C CG2 1 
ATOM   5942  N  N   . ASN C  1 213 ? 37.308  55.000  123.649 1.00 29.14  ? 213  ASN C N   1 
ATOM   5943  C  CA  . ASN C  1 213 ? 36.590  56.254  123.569 1.00 31.11  ? 213  ASN C CA  1 
ATOM   5944  C  C   . ASN C  1 213 ? 35.786  56.397  122.266 1.00 31.85  ? 213  ASN C C   1 
ATOM   5945  O  O   . ASN C  1 213 ? 34.572  56.659  122.294 1.00 26.60  ? 213  ASN C O   1 
ATOM   5946  C  CB  . ASN C  1 213 ? 37.558  57.438  123.727 1.00 29.51  ? 213  ASN C CB  1 
ATOM   5947  C  CG  . ASN C  1 213 ? 36.857  58.778  123.587 1.00 30.64  ? 213  ASN C CG  1 
ATOM   5948  O  OD1 . ASN C  1 213 ? 36.671  59.276  122.483 1.00 37.99  ? 213  ASN C OD1 1 
ATOM   5949  N  ND2 . ASN C  1 213 ? 36.436  59.350  124.703 1.00 29.81  ? 213  ASN C ND2 1 
ATOM   5950  N  N   . GLN C  1 214 ? 36.454  56.222  121.129 1.00 30.51  ? 214  GLN C N   1 
ATOM   5951  C  CA  . GLN C  1 214 ? 35.775  56.365  119.849 1.00 30.30  ? 214  GLN C CA  1 
ATOM   5952  C  C   . GLN C  1 214 ? 34.688  55.326  119.682 1.00 29.68  ? 214  GLN C C   1 
ATOM   5953  O  O   . GLN C  1 214 ? 33.696  55.567  118.996 1.00 30.15  ? 214  GLN C O   1 
ATOM   5954  C  CB  . GLN C  1 214 ? 36.767  56.281  118.687 1.00 28.58  ? 214  GLN C CB  1 
ATOM   5955  C  CG  . GLN C  1 214 ? 37.683  55.090  118.731 1.00 31.92  ? 214  GLN C CG  1 
ATOM   5956  C  CD  . GLN C  1 214 ? 38.747  55.167  117.669 1.00 39.15  ? 214  GLN C CD  1 
ATOM   5957  O  OE1 . GLN C  1 214 ? 39.318  56.243  117.419 1.00 40.63  ? 214  GLN C OE1 1 
ATOM   5958  N  NE2 . GLN C  1 214 ? 39.039  54.026  117.038 1.00 40.40  ? 214  GLN C NE2 1 
HETATM 5959  N  N   . MSE C  1 215 ? 34.858  54.166  120.305 1.00 30.36  ? 215  MSE C N   1 
HETATM 5960  C  CA  . MSE C  1 215 ? 33.824  53.154  120.185 1.00 28.62  ? 215  MSE C CA  1 
HETATM 5961  C  C   . MSE C  1 215 ? 32.570  53.658  120.909 1.00 27.08  ? 215  MSE C C   1 
HETATM 5962  O  O   . MSE C  1 215 ? 31.455  53.408  120.469 1.00 26.33  ? 215  MSE C O   1 
HETATM 5963  C  CB  . MSE C  1 215 ? 34.282  51.834  120.781 1.00 27.90  ? 215  MSE C CB  1 
HETATM 5964  C  CG  . MSE C  1 215 ? 33.208  50.770  120.706 1.00 37.25  ? 215  MSE C CG  1 
HETATM 5965  SE SE  . MSE C  1 215 ? 33.757  49.030  121.324 1.00 45.78  ? 215  MSE C SE  1 
HETATM 5966  C  CE  . MSE C  1 215 ? 34.692  48.473  119.722 1.00 43.18  ? 215  MSE C CE  1 
ATOM   5967  N  N   . ALA C  1 216 ? 32.770  54.388  122.006 1.00 24.17  ? 216  ALA C N   1 
ATOM   5968  C  CA  . ALA C  1 216 ? 31.672  54.939  122.788 1.00 23.75  ? 216  ALA C CA  1 
ATOM   5969  C  C   . ALA C  1 216 ? 30.909  56.015  122.020 1.00 25.66  ? 216  ALA C C   1 
ATOM   5970  O  O   . ALA C  1 216 ? 29.673  56.012  121.966 1.00 28.76  ? 216  ALA C O   1 
ATOM   5971  C  CB  . ALA C  1 216 ? 32.204  55.502  124.072 1.00 17.63  ? 216  ALA C CB  1 
ATOM   5972  N  N   . VAL C  1 217 ? 31.660  56.929  121.419 1.00 26.17  ? 217  VAL C N   1 
ATOM   5973  C  CA  . VAL C  1 217 ? 31.097  58.018  120.642 1.00 22.25  ? 217  VAL C CA  1 
ATOM   5974  C  C   . VAL C  1 217 ? 30.311  57.443  119.457 1.00 25.76  ? 217  VAL C C   1 
ATOM   5975  O  O   . VAL C  1 217 ? 29.251  57.958  119.104 1.00 25.55  ? 217  VAL C O   1 
ATOM   5976  C  CB  . VAL C  1 217 ? 32.239  58.981  120.166 1.00 20.61  ? 217  VAL C CB  1 
ATOM   5977  C  CG1 . VAL C  1 217 ? 31.700  60.025  119.190 1.00 19.76  ? 217  VAL C CG1 1 
ATOM   5978  C  CG2 . VAL C  1 217 ? 32.873  59.687  121.380 1.00 6.21   ? 217  VAL C CG2 1 
ATOM   5979  N  N   . CYS C  1 218 ? 30.814  56.365  118.857 1.00 26.95  ? 218  CYS C N   1 
ATOM   5980  C  CA  . CYS C  1 218 ? 30.131  55.744  117.715 1.00 28.15  ? 218  CYS C CA  1 
ATOM   5981  C  C   . CYS C  1 218 ? 28.849  55.040  118.109 1.00 27.95  ? 218  CYS C C   1 
ATOM   5982  O  O   . CYS C  1 218 ? 27.895  55.017  117.338 1.00 34.20  ? 218  CYS C O   1 
ATOM   5983  C  CB  . CYS C  1 218 ? 31.032  54.734  117.010 1.00 28.01  ? 218  CYS C CB  1 
ATOM   5984  S  SG  . CYS C  1 218 ? 32.175  55.456  115.829 1.00 38.13  ? 218  CYS C SG  1 
ATOM   5985  N  N   . ALA C  1 219 ? 28.834  54.450  119.298 1.00 24.14  ? 219  ALA C N   1 
ATOM   5986  C  CA  . ALA C  1 219 ? 27.666  53.749  119.786 1.00 20.72  ? 219  ALA C CA  1 
ATOM   5987  C  C   . ALA C  1 219 ? 26.613  54.777  120.230 1.00 26.37  ? 219  ALA C C   1 
ATOM   5988  O  O   . ALA C  1 219 ? 25.406  54.560  120.073 1.00 24.05  ? 219  ALA C O   1 
ATOM   5989  C  CB  . ALA C  1 219 ? 28.053  52.863  120.937 1.00 13.21  ? 219  ALA C CB  1 
ATOM   5990  N  N   . LYS C  1 220 ? 27.061  55.899  120.793 1.00 26.01  ? 220  LYS C N   1 
ATOM   5991  C  CA  . LYS C  1 220 ? 26.106  56.914  121.214 1.00 26.94  ? 220  LYS C CA  1 
ATOM   5992  C  C   . LYS C  1 220 ? 25.368  57.409  119.957 1.00 27.47  ? 220  LYS C C   1 
ATOM   5993  O  O   . LYS C  1 220 ? 24.129  57.418  119.912 1.00 27.60  ? 220  LYS C O   1 
ATOM   5994  C  CB  . LYS C  1 220 ? 26.826  58.070  121.896 1.00 26.01  ? 220  LYS C CB  1 
ATOM   5995  C  CG  . LYS C  1 220 ? 25.909  59.092  122.517 1.00 28.32  ? 220  LYS C CG  1 
ATOM   5996  C  CD  . LYS C  1 220 ? 25.590  58.722  123.947 1.00 39.91  ? 220  LYS C CD  1 
ATOM   5997  C  CE  . LYS C  1 220 ? 24.943  59.879  124.678 1.00 44.52  ? 220  LYS C CE  1 
ATOM   5998  N  NZ  . LYS C  1 220 ? 25.760  61.138  124.557 1.00 51.21  ? 220  LYS C NZ  1 
ATOM   5999  N  N   . ALA C  1 221 ? 26.137  57.784  118.933 1.00 22.62  ? 221  ALA C N   1 
ATOM   6000  C  CA  . ALA C  1 221 ? 25.572  58.266  117.680 1.00 21.54  ? 221  ALA C CA  1 
ATOM   6001  C  C   . ALA C  1 221 ? 24.587  57.291  117.063 1.00 23.10  ? 221  ALA C C   1 
ATOM   6002  O  O   . ALA C  1 221 ? 23.671  57.713  116.378 1.00 26.25  ? 221  ALA C O   1 
ATOM   6003  C  CB  . ALA C  1 221 ? 26.664  58.586  116.682 1.00 11.88  ? 221  ALA C CB  1 
ATOM   6004  N  N   . GLN C  1 222 ? 24.761  55.992  117.264 1.00 25.19  ? 222  GLN C N   1 
ATOM   6005  C  CA  . GLN C  1 222 ? 23.784  55.074  116.695 1.00 28.66  ? 222  GLN C CA  1 
ATOM   6006  C  C   . GLN C  1 222 ? 22.771  54.595  117.730 1.00 30.64  ? 222  GLN C C   1 
ATOM   6007  O  O   . GLN C  1 222 ? 21.999  53.660  117.499 1.00 28.98  ? 222  GLN C O   1 
ATOM   6008  C  CB  . GLN C  1 222 ? 24.463  53.893  116.013 1.00 27.59  ? 222  GLN C CB  1 
ATOM   6009  C  CG  . GLN C  1 222 ? 24.998  54.283  114.655 1.00 29.98  ? 222  GLN C CG  1 
ATOM   6010  C  CD  . GLN C  1 222 ? 25.211  53.101  113.740 1.00 36.28  ? 222  GLN C CD  1 
ATOM   6011  O  OE1 . GLN C  1 222 ? 26.144  53.099  112.937 1.00 39.05  ? 222  GLN C OE1 1 
ATOM   6012  N  NE2 . GLN C  1 222 ? 24.343  52.091  113.840 1.00 35.88  ? 222  GLN C NE2 1 
ATOM   6013  N  N   . ASN C  1 223 ? 22.772  55.271  118.869 1.00 34.40  ? 223  ASN C N   1 
ATOM   6014  C  CA  . ASN C  1 223 ? 21.864  54.962  119.957 1.00 38.80  ? 223  ASN C CA  1 
ATOM   6015  C  C   . ASN C  1 223 ? 21.955  53.510  120.432 1.00 38.11  ? 223  ASN C C   1 
ATOM   6016  O  O   . ASN C  1 223 ? 20.940  52.851  120.690 1.00 39.72  ? 223  ASN C O   1 
ATOM   6017  C  CB  . ASN C  1 223 ? 20.428  55.292  119.547 1.00 44.08  ? 223  ASN C CB  1 
ATOM   6018  C  CG  . ASN C  1 223 ? 19.550  55.574  120.740 1.00 49.67  ? 223  ASN C CG  1 
ATOM   6019  O  OD1 . ASN C  1 223 ? 19.856  56.456  121.545 1.00 55.54  ? 223  ASN C OD1 1 
ATOM   6020  N  ND2 . ASN C  1 223 ? 18.461  54.826  120.874 1.00 53.11  ? 223  ASN C ND2 1 
ATOM   6021  N  N   . LYS C  1 224 ? 23.182  53.020  120.547 1.00 33.83  ? 224  LYS C N   1 
ATOM   6022  C  CA  . LYS C  1 224 ? 23.413  51.672  121.011 1.00 30.45  ? 224  LYS C CA  1 
ATOM   6023  C  C   . LYS C  1 224 ? 23.862  51.760  122.455 1.00 27.63  ? 224  LYS C C   1 
ATOM   6024  O  O   . LYS C  1 224 ? 24.705  52.587  122.799 1.00 26.88  ? 224  LYS C O   1 
ATOM   6025  C  CB  . LYS C  1 224 ? 24.491  51.011  120.172 1.00 30.35  ? 224  LYS C CB  1 
ATOM   6026  C  CG  . LYS C  1 224 ? 24.217  51.091  118.680 1.00 33.03  ? 224  LYS C CG  1 
ATOM   6027  C  CD  . LYS C  1 224 ? 23.099  50.164  118.222 1.00 29.35  ? 224  LYS C CD  1 
ATOM   6028  C  CE  . LYS C  1 224 ? 23.079  50.115  116.703 1.00 29.52  ? 224  LYS C CE  1 
ATOM   6029  N  NZ  . LYS C  1 224 ? 22.230  49.027  116.165 1.00 26.51  ? 224  LYS C NZ  1 
ATOM   6030  N  N   . PRO C  1 225 ? 23.252  50.947  123.338 1.00 27.98  ? 225  PRO C N   1 
ATOM   6031  C  CA  . PRO C  1 225 ? 23.663  50.996  124.743 1.00 24.75  ? 225  PRO C CA  1 
ATOM   6032  C  C   . PRO C  1 225 ? 25.121  50.578  124.890 1.00 26.79  ? 225  PRO C C   1 
ATOM   6033  O  O   . PRO C  1 225 ? 25.596  49.624  124.238 1.00 24.33  ? 225  PRO C O   1 
ATOM   6034  C  CB  . PRO C  1 225 ? 22.678  50.034  125.440 1.00 22.97  ? 225  PRO C CB  1 
ATOM   6035  C  CG  . PRO C  1 225 ? 22.168  49.161  124.350 1.00 19.81  ? 225  PRO C CG  1 
ATOM   6036  C  CD  . PRO C  1 225 ? 22.068  50.082  123.162 1.00 21.74  ? 225  PRO C CD  1 
ATOM   6037  N  N   . PHE C  1 226 ? 25.823  51.324  125.736 1.00 27.07  ? 226  PHE C N   1 
ATOM   6038  C  CA  . PHE C  1 226 ? 27.236  51.097  126.025 1.00 27.03  ? 226  PHE C CA  1 
ATOM   6039  C  C   . PHE C  1 226 ? 27.373  50.601  127.482 1.00 28.11  ? 226  PHE C C   1 
ATOM   6040  O  O   . PHE C  1 226 ? 27.128  51.344  128.443 1.00 25.13  ? 226  PHE C O   1 
ATOM   6041  C  CB  . PHE C  1 226 ? 28.008  52.407  125.830 1.00 23.82  ? 226  PHE C CB  1 
ATOM   6042  C  CG  . PHE C  1 226 ? 29.503  52.244  125.783 1.00 22.73  ? 226  PHE C CG  1 
ATOM   6043  C  CD1 . PHE C  1 226 ? 30.147  51.940  124.587 1.00 25.04  ? 226  PHE C CD1 1 
ATOM   6044  C  CD2 . PHE C  1 226 ? 30.270  52.435  126.919 1.00 20.75  ? 226  PHE C CD2 1 
ATOM   6045  C  CE1 . PHE C  1 226 ? 31.541  51.833  124.526 1.00 23.20  ? 226  PHE C CE1 1 
ATOM   6046  C  CE2 . PHE C  1 226 ? 31.655  52.330  126.872 1.00 24.33  ? 226  PHE C CE2 1 
ATOM   6047  C  CZ  . PHE C  1 226 ? 32.294  52.031  125.677 1.00 23.05  ? 226  PHE C CZ  1 
ATOM   6048  N  N   . TYR C  1 227 ? 27.756  49.339  127.639 1.00 29.12  ? 227  TYR C N   1 
ATOM   6049  C  CA  . TYR C  1 227 ? 27.908  48.764  128.967 1.00 27.01  ? 227  TYR C CA  1 
ATOM   6050  C  C   . TYR C  1 227 ? 29.348  48.546  129.342 1.00 28.08  ? 227  TYR C C   1 
ATOM   6051  O  O   . TYR C  1 227 ? 30.185  48.231  128.505 1.00 26.90  ? 227  TYR C O   1 
ATOM   6052  C  CB  . TYR C  1 227 ? 27.148  47.436  129.082 1.00 26.17  ? 227  TYR C CB  1 
ATOM   6053  C  CG  . TYR C  1 227 ? 25.664  47.588  128.852 1.00 27.30  ? 227  TYR C CG  1 
ATOM   6054  C  CD1 . TYR C  1 227 ? 24.952  48.597  129.491 1.00 29.18  ? 227  TYR C CD1 1 
ATOM   6055  C  CD2 . TYR C  1 227 ? 24.969  46.721  128.015 1.00 28.73  ? 227  TYR C CD2 1 
ATOM   6056  C  CE1 . TYR C  1 227 ? 23.586  48.743  129.308 1.00 28.90  ? 227  TYR C CE1 1 
ATOM   6057  C  CE2 . TYR C  1 227 ? 23.590  46.859  127.828 1.00 29.56  ? 227  TYR C CE2 1 
ATOM   6058  C  CZ  . TYR C  1 227 ? 22.917  47.877  128.482 1.00 30.53  ? 227  TYR C CZ  1 
ATOM   6059  O  OH  . TYR C  1 227 ? 21.567  48.049  128.318 1.00 40.76  ? 227  TYR C OH  1 
ATOM   6060  N  N   . VAL C  1 228 ? 29.605  48.702  130.636 1.00 31.14  ? 228  VAL C N   1 
ATOM   6061  C  CA  . VAL C  1 228 ? 30.915  48.540  131.223 1.00 27.81  ? 228  VAL C CA  1 
ATOM   6062  C  C   . VAL C  1 228 ? 30.862  47.557  132.386 1.00 29.95  ? 228  VAL C C   1 
ATOM   6063  O  O   . VAL C  1 228 ? 30.097  47.744  133.338 1.00 32.80  ? 228  VAL C O   1 
ATOM   6064  C  CB  . VAL C  1 228 ? 31.435  49.891  131.753 1.00 26.91  ? 228  VAL C CB  1 
ATOM   6065  C  CG1 . VAL C  1 228 ? 32.820  49.714  132.373 1.00 24.81  ? 228  VAL C CG1 1 
ATOM   6066  C  CG2 . VAL C  1 228 ? 31.475  50.903  130.612 1.00 26.98  ? 228  VAL C CG2 1 
ATOM   6067  N  N   . VAL C  1 229 ? 31.659  46.499  132.305 1.00 27.28  ? 229  VAL C N   1 
ATOM   6068  C  CA  . VAL C  1 229 ? 31.718  45.553  133.401 1.00 28.39  ? 229  VAL C CA  1 
ATOM   6069  C  C   . VAL C  1 229 ? 33.088  45.773  134.028 1.00 31.66  ? 229  VAL C C   1 
ATOM   6070  O  O   . VAL C  1 229 ? 34.102  45.751  133.329 1.00 33.92  ? 229  VAL C O   1 
ATOM   6071  C  CB  . VAL C  1 229 ? 31.553  44.088  132.928 1.00 28.72  ? 229  VAL C CB  1 
ATOM   6072  C  CG1 . VAL C  1 229 ? 30.102  43.856  132.487 1.00 25.12  ? 229  VAL C CG1 1 
ATOM   6073  C  CG2 . VAL C  1 229 ? 32.534  43.775  131.799 1.00 25.94  ? 229  VAL C CG2 1 
ATOM   6074  N  N   . ALA C  1 230 ? 33.117  46.006  135.339 1.00 31.55  ? 230  ALA C N   1 
ATOM   6075  C  CA  . ALA C  1 230 ? 34.371  46.267  136.021 1.00 31.74  ? 230  ALA C CA  1 
ATOM   6076  C  C   . ALA C  1 230 ? 34.296  46.153  137.555 1.00 31.19  ? 230  ALA C C   1 
ATOM   6077  O  O   . ALA C  1 230 ? 33.332  46.592  138.168 1.00 29.45  ? 230  ALA C O   1 
ATOM   6078  C  CB  . ALA C  1 230 ? 34.871  47.665  135.615 1.00 29.12  ? 230  ALA C CB  1 
ATOM   6079  N  N   . GLU C  1 231 ? 35.339  45.589  138.163 1.00 29.31  ? 231  GLU C N   1 
ATOM   6080  C  CA  . GLU C  1 231 ? 35.400  45.420  139.613 1.00 33.34  ? 231  GLU C CA  1 
ATOM   6081  C  C   . GLU C  1 231 ? 35.497  46.758  140.350 1.00 33.13  ? 231  GLU C C   1 
ATOM   6082  O  O   . GLU C  1 231 ? 36.041  47.730  139.826 1.00 31.45  ? 231  GLU C O   1 
ATOM   6083  C  CB  . GLU C  1 231 ? 36.606  44.548  140.013 1.00 37.21  ? 231  GLU C CB  1 
ATOM   6084  C  CG  . GLU C  1 231 ? 36.711  43.181  139.323 1.00 38.41  ? 231  GLU C CG  1 
ATOM   6085  C  CD  . GLU C  1 231 ? 37.418  43.250  137.972 1.00 41.19  ? 231  GLU C CD  1 
ATOM   6086  O  OE1 . GLU C  1 231 ? 36.947  44.004  137.096 1.00 44.32  ? 231  GLU C OE1 1 
ATOM   6087  O  OE2 . GLU C  1 231 ? 38.445  42.554  137.783 1.00 41.04  ? 231  GLU C OE2 1 
ATOM   6088  N  N   . SER C  1 232 ? 34.993  46.796  141.580 1.00 32.67  ? 232  SER C N   1 
ATOM   6089  C  CA  . SER C  1 232 ? 35.027  48.024  142.371 1.00 34.92  ? 232  SER C CA  1 
ATOM   6090  C  C   . SER C  1 232 ? 36.437  48.433  142.817 1.00 33.43  ? 232  SER C C   1 
ATOM   6091  O  O   . SER C  1 232 ? 36.641  49.574  143.250 1.00 34.39  ? 232  SER C O   1 
ATOM   6092  C  CB  . SER C  1 232 ? 34.110  47.909  143.601 1.00 37.77  ? 232  SER C CB  1 
ATOM   6093  O  OG  . SER C  1 232 ? 34.487  46.818  144.433 1.00 42.68  ? 232  SER C OG  1 
ATOM   6094  N  N   . PHE C  1 233 ? 37.411  47.530  142.730 1.00 28.06  ? 233  PHE C N   1 
ATOM   6095  C  CA  . PHE C  1 233 ? 38.752  47.928  143.127 1.00 31.57  ? 233  PHE C CA  1 
ATOM   6096  C  C   . PHE C  1 233 ? 39.409  48.772  142.009 1.00 34.09  ? 233  PHE C C   1 
ATOM   6097  O  O   . PHE C  1 233 ? 40.566  49.167  142.105 1.00 35.32  ? 233  PHE C O   1 
ATOM   6098  C  CB  . PHE C  1 233 ? 39.614  46.706  143.522 1.00 25.90  ? 233  PHE C CB  1 
ATOM   6099  C  CG  . PHE C  1 233 ? 39.881  45.747  142.407 1.00 26.91  ? 233  PHE C CG  1 
ATOM   6100  C  CD1 . PHE C  1 233 ? 40.737  46.085  141.365 1.00 25.71  ? 233  PHE C CD1 1 
ATOM   6101  C  CD2 . PHE C  1 233 ? 39.279  44.494  142.399 1.00 27.76  ? 233  PHE C CD2 1 
ATOM   6102  C  CE1 . PHE C  1 233 ? 40.988  45.182  140.329 1.00 26.39  ? 233  PHE C CE1 1 
ATOM   6103  C  CE2 . PHE C  1 233 ? 39.523  43.586  141.367 1.00 27.85  ? 233  PHE C CE2 1 
ATOM   6104  C  CZ  . PHE C  1 233 ? 40.382  43.933  140.329 1.00 23.52  ? 233  PHE C CZ  1 
ATOM   6105  N  N   . LYS C  1 234 ? 38.651  49.048  140.953 1.00 34.66  ? 234  LYS C N   1 
ATOM   6106  C  CA  . LYS C  1 234 ? 39.151  49.865  139.866 1.00 34.48  ? 234  LYS C CA  1 
ATOM   6107  C  C   . LYS C  1 234 ? 38.633  51.287  140.042 1.00 35.82  ? 234  LYS C C   1 
ATOM   6108  O  O   . LYS C  1 234 ? 38.941  52.169  139.249 1.00 34.01  ? 234  LYS C O   1 
ATOM   6109  C  CB  . LYS C  1 234 ? 38.731  49.299  138.510 1.00 32.50  ? 234  LYS C CB  1 
ATOM   6110  C  CG  . LYS C  1 234 ? 39.557  48.109  138.102 1.00 31.63  ? 234  LYS C CG  1 
ATOM   6111  C  CD  . LYS C  1 234 ? 39.007  47.454  136.860 1.00 33.32  ? 234  LYS C CD  1 
ATOM   6112  C  CE  . LYS C  1 234 ? 39.762  46.165  136.556 1.00 31.84  ? 234  LYS C CE  1 
ATOM   6113  N  NZ  . LYS C  1 234 ? 39.163  45.405  135.417 1.00 30.62  ? 234  LYS C NZ  1 
ATOM   6114  N  N   . PHE C  1 235 ? 37.838  51.509  141.085 1.00 35.59  ? 235  PHE C N   1 
ATOM   6115  C  CA  . PHE C  1 235 ? 37.342  52.849  141.358 1.00 36.26  ? 235  PHE C CA  1 
ATOM   6116  C  C   . PHE C  1 235 ? 38.556  53.639  141.845 1.00 38.33  ? 235  PHE C C   1 
ATOM   6117  O  O   . PHE C  1 235 ? 39.063  53.407  142.945 1.00 40.95  ? 235  PHE C O   1 
ATOM   6118  C  CB  . PHE C  1 235 ? 36.268  52.806  142.438 1.00 36.97  ? 235  PHE C CB  1 
ATOM   6119  C  CG  . PHE C  1 235 ? 34.912  52.397  141.933 1.00 37.87  ? 235  PHE C CG  1 
ATOM   6120  C  CD1 . PHE C  1 235 ? 34.776  51.382  141.000 1.00 37.08  ? 235  PHE C CD1 1 
ATOM   6121  C  CD2 . PHE C  1 235 ? 33.766  53.020  142.410 1.00 37.95  ? 235  PHE C CD2 1 
ATOM   6122  C  CE1 . PHE C  1 235 ? 33.517  50.998  140.549 1.00 38.25  ? 235  PHE C CE1 1 
ATOM   6123  C  CE2 . PHE C  1 235 ? 32.506  52.639  141.960 1.00 35.08  ? 235  PHE C CE2 1 
ATOM   6124  C  CZ  . PHE C  1 235 ? 32.383  51.632  141.033 1.00 36.14  ? 235  PHE C CZ  1 
ATOM   6125  N  N   . VAL C  1 236 ? 39.029  54.569  141.025 1.00 37.61  ? 236  VAL C N   1 
ATOM   6126  C  CA  . VAL C  1 236 ? 40.208  55.346  141.377 1.00 36.47  ? 236  VAL C CA  1 
ATOM   6127  C  C   . VAL C  1 236 ? 39.926  56.836  141.660 1.00 36.26  ? 236  VAL C C   1 
ATOM   6128  O  O   . VAL C  1 236 ? 38.967  57.411  141.128 1.00 35.53  ? 236  VAL C O   1 
ATOM   6129  C  CB  . VAL C  1 236 ? 41.261  55.200  140.255 1.00 36.87  ? 236  VAL C CB  1 
ATOM   6130  C  CG1 . VAL C  1 236 ? 40.751  55.873  138.989 1.00 37.07  ? 236  VAL C CG1 1 
ATOM   6131  C  CG2 . VAL C  1 236 ? 42.592  55.780  140.690 1.00 36.44  ? 236  VAL C CG2 1 
ATOM   6132  N  N   . ARG C  1 237 ? 40.763  57.447  142.504 1.00 34.61  ? 237  ARG C N   1 
ATOM   6133  C  CA  . ARG C  1 237 ? 40.618  58.857  142.863 1.00 34.73  ? 237  ARG C CA  1 
ATOM   6134  C  C   . ARG C  1 237 ? 41.244  59.720  141.766 1.00 36.77  ? 237  ARG C C   1 
ATOM   6135  O  O   . ARG C  1 237 ? 42.413  60.101  141.852 1.00 35.19  ? 237  ARG C O   1 
ATOM   6136  C  CB  . ARG C  1 237 ? 41.331  59.188  144.188 1.00 37.84  ? 237  ARG C CB  1 
ATOM   6137  C  CG  . ARG C  1 237 ? 41.233  58.169  145.341 1.00 40.83  ? 237  ARG C CG  1 
ATOM   6138  C  CD  . ARG C  1 237 ? 40.106  58.447  146.339 1.00 40.43  ? 237  ARG C CD  1 
ATOM   6139  N  NE  . ARG C  1 237 ? 40.260  59.705  147.078 1.00 42.93  ? 237  ARG C NE  1 
ATOM   6140  C  CZ  . ARG C  1 237 ? 41.200  59.967  147.986 1.00 43.31  ? 237  ARG C CZ  1 
ATOM   6141  N  NH1 . ARG C  1 237 ? 42.119  59.063  148.306 1.00 42.70  ? 237  ARG C NH1 1 
ATOM   6142  N  NH2 . ARG C  1 237 ? 41.205  61.149  148.590 1.00 43.11  ? 237  ARG C NH2 1 
ATOM   6143  N  N   . LEU C  1 238 ? 40.465  60.009  140.728 1.00 38.38  ? 238  LEU C N   1 
ATOM   6144  C  CA  . LEU C  1 238 ? 40.897  60.853  139.612 1.00 37.71  ? 238  LEU C CA  1 
ATOM   6145  C  C   . LEU C  1 238 ? 39.632  61.442  139.008 1.00 38.01  ? 238  LEU C C   1 
ATOM   6146  O  O   . LEU C  1 238 ? 38.609  60.766  138.928 1.00 38.51  ? 238  LEU C O   1 
ATOM   6147  C  CB  . LEU C  1 238 ? 41.637  60.037  138.543 1.00 37.62  ? 238  LEU C CB  1 
ATOM   6148  C  CG  . LEU C  1 238 ? 43.013  59.449  138.875 1.00 38.01  ? 238  LEU C CG  1 
ATOM   6149  C  CD1 . LEU C  1 238 ? 43.635  58.837  137.630 1.00 30.88  ? 238  LEU C CD1 1 
ATOM   6150  C  CD2 . LEU C  1 238 ? 43.906  60.546  139.425 1.00 35.39  ? 238  LEU C CD2 1 
ATOM   6151  N  N   . PHE C  1 239 ? 39.683  62.700  138.594 1.00 38.43  ? 239  PHE C N   1 
ATOM   6152  C  CA  . PHE C  1 239 ? 38.506  63.318  138.008 1.00 36.35  ? 239  PHE C CA  1 
ATOM   6153  C  C   . PHE C  1 239 ? 38.834  63.971  136.665 1.00 33.40  ? 239  PHE C C   1 
ATOM   6154  O  O   . PHE C  1 239 ? 38.767  65.191  136.508 1.00 35.67  ? 239  PHE C O   1 
ATOM   6155  C  CB  . PHE C  1 239 ? 37.919  64.346  138.988 1.00 40.29  ? 239  PHE C CB  1 
ATOM   6156  C  CG  . PHE C  1 239 ? 36.442  64.653  138.764 1.00 47.95  ? 239  PHE C CG  1 
ATOM   6157  C  CD1 . PHE C  1 239 ? 35.560  64.718  139.848 1.00 50.47  ? 239  PHE C CD1 1 
ATOM   6158  C  CD2 . PHE C  1 239 ? 35.948  64.937  137.491 1.00 47.69  ? 239  PHE C CD2 1 
ATOM   6159  C  CE1 . PHE C  1 239 ? 34.217  65.067  139.673 1.00 51.23  ? 239  PHE C CE1 1 
ATOM   6160  C  CE2 . PHE C  1 239 ? 34.613  65.284  137.309 1.00 51.10  ? 239  PHE C CE2 1 
ATOM   6161  C  CZ  . PHE C  1 239 ? 33.743  65.351  138.407 1.00 49.76  ? 239  PHE C CZ  1 
ATOM   6162  N  N   . PRO C  1 240 ? 39.216  63.164  135.677 1.00 28.58  ? 240  PRO C N   1 
ATOM   6163  C  CA  . PRO C  1 240 ? 39.518  63.808  134.405 1.00 28.15  ? 240  PRO C CA  1 
ATOM   6164  C  C   . PRO C  1 240 ? 38.241  64.214  133.672 1.00 31.69  ? 240  PRO C C   1 
ATOM   6165  O  O   . PRO C  1 240 ? 37.222  63.519  133.739 1.00 33.76  ? 240  PRO C O   1 
ATOM   6166  C  CB  . PRO C  1 240 ? 40.302  62.734  133.657 1.00 29.07  ? 240  PRO C CB  1 
ATOM   6167  C  CG  . PRO C  1 240 ? 39.711  61.453  134.192 1.00 26.71  ? 240  PRO C CG  1 
ATOM   6168  C  CD  . PRO C  1 240 ? 39.616  61.746  135.666 1.00 27.49  ? 240  PRO C CD  1 
ATOM   6169  N  N   . LEU C  1 241 ? 38.309  65.345  132.975 1.00 31.85  ? 241  LEU C N   1 
ATOM   6170  C  CA  . LEU C  1 241 ? 37.197  65.856  132.190 1.00 30.34  ? 241  LEU C CA  1 
ATOM   6171  C  C   . LEU C  1 241 ? 37.510  65.743  130.686 1.00 31.93  ? 241  LEU C C   1 
ATOM   6172  O  O   . LEU C  1 241 ? 36.626  65.881  129.843 1.00 31.86  ? 241  LEU C O   1 
ATOM   6173  C  CB  . LEU C  1 241 ? 36.941  67.316  132.557 1.00 29.74  ? 241  LEU C CB  1 
ATOM   6174  C  CG  . LEU C  1 241 ? 36.282  67.569  133.915 1.00 32.39  ? 241  LEU C CG  1 
ATOM   6175  C  CD1 . LEU C  1 241 ? 36.278  69.062  134.196 1.00 29.22  ? 241  LEU C CD1 1 
ATOM   6176  C  CD2 . LEU C  1 241 ? 34.853  67.021  133.923 1.00 24.13  ? 241  LEU C CD2 1 
ATOM   6177  N  N   . ASN C  1 242 ? 38.772  65.487  130.356 1.00 31.26  ? 242  ASN C N   1 
ATOM   6178  C  CA  . ASN C  1 242 ? 39.198  65.379  128.967 1.00 30.88  ? 242  ASN C CA  1 
ATOM   6179  C  C   . ASN C  1 242 ? 40.435  64.487  128.951 1.00 30.27  ? 242  ASN C C   1 
ATOM   6180  O  O   . ASN C  1 242 ? 40.902  64.093  130.017 1.00 30.94  ? 242  ASN C O   1 
ATOM   6181  C  CB  . ASN C  1 242 ? 39.556  66.755  128.426 1.00 33.17  ? 242  ASN C CB  1 
ATOM   6182  C  CG  . ASN C  1 242 ? 40.714  67.376  129.176 1.00 38.63  ? 242  ASN C CG  1 
ATOM   6183  O  OD1 . ASN C  1 242 ? 41.746  66.731  129.390 1.00 42.81  ? 242  ASN C OD1 1 
ATOM   6184  N  ND2 . ASN C  1 242 ? 40.554  68.624  129.586 1.00 39.46  ? 242  ASN C ND2 1 
ATOM   6185  N  N   . GLN C  1 243 ? 40.983  64.194  127.770 1.00 25.19  ? 243  GLN C N   1 
ATOM   6186  C  CA  . GLN C  1 243 ? 42.143  63.317  127.693 1.00 28.07  ? 243  GLN C CA  1 
ATOM   6187  C  C   . GLN C  1 243 ? 43.368  63.917  128.379 1.00 31.15  ? 243  GLN C C   1 
ATOM   6188  O  O   . GLN C  1 243 ? 44.083  63.226  129.118 1.00 31.47  ? 243  GLN C O   1 
ATOM   6189  C  CB  . GLN C  1 243 ? 42.476  62.950  126.233 1.00 25.07  ? 243  GLN C CB  1 
ATOM   6190  C  CG  . GLN C  1 243 ? 41.340  62.298  125.418 1.00 21.99  ? 243  GLN C CG  1 
ATOM   6191  C  CD  . GLN C  1 243 ? 40.703  61.074  126.090 1.00 28.61  ? 243  GLN C CD  1 
ATOM   6192  O  OE1 . GLN C  1 243 ? 41.390  60.270  126.712 1.00 33.84  ? 243  GLN C OE1 1 
ATOM   6193  N  NE2 . GLN C  1 243 ? 39.386  60.927  125.947 1.00 25.04  ? 243  GLN C NE2 1 
ATOM   6194  N  N   . GLN C  1 244 ? 43.611  65.199  128.148 1.00 34.47  ? 244  GLN C N   1 
ATOM   6195  C  CA  . GLN C  1 244 ? 44.746  65.876  128.771 1.00 36.54  ? 244  GLN C CA  1 
ATOM   6196  C  C   . GLN C  1 244 ? 44.841  65.599  130.256 1.00 36.12  ? 244  GLN C C   1 
ATOM   6197  O  O   . GLN C  1 244 ? 45.918  65.635  130.821 1.00 36.59  ? 244  GLN C O   1 
ATOM   6198  C  CB  . GLN C  1 244 ? 44.624  67.378  128.633 1.00 39.93  ? 244  GLN C CB  1 
ATOM   6199  C  CG  . GLN C  1 244 ? 45.280  67.976  127.445 1.00 48.42  ? 244  GLN C CG  1 
ATOM   6200  C  CD  . GLN C  1 244 ? 45.242  69.482  127.533 1.00 53.54  ? 244  GLN C CD  1 
ATOM   6201  O  OE1 . GLN C  1 244 ? 45.672  70.182  126.614 1.00 57.14  ? 244  GLN C OE1 1 
ATOM   6202  N  NE2 . GLN C  1 244 ? 44.724  69.995  128.652 1.00 51.32  ? 244  GLN C NE2 1 
ATOM   6203  N  N   . ASP C  1 245 ? 43.709  65.354  130.901 1.00 35.95  ? 245  ASP C N   1 
ATOM   6204  C  CA  . ASP C  1 245 ? 43.724  65.116  132.337 1.00 34.60  ? 245  ASP C CA  1 
ATOM   6205  C  C   . ASP C  1 245 ? 44.214  63.768  132.823 1.00 32.93  ? 245  ASP C C   1 
ATOM   6206  O  O   . ASP C  1 245 ? 44.580  63.649  133.976 1.00 35.71  ? 245  ASP C O   1 
ATOM   6207  C  CB  . ASP C  1 245 ? 42.351  65.416  132.920 1.00 32.71  ? 245  ASP C CB  1 
ATOM   6208  C  CG  . ASP C  1 245 ? 41.909  66.811  132.609 1.00 32.80  ? 245  ASP C CG  1 
ATOM   6209  O  OD1 . ASP C  1 245 ? 42.805  67.665  132.431 1.00 33.36  ? 245  ASP C OD1 1 
ATOM   6210  O  OD2 . ASP C  1 245 ? 40.687  67.060  132.544 1.00 35.34  ? 245  ASP C OD2 1 
ATOM   6211  N  N   . VAL C  1 246 ? 44.225  62.749  131.975 1.00 33.69  ? 246  VAL C N   1 
ATOM   6212  C  CA  . VAL C  1 246 ? 44.727  61.449  132.415 1.00 35.50  ? 246  VAL C CA  1 
ATOM   6213  C  C   . VAL C  1 246 ? 46.246  61.573  132.644 1.00 35.59  ? 246  VAL C C   1 
ATOM   6214  O  O   . VAL C  1 246 ? 46.972  62.050  131.766 1.00 38.61  ? 246  VAL C O   1 
ATOM   6215  C  CB  . VAL C  1 246 ? 44.430  60.349  131.369 1.00 32.57  ? 246  VAL C CB  1 
ATOM   6216  C  CG1 . VAL C  1 246 ? 45.108  59.051  131.768 1.00 32.34  ? 246  VAL C CG1 1 
ATOM   6217  C  CG2 . VAL C  1 246 ? 42.930  60.131  131.278 1.00 30.07  ? 246  VAL C CG2 1 
ATOM   6218  N  N   . PRO C  1 247 ? 46.742  61.150  133.828 1.00 35.77  ? 247  PRO C N   1 
ATOM   6219  C  CA  . PRO C  1 247 ? 48.172  61.234  134.149 1.00 33.68  ? 247  PRO C CA  1 
ATOM   6220  C  C   . PRO C  1 247 ? 49.027  60.407  133.212 1.00 35.17  ? 247  PRO C C   1 
ATOM   6221  O  O   . PRO C  1 247 ? 48.679  59.280  132.862 1.00 35.67  ? 247  PRO C O   1 
ATOM   6222  C  CB  . PRO C  1 247 ? 48.246  60.713  135.583 1.00 30.54  ? 247  PRO C CB  1 
ATOM   6223  C  CG  . PRO C  1 247 ? 46.894  60.933  136.123 1.00 28.51  ? 247  PRO C CG  1 
ATOM   6224  C  CD  . PRO C  1 247 ? 46.008  60.558  134.957 1.00 35.51  ? 247  PRO C CD  1 
ATOM   6225  N  N   . ASP C  1 248 ? 50.158  60.971  132.818 1.00 36.76  ? 248  ASP C N   1 
ATOM   6226  C  CA  . ASP C  1 248 ? 51.064  60.284  131.923 1.00 39.26  ? 248  ASP C CA  1 
ATOM   6227  C  C   . ASP C  1 248 ? 51.458  58.922  132.460 1.00 38.10  ? 248  ASP C C   1 
ATOM   6228  O  O   . ASP C  1 248 ? 51.612  57.985  131.692 1.00 38.53  ? 248  ASP C O   1 
ATOM   6229  C  CB  . ASP C  1 248 ? 52.301  61.143  131.685 1.00 43.08  ? 248  ASP C CB  1 
ATOM   6230  C  CG  . ASP C  1 248 ? 52.000  62.376  130.844 1.00 48.99  ? 248  ASP C CG  1 
ATOM   6231  O  OD1 . ASP C  1 248 ? 50.812  62.611  130.517 1.00 51.83  ? 248  ASP C OD1 1 
ATOM   6232  O  OD2 . ASP C  1 248 ? 52.951  63.111  130.507 1.00 50.91  ? 248  ASP C OD2 1 
ATOM   6233  N  N   . LYS C  1 249 ? 51.609  58.811  133.776 1.00 40.24  ? 249  LYS C N   1 
ATOM   6234  C  CA  . LYS C  1 249 ? 51.990  57.540  134.406 1.00 42.56  ? 249  LYS C CA  1 
ATOM   6235  C  C   . LYS C  1 249 ? 51.051  56.402  134.021 1.00 44.02  ? 249  LYS C C   1 
ATOM   6236  O  O   . LYS C  1 249 ? 51.461  55.235  133.996 1.00 44.25  ? 249  LYS C O   1 
ATOM   6237  C  CB  . LYS C  1 249 ? 52.005  57.669  135.937 1.00 42.83  ? 249  LYS C CB  1 
ATOM   6238  C  CG  . LYS C  1 249 ? 50.631  57.846  136.561 1.00 44.90  ? 249  LYS C CG  1 
ATOM   6239  C  CD  . LYS C  1 249 ? 50.709  58.268  138.025 1.00 47.87  ? 249  LYS C CD  1 
ATOM   6240  C  CE  . LYS C  1 249 ? 51.187  57.129  138.916 1.00 54.78  ? 249  LYS C CE  1 
ATOM   6241  N  NZ  . LYS C  1 249 ? 50.876  57.358  140.372 1.00 56.53  ? 249  LYS C NZ  1 
ATOM   6242  N  N   . PHE C  1 250 ? 49.796  56.742  133.725 1.00 44.13  ? 250  PHE C N   1 
ATOM   6243  C  CA  . PHE C  1 250 ? 48.804  55.740  133.342 1.00 43.66  ? 250  PHE C CA  1 
ATOM   6244  C  C   . PHE C  1 250 ? 48.677  55.495  131.825 1.00 44.14  ? 250  PHE C C   1 
ATOM   6245  O  O   . PHE C  1 250 ? 48.310  54.392  131.404 1.00 46.11  ? 250  PHE C O   1 
ATOM   6246  C  CB  . PHE C  1 250 ? 47.437  56.112  133.922 1.00 42.39  ? 250  PHE C CB  1 
ATOM   6247  C  CG  . PHE C  1 250 ? 47.421  56.232  135.423 1.00 41.70  ? 250  PHE C CG  1 
ATOM   6248  C  CD1 . PHE C  1 250 ? 46.839  57.344  136.040 1.00 42.28  ? 250  PHE C CD1 1 
ATOM   6249  C  CD2 . PHE C  1 250 ? 47.991  55.246  136.225 1.00 41.46  ? 250  PHE C CD2 1 
ATOM   6250  C  CE1 . PHE C  1 250 ? 46.826  57.475  137.435 1.00 40.79  ? 250  PHE C CE1 1 
ATOM   6251  C  CE2 . PHE C  1 250 ? 47.982  55.368  137.629 1.00 42.13  ? 250  PHE C CE2 1 
ATOM   6252  C  CZ  . PHE C  1 250 ? 47.399  56.485  138.232 1.00 39.23  ? 250  PHE C CZ  1 
ATOM   6253  N  N   . LYS C  1 251 ? 48.995  56.488  130.996 1.00 43.76  ? 251  LYS C N   1 
ATOM   6254  C  CA  . LYS C  1 251 ? 48.872  56.284  129.552 1.00 43.02  ? 251  LYS C CA  1 
ATOM   6255  C  C   . LYS C  1 251 ? 50.115  55.894  128.747 1.00 43.84  ? 251  LYS C C   1 
ATOM   6256  O  O   . LYS C  1 251 ? 50.001  55.545  127.576 1.00 43.18  ? 251  LYS C O   1 
ATOM   6257  C  CB  . LYS C  1 251 ? 48.217  57.499  128.903 1.00 42.09  ? 251  LYS C CB  1 
ATOM   6258  C  CG  . LYS C  1 251 ? 49.072  58.717  128.847 1.00 39.21  ? 251  LYS C CG  1 
ATOM   6259  C  CD  . LYS C  1 251 ? 48.363  59.839  128.113 1.00 35.85  ? 251  LYS C CD  1 
ATOM   6260  C  CE  . LYS C  1 251 ? 47.143  60.330  128.858 1.00 30.91  ? 251  LYS C CE  1 
ATOM   6261  N  NZ  . LYS C  1 251 ? 46.681  61.596  128.244 1.00 31.02  ? 251  LYS C NZ  1 
ATOM   6262  N  N   . TYR C  1 252 ? 51.298  55.936  129.344 1.00 45.18  ? 252  TYR C N   1 
ATOM   6263  C  CA  . TYR C  1 252 ? 52.488  55.541  128.598 1.00 49.87  ? 252  TYR C CA  1 
ATOM   6264  C  C   . TYR C  1 252 ? 53.241  54.384  129.259 1.00 54.06  ? 252  TYR C C   1 
ATOM   6265  O  O   . TYR C  1 252 ? 53.485  54.391  130.466 1.00 56.08  ? 252  TYR C O   1 
ATOM   6266  C  CB  . TYR C  1 252 ? 53.408  56.743  128.392 1.00 46.89  ? 252  TYR C CB  1 
ATOM   6267  C  CG  . TYR C  1 252 ? 52.747  57.859  127.617 1.00 41.99  ? 252  TYR C CG  1 
ATOM   6268  C  CD1 . TYR C  1 252 ? 52.334  59.025  128.253 1.00 38.57  ? 252  TYR C CD1 1 
ATOM   6269  C  CD2 . TYR C  1 252 ? 52.488  57.723  126.253 1.00 41.65  ? 252  TYR C CD2 1 
ATOM   6270  C  CE1 . TYR C  1 252 ? 51.674  60.034  127.553 1.00 38.64  ? 252  TYR C CE1 1 
ATOM   6271  C  CE2 . TYR C  1 252 ? 51.823  58.724  125.537 1.00 41.58  ? 252  TYR C CE2 1 
ATOM   6272  C  CZ  . TYR C  1 252 ? 51.412  59.881  126.196 1.00 40.97  ? 252  TYR C CZ  1 
ATOM   6273  O  OH  . TYR C  1 252 ? 50.704  60.858  125.506 1.00 37.71  ? 252  TYR C OH  1 
ATOM   6274  N  N   . LYS C  1 253 ? 53.596  53.391  128.445 1.00 58.50  ? 253  LYS C N   1 
ATOM   6275  C  CA  . LYS C  1 253 ? 54.291  52.182  128.891 1.00 61.06  ? 253  LYS C CA  1 
ATOM   6276  C  C   . LYS C  1 253 ? 53.298  51.239  129.569 1.00 62.60  ? 253  LYS C C   1 
ATOM   6277  O  O   . LYS C  1 253 ? 52.415  50.658  128.922 1.00 62.62  ? 253  LYS C O   1 
ATOM   6278  C  CB  . LYS C  1 253 ? 55.434  52.515  129.864 1.00 63.42  ? 253  LYS C CB  1 
ATOM   6279  C  CG  . LYS C  1 253 ? 56.632  53.207  129.227 1.00 66.55  ? 253  LYS C CG  1 
ATOM   6280  C  CD  . LYS C  1 253 ? 57.261  52.345  128.143 1.00 69.05  ? 253  LYS C CD  1 
ATOM   6281  C  CE  . LYS C  1 253 ? 58.390  53.086  127.445 1.00 71.83  ? 253  LYS C CE  1 
ATOM   6282  N  NZ  . LYS C  1 253 ? 58.912  52.347  126.266 1.00 72.88  ? 253  LYS C NZ  1 
ATOM   6283  N  N   . GLN C  1 264 ? 58.358  69.865  109.709 1.00 85.62  ? 264  GLN C N   1 
ATOM   6284  C  CA  . GLN C  1 264 ? 59.292  69.405  110.721 1.00 82.92  ? 264  GLN C CA  1 
ATOM   6285  C  C   . GLN C  1 264 ? 59.139  67.903  110.947 1.00 80.71  ? 264  GLN C C   1 
ATOM   6286  O  O   . GLN C  1 264 ? 58.177  67.285  110.477 1.00 79.15  ? 264  GLN C O   1 
ATOM   6287  C  CB  . GLN C  1 264 ? 59.080  70.198  112.014 1.00 84.17  ? 264  GLN C CB  1 
ATOM   6288  C  CG  . GLN C  1 264 ? 59.287  71.701  111.809 1.00 85.68  ? 264  GLN C CG  1 
ATOM   6289  C  CD  . GLN C  1 264 ? 58.908  72.536  113.018 1.00 87.34  ? 264  GLN C CD  1 
ATOM   6290  O  OE1 . GLN C  1 264 ? 59.073  73.759  113.014 1.00 85.13  ? 264  GLN C OE1 1 
ATOM   6291  N  NE2 . GLN C  1 264 ? 58.394  71.881  114.062 1.00 87.08  ? 264  GLN C NE2 1 
ATOM   6292  N  N   . ASP C  1 265 ? 60.100  67.330  111.666 1.00 78.55  ? 265  ASP C N   1 
ATOM   6293  C  CA  . ASP C  1 265 ? 60.136  65.897  111.936 1.00 75.52  ? 265  ASP C CA  1 
ATOM   6294  C  C   . ASP C  1 265 ? 58.804  65.159  112.133 1.00 72.12  ? 265  ASP C C   1 
ATOM   6295  O  O   . ASP C  1 265 ? 57.763  65.742  112.469 1.00 68.24  ? 265  ASP C O   1 
ATOM   6296  C  CB  . ASP C  1 265 ? 61.092  65.605  113.111 1.00 75.88  ? 265  ASP C CB  1 
ATOM   6297  C  CG  . ASP C  1 265 ? 60.736  66.371  114.371 1.00 77.81  ? 265  ASP C CG  1 
ATOM   6298  O  OD1 . ASP C  1 265 ? 60.522  67.603  114.278 1.00 78.43  ? 265  ASP C OD1 1 
ATOM   6299  O  OD2 . ASP C  1 265 ? 60.686  65.744  115.457 1.00 77.26  ? 265  ASP C OD2 1 
ATOM   6300  N  N   . LEU C  1 266 ? 58.874  63.856  111.883 1.00 67.85  ? 266  LEU C N   1 
ATOM   6301  C  CA  . LEU C  1 266 ? 57.748  62.952  111.995 1.00 65.07  ? 266  LEU C CA  1 
ATOM   6302  C  C   . LEU C  1 266 ? 57.701  62.425  113.428 1.00 63.75  ? 266  LEU C C   1 
ATOM   6303  O  O   . LEU C  1 266 ? 58.500  61.571  113.811 1.00 63.31  ? 266  LEU C O   1 
ATOM   6304  C  CB  . LEU C  1 266 ? 57.940  61.810  110.987 1.00 63.92  ? 266  LEU C CB  1 
ATOM   6305  C  CG  . LEU C  1 266 ? 56.978  60.628  110.846 1.00 62.44  ? 266  LEU C CG  1 
ATOM   6306  C  CD1 . LEU C  1 266 ? 57.382  59.834  109.613 1.00 64.34  ? 266  LEU C CD1 1 
ATOM   6307  C  CD2 . LEU C  1 266 ? 57.019  59.729  112.075 1.00 62.78  ? 266  LEU C CD2 1 
ATOM   6308  N  N   . LYS C  1 267 ? 56.766  62.946  114.217 1.00 61.72  ? 267  LYS C N   1 
ATOM   6309  C  CA  . LYS C  1 267 ? 56.610  62.528  115.604 1.00 59.26  ? 267  LYS C CA  1 
ATOM   6310  C  C   . LYS C  1 267 ? 55.631  61.352  115.679 1.00 58.14  ? 267  LYS C C   1 
ATOM   6311  O  O   . LYS C  1 267 ? 55.019  60.968  114.679 1.00 57.62  ? 267  LYS C O   1 
ATOM   6312  C  CB  . LYS C  1 267 ? 56.092  63.700  116.440 1.00 61.38  ? 267  LYS C CB  1 
ATOM   6313  C  CG  . LYS C  1 267 ? 56.268  63.546  117.952 1.00 66.59  ? 267  LYS C CG  1 
ATOM   6314  C  CD  . LYS C  1 267 ? 57.727  63.695  118.370 1.00 69.33  ? 267  LYS C CD  1 
ATOM   6315  C  CE  . LYS C  1 267 ? 58.285  65.070  117.999 1.00 69.94  ? 267  LYS C CE  1 
ATOM   6316  N  NZ  . LYS C  1 267 ? 59.769  65.140  118.173 1.00 69.98  ? 267  LYS C NZ  1 
ATOM   6317  N  N   . GLU C  1 268 ? 55.479  60.781  116.866 1.00 56.80  ? 268  GLU C N   1 
ATOM   6318  C  CA  . GLU C  1 268 ? 54.580  59.645  117.045 1.00 54.69  ? 268  GLU C CA  1 
ATOM   6319  C  C   . GLU C  1 268 ? 54.046  59.659  118.477 1.00 53.54  ? 268  GLU C C   1 
ATOM   6320  O  O   . GLU C  1 268 ? 54.813  59.807  119.429 1.00 52.80  ? 268  GLU C O   1 
ATOM   6321  C  CB  . GLU C  1 268 ? 55.348  58.348  116.780 1.00 53.69  ? 268  GLU C CB  1 
ATOM   6322  C  CG  . GLU C  1 268 ? 54.575  57.256  116.071 1.00 56.37  ? 268  GLU C CG  1 
ATOM   6323  C  CD  . GLU C  1 268 ? 55.487  56.131  115.583 1.00 59.38  ? 268  GLU C CD  1 
ATOM   6324  O  OE1 . GLU C  1 268 ? 56.171  55.505  116.422 1.00 59.74  ? 268  GLU C OE1 1 
ATOM   6325  O  OE2 . GLU C  1 268 ? 55.525  55.877  114.359 1.00 59.75  ? 268  GLU C OE2 1 
ATOM   6326  N  N   . GLU C  1 269 ? 52.733  59.521  118.626 1.00 52.87  ? 269  GLU C N   1 
ATOM   6327  C  CA  . GLU C  1 269 ? 52.115  59.511  119.950 1.00 52.48  ? 269  GLU C CA  1 
ATOM   6328  C  C   . GLU C  1 269 ? 51.425  58.164  120.186 1.00 50.76  ? 269  GLU C C   1 
ATOM   6329  O  O   . GLU C  1 269 ? 50.634  57.719  119.356 1.00 52.20  ? 269  GLU C O   1 
ATOM   6330  C  CB  . GLU C  1 269 ? 51.098  60.657  120.068 1.00 53.55  ? 269  GLU C CB  1 
ATOM   6331  C  CG  . GLU C  1 269 ? 50.797  61.071  121.498 1.00 56.07  ? 269  GLU C CG  1 
ATOM   6332  C  CD  . GLU C  1 269 ? 49.954  62.329  121.581 1.00 60.38  ? 269  GLU C CD  1 
ATOM   6333  O  OE1 . GLU C  1 269 ? 50.262  63.303  120.855 1.00 59.43  ? 269  GLU C OE1 1 
ATOM   6334  O  OE2 . GLU C  1 269 ? 48.994  62.349  122.385 1.00 62.84  ? 269  GLU C OE2 1 
ATOM   6335  N  N   . HIS C  1 270 ? 51.727  57.516  121.312 1.00 48.90  ? 270  HIS C N   1 
ATOM   6336  C  CA  . HIS C  1 270 ? 51.124  56.222  121.609 1.00 47.32  ? 270  HIS C CA  1 
ATOM   6337  C  C   . HIS C  1 270 ? 50.551  56.050  123.002 1.00 41.99  ? 270  HIS C C   1 
ATOM   6338  O  O   . HIS C  1 270 ? 51.173  55.450  123.864 1.00 40.37  ? 270  HIS C O   1 
ATOM   6339  C  CB  . HIS C  1 270 ? 52.119  55.084  121.363 1.00 51.22  ? 270  HIS C CB  1 
ATOM   6340  C  CG  . HIS C  1 270 ? 52.515  54.926  119.931 1.00 59.89  ? 270  HIS C CG  1 
ATOM   6341  N  ND1 . HIS C  1 270 ? 51.591  54.802  118.914 1.00 61.82  ? 270  HIS C ND1 1 
ATOM   6342  C  CD2 . HIS C  1 270 ? 53.734  54.889  119.340 1.00 61.55  ? 270  HIS C CD2 1 
ATOM   6343  C  CE1 . HIS C  1 270 ? 52.225  54.698  117.758 1.00 63.77  ? 270  HIS C CE1 1 
ATOM   6344  N  NE2 . HIS C  1 270 ? 53.526  54.747  117.989 1.00 64.84  ? 270  HIS C NE2 1 
ATOM   6345  N  N   . PRO C  1 271 ? 49.358  56.588  123.248 1.00 38.49  ? 271  PRO C N   1 
ATOM   6346  C  CA  . PRO C  1 271 ? 48.818  56.393  124.589 1.00 37.03  ? 271  PRO C CA  1 
ATOM   6347  C  C   . PRO C  1 271 ? 48.180  54.999  124.610 1.00 34.56  ? 271  PRO C C   1 
ATOM   6348  O  O   . PRO C  1 271 ? 47.568  54.595  123.633 1.00 35.49  ? 271  PRO C O   1 
ATOM   6349  C  CB  . PRO C  1 271 ? 47.801  57.522  124.709 1.00 37.83  ? 271  PRO C CB  1 
ATOM   6350  C  CG  . PRO C  1 271 ? 47.313  57.687  123.293 1.00 36.53  ? 271  PRO C CG  1 
ATOM   6351  C  CD  . PRO C  1 271 ? 48.585  57.593  122.498 1.00 39.11  ? 271  PRO C CD  1 
ATOM   6352  N  N   . TRP C  1 272 ? 48.341  54.268  125.709 1.00 33.68  ? 272  TRP C N   1 
ATOM   6353  C  CA  . TRP C  1 272 ? 47.782  52.923  125.838 1.00 32.47  ? 272  TRP C CA  1 
ATOM   6354  C  C   . TRP C  1 272 ? 46.328  52.904  126.298 1.00 29.84  ? 272  TRP C C   1 
ATOM   6355  O  O   . TRP C  1 272 ? 45.646  51.890  126.175 1.00 28.82  ? 272  TRP C O   1 
ATOM   6356  C  CB  . TRP C  1 272 ? 48.621  52.079  126.811 1.00 35.07  ? 272  TRP C CB  1 
ATOM   6357  C  CG  . TRP C  1 272 ? 49.815  51.438  126.169 1.00 40.31  ? 272  TRP C CG  1 
ATOM   6358  C  CD1 . TRP C  1 272 ? 51.026  52.026  125.886 1.00 42.05  ? 272  TRP C CD1 1 
ATOM   6359  C  CD2 . TRP C  1 272 ? 49.880  50.115  125.628 1.00 38.42  ? 272  TRP C CD2 1 
ATOM   6360  N  NE1 . TRP C  1 272 ? 51.829  51.148  125.193 1.00 38.82  ? 272  TRP C NE1 1 
ATOM   6361  C  CE2 . TRP C  1 272 ? 51.149  49.971  125.020 1.00 38.16  ? 272  TRP C CE2 1 
ATOM   6362  C  CE3 . TRP C  1 272 ? 48.986  49.039  125.595 1.00 36.52  ? 272  TRP C CE3 1 
ATOM   6363  C  CZ2 . TRP C  1 272 ? 51.541  48.793  124.382 1.00 38.86  ? 272  TRP C CZ2 1 
ATOM   6364  C  CZ3 . TRP C  1 272 ? 49.378  47.867  124.961 1.00 35.08  ? 272  TRP C CZ3 1 
ATOM   6365  C  CH2 . TRP C  1 272 ? 50.643  47.755  124.362 1.00 38.57  ? 272  TRP C CH2 1 
ATOM   6366  N  N   . VAL C  1 273 ? 45.863  54.019  126.846 1.00 27.26  ? 273  VAL C N   1 
ATOM   6367  C  CA  . VAL C  1 273 ? 44.493  54.121  127.322 1.00 26.40  ? 273  VAL C CA  1 
ATOM   6368  C  C   . VAL C  1 273 ? 43.929  55.477  126.927 1.00 27.87  ? 273  VAL C C   1 
ATOM   6369  O  O   . VAL C  1 273 ? 44.684  56.377  126.571 1.00 28.30  ? 273  VAL C O   1 
ATOM   6370  C  CB  . VAL C  1 273 ? 44.418  54.016  128.864 1.00 24.39  ? 273  VAL C CB  1 
ATOM   6371  C  CG1 . VAL C  1 273 ? 44.998  52.703  129.339 1.00 24.21  ? 273  VAL C CG1 1 
ATOM   6372  C  CG2 . VAL C  1 273 ? 45.157  55.179  129.500 1.00 22.96  ? 273  VAL C CG2 1 
ATOM   6373  N  N   . ASP C  1 274 ? 42.606  55.613  126.973 1.00 28.75  ? 274  ASP C N   1 
ATOM   6374  C  CA  . ASP C  1 274 ? 41.935  56.889  126.694 1.00 26.26  ? 274  ASP C CA  1 
ATOM   6375  C  C   . ASP C  1 274 ? 40.808  57.007  127.728 1.00 23.21  ? 274  ASP C C   1 
ATOM   6376  O  O   . ASP C  1 274 ? 40.521  56.048  128.433 1.00 23.06  ? 274  ASP C O   1 
ATOM   6377  C  CB  . ASP C  1 274 ? 41.391  56.961  125.250 1.00 26.24  ? 274  ASP C CB  1 
ATOM   6378  C  CG  . ASP C  1 274 ? 40.430  55.832  124.915 1.00 31.36  ? 274  ASP C CG  1 
ATOM   6379  O  OD1 . ASP C  1 274 ? 39.724  55.342  125.821 1.00 37.03  ? 274  ASP C OD1 1 
ATOM   6380  O  OD2 . ASP C  1 274 ? 40.364  55.444  123.732 1.00 31.01  ? 274  ASP C OD2 1 
ATOM   6381  N  N   . TYR C  1 275 ? 40.189  58.172  127.844 1.00 20.46  ? 275  TYR C N   1 
ATOM   6382  C  CA  . TYR C  1 275 ? 39.125  58.346  128.823 1.00 22.68  ? 275  TYR C CA  1 
ATOM   6383  C  C   . TYR C  1 275 ? 37.775  58.394  128.124 1.00 23.30  ? 275  TYR C C   1 
ATOM   6384  O  O   . TYR C  1 275 ? 37.664  58.937  127.035 1.00 23.28  ? 275  TYR C O   1 
ATOM   6385  C  CB  . TYR C  1 275 ? 39.389  59.620  129.638 1.00 21.80  ? 275  TYR C CB  1 
ATOM   6386  C  CG  . TYR C  1 275 ? 38.179  60.323  130.207 1.00 21.86  ? 275  TYR C CG  1 
ATOM   6387  C  CD1 . TYR C  1 275 ? 37.493  59.820  131.310 1.00 26.63  ? 275  TYR C CD1 1 
ATOM   6388  C  CD2 . TYR C  1 275 ? 37.753  61.530  129.671 1.00 24.04  ? 275  TYR C CD2 1 
ATOM   6389  C  CE1 . TYR C  1 275 ? 36.403  60.518  131.871 1.00 26.55  ? 275  TYR C CE1 1 
ATOM   6390  C  CE2 . TYR C  1 275 ? 36.680  62.231  130.214 1.00 27.64  ? 275  TYR C CE2 1 
ATOM   6391  C  CZ  . TYR C  1 275 ? 36.007  61.727  131.309 1.00 29.56  ? 275  TYR C CZ  1 
ATOM   6392  O  OH  . TYR C  1 275 ? 34.940  62.443  131.814 1.00 31.15  ? 275  TYR C OH  1 
ATOM   6393  N  N   . THR C  1 276 ? 36.766  57.784  128.743 1.00 23.13  ? 276  THR C N   1 
ATOM   6394  C  CA  . THR C  1 276 ? 35.421  57.761  128.186 1.00 21.25  ? 276  THR C CA  1 
ATOM   6395  C  C   . THR C  1 276 ? 34.507  58.446  129.181 1.00 22.38  ? 276  THR C C   1 
ATOM   6396  O  O   . THR C  1 276 ? 34.298  57.951  130.288 1.00 26.32  ? 276  THR C O   1 
ATOM   6397  C  CB  . THR C  1 276 ? 34.930  56.313  127.934 1.00 21.13  ? 276  THR C CB  1 
ATOM   6398  O  OG1 . THR C  1 276 ? 35.802  55.673  126.998 1.00 28.62  ? 276  THR C OG1 1 
ATOM   6399  C  CG2 . THR C  1 276 ? 33.539  56.310  127.336 1.00 20.05  ? 276  THR C CG2 1 
ATOM   6400  N  N   . ALA C  1 277 ? 33.978  59.596  128.778 1.00 19.74  ? 277  ALA C N   1 
ATOM   6401  C  CA  . ALA C  1 277 ? 33.098  60.396  129.615 1.00 21.68  ? 277  ALA C CA  1 
ATOM   6402  C  C   . ALA C  1 277 ? 31.834  59.663  130.041 1.00 25.06  ? 277  ALA C C   1 
ATOM   6403  O  O   . ALA C  1 277 ? 31.330  58.780  129.332 1.00 25.62  ? 277  ALA C O   1 
ATOM   6404  C  CB  . ALA C  1 277 ? 32.720  61.690  128.877 1.00 20.80  ? 277  ALA C CB  1 
ATOM   6405  N  N   . PRO C  1 278 ? 31.293  60.032  131.213 1.00 26.65  ? 278  PRO C N   1 
ATOM   6406  C  CA  . PRO C  1 278 ? 30.071  59.422  131.755 1.00 23.94  ? 278  PRO C CA  1 
ATOM   6407  C  C   . PRO C  1 278 ? 28.880  59.526  130.809 1.00 23.48  ? 278  PRO C C   1 
ATOM   6408  O  O   . PRO C  1 278 ? 28.032  58.627  130.757 1.00 23.97  ? 278  PRO C O   1 
ATOM   6409  C  CB  . PRO C  1 278 ? 29.855  60.177  133.069 1.00 20.00  ? 278  PRO C CB  1 
ATOM   6410  C  CG  . PRO C  1 278 ? 30.627  61.452  132.882 1.00 15.23  ? 278  PRO C CG  1 
ATOM   6411  C  CD  . PRO C  1 278 ? 31.846  61.020  132.157 1.00 23.52  ? 278  PRO C CD  1 
ATOM   6412  N  N   . SER C  1 279 ? 28.828  60.617  130.054 1.00 22.13  ? 279  SER C N   1 
ATOM   6413  C  CA  . SER C  1 279 ? 27.742  60.831  129.102 1.00 21.29  ? 279  SER C CA  1 
ATOM   6414  C  C   . SER C  1 279 ? 27.713  59.778  127.992 1.00 21.94  ? 279  SER C C   1 
ATOM   6415  O  O   . SER C  1 279 ? 26.710  59.623  127.292 1.00 23.72  ? 279  SER C O   1 
ATOM   6416  C  CB  . SER C  1 279 ? 27.850  62.233  128.497 1.00 22.42  ? 279  SER C CB  1 
ATOM   6417  O  OG  . SER C  1 279 ? 29.136  62.494  127.957 1.00 25.67  ? 279  SER C OG  1 
ATOM   6418  N  N   . LEU C  1 280 ? 28.811  59.049  127.835 1.00 23.29  ? 280  LEU C N   1 
ATOM   6419  C  CA  . LEU C  1 280 ? 28.895  58.005  126.822 1.00 23.82  ? 280  LEU C CA  1 
ATOM   6420  C  C   . LEU C  1 280 ? 28.629  56.599  127.365 1.00 27.18  ? 280  LEU C C   1 
ATOM   6421  O  O   . LEU C  1 280 ? 28.617  55.629  126.601 1.00 30.89  ? 280  LEU C O   1 
ATOM   6422  C  CB  . LEU C  1 280 ? 30.260  58.061  126.165 1.00 19.53  ? 280  LEU C CB  1 
ATOM   6423  C  CG  . LEU C  1 280 ? 30.405  59.461  125.568 1.00 23.40  ? 280  LEU C CG  1 
ATOM   6424  C  CD1 . LEU C  1 280 ? 31.848  59.734  125.121 1.00 19.68  ? 280  LEU C CD1 1 
ATOM   6425  C  CD2 . LEU C  1 280 ? 29.426  59.572  124.412 1.00 16.67  ? 280  LEU C CD2 1 
ATOM   6426  N  N   . ILE C  1 281 ? 28.398  56.489  128.675 1.00 27.59  ? 281  ILE C N   1 
ATOM   6427  C  CA  . ILE C  1 281 ? 28.144  55.194  129.301 1.00 27.30  ? 281  ILE C CA  1 
ATOM   6428  C  C   . ILE C  1 281 ? 26.696  55.037  129.764 1.00 27.04  ? 281  ILE C C   1 
ATOM   6429  O  O   . ILE C  1 281 ? 26.153  55.908  130.446 1.00 24.96  ? 281  ILE C O   1 
ATOM   6430  C  CB  . ILE C  1 281 ? 29.073  54.975  130.524 1.00 27.20  ? 281  ILE C CB  1 
ATOM   6431  C  CG1 . ILE C  1 281 ? 30.536  55.085  130.089 1.00 19.63  ? 281  ILE C CG1 1 
ATOM   6432  C  CG2 . ILE C  1 281 ? 28.778  53.608  131.173 1.00 18.11  ? 281  ILE C CG2 1 
ATOM   6433  C  CD1 . ILE C  1 281 ? 31.507  54.990  131.244 1.00 16.46  ? 281  ILE C CD1 1 
ATOM   6434  N  N   . THR C  1 282 ? 26.087  53.913  129.392 1.00 27.37  ? 282  THR C N   1 
ATOM   6435  C  CA  . THR C  1 282 ? 24.700  53.617  129.756 1.00 26.57  ? 282  THR C CA  1 
ATOM   6436  C  C   . THR C  1 282 ? 24.627  53.079  131.189 1.00 27.53  ? 282  THR C C   1 
ATOM   6437  O  O   . THR C  1 282 ? 23.905  53.604  132.030 1.00 25.92  ? 282  THR C O   1 
ATOM   6438  C  CB  . THR C  1 282 ? 24.091  52.558  128.802 1.00 24.90  ? 282  THR C CB  1 
ATOM   6439  O  OG1 . THR C  1 282 ? 24.221  53.000  127.446 1.00 26.84  ? 282  THR C OG1 1 
ATOM   6440  C  CG2 . THR C  1 282 ? 22.613  52.343  129.108 1.00 21.69  ? 282  THR C CG2 1 
ATOM   6441  N  N   . LEU C  1 283 ? 25.382  52.023  131.453 1.00 27.08  ? 283  LEU C N   1 
ATOM   6442  C  CA  . LEU C  1 283 ? 25.408  51.417  132.767 1.00 27.48  ? 283  LEU C CA  1 
ATOM   6443  C  C   . LEU C  1 283 ? 26.738  50.776  133.049 1.00 29.10  ? 283  LEU C C   1 
ATOM   6444  O  O   . LEU C  1 283 ? 27.396  50.274  132.146 1.00 26.73  ? 283  LEU C O   1 
ATOM   6445  C  CB  . LEU C  1 283 ? 24.343  50.331  132.876 1.00 25.23  ? 283  LEU C CB  1 
ATOM   6446  C  CG  . LEU C  1 283 ? 22.900  50.803  132.893 1.00 23.41  ? 283  LEU C CG  1 
ATOM   6447  C  CD1 . LEU C  1 283 ? 21.971  49.598  132.844 1.00 19.21  ? 283  LEU C CD1 1 
ATOM   6448  C  CD2 . LEU C  1 283 ? 22.674  51.619  134.154 1.00 17.89  ? 283  LEU C CD2 1 
ATOM   6449  N  N   . LEU C  1 284 ? 27.124  50.797  134.318 1.00 34.38  ? 284  LEU C N   1 
ATOM   6450  C  CA  . LEU C  1 284 ? 28.348  50.149  134.765 1.00 35.99  ? 284  LEU C CA  1 
ATOM   6451  C  C   . LEU C  1 284 ? 27.921  48.983  135.642 1.00 36.92  ? 284  LEU C C   1 
ATOM   6452  O  O   . LEU C  1 284 ? 27.164  49.162  136.595 1.00 38.46  ? 284  LEU C O   1 
ATOM   6453  C  CB  . LEU C  1 284 ? 29.207  51.094  135.593 1.00 38.25  ? 284  LEU C CB  1 
ATOM   6454  C  CG  . LEU C  1 284 ? 29.845  52.226  134.806 1.00 39.41  ? 284  LEU C CG  1 
ATOM   6455  C  CD1 . LEU C  1 284 ? 29.100  53.527  135.094 1.00 40.08  ? 284  LEU C CD1 1 
ATOM   6456  C  CD2 . LEU C  1 284 ? 31.298  52.328  135.188 1.00 38.92  ? 284  LEU C CD2 1 
ATOM   6457  N  N   . PHE C  1 285 ? 28.374  47.786  135.306 1.00 37.75  ? 285  PHE C N   1 
ATOM   6458  C  CA  . PHE C  1 285 ? 28.039  46.623  136.113 1.00 38.27  ? 285  PHE C CA  1 
ATOM   6459  C  C   . PHE C  1 285 ? 29.223  46.308  137.023 1.00 39.19  ? 285  PHE C C   1 
ATOM   6460  O  O   . PHE C  1 285 ? 30.247  45.803  136.576 1.00 40.58  ? 285  PHE C O   1 
ATOM   6461  C  CB  . PHE C  1 285 ? 27.713  45.429  135.221 1.00 36.67  ? 285  PHE C CB  1 
ATOM   6462  C  CG  . PHE C  1 285 ? 26.472  45.620  134.384 1.00 38.88  ? 285  PHE C CG  1 
ATOM   6463  C  CD1 . PHE C  1 285 ? 26.504  46.410  133.234 1.00 37.82  ? 285  PHE C CD1 1 
ATOM   6464  C  CD2 . PHE C  1 285 ? 25.275  44.993  134.737 1.00 35.56  ? 285  PHE C CD2 1 
ATOM   6465  C  CE1 . PHE C  1 285 ? 25.366  46.569  132.444 1.00 37.35  ? 285  PHE C CE1 1 
ATOM   6466  C  CE2 . PHE C  1 285 ? 24.137  45.145  133.957 1.00 38.49  ? 285  PHE C CE2 1 
ATOM   6467  C  CZ  . PHE C  1 285 ? 24.182  45.935  132.805 1.00 38.85  ? 285  PHE C CZ  1 
ATOM   6468  N  N   . THR C  1 286 ? 29.074  46.627  138.301 1.00 38.96  ? 286  THR C N   1 
ATOM   6469  C  CA  . THR C  1 286 ? 30.123  46.401  139.277 1.00 39.61  ? 286  THR C CA  1 
ATOM   6470  C  C   . THR C  1 286 ? 29.645  45.419  140.334 1.00 41.37  ? 286  THR C C   1 
ATOM   6471  O  O   . THR C  1 286 ? 28.468  45.054  140.355 1.00 40.84  ? 286  THR C O   1 
ATOM   6472  C  CB  . THR C  1 286 ? 30.488  47.718  139.967 1.00 41.28  ? 286  THR C CB  1 
ATOM   6473  O  OG1 . THR C  1 286 ? 29.448  48.081  140.886 1.00 41.60  ? 286  THR C OG1 1 
ATOM   6474  C  CG2 . THR C  1 286 ? 30.629  48.827  138.929 1.00 41.47  ? 286  THR C CG2 1 
ATOM   6475  N  N   . ASP C  1 287 ? 30.557  44.991  141.207 1.00 43.48  ? 287  ASP C N   1 
ATOM   6476  C  CA  . ASP C  1 287 ? 30.206  44.071  142.293 1.00 41.94  ? 287  ASP C CA  1 
ATOM   6477  C  C   . ASP C  1 287 ? 29.415  44.820  143.367 1.00 42.18  ? 287  ASP C C   1 
ATOM   6478  O  O   . ASP C  1 287 ? 28.832  44.208  144.254 1.00 43.53  ? 287  ASP C O   1 
ATOM   6479  C  CB  . ASP C  1 287 ? 31.457  43.426  142.908 1.00 39.65  ? 287  ASP C CB  1 
ATOM   6480  C  CG  . ASP C  1 287 ? 32.596  44.411  143.098 1.00 38.95  ? 287  ASP C CG  1 
ATOM   6481  O  OD1 . ASP C  1 287 ? 33.289  44.723  142.110 1.00 41.34  ? 287  ASP C OD1 1 
ATOM   6482  O  OD2 . ASP C  1 287 ? 32.796  44.886  144.230 1.00 39.47  ? 287  ASP C OD2 1 
ATOM   6483  N  N   . LEU C  1 288 ? 29.405  46.150  143.281 1.00 42.55  ? 288  LEU C N   1 
ATOM   6484  C  CA  . LEU C  1 288 ? 28.641  46.988  144.211 1.00 41.22  ? 288  LEU C CA  1 
ATOM   6485  C  C   . LEU C  1 288 ? 27.214  47.127  143.671 1.00 39.97  ? 288  LEU C C   1 
ATOM   6486  O  O   . LEU C  1 288 ? 26.348  47.668  144.344 1.00 35.39  ? 288  LEU C O   1 
ATOM   6487  C  CB  . LEU C  1 288 ? 29.236  48.394  144.313 1.00 41.11  ? 288  LEU C CB  1 
ATOM   6488  C  CG  . LEU C  1 288 ? 30.697  48.614  144.718 1.00 45.23  ? 288  LEU C CG  1 
ATOM   6489  C  CD1 . LEU C  1 288 ? 31.059  50.068  144.401 1.00 41.73  ? 288  LEU C CD1 1 
ATOM   6490  C  CD2 . LEU C  1 288 ? 30.924  48.288  146.201 1.00 38.89  ? 288  LEU C CD2 1 
ATOM   6491  N  N   . GLY C  1 289 ? 26.987  46.647  142.448 1.00 40.74  ? 289  GLY C N   1 
ATOM   6492  C  CA  . GLY C  1 289 ? 25.669  46.738  141.830 1.00 40.60  ? 289  GLY C CA  1 
ATOM   6493  C  C   . GLY C  1 289 ? 25.671  47.419  140.463 1.00 41.25  ? 289  GLY C C   1 
ATOM   6494  O  O   . GLY C  1 289 ? 26.713  47.882  139.981 1.00 39.92  ? 289  GLY C O   1 
ATOM   6495  N  N   . VAL C  1 290 ? 24.507  47.473  139.823 1.00 39.32  ? 290  VAL C N   1 
ATOM   6496  C  CA  . VAL C  1 290 ? 24.398  48.110  138.518 1.00 40.46  ? 290  VAL C CA  1 
ATOM   6497  C  C   . VAL C  1 290 ? 24.248  49.599  138.790 1.00 41.24  ? 290  VAL C C   1 
ATOM   6498  O  O   . VAL C  1 290 ? 23.464  49.994  139.650 1.00 43.92  ? 290  VAL C O   1 
ATOM   6499  C  CB  . VAL C  1 290 ? 23.177  47.585  137.753 1.00 40.83  ? 290  VAL C CB  1 
ATOM   6500  C  CG1 . VAL C  1 290 ? 23.204  48.068  136.311 1.00 40.00  ? 290  VAL C CG1 1 
ATOM   6501  C  CG2 . VAL C  1 290 ? 23.178  46.073  137.793 1.00 42.02  ? 290  VAL C CG2 1 
ATOM   6502  N  N   . LEU C  1 291 ? 25.003  50.425  138.073 1.00 39.08  ? 291  LEU C N   1 
ATOM   6503  C  CA  . LEU C  1 291 ? 24.958  51.861  138.305 1.00 36.89  ? 291  LEU C CA  1 
ATOM   6504  C  C   . LEU C  1 291 ? 24.931  52.706  137.034 1.00 38.02  ? 291  LEU C C   1 
ATOM   6505  O  O   . LEU C  1 291 ? 25.468  52.316  135.992 1.00 41.47  ? 291  LEU C O   1 
ATOM   6506  C  CB  . LEU C  1 291 ? 26.190  52.281  139.110 1.00 39.80  ? 291  LEU C CB  1 
ATOM   6507  C  CG  . LEU C  1 291 ? 26.679  51.493  140.330 1.00 39.25  ? 291  LEU C CG  1 
ATOM   6508  C  CD1 . LEU C  1 291 ? 28.083  51.944  140.691 1.00 35.24  ? 291  LEU C CD1 1 
ATOM   6509  C  CD2 . LEU C  1 291 ? 25.737  51.700  141.490 1.00 38.01  ? 291  LEU C CD2 1 
ATOM   6510  N  N   . THR C  1 292 ? 24.300  53.869  137.116 1.00 33.99  ? 292  THR C N   1 
ATOM   6511  C  CA  . THR C  1 292 ? 24.303  54.777  135.982 1.00 31.72  ? 292  THR C CA  1 
ATOM   6512  C  C   . THR C  1 292 ? 25.584  55.547  136.291 1.00 31.20  ? 292  THR C C   1 
ATOM   6513  O  O   . THR C  1 292 ? 25.974  55.648  137.451 1.00 31.53  ? 292  THR C O   1 
ATOM   6514  C  CB  . THR C  1 292 ? 23.078  55.730  135.982 1.00 29.36  ? 292  THR C CB  1 
ATOM   6515  O  OG1 . THR C  1 292 ? 23.015  56.444  137.223 1.00 30.08  ? 292  THR C OG1 1 
ATOM   6516  C  CG2 . THR C  1 292 ? 21.800  54.947  135.792 1.00 22.23  ? 292  THR C CG2 1 
ATOM   6517  N  N   . PRO C  1 293 ? 26.265  56.077  135.273 1.00 30.30  ? 293  PRO C N   1 
ATOM   6518  C  CA  . PRO C  1 293 ? 27.501  56.811  135.552 1.00 32.02  ? 293  PRO C CA  1 
ATOM   6519  C  C   . PRO C  1 293 ? 27.424  57.845  136.685 1.00 34.49  ? 293  PRO C C   1 
ATOM   6520  O  O   . PRO C  1 293 ? 28.399  58.017  137.425 1.00 34.78  ? 293  PRO C O   1 
ATOM   6521  C  CB  . PRO C  1 293 ? 27.838  57.441  134.199 1.00 30.32  ? 293  PRO C CB  1 
ATOM   6522  C  CG  . PRO C  1 293 ? 27.339  56.412  133.231 1.00 28.60  ? 293  PRO C CG  1 
ATOM   6523  C  CD  . PRO C  1 293 ? 26.012  55.992  133.825 1.00 28.97  ? 293  PRO C CD  1 
ATOM   6524  N  N   . SER C  1 294 ? 26.274  58.514  136.835 1.00 35.23  ? 294  SER C N   1 
ATOM   6525  C  CA  . SER C  1 294 ? 26.121  59.550  137.868 1.00 35.98  ? 294  SER C CA  1 
ATOM   6526  C  C   . SER C  1 294 ? 25.989  59.028  139.303 1.00 36.35  ? 294  SER C C   1 
ATOM   6527  O  O   . SER C  1 294 ? 26.099  59.794  140.261 1.00 38.68  ? 294  SER C O   1 
ATOM   6528  C  CB  . SER C  1 294 ? 24.938  60.483  137.537 1.00 37.84  ? 294  SER C CB  1 
ATOM   6529  O  OG  . SER C  1 294 ? 23.683  59.824  137.594 1.00 40.82  ? 294  SER C OG  1 
ATOM   6530  N  N   . ALA C  1 295 ? 25.764  57.729  139.457 1.00 32.45  ? 295  ALA C N   1 
ATOM   6531  C  CA  . ALA C  1 295 ? 25.660  57.144  140.779 1.00 33.15  ? 295  ALA C CA  1 
ATOM   6532  C  C   . ALA C  1 295 ? 27.054  56.723  141.278 1.00 35.38  ? 295  ALA C C   1 
ATOM   6533  O  O   . ALA C  1 295 ? 27.264  56.488  142.465 1.00 36.61  ? 295  ALA C O   1 
ATOM   6534  C  CB  . ALA C  1 295 ? 24.723  55.941  140.734 1.00 30.81  ? 295  ALA C CB  1 
ATOM   6535  N  N   . VAL C  1 296 ? 28.013  56.639  140.367 1.00 35.10  ? 296  VAL C N   1 
ATOM   6536  C  CA  . VAL C  1 296 ? 29.363  56.230  140.740 1.00 37.10  ? 296  VAL C CA  1 
ATOM   6537  C  C   . VAL C  1 296 ? 30.039  57.131  141.782 1.00 39.54  ? 296  VAL C C   1 
ATOM   6538  O  O   . VAL C  1 296 ? 30.520  56.652  142.797 1.00 42.98  ? 296  VAL C O   1 
ATOM   6539  C  CB  . VAL C  1 296 ? 30.247  56.119  139.474 1.00 35.89  ? 296  VAL C CB  1 
ATOM   6540  C  CG1 . VAL C  1 296 ? 31.691  55.868  139.848 1.00 27.48  ? 296  VAL C CG1 1 
ATOM   6541  C  CG2 . VAL C  1 296 ? 29.710  55.005  138.586 1.00 30.41  ? 296  VAL C CG2 1 
ATOM   6542  N  N   . SER C  1 297 ? 30.091  58.429  141.527 1.00 42.26  ? 297  SER C N   1 
ATOM   6543  C  CA  . SER C  1 297 ? 30.703  59.368  142.464 1.00 45.10  ? 297  SER C CA  1 
ATOM   6544  C  C   . SER C  1 297 ? 30.428  59.093  143.955 1.00 46.60  ? 297  SER C C   1 
ATOM   6545  O  O   . SER C  1 297 ? 31.358  59.034  144.769 1.00 44.94  ? 297  SER C O   1 
ATOM   6546  C  CB  . SER C  1 297 ? 30.230  60.786  142.147 1.00 46.39  ? 297  SER C CB  1 
ATOM   6547  O  OG  . SER C  1 297 ? 30.424  61.632  143.264 1.00 50.00  ? 297  SER C OG  1 
ATOM   6548  N  N   . ASP C  1 298 ? 29.150  58.946  144.302 1.00 46.70  ? 298  ASP C N   1 
ATOM   6549  C  CA  . ASP C  1 298 ? 28.741  58.713  145.681 1.00 44.86  ? 298  ASP C CA  1 
ATOM   6550  C  C   . ASP C  1 298 ? 29.134  57.341  146.197 1.00 44.30  ? 298  ASP C C   1 
ATOM   6551  O  O   . ASP C  1 298 ? 29.496  57.196  147.361 1.00 40.49  ? 298  ASP C O   1 
ATOM   6552  C  CB  . ASP C  1 298 ? 27.239  58.895  145.817 1.00 46.32  ? 298  ASP C CB  1 
ATOM   6553  C  CG  . ASP C  1 298 ? 26.828  59.147  147.243 1.00 53.84  ? 298  ASP C CG  1 
ATOM   6554  O  OD1 . ASP C  1 298 ? 27.355  60.121  147.830 1.00 53.63  ? 298  ASP C OD1 1 
ATOM   6555  O  OD2 . ASP C  1 298 ? 25.991  58.379  147.778 1.00 56.47  ? 298  ASP C OD2 1 
ATOM   6556  N  N   . GLU C  1 299 ? 29.051  56.342  145.322 1.00 44.88  ? 299  GLU C N   1 
ATOM   6557  C  CA  . GLU C  1 299 ? 29.417  54.965  145.648 1.00 45.73  ? 299  GLU C CA  1 
ATOM   6558  C  C   . GLU C  1 299 ? 30.904  54.859  145.926 1.00 45.78  ? 299  GLU C C   1 
ATOM   6559  O  O   . GLU C  1 299 ? 31.347  54.108  146.803 1.00 46.61  ? 299  GLU C O   1 
ATOM   6560  C  CB  . GLU C  1 299 ? 29.082  54.038  144.484 1.00 44.92  ? 299  GLU C CB  1 
ATOM   6561  C  CG  . GLU C  1 299 ? 27.729  53.395  144.588 1.00 50.71  ? 299  GLU C CG  1 
ATOM   6562  C  CD  . GLU C  1 299 ? 27.598  52.556  145.846 1.00 56.69  ? 299  GLU C CD  1 
ATOM   6563  O  OE1 . GLU C  1 299 ? 28.645  52.108  146.380 1.00 58.29  ? 299  GLU C OE1 1 
ATOM   6564  O  OE2 . GLU C  1 299 ? 26.449  52.337  146.295 1.00 57.83  ? 299  GLU C OE2 1 
ATOM   6565  N  N   . LEU C  1 300 ? 31.670  55.611  145.150 1.00 47.41  ? 300  LEU C N   1 
ATOM   6566  C  CA  . LEU C  1 300 ? 33.113  55.619  145.275 1.00 48.48  ? 300  LEU C CA  1 
ATOM   6567  C  C   . LEU C  1 300 ? 33.549  56.108  146.649 1.00 49.00  ? 300  LEU C C   1 
ATOM   6568  O  O   . LEU C  1 300 ? 34.436  55.505  147.253 1.00 49.85  ? 300  LEU C O   1 
ATOM   6569  C  CB  . LEU C  1 300 ? 33.734  56.478  144.163 1.00 47.81  ? 300  LEU C CB  1 
ATOM   6570  C  CG  . LEU C  1 300 ? 35.262  56.467  144.036 1.00 49.08  ? 300  LEU C CG  1 
ATOM   6571  C  CD1 . LEU C  1 300 ? 35.664  56.912  142.640 1.00 50.02  ? 300  LEU C CD1 1 
ATOM   6572  C  CD2 . LEU C  1 300 ? 35.880  57.368  145.086 1.00 44.86  ? 300  LEU C CD2 1 
ATOM   6573  N  N   . ILE C  1 301 ? 32.933  57.180  147.157 1.00 50.80  ? 301  ILE C N   1 
ATOM   6574  C  CA  . ILE C  1 301 ? 33.321  57.685  148.474 1.00 49.34  ? 301  ILE C CA  1 
ATOM   6575  C  C   . ILE C  1 301 ? 32.889  56.693  149.557 1.00 48.70  ? 301  ILE C C   1 
ATOM   6576  O  O   . ILE C  1 301 ? 33.632  56.444  150.502 1.00 50.43  ? 301  ILE C O   1 
ATOM   6577  C  CB  . ILE C  1 301 ? 32.745  59.108  148.789 1.00 49.82  ? 301  ILE C CB  1 
ATOM   6578  C  CG1 . ILE C  1 301 ? 31.452  58.996  149.574 1.00 49.98  ? 301  ILE C CG1 1 
ATOM   6579  C  CG2 . ILE C  1 301 ? 32.506  59.896  147.504 1.00 46.73  ? 301  ILE C CG2 1 
ATOM   6580  C  CD1 . ILE C  1 301 ? 31.102  60.266  150.273 1.00 54.30  ? 301  ILE C CD1 1 
ATOM   6581  N  N   . LYS C  1 302 ? 31.702  56.111  149.426 1.00 47.46  ? 302  LYS C N   1 
ATOM   6582  C  CA  . LYS C  1 302 ? 31.273  55.124  150.408 1.00 48.23  ? 302  LYS C CA  1 
ATOM   6583  C  C   . LYS C  1 302 ? 32.303  54.004  150.359 1.00 49.03  ? 302  LYS C C   1 
ATOM   6584  O  O   . LYS C  1 302 ? 32.630  53.398  151.379 1.00 51.67  ? 302  LYS C O   1 
ATOM   6585  C  CB  . LYS C  1 302 ? 29.895  54.575  150.058 1.00 47.38  ? 302  LYS C CB  1 
ATOM   6586  C  CG  . LYS C  1 302 ? 28.814  55.633  150.066 1.00 53.28  ? 302  LYS C CG  1 
ATOM   6587  C  CD  . LYS C  1 302 ? 27.538  55.128  149.432 1.00 54.41  ? 302  LYS C CD  1 
ATOM   6588  C  CE  . LYS C  1 302 ? 26.955  53.995  150.238 1.00 55.78  ? 302  LYS C CE  1 
ATOM   6589  N  NZ  . LYS C  1 302 ? 25.887  53.301  149.480 1.00 58.88  ? 302  LYS C NZ  1 
ATOM   6590  N  N   . LEU C  1 303 ? 32.820  53.746  149.160 1.00 47.53  ? 303  LEU C N   1 
ATOM   6591  C  CA  . LEU C  1 303 ? 33.827  52.715  148.963 1.00 46.45  ? 303  LEU C CA  1 
ATOM   6592  C  C   . LEU C  1 303 ? 35.132  53.080  149.686 1.00 48.05  ? 303  LEU C C   1 
ATOM   6593  O  O   . LEU C  1 303 ? 35.795  52.209  150.246 1.00 48.80  ? 303  LEU C O   1 
ATOM   6594  C  CB  . LEU C  1 303 ? 34.091  52.520  147.467 1.00 44.53  ? 303  LEU C CB  1 
ATOM   6595  C  CG  . LEU C  1 303 ? 35.200  51.525  147.106 1.00 37.95  ? 303  LEU C CG  1 
ATOM   6596  C  CD1 . LEU C  1 303 ? 34.836  50.171  147.666 1.00 32.78  ? 303  LEU C CD1 1 
ATOM   6597  C  CD2 . LEU C  1 303 ? 35.395  51.458  145.601 1.00 35.27  ? 303  LEU C CD2 1 
ATOM   6598  N  N   . TYR C  1 304 ? 35.506  54.358  149.659 1.00 47.67  ? 304  TYR C N   1 
ATOM   6599  C  CA  . TYR C  1 304 ? 36.716  54.812  150.344 1.00 49.43  ? 304  TYR C CA  1 
ATOM   6600  C  C   . TYR C  1 304 ? 36.377  55.231  151.778 1.00 52.65  ? 304  TYR C C   1 
ATOM   6601  O  O   . TYR C  1 304 ? 36.728  56.322  152.229 1.00 53.57  ? 304  TYR C O   1 
ATOM   6602  C  CB  . TYR C  1 304 ? 37.380  55.976  149.582 1.00 47.27  ? 304  TYR C CB  1 
ATOM   6603  C  CG  . TYR C  1 304 ? 38.166  55.534  148.359 1.00 46.62  ? 304  TYR C CG  1 
ATOM   6604  C  CD1 . TYR C  1 304 ? 39.552  55.332  148.419 1.00 42.50  ? 304  TYR C CD1 1 
ATOM   6605  C  CD2 . TYR C  1 304 ? 37.512  55.251  147.156 1.00 46.51  ? 304  TYR C CD2 1 
ATOM   6606  C  CE1 . TYR C  1 304 ? 40.257  54.857  147.311 1.00 40.06  ? 304  TYR C CE1 1 
ATOM   6607  C  CE2 . TYR C  1 304 ? 38.204  54.777  146.048 1.00 43.86  ? 304  TYR C CE2 1 
ATOM   6608  C  CZ  . TYR C  1 304 ? 39.573  54.583  146.126 1.00 44.08  ? 304  TYR C CZ  1 
ATOM   6609  O  OH  . TYR C  1 304 ? 40.241  54.132  145.004 1.00 43.71  ? 304  TYR C OH  1 
ATOM   6610  N  N   . LEU C  1 305 ? 35.666  54.348  152.473 1.00 56.72  ? 305  LEU C N   1 
ATOM   6611  C  CA  . LEU C  1 305 ? 35.279  54.543  153.866 1.00 59.76  ? 305  LEU C CA  1 
ATOM   6612  C  C   . LEU C  1 305 ? 35.274  53.165  154.530 1.00 62.59  ? 305  LEU C C   1 
ATOM   6613  O  O   . LEU C  1 305 ? 34.464  52.295  154.199 1.00 60.47  ? 305  LEU C O   1 
ATOM   6614  C  CB  . LEU C  1 305 ? 33.899  55.190  153.971 1.00 60.16  ? 305  LEU C CB  1 
ATOM   6615  C  CG  . LEU C  1 305 ? 33.740  56.598  153.385 1.00 61.59  ? 305  LEU C CG  1 
ATOM   6616  C  CD1 . LEU C  1 305 ? 32.357  57.121  153.752 1.00 61.66  ? 305  LEU C CD1 1 
ATOM   6617  C  CD2 . LEU C  1 305 ? 34.818  57.544  153.917 1.00 61.99  ? 305  LEU C CD2 1 
ATOM   6618  N  N   . ALA C  1 306 ? 36.207  52.973  155.457 1.00 66.84  ? 306  ALA C N   1 
ATOM   6619  C  CA  . ALA C  1 306 ? 36.356  51.709  156.164 1.00 68.60  ? 306  ALA C CA  1 
ATOM   6620  C  C   . ALA C  1 306 ? 35.988  51.814  157.653 1.00 70.19  ? 306  ALA C C   1 
ATOM   6621  O  O   . ALA C  1 306 ? 36.255  52.832  158.305 1.00 68.17  ? 306  ALA C O   1 
ATOM   6622  C  CB  . ALA C  1 306 ? 37.799  51.200  155.997 1.00 66.99  ? 306  ALA C CB  1 
ATOM   6623  N  N   . ALA C  1 307 ? 35.379  50.738  158.162 1.00 71.68  ? 307  ALA C N   1 
ATOM   6624  C  CA  . ALA C  1 307 ? 34.918  50.605  159.550 1.00 71.98  ? 307  ALA C CA  1 
ATOM   6625  C  C   . ALA C  1 307 ? 35.297  51.762  160.465 1.00 71.13  ? 307  ALA C C   1 
ATOM   6626  O  O   . ALA C  1 307 ? 34.560  51.942  161.457 1.00 71.30  ? 307  ALA C O   1 
ATOM   6627  C  CB  . ALA C  1 307 ? 35.418  49.277  160.145 1.00 70.80  ? 307  ALA C CB  1 
HETATM 6628  N  N   . MSE D  1 1   ? -5.194  120.957 115.695 1.00 88.08  ? 1    MSE D N   1 
HETATM 6629  C  CA  . MSE D  1 1   ? -4.842  119.947 116.739 1.00 88.02  ? 1    MSE D CA  1 
HETATM 6630  C  C   . MSE D  1 1   ? -3.492  120.292 117.375 1.00 87.14  ? 1    MSE D C   1 
HETATM 6631  O  O   . MSE D  1 1   ? -2.468  120.340 116.690 1.00 86.17  ? 1    MSE D O   1 
HETATM 6632  C  CB  . MSE D  1 1   ? -4.800  118.554 116.104 1.00 89.88  ? 1    MSE D CB  1 
HETATM 6633  C  CG  . MSE D  1 1   ? -4.703  117.391 117.081 1.00 92.46  ? 1    MSE D CG  1 
HETATM 6634  SE SE  . MSE D  1 1   ? -4.883  115.677 116.168 1.00 96.67  ? 1    MSE D SE  1 
HETATM 6635  C  CE  . MSE D  1 1   ? -6.459  115.007 117.053 1.00 95.71  ? 1    MSE D CE  1 
ATOM   6636  N  N   . ASP D  1 2   ? -3.502  120.545 118.684 1.00 86.15  ? 2    ASP D N   1 
ATOM   6637  C  CA  . ASP D  1 2   ? -2.290  120.899 119.422 1.00 85.12  ? 2    ASP D CA  1 
ATOM   6638  C  C   . ASP D  1 2   ? -1.867  119.746 120.322 1.00 83.68  ? 2    ASP D C   1 
ATOM   6639  O  O   . ASP D  1 2   ? -2.669  118.868 120.634 1.00 84.69  ? 2    ASP D O   1 
ATOM   6640  C  CB  . ASP D  1 2   ? -2.529  122.156 120.266 1.00 87.12  ? 2    ASP D CB  1 
ATOM   6641  C  CG  . ASP D  1 2   ? -3.383  121.886 121.489 1.00 89.09  ? 2    ASP D CG  1 
ATOM   6642  O  OD1 . ASP D  1 2   ? -4.409  121.185 121.353 1.00 90.90  ? 2    ASP D OD1 1 
ATOM   6643  O  OD2 . ASP D  1 2   ? -3.033  122.379 122.585 1.00 89.71  ? 2    ASP D OD2 1 
ATOM   6644  N  N   . ASP D  1 3   ? -0.608  119.767 120.745 1.00 81.80  ? 3    ASP D N   1 
ATOM   6645  C  CA  . ASP D  1 3   ? -0.043  118.711 121.583 1.00 81.43  ? 3    ASP D CA  1 
ATOM   6646  C  C   . ASP D  1 3   ? -0.985  118.001 122.551 1.00 81.08  ? 3    ASP D C   1 
ATOM   6647  O  O   . ASP D  1 3   ? -1.088  116.775 122.527 1.00 81.67  ? 3    ASP D O   1 
ATOM   6648  C  CB  . ASP D  1 3   ? 1.167   119.247 122.341 1.00 80.76  ? 3    ASP D CB  1 
ATOM   6649  C  CG  . ASP D  1 3   ? 2.292   119.656 121.413 1.00 81.29  ? 3    ASP D CG  1 
ATOM   6650  O  OD1 . ASP D  1 3   ? 2.715   118.824 120.580 1.00 81.36  ? 3    ASP D OD1 1 
ATOM   6651  O  OD2 . ASP D  1 3   ? 2.755   120.810 121.513 1.00 83.67  ? 3    ASP D OD2 1 
ATOM   6652  N  N   . LYS D  1 4   ? -1.666  118.753 123.406 1.00 81.27  ? 4    LYS D N   1 
ATOM   6653  C  CA  . LYS D  1 4   ? -2.588  118.139 124.356 1.00 80.98  ? 4    LYS D CA  1 
ATOM   6654  C  C   . LYS D  1 4   ? -3.585  117.268 123.587 1.00 79.48  ? 4    LYS D C   1 
ATOM   6655  O  O   . LYS D  1 4   ? -3.864  116.133 123.981 1.00 77.69  ? 4    LYS D O   1 
ATOM   6656  C  CB  . LYS D  1 4   ? -3.304  119.227 125.167 1.00 82.96  ? 4    LYS D CB  1 
ATOM   6657  C  CG  . LYS D  1 4   ? -2.326  120.140 125.910 1.00 85.82  ? 4    LYS D CG  1 
ATOM   6658  C  CD  . LYS D  1 4   ? -2.982  121.375 126.531 1.00 87.56  ? 4    LYS D CD  1 
ATOM   6659  C  CE  . LYS D  1 4   ? -3.718  121.062 127.831 1.00 87.82  ? 4    LYS D CE  1 
ATOM   6660  N  NZ  . LYS D  1 4   ? -4.146  122.306 128.555 1.00 85.55  ? 4    LYS D NZ  1 
ATOM   6661  N  N   . GLU D  1 5   ? -4.098  117.795 122.477 1.00 77.04  ? 5    GLU D N   1 
ATOM   6662  C  CA  . GLU D  1 5   ? -5.043  117.062 121.641 1.00 76.14  ? 5    GLU D CA  1 
ATOM   6663  C  C   . GLU D  1 5   ? -4.433  115.759 121.125 1.00 73.41  ? 5    GLU D C   1 
ATOM   6664  O  O   . GLU D  1 5   ? -5.020  114.683 121.269 1.00 72.70  ? 5    GLU D O   1 
ATOM   6665  C  CB  . GLU D  1 5   ? -5.485  117.932 120.465 1.00 79.24  ? 5    GLU D CB  1 
ATOM   6666  C  CG  . GLU D  1 5   ? -6.546  118.961 120.827 1.00 85.97  ? 5    GLU D CG  1 
ATOM   6667  C  CD  . GLU D  1 5   ? -6.924  119.854 119.654 1.00 90.48  ? 5    GLU D CD  1 
ATOM   6668  O  OE1 . GLU D  1 5   ? -6.082  120.678 119.241 1.00 93.13  ? 5    GLU D OE1 1 
ATOM   6669  O  OE2 . GLU D  1 5   ? -8.059  119.731 119.141 1.00 91.58  ? 5    GLU D OE2 1 
ATOM   6670  N  N   . LEU D  1 6   ? -3.258  115.862 120.514 1.00 69.97  ? 6    LEU D N   1 
ATOM   6671  C  CA  . LEU D  1 6   ? -2.560  114.691 120.004 1.00 66.37  ? 6    LEU D CA  1 
ATOM   6672  C  C   . LEU D  1 6   ? -2.519  113.596 121.062 1.00 66.16  ? 6    LEU D C   1 
ATOM   6673  O  O   . LEU D  1 6   ? -3.095  112.524 120.888 1.00 66.47  ? 6    LEU D O   1 
ATOM   6674  C  CB  . LEU D  1 6   ? -1.124  115.050 119.636 1.00 65.93  ? 6    LEU D CB  1 
ATOM   6675  C  CG  . LEU D  1 6   ? -0.777  115.542 118.235 1.00 68.23  ? 6    LEU D CG  1 
ATOM   6676  C  CD1 . LEU D  1 6   ? 0.697   115.907 118.208 1.00 67.90  ? 6    LEU D CD1 1 
ATOM   6677  C  CD2 . LEU D  1 6   ? -1.066  114.457 117.203 1.00 67.06  ? 6    LEU D CD2 1 
ATOM   6678  N  N   . ILE D  1 7   ? -1.830  113.888 122.161 1.00 63.64  ? 7    ILE D N   1 
ATOM   6679  C  CA  . ILE D  1 7   ? -1.664  112.947 123.256 1.00 63.97  ? 7    ILE D CA  1 
ATOM   6680  C  C   . ILE D  1 7   ? -2.956  112.264 123.688 1.00 66.25  ? 7    ILE D C   1 
ATOM   6681  O  O   . ILE D  1 7   ? -2.990  111.045 123.875 1.00 67.03  ? 7    ILE D O   1 
ATOM   6682  C  CB  . ILE D  1 7   ? -1.045  113.640 124.484 1.00 63.77  ? 7    ILE D CB  1 
ATOM   6683  C  CG1 . ILE D  1 7   ? 0.225   114.383 124.071 1.00 65.70  ? 7    ILE D CG1 1 
ATOM   6684  C  CG2 . ILE D  1 7   ? -0.706  112.609 125.550 1.00 59.83  ? 7    ILE D CG2 1 
ATOM   6685  C  CD1 . ILE D  1 7   ? 0.897   115.129 125.201 1.00 65.32  ? 7    ILE D CD1 1 
ATOM   6686  N  N   . GLU D  1 8   ? -4.014  113.050 123.855 1.00 66.23  ? 8    GLU D N   1 
ATOM   6687  C  CA  . GLU D  1 8   ? -5.298  112.511 124.281 1.00 64.39  ? 8    GLU D CA  1 
ATOM   6688  C  C   . GLU D  1 8   ? -5.889  111.642 123.190 1.00 60.52  ? 8    GLU D C   1 
ATOM   6689  O  O   . GLU D  1 8   ? -6.528  110.621 123.468 1.00 56.64  ? 8    GLU D O   1 
ATOM   6690  C  CB  . GLU D  1 8   ? -6.264  113.646 124.612 1.00 68.97  ? 8    GLU D CB  1 
ATOM   6691  C  CG  . GLU D  1 8   ? -5.783  114.554 125.733 1.00 77.86  ? 8    GLU D CG  1 
ATOM   6692  C  CD  . GLU D  1 8   ? -6.646  115.798 125.880 1.00 82.75  ? 8    GLU D CD  1 
ATOM   6693  O  OE1 . GLU D  1 8   ? -6.743  116.578 124.903 1.00 84.46  ? 8    GLU D OE1 1 
ATOM   6694  O  OE2 . GLU D  1 8   ? -7.228  115.996 126.969 1.00 84.58  ? 8    GLU D OE2 1 
ATOM   6695  N  N   . TYR D  1 9   ? -5.687  112.055 121.945 1.00 56.76  ? 9    TYR D N   1 
ATOM   6696  C  CA  . TYR D  1 9   ? -6.206  111.285 120.829 1.00 55.90  ? 9    TYR D CA  1 
ATOM   6697  C  C   . TYR D  1 9   ? -5.433  109.972 120.772 1.00 57.07  ? 9    TYR D C   1 
ATOM   6698  O  O   . TYR D  1 9   ? -6.012  108.903 120.570 1.00 57.53  ? 9    TYR D O   1 
ATOM   6699  C  CB  . TYR D  1 9   ? -6.024  112.042 119.521 1.00 52.91  ? 9    TYR D CB  1 
ATOM   6700  C  CG  . TYR D  1 9   ? -6.702  111.362 118.366 1.00 52.66  ? 9    TYR D CG  1 
ATOM   6701  C  CD1 . TYR D  1 9   ? -7.922  111.824 117.877 1.00 52.89  ? 9    TYR D CD1 1 
ATOM   6702  C  CD2 . TYR D  1 9   ? -6.151  110.223 117.788 1.00 54.52  ? 9    TYR D CD2 1 
ATOM   6703  C  CE1 . TYR D  1 9   ? -8.580  111.160 116.838 1.00 51.82  ? 9    TYR D CE1 1 
ATOM   6704  C  CE2 . TYR D  1 9   ? -6.797  109.553 116.751 1.00 55.21  ? 9    TYR D CE2 1 
ATOM   6705  C  CZ  . TYR D  1 9   ? -8.011  110.028 116.283 1.00 51.92  ? 9    TYR D CZ  1 
ATOM   6706  O  OH  . TYR D  1 9   ? -8.638  109.371 115.258 1.00 49.20  ? 9    TYR D OH  1 
ATOM   6707  N  N   . PHE D  1 10  ? -4.120  110.066 120.965 1.00 55.67  ? 10   PHE D N   1 
ATOM   6708  C  CA  . PHE D  1 10  ? -3.252  108.906 120.944 1.00 53.37  ? 10   PHE D CA  1 
ATOM   6709  C  C   . PHE D  1 10  ? -3.572  107.928 122.075 1.00 54.31  ? 10   PHE D C   1 
ATOM   6710  O  O   . PHE D  1 10  ? -3.622  106.720 121.854 1.00 55.52  ? 10   PHE D O   1 
ATOM   6711  C  CB  . PHE D  1 10  ? -1.787  109.345 121.026 1.00 52.37  ? 10   PHE D CB  1 
ATOM   6712  C  CG  . PHE D  1 10  ? -0.813  108.199 121.013 1.00 49.26  ? 10   PHE D CG  1 
ATOM   6713  C  CD1 . PHE D  1 10  ? -0.827  107.265 119.974 1.00 48.20  ? 10   PHE D CD1 1 
ATOM   6714  C  CD2 . PHE D  1 10  ? 0.099   108.034 122.047 1.00 46.35  ? 10   PHE D CD2 1 
ATOM   6715  C  CE1 . PHE D  1 10  ? 0.055   106.179 119.973 1.00 44.23  ? 10   PHE D CE1 1 
ATOM   6716  C  CE2 . PHE D  1 10  ? 0.982   106.953 122.049 1.00 46.63  ? 10   PHE D CE2 1 
ATOM   6717  C  CZ  . PHE D  1 10  ? 0.958   106.023 121.008 1.00 42.01  ? 10   PHE D CZ  1 
ATOM   6718  N  N   . LYS D  1 11  ? -3.783  108.435 123.285 1.00 54.25  ? 11   LYS D N   1 
ATOM   6719  C  CA  . LYS D  1 11  ? -4.100  107.552 124.408 1.00 55.77  ? 11   LYS D CA  1 
ATOM   6720  C  C   . LYS D  1 11  ? -5.504  106.963 124.275 1.00 56.59  ? 11   LYS D C   1 
ATOM   6721  O  O   . LYS D  1 11  ? -5.778  105.860 124.760 1.00 56.71  ? 11   LYS D O   1 
ATOM   6722  C  CB  . LYS D  1 11  ? -3.996  108.296 125.740 1.00 56.48  ? 11   LYS D CB  1 
ATOM   6723  C  CG  . LYS D  1 11  ? -2.607  108.786 126.103 1.00 57.49  ? 11   LYS D CG  1 
ATOM   6724  C  CD  . LYS D  1 11  ? -2.577  109.192 127.566 1.00 57.93  ? 11   LYS D CD  1 
ATOM   6725  C  CE  . LYS D  1 11  ? -1.314  109.937 127.946 1.00 58.90  ? 11   LYS D CE  1 
ATOM   6726  N  NZ  . LYS D  1 11  ? -1.324  110.232 129.409 1.00 61.96  ? 11   LYS D NZ  1 
ATOM   6727  N  N   . SER D  1 12  ? -6.396  107.715 123.636 1.00 57.57  ? 12   SER D N   1 
ATOM   6728  C  CA  . SER D  1 12  ? -7.764  107.258 123.417 1.00 57.38  ? 12   SER D CA  1 
ATOM   6729  C  C   . SER D  1 12  ? -7.685  106.031 122.530 1.00 57.08  ? 12   SER D C   1 
ATOM   6730  O  O   . SER D  1 12  ? -8.243  104.982 122.846 1.00 55.66  ? 12   SER D O   1 
ATOM   6731  C  CB  . SER D  1 12  ? -8.588  108.336 122.708 1.00 59.22  ? 12   SER D CB  1 
ATOM   6732  O  OG  . SER D  1 12  ? -9.710  107.768 122.043 1.00 59.43  ? 12   SER D OG  1 
ATOM   6733  N  N   . GLN D  1 13  ? -6.985  106.183 121.410 1.00 55.59  ? 13   GLN D N   1 
ATOM   6734  C  CA  . GLN D  1 13  ? -6.814  105.096 120.470 1.00 54.75  ? 13   GLN D CA  1 
ATOM   6735  C  C   . GLN D  1 13  ? -6.386  103.841 121.200 1.00 55.93  ? 13   GLN D C   1 
ATOM   6736  O  O   . GLN D  1 13  ? -6.857  102.749 120.902 1.00 57.04  ? 13   GLN D O   1 
ATOM   6737  C  CB  . GLN D  1 13  ? -5.757  105.456 119.431 1.00 53.64  ? 13   GLN D CB  1 
ATOM   6738  C  CG  . GLN D  1 13  ? -6.209  106.457 118.386 1.00 53.77  ? 13   GLN D CG  1 
ATOM   6739  C  CD  . GLN D  1 13  ? -7.340  105.927 117.528 1.00 53.43  ? 13   GLN D CD  1 
ATOM   6740  O  OE1 . GLN D  1 13  ? -7.317  104.773 117.096 1.00 50.96  ? 13   GLN D OE1 1 
ATOM   6741  N  NE2 . GLN D  1 13  ? -8.333  106.774 117.265 1.00 54.30  ? 13   GLN D NE2 1 
HETATM 6742  N  N   . MSE D  1 14  ? -5.492  103.990 122.167 1.00 58.49  ? 14   MSE D N   1 
HETATM 6743  C  CA  . MSE D  1 14  ? -5.023  102.825 122.890 1.00 60.69  ? 14   MSE D CA  1 
HETATM 6744  C  C   . MSE D  1 14  ? -6.013  102.317 123.913 1.00 58.82  ? 14   MSE D C   1 
HETATM 6745  O  O   . MSE D  1 14  ? -6.066  101.118 124.170 1.00 58.82  ? 14   MSE D O   1 
HETATM 6746  C  CB  . MSE D  1 14  ? -3.668  103.112 123.521 1.00 65.77  ? 14   MSE D CB  1 
HETATM 6747  C  CG  . MSE D  1 14  ? -2.627  103.426 122.465 1.00 72.42  ? 14   MSE D CG  1 
HETATM 6748  SE SE  . MSE D  1 14  ? -0.819  103.319 123.095 1.00 84.06  ? 14   MSE D SE  1 
HETATM 6749  C  CE  . MSE D  1 14  ? -0.729  105.019 124.027 1.00 77.84  ? 14   MSE D CE  1 
ATOM   6750  N  N   . LYS D  1 15  ? -6.806  103.211 124.495 1.00 58.85  ? 15   LYS D N   1 
ATOM   6751  C  CA  . LYS D  1 15  ? -7.805  102.769 125.459 1.00 58.02  ? 15   LYS D CA  1 
ATOM   6752  C  C   . LYS D  1 15  ? -8.961  102.164 124.665 1.00 57.36  ? 15   LYS D C   1 
ATOM   6753  O  O   . LYS D  1 15  ? -9.567  101.192 125.105 1.00 55.50  ? 15   LYS D O   1 
ATOM   6754  C  CB  . LYS D  1 15  ? -8.307  103.932 126.314 1.00 59.56  ? 15   LYS D CB  1 
ATOM   6755  C  CG  . LYS D  1 15  ? -9.060  103.479 127.561 1.00 62.00  ? 15   LYS D CG  1 
ATOM   6756  C  CD  . LYS D  1 15  ? -9.920  104.591 128.152 1.00 66.43  ? 15   LYS D CD  1 
ATOM   6757  C  CE  . LYS D  1 15  ? -9.096  105.817 128.555 1.00 68.95  ? 15   LYS D CE  1 
ATOM   6758  N  NZ  . LYS D  1 15  ? -9.966  107.010 128.809 1.00 67.79  ? 15   LYS D NZ  1 
ATOM   6759  N  N   . GLU D  1 16  ? -9.250  102.751 123.497 1.00 56.68  ? 16   GLU D N   1 
ATOM   6760  C  CA  . GLU D  1 16  ? -10.306 102.282 122.591 1.00 59.88  ? 16   GLU D CA  1 
ATOM   6761  C  C   . GLU D  1 16  ? -10.092 100.795 122.315 1.00 60.92  ? 16   GLU D C   1 
ATOM   6762  O  O   . GLU D  1 16  ? -11.013 99.982  122.426 1.00 63.28  ? 16   GLU D O   1 
ATOM   6763  C  CB  . GLU D  1 16  ? -10.246 103.025 121.235 1.00 64.93  ? 16   GLU D CB  1 
ATOM   6764  C  CG  . GLU D  1 16  ? -11.106 104.298 121.084 1.00 70.23  ? 16   GLU D CG  1 
ATOM   6765  C  CD  . GLU D  1 16  ? -10.865 105.061 119.753 1.00 72.01  ? 16   GLU D CD  1 
ATOM   6766  O  OE1 . GLU D  1 16  ? -10.888 104.433 118.667 1.00 70.25  ? 16   GLU D OE1 1 
ATOM   6767  O  OE2 . GLU D  1 16  ? -10.667 106.299 119.799 1.00 72.01  ? 16   GLU D OE2 1 
ATOM   6768  N  N   . ASP D  1 17  ? -8.861  100.459 121.942 1.00 59.47  ? 17   ASP D N   1 
ATOM   6769  C  CA  . ASP D  1 17  ? -8.477  99.092  121.617 1.00 58.49  ? 17   ASP D CA  1 
ATOM   6770  C  C   . ASP D  1 17  ? -7.079  98.781  122.173 1.00 57.41  ? 17   ASP D C   1 
ATOM   6771  O  O   . ASP D  1 17  ? -6.063  99.165  121.588 1.00 57.62  ? 17   ASP D O   1 
ATOM   6772  C  CB  . ASP D  1 17  ? -8.519  98.916  120.088 1.00 58.31  ? 17   ASP D CB  1 
ATOM   6773  C  CG  . ASP D  1 17  ? -7.951  97.585  119.624 1.00 59.49  ? 17   ASP D CG  1 
ATOM   6774  O  OD1 . ASP D  1 17  ? -7.927  96.626  120.429 1.00 60.66  ? 17   ASP D OD1 1 
ATOM   6775  O  OD2 . ASP D  1 17  ? -7.541  97.498  118.442 1.00 57.99  ? 17   ASP D OD2 1 
ATOM   6776  N  N   . PRO D  1 18  ? -7.018  98.080  123.319 1.00 55.56  ? 18   PRO D N   1 
ATOM   6777  C  CA  . PRO D  1 18  ? -5.763  97.703  123.979 1.00 56.18  ? 18   PRO D CA  1 
ATOM   6778  C  C   . PRO D  1 18  ? -4.908  96.679  123.214 1.00 57.54  ? 18   PRO D C   1 
ATOM   6779  O  O   . PRO D  1 18  ? -3.725  96.508  123.514 1.00 56.32  ? 18   PRO D O   1 
ATOM   6780  C  CB  . PRO D  1 18  ? -6.237  97.183  125.334 1.00 54.61  ? 18   PRO D CB  1 
ATOM   6781  C  CG  . PRO D  1 18  ? -7.545  96.549  124.993 1.00 54.61  ? 18   PRO D CG  1 
ATOM   6782  C  CD  . PRO D  1 18  ? -8.178  97.573  124.075 1.00 55.35  ? 18   PRO D CD  1 
ATOM   6783  N  N   . ASP D  1 19  ? -5.497  96.002  122.232 1.00 57.56  ? 19   ASP D N   1 
ATOM   6784  C  CA  . ASP D  1 19  ? -4.745  95.028  121.447 1.00 59.94  ? 19   ASP D CA  1 
ATOM   6785  C  C   . ASP D  1 19  ? -4.038  95.699  120.281 1.00 58.83  ? 19   ASP D C   1 
ATOM   6786  O  O   . ASP D  1 19  ? -3.264  95.073  119.568 1.00 60.22  ? 19   ASP D O   1 
ATOM   6787  C  CB  . ASP D  1 19  ? -5.668  93.945  120.900 1.00 64.08  ? 19   ASP D CB  1 
ATOM   6788  C  CG  . ASP D  1 19  ? -6.491  93.305  121.974 1.00 68.80  ? 19   ASP D CG  1 
ATOM   6789  O  OD1 . ASP D  1 19  ? -5.939  93.069  123.071 1.00 70.30  ? 19   ASP D OD1 1 
ATOM   6790  O  OD2 . ASP D  1 19  ? -7.684  93.032  121.720 1.00 73.52  ? 19   ASP D OD2 1 
HETATM 6791  N  N   . MSE D  1 20  ? -4.318  96.977  120.080 1.00 56.79  ? 20   MSE D N   1 
HETATM 6792  C  CA  . MSE D  1 20  ? -3.705  97.722  119.000 1.00 53.37  ? 20   MSE D CA  1 
HETATM 6793  C  C   . MSE D  1 20  ? -2.245  98.024  119.311 1.00 51.65  ? 20   MSE D C   1 
HETATM 6794  O  O   . MSE D  1 20  ? -1.920  98.488  120.403 1.00 51.93  ? 20   MSE D O   1 
HETATM 6795  C  CB  . MSE D  1 20  ? -4.466  99.025  118.790 1.00 55.75  ? 20   MSE D CB  1 
HETATM 6796  C  CG  . MSE D  1 20  ? -3.903  99.886  117.685 1.00 63.45  ? 20   MSE D CG  1 
HETATM 6797  SE SE  . MSE D  1 20  ? -5.009  101.426 117.340 1.00 72.92  ? 20   MSE D SE  1 
HETATM 6798  C  CE  . MSE D  1 20  ? -6.265  100.635 116.094 1.00 67.58  ? 20   MSE D CE  1 
ATOM   6799  N  N   . ALA D  1 21  ? -1.363  97.751  118.357 1.00 48.34  ? 21   ALA D N   1 
ATOM   6800  C  CA  . ALA D  1 21  ? 0.050   98.035  118.540 1.00 43.75  ? 21   ALA D CA  1 
ATOM   6801  C  C   . ALA D  1 21  ? 0.205   99.512  118.873 1.00 43.29  ? 21   ALA D C   1 
ATOM   6802  O  O   . ALA D  1 21  ? -0.504  100.359 118.332 1.00 45.14  ? 21   ALA D O   1 
ATOM   6803  C  CB  . ALA D  1 21  ? 0.806   97.724  117.278 1.00 43.98  ? 21   ALA D CB  1 
ATOM   6804  N  N   . SER D  1 22  ? 1.135   99.819  119.763 1.00 41.54  ? 22   SER D N   1 
ATOM   6805  C  CA  . SER D  1 22  ? 1.378   101.191 120.162 1.00 40.55  ? 22   SER D CA  1 
ATOM   6806  C  C   . SER D  1 22  ? 1.725   102.068 118.958 1.00 41.16  ? 22   SER D C   1 
ATOM   6807  O  O   . SER D  1 22  ? 1.358   103.242 118.885 1.00 42.47  ? 22   SER D O   1 
ATOM   6808  C  CB  . SER D  1 22  ? 2.522   101.221 121.161 1.00 41.82  ? 22   SER D CB  1 
ATOM   6809  O  OG  . SER D  1 22  ? 2.810   102.550 121.535 1.00 47.92  ? 22   SER D OG  1 
ATOM   6810  N  N   . ALA D  1 23  ? 2.438   101.488 118.008 1.00 39.60  ? 23   ALA D N   1 
ATOM   6811  C  CA  . ALA D  1 23  ? 2.839   102.215 116.823 1.00 36.34  ? 23   ALA D CA  1 
ATOM   6812  C  C   . ALA D  1 23  ? 1.637   102.481 115.928 1.00 36.85  ? 23   ALA D C   1 
ATOM   6813  O  O   . ALA D  1 23  ? 1.536   103.546 115.297 1.00 33.89  ? 23   ALA D O   1 
ATOM   6814  C  CB  . ALA D  1 23  ? 3.886   101.417 116.070 1.00 36.36  ? 23   ALA D CB  1 
ATOM   6815  N  N   . VAL D  1 24  ? 0.736   101.501 115.861 1.00 37.34  ? 24   VAL D N   1 
ATOM   6816  C  CA  . VAL D  1 24  ? -0.465  101.620 115.039 1.00 36.18  ? 24   VAL D CA  1 
ATOM   6817  C  C   . VAL D  1 24  ? -1.336  102.723 115.608 1.00 34.17  ? 24   VAL D C   1 
ATOM   6818  O  O   . VAL D  1 24  ? -1.870  103.550 114.872 1.00 35.33  ? 24   VAL D O   1 
ATOM   6819  C  CB  . VAL D  1 24  ? -1.248  100.293 115.000 1.00 39.65  ? 24   VAL D CB  1 
ATOM   6820  C  CG1 . VAL D  1 24  ? -2.596  100.497 114.316 1.00 36.98  ? 24   VAL D CG1 1 
ATOM   6821  C  CG2 . VAL D  1 24  ? -0.435  99.245  114.245 1.00 38.75  ? 24   VAL D CG2 1 
ATOM   6822  N  N   . ALA D  1 25  ? -1.465  102.743 116.925 1.00 29.31  ? 25   ALA D N   1 
ATOM   6823  C  CA  . ALA D  1 25  ? -2.239  103.781 117.562 1.00 29.84  ? 25   ALA D CA  1 
ATOM   6824  C  C   . ALA D  1 25  ? -1.620  105.102 117.142 1.00 30.46  ? 25   ALA D C   1 
ATOM   6825  O  O   . ALA D  1 25  ? -2.329  106.026 116.777 1.00 33.94  ? 25   ALA D O   1 
ATOM   6826  C  CB  . ALA D  1 25  ? -2.194  103.627 119.094 1.00 29.89  ? 25   ALA D CB  1 
ATOM   6827  N  N   . ALA D  1 26  ? -0.293  105.178 117.170 1.00 32.28  ? 26   ALA D N   1 
ATOM   6828  C  CA  . ALA D  1 26  ? 0.420   106.403 116.803 1.00 33.77  ? 26   ALA D CA  1 
ATOM   6829  C  C   . ALA D  1 26  ? 0.267   106.868 115.359 1.00 34.57  ? 26   ALA D C   1 
ATOM   6830  O  O   . ALA D  1 26  ? 0.026   108.056 115.127 1.00 36.05  ? 26   ALA D O   1 
ATOM   6831  C  CB  . ALA D  1 26  ? 1.914   106.276 117.138 1.00 32.62  ? 26   ALA D CB  1 
ATOM   6832  N  N   . ILE D  1 27  ? 0.414   105.986 114.375 1.00 33.62  ? 27   ILE D N   1 
ATOM   6833  C  CA  . ILE D  1 27  ? 0.277   106.511 113.031 1.00 38.78  ? 27   ILE D CA  1 
ATOM   6834  C  C   . ILE D  1 27  ? -1.170  106.940 112.833 1.00 40.73  ? 27   ILE D C   1 
ATOM   6835  O  O   . ILE D  1 27  ? -1.444  107.895 112.109 1.00 42.57  ? 27   ILE D O   1 
ATOM   6836  C  CB  . ILE D  1 27  ? 0.719   105.521 111.910 1.00 39.89  ? 27   ILE D CB  1 
ATOM   6837  C  CG1 . ILE D  1 27  ? -0.428  104.615 111.516 1.00 44.66  ? 27   ILE D CG1 1 
ATOM   6838  C  CG2 . ILE D  1 27  ? 1.914   104.704 112.360 1.00 39.67  ? 27   ILE D CG2 1 
ATOM   6839  C  CD1 . ILE D  1 27  ? -0.193  103.952 110.190 1.00 52.19  ? 27   ILE D CD1 1 
ATOM   6840  N  N   . ARG D  1 28  ? -2.104  106.260 113.490 1.00 41.42  ? 28   ARG D N   1 
ATOM   6841  C  CA  . ARG D  1 28  ? -3.499  106.659 113.358 1.00 42.60  ? 28   ARG D CA  1 
ATOM   6842  C  C   . ARG D  1 28  ? -3.721  108.108 113.783 1.00 42.15  ? 28   ARG D C   1 
ATOM   6843  O  O   . ARG D  1 28  ? -4.406  108.861 113.087 1.00 42.78  ? 28   ARG D O   1 
ATOM   6844  C  CB  . ARG D  1 28  ? -4.416  105.769 114.188 1.00 43.24  ? 28   ARG D CB  1 
ATOM   6845  C  CG  . ARG D  1 28  ? -4.701  104.449 113.550 1.00 47.75  ? 28   ARG D CG  1 
ATOM   6846  C  CD  . ARG D  1 28  ? -5.991  103.865 114.080 1.00 53.84  ? 28   ARG D CD  1 
ATOM   6847  N  NE  . ARG D  1 28  ? -6.168  102.508 113.580 1.00 62.49  ? 28   ARG D NE  1 
ATOM   6848  C  CZ  . ARG D  1 28  ? -6.197  102.183 112.291 1.00 65.43  ? 28   ARG D CZ  1 
ATOM   6849  N  NH1 . ARG D  1 28  ? -6.071  103.126 111.365 1.00 68.06  ? 28   ARG D NH1 1 
ATOM   6850  N  NH2 . ARG D  1 28  ? -6.318  100.911 111.927 1.00 64.52  ? 28   ARG D NH2 1 
ATOM   6851  N  N   . THR D  1 29  ? -3.149  108.507 114.917 1.00 40.75  ? 29   THR D N   1 
ATOM   6852  C  CA  . THR D  1 29  ? -3.348  109.873 115.375 1.00 40.35  ? 29   THR D CA  1 
ATOM   6853  C  C   . THR D  1 29  ? -2.526  110.858 114.541 1.00 39.57  ? 29   THR D C   1 
ATOM   6854  O  O   . THR D  1 29  ? -2.827  112.046 114.514 1.00 36.39  ? 29   THR D O   1 
ATOM   6855  C  CB  . THR D  1 29  ? -3.061  110.047 116.912 1.00 39.49  ? 29   THR D CB  1 
ATOM   6856  O  OG1 . THR D  1 29  ? -1.793  110.662 117.108 1.00 38.05  ? 29   THR D OG1 1 
ATOM   6857  C  CG2 . THR D  1 29  ? -3.112  108.705 117.642 1.00 35.09  ? 29   THR D CG2 1 
ATOM   6858  N  N   . LEU D  1 30  ? -1.506  110.361 113.844 1.00 40.47  ? 30   LEU D N   1 
ATOM   6859  C  CA  . LEU D  1 30  ? -0.700  111.219 112.976 1.00 41.83  ? 30   LEU D CA  1 
ATOM   6860  C  C   . LEU D  1 30  ? -1.556  111.498 111.752 1.00 44.45  ? 30   LEU D C   1 
ATOM   6861  O  O   . LEU D  1 30  ? -1.554  112.608 111.203 1.00 46.62  ? 30   LEU D O   1 
ATOM   6862  C  CB  . LEU D  1 30  ? 0.592   110.524 112.536 1.00 42.12  ? 30   LEU D CB  1 
ATOM   6863  C  CG  . LEU D  1 30  ? 1.793   110.644 113.480 1.00 45.60  ? 30   LEU D CG  1 
ATOM   6864  C  CD1 . LEU D  1 30  ? 2.998   109.904 112.907 1.00 42.14  ? 30   LEU D CD1 1 
ATOM   6865  C  CD2 . LEU D  1 30  ? 2.122   112.116 113.688 1.00 40.72  ? 30   LEU D CD2 1 
ATOM   6866  N  N   . LEU D  1 31  ? -2.297  110.475 111.335 1.00 44.25  ? 31   LEU D N   1 
ATOM   6867  C  CA  . LEU D  1 31  ? -3.181  110.591 110.186 1.00 45.04  ? 31   LEU D CA  1 
ATOM   6868  C  C   . LEU D  1 31  ? -4.297  111.578 110.507 1.00 44.71  ? 31   LEU D C   1 
ATOM   6869  O  O   . LEU D  1 31  ? -4.714  112.353 109.654 1.00 41.52  ? 31   LEU D O   1 
ATOM   6870  C  CB  . LEU D  1 31  ? -3.803  109.237 109.847 1.00 43.72  ? 31   LEU D CB  1 
ATOM   6871  C  CG  . LEU D  1 31  ? -3.956  108.906 108.361 1.00 44.11  ? 31   LEU D CG  1 
ATOM   6872  C  CD1 . LEU D  1 31  ? -5.169  108.006 108.169 1.00 41.49  ? 31   LEU D CD1 1 
ATOM   6873  C  CD2 . LEU D  1 31  ? -4.114  110.172 107.553 1.00 43.03  ? 31   LEU D CD2 1 
ATOM   6874  N  N   . GLU D  1 32  ? -4.779  111.539 111.744 1.00 46.26  ? 32   GLU D N   1 
ATOM   6875  C  CA  . GLU D  1 32  ? -5.851  112.428 112.161 1.00 51.87  ? 32   GLU D CA  1 
ATOM   6876  C  C   . GLU D  1 32  ? -5.320  113.846 112.231 1.00 54.06  ? 32   GLU D C   1 
ATOM   6877  O  O   . GLU D  1 32  ? -6.016  114.796 111.875 1.00 54.56  ? 32   GLU D O   1 
ATOM   6878  C  CB  . GLU D  1 32  ? -6.401  111.996 113.527 1.00 54.50  ? 32   GLU D CB  1 
ATOM   6879  C  CG  . GLU D  1 32  ? -7.816  112.495 113.821 1.00 58.06  ? 32   GLU D CG  1 
ATOM   6880  C  CD  . GLU D  1 32  ? -8.763  112.326 112.633 1.00 60.70  ? 32   GLU D CD  1 
ATOM   6881  O  OE1 . GLU D  1 32  ? -8.641  111.320 111.893 1.00 60.29  ? 32   GLU D OE1 1 
ATOM   6882  O  OE2 . GLU D  1 32  ? -9.637  113.200 112.447 1.00 61.72  ? 32   GLU D OE2 1 
ATOM   6883  N  N   . PHE D  1 33  ? -4.078  113.978 112.688 1.00 55.85  ? 33   PHE D N   1 
ATOM   6884  C  CA  . PHE D  1 33  ? -3.429  115.276 112.793 1.00 55.53  ? 33   PHE D CA  1 
ATOM   6885  C  C   . PHE D  1 33  ? -3.212  115.854 111.406 1.00 56.42  ? 33   PHE D C   1 
ATOM   6886  O  O   . PHE D  1 33  ? -3.352  117.062 111.196 1.00 58.44  ? 33   PHE D O   1 
ATOM   6887  C  CB  . PHE D  1 33  ? -2.083  115.148 113.500 1.00 55.70  ? 33   PHE D CB  1 
ATOM   6888  C  CG  . PHE D  1 33  ? -1.289  116.419 113.508 1.00 57.46  ? 33   PHE D CG  1 
ATOM   6889  C  CD1 . PHE D  1 33  ? -0.630  116.851 112.356 1.00 57.93  ? 33   PHE D CD1 1 
ATOM   6890  C  CD2 . PHE D  1 33  ? -1.243  117.213 114.648 1.00 57.14  ? 33   PHE D CD2 1 
ATOM   6891  C  CE1 . PHE D  1 33  ? 0.054   118.050 112.336 1.00 58.51  ? 33   PHE D CE1 1 
ATOM   6892  C  CE2 . PHE D  1 33  ? -0.560  118.419 114.641 1.00 58.86  ? 33   PHE D CE2 1 
ATOM   6893  C  CZ  . PHE D  1 33  ? 0.091   118.841 113.481 1.00 60.36  ? 33   PHE D CZ  1 
ATOM   6894  N  N   . LEU D  1 34  ? -2.847  114.993 110.463 1.00 55.65  ? 34   LEU D N   1 
ATOM   6895  C  CA  . LEU D  1 34  ? -2.625  115.431 109.092 1.00 55.86  ? 34   LEU D CA  1 
ATOM   6896  C  C   . LEU D  1 34  ? -3.934  115.867 108.430 1.00 57.67  ? 34   LEU D C   1 
ATOM   6897  O  O   . LEU D  1 34  ? -3.931  116.694 107.517 1.00 58.27  ? 34   LEU D O   1 
ATOM   6898  C  CB  . LEU D  1 34  ? -2.009  114.305 108.264 1.00 53.41  ? 34   LEU D CB  1 
ATOM   6899  C  CG  . LEU D  1 34  ? -1.800  114.731 106.815 1.00 51.16  ? 34   LEU D CG  1 
ATOM   6900  C  CD1 . LEU D  1 34  ? -0.700  115.773 106.782 1.00 49.63  ? 34   LEU D CD1 1 
ATOM   6901  C  CD2 . LEU D  1 34  ? -1.459  113.539 105.942 1.00 49.61  ? 34   LEU D CD2 1 
ATOM   6902  N  N   . LYS D  1 35  ? -5.049  115.297 108.886 1.00 59.23  ? 35   LYS D N   1 
ATOM   6903  C  CA  . LYS D  1 35  ? -6.361  115.622 108.334 1.00 59.20  ? 35   LYS D CA  1 
ATOM   6904  C  C   . LYS D  1 35  ? -6.856  116.979 108.805 1.00 61.35  ? 35   LYS D C   1 
ATOM   6905  O  O   . LYS D  1 35  ? -7.475  117.724 108.049 1.00 61.48  ? 35   LYS D O   1 
ATOM   6906  C  CB  . LYS D  1 35  ? -7.384  114.542 108.704 1.00 54.58  ? 35   LYS D CB  1 
ATOM   6907  C  CG  . LYS D  1 35  ? -7.186  113.238 107.942 1.00 54.72  ? 35   LYS D CG  1 
ATOM   6908  C  CD  . LYS D  1 35  ? -8.291  112.216 108.206 1.00 50.67  ? 35   LYS D CD  1 
ATOM   6909  C  CE  . LYS D  1 35  ? -8.057  110.950 107.390 1.00 49.12  ? 35   LYS D CE  1 
ATOM   6910  N  NZ  . LYS D  1 35  ? -9.172  109.972 107.491 1.00 50.73  ? 35   LYS D NZ  1 
ATOM   6911  N  N   . ARG D  1 36  ? -6.568  117.306 110.053 1.00 64.36  ? 36   ARG D N   1 
ATOM   6912  C  CA  . ARG D  1 36  ? -7.005  118.571 110.602 1.00 68.16  ? 36   ARG D CA  1 
ATOM   6913  C  C   . ARG D  1 36  ? -6.071  119.735 110.294 1.00 73.16  ? 36   ARG D C   1 
ATOM   6914  O  O   . ARG D  1 36  ? -6.533  120.853 110.064 1.00 73.86  ? 36   ARG D O   1 
ATOM   6915  C  CB  . ARG D  1 36  ? -7.169  118.443 112.109 1.00 65.90  ? 36   ARG D CB  1 
ATOM   6916  C  CG  . ARG D  1 36  ? -8.118  117.349 112.532 1.00 63.78  ? 36   ARG D CG  1 
ATOM   6917  C  CD  . ARG D  1 36  ? -8.382  117.463 114.012 1.00 61.89  ? 36   ARG D CD  1 
ATOM   6918  N  NE  . ARG D  1 36  ? -9.076  116.302 114.545 1.00 60.76  ? 36   ARG D NE  1 
ATOM   6919  C  CZ  . ARG D  1 36  ? -9.316  116.123 115.838 1.00 63.03  ? 36   ARG D CZ  1 
ATOM   6920  N  NH1 . ARG D  1 36  ? -8.914  117.036 116.720 1.00 61.59  ? 36   ARG D NH1 1 
ATOM   6921  N  NH2 . ARG D  1 36  ? -9.951  115.034 116.252 1.00 62.66  ? 36   ARG D NH2 1 
ATOM   6922  N  N   . ASP D  1 37  ? -4.767  119.471 110.280 1.00 78.62  ? 37   ASP D N   1 
ATOM   6923  C  CA  . ASP D  1 37  ? -3.775  120.517 110.036 1.00 83.62  ? 37   ASP D CA  1 
ATOM   6924  C  C   . ASP D  1 37  ? -4.203  121.598 109.035 1.00 85.32  ? 37   ASP D C   1 
ATOM   6925  O  O   . ASP D  1 37  ? -4.197  121.397 107.815 1.00 82.98  ? 37   ASP D O   1 
ATOM   6926  C  CB  . ASP D  1 37  ? -2.442  119.907 109.603 1.00 85.39  ? 37   ASP D CB  1 
ATOM   6927  C  CG  . ASP D  1 37  ? -1.254  120.672 110.160 1.00 88.08  ? 37   ASP D CG  1 
ATOM   6928  O  OD1 . ASP D  1 37  ? -0.100  120.308 109.844 1.00 91.18  ? 37   ASP D OD1 1 
ATOM   6929  O  OD2 . ASP D  1 37  ? -1.480  121.638 110.924 1.00 87.15  ? 37   ASP D OD2 1 
ATOM   6930  N  N   . LYS D  1 38  ? -4.563  122.752 109.593 1.00 87.09  ? 38   LYS D N   1 
ATOM   6931  C  CA  . LYS D  1 38  ? -5.015  123.910 108.833 1.00 87.19  ? 38   LYS D CA  1 
ATOM   6932  C  C   . LYS D  1 38  ? -3.851  124.832 108.480 1.00 86.34  ? 38   LYS D C   1 
ATOM   6933  O  O   . LYS D  1 38  ? -4.050  125.933 107.971 1.00 84.00  ? 38   LYS D O   1 
ATOM   6934  C  CB  . LYS D  1 38  ? -6.068  124.665 109.653 1.00 88.44  ? 38   LYS D CB  1 
ATOM   6935  C  CG  . LYS D  1 38  ? -5.621  124.989 111.079 1.00 89.81  ? 38   LYS D CG  1 
ATOM   6936  C  CD  . LYS D  1 38  ? -6.765  125.511 111.959 1.00 89.75  ? 38   LYS D CD  1 
ATOM   6937  C  CE  . LYS D  1 38  ? -7.604  124.383 112.562 1.00 89.99  ? 38   LYS D CE  1 
ATOM   6938  N  NZ  . LYS D  1 38  ? -8.307  123.546 111.546 1.00 90.88  ? 38   LYS D NZ  1 
ATOM   6939  N  N   . GLY D  1 39  ? -2.636  124.369 108.757 1.00 86.83  ? 39   GLY D N   1 
ATOM   6940  C  CA  . GLY D  1 39  ? -1.452  125.152 108.454 1.00 87.00  ? 39   GLY D CA  1 
ATOM   6941  C  C   . GLY D  1 39  ? -1.007  124.962 107.016 1.00 88.24  ? 39   GLY D C   1 
ATOM   6942  O  O   . GLY D  1 39  ? -1.832  124.884 106.101 1.00 87.14  ? 39   GLY D O   1 
ATOM   6943  N  N   . ILE D  1 42  ? 0.632   125.415 104.285 1.00 90.52  ? 42   ILE D N   1 
ATOM   6944  C  CA  . ILE D  1 42  ? 1.602   125.235 103.212 1.00 91.68  ? 42   ILE D CA  1 
ATOM   6945  C  C   . ILE D  1 42  ? 2.230   123.849 103.323 1.00 92.05  ? 42   ILE D C   1 
ATOM   6946  O  O   . ILE D  1 42  ? 2.072   123.180 104.341 1.00 92.38  ? 42   ILE D O   1 
ATOM   6947  C  CB  . ILE D  1 42  ? 2.710   126.298 103.288 1.00 91.93  ? 42   ILE D CB  1 
ATOM   6948  C  CG1 . ILE D  1 42  ? 3.728   125.918 104.362 1.00 92.70  ? 42   ILE D CG1 1 
ATOM   6949  C  CG2 . ILE D  1 42  ? 2.100   127.650 103.635 1.00 92.13  ? 42   ILE D CG2 1 
ATOM   6950  C  CD1 . ILE D  1 42  ? 4.909   126.870 104.460 1.00 92.49  ? 42   ILE D CD1 1 
ATOM   6951  N  N   . GLN D  1 43  ? 2.952   123.427 102.288 1.00 92.47  ? 43   GLN D N   1 
ATOM   6952  C  CA  . GLN D  1 43  ? 3.575   122.104 102.278 1.00 95.14  ? 43   GLN D CA  1 
ATOM   6953  C  C   . GLN D  1 43  ? 4.730   121.931 103.268 1.00 96.18  ? 43   GLN D C   1 
ATOM   6954  O  O   . GLN D  1 43  ? 4.769   120.955 104.022 1.00 95.27  ? 43   GLN D O   1 
ATOM   6955  C  CB  . GLN D  1 43  ? 4.036   121.761 100.859 1.00 96.38  ? 43   GLN D CB  1 
ATOM   6956  C  CG  . GLN D  1 43  ? 2.896   121.810 99.841  1.00 101.73 ? 43   GLN D CG  1 
ATOM   6957  C  CD  . GLN D  1 43  ? 3.303   121.367 98.439  1.00 103.93 ? 43   GLN D CD  1 
ATOM   6958  O  OE1 . GLN D  1 43  ? 3.723   120.226 98.236  1.00 105.27 ? 43   GLN D OE1 1 
ATOM   6959  N  NE2 . GLN D  1 43  ? 3.171   122.269 97.465  1.00 102.67 ? 43   GLN D NE2 1 
ATOM   6960  N  N   . GLY D  1 44  ? 5.669   122.872 103.267 1.00 97.42  ? 44   GLY D N   1 
ATOM   6961  C  CA  . GLY D  1 44  ? 6.792   122.791 104.188 1.00 97.22  ? 44   GLY D CA  1 
ATOM   6962  C  C   . GLY D  1 44  ? 6.324   122.695 105.631 1.00 96.86  ? 44   GLY D C   1 
ATOM   6963  O  O   . GLY D  1 44  ? 6.792   121.840 106.384 1.00 96.90  ? 44   GLY D O   1 
ATOM   6964  N  N   . LEU D  1 45  ? 5.405   123.580 106.020 1.00 96.61  ? 45   LEU D N   1 
ATOM   6965  C  CA  . LEU D  1 45  ? 4.854   123.583 107.374 1.00 95.88  ? 45   LEU D CA  1 
ATOM   6966  C  C   . LEU D  1 45  ? 4.390   122.172 107.705 1.00 94.27  ? 45   LEU D C   1 
ATOM   6967  O  O   . LEU D  1 45  ? 4.935   121.504 108.588 1.00 93.30  ? 45   LEU D O   1 
ATOM   6968  C  CB  . LEU D  1 45  ? 3.646   124.533 107.472 1.00 98.26  ? 45   LEU D CB  1 
ATOM   6969  C  CG  . LEU D  1 45  ? 3.804   126.058 107.584 1.00 100.40 ? 45   LEU D CG  1 
ATOM   6970  C  CD1 . LEU D  1 45  ? 2.423   126.727 107.496 1.00 99.20  ? 45   LEU D CD1 1 
ATOM   6971  C  CD2 . LEU D  1 45  ? 4.494   126.418 108.899 1.00 100.45 ? 45   LEU D CD2 1 
ATOM   6972  N  N   . ARG D  1 46  ? 3.377   121.732 106.968 1.00 92.25  ? 46   ARG D N   1 
ATOM   6973  C  CA  . ARG D  1 46  ? 2.786   120.415 107.138 1.00 90.68  ? 46   ARG D CA  1 
ATOM   6974  C  C   . ARG D  1 46  ? 3.847   119.365 107.451 1.00 87.23  ? 46   ARG D C   1 
ATOM   6975  O  O   . ARG D  1 46  ? 3.641   118.489 108.294 1.00 84.97  ? 46   ARG D O   1 
ATOM   6976  C  CB  . ARG D  1 46  ? 2.021   120.041 105.866 1.00 92.47  ? 46   ARG D CB  1 
ATOM   6977  C  CG  . ARG D  1 46  ? 1.055   118.886 106.022 1.00 96.22  ? 46   ARG D CG  1 
ATOM   6978  C  CD  . ARG D  1 46  ? -0.206  119.145 105.208 1.00 101.97 ? 46   ARG D CD  1 
ATOM   6979  N  NE  . ARG D  1 46  ? -0.952  120.304 105.708 1.00 107.89 ? 46   ARG D NE  1 
ATOM   6980  C  CZ  . ARG D  1 46  ? -2.032  120.823 105.123 1.00 109.83 ? 46   ARG D CZ  1 
ATOM   6981  N  NH1 . ARG D  1 46  ? -2.641  121.877 105.659 1.00 110.42 ? 46   ARG D NH1 1 
ATOM   6982  N  NH2 . ARG D  1 46  ? -2.501  120.299 103.996 1.00 109.19 ? 46   ARG D NH2 1 
ATOM   6983  N  N   . ALA D  1 47  ? 4.988   119.476 106.777 1.00 84.25  ? 47   ALA D N   1 
ATOM   6984  C  CA  . ALA D  1 47  ? 6.086   118.543 106.968 1.00 80.34  ? 47   ALA D CA  1 
ATOM   6985  C  C   . ALA D  1 47  ? 6.657   118.590 108.380 1.00 78.56  ? 47   ALA D C   1 
ATOM   6986  O  O   . ALA D  1 47  ? 6.527   117.622 109.120 1.00 78.04  ? 47   ALA D O   1 
ATOM   6987  C  CB  . ALA D  1 47  ? 7.182   118.807 105.950 1.00 80.00  ? 47   ALA D CB  1 
ATOM   6988  N  N   . ASN D  1 48  ? 7.280   119.698 108.774 1.00 76.49  ? 48   ASN D N   1 
ATOM   6989  C  CA  . ASN D  1 48  ? 7.848   119.737 110.117 1.00 76.73  ? 48   ASN D CA  1 
ATOM   6990  C  C   . ASN D  1 48  ? 6.755   119.755 111.160 1.00 75.40  ? 48   ASN D C   1 
ATOM   6991  O  O   . ASN D  1 48  ? 7.008   119.541 112.342 1.00 74.89  ? 48   ASN D O   1 
ATOM   6992  C  CB  . ASN D  1 48  ? 8.761   120.947 110.322 1.00 81.06  ? 48   ASN D CB  1 
ATOM   6993  C  CG  . ASN D  1 48  ? 9.741   120.753 111.498 1.00 85.18  ? 48   ASN D CG  1 
ATOM   6994  O  OD1 . ASN D  1 48  ? 9.331   120.493 112.635 1.00 86.24  ? 48   ASN D OD1 1 
ATOM   6995  N  ND2 . ASN D  1 48  ? 11.039  120.881 111.220 1.00 85.61  ? 48   ASN D ND2 1 
ATOM   6996  N  N   . LEU D  1 49  ? 5.530   120.013 110.729 1.00 74.34  ? 49   LEU D N   1 
ATOM   6997  C  CA  . LEU D  1 49  ? 4.426   120.029 111.672 1.00 73.59  ? 49   LEU D CA  1 
ATOM   6998  C  C   . LEU D  1 49  ? 4.061   118.594 112.026 1.00 72.19  ? 49   LEU D C   1 
ATOM   6999  O  O   . LEU D  1 49  ? 3.948   118.239 113.205 1.00 68.95  ? 49   LEU D O   1 
ATOM   7000  C  CB  . LEU D  1 49  ? 3.229   120.758 111.068 1.00 73.60  ? 49   LEU D CB  1 
ATOM   7001  C  CG  . LEU D  1 49  ? 3.502   122.245 110.856 1.00 72.70  ? 49   LEU D CG  1 
ATOM   7002  C  CD1 . LEU D  1 49  ? 2.280   122.888 110.224 1.00 74.25  ? 49   LEU D CD1 1 
ATOM   7003  C  CD2 . LEU D  1 49  ? 3.860   122.905 112.188 1.00 69.37  ? 49   LEU D CD2 1 
ATOM   7004  N  N   . THR D  1 50  ? 3.899   117.770 110.994 1.00 70.60  ? 50   THR D N   1 
ATOM   7005  C  CA  . THR D  1 50  ? 3.560   116.368 111.180 1.00 69.34  ? 50   THR D CA  1 
ATOM   7006  C  C   . THR D  1 50  ? 4.811   115.643 111.695 1.00 68.70  ? 50   THR D C   1 
ATOM   7007  O  O   . THR D  1 50  ? 4.809   114.431 111.902 1.00 69.19  ? 50   THR D O   1 
ATOM   7008  C  CB  . THR D  1 50  ? 3.057   115.746 109.842 1.00 68.32  ? 50   THR D CB  1 
ATOM   7009  O  OG1 . THR D  1 50  ? 2.341   114.531 110.100 1.00 65.79  ? 50   THR D OG1 1 
ATOM   7010  C  CG2 . THR D  1 50  ? 4.215   115.455 108.925 1.00 67.36  ? 50   THR D CG2 1 
ATOM   7011  N  N   . SER D  1 51  ? 5.872   116.413 111.923 1.00 69.21  ? 51   SER D N   1 
ATOM   7012  C  CA  . SER D  1 51  ? 7.144   115.882 112.413 1.00 68.33  ? 51   SER D CA  1 
ATOM   7013  C  C   . SER D  1 51  ? 7.439   116.332 113.840 1.00 68.45  ? 51   SER D C   1 
ATOM   7014  O  O   . SER D  1 51  ? 7.883   115.539 114.668 1.00 66.22  ? 51   SER D O   1 
ATOM   7015  C  CB  . SER D  1 51  ? 8.284   116.324 111.498 1.00 67.76  ? 51   SER D CB  1 
ATOM   7016  O  OG  . SER D  1 51  ? 9.535   115.936 112.029 1.00 66.75  ? 51   SER D OG  1 
ATOM   7017  N  N   . ALA D  1 52  ? 7.199   117.610 114.117 1.00 70.46  ? 52   ALA D N   1 
ATOM   7018  C  CA  . ALA D  1 52  ? 7.423   118.165 115.449 1.00 72.74  ? 52   ALA D CA  1 
ATOM   7019  C  C   . ALA D  1 52  ? 6.244   117.785 116.335 1.00 74.43  ? 52   ALA D C   1 
ATOM   7020  O  O   . ALA D  1 52  ? 5.840   118.545 117.220 1.00 77.71  ? 52   ALA D O   1 
ATOM   7021  C  CB  . ALA D  1 52  ? 7.556   119.688 115.377 1.00 71.28  ? 52   ALA D CB  1 
ATOM   7022  N  N   . ILE D  1 53  ? 5.697   116.602 116.082 1.00 73.55  ? 53   ILE D N   1 
ATOM   7023  C  CA  . ILE D  1 53  ? 4.561   116.089 116.834 1.00 72.99  ? 53   ILE D CA  1 
ATOM   7024  C  C   . ILE D  1 53  ? 4.729   114.591 116.929 1.00 69.99  ? 53   ILE D C   1 
ATOM   7025  O  O   . ILE D  1 53  ? 4.310   113.958 117.891 1.00 70.93  ? 53   ILE D O   1 
ATOM   7026  C  CB  . ILE D  1 53  ? 3.256   116.379 116.109 1.00 75.66  ? 53   ILE D CB  1 
ATOM   7027  C  CG1 . ILE D  1 53  ? 3.255   115.666 114.757 1.00 75.36  ? 53   ILE D CG1 1 
ATOM   7028  C  CG2 . ILE D  1 53  ? 3.091   117.891 115.934 1.00 78.43  ? 53   ILE D CG2 1 
ATOM   7029  C  CD1 . ILE D  1 53  ? 1.950   115.778 114.012 1.00 74.82  ? 53   ILE D CD1 1 
ATOM   7030  N  N   . GLU D  1 54  ? 5.335   114.031 115.897 1.00 67.31  ? 54   GLU D N   1 
ATOM   7031  C  CA  . GLU D  1 54  ? 5.607   112.614 115.855 1.00 64.77  ? 54   GLU D CA  1 
ATOM   7032  C  C   . GLU D  1 54  ? 6.563   112.375 117.006 1.00 63.43  ? 54   GLU D C   1 
ATOM   7033  O  O   . GLU D  1 54  ? 6.492   111.369 117.709 1.00 59.96  ? 54   GLU D O   1 
ATOM   7034  C  CB  . GLU D  1 54  ? 6.287   112.284 114.547 1.00 64.69  ? 54   GLU D CB  1 
ATOM   7035  C  CG  . GLU D  1 54  ? 6.571   110.839 114.350 1.00 68.50  ? 54   GLU D CG  1 
ATOM   7036  C  CD  . GLU D  1 54  ? 7.060   110.587 112.950 1.00 75.06  ? 54   GLU D CD  1 
ATOM   7037  O  OE1 . GLU D  1 54  ? 6.448   111.145 112.012 1.00 76.17  ? 54   GLU D OE1 1 
ATOM   7038  O  OE2 . GLU D  1 54  ? 8.047   109.840 112.780 1.00 80.10  ? 54   GLU D OE2 1 
ATOM   7039  N  N   . THR D  1 55  ? 7.463   113.334 117.189 1.00 63.52  ? 55   THR D N   1 
ATOM   7040  C  CA  . THR D  1 55  ? 8.443   113.262 118.256 1.00 63.49  ? 55   THR D CA  1 
ATOM   7041  C  C   . THR D  1 55  ? 7.712   113.586 119.550 1.00 60.83  ? 55   THR D C   1 
ATOM   7042  O  O   . THR D  1 55  ? 8.112   113.160 120.633 1.00 60.53  ? 55   THR D O   1 
ATOM   7043  C  CB  . THR D  1 55  ? 9.602   114.264 118.014 1.00 66.15  ? 55   THR D CB  1 
ATOM   7044  O  OG1 . THR D  1 55  ? 10.744  113.879 118.794 1.00 70.44  ? 55   THR D OG1 1 
ATOM   7045  C  CG2 . THR D  1 55  ? 9.179   115.678 118.382 1.00 66.96  ? 55   THR D CG2 1 
ATOM   7046  N  N   . LEU D  1 56  ? 6.628   114.343 119.428 1.00 59.90  ? 56   LEU D N   1 
ATOM   7047  C  CA  . LEU D  1 56  ? 5.836   114.689 120.592 1.00 59.29  ? 56   LEU D CA  1 
ATOM   7048  C  C   . LEU D  1 56  ? 5.149   113.408 121.032 1.00 60.54  ? 56   LEU D C   1 
ATOM   7049  O  O   . LEU D  1 56  ? 4.891   113.199 122.215 1.00 60.14  ? 56   LEU D O   1 
ATOM   7050  C  CB  . LEU D  1 56  ? 4.813   115.764 120.247 1.00 58.06  ? 56   LEU D CB  1 
ATOM   7051  C  CG  . LEU D  1 56  ? 4.009   116.239 121.453 1.00 60.90  ? 56   LEU D CG  1 
ATOM   7052  C  CD1 . LEU D  1 56  ? 2.868   115.277 121.724 1.00 62.35  ? 56   LEU D CD1 1 
ATOM   7053  C  CD2 . LEU D  1 56  ? 4.929   116.362 122.673 1.00 62.19  ? 56   LEU D CD2 1 
ATOM   7054  N  N   . CYS D  1 57  ? 4.853   112.551 120.058 1.00 63.01  ? 57   CYS D N   1 
ATOM   7055  C  CA  . CYS D  1 57  ? 4.243   111.256 120.324 1.00 64.08  ? 57   CYS D CA  1 
ATOM   7056  C  C   . CYS D  1 57  ? 5.351   110.402 120.934 1.00 65.05  ? 57   CYS D C   1 
ATOM   7057  O  O   . CYS D  1 57  ? 5.096   109.353 121.520 1.00 65.77  ? 57   CYS D O   1 
ATOM   7058  C  CB  . CYS D  1 57  ? 3.744   110.614 119.025 1.00 65.57  ? 57   CYS D CB  1 
ATOM   7059  S  SG  . CYS D  1 57  ? 1.949   110.678 118.746 1.00 69.39  ? 57   CYS D SG  1 
ATOM   7060  N  N   . GLY D  1 58  ? 6.590   110.861 120.778 1.00 67.54  ? 58   GLY D N   1 
ATOM   7061  C  CA  . GLY D  1 58  ? 7.723   110.154 121.343 1.00 67.92  ? 58   GLY D CA  1 
ATOM   7062  C  C   . GLY D  1 58  ? 7.571   110.066 122.854 1.00 69.35  ? 58   GLY D C   1 
ATOM   7063  O  O   . GLY D  1 58  ? 8.436   109.506 123.524 1.00 67.10  ? 58   GLY D O   1 
ATOM   7064  N  N   . VAL D  1 59  ? 6.486   110.640 123.391 1.00 72.62  ? 59   VAL D N   1 
ATOM   7065  C  CA  . VAL D  1 59  ? 6.186   110.585 124.832 1.00 73.40  ? 59   VAL D CA  1 
ATOM   7066  C  C   . VAL D  1 59  ? 5.479   109.247 125.128 1.00 73.13  ? 59   VAL D C   1 
ATOM   7067  O  O   . VAL D  1 59  ? 4.353   109.158 125.639 1.00 67.98  ? 59   VAL D O   1 
ATOM   7068  C  CB  . VAL D  1 59  ? 5.297   111.752 125.297 1.00 76.24  ? 59   VAL D CB  1 
ATOM   7069  C  CG1 . VAL D  1 59  ? 5.142   111.697 126.812 1.00 75.04  ? 59   VAL D CG1 1 
ATOM   7070  C  CG2 . VAL D  1 59  ? 5.921   113.088 124.881 1.00 77.41  ? 59   VAL D CG2 1 
ATOM   7071  N  N   . ASP D  1 60  ? 6.217   108.223 124.722 1.00 74.03  ? 60   ASP D N   1 
ATOM   7072  C  CA  . ASP D  1 60  ? 5.968   106.796 124.835 1.00 69.21  ? 60   ASP D CA  1 
ATOM   7073  C  C   . ASP D  1 60  ? 7.270   106.380 124.170 1.00 65.81  ? 60   ASP D C   1 
ATOM   7074  O  O   . ASP D  1 60  ? 7.336   106.191 122.954 1.00 65.13  ? 60   ASP D O   1 
ATOM   7075  C  CB  . ASP D  1 60  ? 4.788   106.319 124.000 1.00 67.54  ? 60   ASP D CB  1 
ATOM   7076  C  CG  . ASP D  1 60  ? 4.600   104.810 124.104 1.00 68.93  ? 60   ASP D CG  1 
ATOM   7077  O  OD1 . ASP D  1 60  ? 4.679   104.284 125.237 1.00 72.65  ? 60   ASP D OD1 1 
ATOM   7078  O  OD2 . ASP D  1 60  ? 4.379   104.145 123.074 1.00 63.97  ? 60   ASP D OD2 1 
ATOM   7079  N  N   . SER D  1 61  ? 8.315   106.319 124.987 1.00 62.50  ? 61   SER D N   1 
ATOM   7080  C  CA  . SER D  1 61  ? 9.663   105.997 124.543 1.00 60.26  ? 61   SER D CA  1 
ATOM   7081  C  C   . SER D  1 61  ? 9.830   104.637 123.872 1.00 58.30  ? 61   SER D C   1 
ATOM   7082  O  O   . SER D  1 61  ? 10.790  103.920 124.141 1.00 60.26  ? 61   SER D O   1 
ATOM   7083  C  CB  . SER D  1 61  ? 10.610  106.105 125.735 1.00 59.93  ? 61   SER D CB  1 
ATOM   7084  O  OG  . SER D  1 61  ? 10.205  105.227 126.765 1.00 57.77  ? 61   SER D OG  1 
ATOM   7085  N  N   . SER D  1 62  ? 8.895   104.283 123.000 1.00 55.83  ? 62   SER D N   1 
ATOM   7086  C  CA  . SER D  1 62  ? 8.958   103.015 122.286 1.00 53.49  ? 62   SER D CA  1 
ATOM   7087  C  C   . SER D  1 62  ? 9.608   103.214 120.912 1.00 49.65  ? 62   SER D C   1 
ATOM   7088  O  O   . SER D  1 62  ? 9.338   104.198 120.209 1.00 48.71  ? 62   SER D O   1 
ATOM   7089  C  CB  . SER D  1 62  ? 7.556   102.428 122.114 1.00 55.30  ? 62   SER D CB  1 
ATOM   7090  O  OG  . SER D  1 62  ? 7.590   101.300 121.255 1.00 60.40  ? 62   SER D OG  1 
ATOM   7091  N  N   . VAL D  1 63  ? 10.465  102.271 120.543 1.00 41.97  ? 63   VAL D N   1 
ATOM   7092  C  CA  . VAL D  1 63  ? 11.163  102.337 119.275 1.00 38.21  ? 63   VAL D CA  1 
ATOM   7093  C  C   . VAL D  1 63  ? 10.170  102.306 118.134 1.00 36.88  ? 63   VAL D C   1 
ATOM   7094  O  O   . VAL D  1 63  ? 10.326  103.039 117.163 1.00 34.88  ? 63   VAL D O   1 
ATOM   7095  C  CB  . VAL D  1 63  ? 12.125  101.147 119.091 1.00 37.40  ? 63   VAL D CB  1 
ATOM   7096  C  CG1 . VAL D  1 63  ? 13.423  101.626 118.456 1.00 35.49  ? 63   VAL D CG1 1 
ATOM   7097  C  CG2 . VAL D  1 63  ? 12.377  100.471 120.419 1.00 37.61  ? 63   VAL D CG2 1 
ATOM   7098  N  N   . ALA D  1 64  ? 9.157   101.446 118.269 1.00 38.26  ? 64   ALA D N   1 
ATOM   7099  C  CA  . ALA D  1 64  ? 8.109   101.250 117.265 1.00 35.91  ? 64   ALA D CA  1 
ATOM   7100  C  C   . ALA D  1 64  ? 7.396   102.540 116.881 1.00 36.78  ? 64   ALA D C   1 
ATOM   7101  O  O   . ALA D  1 64  ? 7.233   102.837 115.687 1.00 35.45  ? 64   ALA D O   1 
ATOM   7102  C  CB  . ALA D  1 64  ? 7.114   100.246 117.768 1.00 37.09  ? 64   ALA D CB  1 
ATOM   7103  N  N   . VAL D  1 65  ? 6.973   103.301 117.889 1.00 34.83  ? 65   VAL D N   1 
ATOM   7104  C  CA  . VAL D  1 65  ? 6.296   104.569 117.651 1.00 35.10  ? 65   VAL D CA  1 
ATOM   7105  C  C   . VAL D  1 65  ? 7.194   105.433 116.786 1.00 37.14  ? 65   VAL D C   1 
ATOM   7106  O  O   . VAL D  1 65  ? 6.743   106.162 115.904 1.00 35.69  ? 65   VAL D O   1 
ATOM   7107  C  CB  . VAL D  1 65  ? 6.022   105.290 118.970 1.00 33.75  ? 65   VAL D CB  1 
ATOM   7108  C  CG1 . VAL D  1 65  ? 5.659   106.735 118.719 1.00 27.08  ? 65   VAL D CG1 1 
ATOM   7109  C  CG2 . VAL D  1 65  ? 4.901   104.585 119.696 1.00 35.69  ? 65   VAL D CG2 1 
ATOM   7110  N  N   . SER D  1 66  ? 8.486   105.334 117.047 1.00 39.54  ? 66   SER D N   1 
ATOM   7111  C  CA  . SER D  1 66  ? 9.467   106.091 116.298 1.00 40.72  ? 66   SER D CA  1 
ATOM   7112  C  C   . SER D  1 66  ? 9.614   105.528 114.875 1.00 39.61  ? 66   SER D C   1 
ATOM   7113  O  O   . SER D  1 66  ? 9.543   106.278 113.906 1.00 40.01  ? 66   SER D O   1 
ATOM   7114  C  CB  . SER D  1 66  ? 10.803  106.060 117.047 1.00 41.91  ? 66   SER D CB  1 
ATOM   7115  O  OG  . SER D  1 66  ? 11.687  107.028 116.531 1.00 47.09  ? 66   SER D OG  1 
ATOM   7116  N  N   . SER D  1 67  ? 9.807   104.215 114.752 1.00 40.04  ? 67   SER D N   1 
ATOM   7117  C  CA  . SER D  1 67  ? 9.960   103.569 113.444 1.00 43.16  ? 67   SER D CA  1 
ATOM   7118  C  C   . SER D  1 67  ? 8.695   103.718 112.600 1.00 44.05  ? 67   SER D C   1 
ATOM   7119  O  O   . SER D  1 67  ? 8.760   104.028 111.402 1.00 42.50  ? 67   SER D O   1 
ATOM   7120  C  CB  . SER D  1 67  ? 10.270  102.078 113.610 1.00 42.97  ? 67   SER D CB  1 
ATOM   7121  O  OG  . SER D  1 67  ? 11.460  101.886 114.350 1.00 47.97  ? 67   SER D OG  1 
ATOM   7122  N  N   . GLY D  1 68  ? 7.548   103.478 113.234 1.00 42.70  ? 68   GLY D N   1 
ATOM   7123  C  CA  . GLY D  1 68  ? 6.279   103.605 112.540 1.00 42.16  ? 68   GLY D CA  1 
ATOM   7124  C  C   . GLY D  1 68  ? 6.107   104.999 111.962 1.00 40.20  ? 68   GLY D C   1 
ATOM   7125  O  O   . GLY D  1 68  ? 5.864   105.156 110.757 1.00 35.70  ? 68   GLY D O   1 
ATOM   7126  N  N   . GLY D  1 69  ? 6.232   106.009 112.824 1.00 37.89  ? 69   GLY D N   1 
ATOM   7127  C  CA  . GLY D  1 69  ? 6.107   107.380 112.372 1.00 41.28  ? 69   GLY D CA  1 
ATOM   7128  C  C   . GLY D  1 69  ? 7.045   107.674 111.206 1.00 44.10  ? 69   GLY D C   1 
ATOM   7129  O  O   . GLY D  1 69  ? 6.615   108.132 110.142 1.00 43.96  ? 69   GLY D O   1 
ATOM   7130  N  N   . GLU D  1 70  ? 8.329   107.397 111.402 1.00 43.22  ? 70   GLU D N   1 
ATOM   7131  C  CA  . GLU D  1 70  ? 9.322   107.639 110.368 1.00 43.85  ? 70   GLU D CA  1 
ATOM   7132  C  C   . GLU D  1 70  ? 8.867   107.021 109.051 1.00 41.08  ? 70   GLU D C   1 
ATOM   7133  O  O   . GLU D  1 70  ? 8.818   107.706 108.023 1.00 39.22  ? 70   GLU D O   1 
ATOM   7134  C  CB  . GLU D  1 70  ? 10.672  107.051 110.800 1.00 50.98  ? 70   GLU D CB  1 
ATOM   7135  C  CG  . GLU D  1 70  ? 11.890  107.570 110.029 1.00 58.05  ? 70   GLU D CG  1 
ATOM   7136  C  CD  . GLU D  1 70  ? 13.228  107.132 110.653 1.00 65.24  ? 70   GLU D CD  1 
ATOM   7137  O  OE1 . GLU D  1 70  ? 13.459  107.444 111.852 1.00 63.03  ? 70   GLU D OE1 1 
ATOM   7138  O  OE2 . GLU D  1 70  ? 14.044  106.483 109.941 1.00 65.50  ? 70   GLU D OE2 1 
ATOM   7139  N  N   . LEU D  1 71  ? 8.525   105.731 109.086 1.00 38.09  ? 71   LEU D N   1 
ATOM   7140  C  CA  . LEU D  1 71  ? 8.084   105.019 107.889 1.00 36.18  ? 71   LEU D CA  1 
ATOM   7141  C  C   . LEU D  1 71  ? 6.838   105.623 107.263 1.00 39.14  ? 71   LEU D C   1 
ATOM   7142  O  O   . LEU D  1 71  ? 6.690   105.640 106.037 1.00 38.71  ? 71   LEU D O   1 
ATOM   7143  C  CB  . LEU D  1 71  ? 7.825   103.562 108.206 1.00 33.74  ? 71   LEU D CB  1 
ATOM   7144  C  CG  . LEU D  1 71  ? 9.072   102.697 108.173 1.00 35.58  ? 71   LEU D CG  1 
ATOM   7145  C  CD1 . LEU D  1 71  ? 8.736   101.304 108.681 1.00 37.51  ? 71   LEU D CD1 1 
ATOM   7146  C  CD2 . LEU D  1 71  ? 9.613   102.657 106.758 1.00 26.10  ? 71   LEU D CD2 1 
ATOM   7147  N  N   . PHE D  1 72  ? 5.938   106.107 108.113 1.00 40.31  ? 72   PHE D N   1 
ATOM   7148  C  CA  . PHE D  1 72  ? 4.709   106.737 107.647 1.00 40.74  ? 72   PHE D CA  1 
ATOM   7149  C  C   . PHE D  1 72  ? 5.066   108.046 106.932 1.00 39.72  ? 72   PHE D C   1 
ATOM   7150  O  O   . PHE D  1 72  ? 4.646   108.266 105.801 1.00 37.63  ? 72   PHE D O   1 
ATOM   7151  C  CB  . PHE D  1 72  ? 3.787   107.012 108.838 1.00 42.30  ? 72   PHE D CB  1 
ATOM   7152  C  CG  . PHE D  1 72  ? 2.531   107.752 108.488 1.00 41.88  ? 72   PHE D CG  1 
ATOM   7153  C  CD1 . PHE D  1 72  ? 1.547   107.156 107.716 1.00 43.87  ? 72   PHE D CD1 1 
ATOM   7154  C  CD2 . PHE D  1 72  ? 2.310   109.037 108.979 1.00 39.72  ? 72   PHE D CD2 1 
ATOM   7155  C  CE1 . PHE D  1 72  ? 0.348   107.834 107.445 1.00 42.65  ? 72   PHE D CE1 1 
ATOM   7156  C  CE2 . PHE D  1 72  ? 1.127   109.710 108.714 1.00 37.36  ? 72   PHE D CE2 1 
ATOM   7157  C  CZ  . PHE D  1 72  ? 0.144   109.105 107.947 1.00 39.55  ? 72   PHE D CZ  1 
ATOM   7158  N  N   . LEU D  1 73  ? 5.844   108.910 107.580 1.00 38.17  ? 73   LEU D N   1 
ATOM   7159  C  CA  . LEU D  1 73  ? 6.214   110.156 106.934 1.00 38.99  ? 73   LEU D CA  1 
ATOM   7160  C  C   . LEU D  1 73  ? 6.909   109.855 105.619 1.00 39.71  ? 73   LEU D C   1 
ATOM   7161  O  O   . LEU D  1 73  ? 6.719   110.553 104.627 1.00 37.62  ? 73   LEU D O   1 
ATOM   7162  C  CB  . LEU D  1 73  ? 7.148   110.990 107.806 1.00 39.06  ? 73   LEU D CB  1 
ATOM   7163  C  CG  . LEU D  1 73  ? 6.668   111.500 109.164 1.00 44.70  ? 73   LEU D CG  1 
ATOM   7164  C  CD1 . LEU D  1 73  ? 7.502   112.723 109.533 1.00 46.65  ? 73   LEU D CD1 1 
ATOM   7165  C  CD2 . LEU D  1 73  ? 5.196   111.883 109.125 1.00 43.26  ? 73   LEU D CD2 1 
ATOM   7166  N  N   . ARG D  1 74  ? 7.703   108.796 105.603 1.00 40.56  ? 74   ARG D N   1 
ATOM   7167  C  CA  . ARG D  1 74  ? 8.429   108.452 104.394 1.00 42.89  ? 74   ARG D CA  1 
ATOM   7168  C  C   . ARG D  1 74  ? 7.492   108.059 103.248 1.00 42.17  ? 74   ARG D C   1 
ATOM   7169  O  O   . ARG D  1 74  ? 7.577   108.599 102.147 1.00 42.82  ? 74   ARG D O   1 
ATOM   7170  C  CB  . ARG D  1 74  ? 9.421   107.325 104.698 1.00 45.85  ? 74   ARG D CB  1 
ATOM   7171  C  CG  . ARG D  1 74  ? 10.812  107.553 104.121 1.00 47.61  ? 74   ARG D CG  1 
ATOM   7172  C  CD  . ARG D  1 74  ? 11.741  106.379 104.413 1.00 50.88  ? 74   ARG D CD  1 
ATOM   7173  N  NE  . ARG D  1 74  ? 12.914  106.391 103.541 1.00 50.46  ? 74   ARG D NE  1 
ATOM   7174  C  CZ  . ARG D  1 74  ? 13.949  107.216 103.679 1.00 52.12  ? 74   ARG D CZ  1 
ATOM   7175  N  NH1 . ARG D  1 74  ? 13.978  108.108 104.667 1.00 53.42  ? 74   ARG D NH1 1 
ATOM   7176  N  NH2 . ARG D  1 74  ? 14.953  107.161 102.814 1.00 52.23  ? 74   ARG D NH2 1 
ATOM   7177  N  N   . PHE D  1 75  ? 6.588   107.129 103.525 1.00 43.09  ? 75   PHE D N   1 
ATOM   7178  C  CA  . PHE D  1 75  ? 5.631   106.635 102.543 1.00 44.25  ? 75   PHE D CA  1 
ATOM   7179  C  C   . PHE D  1 75  ? 4.641   107.709 102.072 1.00 45.44  ? 75   PHE D C   1 
ATOM   7180  O  O   . PHE D  1 75  ? 4.236   107.754 100.912 1.00 38.49  ? 75   PHE D O   1 
ATOM   7181  C  CB  . PHE D  1 75  ? 4.856   105.481 103.166 1.00 46.06  ? 75   PHE D CB  1 
ATOM   7182  C  CG  . PHE D  1 75  ? 4.000   104.738 102.196 1.00 49.77  ? 75   PHE D CG  1 
ATOM   7183  C  CD1 . PHE D  1 75  ? 4.573   103.881 101.263 1.00 51.06  ? 75   PHE D CD1 1 
ATOM   7184  C  CD2 . PHE D  1 75  ? 2.618   104.898 102.208 1.00 49.67  ? 75   PHE D CD2 1 
ATOM   7185  C  CE1 . PHE D  1 75  ? 3.785   103.195 100.360 1.00 52.24  ? 75   PHE D CE1 1 
ATOM   7186  C  CE2 . PHE D  1 75  ? 1.818   104.219 101.311 1.00 49.30  ? 75   PHE D CE2 1 
ATOM   7187  C  CZ  . PHE D  1 75  ? 2.400   103.364 100.384 1.00 52.68  ? 75   PHE D CZ  1 
ATOM   7188  N  N   . ILE D  1 76  ? 4.260   108.572 102.999 1.00 49.87  ? 76   ILE D N   1 
ATOM   7189  C  CA  . ILE D  1 76  ? 3.312   109.635 102.737 1.00 53.48  ? 76   ILE D CA  1 
ATOM   7190  C  C   . ILE D  1 76  ? 3.958   110.801 101.981 1.00 57.57  ? 76   ILE D C   1 
ATOM   7191  O  O   . ILE D  1 76  ? 3.308   111.445 101.156 1.00 59.64  ? 76   ILE D O   1 
ATOM   7192  C  CB  . ILE D  1 76  ? 2.707   110.128 104.085 1.00 54.35  ? 76   ILE D CB  1 
ATOM   7193  C  CG1 . ILE D  1 76  ? 1.250   110.521 103.905 1.00 58.77  ? 76   ILE D CG1 1 
ATOM   7194  C  CG2 . ILE D  1 76  ? 3.484   111.318 104.629 1.00 53.82  ? 76   ILE D CG2 1 
ATOM   7195  C  CD1 . ILE D  1 76  ? 0.607   111.033 105.190 1.00 59.09  ? 76   ILE D CD1 1 
ATOM   7196  N  N   . SER D  1 77  ? 5.240   111.059 102.242 1.00 60.34  ? 77   SER D N   1 
ATOM   7197  C  CA  . SER D  1 77  ? 5.948   112.178 101.606 1.00 61.02  ? 77   SER D CA  1 
ATOM   7198  C  C   . SER D  1 77  ? 6.195   112.040 100.110 1.00 61.88  ? 77   SER D C   1 
ATOM   7199  O  O   . SER D  1 77  ? 6.117   110.946 99.552  1.00 63.28  ? 77   SER D O   1 
ATOM   7200  C  CB  . SER D  1 77  ? 7.284   112.434 102.314 1.00 60.54  ? 77   SER D CB  1 
ATOM   7201  O  OG  . SER D  1 77  ? 7.095   112.976 103.615 1.00 58.25  ? 77   SER D OG  1 
ATOM   7202  N  N   . LEU D  1 78  ? 6.498   113.170 99.473  1.00 63.13  ? 78   LEU D N   1 
ATOM   7203  C  CA  . LEU D  1 78  ? 6.765   113.224 98.032  1.00 63.86  ? 78   LEU D CA  1 
ATOM   7204  C  C   . LEU D  1 78  ? 7.620   114.447 97.655  1.00 61.42  ? 78   LEU D C   1 
ATOM   7205  O  O   . LEU D  1 78  ? 8.777   114.326 97.228  1.00 57.95  ? 78   LEU D O   1 
ATOM   7206  C  CB  . LEU D  1 78  ? 5.434   113.249 97.259  1.00 64.73  ? 78   LEU D CB  1 
ATOM   7207  C  CG  . LEU D  1 78  ? 4.442   114.386 97.563  1.00 65.10  ? 78   LEU D CG  1 
ATOM   7208  C  CD1 . LEU D  1 78  ? 4.872   115.653 96.840  1.00 63.84  ? 78   LEU D CD1 1 
ATOM   7209  C  CD2 . LEU D  1 78  ? 3.033   113.988 97.119  1.00 63.72  ? 78   LEU D CD2 1 
ATOM   7210  N  N   . TYR D  1 86  ? -2.509  125.941 94.908  1.00 112.28 ? 86   TYR D N   1 
ATOM   7211  C  CA  . TYR D  1 86  ? -3.168  124.870 94.166  1.00 112.75 ? 86   TYR D CA  1 
ATOM   7212  C  C   . TYR D  1 86  ? -2.575  123.497 94.484  1.00 110.32 ? 86   TYR D C   1 
ATOM   7213  O  O   . TYR D  1 86  ? -3.296  122.586 94.904  1.00 110.41 ? 86   TYR D O   1 
ATOM   7214  C  CB  . TYR D  1 86  ? -3.103  125.150 92.655  1.00 115.59 ? 86   TYR D CB  1 
ATOM   7215  C  CG  . TYR D  1 86  ? -1.934  126.016 92.220  1.00 119.23 ? 86   TYR D CG  1 
ATOM   7216  C  CD1 . TYR D  1 86  ? -0.613  125.574 92.360  1.00 120.01 ? 86   TYR D CD1 1 
ATOM   7217  C  CD2 . TYR D  1 86  ? -2.149  127.284 91.670  1.00 120.01 ? 86   TYR D CD2 1 
ATOM   7218  C  CE1 . TYR D  1 86  ? 0.465   126.374 91.964  1.00 120.24 ? 86   TYR D CE1 1 
ATOM   7219  C  CE2 . TYR D  1 86  ? -1.079  128.091 91.272  1.00 120.77 ? 86   TYR D CE2 1 
ATOM   7220  C  CZ  . TYR D  1 86  ? 0.223   127.630 91.422  1.00 121.02 ? 86   TYR D CZ  1 
ATOM   7221  O  OH  . TYR D  1 86  ? 1.280   128.424 91.035  1.00 121.14 ? 86   TYR D OH  1 
ATOM   7222  N  N   . SER D  1 87  ? -1.266  123.351 94.282  1.00 107.07 ? 87   SER D N   1 
ATOM   7223  C  CA  . SER D  1 87  ? -0.586  122.090 94.565  1.00 101.75 ? 87   SER D CA  1 
ATOM   7224  C  C   . SER D  1 87  ? -0.932  121.691 95.991  1.00 98.40  ? 87   SER D C   1 
ATOM   7225  O  O   . SER D  1 87  ? -1.235  120.531 96.270  1.00 99.17  ? 87   SER D O   1 
ATOM   7226  C  CB  . SER D  1 87  ? 0.939   122.247 94.441  1.00 101.48 ? 87   SER D CB  1 
ATOM   7227  O  OG  . SER D  1 87  ? 1.341   122.524 93.109  1.00 99.60  ? 87   SER D OG  1 
ATOM   7228  N  N   . LYS D  1 88  ? -0.901  122.673 96.883  1.00 93.47  ? 88   LYS D N   1 
ATOM   7229  C  CA  . LYS D  1 88  ? -1.193  122.452 98.290  1.00 89.93  ? 88   LYS D CA  1 
ATOM   7230  C  C   . LYS D  1 88  ? -2.376  121.512 98.504  1.00 89.28  ? 88   LYS D C   1 
ATOM   7231  O  O   . LYS D  1 88  ? -2.204  120.298 98.615  1.00 89.22  ? 88   LYS D O   1 
ATOM   7232  C  CB  . LYS D  1 88  ? -1.463  123.790 98.974  1.00 87.92  ? 88   LYS D CB  1 
ATOM   7233  C  CG  . LYS D  1 88  ? -1.285  123.770 100.479 1.00 85.80  ? 88   LYS D CG  1 
ATOM   7234  C  CD  . LYS D  1 88  ? -2.269  122.843 101.160 1.00 83.73  ? 88   LYS D CD  1 
ATOM   7235  C  CE  . LYS D  1 88  ? -2.055  122.847 102.653 1.00 82.66  ? 88   LYS D CE  1 
ATOM   7236  N  NZ  . LYS D  1 88  ? -0.658  122.470 102.985 1.00 80.52  ? 88   LYS D NZ  1 
ATOM   7237  N  N   . CYS D  1 89  ? -3.574  122.083 98.559  1.00 88.41  ? 89   CYS D N   1 
ATOM   7238  C  CA  . CYS D  1 89  ? -4.800  121.323 98.778  1.00 87.28  ? 89   CYS D CA  1 
ATOM   7239  C  C   . CYS D  1 89  ? -4.862  119.962 98.111  1.00 86.58  ? 89   CYS D C   1 
ATOM   7240  O  O   . CYS D  1 89  ? -5.321  118.990 98.712  1.00 86.01  ? 89   CYS D O   1 
ATOM   7241  C  CB  . CYS D  1 89  ? -6.005  122.149 98.346  1.00 87.40  ? 89   CYS D CB  1 
ATOM   7242  S  SG  . CYS D  1 89  ? -6.360  123.494 99.486  1.00 91.05  ? 89   CYS D SG  1 
ATOM   7243  N  N   . LYS D  1 90  ? -4.403  119.888 96.871  1.00 85.37  ? 90   LYS D N   1 
ATOM   7244  C  CA  . LYS D  1 90  ? -4.422  118.634 96.136  1.00 84.45  ? 90   LYS D CA  1 
ATOM   7245  C  C   . LYS D  1 90  ? -3.549  117.550 96.788  1.00 82.77  ? 90   LYS D C   1 
ATOM   7246  O  O   . LYS D  1 90  ? -3.173  116.578 96.131  1.00 84.15  ? 90   LYS D O   1 
ATOM   7247  C  CB  . LYS D  1 90  ? -3.971  118.893 94.694  1.00 86.52  ? 90   LYS D CB  1 
ATOM   7248  C  CG  . LYS D  1 90  ? -4.697  120.079 94.046  1.00 90.24  ? 90   LYS D CG  1 
ATOM   7249  C  CD  . LYS D  1 90  ? -4.206  120.395 92.629  1.00 91.33  ? 90   LYS D CD  1 
ATOM   7250  C  CE  . LYS D  1 90  ? -4.612  119.321 91.621  1.00 91.37  ? 90   LYS D CE  1 
ATOM   7251  N  NZ  . LYS D  1 90  ? -4.232  119.690 90.222  1.00 90.17  ? 90   LYS D NZ  1 
ATOM   7252  N  N   . LYS D  1 91  ? -3.242  117.704 98.079  1.00 79.90  ? 91   LYS D N   1 
ATOM   7253  C  CA  . LYS D  1 91  ? -2.411  116.735 98.800  1.00 74.97  ? 91   LYS D CA  1 
ATOM   7254  C  C   . LYS D  1 91  ? -3.022  115.331 98.862  1.00 76.59  ? 91   LYS D C   1 
ATOM   7255  O  O   . LYS D  1 91  ? -3.965  115.042 99.621  1.00 73.11  ? 91   LYS D O   1 
ATOM   7256  C  CB  . LYS D  1 91  ? -2.114  117.221 100.218 1.00 68.29  ? 91   LYS D CB  1 
ATOM   7257  C  CG  . LYS D  1 91  ? -3.273  117.097 101.174 1.00 62.65  ? 91   LYS D CG  1 
ATOM   7258  C  CD  . LYS D  1 91  ? -2.957  117.760 102.489 1.00 58.05  ? 91   LYS D CD  1 
ATOM   7259  C  CE  . LYS D  1 91  ? -4.126  117.636 103.441 1.00 57.72  ? 91   LYS D CE  1 
ATOM   7260  N  NZ  . LYS D  1 91  ? -3.912  118.379 104.716 1.00 55.63  ? 91   LYS D NZ  1 
ATOM   7261  N  N   . ILE D  1 92  ? -2.451  114.470 98.028  1.00 77.53  ? 92   ILE D N   1 
ATOM   7262  C  CA  . ILE D  1 92  ? -2.835  113.072 97.906  1.00 75.76  ? 92   ILE D CA  1 
ATOM   7263  C  C   . ILE D  1 92  ? -2.126  112.292 99.016  1.00 74.31  ? 92   ILE D C   1 
ATOM   7264  O  O   . ILE D  1 92  ? -2.023  111.065 98.976  1.00 71.92  ? 92   ILE D O   1 
ATOM   7265  C  CB  . ILE D  1 92  ? -2.397  112.531 96.519  1.00 76.70  ? 92   ILE D CB  1 
ATOM   7266  C  CG1 . ILE D  1 92  ? -0.955  112.955 96.212  1.00 77.06  ? 92   ILE D CG1 1 
ATOM   7267  C  CG2 . ILE D  1 92  ? -3.278  113.116 95.424  1.00 76.15  ? 92   ILE D CG2 1 
ATOM   7268  C  CD1 . ILE D  1 92  ? 0.094   112.412 97.165  1.00 79.47  ? 92   ILE D CD1 1 
HETATM 7269  N  N   . MSE D  1 93  ? -1.624  113.031 99.999  1.00 73.57  ? 93   MSE D N   1 
HETATM 7270  C  CA  . MSE D  1 93  ? -0.913  112.445 101.121 1.00 73.38  ? 93   MSE D CA  1 
HETATM 7271  C  C   . MSE D  1 93  ? -1.849  111.623 101.985 1.00 71.25  ? 93   MSE D C   1 
HETATM 7272  O  O   . MSE D  1 93  ? -1.537  110.491 102.354 1.00 68.95  ? 93   MSE D O   1 
HETATM 7273  C  CB  . MSE D  1 93  ? -0.280  113.544 101.967 1.00 77.10  ? 93   MSE D CB  1 
HETATM 7274  C  CG  . MSE D  1 93  ? 0.568   114.513 101.171 1.00 82.77  ? 93   MSE D CG  1 
HETATM 7275  SE SE  . MSE D  1 93  ? 1.618   115.684 102.298 1.00 89.78  ? 93   MSE D SE  1 
HETATM 7276  C  CE  . MSE D  1 93  ? 3.365   115.378 101.491 1.00 86.35  ? 93   MSE D CE  1 
ATOM   7277  N  N   . ILE D  1 94  ? -2.999  112.202 102.307 1.00 69.80  ? 94   ILE D N   1 
ATOM   7278  C  CA  . ILE D  1 94  ? -3.986  111.525 103.131 1.00 68.78  ? 94   ILE D CA  1 
ATOM   7279  C  C   . ILE D  1 94  ? -4.409  110.185 102.520 1.00 68.77  ? 94   ILE D C   1 
ATOM   7280  O  O   . ILE D  1 94  ? -4.615  109.202 103.233 1.00 69.04  ? 94   ILE D O   1 
ATOM   7281  C  CB  . ILE D  1 94  ? -5.215  112.424 103.340 1.00 68.50  ? 94   ILE D CB  1 
ATOM   7282  C  CG1 . ILE D  1 94  ? -4.768  113.736 103.984 1.00 70.14  ? 94   ILE D CG1 1 
ATOM   7283  C  CG2 . ILE D  1 94  ? -6.230  111.734 104.224 1.00 67.03  ? 94   ILE D CG2 1 
ATOM   7284  C  CD1 . ILE D  1 94  ? -5.899  114.659 104.364 1.00 70.12  ? 94   ILE D CD1 1 
ATOM   7285  N  N   . GLU D  1 95  ? -4.528  110.137 101.200 1.00 68.60  ? 95   GLU D N   1 
ATOM   7286  C  CA  . GLU D  1 95  ? -4.909  108.895 100.543 1.00 68.99  ? 95   GLU D CA  1 
ATOM   7287  C  C   . GLU D  1 95  ? -3.824  107.838 100.780 1.00 65.12  ? 95   GLU D C   1 
ATOM   7288  O  O   . GLU D  1 95  ? -4.121  106.730 101.232 1.00 64.05  ? 95   GLU D O   1 
ATOM   7289  C  CB  . GLU D  1 95  ? -5.124  109.146 99.050  1.00 75.11  ? 95   GLU D CB  1 
ATOM   7290  C  CG  . GLU D  1 95  ? -5.573  107.925 98.254  1.00 84.74  ? 95   GLU D CG  1 
ATOM   7291  C  CD  . GLU D  1 95  ? -6.071  108.300 96.862  1.00 90.34  ? 95   GLU D CD  1 
ATOM   7292  O  OE1 . GLU D  1 95  ? -5.652  109.369 96.356  1.00 92.41  ? 95   GLU D OE1 1 
ATOM   7293  O  OE2 . GLU D  1 95  ? -6.869  107.527 96.276  1.00 91.74  ? 95   GLU D OE2 1 
ATOM   7294  N  N   . ARG D  1 96  ? -2.572  108.182 100.480 1.00 60.59  ? 96   ARG D N   1 
ATOM   7295  C  CA  . ARG D  1 96  ? -1.456  107.265 100.705 1.00 55.97  ? 96   ARG D CA  1 
ATOM   7296  C  C   . ARG D  1 96  ? -1.465  106.877 102.180 1.00 53.08  ? 96   ARG D C   1 
ATOM   7297  O  O   . ARG D  1 96  ? -1.287  105.709 102.530 1.00 51.22  ? 96   ARG D O   1 
ATOM   7298  C  CB  . ARG D  1 96  ? -0.117  107.939 100.425 1.00 56.30  ? 96   ARG D CB  1 
ATOM   7299  C  CG  . ARG D  1 96  ? 0.170   108.329 98.998  1.00 61.78  ? 96   ARG D CG  1 
ATOM   7300  C  CD  . ARG D  1 96  ? 1.491   109.081 98.992  1.00 68.17  ? 96   ARG D CD  1 
ATOM   7301  N  NE  . ARG D  1 96  ? 1.942   109.513 97.672  1.00 74.39  ? 96   ARG D NE  1 
ATOM   7302  C  CZ  . ARG D  1 96  ? 3.055   110.218 97.464  1.00 76.89  ? 96   ARG D CZ  1 
ATOM   7303  N  NH1 . ARG D  1 96  ? 3.824   110.567 98.489  1.00 77.76  ? 96   ARG D NH1 1 
ATOM   7304  N  NH2 . ARG D  1 96  ? 3.401   110.577 96.234  1.00 77.95  ? 96   ARG D NH2 1 
ATOM   7305  N  N   . GLY D  1 97  ? -1.654  107.884 103.032 1.00 46.78  ? 97   GLY D N   1 
ATOM   7306  C  CA  . GLY D  1 97  ? -1.680  107.665 104.460 1.00 43.85  ? 97   GLY D CA  1 
ATOM   7307  C  C   . GLY D  1 97  ? -2.589  106.526 104.874 1.00 44.74  ? 97   GLY D C   1 
ATOM   7308  O  O   . GLY D  1 97  ? -2.185  105.631 105.613 1.00 43.59  ? 97   GLY D O   1 
ATOM   7309  N  N   . GLU D  1 98  ? -3.824  106.550 104.393 1.00 46.65  ? 98   GLU D N   1 
ATOM   7310  C  CA  . GLU D  1 98  ? -4.778  105.512 104.737 1.00 46.63  ? 98   GLU D CA  1 
ATOM   7311  C  C   . GLU D  1 98  ? -4.385  104.156 104.155 1.00 44.35  ? 98   GLU D C   1 
ATOM   7312  O  O   . GLU D  1 98  ? -4.621  103.124 104.790 1.00 41.43  ? 98   GLU D O   1 
ATOM   7313  C  CB  . GLU D  1 98  ? -6.189  105.944 104.308 1.00 50.08  ? 98   GLU D CB  1 
ATOM   7314  C  CG  . GLU D  1 98  ? -6.732  107.070 105.202 1.00 55.16  ? 98   GLU D CG  1 
ATOM   7315  C  CD  . GLU D  1 98  ? -7.861  107.870 104.570 1.00 59.69  ? 98   GLU D CD  1 
ATOM   7316  O  OE1 . GLU D  1 98  ? -7.890  107.965 103.323 1.00 62.32  ? 98   GLU D OE1 1 
ATOM   7317  O  OE2 . GLU D  1 98  ? -8.703  108.424 105.319 1.00 58.53  ? 98   GLU D OE2 1 
ATOM   7318  N  N   . LEU D  1 99  ? -3.773  104.159 102.969 1.00 43.03  ? 99   LEU D N   1 
ATOM   7319  C  CA  . LEU D  1 99  ? -3.318  102.915 102.334 1.00 43.03  ? 99   LEU D CA  1 
ATOM   7320  C  C   . LEU D  1 99  ? -2.240  102.259 103.199 1.00 43.37  ? 99   LEU D C   1 
ATOM   7321  O  O   . LEU D  1 99  ? -2.274  101.058 103.456 1.00 44.77  ? 99   LEU D O   1 
ATOM   7322  C  CB  . LEU D  1 99  ? -2.736  103.193 100.946 1.00 43.64  ? 99   LEU D CB  1 
ATOM   7323  C  CG  . LEU D  1 99  ? -1.933  102.044 100.305 1.00 46.42  ? 99   LEU D CG  1 
ATOM   7324  C  CD1 . LEU D  1 99  ? -2.792  100.795 100.170 1.00 44.66  ? 99   LEU D CD1 1 
ATOM   7325  C  CD2 . LEU D  1 99  ? -1.428  102.471 98.944  1.00 44.65  ? 99   LEU D CD2 1 
ATOM   7326  N  N   . PHE D  1 100 ? -1.275  103.062 103.630 1.00 42.58  ? 100  PHE D N   1 
ATOM   7327  C  CA  . PHE D  1 100 ? -0.192  102.590 104.478 1.00 40.74  ? 100  PHE D CA  1 
ATOM   7328  C  C   . PHE D  1 100 ? -0.834  101.999 105.731 1.00 41.26  ? 100  PHE D C   1 
ATOM   7329  O  O   . PHE D  1 100 ? -0.514  100.890 106.169 1.00 38.50  ? 100  PHE D O   1 
ATOM   7330  C  CB  . PHE D  1 100 ? 0.722   103.777 104.831 1.00 40.16  ? 100  PHE D CB  1 
ATOM   7331  C  CG  . PHE D  1 100 ? 1.766   103.473 105.881 1.00 42.36  ? 100  PHE D CG  1 
ATOM   7332  C  CD1 . PHE D  1 100 ? 1.436   103.463 107.239 1.00 42.46  ? 100  PHE D CD1 1 
ATOM   7333  C  CD2 . PHE D  1 100 ? 3.093   103.214 105.515 1.00 41.84  ? 100  PHE D CD2 1 
ATOM   7334  C  CE1 . PHE D  1 100 ? 2.412   103.203 108.211 1.00 42.89  ? 100  PHE D CE1 1 
ATOM   7335  C  CE2 . PHE D  1 100 ? 4.077   102.954 106.481 1.00 39.18  ? 100  PHE D CE2 1 
ATOM   7336  C  CZ  . PHE D  1 100 ? 3.738   102.949 107.827 1.00 42.45  ? 100  PHE D CZ  1 
ATOM   7337  N  N   . LEU D  1 101 ? -1.760  102.756 106.296 1.00 42.35  ? 101  LEU D N   1 
ATOM   7338  C  CA  . LEU D  1 101 ? -2.447  102.329 107.493 1.00 43.89  ? 101  LEU D CA  1 
ATOM   7339  C  C   . LEU D  1 101 ? -3.152  100.994 107.276 1.00 43.06  ? 101  LEU D C   1 
ATOM   7340  O  O   . LEU D  1 101 ? -3.201  100.166 108.177 1.00 42.59  ? 101  LEU D O   1 
ATOM   7341  C  CB  . LEU D  1 101 ? -3.459  103.399 107.921 1.00 45.85  ? 101  LEU D CB  1 
ATOM   7342  C  CG  . LEU D  1 101 ? -3.378  103.864 109.381 1.00 47.55  ? 101  LEU D CG  1 
ATOM   7343  C  CD1 . LEU D  1 101 ? -4.492  104.853 109.668 1.00 46.49  ? 101  LEU D CD1 1 
ATOM   7344  C  CD2 . LEU D  1 101 ? -3.475  102.666 110.313 1.00 44.31  ? 101  LEU D CD2 1 
ATOM   7345  N  N   . ARG D  1 102 ? -3.678  100.775 106.075 1.00 44.18  ? 102  ARG D N   1 
ATOM   7346  C  CA  . ARG D  1 102 ? -4.394  99.536  105.782 1.00 45.19  ? 102  ARG D CA  1 
ATOM   7347  C  C   . ARG D  1 102 ? -3.499  98.319  105.651 1.00 46.99  ? 102  ARG D C   1 
ATOM   7348  O  O   . ARG D  1 102 ? -3.915  97.205  105.970 1.00 50.83  ? 102  ARG D O   1 
ATOM   7349  C  CB  . ARG D  1 102 ? -5.232  99.684  104.514 1.00 46.34  ? 102  ARG D CB  1 
ATOM   7350  C  CG  . ARG D  1 102 ? -6.723  99.564  104.764 1.00 49.61  ? 102  ARG D CG  1 
ATOM   7351  C  CD  . ARG D  1 102 ? -7.524  99.815  103.495 1.00 52.77  ? 102  ARG D CD  1 
ATOM   7352  N  NE  . ARG D  1 102 ? -7.522  101.226 103.113 1.00 54.73  ? 102  ARG D NE  1 
ATOM   7353  C  CZ  . ARG D  1 102 ? -7.347  101.656 101.867 1.00 55.19  ? 102  ARG D CZ  1 
ATOM   7354  N  NH1 . ARG D  1 102 ? -7.158  100.779 100.891 1.00 54.81  ? 102  ARG D NH1 1 
ATOM   7355  N  NH2 . ARG D  1 102 ? -7.362  102.955 101.594 1.00 52.32  ? 102  ARG D NH2 1 
ATOM   7356  N  N   . ARG D  1 103 ? -2.273  98.512  105.189 1.00 46.28  ? 103  ARG D N   1 
ATOM   7357  C  CA  . ARG D  1 103 ? -1.376  97.379  105.057 1.00 46.46  ? 103  ARG D CA  1 
ATOM   7358  C  C   . ARG D  1 103 ? -0.746  96.962  106.387 1.00 44.72  ? 103  ARG D C   1 
ATOM   7359  O  O   . ARG D  1 103 ? -0.717  95.778  106.708 1.00 45.98  ? 103  ARG D O   1 
ATOM   7360  C  CB  . ARG D  1 103 ? -0.286  97.685  104.039 1.00 49.26  ? 103  ARG D CB  1 
ATOM   7361  C  CG  . ARG D  1 103 ? -0.797  97.967  102.642 1.00 53.85  ? 103  ARG D CG  1 
ATOM   7362  C  CD  . ARG D  1 103 ? 0.384   98.298  101.751 1.00 61.61  ? 103  ARG D CD  1 
ATOM   7363  N  NE  . ARG D  1 103 ? 0.022   98.762  100.411 1.00 64.74  ? 103  ARG D NE  1 
ATOM   7364  C  CZ  . ARG D  1 103 ? 0.912   99.232  99.539  1.00 64.79  ? 103  ARG D CZ  1 
ATOM   7365  N  NH1 . ARG D  1 103 ? 2.191   99.292  99.879  1.00 64.42  ? 103  ARG D NH1 1 
ATOM   7366  N  NH2 . ARG D  1 103 ? 0.533   99.637  98.334  1.00 66.32  ? 103  ARG D NH2 1 
ATOM   7367  N  N   . ILE D  1 104 ? -0.258  97.913  107.176 1.00 43.60  ? 104  ILE D N   1 
ATOM   7368  C  CA  . ILE D  1 104 ? 0.376   97.543  108.445 1.00 46.42  ? 104  ILE D CA  1 
ATOM   7369  C  C   . ILE D  1 104 ? -0.561  96.817  109.410 1.00 47.97  ? 104  ILE D C   1 
ATOM   7370  O  O   . ILE D  1 104 ? -0.106  96.128  110.330 1.00 47.58  ? 104  ILE D O   1 
ATOM   7371  C  CB  . ILE D  1 104 ? 0.976   98.768  109.200 1.00 44.41  ? 104  ILE D CB  1 
ATOM   7372  C  CG1 . ILE D  1 104 ? -0.133  99.595  109.852 1.00 43.49  ? 104  ILE D CG1 1 
ATOM   7373  C  CG2 . ILE D  1 104 ? 1.784   99.623  108.248 1.00 44.66  ? 104  ILE D CG2 1 
ATOM   7374  C  CD1 . ILE D  1 104 ? 0.400   100.755 110.703 1.00 44.73  ? 104  ILE D CD1 1 
ATOM   7375  N  N   . SER D  1 105 ? -1.865  96.972  109.197 1.00 49.52  ? 105  SER D N   1 
ATOM   7376  C  CA  . SER D  1 105 ? -2.869  96.342  110.053 1.00 48.74  ? 105  SER D CA  1 
ATOM   7377  C  C   . SER D  1 105 ? -3.113  94.905  109.598 1.00 47.35  ? 105  SER D C   1 
ATOM   7378  O  O   . SER D  1 105 ? -3.891  94.162  110.193 1.00 49.07  ? 105  SER D O   1 
ATOM   7379  C  CB  . SER D  1 105 ? -4.171  97.133  109.996 1.00 46.66  ? 105  SER D CB  1 
ATOM   7380  O  OG  . SER D  1 105 ? -4.715  97.020  108.697 1.00 52.38  ? 105  SER D OG  1 
ATOM   7381  N  N   . LEU D  1 106 ? -2.436  94.518  108.534 1.00 46.29  ? 106  LEU D N   1 
ATOM   7382  C  CA  . LEU D  1 106 ? -2.558  93.172  108.009 1.00 46.81  ? 106  LEU D CA  1 
ATOM   7383  C  C   . LEU D  1 106 ? -1.417  92.337  108.616 1.00 46.36  ? 106  LEU D C   1 
ATOM   7384  O  O   . LEU D  1 106 ? -1.584  91.173  108.982 1.00 43.27  ? 106  LEU D O   1 
ATOM   7385  C  CB  . LEU D  1 106 ? -2.440  93.230  106.479 1.00 44.85  ? 106  LEU D CB  1 
ATOM   7386  C  CG  . LEU D  1 106 ? -3.625  92.765  105.628 1.00 47.27  ? 106  LEU D CG  1 
ATOM   7387  C  CD1 . LEU D  1 106 ? -4.941  92.952  106.369 1.00 43.08  ? 106  LEU D CD1 1 
ATOM   7388  C  CD2 . LEU D  1 106 ? -3.614  93.537  104.314 1.00 45.77  ? 106  LEU D CD2 1 
ATOM   7389  N  N   . SER D  1 107 ? -0.260  92.982  108.727 1.00 46.29  ? 107  SER D N   1 
ATOM   7390  C  CA  . SER D  1 107 ? 0.956   92.383  109.249 1.00 44.00  ? 107  SER D CA  1 
ATOM   7391  C  C   . SER D  1 107 ? 0.794   91.395  110.383 1.00 42.35  ? 107  SER D C   1 
ATOM   7392  O  O   . SER D  1 107 ? 1.163   90.234  110.251 1.00 42.72  ? 107  SER D O   1 
ATOM   7393  C  CB  . SER D  1 107 ? 1.911   93.483  109.686 1.00 41.37  ? 107  SER D CB  1 
ATOM   7394  O  OG  . SER D  1 107 ? 2.213   94.312  108.588 1.00 39.24  ? 107  SER D OG  1 
ATOM   7395  N  N   . ARG D  1 108 ? 0.240   91.842  111.498 1.00 40.88  ? 108  ARG D N   1 
ATOM   7396  C  CA  . ARG D  1 108 ? 0.106   90.946  112.630 1.00 41.40  ? 108  ARG D CA  1 
ATOM   7397  C  C   . ARG D  1 108 ? -0.454  89.567  112.264 1.00 40.80  ? 108  ARG D C   1 
ATOM   7398  O  O   . ARG D  1 108 ? 0.051   88.550  112.740 1.00 38.94  ? 108  ARG D O   1 
ATOM   7399  C  CB  . ARG D  1 108 ? -0.733  91.591  113.727 1.00 42.42  ? 108  ARG D CB  1 
ATOM   7400  C  CG  . ARG D  1 108 ? -0.608  90.874  115.057 1.00 47.71  ? 108  ARG D CG  1 
ATOM   7401  C  CD  . ARG D  1 108 ? -1.669  91.339  116.031 1.00 51.51  ? 108  ARG D CD  1 
ATOM   7402  N  NE  . ARG D  1 108 ? -1.337  92.610  116.660 1.00 52.56  ? 108  ARG D NE  1 
ATOM   7403  C  CZ  . ARG D  1 108 ? -2.238  93.522  117.007 1.00 53.85  ? 108  ARG D CZ  1 
ATOM   7404  N  NH1 . ARG D  1 108 ? -3.529  93.307  116.778 1.00 51.95  ? 108  ARG D NH1 1 
ATOM   7405  N  NH2 . ARG D  1 108 ? -1.848  94.646  117.595 1.00 57.12  ? 108  ARG D NH2 1 
ATOM   7406  N  N   . ASN D  1 109 ? -1.474  89.512  111.415 1.00 39.93  ? 109  ASN D N   1 
ATOM   7407  C  CA  . ASN D  1 109 ? -2.026  88.213  111.036 1.00 41.85  ? 109  ASN D CA  1 
ATOM   7408  C  C   . ASN D  1 109 ? -1.117  87.388  110.150 1.00 40.10  ? 109  ASN D C   1 
ATOM   7409  O  O   . ASN D  1 109 ? -1.094  86.161  110.270 1.00 39.37  ? 109  ASN D O   1 
ATOM   7410  C  CB  . ASN D  1 109 ? -3.388  88.357  110.364 1.00 43.61  ? 109  ASN D CB  1 
ATOM   7411  C  CG  . ASN D  1 109 ? -4.515  88.394  111.367 1.00 48.56  ? 109  ASN D CG  1 
ATOM   7412  O  OD1 . ASN D  1 109 ? -5.373  89.282  111.322 1.00 49.71  ? 109  ASN D OD1 1 
ATOM   7413  N  ND2 . ASN D  1 109 ? -4.521  87.426  112.289 1.00 46.33  ? 109  ASN D ND2 1 
ATOM   7414  N  N   . LYS D  1 110 ? -0.381  88.045  109.255 1.00 37.49  ? 110  LYS D N   1 
ATOM   7415  C  CA  . LYS D  1 110 ? 0.546   87.322  108.391 1.00 37.68  ? 110  LYS D CA  1 
ATOM   7416  C  C   . LYS D  1 110 ? 1.561   86.576  109.273 1.00 35.48  ? 110  LYS D C   1 
ATOM   7417  O  O   . LYS D  1 110 ? 1.911   85.434  108.993 1.00 30.35  ? 110  LYS D O   1 
ATOM   7418  C  CB  . LYS D  1 110 ? 1.281   88.281  107.452 1.00 40.24  ? 110  LYS D CB  1 
ATOM   7419  C  CG  . LYS D  1 110 ? 0.386   88.931  106.404 1.00 48.17  ? 110  LYS D CG  1 
ATOM   7420  C  CD  . LYS D  1 110 ? 1.201   89.653  105.326 1.00 50.71  ? 110  LYS D CD  1 
ATOM   7421  C  CE  . LYS D  1 110 ? 0.312   90.356  104.292 1.00 51.31  ? 110  LYS D CE  1 
ATOM   7422  N  NZ  . LYS D  1 110 ? -0.445  91.517  104.861 1.00 53.54  ? 110  LYS D NZ  1 
ATOM   7423  N  N   . ILE D  1 111 ? 2.018   87.229  110.343 1.00 34.37  ? 111  ILE D N   1 
ATOM   7424  C  CA  . ILE D  1 111 ? 2.976   86.623  111.265 1.00 33.24  ? 111  ILE D CA  1 
ATOM   7425  C  C   . ILE D  1 111 ? 2.350   85.411  111.958 1.00 34.84  ? 111  ILE D C   1 
ATOM   7426  O  O   . ILE D  1 111 ? 2.966   84.346  112.050 1.00 34.12  ? 111  ILE D O   1 
ATOM   7427  C  CB  . ILE D  1 111 ? 3.453   87.645  112.322 1.00 29.01  ? 111  ILE D CB  1 
ATOM   7428  C  CG1 . ILE D  1 111 ? 4.254   88.748  111.637 1.00 26.51  ? 111  ILE D CG1 1 
ATOM   7429  C  CG2 . ILE D  1 111 ? 4.294   86.949  113.403 1.00 23.35  ? 111  ILE D CG2 1 
ATOM   7430  C  CD1 . ILE D  1 111 ? 4.429   89.997  112.502 1.00 24.11  ? 111  ILE D CD1 1 
ATOM   7431  N  N   . ALA D  1 112 ? 1.121   85.575  112.435 1.00 37.71  ? 112  ALA D N   1 
ATOM   7432  C  CA  . ALA D  1 112 ? 0.407   84.491  113.090 1.00 39.68  ? 112  ALA D CA  1 
ATOM   7433  C  C   . ALA D  1 112 ? 0.436   83.227  112.202 1.00 42.76  ? 112  ALA D C   1 
ATOM   7434  O  O   . ALA D  1 112 ? 0.794   82.139  112.666 1.00 42.63  ? 112  ALA D O   1 
ATOM   7435  C  CB  . ALA D  1 112 ? -1.021  84.924  113.361 1.00 39.45  ? 112  ALA D CB  1 
ATOM   7436  N  N   . ASP D  1 113 ? 0.067   83.386  110.927 1.00 44.27  ? 113  ASP D N   1 
ATOM   7437  C  CA  . ASP D  1 113 ? 0.049   82.287  109.955 1.00 45.21  ? 113  ASP D CA  1 
ATOM   7438  C  C   . ASP D  1 113 ? 1.409   81.655  109.722 1.00 44.15  ? 113  ASP D C   1 
ATOM   7439  O  O   . ASP D  1 113 ? 1.542   80.440  109.732 1.00 48.40  ? 113  ASP D O   1 
ATOM   7440  C  CB  . ASP D  1 113 ? -0.464  82.776  108.609 1.00 50.09  ? 113  ASP D CB  1 
ATOM   7441  C  CG  . ASP D  1 113 ? -1.951  82.963  108.587 1.00 53.04  ? 113  ASP D CG  1 
ATOM   7442  O  OD1 . ASP D  1 113 ? -2.577  82.964  109.674 1.00 56.57  ? 113  ASP D OD1 1 
ATOM   7443  O  OD2 . ASP D  1 113 ? -2.486  83.119  107.468 1.00 54.89  ? 113  ASP D OD2 1 
ATOM   7444  N  N   . LEU D  1 114 ? 2.414   82.487  109.485 1.00 43.56  ? 114  LEU D N   1 
ATOM   7445  C  CA  . LEU D  1 114 ? 3.768   82.012  109.244 1.00 42.19  ? 114  LEU D CA  1 
ATOM   7446  C  C   . LEU D  1 114 ? 4.375   81.254  110.406 1.00 44.33  ? 114  LEU D C   1 
ATOM   7447  O  O   . LEU D  1 114 ? 4.966   80.193  110.229 1.00 47.22  ? 114  LEU D O   1 
ATOM   7448  C  CB  . LEU D  1 114 ? 4.687   83.183  108.941 1.00 40.21  ? 114  LEU D CB  1 
ATOM   7449  C  CG  . LEU D  1 114 ? 4.607   83.816  107.564 1.00 40.38  ? 114  LEU D CG  1 
ATOM   7450  C  CD1 . LEU D  1 114 ? 5.479   85.059  107.549 1.00 41.62  ? 114  LEU D CD1 1 
ATOM   7451  C  CD2 . LEU D  1 114 ? 5.068   82.822  106.524 1.00 35.51  ? 114  LEU D CD2 1 
ATOM   7452  N  N   . CYS D  1 115 ? 4.219   81.801  111.603 1.00 45.82  ? 115  CYS D N   1 
ATOM   7453  C  CA  . CYS D  1 115 ? 4.828   81.205  112.770 1.00 46.10  ? 115  CYS D CA  1 
ATOM   7454  C  C   . CYS D  1 115 ? 4.226   79.949  113.388 1.00 46.53  ? 115  CYS D C   1 
ATOM   7455  O  O   . CYS D  1 115 ? 4.952   78.980  113.596 1.00 45.25  ? 115  CYS D O   1 
ATOM   7456  C  CB  . CYS D  1 115 ? 4.994   82.273  113.845 1.00 44.79  ? 115  CYS D CB  1 
ATOM   7457  S  SG  . CYS D  1 115 ? 6.248   81.819  115.043 1.00 51.38  ? 115  CYS D SG  1 
ATOM   7458  N  N   . HIS D  1 116 ? 2.926   79.942  113.680 1.00 47.73  ? 116  HIS D N   1 
ATOM   7459  C  CA  . HIS D  1 116 ? 2.306   78.769  114.320 1.00 49.02  ? 116  HIS D CA  1 
ATOM   7460  C  C   . HIS D  1 116 ? 2.671   77.439  113.653 1.00 48.81  ? 116  HIS D C   1 
ATOM   7461  O  O   . HIS D  1 116 ? 2.624   76.381  114.275 1.00 49.19  ? 116  HIS D O   1 
ATOM   7462  C  CB  . HIS D  1 116 ? 0.779   78.919  114.388 1.00 49.14  ? 116  HIS D CB  1 
ATOM   7463  C  CG  . HIS D  1 116 ? 0.060   78.425  113.173 1.00 52.90  ? 116  HIS D CG  1 
ATOM   7464  N  ND1 . HIS D  1 116 ? 0.063   79.106  111.975 1.00 54.47  ? 116  HIS D ND1 1 
ATOM   7465  C  CD2 . HIS D  1 116 ? -0.671  77.305  112.967 1.00 53.46  ? 116  HIS D CD2 1 
ATOM   7466  C  CE1 . HIS D  1 116 ? -0.636  78.427  111.083 1.00 52.90  ? 116  HIS D CE1 1 
ATOM   7467  N  NE2 . HIS D  1 116 ? -1.092  77.331  111.661 1.00 54.62  ? 116  HIS D NE2 1 
ATOM   7468  N  N   . THR D  1 117 ? 3.031   77.513  112.379 1.00 50.01  ? 117  THR D N   1 
ATOM   7469  C  CA  . THR D  1 117 ? 3.448   76.356  111.598 1.00 50.36  ? 117  THR D CA  1 
ATOM   7470  C  C   . THR D  1 117 ? 4.638   75.632  112.250 1.00 50.14  ? 117  THR D C   1 
ATOM   7471  O  O   . THR D  1 117 ? 4.783   74.422  112.114 1.00 47.76  ? 117  THR D O   1 
ATOM   7472  C  CB  . THR D  1 117 ? 3.880   76.805  110.195 1.00 51.38  ? 117  THR D CB  1 
ATOM   7473  O  OG1 . THR D  1 117 ? 2.737   77.273  109.468 1.00 51.44  ? 117  THR D OG1 1 
ATOM   7474  C  CG2 . THR D  1 117 ? 4.543   75.672  109.459 1.00 52.32  ? 117  THR D CG2 1 
ATOM   7475  N  N   . PHE D  1 118 ? 5.482   76.393  112.949 1.00 51.20  ? 118  PHE D N   1 
ATOM   7476  C  CA  . PHE D  1 118 ? 6.677   75.878  113.627 1.00 48.91  ? 118  PHE D CA  1 
ATOM   7477  C  C   . PHE D  1 118 ? 6.468   75.346  115.053 1.00 45.74  ? 118  PHE D C   1 
ATOM   7478  O  O   . PHE D  1 118 ? 7.419   74.923  115.701 1.00 43.76  ? 118  PHE D O   1 
ATOM   7479  C  CB  . PHE D  1 118 ? 7.757   76.965  113.683 1.00 51.87  ? 118  PHE D CB  1 
ATOM   7480  C  CG  . PHE D  1 118 ? 8.427   77.242  112.362 1.00 54.66  ? 118  PHE D CG  1 
ATOM   7481  C  CD1 . PHE D  1 118 ? 7.705   77.765  111.290 1.00 53.70  ? 118  PHE D CD1 1 
ATOM   7482  C  CD2 . PHE D  1 118 ? 9.796   77.005  112.202 1.00 54.03  ? 118  PHE D CD2 1 
ATOM   7483  C  CE1 . PHE D  1 118 ? 8.333   78.050  110.083 1.00 53.03  ? 118  PHE D CE1 1 
ATOM   7484  C  CE2 . PHE D  1 118 ? 10.434  77.284  111.001 1.00 54.17  ? 118  PHE D CE2 1 
ATOM   7485  C  CZ  . PHE D  1 118 ? 9.699   77.811  109.937 1.00 55.41  ? 118  PHE D CZ  1 
ATOM   7486  N  N   . ILE D  1 119 ? 5.242   75.380  115.551 1.00 43.58  ? 119  ILE D N   1 
ATOM   7487  C  CA  . ILE D  1 119 ? 4.971   74.892  116.892 1.00 43.86  ? 119  ILE D CA  1 
ATOM   7488  C  C   . ILE D  1 119 ? 4.604   73.413  116.825 1.00 47.01  ? 119  ILE D C   1 
ATOM   7489  O  O   . ILE D  1 119 ? 3.479   73.063  116.467 1.00 45.92  ? 119  ILE D O   1 
ATOM   7490  C  CB  . ILE D  1 119 ? 3.820   75.683  117.509 1.00 42.39  ? 119  ILE D CB  1 
ATOM   7491  C  CG1 . ILE D  1 119 ? 4.265   77.130  117.703 1.00 43.57  ? 119  ILE D CG1 1 
ATOM   7492  C  CG2 . ILE D  1 119 ? 3.366   75.045  118.808 1.00 36.09  ? 119  ILE D CG2 1 
ATOM   7493  C  CD1 . ILE D  1 119 ? 3.162   78.050  118.204 1.00 48.55  ? 119  ILE D CD1 1 
ATOM   7494  N  N   . LYS D  1 120 ? 5.552   72.542  117.166 1.00 49.74  ? 120  LYS D N   1 
ATOM   7495  C  CA  . LYS D  1 120 ? 5.288   71.105  117.110 1.00 52.29  ? 120  LYS D CA  1 
ATOM   7496  C  C   . LYS D  1 120 ? 4.273   70.701  118.171 1.00 51.21  ? 120  LYS D C   1 
ATOM   7497  O  O   . LYS D  1 120 ? 4.338   71.175  119.296 1.00 51.70  ? 120  LYS D O   1 
ATOM   7498  C  CB  . LYS D  1 120 ? 6.600   70.304  117.243 1.00 52.21  ? 120  LYS D CB  1 
ATOM   7499  C  CG  . LYS D  1 120 ? 7.418   70.524  118.510 1.00 57.28  ? 120  LYS D CG  1 
ATOM   7500  C  CD  . LYS D  1 120 ? 7.110   69.459  119.572 1.00 58.50  ? 120  LYS D CD  1 
ATOM   7501  C  CE  . LYS D  1 120 ? 8.156   69.432  120.691 1.00 56.86  ? 120  LYS D CE  1 
ATOM   7502  N  NZ  . LYS D  1 120 ? 9.506   69.024  120.203 1.00 54.00  ? 120  LYS D NZ  1 
ATOM   7503  N  N   . ASP D  1 121 ? 3.322   69.847  117.798 1.00 53.12  ? 121  ASP D N   1 
ATOM   7504  C  CA  . ASP D  1 121 ? 2.278   69.399  118.720 1.00 52.10  ? 121  ASP D CA  1 
ATOM   7505  C  C   . ASP D  1 121 ? 2.888   68.861  120.010 1.00 51.63  ? 121  ASP D C   1 
ATOM   7506  O  O   . ASP D  1 121 ? 3.872   68.115  119.980 1.00 52.25  ? 121  ASP D O   1 
ATOM   7507  C  CB  . ASP D  1 121 ? 1.408   68.313  118.074 1.00 52.58  ? 121  ASP D CB  1 
ATOM   7508  C  CG  . ASP D  1 121 ? 0.069   68.137  118.791 1.00 56.74  ? 121  ASP D CG  1 
ATOM   7509  O  OD1 . ASP D  1 121 ? -0.754  69.084  118.745 1.00 54.07  ? 121  ASP D OD1 1 
ATOM   7510  O  OD2 . ASP D  1 121 ? -0.158  67.063  119.405 1.00 54.80  ? 121  ASP D OD2 1 
ATOM   7511  N  N   . GLY D  1 122 ? 2.304   69.247  121.141 1.00 48.93  ? 122  GLY D N   1 
ATOM   7512  C  CA  . GLY D  1 122 ? 2.813   68.799  122.427 1.00 47.18  ? 122  GLY D CA  1 
ATOM   7513  C  C   . GLY D  1 122 ? 4.007   69.594  122.939 1.00 45.82  ? 122  GLY D C   1 
ATOM   7514  O  O   . GLY D  1 122 ? 4.551   69.281  123.995 1.00 47.86  ? 122  GLY D O   1 
ATOM   7515  N  N   . ALA D  1 123 ? 4.406   70.631  122.205 1.00 42.46  ? 123  ALA D N   1 
ATOM   7516  C  CA  . ALA D  1 123 ? 5.542   71.468  122.581 1.00 39.27  ? 123  ALA D CA  1 
ATOM   7517  C  C   . ALA D  1 123 ? 5.274   72.441  123.719 1.00 36.93  ? 123  ALA D C   1 
ATOM   7518  O  O   . ALA D  1 123 ? 4.166   72.931  123.890 1.00 39.29  ? 123  ALA D O   1 
ATOM   7519  C  CB  . ALA D  1 123 ? 6.031   72.241  121.366 1.00 39.24  ? 123  ALA D CB  1 
ATOM   7520  N  N   . THR D  1 124 ? 6.311   72.700  124.505 1.00 38.27  ? 124  THR D N   1 
ATOM   7521  C  CA  . THR D  1 124 ? 6.242   73.644  125.618 1.00 37.41  ? 124  THR D CA  1 
ATOM   7522  C  C   . THR D  1 124 ? 6.986   74.870  125.114 1.00 36.97  ? 124  THR D C   1 
ATOM   7523  O  O   . THR D  1 124 ? 8.174   74.794  124.780 1.00 33.34  ? 124  THR D O   1 
ATOM   7524  C  CB  . THR D  1 124 ? 6.968   73.108  126.881 1.00 40.33  ? 124  THR D CB  1 
ATOM   7525  O  OG1 . THR D  1 124 ? 6.239   72.002  127.430 1.00 41.14  ? 124  THR D OG1 1 
ATOM   7526  C  CG2 . THR D  1 124 ? 7.106   74.209  127.937 1.00 37.62  ? 124  THR D CG2 1 
ATOM   7527  N  N   . ILE D  1 125 ? 6.278   75.990  125.042 1.00 35.92  ? 125  ILE D N   1 
ATOM   7528  C  CA  . ILE D  1 125 ? 6.856   77.235  124.563 1.00 33.97  ? 125  ILE D CA  1 
ATOM   7529  C  C   . ILE D  1 125 ? 7.106   78.185  125.720 1.00 32.89  ? 125  ILE D C   1 
ATOM   7530  O  O   . ILE D  1 125 ? 6.283   78.289  126.622 1.00 33.60  ? 125  ILE D O   1 
ATOM   7531  C  CB  . ILE D  1 125 ? 5.910   77.932  123.571 1.00 32.75  ? 125  ILE D CB  1 
ATOM   7532  C  CG1 . ILE D  1 125 ? 5.344   76.915  122.583 1.00 33.70  ? 125  ILE D CG1 1 
ATOM   7533  C  CG2 . ILE D  1 125 ? 6.661   78.999  122.810 1.00 33.09  ? 125  ILE D CG2 1 
ATOM   7534  C  CD1 . ILE D  1 125 ? 4.270   77.478  121.661 1.00 33.45  ? 125  ILE D CD1 1 
ATOM   7535  N  N   . LEU D  1 126 ? 8.239   78.884  125.681 1.00 33.11  ? 126  LEU D N   1 
ATOM   7536  C  CA  . LEU D  1 126 ? 8.604   79.844  126.722 1.00 32.06  ? 126  LEU D CA  1 
ATOM   7537  C  C   . LEU D  1 126 ? 8.528   81.260  126.146 1.00 33.57  ? 126  LEU D C   1 
ATOM   7538  O  O   . LEU D  1 126 ? 8.975   81.509  125.021 1.00 33.14  ? 126  LEU D O   1 
ATOM   7539  C  CB  . LEU D  1 126 ? 10.032  79.571  127.197 1.00 33.28  ? 126  LEU D CB  1 
ATOM   7540  C  CG  . LEU D  1 126 ? 10.629  80.081  128.522 1.00 33.67  ? 126  LEU D CG  1 
ATOM   7541  C  CD1 . LEU D  1 126 ? 12.150  80.140  128.340 1.00 31.48  ? 126  LEU D CD1 1 
ATOM   7542  C  CD2 . LEU D  1 126 ? 10.141  81.458  128.898 1.00 31.00  ? 126  LEU D CD2 1 
ATOM   7543  N  N   . THR D  1 127 ? 7.950   82.182  126.913 1.00 33.59  ? 127  THR D N   1 
ATOM   7544  C  CA  . THR D  1 127 ? 7.844   83.573  126.481 1.00 31.59  ? 127  THR D CA  1 
ATOM   7545  C  C   . THR D  1 127 ? 8.260   84.506  127.590 1.00 28.82  ? 127  THR D C   1 
ATOM   7546  O  O   . THR D  1 127 ? 8.424   84.102  128.735 1.00 26.01  ? 127  THR D O   1 
ATOM   7547  C  CB  . THR D  1 127 ? 6.407   84.010  126.112 1.00 33.33  ? 127  THR D CB  1 
ATOM   7548  O  OG1 . THR D  1 127 ? 5.649   82.896  125.632 1.00 33.91  ? 127  THR D OG1 1 
ATOM   7549  C  CG2 . THR D  1 127 ? 6.470   85.101  125.038 1.00 31.92  ? 127  THR D CG2 1 
ATOM   7550  N  N   . HIS D  1 128 ? 8.378   85.775  127.227 1.00 28.91  ? 128  HIS D N   1 
ATOM   7551  C  CA  . HIS D  1 128 ? 8.760   86.825  128.154 1.00 31.03  ? 128  HIS D CA  1 
ATOM   7552  C  C   . HIS D  1 128 ? 7.776   88.005  128.066 1.00 31.81  ? 128  HIS D C   1 
ATOM   7553  O  O   . HIS D  1 128 ? 7.393   88.442  126.974 1.00 25.33  ? 128  HIS D O   1 
ATOM   7554  C  CB  . HIS D  1 128 ? 10.180  87.302  127.828 1.00 28.28  ? 128  HIS D CB  1 
ATOM   7555  C  CG  . HIS D  1 128 ? 10.645  88.451  128.667 1.00 32.47  ? 128  HIS D CG  1 
ATOM   7556  N  ND1 . HIS D  1 128 ? 10.697  88.398  130.046 1.00 32.03  ? 128  HIS D ND1 1 
ATOM   7557  C  CD2 . HIS D  1 128 ? 11.097  89.680  128.321 1.00 32.28  ? 128  HIS D CD2 1 
ATOM   7558  C  CE1 . HIS D  1 128 ? 11.163  89.544  130.510 1.00 32.32  ? 128  HIS D CE1 1 
ATOM   7559  N  NE2 . HIS D  1 128 ? 11.413  90.339  129.485 1.00 33.69  ? 128  HIS D NE2 1 
ATOM   7560  N  N   . ALA D  1 129 ? 7.369   88.506  129.230 1.00 32.80  ? 129  ALA D N   1 
ATOM   7561  C  CA  . ALA D  1 129 ? 6.459   89.635  129.305 1.00 34.09  ? 129  ALA D CA  1 
ATOM   7562  C  C   . ALA D  1 129 ? 5.181   89.450  128.470 1.00 36.44  ? 129  ALA D C   1 
ATOM   7563  O  O   . ALA D  1 129 ? 4.793   88.329  128.112 1.00 35.31  ? 129  ALA D O   1 
ATOM   7564  C  CB  . ALA D  1 129 ? 7.199   90.902  128.859 1.00 34.96  ? 129  ALA D CB  1 
ATOM   7565  N  N   . TYR D  1 130 ? 4.537   90.570  128.162 1.00 35.97  ? 130  TYR D N   1 
ATOM   7566  C  CA  . TYR D  1 130 ? 3.320   90.568  127.372 1.00 35.27  ? 130  TYR D CA  1 
ATOM   7567  C  C   . TYR D  1 130 ? 3.608   90.965  125.924 1.00 34.31  ? 130  TYR D C   1 
ATOM   7568  O  O   . TYR D  1 130 ? 4.222   91.994  125.667 1.00 32.30  ? 130  TYR D O   1 
ATOM   7569  C  CB  . TYR D  1 130 ? 2.316   91.567  127.955 1.00 37.34  ? 130  TYR D CB  1 
ATOM   7570  C  CG  . TYR D  1 130 ? 0.922   91.400  127.404 1.00 41.20  ? 130  TYR D CG  1 
ATOM   7571  C  CD1 . TYR D  1 130 ? 0.020   90.536  128.021 1.00 45.47  ? 130  TYR D CD1 1 
ATOM   7572  C  CD2 . TYR D  1 130 ? 0.520   92.042  126.230 1.00 37.63  ? 130  TYR D CD2 1 
ATOM   7573  C  CE1 . TYR D  1 130 ? -1.243  90.306  127.491 1.00 43.06  ? 130  TYR D CE1 1 
ATOM   7574  C  CE2 . TYR D  1 130 ? -0.745  91.812  125.692 1.00 41.05  ? 130  TYR D CE2 1 
ATOM   7575  C  CZ  . TYR D  1 130 ? -1.619  90.939  126.334 1.00 40.51  ? 130  TYR D CZ  1 
ATOM   7576  O  OH  . TYR D  1 130 ? -2.875  90.680  125.842 1.00 42.92  ? 130  TYR D OH  1 
ATOM   7577  N  N   . SER D  1 131 ? 3.182   90.148  124.974 1.00 33.20  ? 131  SER D N   1 
ATOM   7578  C  CA  . SER D  1 131 ? 3.369   90.511  123.576 1.00 34.33  ? 131  SER D CA  1 
ATOM   7579  C  C   . SER D  1 131 ? 2.067   90.227  122.832 1.00 35.15  ? 131  SER D C   1 
ATOM   7580  O  O   . SER D  1 131 ? 1.579   89.096  122.818 1.00 34.52  ? 131  SER D O   1 
ATOM   7581  C  CB  . SER D  1 131 ? 4.522   89.725  122.937 1.00 35.54  ? 131  SER D CB  1 
ATOM   7582  O  OG  . SER D  1 131 ? 4.537   89.895  121.516 1.00 34.05  ? 131  SER D OG  1 
ATOM   7583  N  N   . ARG D  1 132 ? 1.497   91.263  122.229 1.00 33.93  ? 132  ARG D N   1 
ATOM   7584  C  CA  . ARG D  1 132 ? 0.265   91.114  121.485 1.00 34.25  ? 132  ARG D CA  1 
ATOM   7585  C  C   . ARG D  1 132 ? 0.425   90.169  120.295 1.00 32.61  ? 132  ARG D C   1 
ATOM   7586  O  O   . ARG D  1 132 ? -0.398  89.282  120.071 1.00 31.67  ? 132  ARG D O   1 
ATOM   7587  C  CB  . ARG D  1 132 ? -0.213  92.486  121.027 1.00 35.94  ? 132  ARG D CB  1 
ATOM   7588  C  CG  . ARG D  1 132 ? -0.855  93.303  122.147 1.00 43.91  ? 132  ARG D CG  1 
ATOM   7589  C  CD  . ARG D  1 132 ? -1.125  94.748  121.713 1.00 47.10  ? 132  ARG D CD  1 
ATOM   7590  N  NE  . ARG D  1 132 ? 0.109   95.524  121.646 1.00 48.34  ? 132  ARG D NE  1 
ATOM   7591  C  CZ  . ARG D  1 132 ? 0.518   96.352  122.600 1.00 49.50  ? 132  ARG D CZ  1 
ATOM   7592  N  NH1 . ARG D  1 132 ? -0.221  96.520  123.687 1.00 48.56  ? 132  ARG D NH1 1 
ATOM   7593  N  NH2 . ARG D  1 132 ? 1.678   96.991  122.478 1.00 48.72  ? 132  ARG D NH2 1 
ATOM   7594  N  N   . VAL D  1 133 ? 1.490   90.340  119.532 1.00 33.45  ? 133  VAL D N   1 
ATOM   7595  C  CA  . VAL D  1 133 ? 1.685   89.470  118.385 1.00 35.63  ? 133  VAL D CA  1 
ATOM   7596  C  C   . VAL D  1 133 ? 1.934   88.025  118.817 1.00 32.84  ? 133  VAL D C   1 
ATOM   7597  O  O   . VAL D  1 133 ? 1.514   87.099  118.133 1.00 34.57  ? 133  VAL D O   1 
ATOM   7598  C  CB  . VAL D  1 133 ? 2.852   89.962  117.460 1.00 34.41  ? 133  VAL D CB  1 
ATOM   7599  C  CG1 . VAL D  1 133 ? 2.703   91.451  117.187 1.00 34.48  ? 133  VAL D CG1 1 
ATOM   7600  C  CG2 . VAL D  1 133 ? 4.180   89.682  118.089 1.00 36.55  ? 133  VAL D CG2 1 
ATOM   7601  N  N   . VAL D  1 134 ? 2.601   87.805  119.941 1.00 30.64  ? 134  VAL D N   1 
ATOM   7602  C  CA  . VAL D  1 134 ? 2.818   86.417  120.331 1.00 35.35  ? 134  VAL D CA  1 
ATOM   7603  C  C   . VAL D  1 134 ? 1.456   85.832  120.726 1.00 35.54  ? 134  VAL D C   1 
ATOM   7604  O  O   . VAL D  1 134 ? 1.153   84.666  120.454 1.00 33.16  ? 134  VAL D O   1 
ATOM   7605  C  CB  . VAL D  1 134 ? 3.842   86.273  121.492 1.00 34.71  ? 134  VAL D CB  1 
ATOM   7606  C  CG1 . VAL D  1 134 ? 3.215   86.656  122.806 1.00 40.51  ? 134  VAL D CG1 1 
ATOM   7607  C  CG2 . VAL D  1 134 ? 4.334   84.856  121.557 1.00 33.45  ? 134  VAL D CG2 1 
ATOM   7608  N  N   . LEU D  1 135 ? 0.629   86.664  121.350 1.00 36.91  ? 135  LEU D N   1 
ATOM   7609  C  CA  . LEU D  1 135 ? -0.702  86.244  121.729 1.00 37.50  ? 135  LEU D CA  1 
ATOM   7610  C  C   . LEU D  1 135 ? -1.441  85.820  120.452 1.00 38.26  ? 135  LEU D C   1 
ATOM   7611  O  O   . LEU D  1 135 ? -2.035  84.742  120.414 1.00 40.84  ? 135  LEU D O   1 
ATOM   7612  C  CB  . LEU D  1 135 ? -1.455  87.387  122.394 1.00 39.32  ? 135  LEU D CB  1 
ATOM   7613  C  CG  . LEU D  1 135 ? -2.315  87.010  123.604 1.00 43.90  ? 135  LEU D CG  1 
ATOM   7614  C  CD1 . LEU D  1 135 ? -3.387  88.096  123.800 1.00 41.04  ? 135  LEU D CD1 1 
ATOM   7615  C  CD2 . LEU D  1 135 ? -2.954  85.644  123.404 1.00 39.09  ? 135  LEU D CD2 1 
ATOM   7616  N  N   . ARG D  1 136 ? -1.399  86.643  119.403 1.00 35.66  ? 136  ARG D N   1 
ATOM   7617  C  CA  . ARG D  1 136 ? -2.087  86.274  118.168 1.00 37.75  ? 136  ARG D CA  1 
ATOM   7618  C  C   . ARG D  1 136 ? -1.493  85.026  117.531 1.00 37.32  ? 136  ARG D C   1 
ATOM   7619  O  O   . ARG D  1 136 ? -2.212  84.228  116.939 1.00 35.43  ? 136  ARG D O   1 
ATOM   7620  C  CB  . ARG D  1 136 ? -2.097  87.426  117.155 1.00 39.13  ? 136  ARG D CB  1 
ATOM   7621  C  CG  . ARG D  1 136 ? -3.234  88.452  117.380 1.00 46.25  ? 136  ARG D CG  1 
ATOM   7622  C  CD  . ARG D  1 136 ? -4.094  88.669  116.119 1.00 49.27  ? 136  ARG D CD  1 
ATOM   7623  N  NE  . ARG D  1 136 ? -4.607  90.043  116.006 1.00 52.52  ? 136  ARG D NE  1 
ATOM   7624  C  CZ  . ARG D  1 136 ? -5.127  90.568  114.894 1.00 51.45  ? 136  ARG D CZ  1 
ATOM   7625  N  NH1 . ARG D  1 136 ? -5.211  89.834  113.796 1.00 50.69  ? 136  ARG D NH1 1 
ATOM   7626  N  NH2 . ARG D  1 136 ? -5.546  91.830  114.868 1.00 49.26  ? 136  ARG D NH2 1 
ATOM   7627  N  N   . VAL D  1 137 ? -0.183  84.848  117.667 1.00 36.50  ? 137  VAL D N   1 
ATOM   7628  C  CA  . VAL D  1 137 ? 0.460   83.679  117.099 1.00 33.70  ? 137  VAL D CA  1 
ATOM   7629  C  C   . VAL D  1 137 ? -0.057  82.425  117.782 1.00 33.81  ? 137  VAL D C   1 
ATOM   7630  O  O   . VAL D  1 137 ? -0.341  81.428  117.124 1.00 33.65  ? 137  VAL D O   1 
ATOM   7631  C  CB  . VAL D  1 137 ? 1.994   83.735  117.255 1.00 33.48  ? 137  VAL D CB  1 
ATOM   7632  C  CG1 . VAL D  1 137 ? 2.616   82.426  116.764 1.00 31.97  ? 137  VAL D CG1 1 
ATOM   7633  C  CG2 . VAL D  1 137 ? 2.554   84.895  116.458 1.00 28.48  ? 137  VAL D CG2 1 
ATOM   7634  N  N   . LEU D  1 138 ? -0.187  82.481  119.103 1.00 35.06  ? 138  LEU D N   1 
ATOM   7635  C  CA  . LEU D  1 138 ? -0.668  81.341  119.873 1.00 35.21  ? 138  LEU D CA  1 
ATOM   7636  C  C   . LEU D  1 138 ? -2.166  81.053  119.686 1.00 39.62  ? 138  LEU D C   1 
ATOM   7637  O  O   . LEU D  1 138 ? -2.623  79.945  119.955 1.00 40.43  ? 138  LEU D O   1 
ATOM   7638  C  CB  . LEU D  1 138 ? -0.332  81.537  121.350 1.00 32.21  ? 138  LEU D CB  1 
ATOM   7639  C  CG  . LEU D  1 138 ? 1.179   81.519  121.635 1.00 33.06  ? 138  LEU D CG  1 
ATOM   7640  C  CD1 . LEU D  1 138 ? 1.469   81.750  123.120 1.00 25.87  ? 138  LEU D CD1 1 
ATOM   7641  C  CD2 . LEU D  1 138 ? 1.747   80.180  121.169 1.00 28.29  ? 138  LEU D CD2 1 
ATOM   7642  N  N   . GLU D  1 139 ? -2.933  82.040  119.230 1.00 42.09  ? 139  GLU D N   1 
ATOM   7643  C  CA  . GLU D  1 139 ? -4.354  81.819  118.983 1.00 43.67  ? 139  GLU D CA  1 
ATOM   7644  C  C   . GLU D  1 139 ? -4.441  81.087  117.652 1.00 46.70  ? 139  GLU D C   1 
ATOM   7645  O  O   . GLU D  1 139 ? -5.257  80.183  117.458 1.00 49.05  ? 139  GLU D O   1 
ATOM   7646  C  CB  . GLU D  1 139 ? -5.099  83.149  118.905 1.00 40.07  ? 139  GLU D CB  1 
ATOM   7647  C  CG  . GLU D  1 139 ? -5.132  83.867  120.228 1.00 43.07  ? 139  GLU D CG  1 
ATOM   7648  C  CD  . GLU D  1 139 ? -5.527  85.320  120.103 1.00 45.94  ? 139  GLU D CD  1 
ATOM   7649  O  OE1 . GLU D  1 139 ? -5.124  85.980  119.119 1.00 46.45  ? 139  GLU D OE1 1 
ATOM   7650  O  OE2 . GLU D  1 139 ? -6.224  85.818  121.009 1.00 51.08  ? 139  GLU D OE2 1 
ATOM   7651  N  N   . ALA D  1 140 ? -3.572  81.488  116.737 1.00 49.45  ? 140  ALA D N   1 
ATOM   7652  C  CA  . ALA D  1 140 ? -3.506  80.882  115.425 1.00 50.75  ? 140  ALA D CA  1 
ATOM   7653  C  C   . ALA D  1 140 ? -3.097  79.434  115.623 1.00 53.57  ? 140  ALA D C   1 
ATOM   7654  O  O   . ALA D  1 140 ? -3.270  78.604  114.729 1.00 56.75  ? 140  ALA D O   1 
ATOM   7655  C  CB  . ALA D  1 140 ? -2.466  81.603  114.566 1.00 50.52  ? 140  ALA D CB  1 
ATOM   7656  N  N   . ALA D  1 141 ? -2.545  79.140  116.797 1.00 51.75  ? 141  ALA D N   1 
ATOM   7657  C  CA  . ALA D  1 141 ? -2.101  77.793  117.102 1.00 52.50  ? 141  ALA D CA  1 
ATOM   7658  C  C   . ALA D  1 141 ? -3.231  76.906  117.613 1.00 53.54  ? 141  ALA D C   1 
ATOM   7659  O  O   . ALA D  1 141 ? -3.319  75.738  117.238 1.00 55.86  ? 141  ALA D O   1 
ATOM   7660  C  CB  . ALA D  1 141 ? -0.977  77.839  118.110 1.00 54.80  ? 141  ALA D CB  1 
ATOM   7661  N  N   . VAL D  1 142 ? -4.087  77.447  118.474 1.00 52.96  ? 142  VAL D N   1 
ATOM   7662  C  CA  . VAL D  1 142 ? -5.205  76.673  118.996 1.00 52.45  ? 142  VAL D CA  1 
ATOM   7663  C  C   . VAL D  1 142 ? -6.122  76.387  117.814 1.00 53.81  ? 142  VAL D C   1 
ATOM   7664  O  O   . VAL D  1 142 ? -6.671  75.293  117.683 1.00 54.12  ? 142  VAL D O   1 
ATOM   7665  C  CB  . VAL D  1 142 ? -6.002  77.455  120.072 1.00 51.84  ? 142  VAL D CB  1 
ATOM   7666  C  CG1 . VAL D  1 142 ? -5.077  77.913  121.185 1.00 48.35  ? 142  VAL D CG1 1 
ATOM   7667  C  CG2 . VAL D  1 142 ? -6.698  78.650  119.442 1.00 55.60  ? 142  VAL D CG2 1 
ATOM   7668  N  N   . ALA D  1 143 ? -6.263  77.380  116.943 1.00 54.27  ? 143  ALA D N   1 
ATOM   7669  C  CA  . ALA D  1 143 ? -7.107  77.257  115.764 1.00 54.26  ? 143  ALA D CA  1 
ATOM   7670  C  C   . ALA D  1 143 ? -6.625  76.135  114.848 1.00 54.16  ? 143  ALA D C   1 
ATOM   7671  O  O   . ALA D  1 143 ? -7.431  75.460  114.215 1.00 56.02  ? 143  ALA D O   1 
ATOM   7672  C  CB  . ALA D  1 143 ? -7.131  78.577  115.009 1.00 54.36  ? 143  ALA D CB  1 
ATOM   7673  N  N   . ALA D  1 144 ? -5.312  75.942  114.775 1.00 54.31  ? 144  ALA D N   1 
ATOM   7674  C  CA  . ALA D  1 144 ? -4.734  74.896  113.939 1.00 55.19  ? 144  ALA D CA  1 
ATOM   7675  C  C   . ALA D  1 144 ? -4.828  73.547  114.649 1.00 56.21  ? 144  ALA D C   1 
ATOM   7676  O  O   . ALA D  1 144 ? -4.213  72.560  114.234 1.00 54.72  ? 144  ALA D O   1 
ATOM   7677  C  CB  . ALA D  1 144 ? -3.278  75.225  113.614 1.00 56.22  ? 144  ALA D CB  1 
ATOM   7678  N  N   . LYS D  1 145 ? -5.596  73.525  115.735 1.00 57.63  ? 145  LYS D N   1 
ATOM   7679  C  CA  . LYS D  1 145 ? -5.820  72.309  116.513 1.00 59.50  ? 145  LYS D CA  1 
ATOM   7680  C  C   . LYS D  1 145 ? -4.543  71.751  117.150 1.00 59.80  ? 145  LYS D C   1 
ATOM   7681  O  O   . LYS D  1 145 ? -4.457  70.553  117.442 1.00 61.42  ? 145  LYS D O   1 
ATOM   7682  C  CB  . LYS D  1 145 ? -6.460  71.235  115.621 1.00 60.33  ? 145  LYS D CB  1 
ATOM   7683  C  CG  . LYS D  1 145 ? -7.592  71.738  114.719 1.00 63.35  ? 145  LYS D CG  1 
ATOM   7684  C  CD  . LYS D  1 145 ? -8.625  72.561  115.489 1.00 67.18  ? 145  LYS D CD  1 
ATOM   7685  C  CE  . LYS D  1 145 ? -9.272  71.765  116.621 1.00 68.94  ? 145  LYS D CE  1 
ATOM   7686  N  NZ  . LYS D  1 145 ? -10.251 72.586  117.394 1.00 69.32  ? 145  LYS D NZ  1 
ATOM   7687  N  N   . LYS D  1 146 ? -3.556  72.617  117.365 1.00 56.62  ? 146  LYS D N   1 
ATOM   7688  C  CA  . LYS D  1 146 ? -2.292  72.208  117.961 1.00 52.17  ? 146  LYS D CA  1 
ATOM   7689  C  C   . LYS D  1 146 ? -2.381  72.240  119.480 1.00 51.33  ? 146  LYS D C   1 
ATOM   7690  O  O   . LYS D  1 146 ? -3.051  73.101  120.044 1.00 51.73  ? 146  LYS D O   1 
ATOM   7691  C  CB  . LYS D  1 146 ? -1.166  73.121  117.461 1.00 49.95  ? 146  LYS D CB  1 
ATOM   7692  C  CG  . LYS D  1 146 ? -0.752  72.802  116.035 1.00 50.90  ? 146  LYS D CG  1 
ATOM   7693  C  CD  . LYS D  1 146 ? 0.495   73.551  115.601 1.00 53.13  ? 146  LYS D CD  1 
ATOM   7694  C  CE  . LYS D  1 146 ? 1.143   72.902  114.362 1.00 52.86  ? 146  LYS D CE  1 
ATOM   7695  N  NZ  . LYS D  1 146 ? 1.732   71.539  114.619 1.00 48.14  ? 146  LYS D NZ  1 
ATOM   7696  N  N   . ARG D  1 147 ? -1.735  71.288  120.144 1.00 49.04  ? 147  ARG D N   1 
ATOM   7697  C  CA  . ARG D  1 147 ? -1.756  71.254  121.602 1.00 50.61  ? 147  ARG D CA  1 
ATOM   7698  C  C   . ARG D  1 147 ? -0.380  71.605  122.121 1.00 48.82  ? 147  ARG D C   1 
ATOM   7699  O  O   . ARG D  1 147 ? 0.613   70.988  121.741 1.00 50.04  ? 147  ARG D O   1 
ATOM   7700  C  CB  . ARG D  1 147 ? -2.167  69.877  122.130 1.00 55.66  ? 147  ARG D CB  1 
ATOM   7701  C  CG  . ARG D  1 147 ? -3.673  69.603  122.079 1.00 63.67  ? 147  ARG D CG  1 
ATOM   7702  C  CD  . ARG D  1 147 ? -4.045  68.382  122.924 1.00 69.26  ? 147  ARG D CD  1 
ATOM   7703  N  NE  . ARG D  1 147 ? -3.415  67.161  122.427 1.00 72.79  ? 147  ARG D NE  1 
ATOM   7704  C  CZ  . ARG D  1 147 ? -3.831  66.484  121.363 1.00 75.27  ? 147  ARG D CZ  1 
ATOM   7705  N  NH1 . ARG D  1 147 ? -4.890  66.905  120.681 1.00 75.84  ? 147  ARG D NH1 1 
ATOM   7706  N  NH2 . ARG D  1 147 ? -3.177  65.397  120.969 1.00 76.30  ? 147  ARG D NH2 1 
ATOM   7707  N  N   . PHE D  1 148 ? -0.329  72.601  122.996 1.00 45.27  ? 148  PHE D N   1 
ATOM   7708  C  CA  . PHE D  1 148 ? 0.930   73.061  123.550 1.00 41.86  ? 148  PHE D CA  1 
ATOM   7709  C  C   . PHE D  1 148 ? 0.714   73.609  124.948 1.00 42.07  ? 148  PHE D C   1 
ATOM   7710  O  O   . PHE D  1 148 ? -0.407  73.644  125.443 1.00 44.04  ? 148  PHE D O   1 
ATOM   7711  C  CB  . PHE D  1 148 ? 1.520   74.166  122.659 1.00 38.47  ? 148  PHE D CB  1 
ATOM   7712  C  CG  . PHE D  1 148 ? 0.594   75.347  122.442 1.00 35.03  ? 148  PHE D CG  1 
ATOM   7713  C  CD1 . PHE D  1 148 ? -0.380  75.320  121.439 1.00 32.49  ? 148  PHE D CD1 1 
ATOM   7714  C  CD2 . PHE D  1 148 ? 0.689   76.489  123.247 1.00 34.31  ? 148  PHE D CD2 1 
ATOM   7715  C  CE1 . PHE D  1 148 ? -1.252  76.417  121.239 1.00 29.76  ? 148  PHE D CE1 1 
ATOM   7716  C  CE2 . PHE D  1 148 ? -0.182  77.594  123.054 1.00 32.44  ? 148  PHE D CE2 1 
ATOM   7717  C  CZ  . PHE D  1 148 ? -1.150  77.551  122.049 1.00 29.07  ? 148  PHE D CZ  1 
ATOM   7718  N  N   . SER D  1 149 ? 1.800   74.028  125.582 1.00 39.91  ? 149  SER D N   1 
ATOM   7719  C  CA  . SER D  1 149 ? 1.740   74.612  126.913 1.00 38.02  ? 149  SER D CA  1 
ATOM   7720  C  C   . SER D  1 149 ? 2.783   75.726  126.991 1.00 39.24  ? 149  SER D C   1 
ATOM   7721  O  O   . SER D  1 149 ? 3.855   75.648  126.374 1.00 38.14  ? 149  SER D O   1 
ATOM   7722  C  CB  . SER D  1 149 ? 1.997   73.552  127.978 1.00 35.45  ? 149  SER D CB  1 
ATOM   7723  O  OG  . SER D  1 149 ? 3.133   72.770  127.655 1.00 43.09  ? 149  SER D OG  1 
ATOM   7724  N  N   . VAL D  1 150 ? 2.451   76.763  127.751 1.00 38.59  ? 150  VAL D N   1 
ATOM   7725  C  CA  . VAL D  1 150 ? 3.310   77.921  127.908 1.00 36.67  ? 150  VAL D CA  1 
ATOM   7726  C  C   . VAL D  1 150 ? 3.892   78.149  129.310 1.00 36.16  ? 150  VAL D C   1 
ATOM   7727  O  O   . VAL D  1 150 ? 3.332   77.746  130.336 1.00 36.28  ? 150  VAL D O   1 
ATOM   7728  C  CB  . VAL D  1 150 ? 2.543   79.212  127.493 1.00 36.04  ? 150  VAL D CB  1 
ATOM   7729  C  CG1 . VAL D  1 150 ? 3.442   80.447  127.611 1.00 33.88  ? 150  VAL D CG1 1 
ATOM   7730  C  CG2 . VAL D  1 150 ? 2.043   79.071  126.090 1.00 34.10  ? 150  VAL D CG2 1 
ATOM   7731  N  N   . TYR D  1 151 ? 5.041   78.809  129.306 1.00 33.78  ? 151  TYR D N   1 
ATOM   7732  C  CA  . TYR D  1 151 ? 5.762   79.218  130.496 1.00 31.09  ? 151  TYR D CA  1 
ATOM   7733  C  C   . TYR D  1 151 ? 6.073   80.687  130.178 1.00 30.55  ? 151  TYR D C   1 
ATOM   7734  O  O   . TYR D  1 151 ? 6.566   80.998  129.083 1.00 29.33  ? 151  TYR D O   1 
ATOM   7735  C  CB  . TYR D  1 151 ? 7.054   78.424  130.636 1.00 30.60  ? 151  TYR D CB  1 
ATOM   7736  C  CG  . TYR D  1 151 ? 6.971   77.215  131.530 1.00 32.31  ? 151  TYR D CG  1 
ATOM   7737  C  CD1 . TYR D  1 151 ? 6.976   77.344  132.919 1.00 37.41  ? 151  TYR D CD1 1 
ATOM   7738  C  CD2 . TYR D  1 151 ? 6.927   75.938  130.991 1.00 37.88  ? 151  TYR D CD2 1 
ATOM   7739  C  CE1 . TYR D  1 151 ? 6.948   76.226  133.749 1.00 32.80  ? 151  TYR D CE1 1 
ATOM   7740  C  CE2 . TYR D  1 151 ? 6.897   74.811  131.808 1.00 39.22  ? 151  TYR D CE2 1 
ATOM   7741  C  CZ  . TYR D  1 151 ? 6.914   74.965  133.183 1.00 37.80  ? 151  TYR D CZ  1 
ATOM   7742  O  OH  . TYR D  1 151 ? 6.944   73.842  133.974 1.00 42.66  ? 151  TYR D OH  1 
ATOM   7743  N  N   . VAL D  1 152 ? 5.755   81.589  131.102 1.00 26.88  ? 152  VAL D N   1 
ATOM   7744  C  CA  . VAL D  1 152 ? 6.009   83.005  130.874 1.00 27.91  ? 152  VAL D CA  1 
ATOM   7745  C  C   . VAL D  1 152 ? 6.514   83.710  132.126 1.00 29.97  ? 152  VAL D C   1 
ATOM   7746  O  O   . VAL D  1 152 ? 6.017   83.467  133.228 1.00 30.42  ? 152  VAL D O   1 
ATOM   7747  C  CB  . VAL D  1 152 ? 4.719   83.738  130.332 1.00 27.89  ? 152  VAL D CB  1 
ATOM   7748  C  CG1 . VAL D  1 152 ? 3.530   83.455  131.225 1.00 25.93  ? 152  VAL D CG1 1 
ATOM   7749  C  CG2 . VAL D  1 152 ? 4.952   85.240  130.239 1.00 22.82  ? 152  VAL D CG2 1 
ATOM   7750  N  N   . THR D  1 153 ? 7.527   84.561  131.937 1.00 30.36  ? 153  THR D N   1 
ATOM   7751  C  CA  . THR D  1 153 ? 8.129   85.354  133.010 1.00 29.13  ? 153  THR D CA  1 
ATOM   7752  C  C   . THR D  1 153 ? 7.118   86.423  133.449 1.00 31.23  ? 153  THR D C   1 
ATOM   7753  O  O   . THR D  1 153 ? 6.397   86.979  132.615 1.00 27.01  ? 153  THR D O   1 
ATOM   7754  C  CB  . THR D  1 153 ? 9.406   86.063  132.513 1.00 27.46  ? 153  THR D CB  1 
ATOM   7755  O  OG1 . THR D  1 153 ? 9.168   86.591  131.206 1.00 28.44  ? 153  THR D OG1 1 
ATOM   7756  C  CG2 . THR D  1 153 ? 10.578  85.108  132.456 1.00 27.10  ? 153  THR D CG2 1 
ATOM   7757  N  N   . GLU D  1 154 ? 7.058   86.714  134.748 1.00 32.43  ? 154  GLU D N   1 
ATOM   7758  C  CA  . GLU D  1 154 ? 6.109   87.716  135.223 1.00 34.38  ? 154  GLU D CA  1 
ATOM   7759  C  C   . GLU D  1 154 ? 6.486   89.094  134.695 1.00 33.68  ? 154  GLU D C   1 
ATOM   7760  O  O   . GLU D  1 154 ? 5.622   89.928  134.421 1.00 33.69  ? 154  GLU D O   1 
ATOM   7761  C  CB  . GLU D  1 154 ? 6.026   87.714  136.752 1.00 35.04  ? 154  GLU D CB  1 
ATOM   7762  C  CG  . GLU D  1 154 ? 7.338   87.853  137.464 1.00 43.25  ? 154  GLU D CG  1 
ATOM   7763  C  CD  . GLU D  1 154 ? 7.152   88.090  138.949 1.00 49.51  ? 154  GLU D CD  1 
ATOM   7764  O  OE1 . GLU D  1 154 ? 6.258   87.446  139.549 1.00 54.70  ? 154  GLU D OE1 1 
ATOM   7765  O  OE2 . GLU D  1 154 ? 7.903   88.916  139.519 1.00 52.02  ? 154  GLU D OE2 1 
ATOM   7766  N  N   . SER D  1 155 ? 7.789   89.303  134.538 1.00 35.24  ? 155  SER D N   1 
ATOM   7767  C  CA  . SER D  1 155 ? 8.367   90.533  134.004 1.00 32.26  ? 155  SER D CA  1 
ATOM   7768  C  C   . SER D  1 155 ? 8.210   91.785  134.856 1.00 33.86  ? 155  SER D C   1 
ATOM   7769  O  O   . SER D  1 155 ? 7.198   92.483  134.798 1.00 31.48  ? 155  SER D O   1 
ATOM   7770  C  CB  . SER D  1 155 ? 7.823   90.807  132.600 1.00 31.36  ? 155  SER D CB  1 
ATOM   7771  O  OG  . SER D  1 155 ? 8.680   91.682  131.877 1.00 28.54  ? 155  SER D OG  1 
ATOM   7772  N  N   . GLN D  1 156 ? 9.235   92.068  135.649 1.00 35.43  ? 156  GLN D N   1 
ATOM   7773  C  CA  . GLN D  1 156 ? 9.243   93.254  136.481 1.00 33.74  ? 156  GLN D CA  1 
ATOM   7774  C  C   . GLN D  1 156 ? 9.553   94.444  135.566 1.00 34.75  ? 156  GLN D C   1 
ATOM   7775  O  O   . GLN D  1 156 ? 10.142  94.283  134.487 1.00 32.89  ? 156  GLN D O   1 
ATOM   7776  C  CB  . GLN D  1 156 ? 10.321  93.113  137.539 1.00 32.85  ? 156  GLN D CB  1 
ATOM   7777  C  CG  . GLN D  1 156 ? 10.067  92.000  138.508 1.00 33.43  ? 156  GLN D CG  1 
ATOM   7778  C  CD  . GLN D  1 156 ? 9.088   92.393  139.582 1.00 36.19  ? 156  GLN D CD  1 
ATOM   7779  O  OE1 . GLN D  1 156 ? 8.936   93.577  139.892 1.00 37.22  ? 156  GLN D OE1 1 
ATOM   7780  N  NE2 . GLN D  1 156 ? 8.434   91.405  140.177 1.00 35.17  ? 156  GLN D NE2 1 
ATOM   7781  N  N   . PRO D  1 157 ? 9.165   95.656  135.982 1.00 35.06  ? 157  PRO D N   1 
ATOM   7782  C  CA  . PRO D  1 157 ? 8.468   95.935  137.239 1.00 35.47  ? 157  PRO D CA  1 
ATOM   7783  C  C   . PRO D  1 157 ? 6.947   96.014  137.115 1.00 36.89  ? 157  PRO D C   1 
ATOM   7784  O  O   . PRO D  1 157 ? 6.253   96.081  138.121 1.00 42.48  ? 157  PRO D O   1 
ATOM   7785  C  CB  . PRO D  1 157 ? 9.071   97.271  137.658 1.00 33.29  ? 157  PRO D CB  1 
ATOM   7786  C  CG  . PRO D  1 157 ? 9.225   97.968  136.331 1.00 30.85  ? 157  PRO D CG  1 
ATOM   7787  C  CD  . PRO D  1 157 ? 9.781   96.885  135.439 1.00 32.16  ? 157  PRO D CD  1 
ATOM   7788  N  N   . ASP D  1 158 ? 6.430   96.003  135.892 1.00 36.12  ? 158  ASP D N   1 
ATOM   7789  C  CA  . ASP D  1 158 ? 4.990   96.115  135.663 1.00 36.28  ? 158  ASP D CA  1 
ATOM   7790  C  C   . ASP D  1 158 ? 4.225   94.795  135.645 1.00 35.46  ? 158  ASP D C   1 
ATOM   7791  O  O   . ASP D  1 158 ? 3.015   94.773  135.428 1.00 33.15  ? 158  ASP D O   1 
ATOM   7792  C  CB  . ASP D  1 158 ? 4.742   96.884  134.356 1.00 39.82  ? 158  ASP D CB  1 
ATOM   7793  C  CG  . ASP D  1 158 ? 5.335   96.188  133.138 1.00 42.95  ? 158  ASP D CG  1 
ATOM   7794  O  OD1 . ASP D  1 158 ? 6.305   95.415  133.282 1.00 47.34  ? 158  ASP D OD1 1 
ATOM   7795  O  OD2 . ASP D  1 158 ? 4.837   96.429  132.023 1.00 47.81  ? 158  ASP D OD2 1 
ATOM   7796  N  N   . LEU D  1 159 ? 4.945   93.698  135.853 1.00 36.74  ? 159  LEU D N   1 
ATOM   7797  C  CA  . LEU D  1 159 ? 4.361   92.360  135.894 1.00 37.57  ? 159  LEU D CA  1 
ATOM   7798  C  C   . LEU D  1 159 ? 3.484   91.999  134.697 1.00 36.49  ? 159  LEU D C   1 
ATOM   7799  O  O   . LEU D  1 159 ? 2.561   91.180  134.809 1.00 36.26  ? 159  LEU D O   1 
ATOM   7800  C  CB  . LEU D  1 159 ? 3.564   92.198  137.191 1.00 37.07  ? 159  LEU D CB  1 
ATOM   7801  C  CG  . LEU D  1 159 ? 4.433   92.375  138.434 1.00 39.21  ? 159  LEU D CG  1 
ATOM   7802  C  CD1 . LEU D  1 159 ? 3.557   92.388  139.674 1.00 39.29  ? 159  LEU D CD1 1 
ATOM   7803  C  CD2 . LEU D  1 159 ? 5.461   91.253  138.499 1.00 36.89  ? 159  LEU D CD2 1 
ATOM   7804  N  N   . SER D  1 160 ? 3.789   92.596  133.552 1.00 35.35  ? 160  SER D N   1 
ATOM   7805  C  CA  . SER D  1 160 ? 3.025   92.346  132.332 1.00 37.20  ? 160  SER D CA  1 
ATOM   7806  C  C   . SER D  1 160 ? 2.961   90.869  131.943 1.00 36.69  ? 160  SER D C   1 
ATOM   7807  O  O   . SER D  1 160 ? 2.126   90.476  131.142 1.00 38.02  ? 160  SER D O   1 
ATOM   7808  C  CB  . SER D  1 160 ? 3.606   93.164  131.172 1.00 34.37  ? 160  SER D CB  1 
ATOM   7809  O  OG  . SER D  1 160 ? 4.982   92.876  130.979 1.00 40.83  ? 160  SER D OG  1 
ATOM   7810  N  N   . GLY D  1 161 ? 3.843   90.050  132.504 1.00 36.64  ? 161  GLY D N   1 
ATOM   7811  C  CA  . GLY D  1 161 ? 3.827   88.638  132.170 1.00 35.95  ? 161  GLY D CA  1 
ATOM   7812  C  C   . GLY D  1 161 ? 2.603   87.958  132.748 1.00 36.62  ? 161  GLY D C   1 
ATOM   7813  O  O   . GLY D  1 161 ? 2.045   87.019  132.171 1.00 36.70  ? 161  GLY D O   1 
ATOM   7814  N  N   . LYS D  1 162 ? 2.199   88.442  133.911 1.00 36.69  ? 162  LYS D N   1 
ATOM   7815  C  CA  . LYS D  1 162 ? 1.038   87.929  134.599 1.00 35.69  ? 162  LYS D CA  1 
ATOM   7816  C  C   . LYS D  1 162 ? -0.210  88.172  133.757 1.00 33.34  ? 162  LYS D C   1 
ATOM   7817  O  O   . LYS D  1 162 ? -1.076  87.303  133.626 1.00 32.42  ? 162  LYS D O   1 
ATOM   7818  C  CB  . LYS D  1 162 ? 0.894   88.636  135.947 1.00 37.78  ? 162  LYS D CB  1 
ATOM   7819  C  CG  . LYS D  1 162 ? 1.918   88.236  137.007 1.00 39.51  ? 162  LYS D CG  1 
ATOM   7820  C  CD  . LYS D  1 162 ? 1.563   88.876  138.354 1.00 38.26  ? 162  LYS D CD  1 
ATOM   7821  C  CE  . LYS D  1 162 ? 2.379   88.284  139.488 1.00 40.50  ? 162  LYS D CE  1 
ATOM   7822  N  NZ  . LYS D  1 162 ? 2.230   86.799  139.532 1.00 38.46  ? 162  LYS D NZ  1 
ATOM   7823  N  N   . LYS D  1 163 ? -0.298  89.370  133.196 1.00 33.13  ? 163  LYS D N   1 
ATOM   7824  C  CA  . LYS D  1 163 ? -1.436  89.761  132.374 1.00 32.82  ? 163  LYS D CA  1 
ATOM   7825  C  C   . LYS D  1 163 ? -1.471  88.869  131.137 1.00 36.66  ? 163  LYS D C   1 
ATOM   7826  O  O   . LYS D  1 163 ? -2.537  88.518  130.628 1.00 38.28  ? 163  LYS D O   1 
ATOM   7827  C  CB  . LYS D  1 163 ? -1.302  91.237  131.993 1.00 29.72  ? 163  LYS D CB  1 
ATOM   7828  C  CG  . LYS D  1 163 ? -2.397  91.750  131.102 1.00 36.21  ? 163  LYS D CG  1 
ATOM   7829  C  CD  . LYS D  1 163 ? -2.397  93.266  131.002 1.00 40.14  ? 163  LYS D CD  1 
ATOM   7830  C  CE  . LYS D  1 163 ? -1.299  93.779  130.093 1.00 47.25  ? 163  LYS D CE  1 
ATOM   7831  N  NZ  . LYS D  1 163 ? -1.425  95.248  129.889 1.00 49.52  ? 163  LYS D NZ  1 
HETATM 7832  N  N   . MSE D  1 164 ? -0.287  88.487  130.669 1.00 38.49  ? 164  MSE D N   1 
HETATM 7833  C  CA  . MSE D  1 164 ? -0.154  87.610  129.514 1.00 38.42  ? 164  MSE D CA  1 
HETATM 7834  C  C   . MSE D  1 164 ? -0.694  86.210  129.868 1.00 37.69  ? 164  MSE D C   1 
HETATM 7835  O  O   . MSE D  1 164 ? -1.349  85.546  129.054 1.00 34.54  ? 164  MSE D O   1 
HETATM 7836  C  CB  . MSE D  1 164 ? 1.326   87.527  129.117 1.00 40.98  ? 164  MSE D CB  1 
HETATM 7837  C  CG  . MSE D  1 164 ? 1.654   86.591  127.950 1.00 43.57  ? 164  MSE D CG  1 
HETATM 7838  SE SE  . MSE D  1 164 ? 1.041   87.225  126.201 1.00 58.64  ? 164  MSE D SE  1 
HETATM 7839  C  CE  . MSE D  1 164 ? 1.408   85.623  125.178 1.00 46.46  ? 164  MSE D CE  1 
ATOM   7840  N  N   . ALA D  1 165 ? -0.410  85.777  131.092 1.00 36.27  ? 165  ALA D N   1 
ATOM   7841  C  CA  . ALA D  1 165 ? -0.841  84.475  131.575 1.00 38.38  ? 165  ALA D CA  1 
ATOM   7842  C  C   . ALA D  1 165 ? -2.364  84.345  131.629 1.00 39.92  ? 165  ALA D C   1 
ATOM   7843  O  O   . ALA D  1 165 ? -2.901  83.281  131.327 1.00 38.80  ? 165  ALA D O   1 
ATOM   7844  C  CB  . ALA D  1 165 ? -0.239  84.216  132.947 1.00 39.49  ? 165  ALA D CB  1 
ATOM   7845  N  N   . LYS D  1 166 ? -3.055  85.417  132.016 1.00 40.50  ? 166  LYS D N   1 
ATOM   7846  C  CA  . LYS D  1 166 ? -4.513  85.387  132.078 1.00 41.50  ? 166  LYS D CA  1 
ATOM   7847  C  C   . LYS D  1 166 ? -5.091  85.311  130.672 1.00 42.74  ? 166  LYS D C   1 
ATOM   7848  O  O   . LYS D  1 166 ? -6.018  84.536  130.406 1.00 43.69  ? 166  LYS D O   1 
ATOM   7849  C  CB  . LYS D  1 166 ? -5.060  86.632  132.772 1.00 43.10  ? 166  LYS D CB  1 
ATOM   7850  C  CG  . LYS D  1 166 ? -4.804  86.675  134.255 1.00 50.42  ? 166  LYS D CG  1 
ATOM   7851  C  CD  . LYS D  1 166 ? -5.556  87.832  134.910 1.00 55.94  ? 166  LYS D CD  1 
ATOM   7852  C  CE  . LYS D  1 166 ? -5.323  87.861  136.424 1.00 58.29  ? 166  LYS D CE  1 
ATOM   7853  N  NZ  . LYS D  1 166 ? -6.051  88.979  137.098 1.00 62.02  ? 166  LYS D NZ  1 
ATOM   7854  N  N   . ALA D  1 167 ? -4.552  86.125  129.773 1.00 40.28  ? 167  ALA D N   1 
ATOM   7855  C  CA  . ALA D  1 167 ? -5.021  86.124  128.402 1.00 40.46  ? 167  ALA D CA  1 
ATOM   7856  C  C   . ALA D  1 167 ? -4.990  84.696  127.903 1.00 42.73  ? 167  ALA D C   1 
ATOM   7857  O  O   . ALA D  1 167 ? -5.953  84.217  127.309 1.00 44.24  ? 167  ALA D O   1 
ATOM   7858  C  CB  . ALA D  1 167 ? -4.128  86.997  127.539 1.00 40.97  ? 167  ALA D CB  1 
ATOM   7859  N  N   . LEU D  1 168 ? -3.876  84.016  128.154 1.00 43.67  ? 168  LEU D N   1 
ATOM   7860  C  CA  . LEU D  1 168 ? -3.715  82.634  127.724 1.00 46.88  ? 168  LEU D CA  1 
ATOM   7861  C  C   . LEU D  1 168 ? -4.669  81.711  128.476 1.00 50.54  ? 168  LEU D C   1 
ATOM   7862  O  O   . LEU D  1 168 ? -5.191  80.748  127.915 1.00 50.73  ? 168  LEU D O   1 
ATOM   7863  C  CB  . LEU D  1 168 ? -2.266  82.182  127.939 1.00 44.08  ? 168  LEU D CB  1 
ATOM   7864  C  CG  . LEU D  1 168 ? -1.248  82.838  127.003 1.00 42.57  ? 168  LEU D CG  1 
ATOM   7865  C  CD1 . LEU D  1 168 ? 0.170   82.546  127.459 1.00 38.88  ? 168  LEU D CD1 1 
ATOM   7866  C  CD2 . LEU D  1 168 ? -1.481  82.330  125.600 1.00 37.41  ? 168  LEU D CD2 1 
ATOM   7867  N  N   . CYS D  1 169 ? -4.893  82.012  129.750 1.00 53.99  ? 169  CYS D N   1 
ATOM   7868  C  CA  . CYS D  1 169 ? -5.785  81.214  130.568 1.00 58.08  ? 169  CYS D CA  1 
ATOM   7869  C  C   . CYS D  1 169 ? -7.206  81.351  130.010 1.00 59.56  ? 169  CYS D C   1 
ATOM   7870  O  O   . CYS D  1 169 ? -7.964  80.382  129.965 1.00 60.01  ? 169  CYS D O   1 
ATOM   7871  C  CB  . CYS D  1 169 ? -5.723  81.695  132.022 1.00 59.63  ? 169  CYS D CB  1 
ATOM   7872  S  SG  . CYS D  1 169 ? -6.603  80.630  133.192 1.00 67.52  ? 169  CYS D SG  1 
ATOM   7873  N  N   . HIS D  1 170 ? -7.553  82.559  129.572 1.00 59.73  ? 170  HIS D N   1 
ATOM   7874  C  CA  . HIS D  1 170 ? -8.869  82.824  129.004 1.00 58.64  ? 170  HIS D CA  1 
ATOM   7875  C  C   . HIS D  1 170 ? -8.991  82.283  127.590 1.00 57.09  ? 170  HIS D C   1 
ATOM   7876  O  O   . HIS D  1 170 ? -10.014 82.473  126.947 1.00 60.17  ? 170  HIS D O   1 
ATOM   7877  C  CB  . HIS D  1 170 ? -9.151  84.324  129.002 1.00 61.60  ? 170  HIS D CB  1 
ATOM   7878  C  CG  . HIS D  1 170 ? -9.244  84.914  130.373 1.00 68.08  ? 170  HIS D CG  1 
ATOM   7879  N  ND1 . HIS D  1 170 ? -9.384  86.267  130.596 1.00 68.44  ? 170  HIS D ND1 1 
ATOM   7880  C  CD2 . HIS D  1 170 ? -9.219  84.332  131.596 1.00 69.88  ? 170  HIS D CD2 1 
ATOM   7881  C  CE1 . HIS D  1 170 ? -9.439  86.493  131.897 1.00 69.26  ? 170  HIS D CE1 1 
ATOM   7882  N  NE2 . HIS D  1 170 ? -9.341  85.335  132.526 1.00 70.12  ? 170  HIS D NE2 1 
ATOM   7883  N  N   . LEU D  1 171 ? -7.940  81.634  127.099 1.00 54.63  ? 171  LEU D N   1 
ATOM   7884  C  CA  . LEU D  1 171 ? -7.958  81.035  125.763 1.00 52.23  ? 171  LEU D CA  1 
ATOM   7885  C  C   . LEU D  1 171 ? -7.902  79.540  125.954 1.00 49.97  ? 171  LEU D C   1 
ATOM   7886  O  O   . LEU D  1 171 ? -7.977  78.787  124.992 1.00 49.15  ? 171  LEU D O   1 
ATOM   7887  C  CB  . LEU D  1 171 ? -6.751  81.461  124.922 1.00 52.68  ? 171  LEU D CB  1 
ATOM   7888  C  CG  . LEU D  1 171 ? -6.705  82.882  124.361 1.00 53.76  ? 171  LEU D CG  1 
ATOM   7889  C  CD1 . LEU D  1 171 ? -5.485  83.029  123.454 1.00 52.03  ? 171  LEU D CD1 1 
ATOM   7890  C  CD2 . LEU D  1 171 ? -7.975  83.166  123.584 1.00 50.93  ? 171  LEU D CD2 1 
ATOM   7891  N  N   . ASN D  1 172 ? -7.741  79.138  127.211 1.00 48.68  ? 172  ASN D N   1 
ATOM   7892  C  CA  . ASN D  1 172 ? -7.671  77.740  127.623 1.00 51.74  ? 172  ASN D CA  1 
ATOM   7893  C  C   . ASN D  1 172 ? -6.357  76.988  127.393 1.00 51.22  ? 172  ASN D C   1 
ATOM   7894  O  O   . ASN D  1 172 ? -6.313  75.751  127.470 1.00 50.96  ? 172  ASN D O   1 
ATOM   7895  C  CB  . ASN D  1 172 ? -8.826  76.943  127.014 1.00 54.96  ? 172  ASN D CB  1 
ATOM   7896  C  CG  . ASN D  1 172 ? -9.909  76.658  128.019 1.00 55.59  ? 172  ASN D CG  1 
ATOM   7897  O  OD1 . ASN D  1 172 ? -11.002 77.215  127.945 1.00 59.16  ? 172  ASN D OD1 1 
ATOM   7898  N  ND2 . ASN D  1 172 ? -9.605  75.793  128.985 1.00 55.46  ? 172  ASN D ND2 1 
ATOM   7899  N  N   . VAL D  1 173 ? -5.290  77.725  127.121 1.00 48.12  ? 173  VAL D N   1 
ATOM   7900  C  CA  . VAL D  1 173 ? -3.985  77.109  126.930 1.00 46.81  ? 173  VAL D CA  1 
ATOM   7901  C  C   . VAL D  1 173 ? -3.311  77.016  128.306 1.00 45.24  ? 173  VAL D C   1 
ATOM   7902  O  O   . VAL D  1 173 ? -3.350  77.962  129.094 1.00 44.62  ? 173  VAL D O   1 
ATOM   7903  C  CB  . VAL D  1 173 ? -3.125  77.945  125.921 1.00 48.74  ? 173  VAL D CB  1 
ATOM   7904  C  CG1 . VAL D  1 173 ? -3.677  79.358  125.829 1.00 48.79  ? 173  VAL D CG1 1 
ATOM   7905  C  CG2 . VAL D  1 173 ? -1.651  77.968  126.336 1.00 45.03  ? 173  VAL D CG2 1 
ATOM   7906  N  N   . PRO D  1 174 ? -2.713  75.857  128.627 1.00 44.07  ? 174  PRO D N   1 
ATOM   7907  C  CA  . PRO D  1 174 ? -2.061  75.739  129.935 1.00 42.30  ? 174  PRO D CA  1 
ATOM   7908  C  C   . PRO D  1 174 ? -0.914  76.749  129.996 1.00 43.43  ? 174  PRO D C   1 
ATOM   7909  O  O   . PRO D  1 174 ? -0.122  76.850  129.057 1.00 43.06  ? 174  PRO D O   1 
ATOM   7910  C  CB  . PRO D  1 174 ? -1.547  74.296  129.950 1.00 40.58  ? 174  PRO D CB  1 
ATOM   7911  C  CG  . PRO D  1 174 ? -2.360  73.597  128.891 1.00 40.00  ? 174  PRO D CG  1 
ATOM   7912  C  CD  . PRO D  1 174 ? -2.523  74.636  127.826 1.00 41.11  ? 174  PRO D CD  1 
ATOM   7913  N  N   . VAL D  1 175 ? -0.828  77.497  131.089 1.00 40.97  ? 175  VAL D N   1 
ATOM   7914  C  CA  . VAL D  1 175 ? 0.225   78.484  131.237 1.00 39.26  ? 175  VAL D CA  1 
ATOM   7915  C  C   . VAL D  1 175 ? 0.713   78.535  132.680 1.00 40.53  ? 175  VAL D C   1 
ATOM   7916  O  O   . VAL D  1 175 ? -0.080  78.543  133.619 1.00 38.97  ? 175  VAL D O   1 
ATOM   7917  C  CB  . VAL D  1 175 ? -0.272  79.884  130.818 1.00 38.73  ? 175  VAL D CB  1 
ATOM   7918  C  CG1 . VAL D  1 175 ? -1.531  80.234  131.592 1.00 37.53  ? 175  VAL D CG1 1 
ATOM   7919  C  CG2 . VAL D  1 175 ? 0.806   80.928  131.071 1.00 31.11  ? 175  VAL D CG2 1 
ATOM   7920  N  N   . THR D  1 176 ? 2.030   78.564  132.843 1.00 40.09  ? 176  THR D N   1 
ATOM   7921  C  CA  . THR D  1 176 ? 2.649   78.638  134.163 1.00 39.02  ? 176  THR D CA  1 
ATOM   7922  C  C   . THR D  1 176 ? 3.459   79.942  134.249 1.00 39.19  ? 176  THR D C   1 
ATOM   7923  O  O   . THR D  1 176 ? 4.202   80.267  133.321 1.00 42.22  ? 176  THR D O   1 
ATOM   7924  C  CB  . THR D  1 176 ? 3.629   77.451  134.402 1.00 38.40  ? 176  THR D CB  1 
ATOM   7925  O  OG1 . THR D  1 176 ? 2.909   76.211  134.475 1.00 34.74  ? 176  THR D OG1 1 
ATOM   7926  C  CG2 . THR D  1 176 ? 4.396   77.667  135.692 1.00 36.99  ? 176  THR D CG2 1 
ATOM   7927  N  N   . VAL D  1 177 ? 3.313   80.697  135.338 1.00 35.53  ? 177  VAL D N   1 
ATOM   7928  C  CA  . VAL D  1 177 ? 4.090   81.927  135.490 1.00 29.43  ? 177  VAL D CA  1 
ATOM   7929  C  C   . VAL D  1 177 ? 5.358   81.622  136.287 1.00 26.72  ? 177  VAL D C   1 
ATOM   7930  O  O   . VAL D  1 177 ? 5.327   80.867  137.250 1.00 29.05  ? 177  VAL D O   1 
ATOM   7931  C  CB  . VAL D  1 177 ? 3.293   83.040  136.223 1.00 28.82  ? 177  VAL D CB  1 
ATOM   7932  C  CG1 . VAL D  1 177 ? 4.183   84.262  136.435 1.00 25.99  ? 177  VAL D CG1 1 
ATOM   7933  C  CG2 . VAL D  1 177 ? 2.066   83.434  135.398 1.00 30.41  ? 177  VAL D CG2 1 
ATOM   7934  N  N   . VAL D  1 178 ? 6.478   82.192  135.871 1.00 24.57  ? 178  VAL D N   1 
ATOM   7935  C  CA  . VAL D  1 178 ? 7.729   81.976  136.579 1.00 24.70  ? 178  VAL D CA  1 
ATOM   7936  C  C   . VAL D  1 178 ? 8.463   83.298  136.754 1.00 28.01  ? 178  VAL D C   1 
ATOM   7937  O  O   . VAL D  1 178 ? 8.283   84.244  135.968 1.00 27.09  ? 178  VAL D O   1 
ATOM   7938  C  CB  . VAL D  1 178 ? 8.654   80.983  135.831 1.00 26.23  ? 178  VAL D CB  1 
ATOM   7939  C  CG1 . VAL D  1 178 ? 7.883   79.689  135.550 1.00 27.08  ? 178  VAL D CG1 1 
ATOM   7940  C  CG2 . VAL D  1 178 ? 9.182   81.608  134.522 1.00 22.87  ? 178  VAL D CG2 1 
ATOM   7941  N  N   . LEU D  1 179 ? 9.271   83.353  137.807 1.00 29.38  ? 179  LEU D N   1 
ATOM   7942  C  CA  . LEU D  1 179 ? 10.075  84.520  138.145 1.00 30.46  ? 179  LEU D CA  1 
ATOM   7943  C  C   . LEU D  1 179 ? 11.118  84.776  137.055 1.00 31.54  ? 179  LEU D C   1 
ATOM   7944  O  O   . LEU D  1 179 ? 11.650  83.828  136.464 1.00 31.24  ? 179  LEU D O   1 
ATOM   7945  C  CB  . LEU D  1 179 ? 10.785  84.259  139.476 1.00 31.15  ? 179  LEU D CB  1 
ATOM   7946  C  CG  . LEU D  1 179 ? 10.340  85.029  140.725 1.00 34.66  ? 179  LEU D CG  1 
ATOM   7947  C  CD1 . LEU D  1 179 ? 8.841   85.267  140.714 1.00 30.92  ? 179  LEU D CD1 1 
ATOM   7948  C  CD2 . LEU D  1 179 ? 10.775  84.241  141.967 1.00 36.60  ? 179  LEU D CD2 1 
ATOM   7949  N  N   . ASP D  1 180 ? 11.413  86.052  136.800 1.00 32.38  ? 180  ASP D N   1 
ATOM   7950  C  CA  . ASP D  1 180 ? 12.409  86.440  135.798 1.00 30.83  ? 180  ASP D CA  1 
ATOM   7951  C  C   . ASP D  1 180 ? 13.730  85.723  136.078 1.00 30.31  ? 180  ASP D C   1 
ATOM   7952  O  O   . ASP D  1 180 ? 14.507  85.452  135.173 1.00 31.11  ? 180  ASP D O   1 
ATOM   7953  C  CB  . ASP D  1 180 ? 12.669  87.949  135.838 1.00 36.72  ? 180  ASP D CB  1 
ATOM   7954  C  CG  . ASP D  1 180 ? 11.392  88.779  135.810 1.00 42.28  ? 180  ASP D CG  1 
ATOM   7955  O  OD1 . ASP D  1 180 ? 10.624  88.661  134.829 1.00 44.62  ? 180  ASP D OD1 1 
ATOM   7956  O  OD2 . ASP D  1 180 ? 11.168  89.557  136.773 1.00 42.99  ? 180  ASP D OD2 1 
ATOM   7957  N  N   . ALA D  1 181 ? 13.970  85.417  137.345 1.00 30.36  ? 181  ALA D N   1 
ATOM   7958  C  CA  . ALA D  1 181 ? 15.187  84.732  137.771 1.00 28.86  ? 181  ALA D CA  1 
ATOM   7959  C  C   . ALA D  1 181 ? 15.205  83.222  137.495 1.00 27.78  ? 181  ALA D C   1 
ATOM   7960  O  O   . ALA D  1 181 ? 16.236  82.566  137.694 1.00 25.52  ? 181  ALA D O   1 
ATOM   7961  C  CB  . ALA D  1 181 ? 15.417  84.985  139.277 1.00 22.52  ? 181  ALA D CB  1 
ATOM   7962  N  N   . ALA D  1 182 ? 14.088  82.669  137.028 1.00 26.31  ? 182  ALA D N   1 
ATOM   7963  C  CA  . ALA D  1 182 ? 14.038  81.233  136.804 1.00 30.38  ? 182  ALA D CA  1 
ATOM   7964  C  C   . ALA D  1 182 ? 14.044  80.802  135.342 1.00 31.05  ? 182  ALA D C   1 
ATOM   7965  O  O   . ALA D  1 182 ? 13.613  79.691  134.998 1.00 32.96  ? 182  ALA D O   1 
ATOM   7966  C  CB  . ALA D  1 182 ? 12.822  80.647  137.526 1.00 29.28  ? 182  ALA D CB  1 
ATOM   7967  N  N   . VAL D  1 183 ? 14.544  81.669  134.477 1.00 28.24  ? 183  VAL D N   1 
ATOM   7968  C  CA  . VAL D  1 183 ? 14.584  81.340  133.069 1.00 28.40  ? 183  VAL D CA  1 
ATOM   7969  C  C   . VAL D  1 183 ? 15.630  80.275  132.799 1.00 30.90  ? 183  VAL D C   1 
ATOM   7970  O  O   . VAL D  1 183 ? 15.343  79.282  132.124 1.00 29.24  ? 183  VAL D O   1 
ATOM   7971  C  CB  . VAL D  1 183 ? 14.861  82.580  132.237 1.00 27.40  ? 183  VAL D CB  1 
ATOM   7972  C  CG1 . VAL D  1 183 ? 15.246  82.190  130.839 1.00 25.84  ? 183  VAL D CG1 1 
ATOM   7973  C  CG2 . VAL D  1 183 ? 13.633  83.461  132.231 1.00 25.61  ? 183  VAL D CG2 1 
ATOM   7974  N  N   . GLY D  1 184 ? 16.835  80.474  133.337 1.00 32.10  ? 184  GLY D N   1 
ATOM   7975  C  CA  . GLY D  1 184 ? 17.892  79.500  133.146 1.00 30.09  ? 184  GLY D CA  1 
ATOM   7976  C  C   . GLY D  1 184 ? 17.468  78.168  133.731 1.00 30.56  ? 184  GLY D C   1 
ATOM   7977  O  O   . GLY D  1 184 ? 17.760  77.101  133.191 1.00 33.50  ? 184  GLY D O   1 
ATOM   7978  N  N   . TYR D  1 185 ? 16.761  78.243  134.847 1.00 30.16  ? 185  TYR D N   1 
ATOM   7979  C  CA  . TYR D  1 185 ? 16.269  77.074  135.555 1.00 29.76  ? 185  TYR D CA  1 
ATOM   7980  C  C   . TYR D  1 185 ? 15.179  76.361  134.776 1.00 30.56  ? 185  TYR D C   1 
ATOM   7981  O  O   . TYR D  1 185 ? 15.147  75.133  134.701 1.00 32.16  ? 185  TYR D O   1 
ATOM   7982  C  CB  . TYR D  1 185 ? 15.712  77.506  136.919 1.00 26.27  ? 185  TYR D CB  1 
ATOM   7983  C  CG  . TYR D  1 185 ? 14.844  76.464  137.592 1.00 25.03  ? 185  TYR D CG  1 
ATOM   7984  C  CD1 . TYR D  1 185 ? 15.391  75.486  138.408 1.00 20.44  ? 185  TYR D CD1 1 
ATOM   7985  C  CD2 . TYR D  1 185 ? 13.460  76.460  137.394 1.00 27.32  ? 185  TYR D CD2 1 
ATOM   7986  C  CE1 . TYR D  1 185 ? 14.581  74.528  139.013 1.00 22.74  ? 185  TYR D CE1 1 
ATOM   7987  C  CE2 . TYR D  1 185 ? 12.648  75.522  137.984 1.00 22.12  ? 185  TYR D CE2 1 
ATOM   7988  C  CZ  . TYR D  1 185 ? 13.209  74.559  138.795 1.00 26.64  ? 185  TYR D CZ  1 
ATOM   7989  O  OH  . TYR D  1 185 ? 12.377  73.649  139.401 1.00 28.34  ? 185  TYR D OH  1 
ATOM   7990  N  N   . ILE D  1 186 ? 14.280  77.147  134.204 1.00 31.62  ? 186  ILE D N   1 
ATOM   7991  C  CA  . ILE D  1 186 ? 13.157  76.600  133.469 1.00 34.23  ? 186  ILE D CA  1 
ATOM   7992  C  C   . ILE D  1 186 ? 13.476  76.203  132.028 1.00 35.42  ? 186  ILE D C   1 
ATOM   7993  O  O   . ILE D  1 186 ? 12.811  75.339  131.473 1.00 36.35  ? 186  ILE D O   1 
ATOM   7994  C  CB  . ILE D  1 186 ? 11.961  77.611  133.486 1.00 33.54  ? 186  ILE D CB  1 
ATOM   7995  C  CG1 . ILE D  1 186 ? 10.635  76.866  133.337 1.00 35.85  ? 186  ILE D CG1 1 
ATOM   7996  C  CG2 . ILE D  1 186 ? 12.074  78.601  132.340 1.00 31.51  ? 186  ILE D CG2 1 
ATOM   7997  C  CD1 . ILE D  1 186 ? 10.321  75.929  134.488 1.00 32.58  ? 186  ILE D CD1 1 
HETATM 7998  N  N   . MSE D  1 187 ? 14.497  76.820  131.434 1.00 37.89  ? 187  MSE D N   1 
HETATM 7999  C  CA  . MSE D  1 187 ? 14.873  76.553  130.038 1.00 40.00  ? 187  MSE D CA  1 
HETATM 8000  C  C   . MSE D  1 187 ? 14.807  75.081  129.700 1.00 40.09  ? 187  MSE D C   1 
HETATM 8001  O  O   . MSE D  1 187 ? 14.346  74.690  128.629 1.00 39.32  ? 187  MSE D O   1 
HETATM 8002  C  CB  . MSE D  1 187 ? 16.287  77.077  129.740 1.00 40.91  ? 187  MSE D CB  1 
HETATM 8003  C  CG  . MSE D  1 187 ? 16.634  77.132  128.244 1.00 44.70  ? 187  MSE D CG  1 
HETATM 8004  SE SE  . MSE D  1 187 ? 15.392  78.252  127.219 1.00 50.32  ? 187  MSE D SE  1 
HETATM 8005  C  CE  . MSE D  1 187 ? 14.267  76.844  126.558 1.00 53.07  ? 187  MSE D CE  1 
ATOM   8006  N  N   . GLU D  1 188 ? 15.288  74.283  130.641 1.00 41.39  ? 188  GLU D N   1 
ATOM   8007  C  CA  . GLU D  1 188 ? 15.322  72.831  130.554 1.00 41.32  ? 188  GLU D CA  1 
ATOM   8008  C  C   . GLU D  1 188 ? 13.989  72.240  130.060 1.00 39.34  ? 188  GLU D C   1 
ATOM   8009  O  O   . GLU D  1 188 ? 13.967  71.392  129.161 1.00 40.42  ? 188  GLU D O   1 
ATOM   8010  C  CB  . GLU D  1 188 ? 15.680  72.314  131.950 1.00 45.01  ? 188  GLU D CB  1 
ATOM   8011  C  CG  . GLU D  1 188 ? 15.728  70.833  132.151 1.00 48.73  ? 188  GLU D CG  1 
ATOM   8012  C  CD  . GLU D  1 188 ? 16.099  70.485  133.590 1.00 53.06  ? 188  GLU D CD  1 
ATOM   8013  O  OE1 . GLU D  1 188 ? 17.262  70.752  133.991 1.00 51.17  ? 188  GLU D OE1 1 
ATOM   8014  O  OE2 . GLU D  1 188 ? 15.222  69.956  134.315 1.00 49.69  ? 188  GLU D OE2 1 
ATOM   8015  N  N   . LYS D  1 189 ? 12.883  72.713  130.627 1.00 35.51  ? 189  LYS D N   1 
ATOM   8016  C  CA  . LYS D  1 189 ? 11.552  72.230  130.271 1.00 34.98  ? 189  LYS D CA  1 
ATOM   8017  C  C   . LYS D  1 189 ? 10.957  72.735  128.949 1.00 35.00  ? 189  LYS D C   1 
ATOM   8018  O  O   . LYS D  1 189 ? 9.901   72.259  128.523 1.00 36.02  ? 189  LYS D O   1 
ATOM   8019  C  CB  . LYS D  1 189 ? 10.571  72.565  131.388 1.00 36.20  ? 189  LYS D CB  1 
ATOM   8020  C  CG  . LYS D  1 189 ? 10.947  72.038  132.745 1.00 38.81  ? 189  LYS D CG  1 
ATOM   8021  C  CD  . LYS D  1 189 ? 9.895   72.465  133.752 1.00 44.84  ? 189  LYS D CD  1 
ATOM   8022  C  CE  . LYS D  1 189 ? 10.220  71.988  135.160 1.00 48.68  ? 189  LYS D CE  1 
ATOM   8023  N  NZ  . LYS D  1 189 ? 9.165   72.428  136.128 1.00 49.69  ? 189  LYS D NZ  1 
ATOM   8024  N  N   . ALA D  1 190 ? 11.612  73.686  128.295 1.00 33.48  ? 190  ALA D N   1 
ATOM   8025  C  CA  . ALA D  1 190 ? 11.081  74.213  127.046 1.00 31.56  ? 190  ALA D CA  1 
ATOM   8026  C  C   . ALA D  1 190 ? 11.659  73.583  125.785 1.00 34.65  ? 190  ALA D C   1 
ATOM   8027  O  O   . ALA D  1 190 ? 12.768  73.044  125.779 1.00 35.58  ? 190  ALA D O   1 
ATOM   8028  C  CB  . ALA D  1 190 ? 11.273  75.711  126.998 1.00 26.54  ? 190  ALA D CB  1 
ATOM   8029  N  N   . ASP D  1 191 ? 10.878  73.670  124.712 1.00 36.58  ? 191  ASP D N   1 
ATOM   8030  C  CA  . ASP D  1 191 ? 11.253  73.149  123.406 1.00 35.04  ? 191  ASP D CA  1 
ATOM   8031  C  C   . ASP D  1 191 ? 11.705  74.312  122.522 1.00 34.63  ? 191  ASP D C   1 
ATOM   8032  O  O   . ASP D  1 191 ? 12.513  74.146  121.601 1.00 33.56  ? 191  ASP D O   1 
ATOM   8033  C  CB  . ASP D  1 191 ? 10.051  72.458  122.761 1.00 38.35  ? 191  ASP D CB  1 
ATOM   8034  C  CG  . ASP D  1 191 ? 9.653   71.183  123.480 1.00 42.57  ? 191  ASP D CG  1 
ATOM   8035  O  OD1 . ASP D  1 191 ? 10.550  70.332  123.683 1.00 44.45  ? 191  ASP D OD1 1 
ATOM   8036  O  OD2 . ASP D  1 191 ? 8.453   71.029  123.828 1.00 39.66  ? 191  ASP D OD2 1 
ATOM   8037  N  N   . LEU D  1 192 ? 11.170  75.494  122.806 1.00 32.33  ? 192  LEU D N   1 
ATOM   8038  C  CA  . LEU D  1 192 ? 11.512  76.672  122.036 1.00 32.33  ? 192  LEU D CA  1 
ATOM   8039  C  C   . LEU D  1 192 ? 11.050  77.946  122.731 1.00 30.99  ? 192  LEU D C   1 
ATOM   8040  O  O   . LEU D  1 192 ? 10.212  77.904  123.620 1.00 32.28  ? 192  LEU D O   1 
ATOM   8041  C  CB  . LEU D  1 192 ? 10.903  76.585  120.619 1.00 32.56  ? 192  LEU D CB  1 
ATOM   8042  C  CG  . LEU D  1 192 ? 9.384   76.636  120.393 1.00 32.28  ? 192  LEU D CG  1 
ATOM   8043  C  CD1 . LEU D  1 192 ? 9.123   76.732  118.909 1.00 28.20  ? 192  LEU D CD1 1 
ATOM   8044  C  CD2 . LEU D  1 192 ? 8.703   75.402  120.976 1.00 31.40  ? 192  LEU D CD2 1 
ATOM   8045  N  N   . VAL D  1 193 ? 11.629  79.072  122.319 1.00 29.61  ? 193  VAL D N   1 
ATOM   8046  C  CA  . VAL D  1 193 ? 11.311  80.376  122.863 1.00 28.99  ? 193  VAL D CA  1 
ATOM   8047  C  C   . VAL D  1 193 ? 10.683  81.239  121.786 1.00 32.66  ? 193  VAL D C   1 
ATOM   8048  O  O   . VAL D  1 193 ? 11.207  81.328  120.669 1.00 35.45  ? 193  VAL D O   1 
ATOM   8049  C  CB  . VAL D  1 193 ? 12.563  81.109  123.328 1.00 29.49  ? 193  VAL D CB  1 
ATOM   8050  C  CG1 . VAL D  1 193 ? 12.192  82.504  123.763 1.00 27.31  ? 193  VAL D CG1 1 
ATOM   8051  C  CG2 . VAL D  1 193 ? 13.231  80.351  124.449 1.00 29.29  ? 193  VAL D CG2 1 
ATOM   8052  N  N   . ILE D  1 194 ? 9.565   81.875  122.116 1.00 29.92  ? 194  ILE D N   1 
ATOM   8053  C  CA  . ILE D  1 194 ? 8.898   82.755  121.171 1.00 28.52  ? 194  ILE D CA  1 
ATOM   8054  C  C   . ILE D  1 194 ? 8.696   84.062  121.889 1.00 28.86  ? 194  ILE D C   1 
ATOM   8055  O  O   . ILE D  1 194 ? 7.961   84.135  122.874 1.00 28.59  ? 194  ILE D O   1 
ATOM   8056  C  CB  . ILE D  1 194 ? 7.538   82.200  120.721 1.00 30.98  ? 194  ILE D CB  1 
ATOM   8057  C  CG1 . ILE D  1 194 ? 7.756   80.963  119.854 1.00 31.06  ? 194  ILE D CG1 1 
ATOM   8058  C  CG2 . ILE D  1 194 ? 6.767   83.251  119.935 1.00 22.36  ? 194  ILE D CG2 1 
ATOM   8059  C  CD1 . ILE D  1 194 ? 6.463   80.293  119.446 1.00 36.89  ? 194  ILE D CD1 1 
ATOM   8060  N  N   . VAL D  1 195 ? 9.350   85.098  121.380 1.00 28.31  ? 195  VAL D N   1 
ATOM   8061  C  CA  . VAL D  1 195 ? 9.290   86.418  121.986 1.00 27.41  ? 195  VAL D CA  1 
ATOM   8062  C  C   . VAL D  1 195 ? 8.994   87.476  120.920 1.00 26.72  ? 195  VAL D C   1 
ATOM   8063  O  O   . VAL D  1 195 ? 9.305   87.280  119.749 1.00 27.17  ? 195  VAL D O   1 
ATOM   8064  C  CB  . VAL D  1 195 ? 10.633  86.720  122.683 1.00 25.57  ? 195  VAL D CB  1 
ATOM   8065  C  CG1 . VAL D  1 195 ? 11.721  86.908  121.641 1.00 27.40  ? 195  VAL D CG1 1 
ATOM   8066  C  CG2 . VAL D  1 195 ? 10.522  87.928  123.519 1.00 30.11  ? 195  VAL D CG2 1 
ATOM   8067  N  N   . GLY D  1 196 ? 8.366   88.582  121.326 1.00 27.59  ? 196  GLY D N   1 
ATOM   8068  C  CA  . GLY D  1 196 ? 8.059   89.653  120.393 1.00 24.10  ? 196  GLY D CA  1 
ATOM   8069  C  C   . GLY D  1 196 ? 9.220   90.639  120.365 1.00 28.01  ? 196  GLY D C   1 
ATOM   8070  O  O   . GLY D  1 196 ? 10.297  90.352  120.883 1.00 27.06  ? 196  GLY D O   1 
ATOM   8071  N  N   . ALA D  1 197 ? 9.020   91.804  119.760 1.00 27.66  ? 197  ALA D N   1 
ATOM   8072  C  CA  . ALA D  1 197 ? 10.078  92.800  119.707 1.00 25.95  ? 197  ALA D CA  1 
ATOM   8073  C  C   . ALA D  1 197 ? 9.524   94.218  119.651 1.00 24.84  ? 197  ALA D C   1 
ATOM   8074  O  O   . ALA D  1 197 ? 8.516   94.482  119.025 1.00 24.55  ? 197  ALA D O   1 
ATOM   8075  C  CB  . ALA D  1 197 ? 10.982  92.542  118.503 1.00 24.02  ? 197  ALA D CB  1 
ATOM   8076  N  N   . GLU D  1 198 ? 10.190  95.130  120.330 1.00 26.68  ? 198  GLU D N   1 
ATOM   8077  C  CA  . GLU D  1 198 ? 9.777   96.513  120.307 1.00 29.51  ? 198  GLU D CA  1 
ATOM   8078  C  C   . GLU D  1 198 ? 10.387  97.131  119.040 1.00 30.02  ? 198  GLU D C   1 
ATOM   8079  O  O   . GLU D  1 198 ? 9.862   98.091  118.476 1.00 28.38  ? 198  GLU D O   1 
ATOM   8080  C  CB  . GLU D  1 198 ? 10.305  97.209  121.548 1.00 33.35  ? 198  GLU D CB  1 
ATOM   8081  C  CG  . GLU D  1 198 ? 9.256   97.975  122.329 1.00 43.06  ? 198  GLU D CG  1 
ATOM   8082  C  CD  . GLU D  1 198 ? 9.813   98.524  123.632 1.00 47.48  ? 198  GLU D CD  1 
ATOM   8083  O  OE1 . GLU D  1 198 ? 9.985   97.718  124.576 1.00 47.06  ? 198  GLU D OE1 1 
ATOM   8084  O  OE2 . GLU D  1 198 ? 10.095  99.751  123.699 1.00 50.12  ? 198  GLU D OE2 1 
ATOM   8085  N  N   . GLY D  1 199 ? 11.503  96.548  118.600 1.00 29.83  ? 199  GLY D N   1 
ATOM   8086  C  CA  . GLY D  1 199 ? 12.191  97.021  117.418 1.00 24.03  ? 199  GLY D CA  1 
ATOM   8087  C  C   . GLY D  1 199 ? 13.161  95.991  116.865 1.00 25.56  ? 199  GLY D C   1 
ATOM   8088  O  O   . GLY D  1 199 ? 13.722  95.179  117.601 1.00 25.94  ? 199  GLY D O   1 
ATOM   8089  N  N   . VAL D  1 200 ? 13.339  96.006  115.551 1.00 24.39  ? 200  VAL D N   1 
ATOM   8090  C  CA  . VAL D  1 200 ? 14.258  95.106  114.884 1.00 22.40  ? 200  VAL D CA  1 
ATOM   8091  C  C   . VAL D  1 200 ? 15.310  96.021  114.277 1.00 25.03  ? 200  VAL D C   1 
ATOM   8092  O  O   . VAL D  1 200 ? 14.987  96.905  113.481 1.00 24.38  ? 200  VAL D O   1 
ATOM   8093  C  CB  . VAL D  1 200 ? 13.564  94.299  113.761 1.00 21.29  ? 200  VAL D CB  1 
ATOM   8094  C  CG1 . VAL D  1 200 ? 14.585  93.456  113.009 1.00 22.78  ? 200  VAL D CG1 1 
ATOM   8095  C  CG2 . VAL D  1 200 ? 12.503  93.391  114.347 1.00 20.99  ? 200  VAL D CG2 1 
ATOM   8096  N  N   . VAL D  1 201 ? 16.568  95.817  114.661 1.00 25.94  ? 201  VAL D N   1 
ATOM   8097  C  CA  . VAL D  1 201 ? 17.653  96.645  114.152 1.00 25.62  ? 201  VAL D CA  1 
ATOM   8098  C  C   . VAL D  1 201 ? 18.259  96.103  112.857 1.00 26.65  ? 201  VAL D C   1 
ATOM   8099  O  O   . VAL D  1 201 ? 18.029  94.953  112.476 1.00 27.10  ? 201  VAL D O   1 
ATOM   8100  C  CB  . VAL D  1 201 ? 18.741  96.825  115.224 1.00 28.11  ? 201  VAL D CB  1 
ATOM   8101  C  CG1 . VAL D  1 201 ? 18.146  97.591  116.406 1.00 26.68  ? 201  VAL D CG1 1 
ATOM   8102  C  CG2 . VAL D  1 201 ? 19.287  95.459  115.683 1.00 24.52  ? 201  VAL D CG2 1 
ATOM   8103  N  N   . GLU D  1 202 ? 19.033  96.949  112.188 1.00 25.17  ? 202  GLU D N   1 
ATOM   8104  C  CA  . GLU D  1 202 ? 19.643  96.610  110.915 1.00 27.38  ? 202  GLU D CA  1 
ATOM   8105  C  C   . GLU D  1 202 ? 20.471  95.313  110.874 1.00 28.64  ? 202  GLU D C   1 
ATOM   8106  O  O   . GLU D  1 202 ? 20.483  94.610  109.848 1.00 22.07  ? 202  GLU D O   1 
ATOM   8107  C  CB  . GLU D  1 202 ? 20.464  97.812  110.420 1.00 30.37  ? 202  GLU D CB  1 
ATOM   8108  C  CG  . GLU D  1 202 ? 19.603  99.038  110.142 1.00 35.25  ? 202  GLU D CG  1 
ATOM   8109  C  CD  . GLU D  1 202 ? 20.389  100.348 110.166 1.00 45.64  ? 202  GLU D CD  1 
ATOM   8110  O  OE1 . GLU D  1 202 ? 21.077  100.633 111.172 1.00 48.81  ? 202  GLU D OE1 1 
ATOM   8111  O  OE2 . GLU D  1 202 ? 20.311  101.112 109.181 1.00 51.82  ? 202  GLU D OE2 1 
ATOM   8112  N  N   . ASN D  1 203 ? 21.152  94.969  111.965 1.00 25.24  ? 203  ASN D N   1 
ATOM   8113  C  CA  . ASN D  1 203 ? 21.912  93.733  111.922 1.00 25.57  ? 203  ASN D CA  1 
ATOM   8114  C  C   . ASN D  1 203 ? 21.081  92.466  112.187 1.00 25.51  ? 203  ASN D C   1 
ATOM   8115  O  O   . ASN D  1 203 ? 21.618  91.357  112.196 1.00 25.43  ? 203  ASN D O   1 
ATOM   8116  C  CB  . ASN D  1 203 ? 23.117  93.802  112.867 1.00 28.24  ? 203  ASN D CB  1 
ATOM   8117  C  CG  . ASN D  1 203 ? 22.742  94.170  114.293 1.00 31.25  ? 203  ASN D CG  1 
ATOM   8118  O  OD1 . ASN D  1 203 ? 21.765  93.656  114.863 1.00 27.21  ? 203  ASN D OD1 1 
ATOM   8119  N  ND2 . ASN D  1 203 ? 23.540  95.052  114.889 1.00 26.68  ? 203  ASN D ND2 1 
ATOM   8120  N  N   . GLY D  1 204 ? 19.773  92.622  112.380 1.00 24.64  ? 204  GLY D N   1 
ATOM   8121  C  CA  . GLY D  1 204 ? 18.930  91.463  112.624 1.00 21.36  ? 204  GLY D CA  1 
ATOM   8122  C  C   . GLY D  1 204 ? 18.620  91.252  114.091 1.00 21.92  ? 204  GLY D C   1 
ATOM   8123  O  O   . GLY D  1 204 ? 17.770  90.440  114.454 1.00 19.91  ? 204  GLY D O   1 
ATOM   8124  N  N   . GLY D  1 205 ? 19.329  91.983  114.944 1.00 25.21  ? 205  GLY D N   1 
ATOM   8125  C  CA  . GLY D  1 205 ? 19.102  91.893  116.376 1.00 23.68  ? 205  GLY D CA  1 
ATOM   8126  C  C   . GLY D  1 205 ? 17.792  92.577  116.732 1.00 22.99  ? 205  GLY D C   1 
ATOM   8127  O  O   . GLY D  1 205 ? 17.115  93.139  115.875 1.00 18.98  ? 205  GLY D O   1 
ATOM   8128  N  N   . ILE D  1 206 ? 17.422  92.537  118.002 1.00 24.30  ? 206  ILE D N   1 
ATOM   8129  C  CA  . ILE D  1 206 ? 16.171  93.162  118.394 1.00 25.85  ? 206  ILE D CA  1 
ATOM   8130  C  C   . ILE D  1 206 ? 16.249  93.914  119.709 1.00 26.17  ? 206  ILE D C   1 
ATOM   8131  O  O   . ILE D  1 206 ? 17.076  93.615  120.568 1.00 28.63  ? 206  ILE D O   1 
ATOM   8132  C  CB  . ILE D  1 206 ? 15.061  92.108  118.499 1.00 24.07  ? 206  ILE D CB  1 
ATOM   8133  C  CG1 . ILE D  1 206 ? 15.317  91.204  119.711 1.00 24.42  ? 206  ILE D CG1 1 
ATOM   8134  C  CG2 . ILE D  1 206 ? 15.027  91.281  117.214 1.00 19.13  ? 206  ILE D CG2 1 
ATOM   8135  C  CD1 . ILE D  1 206 ? 14.069  90.509  120.255 1.00 17.48  ? 206  ILE D CD1 1 
ATOM   8136  N  N   . ILE D  1 207 ? 15.389  94.909  119.847 1.00 26.80  ? 207  ILE D N   1 
ATOM   8137  C  CA  . ILE D  1 207 ? 15.303  95.700  121.070 1.00 24.56  ? 207  ILE D CA  1 
ATOM   8138  C  C   . ILE D  1 207 ? 13.988  95.251  121.691 1.00 25.27  ? 207  ILE D C   1 
ATOM   8139  O  O   . ILE D  1 207 ? 12.948  95.270  121.028 1.00 24.05  ? 207  ILE D O   1 
ATOM   8140  C  CB  . ILE D  1 207 ? 15.256  97.200  120.742 1.00 22.76  ? 207  ILE D CB  1 
ATOM   8141  C  CG1 . ILE D  1 207 ? 16.612  97.639  120.194 1.00 21.24  ? 207  ILE D CG1 1 
ATOM   8142  C  CG2 . ILE D  1 207 ? 14.874  98.000  121.977 1.00 20.02  ? 207  ILE D CG2 1 
ATOM   8143  C  CD1 . ILE D  1 207 ? 16.601  99.010  119.549 1.00 21.84  ? 207  ILE D CD1 1 
ATOM   8144  N  N   . ASN D  1 208 ? 14.019  94.834  122.951 1.00 25.30  ? 208  ASN D N   1 
ATOM   8145  C  CA  . ASN D  1 208 ? 12.790  94.361  123.586 1.00 25.46  ? 208  ASN D CA  1 
ATOM   8146  C  C   . ASN D  1 208 ? 12.809  94.446  125.115 1.00 26.53  ? 208  ASN D C   1 
ATOM   8147  O  O   . ASN D  1 208 ? 13.846  94.758  125.715 1.00 28.33  ? 208  ASN D O   1 
ATOM   8148  C  CB  . ASN D  1 208 ? 12.540  92.922  123.137 1.00 24.50  ? 208  ASN D CB  1 
ATOM   8149  C  CG  . ASN D  1 208 ? 11.108  92.481  123.344 1.00 27.20  ? 208  ASN D CG  1 
ATOM   8150  O  OD1 . ASN D  1 208 ? 10.820  91.655  124.205 1.00 30.03  ? 208  ASN D OD1 1 
ATOM   8151  N  ND2 . ASN D  1 208 ? 10.204  93.024  122.548 1.00 25.68  ? 208  ASN D ND2 1 
ATOM   8152  N  N   . LYS D  1 209 ? 11.662  94.163  125.738 1.00 26.41  ? 209  LYS D N   1 
ATOM   8153  C  CA  . LYS D  1 209 ? 11.531  94.200  127.199 1.00 25.02  ? 209  LYS D CA  1 
ATOM   8154  C  C   . LYS D  1 209 ? 12.769  93.657  127.922 1.00 26.17  ? 209  LYS D C   1 
ATOM   8155  O  O   . LYS D  1 209 ? 13.230  92.543  127.650 1.00 20.71  ? 209  LYS D O   1 
ATOM   8156  C  CB  . LYS D  1 209 ? 10.318  93.397  127.651 1.00 23.62  ? 209  LYS D CB  1 
ATOM   8157  C  CG  . LYS D  1 209 ? 10.002  93.576  129.128 1.00 27.17  ? 209  LYS D CG  1 
ATOM   8158  C  CD  . LYS D  1 209 ? 9.540   94.988  129.424 1.00 28.43  ? 209  LYS D CD  1 
ATOM   8159  C  CE  . LYS D  1 209 ? 9.165   95.171  130.896 1.00 35.04  ? 209  LYS D CE  1 
ATOM   8160  N  NZ  . LYS D  1 209 ? 7.990   94.344  131.328 1.00 39.93  ? 209  LYS D NZ  1 
ATOM   8161  N  N   . ILE D  1 210 ? 13.289  94.447  128.856 1.00 24.05  ? 210  ILE D N   1 
ATOM   8162  C  CA  . ILE D  1 210 ? 14.476  94.055  129.589 1.00 22.70  ? 210  ILE D CA  1 
ATOM   8163  C  C   . ILE D  1 210 ? 14.233  92.647  130.104 1.00 21.94  ? 210  ILE D C   1 
ATOM   8164  O  O   . ILE D  1 210 ? 13.171  92.345  130.637 1.00 23.95  ? 210  ILE D O   1 
ATOM   8165  C  CB  . ILE D  1 210 ? 14.774  95.068  130.736 1.00 23.60  ? 210  ILE D CB  1 
ATOM   8166  C  CG1 . ILE D  1 210 ? 16.138  94.778  131.344 1.00 22.33  ? 210  ILE D CG1 1 
ATOM   8167  C  CG2 . ILE D  1 210 ? 13.660  95.056  131.772 1.00 22.83  ? 210  ILE D CG2 1 
ATOM   8168  C  CD1 . ILE D  1 210 ? 17.258  95.126  130.442 1.00 28.03  ? 210  ILE D CD1 1 
ATOM   8169  N  N   . GLY D  1 211 ? 15.206  91.775  129.892 1.00 22.30  ? 211  GLY D N   1 
ATOM   8170  C  CA  . GLY D  1 211 ? 15.068  90.395  130.309 1.00 20.05  ? 211  GLY D CA  1 
ATOM   8171  C  C   . GLY D  1 211 ? 15.164  89.491  129.094 1.00 23.82  ? 211  GLY D C   1 
ATOM   8172  O  O   . GLY D  1 211 ? 15.509  88.304  129.208 1.00 26.92  ? 211  GLY D O   1 
ATOM   8173  N  N   . THR D  1 212 ? 14.888  90.059  127.922 1.00 21.80  ? 212  THR D N   1 
ATOM   8174  C  CA  . THR D  1 212 ? 14.923  89.308  126.680 1.00 23.18  ? 212  THR D CA  1 
ATOM   8175  C  C   . THR D  1 212 ? 16.294  88.721  126.398 1.00 27.43  ? 212  THR D C   1 
ATOM   8176  O  O   . THR D  1 212 ? 16.399  87.534  126.126 1.00 28.64  ? 212  THR D O   1 
ATOM   8177  C  CB  . THR D  1 212 ? 14.508  90.184  125.477 1.00 23.72  ? 212  THR D CB  1 
ATOM   8178  O  OG1 . THR D  1 212 ? 13.284  90.858  125.781 1.00 27.13  ? 212  THR D OG1 1 
ATOM   8179  C  CG2 . THR D  1 212 ? 14.282  89.327  124.228 1.00 21.32  ? 212  THR D CG2 1 
ATOM   8180  N  N   . ASN D  1 213 ? 17.340  89.548  126.456 1.00 31.26  ? 213  ASN D N   1 
ATOM   8181  C  CA  . ASN D  1 213 ? 18.700  89.084  126.184 1.00 31.29  ? 213  ASN D CA  1 
ATOM   8182  C  C   . ASN D  1 213 ? 19.024  87.842  126.986 1.00 28.93  ? 213  ASN D C   1 
ATOM   8183  O  O   . ASN D  1 213 ? 19.451  86.837  126.443 1.00 30.35  ? 213  ASN D O   1 
ATOM   8184  C  CB  . ASN D  1 213 ? 19.728  90.162  126.510 1.00 36.34  ? 213  ASN D CB  1 
ATOM   8185  C  CG  . ASN D  1 213 ? 21.151  89.662  126.352 1.00 36.91  ? 213  ASN D CG  1 
ATOM   8186  O  OD1 . ASN D  1 213 ? 21.578  89.334  125.249 1.00 41.81  ? 213  ASN D OD1 1 
ATOM   8187  N  ND2 . ASN D  1 213 ? 21.887  89.587  127.457 1.00 39.12  ? 213  ASN D ND2 1 
ATOM   8188  N  N   . GLN D  1 214 ? 18.828  87.930  128.288 1.00 28.21  ? 214  GLN D N   1 
ATOM   8189  C  CA  . GLN D  1 214 ? 19.047  86.810  129.203 1.00 28.67  ? 214  GLN D CA  1 
ATOM   8190  C  C   . GLN D  1 214 ? 18.425  85.496  128.719 1.00 27.25  ? 214  GLN D C   1 
ATOM   8191  O  O   . GLN D  1 214 ? 19.045  84.451  128.778 1.00 25.05  ? 214  GLN D O   1 
ATOM   8192  C  CB  . GLN D  1 214 ? 18.426  87.145  130.549 1.00 29.24  ? 214  GLN D CB  1 
ATOM   8193  C  CG  . GLN D  1 214 ? 19.394  87.604  131.570 1.00 38.31  ? 214  GLN D CG  1 
ATOM   8194  C  CD  . GLN D  1 214 ? 18.685  88.214  132.735 1.00 41.35  ? 214  GLN D CD  1 
ATOM   8195  O  OE1 . GLN D  1 214 ? 17.662  87.704  133.187 1.00 45.26  ? 214  GLN D OE1 1 
ATOM   8196  N  NE2 . GLN D  1 214 ? 19.220  89.310  133.239 1.00 46.22  ? 214  GLN D NE2 1 
HETATM 8197  N  N   . MSE D  1 215 ? 17.174  85.564  128.283 1.00 26.10  ? 215  MSE D N   1 
HETATM 8198  C  CA  . MSE D  1 215 ? 16.458  84.393  127.811 1.00 28.12  ? 215  MSE D CA  1 
HETATM 8199  C  C   . MSE D  1 215 ? 17.096  83.785  126.553 1.00 29.04  ? 215  MSE D C   1 
HETATM 8200  O  O   . MSE D  1 215 ? 17.224  82.565  126.426 1.00 28.06  ? 215  MSE D O   1 
HETATM 8201  C  CB  . MSE D  1 215 ? 15.007  84.786  127.545 1.00 28.24  ? 215  MSE D CB  1 
HETATM 8202  C  CG  . MSE D  1 215 ? 14.083  83.656  127.134 1.00 39.20  ? 215  MSE D CG  1 
HETATM 8203  SE SE  . MSE D  1 215 ? 12.217  84.215  127.242 1.00 47.82  ? 215  MSE D SE  1 
HETATM 8204  C  CE  . MSE D  1 215 ? 11.948  84.947  125.472 1.00 51.05  ? 215  MSE D CE  1 
ATOM   8205  N  N   . ALA D  1 216 ? 17.509  84.651  125.636 1.00 28.72  ? 216  ALA D N   1 
ATOM   8206  C  CA  . ALA D  1 216 ? 18.121  84.227  124.392 1.00 29.65  ? 216  ALA D CA  1 
ATOM   8207  C  C   . ALA D  1 216 ? 19.482  83.568  124.628 1.00 30.12  ? 216  ALA D C   1 
ATOM   8208  O  O   . ALA D  1 216 ? 19.810  82.571  123.985 1.00 32.23  ? 216  ALA D O   1 
ATOM   8209  C  CB  . ALA D  1 216 ? 18.247  85.435  123.451 1.00 29.85  ? 216  ALA D CB  1 
ATOM   8210  N  N   . VAL D  1 217 ? 20.268  84.133  125.544 1.00 30.42  ? 217  VAL D N   1 
ATOM   8211  C  CA  . VAL D  1 217 ? 21.577  83.590  125.893 1.00 30.66  ? 217  VAL D CA  1 
ATOM   8212  C  C   . VAL D  1 217 ? 21.406  82.221  126.523 1.00 30.48  ? 217  VAL D C   1 
ATOM   8213  O  O   . VAL D  1 217 ? 22.170  81.310  126.238 1.00 33.28  ? 217  VAL D O   1 
ATOM   8214  C  CB  . VAL D  1 217 ? 22.355  84.501  126.900 1.00 34.54  ? 217  VAL D CB  1 
ATOM   8215  C  CG1 . VAL D  1 217 ? 23.657  83.804  127.360 1.00 29.49  ? 217  VAL D CG1 1 
ATOM   8216  C  CG2 . VAL D  1 217 ? 22.686  85.852  126.242 1.00 30.58  ? 217  VAL D CG2 1 
ATOM   8217  N  N   . CYS D  1 218 ? 20.403  82.068  127.378 1.00 29.53  ? 218  CYS D N   1 
ATOM   8218  C  CA  . CYS D  1 218 ? 20.168  80.774  128.013 1.00 31.85  ? 218  CYS D CA  1 
ATOM   8219  C  C   . CYS D  1 218 ? 19.597  79.760  127.012 1.00 31.31  ? 218  CYS D C   1 
ATOM   8220  O  O   . CYS D  1 218 ? 19.861  78.554  127.100 1.00 31.15  ? 218  CYS D O   1 
ATOM   8221  C  CB  . CYS D  1 218 ? 19.222  80.936  129.206 1.00 32.26  ? 218  CYS D CB  1 
ATOM   8222  S  SG  . CYS D  1 218 ? 19.906  81.927  130.577 1.00 37.71  ? 218  CYS D SG  1 
ATOM   8223  N  N   . ALA D  1 219 ? 18.826  80.265  126.058 1.00 27.32  ? 219  ALA D N   1 
ATOM   8224  C  CA  . ALA D  1 219 ? 18.226  79.432  125.044 1.00 25.07  ? 219  ALA D CA  1 
ATOM   8225  C  C   . ALA D  1 219 ? 19.301  78.835  124.174 1.00 28.77  ? 219  ALA D C   1 
ATOM   8226  O  O   . ALA D  1 219 ? 19.270  77.645  123.883 1.00 29.12  ? 219  ALA D O   1 
ATOM   8227  C  CB  . ALA D  1 219 ? 17.291  80.250  124.192 1.00 21.87  ? 219  ALA D CB  1 
ATOM   8228  N  N   . LYS D  1 220 ? 20.250  79.675  123.761 1.00 30.02  ? 220  LYS D N   1 
ATOM   8229  C  CA  . LYS D  1 220 ? 21.343  79.264  122.886 1.00 30.59  ? 220  LYS D CA  1 
ATOM   8230  C  C   . LYS D  1 220 ? 22.228  78.197  123.520 1.00 31.51  ? 220  LYS D C   1 
ATOM   8231  O  O   . LYS D  1 220 ? 22.672  77.260  122.848 1.00 30.33  ? 220  LYS D O   1 
ATOM   8232  C  CB  . LYS D  1 220 ? 22.200  80.483  122.517 1.00 32.60  ? 220  LYS D CB  1 
ATOM   8233  C  CG  . LYS D  1 220 ? 23.270  80.220  121.455 1.00 30.94  ? 220  LYS D CG  1 
ATOM   8234  C  CD  . LYS D  1 220 ? 22.629  79.923  120.119 1.00 40.40  ? 220  LYS D CD  1 
ATOM   8235  C  CE  . LYS D  1 220 ? 23.666  79.623  119.056 1.00 45.56  ? 220  LYS D CE  1 
ATOM   8236  N  NZ  . LYS D  1 220 ? 24.663  80.725  118.945 1.00 48.86  ? 220  LYS D NZ  1 
ATOM   8237  N  N   . ALA D  1 221 ? 22.464  78.351  124.820 1.00 30.34  ? 221  ALA D N   1 
ATOM   8238  C  CA  . ALA D  1 221 ? 23.304  77.442  125.588 1.00 28.95  ? 221  ALA D CA  1 
ATOM   8239  C  C   . ALA D  1 221 ? 22.748  76.026  125.618 1.00 32.15  ? 221  ALA D C   1 
ATOM   8240  O  O   . ALA D  1 221 ? 23.506  75.068  125.772 1.00 33.60  ? 221  ALA D O   1 
ATOM   8241  C  CB  . ALA D  1 221 ? 23.474  77.975  127.010 1.00 19.67  ? 221  ALA D CB  1 
ATOM   8242  N  N   . GLN D  1 222 ? 21.431  75.895  125.473 1.00 31.61  ? 222  GLN D N   1 
ATOM   8243  C  CA  . GLN D  1 222 ? 20.794  74.584  125.490 1.00 32.53  ? 222  GLN D CA  1 
ATOM   8244  C  C   . GLN D  1 222 ? 20.241  74.269  124.122 1.00 35.01  ? 222  GLN D C   1 
ATOM   8245  O  O   . GLN D  1 222 ? 19.367  73.399  123.952 1.00 32.36  ? 222  GLN D O   1 
ATOM   8246  C  CB  . GLN D  1 222 ? 19.671  74.548  126.512 1.00 29.94  ? 222  GLN D CB  1 
ATOM   8247  C  CG  . GLN D  1 222 ? 20.161  74.599  127.928 1.00 34.58  ? 222  GLN D CG  1 
ATOM   8248  C  CD  . GLN D  1 222 ? 19.069  74.258  128.899 1.00 34.84  ? 222  GLN D CD  1 
ATOM   8249  O  OE1 . GLN D  1 222 ? 18.399  73.236  128.753 1.00 41.45  ? 222  GLN D OE1 1 
ATOM   8250  N  NE2 . GLN D  1 222 ? 18.874  75.104  129.894 1.00 33.81  ? 222  GLN D NE2 1 
ATOM   8251  N  N   . ASN D  1 223 ? 20.761  75.008  123.151 1.00 36.53  ? 223  ASN D N   1 
ATOM   8252  C  CA  . ASN D  1 223 ? 20.377  74.867  121.760 1.00 37.09  ? 223  ASN D CA  1 
ATOM   8253  C  C   . ASN D  1 223 ? 18.861  74.864  121.547 1.00 33.81  ? 223  ASN D C   1 
ATOM   8254  O  O   . ASN D  1 223 ? 18.337  74.061  120.781 1.00 36.67  ? 223  ASN D O   1 
ATOM   8255  C  CB  . ASN D  1 223 ? 21.002  73.593  121.182 1.00 39.75  ? 223  ASN D CB  1 
ATOM   8256  C  CG  . ASN D  1 223 ? 21.067  73.621  119.668 1.00 47.67  ? 223  ASN D CG  1 
ATOM   8257  O  OD1 . ASN D  1 223 ? 21.630  74.556  119.079 1.00 50.70  ? 223  ASN D OD1 1 
ATOM   8258  N  ND2 . ASN D  1 223 ? 20.490  72.604  119.024 1.00 48.81  ? 223  ASN D ND2 1 
ATOM   8259  N  N   . LYS D  1 224 ? 18.156  75.758  122.226 1.00 32.18  ? 224  LYS D N   1 
ATOM   8260  C  CA  . LYS D  1 224 ? 16.709  75.845  122.070 1.00 32.02  ? 224  LYS D CA  1 
ATOM   8261  C  C   . LYS D  1 224 ? 16.439  76.925  121.026 1.00 32.39  ? 224  LYS D C   1 
ATOM   8262  O  O   . LYS D  1 224 ? 16.979  78.019  121.104 1.00 32.97  ? 224  LYS D O   1 
ATOM   8263  C  CB  . LYS D  1 224 ? 16.043  76.199  123.405 1.00 29.60  ? 224  LYS D CB  1 
ATOM   8264  C  CG  . LYS D  1 224 ? 16.191  75.118  124.493 1.00 29.71  ? 224  LYS D CG  1 
ATOM   8265  C  CD  . LYS D  1 224 ? 15.543  73.827  124.072 1.00 32.67  ? 224  LYS D CD  1 
ATOM   8266  C  CE  . LYS D  1 224 ? 16.005  72.633  124.891 1.00 35.65  ? 224  LYS D CE  1 
ATOM   8267  N  NZ  . LYS D  1 224 ? 15.472  72.605  126.275 1.00 34.80  ? 224  LYS D NZ  1 
ATOM   8268  N  N   . PRO D  1 225 ? 15.627  76.617  120.008 1.00 33.19  ? 225  PRO D N   1 
ATOM   8269  C  CA  . PRO D  1 225 ? 15.375  77.659  119.009 1.00 33.70  ? 225  PRO D CA  1 
ATOM   8270  C  C   . PRO D  1 225 ? 14.754  78.925  119.612 1.00 32.58  ? 225  PRO D C   1 
ATOM   8271  O  O   . PRO D  1 225 ? 13.839  78.850  120.427 1.00 31.37  ? 225  PRO D O   1 
ATOM   8272  C  CB  . PRO D  1 225 ? 14.461  76.956  117.992 1.00 33.12  ? 225  PRO D CB  1 
ATOM   8273  C  CG  . PRO D  1 225 ? 13.814  75.866  118.780 1.00 33.67  ? 225  PRO D CG  1 
ATOM   8274  C  CD  . PRO D  1 225 ? 14.921  75.370  119.671 1.00 32.96  ? 225  PRO D CD  1 
ATOM   8275  N  N   . PHE D  1 226 ? 15.276  80.082  119.215 1.00 31.18  ? 226  PHE D N   1 
ATOM   8276  C  CA  . PHE D  1 226 ? 14.785  81.363  119.701 1.00 30.17  ? 226  PHE D CA  1 
ATOM   8277  C  C   . PHE D  1 226 ? 14.050  82.100  118.569 1.00 32.18  ? 226  PHE D C   1 
ATOM   8278  O  O   . PHE D  1 226 ? 14.682  82.663  117.664 1.00 33.51  ? 226  PHE D O   1 
ATOM   8279  C  CB  . PHE D  1 226 ? 15.960  82.204  120.197 1.00 28.25  ? 226  PHE D CB  1 
ATOM   8280  C  CG  . PHE D  1 226 ? 15.553  83.453  120.947 1.00 27.19  ? 226  PHE D CG  1 
ATOM   8281  C  CD1 . PHE D  1 226 ? 15.239  83.399  122.304 1.00 26.13  ? 226  PHE D CD1 1 
ATOM   8282  C  CD2 . PHE D  1 226 ? 15.501  84.687  120.298 1.00 25.57  ? 226  PHE D CD2 1 
ATOM   8283  C  CE1 . PHE D  1 226 ? 14.882  84.555  123.000 1.00 24.54  ? 226  PHE D CE1 1 
ATOM   8284  C  CE2 . PHE D  1 226 ? 15.147  85.842  120.983 1.00 23.30  ? 226  PHE D CE2 1 
ATOM   8285  C  CZ  . PHE D  1 226 ? 14.837  85.775  122.340 1.00 25.29  ? 226  PHE D CZ  1 
ATOM   8286  N  N   . TYR D  1 227 ? 12.720  82.093  118.608 1.00 28.39  ? 227  TYR D N   1 
ATOM   8287  C  CA  . TYR D  1 227 ? 11.963  82.768  117.566 1.00 28.10  ? 227  TYR D CA  1 
ATOM   8288  C  C   . TYR D  1 227 ? 11.437  84.143  117.984 1.00 29.51  ? 227  TYR D C   1 
ATOM   8289  O  O   . TYR D  1 227 ? 11.013  84.356  119.136 1.00 25.14  ? 227  TYR D O   1 
ATOM   8290  C  CB  . TYR D  1 227 ? 10.787  81.912  117.077 1.00 26.55  ? 227  TYR D CB  1 
ATOM   8291  C  CG  . TYR D  1 227 ? 11.182  80.594  116.450 1.00 25.64  ? 227  TYR D CG  1 
ATOM   8292  C  CD1 . TYR D  1 227 ? 12.286  80.504  115.602 1.00 27.57  ? 227  TYR D CD1 1 
ATOM   8293  C  CD2 . TYR D  1 227 ? 10.473  79.426  116.739 1.00 24.78  ? 227  TYR D CD2 1 
ATOM   8294  C  CE1 . TYR D  1 227 ? 12.686  79.276  115.066 1.00 28.40  ? 227  TYR D CE1 1 
ATOM   8295  C  CE2 . TYR D  1 227 ? 10.857  78.200  116.216 1.00 28.89  ? 227  TYR D CE2 1 
ATOM   8296  C  CZ  . TYR D  1 227 ? 11.968  78.130  115.386 1.00 30.40  ? 227  TYR D CZ  1 
ATOM   8297  O  OH  . TYR D  1 227 ? 12.392  76.911  114.932 1.00 32.96  ? 227  TYR D OH  1 
ATOM   8298  N  N   . VAL D  1 228 ? 11.481  85.063  117.019 1.00 26.11  ? 228  VAL D N   1 
ATOM   8299  C  CA  . VAL D  1 228 ? 11.020  86.425  117.187 1.00 25.34  ? 228  VAL D CA  1 
ATOM   8300  C  C   . VAL D  1 228 ? 9.875   86.657  116.213 1.00 27.06  ? 228  VAL D C   1 
ATOM   8301  O  O   . VAL D  1 228 ? 9.965   86.278  115.051 1.00 27.80  ? 228  VAL D O   1 
ATOM   8302  C  CB  . VAL D  1 228 ? 12.150  87.444  116.861 1.00 25.25  ? 228  VAL D CB  1 
ATOM   8303  C  CG1 . VAL D  1 228 ? 11.637  88.876  117.026 1.00 17.52  ? 228  VAL D CG1 1 
ATOM   8304  C  CG2 . VAL D  1 228 ? 13.367  87.201  117.765 1.00 22.72  ? 228  VAL D CG2 1 
ATOM   8305  N  N   . VAL D  1 229 ? 8.792   87.261  116.690 1.00 29.04  ? 229  VAL D N   1 
ATOM   8306  C  CA  . VAL D  1 229 ? 7.643   87.579  115.829 1.00 28.67  ? 229  VAL D CA  1 
ATOM   8307  C  C   . VAL D  1 229 ? 7.480   89.113  115.890 1.00 28.29  ? 229  VAL D C   1 
ATOM   8308  O  O   . VAL D  1 229 ? 7.338   89.679  116.970 1.00 29.69  ? 229  VAL D O   1 
ATOM   8309  C  CB  . VAL D  1 229 ? 6.353   86.819  116.310 1.00 27.88  ? 229  VAL D CB  1 
ATOM   8310  C  CG1 . VAL D  1 229 ? 6.559   85.303  116.138 1.00 23.19  ? 229  VAL D CG1 1 
ATOM   8311  C  CG2 . VAL D  1 229 ? 6.051   87.113  117.782 1.00 18.85  ? 229  VAL D CG2 1 
ATOM   8312  N  N   . ALA D  1 230 ? 7.530   89.788  114.744 1.00 28.10  ? 230  ALA D N   1 
ATOM   8313  C  CA  . ALA D  1 230 ? 7.456   91.251  114.742 1.00 30.19  ? 230  ALA D CA  1 
ATOM   8314  C  C   . ALA D  1 230 ? 7.042   91.903  113.432 1.00 33.03  ? 230  ALA D C   1 
ATOM   8315  O  O   . ALA D  1 230 ? 7.538   91.541  112.368 1.00 36.86  ? 230  ALA D O   1 
ATOM   8316  C  CB  . ALA D  1 230 ? 8.805   91.816  115.170 1.00 26.77  ? 230  ALA D CB  1 
ATOM   8317  N  N   . GLU D  1 231 ? 6.152   92.890  113.518 1.00 34.46  ? 231  GLU D N   1 
ATOM   8318  C  CA  . GLU D  1 231 ? 5.682   93.608  112.338 1.00 36.70  ? 231  GLU D CA  1 
ATOM   8319  C  C   . GLU D  1 231 ? 6.822   94.460  111.761 1.00 37.18  ? 231  GLU D C   1 
ATOM   8320  O  O   . GLU D  1 231 ? 7.636   95.012  112.503 1.00 37.77  ? 231  GLU D O   1 
ATOM   8321  C  CB  . GLU D  1 231 ? 4.503   94.519  112.696 1.00 40.16  ? 231  GLU D CB  1 
ATOM   8322  C  CG  . GLU D  1 231 ? 3.426   93.874  113.536 1.00 46.46  ? 231  GLU D CG  1 
ATOM   8323  C  CD  . GLU D  1 231 ? 3.699   93.999  115.024 1.00 55.01  ? 231  GLU D CD  1 
ATOM   8324  O  OE1 . GLU D  1 231 ? 4.821   93.657  115.456 1.00 56.59  ? 231  GLU D OE1 1 
ATOM   8325  O  OE2 . GLU D  1 231 ? 2.788   94.439  115.769 1.00 62.33  ? 231  GLU D OE2 1 
ATOM   8326  N  N   . SER D  1 232 ? 6.865   94.580  110.440 1.00 34.77  ? 232  SER D N   1 
ATOM   8327  C  CA  . SER D  1 232 ? 7.914   95.349  109.788 1.00 35.88  ? 232  SER D CA  1 
ATOM   8328  C  C   . SER D  1 232 ? 7.960   96.867  110.066 1.00 35.24  ? 232  SER D C   1 
ATOM   8329  O  O   . SER D  1 232 ? 8.994   97.496  109.814 1.00 31.97  ? 232  SER D O   1 
ATOM   8330  C  CB  . SER D  1 232 ? 7.884   95.096  108.274 1.00 35.88  ? 232  SER D CB  1 
ATOM   8331  O  OG  . SER D  1 232 ? 6.666   95.534  107.703 1.00 35.24  ? 232  SER D OG  1 
ATOM   8332  N  N   . PHE D  1 233 ? 6.879   97.473  110.567 1.00 32.00  ? 233  PHE D N   1 
ATOM   8333  C  CA  . PHE D  1 233 ? 6.958   98.909  110.854 1.00 30.85  ? 233  PHE D CA  1 
ATOM   8334  C  C   . PHE D  1 233 ? 7.865   99.125  112.059 1.00 32.16  ? 233  PHE D C   1 
ATOM   8335  O  O   . PHE D  1 233 ? 8.130   100.260 112.457 1.00 34.02  ? 233  PHE D O   1 
ATOM   8336  C  CB  . PHE D  1 233 ? 5.574   99.559  111.090 1.00 30.06  ? 233  PHE D CB  1 
ATOM   8337  C  CG  . PHE D  1 233 ? 4.726   98.874  112.119 1.00 27.15  ? 233  PHE D CG  1 
ATOM   8338  C  CD1 . PHE D  1 233 ? 5.095   98.859  113.458 1.00 31.25  ? 233  PHE D CD1 1 
ATOM   8339  C  CD2 . PHE D  1 233 ? 3.570   98.205  111.740 1.00 26.38  ? 233  PHE D CD2 1 
ATOM   8340  C  CE1 . PHE D  1 233 ? 4.318   98.174  114.416 1.00 29.24  ? 233  PHE D CE1 1 
ATOM   8341  C  CE2 . PHE D  1 233 ? 2.795   97.523  112.679 1.00 27.82  ? 233  PHE D CE2 1 
ATOM   8342  C  CZ  . PHE D  1 233 ? 3.174   97.507  114.025 1.00 26.18  ? 233  PHE D CZ  1 
ATOM   8343  N  N   . LYS D  1 234 ? 8.350   98.018  112.625 1.00 32.05  ? 234  LYS D N   1 
ATOM   8344  C  CA  . LYS D  1 234 ? 9.263   98.059  113.759 1.00 28.81  ? 234  LYS D CA  1 
ATOM   8345  C  C   . LYS D  1 234 ? 10.719  97.977  113.297 1.00 29.20  ? 234  LYS D C   1 
ATOM   8346  O  O   . LYS D  1 234 ? 11.623  97.976  114.122 1.00 26.75  ? 234  LYS D O   1 
ATOM   8347  C  CB  . LYS D  1 234 ? 8.978   96.921  114.734 1.00 27.59  ? 234  LYS D CB  1 
ATOM   8348  C  CG  . LYS D  1 234 ? 7.798   97.159  115.629 1.00 29.31  ? 234  LYS D CG  1 
ATOM   8349  C  CD  . LYS D  1 234 ? 7.401   95.894  116.370 1.00 27.78  ? 234  LYS D CD  1 
ATOM   8350  C  CE  . LYS D  1 234 ? 6.205   96.171  117.269 1.00 29.35  ? 234  LYS D CE  1 
ATOM   8351  N  NZ  . LYS D  1 234 ? 5.646   94.933  117.878 1.00 30.10  ? 234  LYS D NZ  1 
ATOM   8352  N  N   . PHE D  1 235 ? 10.955  97.888  111.988 1.00 28.31  ? 235  PHE D N   1 
ATOM   8353  C  CA  . PHE D  1 235 ? 12.338  97.858  111.503 1.00 29.49  ? 235  PHE D CA  1 
ATOM   8354  C  C   . PHE D  1 235 ? 12.885  99.255  111.733 1.00 28.75  ? 235  PHE D C   1 
ATOM   8355  O  O   . PHE D  1 235 ? 12.374  100.223 111.192 1.00 31.17  ? 235  PHE D O   1 
ATOM   8356  C  CB  . PHE D  1 235 ? 12.422  97.505  110.007 1.00 28.15  ? 235  PHE D CB  1 
ATOM   8357  C  CG  . PHE D  1 235 ? 12.347  96.016  109.712 1.00 26.53  ? 235  PHE D CG  1 
ATOM   8358  C  CD1 . PHE D  1 235 ? 11.488  95.184  110.426 1.00 22.73  ? 235  PHE D CD1 1 
ATOM   8359  C  CD2 . PHE D  1 235 ? 13.098  95.463  108.678 1.00 28.57  ? 235  PHE D CD2 1 
ATOM   8360  C  CE1 . PHE D  1 235 ? 11.373  93.822  110.113 1.00 26.32  ? 235  PHE D CE1 1 
ATOM   8361  C  CE2 . PHE D  1 235 ? 12.993  94.090  108.354 1.00 30.00  ? 235  PHE D CE2 1 
ATOM   8362  C  CZ  . PHE D  1 235 ? 12.124  93.269  109.076 1.00 25.05  ? 235  PHE D CZ  1 
ATOM   8363  N  N   . VAL D  1 236 ? 13.912  99.354  112.562 1.00 29.82  ? 236  VAL D N   1 
ATOM   8364  C  CA  . VAL D  1 236 ? 14.507  100.639 112.871 1.00 30.28  ? 236  VAL D CA  1 
ATOM   8365  C  C   . VAL D  1 236 ? 15.972  100.703 112.387 1.00 30.87  ? 236  VAL D C   1 
ATOM   8366  O  O   . VAL D  1 236 ? 16.675  99.693  112.356 1.00 27.42  ? 236  VAL D O   1 
ATOM   8367  C  CB  . VAL D  1 236 ? 14.382  100.919 114.398 1.00 29.26  ? 236  VAL D CB  1 
ATOM   8368  C  CG1 . VAL D  1 236 ? 15.188  99.907  115.189 1.00 25.92  ? 236  VAL D CG1 1 
ATOM   8369  C  CG2 . VAL D  1 236 ? 14.784  102.349 114.702 1.00 29.20  ? 236  VAL D CG2 1 
ATOM   8370  N  N   . ARG D  1 237 ? 16.411  101.900 111.998 1.00 32.17  ? 237  ARG D N   1 
ATOM   8371  C  CA  . ARG D  1 237 ? 17.757  102.117 111.470 1.00 33.47  ? 237  ARG D CA  1 
ATOM   8372  C  C   . ARG D  1 237 ? 18.847  102.302 112.519 1.00 33.31  ? 237  ARG D C   1 
ATOM   8373  O  O   . ARG D  1 237 ? 19.373  103.396 112.688 1.00 33.22  ? 237  ARG D O   1 
ATOM   8374  C  CB  . ARG D  1 237 ? 17.740  103.319 110.522 1.00 32.21  ? 237  ARG D CB  1 
ATOM   8375  C  CG  . ARG D  1 237 ? 16.817  103.108 109.330 1.00 39.47  ? 237  ARG D CG  1 
ATOM   8376  C  CD  . ARG D  1 237 ? 16.475  104.417 108.635 1.00 44.75  ? 237  ARG D CD  1 
ATOM   8377  N  NE  . ARG D  1 237 ? 17.631  105.001 107.960 1.00 52.64  ? 237  ARG D NE  1 
ATOM   8378  C  CZ  . ARG D  1 237 ? 17.607  106.156 107.298 1.00 54.59  ? 237  ARG D CZ  1 
ATOM   8379  N  NH1 . ARG D  1 237 ? 16.475  106.855 107.234 1.00 55.73  ? 237  ARG D NH1 1 
ATOM   8380  N  NH2 . ARG D  1 237 ? 18.704  106.603 106.688 1.00 50.76  ? 237  ARG D NH2 1 
ATOM   8381  N  N   . LEU D  1 238 ? 19.184  101.217 113.209 1.00 30.20  ? 238  LEU D N   1 
ATOM   8382  C  CA  . LEU D  1 238 ? 20.214  101.231 114.235 1.00 28.24  ? 238  LEU D CA  1 
ATOM   8383  C  C   . LEU D  1 238 ? 21.033  99.972  114.072 1.00 27.59  ? 238  LEU D C   1 
ATOM   8384  O  O   . LEU D  1 238 ? 20.501  98.919  113.722 1.00 26.13  ? 238  LEU D O   1 
ATOM   8385  C  CB  . LEU D  1 238 ? 19.596  101.217 115.625 1.00 29.68  ? 238  LEU D CB  1 
ATOM   8386  C  CG  . LEU D  1 238 ? 18.772  102.403 116.118 1.00 32.22  ? 238  LEU D CG  1 
ATOM   8387  C  CD1 . LEU D  1 238 ? 17.981  101.988 117.377 1.00 26.09  ? 238  LEU D CD1 1 
ATOM   8388  C  CD2 . LEU D  1 238 ? 19.706  103.581 116.404 1.00 24.88  ? 238  LEU D CD2 1 
ATOM   8389  N  N   . PHE D  1 239 ? 22.329  100.079 114.329 1.00 27.49  ? 239  PHE D N   1 
ATOM   8390  C  CA  . PHE D  1 239 ? 23.217  98.935  114.220 1.00 25.49  ? 239  PHE D CA  1 
ATOM   8391  C  C   . PHE D  1 239 ? 24.013  98.837  115.521 1.00 25.55  ? 239  PHE D C   1 
ATOM   8392  O  O   . PHE D  1 239 ? 25.209  99.091  115.539 1.00 30.87  ? 239  PHE D O   1 
ATOM   8393  C  CB  . PHE D  1 239 ? 24.154  99.119  113.027 1.00 19.39  ? 239  PHE D CB  1 
ATOM   8394  C  CG  . PHE D  1 239 ? 24.902  97.871  112.638 1.00 19.39  ? 239  PHE D CG  1 
ATOM   8395  C  CD1 . PHE D  1 239 ? 24.544  97.160  111.502 1.00 15.17  ? 239  PHE D CD1 1 
ATOM   8396  C  CD2 . PHE D  1 239 ? 25.988  97.418  113.396 1.00 22.55  ? 239  PHE D CD2 1 
ATOM   8397  C  CE1 . PHE D  1 239 ? 25.255  96.015  111.113 1.00 18.08  ? 239  PHE D CE1 1 
ATOM   8398  C  CE2 . PHE D  1 239 ? 26.707  96.271  113.012 1.00 24.21  ? 239  PHE D CE2 1 
ATOM   8399  C  CZ  . PHE D  1 239 ? 26.338  95.572  111.865 1.00 16.88  ? 239  PHE D CZ  1 
ATOM   8400  N  N   . PRO D  1 240 ? 23.354  98.445  116.624 1.00 26.03  ? 240  PRO D N   1 
ATOM   8401  C  CA  . PRO D  1 240 ? 24.001  98.319  117.935 1.00 25.32  ? 240  PRO D CA  1 
ATOM   8402  C  C   . PRO D  1 240 ? 25.121  97.283  117.954 1.00 25.24  ? 240  PRO D C   1 
ATOM   8403  O  O   . PRO D  1 240 ? 25.031  96.278  117.277 1.00 28.79  ? 240  PRO D O   1 
ATOM   8404  C  CB  . PRO D  1 240 ? 22.846  97.895  118.857 1.00 27.80  ? 240  PRO D CB  1 
ATOM   8405  C  CG  . PRO D  1 240 ? 21.581  98.211  118.081 1.00 25.34  ? 240  PRO D CG  1 
ATOM   8406  C  CD  . PRO D  1 240 ? 21.979  97.912  116.671 1.00 25.57  ? 240  PRO D CD  1 
ATOM   8407  N  N   . LEU D  1 241 ? 26.175  97.530  118.720 1.00 28.50  ? 241  LEU D N   1 
ATOM   8408  C  CA  . LEU D  1 241 ? 27.269  96.561  118.857 1.00 32.59  ? 241  LEU D CA  1 
ATOM   8409  C  C   . LEU D  1 241 ? 27.222  96.012  120.288 1.00 34.49  ? 241  LEU D C   1 
ATOM   8410  O  O   . LEU D  1 241 ? 27.730  94.929  120.573 1.00 36.86  ? 241  LEU D O   1 
ATOM   8411  C  CB  . LEU D  1 241 ? 28.637  97.204  118.604 1.00 29.23  ? 241  LEU D CB  1 
ATOM   8412  C  CG  . LEU D  1 241 ? 28.987  97.597  117.167 1.00 31.67  ? 241  LEU D CG  1 
ATOM   8413  C  CD1 . LEU D  1 241 ? 30.388  98.229  117.113 1.00 28.12  ? 241  LEU D CD1 1 
ATOM   8414  C  CD2 . LEU D  1 241 ? 28.925  96.363  116.287 1.00 32.07  ? 241  LEU D CD2 1 
ATOM   8415  N  N   . ASN D  1 242 ? 26.604  96.776  121.183 1.00 34.59  ? 242  ASN D N   1 
ATOM   8416  C  CA  . ASN D  1 242 ? 26.466  96.385  122.583 1.00 36.43  ? 242  ASN D CA  1 
ATOM   8417  C  C   . ASN D  1 242 ? 25.295  97.150  123.199 1.00 34.94  ? 242  ASN D C   1 
ATOM   8418  O  O   . ASN D  1 242 ? 24.686  98.008  122.549 1.00 34.31  ? 242  ASN D O   1 
ATOM   8419  C  CB  . ASN D  1 242 ? 27.745  96.708  123.362 1.00 37.73  ? 242  ASN D CB  1 
ATOM   8420  C  CG  . ASN D  1 242 ? 28.073  98.181  123.337 1.00 43.12  ? 242  ASN D CG  1 
ATOM   8421  O  OD1 . ASN D  1 242 ? 27.207  99.019  123.594 1.00 49.80  ? 242  ASN D OD1 1 
ATOM   8422  N  ND2 . ASN D  1 242 ? 29.323  98.515  123.026 1.00 41.62  ? 242  ASN D ND2 1 
ATOM   8423  N  N   . GLN D  1 243 ? 24.999  96.843  124.456 1.00 32.34  ? 243  GLN D N   1 
ATOM   8424  C  CA  . GLN D  1 243 ? 23.909  97.485  125.180 1.00 32.66  ? 243  GLN D CA  1 
ATOM   8425  C  C   . GLN D  1 243 ? 24.002  99.014  125.216 1.00 33.76  ? 243  GLN D C   1 
ATOM   8426  O  O   . GLN D  1 243 ? 22.989  99.715  125.123 1.00 34.82  ? 243  GLN D O   1 
ATOM   8427  C  CB  . GLN D  1 243 ? 23.839  96.941  126.614 1.00 27.28  ? 243  GLN D CB  1 
ATOM   8428  C  CG  . GLN D  1 243 ? 23.608  95.421  126.721 1.00 23.39  ? 243  GLN D CG  1 
ATOM   8429  C  CD  . GLN D  1 243 ? 22.359  94.934  125.972 1.00 23.46  ? 243  GLN D CD  1 
ATOM   8430  O  OE1 . GLN D  1 243 ? 21.293  95.559  126.023 1.00 20.17  ? 243  GLN D OE1 1 
ATOM   8431  N  NE2 . GLN D  1 243 ? 22.492  93.803  125.283 1.00 19.45  ? 243  GLN D NE2 1 
ATOM   8432  N  N   . GLN D  1 244 ? 25.216  99.537  125.335 1.00 37.58  ? 244  GLN D N   1 
ATOM   8433  C  CA  . GLN D  1 244 ? 25.399  100.983 125.397 1.00 39.02  ? 244  GLN D CA  1 
ATOM   8434  C  C   . GLN D  1 244 ? 25.009  101.677 124.090 1.00 36.53  ? 244  GLN D C   1 
ATOM   8435  O  O   . GLN D  1 244 ? 24.844  102.891 124.046 1.00 34.46  ? 244  GLN D O   1 
ATOM   8436  C  CB  . GLN D  1 244 ? 26.851  101.302 125.747 1.00 45.13  ? 244  GLN D CB  1 
ATOM   8437  C  CG  . GLN D  1 244 ? 27.075  102.733 126.231 1.00 57.59  ? 244  GLN D CG  1 
ATOM   8438  C  CD  . GLN D  1 244 ? 28.550  103.052 126.445 1.00 64.04  ? 244  GLN D CD  1 
ATOM   8439  O  OE1 . GLN D  1 244 ? 29.325  103.140 125.487 1.00 67.76  ? 244  GLN D OE1 1 
ATOM   8440  N  NE2 . GLN D  1 244 ? 28.946  103.215 127.707 1.00 66.65  ? 244  GLN D NE2 1 
ATOM   8441  N  N   . ASP D  1 245 ? 24.842  100.897 123.029 1.00 36.31  ? 245  ASP D N   1 
ATOM   8442  C  CA  . ASP D  1 245 ? 24.481  101.453 121.741 1.00 35.10  ? 245  ASP D CA  1 
ATOM   8443  C  C   . ASP D  1 245 ? 23.000  101.698 121.517 1.00 34.87  ? 245  ASP D C   1 
ATOM   8444  O  O   . ASP D  1 245 ? 22.609  102.295 120.515 1.00 33.11  ? 245  ASP D O   1 
ATOM   8445  C  CB  . ASP D  1 245 ? 25.032  100.577 120.622 1.00 39.91  ? 245  ASP D CB  1 
ATOM   8446  C  CG  . ASP D  1 245 ? 26.509  100.761 120.443 1.00 40.08  ? 245  ASP D CG  1 
ATOM   8447  O  OD1 . ASP D  1 245 ? 26.982  101.845 120.834 1.00 40.17  ? 245  ASP D OD1 1 
ATOM   8448  O  OD2 . ASP D  1 245 ? 27.184  99.848  119.915 1.00 39.75  ? 245  ASP D OD2 1 
ATOM   8449  N  N   . VAL D  1 246 ? 22.160  101.215 122.418 1.00 33.67  ? 246  VAL D N   1 
ATOM   8450  C  CA  . VAL D  1 246 ? 20.743  101.488 122.264 1.00 33.79  ? 246  VAL D CA  1 
ATOM   8451  C  C   . VAL D  1 246 ? 20.528  102.882 122.854 1.00 33.96  ? 246  VAL D C   1 
ATOM   8452  O  O   . VAL D  1 246 ? 20.819  103.100 124.035 1.00 34.16  ? 246  VAL D O   1 
ATOM   8453  C  CB  . VAL D  1 246 ? 19.893  100.504 123.053 1.00 33.28  ? 246  VAL D CB  1 
ATOM   8454  C  CG1 . VAL D  1 246 ? 18.425  100.859 122.895 1.00 30.90  ? 246  VAL D CG1 1 
ATOM   8455  C  CG2 . VAL D  1 246 ? 20.183  99.096  122.590 1.00 32.88  ? 246  VAL D CG2 1 
ATOM   8456  N  N   . PRO D  1 247 ? 20.038  103.844 122.043 1.00 34.03  ? 247  PRO D N   1 
ATOM   8457  C  CA  . PRO D  1 247 ? 19.798  105.213 122.528 1.00 34.26  ? 247  PRO D CA  1 
ATOM   8458  C  C   . PRO D  1 247 ? 19.035  105.201 123.847 1.00 33.60  ? 247  PRO D C   1 
ATOM   8459  O  O   . PRO D  1 247 ? 18.206  104.322 124.074 1.00 35.82  ? 247  PRO D O   1 
ATOM   8460  C  CB  . PRO D  1 247 ? 18.978  105.843 121.400 1.00 31.91  ? 247  PRO D CB  1 
ATOM   8461  C  CG  . PRO D  1 247 ? 19.490  105.151 120.187 1.00 29.59  ? 247  PRO D CG  1 
ATOM   8462  C  CD  . PRO D  1 247 ? 19.590  103.706 120.643 1.00 32.67  ? 247  PRO D CD  1 
ATOM   8463  N  N   . ASP D  1 248 ? 19.312  106.171 124.712 1.00 34.92  ? 248  ASP D N   1 
ATOM   8464  C  CA  . ASP D  1 248 ? 18.638  106.240 126.006 1.00 39.29  ? 248  ASP D CA  1 
ATOM   8465  C  C   . ASP D  1 248 ? 17.151  106.584 125.935 1.00 37.99  ? 248  ASP D C   1 
ATOM   8466  O  O   . ASP D  1 248 ? 16.377  106.143 126.777 1.00 36.67  ? 248  ASP D O   1 
ATOM   8467  C  CB  . ASP D  1 248 ? 19.346  107.239 126.925 1.00 42.83  ? 248  ASP D CB  1 
ATOM   8468  C  CG  . ASP D  1 248 ? 20.797  106.862 127.185 1.00 48.14  ? 248  ASP D CG  1 
ATOM   8469  O  OD1 . ASP D  1 248 ? 21.082  105.682 127.508 1.00 46.42  ? 248  ASP D OD1 1 
ATOM   8470  O  OD2 . ASP D  1 248 ? 21.658  107.756 127.067 1.00 53.15  ? 248  ASP D OD2 1 
ATOM   8471  N  N   . LYS D  1 249 ? 16.747  107.361 124.938 1.00 38.68  ? 249  LYS D N   1 
ATOM   8472  C  CA  . LYS D  1 249 ? 15.341  107.716 124.821 1.00 42.71  ? 249  LYS D CA  1 
ATOM   8473  C  C   . LYS D  1 249 ? 14.447  106.495 124.644 1.00 45.02  ? 249  LYS D C   1 
ATOM   8474  O  O   . LYS D  1 249 ? 13.230  106.598 124.768 1.00 48.33  ? 249  LYS D O   1 
ATOM   8475  C  CB  . LYS D  1 249 ? 15.108  108.692 123.663 1.00 41.10  ? 249  LYS D CB  1 
ATOM   8476  C  CG  . LYS D  1 249 ? 15.606  108.237 122.304 1.00 43.25  ? 249  LYS D CG  1 
ATOM   8477  C  CD  . LYS D  1 249 ? 15.130  109.205 121.232 1.00 45.08  ? 249  LYS D CD  1 
ATOM   8478  C  CE  . LYS D  1 249 ? 16.016  109.187 120.003 1.00 46.46  ? 249  LYS D CE  1 
ATOM   8479  N  NZ  . LYS D  1 249 ? 16.065  107.843 119.383 1.00 50.00  ? 249  LYS D NZ  1 
ATOM   8480  N  N   . PHE D  1 250 ? 15.047  105.343 124.358 1.00 44.50  ? 250  PHE D N   1 
ATOM   8481  C  CA  . PHE D  1 250 ? 14.284  104.111 124.174 1.00 42.72  ? 250  PHE D CA  1 
ATOM   8482  C  C   . PHE D  1 250 ? 14.295  103.204 125.397 1.00 42.51  ? 250  PHE D C   1 
ATOM   8483  O  O   . PHE D  1 250 ? 13.414  102.356 125.545 1.00 42.52  ? 250  PHE D O   1 
ATOM   8484  C  CB  . PHE D  1 250 ? 14.824  103.329 122.980 1.00 40.56  ? 250  PHE D CB  1 
ATOM   8485  C  CG  . PHE D  1 250 ? 14.585  103.997 121.666 1.00 40.32  ? 250  PHE D CG  1 
ATOM   8486  C  CD1 . PHE D  1 250 ? 15.497  103.855 120.625 1.00 38.60  ? 250  PHE D CD1 1 
ATOM   8487  C  CD2 . PHE D  1 250 ? 13.449  104.765 121.462 1.00 35.98  ? 250  PHE D CD2 1 
ATOM   8488  C  CE1 . PHE D  1 250 ? 15.276  104.473 119.403 1.00 38.90  ? 250  PHE D CE1 1 
ATOM   8489  C  CE2 . PHE D  1 250 ? 13.222  105.386 120.239 1.00 35.85  ? 250  PHE D CE2 1 
ATOM   8490  C  CZ  . PHE D  1 250 ? 14.137  105.240 119.209 1.00 36.43  ? 250  PHE D CZ  1 
ATOM   8491  N  N   . LYS D  1 251 ? 15.284  103.375 126.271 1.00 41.39  ? 251  LYS D N   1 
ATOM   8492  C  CA  . LYS D  1 251 ? 15.368  102.532 127.450 1.00 44.16  ? 251  LYS D CA  1 
ATOM   8493  C  C   . LYS D  1 251 ? 14.997  103.202 128.776 1.00 46.02  ? 251  LYS D C   1 
ATOM   8494  O  O   . LYS D  1 251 ? 14.846  102.527 129.789 1.00 47.06  ? 251  LYS D O   1 
ATOM   8495  C  CB  . LYS D  1 251 ? 16.767  101.900 127.551 1.00 45.60  ? 251  LYS D CB  1 
ATOM   8496  C  CG  . LYS D  1 251 ? 17.908  102.884 127.664 1.00 44.61  ? 251  LYS D CG  1 
ATOM   8497  C  CD  . LYS D  1 251 ? 19.199  102.219 128.148 1.00 42.34  ? 251  LYS D CD  1 
ATOM   8498  C  CE  . LYS D  1 251 ? 19.841  101.329 127.092 1.00 43.52  ? 251  LYS D CE  1 
ATOM   8499  N  NZ  . LYS D  1 251 ? 21.301  101.118 127.354 1.00 38.13  ? 251  LYS D NZ  1 
ATOM   8500  N  N   . TYR D  1 252 ? 14.839  104.518 128.788 1.00 49.98  ? 252  TYR D N   1 
ATOM   8501  C  CA  . TYR D  1 252 ? 14.467  105.185 130.034 1.00 54.66  ? 252  TYR D CA  1 
ATOM   8502  C  C   . TYR D  1 252 ? 13.143  105.929 129.943 1.00 59.27  ? 252  TYR D C   1 
ATOM   8503  O  O   . TYR D  1 252 ? 12.744  106.395 128.869 1.00 59.15  ? 252  TYR D O   1 
ATOM   8504  C  CB  . TYR D  1 252 ? 15.574  106.133 130.495 1.00 49.88  ? 252  TYR D CB  1 
ATOM   8505  C  CG  . TYR D  1 252 ? 16.835  105.404 130.882 1.00 47.85  ? 252  TYR D CG  1 
ATOM   8506  C  CD1 . TYR D  1 252 ? 18.058  105.732 130.302 1.00 45.86  ? 252  TYR D CD1 1 
ATOM   8507  C  CD2 . TYR D  1 252 ? 16.799  104.349 131.793 1.00 46.05  ? 252  TYR D CD2 1 
ATOM   8508  C  CE1 . TYR D  1 252 ? 19.217  105.020 130.613 1.00 44.53  ? 252  TYR D CE1 1 
ATOM   8509  C  CE2 . TYR D  1 252 ? 17.952  103.632 132.112 1.00 45.46  ? 252  TYR D CE2 1 
ATOM   8510  C  CZ  . TYR D  1 252 ? 19.159  103.972 131.516 1.00 43.95  ? 252  TYR D CZ  1 
ATOM   8511  O  OH  . TYR D  1 252 ? 20.304  103.253 131.806 1.00 44.79  ? 252  TYR D OH  1 
ATOM   8512  N  N   . LYS D  1 253 ? 12.470  106.026 131.090 1.00 65.20  ? 253  LYS D N   1 
ATOM   8513  C  CA  . LYS D  1 253 ? 11.175  106.684 131.184 1.00 70.09  ? 253  LYS D CA  1 
ATOM   8514  C  C   . LYS D  1 253 ? 10.296  106.011 130.138 1.00 73.50  ? 253  LYS D C   1 
ATOM   8515  O  O   . LYS D  1 253 ? 9.705   106.679 129.286 1.00 73.25  ? 253  LYS D O   1 
ATOM   8516  C  CB  . LYS D  1 253 ? 11.322  108.181 130.882 1.00 70.03  ? 253  LYS D CB  1 
ATOM   8517  C  CG  . LYS D  1 253 ? 10.101  109.030 131.218 1.00 69.40  ? 253  LYS D CG  1 
ATOM   8518  C  CD  . LYS D  1 253 ? 10.393  110.494 130.957 1.00 70.30  ? 253  LYS D CD  1 
ATOM   8519  C  CE  . LYS D  1 253 ? 11.646  110.928 131.715 1.00 71.88  ? 253  LYS D CE  1 
ATOM   8520  N  NZ  . LYS D  1 253 ? 12.100  112.303 131.370 1.00 71.53  ? 253  LYS D NZ  1 
ATOM   8521  N  N   . ALA D  1 254 ? 10.220  104.681 130.209 1.00 77.45  ? 254  ALA D N   1 
ATOM   8522  C  CA  . ALA D  1 254 ? 9.442   103.899 129.247 1.00 82.54  ? 254  ALA D CA  1 
ATOM   8523  C  C   . ALA D  1 254 ? 8.264   103.115 129.817 1.00 84.57  ? 254  ALA D C   1 
ATOM   8524  O  O   . ALA D  1 254 ? 7.908   103.251 130.990 1.00 85.25  ? 254  ALA D O   1 
ATOM   8525  C  CB  . ALA D  1 254 ? 10.366  102.943 128.485 1.00 82.92  ? 254  ALA D CB  1 
ATOM   8526  N  N   . ASP D  1 255 ? 7.672   102.294 128.950 1.00 86.31  ? 255  ASP D N   1 
ATOM   8527  C  CA  . ASP D  1 255 ? 6.522   101.453 129.274 1.00 87.96  ? 255  ASP D CA  1 
ATOM   8528  C  C   . ASP D  1 255 ? 5.896   100.987 127.962 1.00 88.57  ? 255  ASP D C   1 
ATOM   8529  O  O   . ASP D  1 255 ? 5.936   101.702 126.955 1.00 87.90  ? 255  ASP D O   1 
ATOM   8530  C  CB  . ASP D  1 255 ? 5.476   102.231 130.086 1.00 89.95  ? 255  ASP D CB  1 
ATOM   8531  C  CG  . ASP D  1 255 ? 4.903   103.420 129.323 1.00 92.17  ? 255  ASP D CG  1 
ATOM   8532  O  OD1 . ASP D  1 255 ? 4.270   103.210 128.263 1.00 93.14  ? 255  ASP D OD1 1 
ATOM   8533  O  OD2 . ASP D  1 255 ? 5.087   104.568 129.787 1.00 91.99  ? 255  ASP D OD2 1 
ATOM   8534  N  N   . GLY D  1 263 ? 23.481  108.559 145.997 1.00 60.81  ? 263  GLY D N   1 
ATOM   8535  C  CA  . GLY D  1 263 ? 24.911  108.691 146.210 1.00 62.62  ? 263  GLY D CA  1 
ATOM   8536  C  C   . GLY D  1 263 ? 25.651  107.402 145.901 1.00 64.31  ? 263  GLY D C   1 
ATOM   8537  O  O   . GLY D  1 263 ? 25.731  106.979 144.743 1.00 62.91  ? 263  GLY D O   1 
ATOM   8538  N  N   . GLN D  1 264 ? 26.179  106.771 146.948 1.00 66.01  ? 264  GLN D N   1 
ATOM   8539  C  CA  . GLN D  1 264 ? 26.926  105.516 146.837 1.00 67.61  ? 264  GLN D CA  1 
ATOM   8540  C  C   . GLN D  1 264 ? 26.093  104.317 146.370 1.00 66.83  ? 264  GLN D C   1 
ATOM   8541  O  O   . GLN D  1 264 ? 26.554  103.497 145.561 1.00 63.41  ? 264  GLN D O   1 
ATOM   8542  C  CB  . GLN D  1 264 ? 27.566  105.195 148.181 1.00 71.12  ? 264  GLN D CB  1 
ATOM   8543  C  CG  . GLN D  1 264 ? 28.187  103.828 148.254 1.00 77.74  ? 264  GLN D CG  1 
ATOM   8544  C  CD  . GLN D  1 264 ? 28.836  103.569 149.592 1.00 83.36  ? 264  GLN D CD  1 
ATOM   8545  O  OE1 . GLN D  1 264 ? 29.143  102.428 149.923 1.00 86.55  ? 264  GLN D OE1 1 
ATOM   8546  N  NE2 . GLN D  1 264 ? 29.054  104.629 150.370 1.00 85.91  ? 264  GLN D NE2 1 
ATOM   8547  N  N   . ASP D  1 265 ? 24.877  104.217 146.904 1.00 66.59  ? 265  ASP D N   1 
ATOM   8548  C  CA  . ASP D  1 265 ? 23.946  103.148 146.562 1.00 65.33  ? 265  ASP D CA  1 
ATOM   8549  C  C   . ASP D  1 265 ? 23.119  103.630 145.379 1.00 64.73  ? 265  ASP D C   1 
ATOM   8550  O  O   . ASP D  1 265 ? 22.525  104.703 145.429 1.00 63.34  ? 265  ASP D O   1 
ATOM   8551  C  CB  . ASP D  1 265 ? 23.029  102.858 147.749 1.00 67.77  ? 265  ASP D CB  1 
ATOM   8552  C  CG  . ASP D  1 265 ? 22.040  101.743 147.470 1.00 69.90  ? 265  ASP D CG  1 
ATOM   8553  O  OD1 . ASP D  1 265 ? 21.338  101.802 146.436 1.00 72.45  ? 265  ASP D OD1 1 
ATOM   8554  O  OD2 . ASP D  1 265 ? 21.956  100.807 148.294 1.00 71.59  ? 265  ASP D OD2 1 
ATOM   8555  N  N   . LEU D  1 266 ? 23.077  102.837 144.315 1.00 65.06  ? 266  LEU D N   1 
ATOM   8556  C  CA  . LEU D  1 266 ? 22.330  103.221 143.127 1.00 64.87  ? 266  LEU D CA  1 
ATOM   8557  C  C   . LEU D  1 266 ? 21.453  102.114 142.562 1.00 65.35  ? 266  LEU D C   1 
ATOM   8558  O  O   . LEU D  1 266 ? 21.875  100.968 142.434 1.00 65.31  ? 266  LEU D O   1 
ATOM   8559  C  CB  . LEU D  1 266 ? 23.288  103.689 142.018 1.00 62.00  ? 266  LEU D CB  1 
ATOM   8560  C  CG  . LEU D  1 266 ? 24.317  104.776 142.332 1.00 62.28  ? 266  LEU D CG  1 
ATOM   8561  C  CD1 . LEU D  1 266 ? 25.192  105.035 141.123 1.00 60.01  ? 266  LEU D CD1 1 
ATOM   8562  C  CD2 . LEU D  1 266 ? 23.601  106.048 142.749 1.00 67.25  ? 266  LEU D CD2 1 
ATOM   8563  N  N   . LYS D  1 267 ? 20.212  102.470 142.257 1.00 66.29  ? 267  LYS D N   1 
ATOM   8564  C  CA  . LYS D  1 267 ? 19.270  101.561 141.619 1.00 65.39  ? 267  LYS D CA  1 
ATOM   8565  C  C   . LYS D  1 267 ? 19.337  102.188 140.252 1.00 65.85  ? 267  LYS D C   1 
ATOM   8566  O  O   . LYS D  1 267 ? 18.523  101.911 139.389 1.00 65.48  ? 267  LYS D O   1 
ATOM   8567  C  CB  . LYS D  1 267 ? 17.849  101.732 142.166 1.00 64.63  ? 267  LYS D CB  1 
ATOM   8568  C  CG  . LYS D  1 267 ? 17.510  100.835 143.348 1.00 66.20  ? 267  LYS D CG  1 
ATOM   8569  C  CD  . LYS D  1 267 ? 16.094  101.081 143.851 1.00 65.60  ? 267  LYS D CD  1 
ATOM   8570  C  CE  . LYS D  1 267 ? 15.733  100.121 144.985 1.00 65.94  ? 267  LYS D CE  1 
ATOM   8571  N  NZ  . LYS D  1 267 ? 14.417  100.454 145.620 1.00 63.68  ? 267  LYS D NZ  1 
ATOM   8572  N  N   . GLU D  1 268 ? 20.329  103.066 140.102 1.00 69.82  ? 268  GLU D N   1 
ATOM   8573  C  CA  . GLU D  1 268 ? 20.582  103.836 138.887 1.00 71.11  ? 268  GLU D CA  1 
ATOM   8574  C  C   . GLU D  1 268 ? 20.393  103.032 137.617 1.00 69.64  ? 268  GLU D C   1 
ATOM   8575  O  O   . GLU D  1 268 ? 20.634  103.531 136.509 1.00 74.57  ? 268  GLU D O   1 
ATOM   8576  C  CB  . GLU D  1 268 ? 21.999  104.428 138.915 1.00 74.06  ? 268  GLU D CB  1 
ATOM   8577  C  CG  . GLU D  1 268 ? 22.308  105.368 137.744 1.00 81.01  ? 268  GLU D CG  1 
ATOM   8578  C  CD  . GLU D  1 268 ? 23.719  105.949 137.797 1.00 87.36  ? 268  GLU D CD  1 
ATOM   8579  O  OE1 . GLU D  1 268 ? 24.692  105.157 137.836 1.00 90.23  ? 268  GLU D OE1 1 
ATOM   8580  O  OE2 . GLU D  1 268 ? 23.857  107.197 137.793 1.00 87.51  ? 268  GLU D OE2 1 
ATOM   8581  N  N   . GLU D  1 269 ? 19.959  101.788 137.768 1.00 61.95  ? 269  GLU D N   1 
ATOM   8582  C  CA  . GLU D  1 269 ? 19.739  100.956 136.614 1.00 56.05  ? 269  GLU D CA  1 
ATOM   8583  C  C   . GLU D  1 269 ? 18.296  100.478 136.481 1.00 51.38  ? 269  GLU D C   1 
ATOM   8584  O  O   . GLU D  1 269 ? 17.859  99.541  137.147 1.00 50.85  ? 269  GLU D O   1 
ATOM   8585  C  CB  . GLU D  1 269 ? 20.717  99.792  136.649 1.00 56.28  ? 269  GLU D CB  1 
ATOM   8586  C  CG  . GLU D  1 269 ? 22.158  100.272 136.720 1.00 58.51  ? 269  GLU D CG  1 
ATOM   8587  C  CD  . GLU D  1 269 ? 22.650  100.888 135.426 1.00 59.04  ? 269  GLU D CD  1 
ATOM   8588  O  OE1 . GLU D  1 269 ? 21.826  101.462 134.681 1.00 60.58  ? 269  GLU D OE1 1 
ATOM   8589  O  OE2 . GLU D  1 269 ? 23.872  100.803 135.162 1.00 60.00  ? 269  GLU D OE2 1 
ATOM   8590  N  N   . HIS D  1 270 ? 17.553  101.162 135.620 1.00 45.99  ? 270  HIS D N   1 
ATOM   8591  C  CA  . HIS D  1 270 ? 16.173  100.807 135.355 1.00 41.35  ? 270  HIS D CA  1 
ATOM   8592  C  C   . HIS D  1 270 ? 15.896  100.843 133.859 1.00 36.72  ? 270  HIS D C   1 
ATOM   8593  O  O   . HIS D  1 270 ? 14.923  101.454 133.425 1.00 36.36  ? 270  HIS D O   1 
ATOM   8594  C  CB  . HIS D  1 270 ? 15.215  101.750 136.082 1.00 42.21  ? 270  HIS D CB  1 
ATOM   8595  C  CG  . HIS D  1 270 ? 15.114  101.484 137.549 1.00 47.08  ? 270  HIS D CG  1 
ATOM   8596  N  ND1 . HIS D  1 270 ? 14.789  100.245 138.058 1.00 49.11  ? 270  HIS D ND1 1 
ATOM   8597  C  CD2 . HIS D  1 270 ? 15.297  102.294 138.620 1.00 49.94  ? 270  HIS D CD2 1 
ATOM   8598  C  CE1 . HIS D  1 270 ? 14.777  100.303 139.379 1.00 49.31  ? 270  HIS D CE1 1 
ATOM   8599  N  NE2 . HIS D  1 270 ? 15.082  101.535 139.746 1.00 47.53  ? 270  HIS D NE2 1 
ATOM   8600  N  N   . PRO D  1 271 ? 16.761  100.203 133.045 1.00 34.26  ? 271  PRO D N   1 
ATOM   8601  C  CA  . PRO D  1 271 ? 16.507  100.217 131.599 1.00 30.44  ? 271  PRO D CA  1 
ATOM   8602  C  C   . PRO D  1 271 ? 15.241  99.388  131.306 1.00 28.26  ? 271  PRO D C   1 
ATOM   8603  O  O   . PRO D  1 271 ? 15.012  98.338  131.916 1.00 25.34  ? 271  PRO D O   1 
ATOM   8604  C  CB  . PRO D  1 271 ? 17.786  99.608  131.021 1.00 30.19  ? 271  PRO D CB  1 
ATOM   8605  C  CG  . PRO D  1 271 ? 18.168  98.596  132.075 1.00 32.30  ? 271  PRO D CG  1 
ATOM   8606  C  CD  . PRO D  1 271 ? 17.945  99.379  133.365 1.00 31.65  ? 271  PRO D CD  1 
ATOM   8607  N  N   . TRP D  1 272 ? 14.406  99.873  130.393 1.00 29.30  ? 272  TRP D N   1 
ATOM   8608  C  CA  . TRP D  1 272 ? 13.165  99.182  130.062 1.00 27.59  ? 272  TRP D CA  1 
ATOM   8609  C  C   . TRP D  1 272 ? 13.315  98.141  128.969 1.00 25.76  ? 272  TRP D C   1 
ATOM   8610  O  O   . TRP D  1 272 ? 12.513  97.205  128.873 1.00 24.31  ? 272  TRP D O   1 
ATOM   8611  C  CB  . TRP D  1 272 ? 12.082  100.194 129.680 1.00 31.47  ? 272  TRP D CB  1 
ATOM   8612  C  CG  . TRP D  1 272 ? 11.380  100.742 130.880 1.00 38.12  ? 272  TRP D CG  1 
ATOM   8613  C  CD1 . TRP D  1 272 ? 11.767  101.809 131.663 1.00 38.46  ? 272  TRP D CD1 1 
ATOM   8614  C  CD2 . TRP D  1 272 ? 10.197  100.208 131.487 1.00 37.88  ? 272  TRP D CD2 1 
ATOM   8615  N  NE1 . TRP D  1 272 ? 10.889  101.964 132.717 1.00 36.31  ? 272  TRP D NE1 1 
ATOM   8616  C  CE2 . TRP D  1 272 ? 9.921   100.995 132.634 1.00 38.43  ? 272  TRP D CE2 1 
ATOM   8617  C  CE3 . TRP D  1 272 ? 9.343   99.143  131.175 1.00 37.34  ? 272  TRP D CE3 1 
ATOM   8618  C  CZ2 . TRP D  1 272 ? 8.825   100.742 133.467 1.00 36.98  ? 272  TRP D CZ2 1 
ATOM   8619  C  CZ3 . TRP D  1 272 ? 8.253   98.898  132.005 1.00 36.86  ? 272  TRP D CZ3 1 
ATOM   8620  C  CH2 . TRP D  1 272 ? 8.007   99.694  133.135 1.00 35.07  ? 272  TRP D CH2 1 
ATOM   8621  N  N   . VAL D  1 273 ? 14.354  98.301  128.161 1.00 24.45  ? 273  VAL D N   1 
ATOM   8622  C  CA  . VAL D  1 273 ? 14.628  97.374  127.075 1.00 25.38  ? 273  VAL D CA  1 
ATOM   8623  C  C   . VAL D  1 273 ? 16.082  96.949  127.123 1.00 26.77  ? 273  VAL D C   1 
ATOM   8624  O  O   . VAL D  1 273 ? 16.875  97.515  127.875 1.00 26.76  ? 273  VAL D O   1 
ATOM   8625  C  CB  . VAL D  1 273 ? 14.367  98.042  125.717 1.00 23.95  ? 273  VAL D CB  1 
ATOM   8626  C  CG1 . VAL D  1 273 ? 12.961  98.567  125.694 1.00 23.23  ? 273  VAL D CG1 1 
ATOM   8627  C  CG2 . VAL D  1 273 ? 15.361  99.191  125.480 1.00 18.49  ? 273  VAL D CG2 1 
ATOM   8628  N  N   . ASP D  1 274 ? 16.419  95.925  126.355 1.00 24.85  ? 274  ASP D N   1 
ATOM   8629  C  CA  . ASP D  1 274 ? 17.804  95.492  126.255 1.00 27.84  ? 274  ASP D CA  1 
ATOM   8630  C  C   . ASP D  1 274 ? 17.983  95.064  124.820 1.00 27.32  ? 274  ASP D C   1 
ATOM   8631  O  O   . ASP D  1 274 ? 17.021  95.006  124.060 1.00 30.58  ? 274  ASP D O   1 
ATOM   8632  C  CB  . ASP D  1 274 ? 18.192  94.357  127.241 1.00 30.59  ? 274  ASP D CB  1 
ATOM   8633  C  CG  . ASP D  1 274 ? 17.313  93.094  127.128 1.00 36.34  ? 274  ASP D CG  1 
ATOM   8634  O  OD1 . ASP D  1 274 ? 16.860  92.729  126.005 1.00 31.63  ? 274  ASP D OD1 1 
ATOM   8635  O  OD2 . ASP D  1 274 ? 17.110  92.449  128.197 1.00 31.05  ? 274  ASP D OD2 1 
ATOM   8636  N  N   . TYR D  1 275 ? 19.212  94.778  124.439 1.00 26.21  ? 275  TYR D N   1 
ATOM   8637  C  CA  . TYR D  1 275 ? 19.495  94.398  123.073 1.00 25.72  ? 275  TYR D CA  1 
ATOM   8638  C  C   . TYR D  1 275 ? 19.900  92.926  122.988 1.00 24.12  ? 275  TYR D C   1 
ATOM   8639  O  O   . TYR D  1 275 ? 20.636  92.431  123.836 1.00 26.06  ? 275  TYR D O   1 
ATOM   8640  C  CB  . TYR D  1 275 ? 20.598  95.325  122.533 1.00 27.64  ? 275  TYR D CB  1 
ATOM   8641  C  CG  . TYR D  1 275 ? 21.269  94.866  121.259 1.00 31.22  ? 275  TYR D CG  1 
ATOM   8642  C  CD1 . TYR D  1 275 ? 20.585  94.868  120.046 1.00 31.57  ? 275  TYR D CD1 1 
ATOM   8643  C  CD2 . TYR D  1 275 ? 22.586  94.407  121.275 1.00 30.19  ? 275  TYR D CD2 1 
ATOM   8644  C  CE1 . TYR D  1 275 ? 21.201  94.415  118.873 1.00 36.93  ? 275  TYR D CE1 1 
ATOM   8645  C  CE2 . TYR D  1 275 ? 23.209  93.957  120.119 1.00 37.25  ? 275  TYR D CE2 1 
ATOM   8646  C  CZ  . TYR D  1 275 ? 22.510  93.961  118.916 1.00 37.00  ? 275  TYR D CZ  1 
ATOM   8647  O  OH  . TYR D  1 275 ? 23.120  93.508  117.767 1.00 36.94  ? 275  TYR D OH  1 
ATOM   8648  N  N   . THR D  1 276 ? 19.388  92.237  121.972 1.00 20.31  ? 276  THR D N   1 
ATOM   8649  C  CA  . THR D  1 276 ? 19.685  90.828  121.726 1.00 20.71  ? 276  THR D CA  1 
ATOM   8650  C  C   . THR D  1 276 ? 20.307  90.774  120.331 1.00 20.65  ? 276  THR D C   1 
ATOM   8651  O  O   . THR D  1 276 ? 19.629  91.036  119.339 1.00 20.11  ? 276  THR D O   1 
ATOM   8652  C  CB  . THR D  1 276 ? 18.386  89.942  121.781 1.00 19.17  ? 276  THR D CB  1 
ATOM   8653  O  OG1 . THR D  1 276 ? 17.813  90.007  123.094 1.00 19.03  ? 276  THR D OG1 1 
ATOM   8654  C  CG2 . THR D  1 276 ? 18.707  88.499  121.469 1.00 15.00  ? 276  THR D CG2 1 
ATOM   8655  N  N   . ALA D  1 277 ? 21.603  90.452  120.281 1.00 24.78  ? 277  ALA D N   1 
ATOM   8656  C  CA  . ALA D  1 277 ? 22.390  90.382  119.041 1.00 23.83  ? 277  ALA D CA  1 
ATOM   8657  C  C   . ALA D  1 277 ? 21.869  89.336  118.077 1.00 23.75  ? 277  ALA D C   1 
ATOM   8658  O  O   . ALA D  1 277 ? 21.213  88.395  118.487 1.00 25.40  ? 277  ALA D O   1 
ATOM   8659  C  CB  . ALA D  1 277 ? 23.833  90.099  119.360 1.00 19.42  ? 277  ALA D CB  1 
ATOM   8660  N  N   . PRO D  1 278 ? 22.161  89.495  116.777 1.00 24.76  ? 278  PRO D N   1 
ATOM   8661  C  CA  . PRO D  1 278 ? 21.716  88.559  115.746 1.00 25.39  ? 278  PRO D CA  1 
ATOM   8662  C  C   . PRO D  1 278 ? 22.155  87.109  115.925 1.00 26.79  ? 278  PRO D C   1 
ATOM   8663  O  O   . PRO D  1 278 ? 21.476  86.204  115.458 1.00 33.19  ? 278  PRO D O   1 
ATOM   8664  C  CB  . PRO D  1 278 ? 22.247  89.187  114.456 1.00 24.59  ? 278  PRO D CB  1 
ATOM   8665  C  CG  . PRO D  1 278 ? 23.411  89.985  114.897 1.00 24.01  ? 278  PRO D CG  1 
ATOM   8666  C  CD  . PRO D  1 278 ? 22.923  90.599  116.171 1.00 26.81  ? 278  PRO D CD  1 
ATOM   8667  N  N   . SER D  1 279 ? 23.270  86.872  116.602 1.00 25.79  ? 279  SER D N   1 
ATOM   8668  C  CA  . SER D  1 279 ? 23.721  85.502  116.801 1.00 26.38  ? 279  SER D CA  1 
ATOM   8669  C  C   . SER D  1 279 ? 22.903  84.723  117.835 1.00 28.35  ? 279  SER D C   1 
ATOM   8670  O  O   . SER D  1 279 ? 23.069  83.508  117.967 1.00 30.55  ? 279  SER D O   1 
ATOM   8671  C  CB  . SER D  1 279 ? 25.193  85.475  117.204 1.00 24.03  ? 279  SER D CB  1 
ATOM   8672  O  OG  . SER D  1 279 ? 25.384  86.124  118.442 1.00 32.40  ? 279  SER D OG  1 
ATOM   8673  N  N   . LEU D  1 280 ? 22.018  85.407  118.560 1.00 29.60  ? 280  LEU D N   1 
ATOM   8674  C  CA  . LEU D  1 280 ? 21.190  84.755  119.582 1.00 27.22  ? 280  LEU D CA  1 
ATOM   8675  C  C   . LEU D  1 280 ? 19.791  84.478  119.088 1.00 30.17  ? 280  LEU D C   1 
ATOM   8676  O  O   . LEU D  1 280 ? 18.967  83.915  119.811 1.00 31.99  ? 280  LEU D O   1 
ATOM   8677  C  CB  . LEU D  1 280 ? 21.108  85.622  120.831 1.00 20.01  ? 280  LEU D CB  1 
ATOM   8678  C  CG  . LEU D  1 280 ? 22.495  85.871  121.415 1.00 26.77  ? 280  LEU D CG  1 
ATOM   8679  C  CD1 . LEU D  1 280 ? 22.418  86.710  122.690 1.00 24.05  ? 280  LEU D CD1 1 
ATOM   8680  C  CD2 . LEU D  1 280 ? 23.144  84.508  121.681 1.00 24.45  ? 280  LEU D CD2 1 
ATOM   8681  N  N   . ILE D  1 281 ? 19.533  84.867  117.845 1.00 30.88  ? 281  ILE D N   1 
ATOM   8682  C  CA  . ILE D  1 281 ? 18.221  84.693  117.246 1.00 30.93  ? 281  ILE D CA  1 
ATOM   8683  C  C   . ILE D  1 281 ? 18.280  83.684  116.097 1.00 30.24  ? 281  ILE D C   1 
ATOM   8684  O  O   . ILE D  1 281 ? 19.170  83.742  115.269 1.00 31.38  ? 281  ILE D O   1 
ATOM   8685  C  CB  . ILE D  1 281 ? 17.694  86.066  116.739 1.00 30.72  ? 281  ILE D CB  1 
ATOM   8686  C  CG1 . ILE D  1 281 ? 17.630  87.051  117.908 1.00 25.64  ? 281  ILE D CG1 1 
ATOM   8687  C  CG2 . ILE D  1 281 ? 16.339  85.909  116.074 1.00 26.61  ? 281  ILE D CG2 1 
ATOM   8688  C  CD1 . ILE D  1 281 ? 17.045  88.378  117.540 1.00 25.79  ? 281  ILE D CD1 1 
ATOM   8689  N  N   . THR D  1 282 ? 17.326  82.759  116.074 1.00 29.87  ? 282  THR D N   1 
ATOM   8690  C  CA  . THR D  1 282 ? 17.248  81.727  115.050 1.00 27.04  ? 282  THR D CA  1 
ATOM   8691  C  C   . THR D  1 282 ? 16.461  82.246  113.849 1.00 29.11  ? 282  THR D C   1 
ATOM   8692  O  O   . THR D  1 282 ? 16.937  82.195  112.711 1.00 28.93  ? 282  THR D O   1 
ATOM   8693  C  CB  . THR D  1 282 ? 16.542  80.458  115.599 1.00 28.96  ? 282  THR D CB  1 
ATOM   8694  O  OG1 . THR D  1 282 ? 17.096  80.104  116.876 1.00 28.62  ? 282  THR D OG1 1 
ATOM   8695  C  CG2 . THR D  1 282 ? 16.722  79.301  114.646 1.00 17.96  ? 282  THR D CG2 1 
ATOM   8696  N  N   . LEU D  1 283 ? 15.251  82.740  114.101 1.00 27.68  ? 283  LEU D N   1 
ATOM   8697  C  CA  . LEU D  1 283 ? 14.426  83.276  113.023 1.00 27.23  ? 283  LEU D CA  1 
ATOM   8698  C  C   . LEU D  1 283 ? 13.546  84.429  113.456 1.00 27.55  ? 283  LEU D C   1 
ATOM   8699  O  O   . LEU D  1 283 ? 13.130  84.509  114.607 1.00 29.48  ? 283  LEU D O   1 
ATOM   8700  C  CB  . LEU D  1 283 ? 13.522  82.190  112.442 1.00 26.51  ? 283  LEU D CB  1 
ATOM   8701  C  CG  . LEU D  1 283 ? 14.171  81.005  111.739 1.00 23.10  ? 283  LEU D CG  1 
ATOM   8702  C  CD1 . LEU D  1 283 ? 13.088  80.016  111.343 1.00 21.07  ? 283  LEU D CD1 1 
ATOM   8703  C  CD2 . LEU D  1 283 ? 14.938  81.486  110.526 1.00 21.54  ? 283  LEU D CD2 1 
ATOM   8704  N  N   . LEU D  1 284 ? 13.275  85.331  112.522 1.00 28.10  ? 284  LEU D N   1 
ATOM   8705  C  CA  . LEU D  1 284 ? 12.375  86.452  112.784 1.00 26.36  ? 284  LEU D CA  1 
ATOM   8706  C  C   . LEU D  1 284 ? 11.186  86.210  111.853 1.00 27.55  ? 284  LEU D C   1 
ATOM   8707  O  O   . LEU D  1 284 ? 11.374  86.018  110.652 1.00 30.18  ? 284  LEU D O   1 
ATOM   8708  C  CB  . LEU D  1 284 ? 13.016  87.804  112.435 1.00 21.92  ? 284  LEU D CB  1 
ATOM   8709  C  CG  . LEU D  1 284 ? 14.183  88.335  113.270 1.00 27.13  ? 284  LEU D CG  1 
ATOM   8710  C  CD1 . LEU D  1 284 ? 15.507  87.788  112.741 1.00 24.28  ? 284  LEU D CD1 1 
ATOM   8711  C  CD2 . LEU D  1 284 ? 14.194  89.856  113.221 1.00 22.53  ? 284  LEU D CD2 1 
ATOM   8712  N  N   . PHE D  1 285 ? 9.976   86.179  112.405 1.00 28.63  ? 285  PHE D N   1 
ATOM   8713  C  CA  . PHE D  1 285 ? 8.768   85.993  111.609 1.00 29.80  ? 285  PHE D CA  1 
ATOM   8714  C  C   . PHE D  1 285 ? 8.167   87.377  111.372 1.00 30.42  ? 285  PHE D C   1 
ATOM   8715  O  O   . PHE D  1 285 ? 7.769   88.073  112.289 1.00 32.15  ? 285  PHE D O   1 
ATOM   8716  C  CB  . PHE D  1 285 ? 7.801   85.048  112.331 1.00 29.82  ? 285  PHE D CB  1 
ATOM   8717  C  CG  . PHE D  1 285 ? 8.337   83.648  112.455 1.00 33.88  ? 285  PHE D CG  1 
ATOM   8718  C  CD1 . PHE D  1 285 ? 9.371   83.362  113.339 1.00 33.85  ? 285  PHE D CD1 1 
ATOM   8719  C  CD2 . PHE D  1 285 ? 7.860   82.629  111.638 1.00 34.80  ? 285  PHE D CD2 1 
ATOM   8720  C  CE1 . PHE D  1 285 ? 9.926   82.079  113.407 1.00 36.74  ? 285  PHE D CE1 1 
ATOM   8721  C  CE2 . PHE D  1 285 ? 8.407   81.347  111.700 1.00 35.74  ? 285  PHE D CE2 1 
ATOM   8722  C  CZ  . PHE D  1 285 ? 9.444   81.072  112.588 1.00 34.69  ? 285  PHE D CZ  1 
ATOM   8723  N  N   . THR D  1 286 ? 8.093   87.753  110.108 1.00 34.86  ? 286  THR D N   1 
ATOM   8724  C  CA  . THR D  1 286 ? 7.644   89.074  109.706 1.00 35.11  ? 286  THR D CA  1 
ATOM   8725  C  C   . THR D  1 286 ? 6.603   89.053  108.597 1.00 35.19  ? 286  THR D C   1 
ATOM   8726  O  O   . THR D  1 286 ? 6.463   88.056  107.886 1.00 35.78  ? 286  THR D O   1 
ATOM   8727  C  CB  . THR D  1 286 ? 8.884   89.831  109.213 1.00 35.96  ? 286  THR D CB  1 
ATOM   8728  O  OG1 . THR D  1 286 ? 9.777   90.019  110.318 1.00 38.22  ? 286  THR D OG1 1 
ATOM   8729  C  CG2 . THR D  1 286 ? 8.526   91.144  108.592 1.00 41.58  ? 286  THR D CG2 1 
ATOM   8730  N  N   . ASP D  1 287 ? 5.879   90.156  108.435 1.00 35.15  ? 287  ASP D N   1 
ATOM   8731  C  CA  . ASP D  1 287 ? 4.903   90.232  107.353 1.00 37.29  ? 287  ASP D CA  1 
ATOM   8732  C  C   . ASP D  1 287 ? 5.663   90.134  106.032 1.00 36.47  ? 287  ASP D C   1 
ATOM   8733  O  O   . ASP D  1 287 ? 5.112   89.721  105.013 1.00 39.61  ? 287  ASP D O   1 
ATOM   8734  C  CB  . ASP D  1 287 ? 4.087   91.533  107.408 1.00 36.49  ? 287  ASP D CB  1 
ATOM   8735  C  CG  . ASP D  1 287 ? 4.851   92.686  108.039 1.00 41.67  ? 287  ASP D CG  1 
ATOM   8736  O  OD1 . ASP D  1 287 ? 5.089   92.636  109.264 1.00 46.59  ? 287  ASP D OD1 1 
ATOM   8737  O  OD2 . ASP D  1 287 ? 5.210   93.644  107.320 1.00 37.50  ? 287  ASP D OD2 1 
ATOM   8738  N  N   . LEU D  1 288 ? 6.941   90.492  106.073 1.00 36.52  ? 288  LEU D N   1 
ATOM   8739  C  CA  . LEU D  1 288 ? 7.815   90.441  104.903 1.00 37.72  ? 288  LEU D CA  1 
ATOM   8740  C  C   . LEU D  1 288 ? 8.362   89.039  104.644 1.00 36.84  ? 288  LEU D C   1 
ATOM   8741  O  O   . LEU D  1 288 ? 9.062   88.826  103.661 1.00 35.23  ? 288  LEU D O   1 
ATOM   8742  C  CB  . LEU D  1 288 ? 9.006   91.392  105.080 1.00 38.62  ? 288  LEU D CB  1 
ATOM   8743  C  CG  . LEU D  1 288 ? 8.712   92.872  105.353 1.00 42.45  ? 288  LEU D CG  1 
ATOM   8744  C  CD1 . LEU D  1 288 ? 10.033  93.649  105.398 1.00 39.42  ? 288  LEU D CD1 1 
ATOM   8745  C  CD2 . LEU D  1 288 ? 7.781   93.432  104.269 1.00 35.49  ? 288  LEU D CD2 1 
ATOM   8746  N  N   . GLY D  1 289 ? 8.054   88.094  105.531 1.00 36.87  ? 289  GLY D N   1 
ATOM   8747  C  CA  . GLY D  1 289 ? 8.552   86.735  105.375 1.00 33.86  ? 289  GLY D CA  1 
ATOM   8748  C  C   . GLY D  1 289 ? 9.355   86.222  106.567 1.00 32.21  ? 289  GLY D C   1 
ATOM   8749  O  O   . GLY D  1 289 ? 9.602   86.953  107.526 1.00 32.78  ? 289  GLY D O   1 
ATOM   8750  N  N   . VAL D  1 290 ? 9.760   84.956  106.499 1.00 31.35  ? 290  VAL D N   1 
ATOM   8751  C  CA  . VAL D  1 290 ? 10.544  84.306  107.556 1.00 30.35  ? 290  VAL D CA  1 
ATOM   8752  C  C   . VAL D  1 290 ? 12.016  84.593  107.268 1.00 31.26  ? 290  VAL D C   1 
ATOM   8753  O  O   . VAL D  1 290 ? 12.604  84.010  106.369 1.00 29.10  ? 290  VAL D O   1 
ATOM   8754  C  CB  . VAL D  1 290 ? 10.273  82.773  107.567 1.00 27.61  ? 290  VAL D CB  1 
ATOM   8755  C  CG1 . VAL D  1 290 ? 11.080  82.090  108.651 1.00 26.45  ? 290  VAL D CG1 1 
ATOM   8756  C  CG2 . VAL D  1 290 ? 8.797   82.522  107.790 1.00 24.51  ? 290  VAL D CG2 1 
ATOM   8757  N  N   . LEU D  1 291 ? 12.603  85.494  108.051 1.00 34.78  ? 291  LEU D N   1 
ATOM   8758  C  CA  . LEU D  1 291 ? 13.985  85.920  107.846 1.00 35.03  ? 291  LEU D CA  1 
ATOM   8759  C  C   . LEU D  1 291 ? 14.983  85.543  108.922 1.00 35.92  ? 291  LEU D C   1 
ATOM   8760  O  O   . LEU D  1 291 ? 14.682  85.578  110.117 1.00 38.31  ? 291  LEU D O   1 
ATOM   8761  C  CB  . LEU D  1 291 ? 14.047  87.443  107.729 1.00 35.01  ? 291  LEU D CB  1 
ATOM   8762  C  CG  . LEU D  1 291 ? 12.837  88.209  107.201 1.00 34.66  ? 291  LEU D CG  1 
ATOM   8763  C  CD1 . LEU D  1 291 ? 12.978  89.693  107.495 1.00 25.99  ? 291  LEU D CD1 1 
ATOM   8764  C  CD2 . LEU D  1 291 ? 12.732  87.962  105.708 1.00 36.79  ? 291  LEU D CD2 1 
ATOM   8765  N  N   . THR D  1 292 ? 16.190  85.218  108.478 1.00 33.13  ? 292  THR D N   1 
ATOM   8766  C  CA  . THR D  1 292 ? 17.289  84.925  109.378 1.00 32.51  ? 292  THR D CA  1 
ATOM   8767  C  C   . THR D  1 292 ? 17.893  86.322  109.612 1.00 33.05  ? 292  THR D C   1 
ATOM   8768  O  O   . THR D  1 292 ? 17.806  87.178  108.732 1.00 33.67  ? 292  THR D O   1 
ATOM   8769  C  CB  . THR D  1 292 ? 18.329  84.008  108.701 1.00 30.91  ? 292  THR D CB  1 
ATOM   8770  O  OG1 . THR D  1 292 ? 18.815  84.625  107.505 1.00 33.99  ? 292  THR D OG1 1 
ATOM   8771  C  CG2 . THR D  1 292 ? 17.703  82.688  108.352 1.00 26.27  ? 292  THR D CG2 1 
ATOM   8772  N  N   . PRO D  1 293 ? 18.509  86.571  110.784 1.00 33.15  ? 293  PRO D N   1 
ATOM   8773  C  CA  . PRO D  1 293 ? 19.107  87.876  111.108 1.00 33.40  ? 293  PRO D CA  1 
ATOM   8774  C  C   . PRO D  1 293 ? 19.897  88.602  110.004 1.00 34.83  ? 293  PRO D C   1 
ATOM   8775  O  O   . PRO D  1 293 ? 19.764  89.812  109.848 1.00 37.97  ? 293  PRO D O   1 
ATOM   8776  C  CB  . PRO D  1 293 ? 19.961  87.562  112.323 1.00 34.23  ? 293  PRO D CB  1 
ATOM   8777  C  CG  . PRO D  1 293 ? 19.154  86.515  113.014 1.00 32.93  ? 293  PRO D CG  1 
ATOM   8778  C  CD  . PRO D  1 293 ? 18.757  85.608  111.871 1.00 32.10  ? 293  PRO D CD  1 
ATOM   8779  N  N   . SER D  1 294 ? 20.706  87.877  109.240 1.00 33.84  ? 294  SER D N   1 
ATOM   8780  C  CA  . SER D  1 294 ? 21.487  88.486  108.160 1.00 34.04  ? 294  SER D CA  1 
ATOM   8781  C  C   . SER D  1 294 ? 20.633  89.055  107.027 1.00 33.40  ? 294  SER D C   1 
ATOM   8782  O  O   . SER D  1 294 ? 20.990  90.053  106.408 1.00 33.35  ? 294  SER D O   1 
ATOM   8783  C  CB  . SER D  1 294 ? 22.453  87.461  107.574 1.00 35.19  ? 294  SER D CB  1 
ATOM   8784  O  OG  . SER D  1 294 ? 23.512  87.205  108.476 1.00 39.33  ? 294  SER D OG  1 
ATOM   8785  N  N   . ALA D  1 295 ? 19.511  88.402  106.756 1.00 32.06  ? 295  ALA D N   1 
ATOM   8786  C  CA  . ALA D  1 295 ? 18.598  88.810  105.699 1.00 31.82  ? 295  ALA D CA  1 
ATOM   8787  C  C   . ALA D  1 295 ? 17.832  90.082  106.026 1.00 31.88  ? 295  ALA D C   1 
ATOM   8788  O  O   . ALA D  1 295 ? 17.202  90.684  105.153 1.00 34.63  ? 295  ALA D O   1 
ATOM   8789  C  CB  . ALA D  1 295 ? 17.611  87.685  105.415 1.00 31.86  ? 295  ALA D CB  1 
ATOM   8790  N  N   . VAL D  1 296 ? 17.887  90.499  107.280 1.00 30.95  ? 296  VAL D N   1 
ATOM   8791  C  CA  . VAL D  1 296 ? 17.156  91.680  107.692 1.00 30.83  ? 296  VAL D CA  1 
ATOM   8792  C  C   . VAL D  1 296 ? 17.642  92.963  107.025 1.00 33.24  ? 296  VAL D C   1 
ATOM   8793  O  O   . VAL D  1 296 ? 16.828  93.812  106.651 1.00 35.91  ? 296  VAL D O   1 
ATOM   8794  C  CB  . VAL D  1 296 ? 17.188  91.834  109.235 1.00 29.70  ? 296  VAL D CB  1 
ATOM   8795  C  CG1 . VAL D  1 296 ? 16.731  93.221  109.636 1.00 24.81  ? 296  VAL D CG1 1 
ATOM   8796  C  CG2 . VAL D  1 296 ? 16.288  90.780  109.878 1.00 21.47  ? 296  VAL D CG2 1 
ATOM   8797  N  N   . SER D  1 297 ? 18.948  93.117  106.850 1.00 29.91  ? 297  SER D N   1 
ATOM   8798  C  CA  . SER D  1 297 ? 19.426  94.341  106.240 1.00 31.58  ? 297  SER D CA  1 
ATOM   8799  C  C   . SER D  1 297 ? 18.872  94.553  104.816 1.00 34.54  ? 297  SER D C   1 
ATOM   8800  O  O   . SER D  1 297 ? 18.603  95.696  104.430 1.00 34.57  ? 297  SER D O   1 
ATOM   8801  C  CB  . SER D  1 297 ? 20.962  94.396  106.270 1.00 27.58  ? 297  SER D CB  1 
ATOM   8802  O  OG  . SER D  1 297 ? 21.529  93.241  105.701 1.00 31.59  ? 297  SER D OG  1 
ATOM   8803  N  N   . ASP D  1 298 ? 18.683  93.479  104.040 1.00 34.03  ? 298  ASP D N   1 
ATOM   8804  C  CA  . ASP D  1 298 ? 18.135  93.626  102.685 1.00 33.12  ? 298  ASP D CA  1 
ATOM   8805  C  C   . ASP D  1 298 ? 16.637  93.945  102.705 1.00 32.34  ? 298  ASP D C   1 
ATOM   8806  O  O   . ASP D  1 298 ? 16.156  94.708  101.884 1.00 31.07  ? 298  ASP D O   1 
ATOM   8807  C  CB  . ASP D  1 298 ? 18.363  92.372  101.845 1.00 37.34  ? 298  ASP D CB  1 
ATOM   8808  C  CG  . ASP D  1 298 ? 19.834  92.019  101.703 1.00 45.89  ? 298  ASP D CG  1 
ATOM   8809  O  OD1 . ASP D  1 298 ? 20.332  91.218  102.535 1.00 52.30  ? 298  ASP D OD1 1 
ATOM   8810  O  OD2 . ASP D  1 298 ? 20.489  92.544  100.767 1.00 45.25  ? 298  ASP D OD2 1 
ATOM   8811  N  N   . GLU D  1 299 ? 15.896  93.361  103.640 1.00 33.24  ? 299  GLU D N   1 
ATOM   8812  C  CA  . GLU D  1 299 ? 14.472  93.649  103.745 1.00 35.49  ? 299  GLU D CA  1 
ATOM   8813  C  C   . GLU D  1 299 ? 14.236  95.074  104.271 1.00 36.06  ? 299  GLU D C   1 
ATOM   8814  O  O   . GLU D  1 299 ? 13.272  95.740  103.884 1.00 35.48  ? 299  GLU D O   1 
ATOM   8815  C  CB  . GLU D  1 299 ? 13.787  92.647  104.677 1.00 37.70  ? 299  GLU D CB  1 
ATOM   8816  C  CG  . GLU D  1 299 ? 13.738  91.231  104.135 1.00 45.85  ? 299  GLU D CG  1 
ATOM   8817  C  CD  . GLU D  1 299 ? 13.221  91.160  102.697 1.00 50.28  ? 299  GLU D CD  1 
ATOM   8818  O  OE1 . GLU D  1 299 ? 12.100  91.649  102.414 1.00 52.88  ? 299  GLU D OE1 1 
ATOM   8819  O  OE2 . GLU D  1 299 ? 13.945  90.607  101.843 1.00 52.58  ? 299  GLU D OE2 1 
ATOM   8820  N  N   . LEU D  1 300 ? 15.125  95.533  105.153 1.00 35.50  ? 300  LEU D N   1 
ATOM   8821  C  CA  . LEU D  1 300 ? 15.018  96.866  105.740 1.00 32.98  ? 300  LEU D CA  1 
ATOM   8822  C  C   . LEU D  1 300 ? 15.270  97.955  104.696 1.00 33.09  ? 300  LEU D C   1 
ATOM   8823  O  O   . LEU D  1 300 ? 14.702  99.052  104.791 1.00 32.10  ? 300  LEU D O   1 
ATOM   8824  C  CB  . LEU D  1 300 ? 15.991  97.002  106.916 1.00 28.73  ? 300  LEU D CB  1 
ATOM   8825  C  CG  . LEU D  1 300 ? 15.839  98.250  107.786 1.00 27.61  ? 300  LEU D CG  1 
ATOM   8826  C  CD1 . LEU D  1 300 ? 16.287  97.931  109.194 1.00 21.53  ? 300  LEU D CD1 1 
ATOM   8827  C  CD2 . LEU D  1 300 ? 16.618  99.419  107.197 1.00 24.11  ? 300  LEU D CD2 1 
ATOM   8828  N  N   . ILE D  1 301 ? 16.114  97.651  103.709 1.00 29.75  ? 301  ILE D N   1 
ATOM   8829  C  CA  . ILE D  1 301 ? 16.401  98.595  102.629 1.00 33.38  ? 301  ILE D CA  1 
ATOM   8830  C  C   . ILE D  1 301 ? 15.158  98.623  101.723 1.00 34.89  ? 301  ILE D C   1 
ATOM   8831  O  O   . ILE D  1 301 ? 14.607  99.684  101.407 1.00 34.27  ? 301  ILE D O   1 
ATOM   8832  C  CB  . ILE D  1 301 ? 17.633  98.151  101.754 1.00 31.38  ? 301  ILE D CB  1 
ATOM   8833  C  CG1 . ILE D  1 301 ? 18.909  98.120  102.593 1.00 31.02  ? 301  ILE D CG1 1 
ATOM   8834  C  CG2 . ILE D  1 301 ? 17.845  99.117  100.605 1.00 21.93  ? 301  ILE D CG2 1 
ATOM   8835  C  CD1 . ILE D  1 301 ? 20.119  97.550  101.854 1.00 25.37  ? 301  ILE D CD1 1 
ATOM   8836  N  N   . LYS D  1 302 ? 14.728  97.439  101.311 1.00 34.03  ? 302  LYS D N   1 
ATOM   8837  C  CA  . LYS D  1 302 ? 13.561  97.309  100.455 1.00 37.32  ? 302  LYS D CA  1 
ATOM   8838  C  C   . LYS D  1 302 ? 12.335  97.997  101.097 1.00 37.18  ? 302  LYS D C   1 
ATOM   8839  O  O   . LYS D  1 302 ? 11.577  98.696  100.432 1.00 36.97  ? 302  LYS D O   1 
ATOM   8840  C  CB  . LYS D  1 302 ? 13.323  95.820  100.188 1.00 37.58  ? 302  LYS D CB  1 
ATOM   8841  C  CG  . LYS D  1 302 ? 11.994  95.440  99.567  1.00 46.89  ? 302  LYS D CG  1 
ATOM   8842  C  CD  . LYS D  1 302 ? 11.918  93.905  99.398  1.00 52.02  ? 302  LYS D CD  1 
ATOM   8843  C  CE  . LYS D  1 302 ? 10.482  93.384  99.241  1.00 50.79  ? 302  LYS D CE  1 
ATOM   8844  N  NZ  . LYS D  1 302 ? 9.840   93.799  97.966  1.00 53.70  ? 302  LYS D NZ  1 
ATOM   8845  N  N   . LEU D  1 303 ? 12.165  97.825  102.401 1.00 37.33  ? 303  LEU D N   1 
ATOM   8846  C  CA  . LEU D  1 303 ? 11.045  98.431  103.112 1.00 34.79  ? 303  LEU D CA  1 
ATOM   8847  C  C   . LEU D  1 303 ? 11.125  99.949  103.042 1.00 35.00  ? 303  LEU D C   1 
ATOM   8848  O  O   . LEU D  1 303 ? 10.207  100.606 102.559 1.00 33.92  ? 303  LEU D O   1 
ATOM   8849  C  CB  . LEU D  1 303 ? 11.075  97.993  104.574 1.00 34.19  ? 303  LEU D CB  1 
ATOM   8850  C  CG  . LEU D  1 303 ? 9.808   97.911  105.429 1.00 34.65  ? 303  LEU D CG  1 
ATOM   8851  C  CD1 . LEU D  1 303 ? 10.029  98.722  106.689 1.00 33.79  ? 303  LEU D CD1 1 
ATOM   8852  C  CD2 . LEU D  1 303 ? 8.596   98.396  104.661 1.00 38.44  ? 303  LEU D CD2 1 
ATOM   8853  N  N   . TYR D  1 304 ? 12.237  100.491 103.530 1.00 36.09  ? 304  TYR D N   1 
ATOM   8854  C  CA  . TYR D  1 304 ? 12.477  101.931 103.560 1.00 34.85  ? 304  TYR D CA  1 
ATOM   8855  C  C   . TYR D  1 304 ? 12.601  102.620 102.196 1.00 39.95  ? 304  TYR D C   1 
ATOM   8856  O  O   . TYR D  1 304 ? 12.435  103.842 102.103 1.00 43.10  ? 304  TYR D O   1 
ATOM   8857  C  CB  . TYR D  1 304 ? 13.717  102.223 104.395 1.00 28.51  ? 304  TYR D CB  1 
ATOM   8858  C  CG  . TYR D  1 304 ? 13.456  102.317 105.878 1.00 24.41  ? 304  TYR D CG  1 
ATOM   8859  C  CD1 . TYR D  1 304 ? 13.375  103.556 106.498 1.00 23.94  ? 304  TYR D CD1 1 
ATOM   8860  C  CD2 . TYR D  1 304 ? 13.273  101.174 106.659 1.00 20.06  ? 304  TYR D CD2 1 
ATOM   8861  C  CE1 . TYR D  1 304 ? 13.116  103.674 107.846 1.00 22.36  ? 304  TYR D CE1 1 
ATOM   8862  C  CE2 . TYR D  1 304 ? 13.012  101.281 108.017 1.00 19.00  ? 304  TYR D CE2 1 
ATOM   8863  C  CZ  . TYR D  1 304 ? 12.933  102.541 108.604 1.00 22.35  ? 304  TYR D CZ  1 
ATOM   8864  O  OH  . TYR D  1 304 ? 12.659  102.700 109.946 1.00 30.22  ? 304  TYR D OH  1 
ATOM   8865  N  N   . LEU D  1 305 ? 12.904  101.865 101.142 1.00 42.53  ? 305  LEU D N   1 
ATOM   8866  C  CA  . LEU D  1 305 ? 13.003  102.469 99.815  1.00 44.60  ? 305  LEU D CA  1 
ATOM   8867  C  C   . LEU D  1 305 ? 11.678  102.363 99.078  1.00 49.80  ? 305  LEU D C   1 
ATOM   8868  O  O   . LEU D  1 305 ? 11.248  103.320 98.433  1.00 51.55  ? 305  LEU D O   1 
ATOM   8869  C  CB  . LEU D  1 305 ? 14.111  101.822 98.984  1.00 39.67  ? 305  LEU D CB  1 
ATOM   8870  C  CG  . LEU D  1 305 ? 15.511  102.360 99.292  1.00 38.80  ? 305  LEU D CG  1 
ATOM   8871  C  CD1 . LEU D  1 305 ? 16.495  101.745 98.343  1.00 37.17  ? 305  LEU D CD1 1 
ATOM   8872  C  CD2 . LEU D  1 305 ? 15.539  103.881 99.161  1.00 36.84  ? 305  LEU D CD2 1 
ATOM   8873  N  N   . ALA D  1 306 ? 11.032  101.203 99.184  1.00 54.80  ? 306  ALA D N   1 
ATOM   8874  C  CA  . ALA D  1 306 ? 9.740   100.977 98.539  1.00 57.80  ? 306  ALA D CA  1 
ATOM   8875  C  C   . ALA D  1 306 ? 8.882   102.220 98.709  1.00 59.49  ? 306  ALA D C   1 
ATOM   8876  O  O   . ALA D  1 306 ? 8.486   102.557 99.828  1.00 58.97  ? 306  ALA D O   1 
ATOM   8877  C  CB  . ALA D  1 306 ? 9.042   99.774  99.159  1.00 58.42  ? 306  ALA D CB  1 
ATOM   8878  N  N   . ALA D  1 307 ? 8.624   102.897 97.589  1.00 62.04  ? 307  ALA D N   1 
ATOM   8879  C  CA  . ALA D  1 307 ? 7.828   104.128 97.549  1.00 62.65  ? 307  ALA D CA  1 
ATOM   8880  C  C   . ALA D  1 307 ? 7.855   104.748 96.140  1.00 61.25  ? 307  ALA D C   1 
ATOM   8881  O  O   . ALA D  1 307 ? 8.955   104.808 95.539  1.00 57.85  ? 307  ALA D O   1 
ATOM   8882  C  CB  . ALA D  1 307 ? 8.360   105.142 98.587  1.00 64.15  ? 307  ALA D CB  1 
HETATM 8883  N  N   . MSE E  1 1   ? 15.184  66.840  174.287 1.00 104.00 ? 1    MSE E N   1 
HETATM 8884  C  CA  . MSE E  1 1   ? 14.626  68.171  173.908 1.00 104.67 ? 1    MSE E CA  1 
HETATM 8885  C  C   . MSE E  1 1   ? 13.434  68.014  172.966 1.00 103.32 ? 1    MSE E C   1 
HETATM 8886  O  O   . MSE E  1 1   ? 13.307  67.000  172.281 1.00 103.39 ? 1    MSE E O   1 
HETATM 8887  C  CB  . MSE E  1 1   ? 15.717  69.014  173.247 1.00 107.66 ? 1    MSE E CB  1 
HETATM 8888  C  CG  . MSE E  1 1   ? 15.278  70.393  172.786 1.00 110.76 ? 1    MSE E CG  1 
HETATM 8889  SE SE  . MSE E  1 1   ? 16.781  71.423  172.121 1.00 116.62 ? 1    MSE E SE  1 
HETATM 8890  C  CE  . MSE E  1 1   ? 16.263  73.172  172.770 1.00 115.47 ? 1    MSE E CE  1 
ATOM   8891  N  N   . ASP E  1 2   ? 12.567  69.022  172.933 1.00 101.72 ? 2    ASP E N   1 
ATOM   8892  C  CA  . ASP E  1 2   ? 11.369  68.996  172.092 1.00 100.60 ? 2    ASP E CA  1 
ATOM   8893  C  C   . ASP E  1 2   ? 11.556  69.549  170.673 1.00 98.61  ? 2    ASP E C   1 
ATOM   8894  O  O   . ASP E  1 2   ? 12.504  70.281  170.394 1.00 97.95  ? 2    ASP E O   1 
ATOM   8895  C  CB  . ASP E  1 2   ? 10.242  69.761  172.795 1.00 101.56 ? 2    ASP E CB  1 
ATOM   8896  C  CG  . ASP E  1 2   ? 9.069   70.059  171.875 1.00 102.71 ? 2    ASP E CG  1 
ATOM   8897  O  OD1 . ASP E  1 2   ? 8.445   69.102  171.365 1.00 103.11 ? 2    ASP E OD1 1 
ATOM   8898  O  OD2 . ASP E  1 2   ? 8.775   71.255  171.662 1.00 103.25 ? 2    ASP E OD2 1 
ATOM   8899  N  N   . ASP E  1 3   ? 10.633  69.193  169.784 1.00 96.97  ? 3    ASP E N   1 
ATOM   8900  C  CA  . ASP E  1 3   ? 10.672  69.650  168.400 1.00 94.79  ? 3    ASP E CA  1 
ATOM   8901  C  C   . ASP E  1 3   ? 10.324  71.132  168.298 1.00 92.28  ? 3    ASP E C   1 
ATOM   8902  O  O   . ASP E  1 3   ? 11.115  71.922  167.786 1.00 92.31  ? 3    ASP E O   1 
ATOM   8903  C  CB  . ASP E  1 3   ? 9.698   68.837  167.546 1.00 95.43  ? 3    ASP E CB  1 
ATOM   8904  C  CG  . ASP E  1 3   ? 9.916   67.348  167.683 1.00 97.60  ? 3    ASP E CG  1 
ATOM   8905  O  OD1 . ASP E  1 3   ? 11.081  66.909  167.584 1.00 98.76  ? 3    ASP E OD1 1 
ATOM   8906  O  OD2 . ASP E  1 3   ? 8.925   66.617  167.890 1.00 98.54  ? 3    ASP E OD2 1 
ATOM   8907  N  N   . LYS E  1 4   ? 9.143   71.507  168.782 1.00 89.05  ? 4    LYS E N   1 
ATOM   8908  C  CA  . LYS E  1 4   ? 8.725   72.903  168.733 1.00 86.20  ? 4    LYS E CA  1 
ATOM   8909  C  C   . LYS E  1 4   ? 9.774   73.787  169.396 1.00 85.01  ? 4    LYS E C   1 
ATOM   8910  O  O   . LYS E  1 4   ? 9.916   74.959  169.050 1.00 84.19  ? 4    LYS E O   1 
ATOM   8911  C  CB  . LYS E  1 4   ? 7.377   73.092  169.428 1.00 85.96  ? 4    LYS E CB  1 
ATOM   8912  C  CG  . LYS E  1 4   ? 6.920   74.542  169.482 1.00 87.51  ? 4    LYS E CG  1 
ATOM   8913  C  CD  . LYS E  1 4   ? 5.512   74.668  170.031 1.00 87.16  ? 4    LYS E CD  1 
ATOM   8914  C  CE  . LYS E  1 4   ? 5.421   74.105  171.434 1.00 88.53  ? 4    LYS E CE  1 
ATOM   8915  N  NZ  . LYS E  1 4   ? 4.024   74.135  171.942 1.00 89.23  ? 4    LYS E NZ  1 
ATOM   8916  N  N   . GLU E  1 5   ? 10.503  73.223  170.354 1.00 83.29  ? 5    GLU E N   1 
ATOM   8917  C  CA  . GLU E  1 5   ? 11.559  73.960  171.036 1.00 82.15  ? 5    GLU E CA  1 
ATOM   8918  C  C   . GLU E  1 5   ? 12.792  73.901  170.152 1.00 79.85  ? 5    GLU E C   1 
ATOM   8919  O  O   . GLU E  1 5   ? 13.520  74.884  170.002 1.00 78.70  ? 5    GLU E O   1 
ATOM   8920  C  CB  . GLU E  1 5   ? 11.889  73.323  172.379 1.00 83.55  ? 5    GLU E CB  1 
ATOM   8921  C  CG  . GLU E  1 5   ? 10.775  73.387  173.384 1.00 87.07  ? 5    GLU E CG  1 
ATOM   8922  C  CD  . GLU E  1 5   ? 11.210  72.850  174.726 1.00 89.64  ? 5    GLU E CD  1 
ATOM   8923  O  OE1 . GLU E  1 5   ? 11.545  71.647  174.800 1.00 90.67  ? 5    GLU E OE1 1 
ATOM   8924  O  OE2 . GLU E  1 5   ? 11.227  73.635  175.702 1.00 90.26  ? 5    GLU E OE2 1 
ATOM   8925  N  N   . LEU E  1 6   ? 13.018  72.725  169.577 1.00 76.16  ? 6    LEU E N   1 
ATOM   8926  C  CA  . LEU E  1 6   ? 14.142  72.503  168.688 1.00 72.62  ? 6    LEU E CA  1 
ATOM   8927  C  C   . LEU E  1 6   ? 14.112  73.620  167.658 1.00 72.33  ? 6    LEU E C   1 
ATOM   8928  O  O   . LEU E  1 6   ? 15.149  74.144  167.254 1.00 73.90  ? 6    LEU E O   1 
ATOM   8929  C  CB  . LEU E  1 6   ? 13.979  71.162  167.979 1.00 70.47  ? 6    LEU E CB  1 
ATOM   8930  C  CG  . LEU E  1 6   ? 15.141  70.173  167.878 1.00 70.31  ? 6    LEU E CG  1 
ATOM   8931  C  CD1 . LEU E  1 6   ? 14.703  69.064  166.951 1.00 68.18  ? 6    LEU E CD1 1 
ATOM   8932  C  CD2 . LEU E  1 6   ? 16.407  70.829  167.349 1.00 69.30  ? 6    LEU E CD2 1 
ATOM   8933  N  N   . ILE E  1 7   ? 12.901  73.981  167.245 1.00 71.42  ? 7    ILE E N   1 
ATOM   8934  C  CA  . ILE E  1 7   ? 12.695  75.026  166.251 1.00 70.76  ? 7    ILE E CA  1 
ATOM   8935  C  C   . ILE E  1 7   ? 12.888  76.415  166.845 1.00 70.99  ? 7    ILE E C   1 
ATOM   8936  O  O   . ILE E  1 7   ? 13.542  77.270  166.247 1.00 70.30  ? 7    ILE E O   1 
ATOM   8937  C  CB  . ILE E  1 7   ? 11.275  74.955  165.660 1.00 70.11  ? 7    ILE E CB  1 
ATOM   8938  C  CG1 . ILE E  1 7   ? 10.969  73.527  165.201 1.00 68.95  ? 7    ILE E CG1 1 
ATOM   8939  C  CG2 . ILE E  1 7   ? 11.155  75.932  164.495 1.00 71.47  ? 7    ILE E CG2 1 
ATOM   8940  C  CD1 . ILE E  1 7   ? 9.550   73.335  164.707 1.00 70.42  ? 7    ILE E CD1 1 
ATOM   8941  N  N   . GLU E  1 8   ? 12.301  76.636  168.018 1.00 71.76  ? 8    GLU E N   1 
ATOM   8942  C  CA  . GLU E  1 8   ? 12.408  77.920  168.697 1.00 71.92  ? 8    GLU E CA  1 
ATOM   8943  C  C   . GLU E  1 8   ? 13.873  78.219  169.001 1.00 69.83  ? 8    GLU E C   1 
ATOM   8944  O  O   . GLU E  1 8   ? 14.331  79.347  168.825 1.00 70.45  ? 8    GLU E O   1 
ATOM   8945  C  CB  . GLU E  1 8   ? 11.583  77.905  169.992 1.00 74.58  ? 8    GLU E CB  1 
ATOM   8946  C  CG  . GLU E  1 8   ? 10.083  77.735  169.756 1.00 79.97  ? 8    GLU E CG  1 
ATOM   8947  C  CD  . GLU E  1 8   ? 9.286   77.492  171.035 1.00 82.63  ? 8    GLU E CD  1 
ATOM   8948  O  OE1 . GLU E  1 8   ? 9.553   76.487  171.738 1.00 83.94  ? 8    GLU E OE1 1 
ATOM   8949  O  OE2 . GLU E  1 8   ? 8.384   78.306  171.332 1.00 82.31  ? 8    GLU E OE2 1 
ATOM   8950  N  N   . TYR E  1 9   ? 14.605  77.202  169.445 1.00 66.38  ? 9    TYR E N   1 
ATOM   8951  C  CA  . TYR E  1 9   ? 16.013  77.369  169.764 1.00 65.26  ? 9    TYR E CA  1 
ATOM   8952  C  C   . TYR E  1 9   ? 16.763  77.739  168.500 1.00 66.31  ? 9    TYR E C   1 
ATOM   8953  O  O   . TYR E  1 9   ? 17.630  78.617  168.500 1.00 66.25  ? 9    TYR E O   1 
ATOM   8954  C  CB  . TYR E  1 9   ? 16.598  76.074  170.315 1.00 65.22  ? 9    TYR E CB  1 
ATOM   8955  C  CG  . TYR E  1 9   ? 18.022  76.232  170.776 1.00 65.22  ? 9    TYR E CG  1 
ATOM   8956  C  CD1 . TYR E  1 9   ? 18.308  76.691  172.058 1.00 65.28  ? 9    TYR E CD1 1 
ATOM   8957  C  CD2 . TYR E  1 9   ? 19.088  75.976  169.913 1.00 66.22  ? 9    TYR E CD2 1 
ATOM   8958  C  CE1 . TYR E  1 9   ? 19.623  76.895  172.474 1.00 64.56  ? 9    TYR E CE1 1 
ATOM   8959  C  CE2 . TYR E  1 9   ? 20.412  76.180  170.318 1.00 65.31  ? 9    TYR E CE2 1 
ATOM   8960  C  CZ  . TYR E  1 9   ? 20.667  76.640  171.602 1.00 63.31  ? 9    TYR E CZ  1 
ATOM   8961  O  OH  . TYR E  1 9   ? 21.957  76.850  172.016 1.00 58.35  ? 9    TYR E OH  1 
ATOM   8962  N  N   . PHE E  1 10  ? 16.421  77.045  167.422 1.00 66.22  ? 10   PHE E N   1 
ATOM   8963  C  CA  . PHE E  1 10  ? 17.037  77.262  166.125 1.00 64.81  ? 10   PHE E CA  1 
ATOM   8964  C  C   . PHE E  1 10  ? 16.734  78.648  165.564 1.00 63.19  ? 10   PHE E C   1 
ATOM   8965  O  O   . PHE E  1 10  ? 17.637  79.364  165.144 1.00 61.89  ? 10   PHE E O   1 
ATOM   8966  C  CB  . PHE E  1 10  ? 16.555  76.197  165.136 1.00 67.71  ? 10   PHE E CB  1 
ATOM   8967  C  CG  . PHE E  1 10  ? 16.994  76.445  163.718 1.00 70.59  ? 10   PHE E CG  1 
ATOM   8968  C  CD1 . PHE E  1 10  ? 18.328  76.288  163.350 1.00 70.65  ? 10   PHE E CD1 1 
ATOM   8969  C  CD2 . PHE E  1 10  ? 16.076  76.859  162.757 1.00 71.18  ? 10   PHE E CD2 1 
ATOM   8970  C  CE1 . PHE E  1 10  ? 18.742  76.540  162.053 1.00 71.83  ? 10   PHE E CE1 1 
ATOM   8971  C  CE2 . PHE E  1 10  ? 16.479  77.115  161.454 1.00 73.19  ? 10   PHE E CE2 1 
ATOM   8972  C  CZ  . PHE E  1 10  ? 17.816  76.955  161.099 1.00 73.69  ? 10   PHE E CZ  1 
ATOM   8973  N  N   . LYS E  1 11  ? 15.463  79.026  165.547 1.00 62.24  ? 11   LYS E N   1 
ATOM   8974  C  CA  . LYS E  1 11  ? 15.104  80.326  165.011 1.00 63.14  ? 11   LYS E CA  1 
ATOM   8975  C  C   . LYS E  1 11  ? 15.711  81.463  165.824 1.00 61.38  ? 11   LYS E C   1 
ATOM   8976  O  O   . LYS E  1 11  ? 16.150  82.468  165.266 1.00 60.67  ? 11   LYS E O   1 
ATOM   8977  C  CB  . LYS E  1 11  ? 13.576  80.458  164.917 1.00 65.39  ? 11   LYS E CB  1 
ATOM   8978  C  CG  . LYS E  1 11  ? 12.978  79.575  163.812 1.00 69.27  ? 11   LYS E CG  1 
ATOM   8979  C  CD  . LYS E  1 11  ? 11.525  79.919  163.475 1.00 71.88  ? 11   LYS E CD  1 
ATOM   8980  C  CE  . LYS E  1 11  ? 10.585  79.620  164.638 1.00 76.04  ? 11   LYS E CE  1 
ATOM   8981  N  NZ  . LYS E  1 11  ? 9.147   79.865  164.300 1.00 75.00  ? 11   LYS E NZ  1 
ATOM   8982  N  N   . SER E  1 12  ? 15.766  81.290  167.139 1.00 59.38  ? 12   SER E N   1 
ATOM   8983  C  CA  . SER E  1 12  ? 16.323  82.314  168.010 1.00 57.55  ? 12   SER E CA  1 
ATOM   8984  C  C   . SER E  1 12  ? 17.832  82.499  167.856 1.00 57.50  ? 12   SER E C   1 
ATOM   8985  O  O   . SER E  1 12  ? 18.349  83.588  168.098 1.00 55.91  ? 12   SER E O   1 
ATOM   8986  C  CB  . SER E  1 12  ? 15.975  82.005  169.467 1.00 56.29  ? 12   SER E CB  1 
ATOM   8987  O  OG  . SER E  1 12  ? 14.595  82.226  169.708 1.00 53.58  ? 12   SER E OG  1 
ATOM   8988  N  N   . GLN E  1 13  ? 18.539  81.442  167.462 1.00 58.64  ? 13   GLN E N   1 
ATOM   8989  C  CA  . GLN E  1 13  ? 19.988  81.529  167.263 1.00 60.20  ? 13   GLN E CA  1 
ATOM   8990  C  C   . GLN E  1 13  ? 20.276  82.497  166.117 1.00 62.07  ? 13   GLN E C   1 
ATOM   8991  O  O   . GLN E  1 13  ? 21.268  83.229  166.134 1.00 61.57  ? 13   GLN E O   1 
ATOM   8992  C  CB  . GLN E  1 13  ? 20.579  80.159  166.903 1.00 60.16  ? 13   GLN E CB  1 
ATOM   8993  C  CG  . GLN E  1 13  ? 20.817  79.198  168.060 1.00 59.80  ? 13   GLN E CG  1 
ATOM   8994  C  CD  . GLN E  1 13  ? 21.871  79.704  169.024 1.00 60.95  ? 13   GLN E CD  1 
ATOM   8995  O  OE1 . GLN E  1 13  ? 22.921  80.201  168.612 1.00 59.78  ? 13   GLN E OE1 1 
ATOM   8996  N  NE2 . GLN E  1 13  ? 21.601  79.573  170.317 1.00 59.24  ? 13   GLN E NE2 1 
HETATM 8997  N  N   . MSE E  1 14  ? 19.391  82.490  165.124 1.00 64.67  ? 14   MSE E N   1 
HETATM 8998  C  CA  . MSE E  1 14  ? 19.529  83.343  163.951 1.00 65.53  ? 14   MSE E CA  1 
HETATM 8999  C  C   . MSE E  1 14  ? 19.053  84.767  164.193 1.00 65.22  ? 14   MSE E C   1 
HETATM 9000  O  O   . MSE E  1 14  ? 19.589  85.705  163.602 1.00 65.72  ? 14   MSE E O   1 
HETATM 9001  C  CB  . MSE E  1 14  ? 18.776  82.728  162.770 1.00 66.53  ? 14   MSE E CB  1 
HETATM 9002  C  CG  . MSE E  1 14  ? 19.374  81.406  162.307 1.00 72.87  ? 14   MSE E CG  1 
HETATM 9003  SE SE  . MSE E  1 14  ? 18.529  80.600  160.754 1.00 82.61  ? 14   MSE E SE  1 
HETATM 9004  C  CE  . MSE E  1 14  ? 19.364  81.679  159.366 1.00 80.11  ? 14   MSE E CE  1 
ATOM   9005  N  N   . LYS E  1 15  ? 18.058  84.931  165.060 1.00 63.46  ? 15   LYS E N   1 
ATOM   9006  C  CA  . LYS E  1 15  ? 17.535  86.257  165.360 1.00 64.09  ? 15   LYS E CA  1 
ATOM   9007  C  C   . LYS E  1 15  ? 18.544  87.051  166.177 1.00 64.82  ? 15   LYS E C   1 
ATOM   9008  O  O   . LYS E  1 15  ? 18.750  88.240  165.939 1.00 63.74  ? 15   LYS E O   1 
ATOM   9009  C  CB  . LYS E  1 15  ? 16.216  86.153  166.131 1.00 64.80  ? 15   LYS E CB  1 
ATOM   9010  C  CG  . LYS E  1 15  ? 15.122  85.423  165.369 1.00 70.23  ? 15   LYS E CG  1 
ATOM   9011  C  CD  . LYS E  1 15  ? 13.893  85.116  166.231 1.00 73.01  ? 15   LYS E CD  1 
ATOM   9012  C  CE  . LYS E  1 15  ? 13.081  86.363  166.543 1.00 74.08  ? 15   LYS E CE  1 
ATOM   9013  N  NZ  . LYS E  1 15  ? 11.807  86.022  167.240 1.00 72.34  ? 15   LYS E NZ  1 
ATOM   9014  N  N   . GLU E  1 16  ? 19.185  86.381  167.129 1.00 66.54  ? 16   GLU E N   1 
ATOM   9015  C  CA  . GLU E  1 16  ? 20.162  87.022  168.000 1.00 68.07  ? 16   GLU E CA  1 
ATOM   9016  C  C   . GLU E  1 16  ? 21.483  87.353  167.311 1.00 70.04  ? 16   GLU E C   1 
ATOM   9017  O  O   . GLU E  1 16  ? 22.210  88.246  167.758 1.00 69.44  ? 16   GLU E O   1 
ATOM   9018  C  CB  . GLU E  1 16  ? 20.408  86.139  169.218 1.00 68.11  ? 16   GLU E CB  1 
ATOM   9019  C  CG  . GLU E  1 16  ? 19.228  86.094  170.175 1.00 67.55  ? 16   GLU E CG  1 
ATOM   9020  C  CD  . GLU E  1 16  ? 19.269  84.885  171.084 1.00 68.58  ? 16   GLU E CD  1 
ATOM   9021  O  OE1 . GLU E  1 16  ? 20.380  84.366  171.318 1.00 67.37  ? 16   GLU E OE1 1 
ATOM   9022  O  OE2 . GLU E  1 16  ? 18.194  84.460  171.565 1.00 66.58  ? 16   GLU E OE2 1 
ATOM   9023  N  N   . ASP E  1 17  ? 21.792  86.633  166.234 1.00 71.79  ? 17   ASP E N   1 
ATOM   9024  C  CA  . ASP E  1 17  ? 23.015  86.868  165.464 1.00 73.69  ? 17   ASP E CA  1 
ATOM   9025  C  C   . ASP E  1 17  ? 22.768  86.646  163.972 1.00 71.44  ? 17   ASP E C   1 
ATOM   9026  O  O   . ASP E  1 17  ? 23.027  85.566  163.443 1.00 70.55  ? 17   ASP E O   1 
ATOM   9027  C  CB  . ASP E  1 17  ? 24.161  85.956  165.941 1.00 78.85  ? 17   ASP E CB  1 
ATOM   9028  C  CG  . ASP E  1 17  ? 24.717  86.359  167.324 1.00 85.76  ? 17   ASP E CG  1 
ATOM   9029  O  OD1 . ASP E  1 17  ? 25.227  87.499  167.483 1.00 84.21  ? 17   ASP E OD1 1 
ATOM   9030  O  OD2 . ASP E  1 17  ? 24.650  85.521  168.257 1.00 89.61  ? 17   ASP E OD2 1 
ATOM   9031  N  N   . PRO E  1 18  ? 22.262  87.678  163.276 1.00 71.70  ? 18   PRO E N   1 
ATOM   9032  C  CA  . PRO E  1 18  ? 21.962  87.644  161.836 1.00 71.65  ? 18   PRO E CA  1 
ATOM   9033  C  C   . PRO E  1 18  ? 23.182  87.214  161.023 1.00 70.31  ? 18   PRO E C   1 
ATOM   9034  O  O   . PRO E  1 18  ? 23.076  86.669  159.917 1.00 67.99  ? 18   PRO E O   1 
ATOM   9035  C  CB  . PRO E  1 18  ? 21.535  89.084  161.542 1.00 71.17  ? 18   PRO E CB  1 
ATOM   9036  C  CG  . PRO E  1 18  ? 22.256  89.882  162.585 1.00 71.73  ? 18   PRO E CG  1 
ATOM   9037  C  CD  . PRO E  1 18  ? 22.064  89.036  163.812 1.00 73.13  ? 18   PRO E CD  1 
ATOM   9038  N  N   . ASP E  1 19  ? 24.337  87.485  161.615 1.00 69.43  ? 19   ASP E N   1 
ATOM   9039  C  CA  . ASP E  1 19  ? 25.656  87.165  161.085 1.00 67.54  ? 19   ASP E CA  1 
ATOM   9040  C  C   . ASP E  1 19  ? 25.777  85.677  160.761 1.00 65.38  ? 19   ASP E C   1 
ATOM   9041  O  O   . ASP E  1 19  ? 26.406  85.276  159.783 1.00 62.67  ? 19   ASP E O   1 
ATOM   9042  C  CB  . ASP E  1 19  ? 26.695  87.513  162.162 1.00 70.38  ? 19   ASP E CB  1 
ATOM   9043  C  CG  . ASP E  1 19  ? 26.202  87.169  163.599 1.00 70.06  ? 19   ASP E CG  1 
ATOM   9044  O  OD1 . ASP E  1 19  ? 25.307  87.884  164.103 1.00 66.95  ? 19   ASP E OD1 1 
ATOM   9045  O  OD2 . ASP E  1 19  ? 26.690  86.189  164.215 1.00 65.32  ? 19   ASP E OD2 1 
HETATM 9046  N  N   . MSE E  1 20  ? 25.153  84.879  161.616 1.00 63.69  ? 20   MSE E N   1 
HETATM 9047  C  CA  . MSE E  1 20  ? 25.192  83.433  161.550 1.00 60.55  ? 20   MSE E CA  1 
HETATM 9048  C  C   . MSE E  1 20  ? 24.521  82.711  160.398 1.00 55.76  ? 20   MSE E C   1 
HETATM 9049  O  O   . MSE E  1 20  ? 23.343  82.909  160.104 1.00 53.16  ? 20   MSE E O   1 
HETATM 9050  C  CB  . MSE E  1 20  ? 24.655  82.877  162.869 1.00 65.14  ? 20   MSE E CB  1 
HETATM 9051  C  CG  . MSE E  1 20  ? 24.952  81.402  163.104 1.00 69.80  ? 20   MSE E CG  1 
HETATM 9052  SE SE  . MSE E  1 20  ? 24.466  80.880  164.893 1.00 77.29  ? 20   MSE E SE  1 
HETATM 9053  C  CE  . MSE E  1 20  ? 25.522  82.203  165.856 1.00 72.79  ? 20   MSE E CE  1 
ATOM   9054  N  N   . ALA E  1 21  ? 25.294  81.828  159.781 1.00 54.05  ? 21   ALA E N   1 
ATOM   9055  C  CA  . ALA E  1 21  ? 24.818  81.010  158.678 1.00 56.25  ? 21   ALA E CA  1 
ATOM   9056  C  C   . ALA E  1 21  ? 23.789  79.980  159.167 1.00 58.31  ? 21   ALA E C   1 
ATOM   9057  O  O   . ALA E  1 21  ? 23.983  79.326  160.198 1.00 59.33  ? 21   ALA E O   1 
ATOM   9058  C  CB  . ALA E  1 21  ? 25.992  80.298  158.033 1.00 52.16  ? 21   ALA E CB  1 
ATOM   9059  N  N   . SER E  1 22  ? 22.697  79.841  158.423 1.00 59.04  ? 22   SER E N   1 
ATOM   9060  C  CA  . SER E  1 22  ? 21.646  78.887  158.762 1.00 59.27  ? 22   SER E CA  1 
ATOM   9061  C  C   . SER E  1 22  ? 22.237  77.580  159.279 1.00 59.04  ? 22   SER E C   1 
ATOM   9062  O  O   . SER E  1 22  ? 21.942  77.153  160.394 1.00 59.86  ? 22   SER E O   1 
ATOM   9063  C  CB  . SER E  1 22  ? 20.795  78.584  157.527 1.00 60.90  ? 22   SER E CB  1 
ATOM   9064  O  OG  . SER E  1 22  ? 20.202  79.757  157.008 1.00 66.74  ? 22   SER E OG  1 
ATOM   9065  N  N   . ALA E  1 23  ? 23.075  76.956  158.455 1.00 57.40  ? 23   ALA E N   1 
ATOM   9066  C  CA  . ALA E  1 23  ? 23.711  75.688  158.790 1.00 55.82  ? 23   ALA E CA  1 
ATOM   9067  C  C   . ALA E  1 23  ? 24.403  75.667  160.151 1.00 56.23  ? 23   ALA E C   1 
ATOM   9068  O  O   . ALA E  1 23  ? 24.309  74.685  160.880 1.00 54.66  ? 23   ALA E O   1 
ATOM   9069  C  CB  . ALA E  1 23  ? 24.705  75.318  157.711 1.00 54.69  ? 23   ALA E CB  1 
ATOM   9070  N  N   . VAL E  1 24  ? 25.101  76.745  160.487 1.00 56.28  ? 24   VAL E N   1 
ATOM   9071  C  CA  . VAL E  1 24  ? 25.816  76.826  161.756 1.00 56.10  ? 24   VAL E CA  1 
ATOM   9072  C  C   . VAL E  1 24  ? 24.879  76.958  162.958 1.00 57.12  ? 24   VAL E C   1 
ATOM   9073  O  O   . VAL E  1 24  ? 25.188  76.472  164.041 1.00 57.86  ? 24   VAL E O   1 
ATOM   9074  C  CB  . VAL E  1 24  ? 26.811  78.004  161.745 1.00 54.60  ? 24   VAL E CB  1 
ATOM   9075  C  CG1 . VAL E  1 24  ? 27.517  78.115  163.080 1.00 51.19  ? 24   VAL E CG1 1 
ATOM   9076  C  CG2 . VAL E  1 24  ? 27.822  77.798  160.637 1.00 56.19  ? 24   VAL E CG2 1 
ATOM   9077  N  N   . ALA E  1 25  ? 23.740  77.618  162.770 1.00 57.01  ? 25   ALA E N   1 
ATOM   9078  C  CA  . ALA E  1 25  ? 22.775  77.777  163.851 1.00 56.24  ? 25   ALA E CA  1 
ATOM   9079  C  C   . ALA E  1 25  ? 22.091  76.440  164.054 1.00 55.93  ? 25   ALA E C   1 
ATOM   9080  O  O   . ALA E  1 25  ? 21.581  76.141  165.130 1.00 54.09  ? 25   ALA E O   1 
ATOM   9081  C  CB  . ALA E  1 25  ? 21.749  78.830  163.489 1.00 57.38  ? 25   ALA E CB  1 
ATOM   9082  N  N   . ALA E  1 26  ? 22.092  75.639  162.997 1.00 56.07  ? 26   ALA E N   1 
ATOM   9083  C  CA  . ALA E  1 26  ? 21.479  74.325  163.029 1.00 57.91  ? 26   ALA E CA  1 
ATOM   9084  C  C   . ALA E  1 26  ? 22.393  73.273  163.658 1.00 58.69  ? 26   ALA E C   1 
ATOM   9085  O  O   . ALA E  1 26  ? 21.982  72.577  164.585 1.00 59.63  ? 26   ALA E O   1 
ATOM   9086  C  CB  . ALA E  1 26  ? 21.083  73.906  161.619 1.00 57.52  ? 26   ALA E CB  1 
ATOM   9087  N  N   . ILE E  1 27  ? 23.625  73.147  163.165 1.00 60.24  ? 27   ILE E N   1 
ATOM   9088  C  CA  . ILE E  1 27  ? 24.536  72.154  163.722 1.00 62.58  ? 27   ILE E CA  1 
ATOM   9089  C  C   . ILE E  1 27  ? 24.785  72.557  165.170 1.00 64.27  ? 27   ILE E C   1 
ATOM   9090  O  O   . ILE E  1 27  ? 25.263  71.769  165.986 1.00 65.18  ? 27   ILE E O   1 
ATOM   9091  C  CB  . ILE E  1 27  ? 25.902  72.065  162.941 1.00 62.40  ? 27   ILE E CB  1 
ATOM   9092  C  CG1 . ILE E  1 27  ? 26.924  73.028  163.528 1.00 64.55  ? 27   ILE E CG1 1 
ATOM   9093  C  CG2 . ILE E  1 27  ? 25.707  72.361  161.475 1.00 63.02  ? 27   ILE E CG2 1 
ATOM   9094  C  CD1 . ILE E  1 27  ? 27.795  72.389  164.585 1.00 64.62  ? 27   ILE E CD1 1 
ATOM   9095  N  N   . ARG E  1 28  ? 24.439  73.799  165.480 1.00 64.81  ? 28   ARG E N   1 
ATOM   9096  C  CA  . ARG E  1 28  ? 24.604  74.332  166.821 1.00 63.69  ? 28   ARG E CA  1 
ATOM   9097  C  C   . ARG E  1 28  ? 23.422  73.910  167.685 1.00 63.39  ? 28   ARG E C   1 
ATOM   9098  O  O   . ARG E  1 28  ? 23.598  73.549  168.848 1.00 64.99  ? 28   ARG E O   1 
ATOM   9099  C  CB  . ARG E  1 28  ? 24.699  75.848  166.742 1.00 62.67  ? 28   ARG E CB  1 
ATOM   9100  C  CG  . ARG E  1 28  ? 24.686  76.557  168.048 1.00 64.84  ? 28   ARG E CG  1 
ATOM   9101  C  CD  . ARG E  1 28  ? 24.722  78.039  167.778 1.00 67.12  ? 28   ARG E CD  1 
ATOM   9102  N  NE  . ARG E  1 28  ? 26.058  78.479  167.408 1.00 67.37  ? 28   ARG E NE  1 
ATOM   9103  C  CZ  . ARG E  1 28  ? 27.030  78.686  168.289 1.00 70.87  ? 28   ARG E CZ  1 
ATOM   9104  N  NH1 . ARG E  1 28  ? 26.802  78.493  169.582 1.00 68.42  ? 28   ARG E NH1 1 
ATOM   9105  N  NH2 . ARG E  1 28  ? 28.227  79.085  167.879 1.00 71.50  ? 28   ARG E NH2 1 
ATOM   9106  N  N   . THR E  1 29  ? 22.223  73.952  167.106 1.00 61.22  ? 29   THR E N   1 
ATOM   9107  C  CA  . THR E  1 29  ? 21.008  73.563  167.809 1.00 59.74  ? 29   THR E CA  1 
ATOM   9108  C  C   . THR E  1 29  ? 21.031  72.076  168.139 1.00 61.34  ? 29   THR E C   1 
ATOM   9109  O  O   . THR E  1 29  ? 20.364  71.631  169.069 1.00 61.42  ? 29   THR E O   1 
ATOM   9110  C  CB  . THR E  1 29  ? 19.746  73.883  166.970 1.00 58.14  ? 29   THR E CB  1 
ATOM   9111  O  OG1 . THR E  1 29  ? 19.624  75.302  166.828 1.00 56.96  ? 29   THR E OG1 1 
ATOM   9112  C  CG2 . THR E  1 29  ? 18.485  73.347  167.643 1.00 53.00  ? 29   THR E CG2 1 
ATOM   9113  N  N   . LEU E  1 30  ? 21.800  71.307  167.376 1.00 63.59  ? 30   LEU E N   1 
ATOM   9114  C  CA  . LEU E  1 30  ? 21.912  69.868  167.620 1.00 63.26  ? 30   LEU E CA  1 
ATOM   9115  C  C   . LEU E  1 30  ? 22.817  69.666  168.813 1.00 61.70  ? 30   LEU E C   1 
ATOM   9116  O  O   . LEU E  1 30  ? 22.585  68.806  169.656 1.00 62.60  ? 30   LEU E O   1 
ATOM   9117  C  CB  . LEU E  1 30  ? 22.539  69.152  166.426 1.00 62.94  ? 30   LEU E CB  1 
ATOM   9118  C  CG  . LEU E  1 30  ? 21.770  69.179  165.115 1.00 63.67  ? 30   LEU E CG  1 
ATOM   9119  C  CD1 . LEU E  1 30  ? 22.558  68.405  164.066 1.00 62.96  ? 30   LEU E CD1 1 
ATOM   9120  C  CD2 . LEU E  1 30  ? 20.382  68.581  165.327 1.00 64.46  ? 30   LEU E CD2 1 
ATOM   9121  N  N   . LEU E  1 31  ? 23.866  70.468  168.865 1.00 60.78  ? 31   LEU E N   1 
ATOM   9122  C  CA  . LEU E  1 31  ? 24.820  70.380  169.947 1.00 60.74  ? 31   LEU E CA  1 
ATOM   9123  C  C   . LEU E  1 31  ? 24.104  70.664  171.265 1.00 61.70  ? 31   LEU E C   1 
ATOM   9124  O  O   . LEU E  1 31  ? 24.499  70.170  172.316 1.00 62.96  ? 31   LEU E O   1 
ATOM   9125  C  CB  . LEU E  1 31  ? 25.957  71.370  169.693 1.00 57.76  ? 31   LEU E CB  1 
ATOM   9126  C  CG  . LEU E  1 31  ? 27.149  71.395  170.642 1.00 55.25  ? 31   LEU E CG  1 
ATOM   9127  C  CD1 . LEU E  1 31  ? 26.814  72.280  171.819 1.00 54.00  ? 31   LEU E CD1 1 
ATOM   9128  C  CD2 . LEU E  1 31  ? 27.514  69.974  171.067 1.00 53.21  ? 31   LEU E CD2 1 
ATOM   9129  N  N   . GLU E  1 32  ? 23.035  71.447  171.201 1.00 60.86  ? 32   GLU E N   1 
ATOM   9130  C  CA  . GLU E  1 32  ? 22.269  71.772  172.394 1.00 62.97  ? 32   GLU E CA  1 
ATOM   9131  C  C   . GLU E  1 32  ? 21.288  70.647  172.720 1.00 64.71  ? 32   GLU E C   1 
ATOM   9132  O  O   . GLU E  1 32  ? 21.048  70.338  173.885 1.00 66.08  ? 32   GLU E O   1 
ATOM   9133  C  CB  . GLU E  1 32  ? 21.513  73.086  172.185 1.00 64.04  ? 32   GLU E CB  1 
ATOM   9134  C  CG  . GLU E  1 32  ? 20.653  73.540  173.359 1.00 64.73  ? 32   GLU E CG  1 
ATOM   9135  C  CD  . GLU E  1 32  ? 21.421  73.606  174.671 1.00 65.32  ? 32   GLU E CD  1 
ATOM   9136  O  OE1 . GLU E  1 32  ? 22.642  73.884  174.647 1.00 64.37  ? 32   GLU E OE1 1 
ATOM   9137  O  OE2 . GLU E  1 32  ? 20.794  73.390  175.729 1.00 63.91  ? 32   GLU E OE2 1 
ATOM   9138  N  N   . PHE E  1 33  ? 20.722  70.037  171.684 1.00 66.46  ? 33   PHE E N   1 
ATOM   9139  C  CA  . PHE E  1 33  ? 19.771  68.940  171.850 1.00 66.89  ? 33   PHE E CA  1 
ATOM   9140  C  C   . PHE E  1 33  ? 20.487  67.694  172.373 1.00 65.32  ? 33   PHE E C   1 
ATOM   9141  O  O   . PHE E  1 33  ? 19.889  66.865  173.060 1.00 65.98  ? 33   PHE E O   1 
ATOM   9142  C  CB  . PHE E  1 33  ? 19.085  68.648  170.503 1.00 70.15  ? 33   PHE E CB  1 
ATOM   9143  C  CG  . PHE E  1 33  ? 18.289  67.363  170.471 1.00 73.04  ? 33   PHE E CG  1 
ATOM   9144  C  CD1 . PHE E  1 33  ? 18.931  66.124  170.410 1.00 75.94  ? 33   PHE E CD1 1 
ATOM   9145  C  CD2 . PHE E  1 33  ? 16.901  67.393  170.479 1.00 74.50  ? 33   PHE E CD2 1 
ATOM   9146  C  CE1 . PHE E  1 33  ? 18.200  64.936  170.358 1.00 76.44  ? 33   PHE E CE1 1 
ATOM   9147  C  CE2 . PHE E  1 33  ? 16.158  66.210  170.427 1.00 76.35  ? 33   PHE E CE2 1 
ATOM   9148  C  CZ  . PHE E  1 33  ? 16.811  64.980  170.366 1.00 77.22  ? 33   PHE E CZ  1 
ATOM   9149  N  N   . LEU E  1 34  ? 21.768  67.574  172.040 1.00 62.32  ? 34   LEU E N   1 
ATOM   9150  C  CA  . LEU E  1 34  ? 22.577  66.441  172.459 1.00 60.50  ? 34   LEU E CA  1 
ATOM   9151  C  C   . LEU E  1 34  ? 22.864  66.523  173.963 1.00 61.67  ? 34   LEU E C   1 
ATOM   9152  O  O   . LEU E  1 34  ? 22.654  65.558  174.695 1.00 62.34  ? 34   LEU E O   1 
ATOM   9153  C  CB  . LEU E  1 34  ? 23.886  66.436  171.670 1.00 57.36  ? 34   LEU E CB  1 
ATOM   9154  C  CG  . LEU E  1 34  ? 24.680  65.137  171.645 1.00 56.11  ? 34   LEU E CG  1 
ATOM   9155  C  CD1 . LEU E  1 34  ? 25.918  65.313  170.791 1.00 54.10  ? 34   LEU E CD1 1 
ATOM   9156  C  CD2 . LEU E  1 34  ? 25.067  64.751  173.043 1.00 57.17  ? 34   LEU E CD2 1 
ATOM   9157  N  N   . LYS E  1 35  ? 23.343  67.679  174.414 1.00 61.82  ? 35   LYS E N   1 
ATOM   9158  C  CA  . LYS E  1 35  ? 23.658  67.904  175.821 1.00 61.51  ? 35   LYS E CA  1 
ATOM   9159  C  C   . LYS E  1 35  ? 22.426  67.739  176.691 1.00 63.67  ? 35   LYS E C   1 
ATOM   9160  O  O   . LYS E  1 35  ? 22.447  67.029  177.694 1.00 65.65  ? 35   LYS E O   1 
ATOM   9161  C  CB  . LYS E  1 35  ? 24.185  69.322  176.028 1.00 59.00  ? 35   LYS E CB  1 
ATOM   9162  C  CG  . LYS E  1 35  ? 25.489  69.638  175.341 1.00 57.93  ? 35   LYS E CG  1 
ATOM   9163  C  CD  . LYS E  1 35  ? 25.810  71.114  175.473 1.00 55.21  ? 35   LYS E CD  1 
ATOM   9164  C  CE  . LYS E  1 35  ? 27.209  71.418  174.975 1.00 54.78  ? 35   LYS E CE  1 
ATOM   9165  N  NZ  . LYS E  1 35  ? 27.515  72.877  175.012 1.00 53.85  ? 35   LYS E NZ  1 
ATOM   9166  N  N   . ARG E  1 36  ? 21.361  68.422  176.290 1.00 64.99  ? 36   ARG E N   1 
ATOM   9167  C  CA  . ARG E  1 36  ? 20.089  68.433  176.998 1.00 65.81  ? 36   ARG E CA  1 
ATOM   9168  C  C   . ARG E  1 36  ? 19.326  67.123  176.862 1.00 68.32  ? 36   ARG E C   1 
ATOM   9169  O  O   . ARG E  1 36  ? 18.155  67.031  177.229 1.00 66.46  ? 36   ARG E O   1 
ATOM   9170  C  CB  . ARG E  1 36  ? 19.245  69.586  176.454 1.00 64.33  ? 36   ARG E CB  1 
ATOM   9171  C  CG  . ARG E  1 36  ? 17.952  69.859  177.192 1.00 65.78  ? 36   ARG E CG  1 
ATOM   9172  C  CD  . ARG E  1 36  ? 17.222  71.048  176.573 1.00 66.01  ? 36   ARG E CD  1 
ATOM   9173  N  NE  . ARG E  1 36  ? 18.088  72.223  176.471 1.00 62.87  ? 36   ARG E NE  1 
ATOM   9174  C  CZ  . ARG E  1 36  ? 17.673  73.425  176.090 1.00 61.36  ? 36   ARG E CZ  1 
ATOM   9175  N  NH1 . ARG E  1 36  ? 16.402  73.622  175.770 1.00 61.61  ? 36   ARG E NH1 1 
ATOM   9176  N  NH2 . ARG E  1 36  ? 18.528  74.433  176.034 1.00 63.42  ? 36   ARG E NH2 1 
ATOM   9177  N  N   . ASP E  1 37  ? 19.994  66.097  176.352 1.00 72.48  ? 37   ASP E N   1 
ATOM   9178  C  CA  . ASP E  1 37  ? 19.319  64.828  176.157 1.00 77.51  ? 37   ASP E CA  1 
ATOM   9179  C  C   . ASP E  1 37  ? 20.295  63.653  176.056 1.00 79.29  ? 37   ASP E C   1 
ATOM   9180  O  O   . ASP E  1 37  ? 21.148  63.449  176.925 1.00 79.54  ? 37   ASP E O   1 
ATOM   9181  C  CB  . ASP E  1 37  ? 18.474  64.929  174.886 1.00 82.27  ? 37   ASP E CB  1 
ATOM   9182  C  CG  . ASP E  1 37  ? 17.457  63.828  174.774 1.00 87.01  ? 37   ASP E CG  1 
ATOM   9183  O  OD1 . ASP E  1 37  ? 16.611  63.724  175.690 1.00 88.53  ? 37   ASP E OD1 1 
ATOM   9184  O  OD2 . ASP E  1 37  ? 17.505  63.077  173.771 1.00 89.28  ? 37   ASP E OD2 1 
ATOM   9185  N  N   . GLU E  1 40  ? 19.326  59.871  175.908 1.00 112.08 ? 40   GLU E N   1 
ATOM   9186  C  CA  . GLU E  1 40  ? 20.344  59.326  176.799 1.00 111.78 ? 40   GLU E CA  1 
ATOM   9187  C  C   . GLU E  1 40  ? 20.146  57.823  176.908 1.00 112.28 ? 40   GLU E C   1 
ATOM   9188  O  O   . GLU E  1 40  ? 21.072  57.043  176.700 1.00 112.49 ? 40   GLU E O   1 
ATOM   9189  C  CB  . GLU E  1 40  ? 20.223  59.938  178.197 1.00 109.99 ? 40   GLU E CB  1 
ATOM   9190  C  CG  . GLU E  1 40  ? 19.593  61.322  178.241 1.00 106.84 ? 40   GLU E CG  1 
ATOM   9191  C  CD  . GLU E  1 40  ? 18.088  61.297  178.034 1.00 103.86 ? 40   GLU E CD  1 
ATOM   9192  O  OE1 . GLU E  1 40  ? 17.474  62.383  178.056 1.00 103.22 ? 40   GLU E OE1 1 
ATOM   9193  O  OE2 . GLU E  1 40  ? 17.522  60.197  177.855 1.00 101.20 ? 40   GLU E OE2 1 
ATOM   9194  N  N   . THR E  1 41  ? 18.918  57.440  177.241 1.00 112.75 ? 41   THR E N   1 
ATOM   9195  C  CA  . THR E  1 41  ? 18.527  56.044  177.401 1.00 112.99 ? 41   THR E CA  1 
ATOM   9196  C  C   . THR E  1 41  ? 19.077  55.120  176.308 1.00 113.03 ? 41   THR E C   1 
ATOM   9197  O  O   . THR E  1 41  ? 20.279  54.839  176.249 1.00 111.77 ? 41   THR E O   1 
ATOM   9198  C  CB  . THR E  1 41  ? 16.981  55.920  177.429 1.00 113.30 ? 41   THR E CB  1 
ATOM   9199  O  OG1 . THR E  1 41  ? 16.436  56.337  176.168 1.00 112.53 ? 41   THR E OG1 1 
ATOM   9200  C  CG2 . THR E  1 41  ? 16.400  56.799  178.529 1.00 112.87 ? 41   THR E CG2 1 
ATOM   9201  N  N   . ILE E  1 42  ? 18.175  54.642  175.456 1.00 113.31 ? 42   ILE E N   1 
ATOM   9202  C  CA  . ILE E  1 42  ? 18.526  53.753  174.357 1.00 113.10 ? 42   ILE E CA  1 
ATOM   9203  C  C   . ILE E  1 42  ? 19.594  54.403  173.481 1.00 113.28 ? 42   ILE E C   1 
ATOM   9204  O  O   . ILE E  1 42  ? 19.330  55.416  172.834 1.00 114.35 ? 42   ILE E O   1 
ATOM   9205  C  CB  . ILE E  1 42  ? 17.282  53.459  173.484 1.00 112.53 ? 42   ILE E CB  1 
ATOM   9206  C  CG1 . ILE E  1 42  ? 16.136  52.953  174.364 1.00 111.92 ? 42   ILE E CG1 1 
ATOM   9207  C  CG2 . ILE E  1 42  ? 17.627  52.440  172.412 1.00 112.93 ? 42   ILE E CG2 1 
ATOM   9208  C  CD1 . ILE E  1 42  ? 14.850  52.691  173.614 1.00 110.34 ? 42   ILE E CD1 1 
ATOM   9209  N  N   . GLN E  1 43  ? 20.798  53.835  173.461 1.00 112.26 ? 43   GLN E N   1 
ATOM   9210  C  CA  . GLN E  1 43  ? 21.868  54.390  172.634 1.00 111.22 ? 43   GLN E CA  1 
ATOM   9211  C  C   . GLN E  1 43  ? 21.363  54.625  171.209 1.00 110.83 ? 43   GLN E C   1 
ATOM   9212  O  O   . GLN E  1 43  ? 21.890  55.463  170.475 1.00 109.03 ? 43   GLN E O   1 
ATOM   9213  C  CB  . GLN E  1 43  ? 23.071  53.445  172.611 1.00 110.85 ? 43   GLN E CB  1 
ATOM   9214  C  CG  . GLN E  1 43  ? 24.133  53.841  171.603 1.00 109.82 ? 43   GLN E CG  1 
ATOM   9215  C  CD  . GLN E  1 43  ? 24.358  55.334  171.582 1.00 108.70 ? 43   GLN E CD  1 
ATOM   9216  O  OE1 . GLN E  1 43  ? 24.572  55.949  172.623 1.00 109.16 ? 43   GLN E OE1 1 
ATOM   9217  N  NE2 . GLN E  1 43  ? 24.306  55.928  170.396 1.00 107.05 ? 43   GLN E NE2 1 
ATOM   9218  N  N   . GLY E  1 44  ? 20.336  53.872  170.827 1.00 111.17 ? 44   GLY E N   1 
ATOM   9219  C  CA  . GLY E  1 44  ? 19.754  54.018  169.507 1.00 110.84 ? 44   GLY E CA  1 
ATOM   9220  C  C   . GLY E  1 44  ? 19.038  55.351  169.414 1.00 111.19 ? 44   GLY E C   1 
ATOM   9221  O  O   . GLY E  1 44  ? 19.238  56.097  168.457 1.00 112.36 ? 44   GLY E O   1 
ATOM   9222  N  N   . LEU E  1 45  ? 18.206  55.650  170.412 1.00 110.45 ? 45   LEU E N   1 
ATOM   9223  C  CA  . LEU E  1 45  ? 17.467  56.910  170.457 1.00 108.93 ? 45   LEU E CA  1 
ATOM   9224  C  C   . LEU E  1 45  ? 18.424  58.081  170.259 1.00 107.83 ? 45   LEU E C   1 
ATOM   9225  O  O   . LEU E  1 45  ? 18.018  59.155  169.825 1.00 107.59 ? 45   LEU E O   1 
ATOM   9226  C  CB  . LEU E  1 45  ? 16.737  57.061  171.801 1.00 109.44 ? 45   LEU E CB  1 
ATOM   9227  C  CG  . LEU E  1 45  ? 15.441  56.270  172.026 1.00 110.16 ? 45   LEU E CG  1 
ATOM   9228  C  CD1 . LEU E  1 45  ? 15.099  56.228  173.513 1.00 108.71 ? 45   LEU E CD1 1 
ATOM   9229  C  CD2 . LEU E  1 45  ? 14.310  56.912  171.223 1.00 108.62 ? 45   LEU E CD2 1 
ATOM   9230  N  N   . ARG E  1 46  ? 19.697  57.868  170.579 1.00 106.85 ? 46   ARG E N   1 
ATOM   9231  C  CA  . ARG E  1 46  ? 20.704  58.912  170.418 1.00 105.23 ? 46   ARG E CA  1 
ATOM   9232  C  C   . ARG E  1 46  ? 20.940  59.139  168.932 1.00 103.15 ? 46   ARG E C   1 
ATOM   9233  O  O   . ARG E  1 46  ? 20.477  60.129  168.367 1.00 103.05 ? 46   ARG E O   1 
ATOM   9234  C  CB  . ARG E  1 46  ? 22.022  58.504  171.081 1.00 106.75 ? 46   ARG E CB  1 
ATOM   9235  C  CG  . ARG E  1 46  ? 23.046  59.627  171.137 1.00 107.41 ? 46   ARG E CG  1 
ATOM   9236  C  CD  . ARG E  1 46  ? 23.226  60.157  172.555 1.00 108.79 ? 46   ARG E CD  1 
ATOM   9237  N  NE  . ARG E  1 46  ? 21.958  60.429  173.233 1.00 111.64 ? 46   ARG E NE  1 
ATOM   9238  C  CZ  . ARG E  1 46  ? 21.024  61.268  172.790 1.00 112.85 ? 46   ARG E CZ  1 
ATOM   9239  N  NH1 . ARG E  1 46  ? 21.203  61.930  171.654 1.00 113.64 ? 46   ARG E NH1 1 
ATOM   9240  N  NH2 . ARG E  1 46  ? 19.908  61.452  173.489 1.00 112.20 ? 46   ARG E NH2 1 
ATOM   9241  N  N   . ALA E  1 47  ? 21.652  58.210  168.303 1.00 100.11 ? 47   ALA E N   1 
ATOM   9242  C  CA  . ALA E  1 47  ? 21.943  58.303  166.880 1.00 98.10  ? 47   ALA E CA  1 
ATOM   9243  C  C   . ALA E  1 47  ? 20.650  58.339  166.069 1.00 96.98  ? 47   ALA E C   1 
ATOM   9244  O  O   . ALA E  1 47  ? 20.676  58.404  164.842 1.00 96.94  ? 47   ALA E O   1 
ATOM   9245  C  CB  . ALA E  1 47  ? 22.797  57.127  166.449 1.00 97.97  ? 47   ALA E CB  1 
ATOM   9246  N  N   . ASN E  1 48  ? 19.520  58.293  166.765 1.00 95.20  ? 48   ASN E N   1 
ATOM   9247  C  CA  . ASN E  1 48  ? 18.219  58.332  166.119 1.00 94.28  ? 48   ASN E CA  1 
ATOM   9248  C  C   . ASN E  1 48  ? 17.601  59.710  166.205 1.00 92.77  ? 48   ASN E C   1 
ATOM   9249  O  O   . ASN E  1 48  ? 17.490  60.415  165.206 1.00 93.43  ? 48   ASN E O   1 
ATOM   9250  C  CB  . ASN E  1 48  ? 17.259  57.340  166.774 1.00 98.46  ? 48   ASN E CB  1 
ATOM   9251  C  CG  . ASN E  1 48  ? 15.810  57.831  166.757 1.00 102.18 ? 48   ASN E CG  1 
ATOM   9252  O  OD1 . ASN E  1 48  ? 15.231  58.063  165.692 1.00 103.29 ? 48   ASN E OD1 1 
ATOM   9253  N  ND2 . ASN E  1 48  ? 15.226  58.001  167.945 1.00 103.22 ? 48   ASN E ND2 1 
ATOM   9254  N  N   . LEU E  1 49  ? 17.190  60.080  167.414 1.00 90.72  ? 49   LEU E N   1 
ATOM   9255  C  CA  . LEU E  1 49  ? 16.543  61.359  167.658 1.00 87.82  ? 49   LEU E CA  1 
ATOM   9256  C  C   . LEU E  1 49  ? 17.248  62.522  166.977 1.00 85.84  ? 49   LEU E C   1 
ATOM   9257  O  O   . LEU E  1 49  ? 16.589  63.390  166.415 1.00 86.02  ? 49   LEU E O   1 
ATOM   9258  C  CB  . LEU E  1 49  ? 16.424  61.606  169.165 1.00 87.99  ? 49   LEU E CB  1 
ATOM   9259  C  CG  . LEU E  1 49  ? 15.660  60.533  169.958 1.00 88.02  ? 49   LEU E CG  1 
ATOM   9260  C  CD1 . LEU E  1 49  ? 15.738  60.855  171.440 1.00 88.20  ? 49   LEU E CD1 1 
ATOM   9261  C  CD2 . LEU E  1 49  ? 14.212  60.446  169.496 1.00 86.57  ? 49   LEU E CD2 1 
ATOM   9262  N  N   . THR E  1 50  ? 18.578  62.540  167.007 1.00 83.52  ? 50   THR E N   1 
ATOM   9263  C  CA  . THR E  1 50  ? 19.319  63.626  166.367 1.00 82.60  ? 50   THR E CA  1 
ATOM   9264  C  C   . THR E  1 50  ? 19.068  63.664  164.855 1.00 82.08  ? 50   THR E C   1 
ATOM   9265  O  O   . THR E  1 50  ? 18.841  64.733  164.282 1.00 81.83  ? 50   THR E O   1 
ATOM   9266  C  CB  . THR E  1 50  ? 20.838  63.515  166.620 1.00 82.35  ? 50   THR E CB  1 
ATOM   9267  O  OG1 . THR E  1 50  ? 21.298  62.219  166.224 1.00 83.03  ? 50   THR E OG1 1 
ATOM   9268  C  CG2 . THR E  1 50  ? 21.153  63.753  168.088 1.00 80.34  ? 50   THR E CG2 1 
ATOM   9269  N  N   . SER E  1 51  ? 19.120  62.506  164.204 1.00 80.24  ? 51   SER E N   1 
ATOM   9270  C  CA  . SER E  1 51  ? 18.859  62.452  162.772 1.00 77.61  ? 51   SER E CA  1 
ATOM   9271  C  C   . SER E  1 51  ? 17.346  62.514  162.597 1.00 78.14  ? 51   SER E C   1 
ATOM   9272  O  O   . SER E  1 51  ? 16.839  62.714  161.496 1.00 80.18  ? 51   SER E O   1 
ATOM   9273  C  CB  . SER E  1 51  ? 19.423  61.165  162.159 1.00 74.39  ? 51   SER E CB  1 
ATOM   9274  O  OG  . SER E  1 51  ? 18.927  60.019  162.818 1.00 71.36  ? 51   SER E OG  1 
ATOM   9275  N  N   . ALA E  1 52  ? 16.632  62.351  163.707 1.00 77.68  ? 52   ALA E N   1 
ATOM   9276  C  CA  . ALA E  1 52  ? 15.178  62.400  163.708 1.00 78.71  ? 52   ALA E CA  1 
ATOM   9277  C  C   . ALA E  1 52  ? 14.757  63.838  163.974 1.00 80.41  ? 52   ALA E C   1 
ATOM   9278  O  O   . ALA E  1 52  ? 13.577  64.128  164.173 1.00 79.52  ? 52   ALA E O   1 
ATOM   9279  C  CB  . ALA E  1 52  ? 14.624  61.482  164.789 1.00 76.51  ? 52   ALA E CB  1 
ATOM   9280  N  N   . ILE E  1 53  ? 15.740  64.733  163.986 1.00 82.63  ? 53   ILE E N   1 
ATOM   9281  C  CA  . ILE E  1 53  ? 15.486  66.145  164.233 1.00 85.56  ? 53   ILE E CA  1 
ATOM   9282  C  C   . ILE E  1 53  ? 16.281  67.074  163.318 1.00 85.42  ? 53   ILE E C   1 
ATOM   9283  O  O   . ILE E  1 53  ? 16.024  68.274  163.281 1.00 83.96  ? 53   ILE E O   1 
ATOM   9284  C  CB  . ILE E  1 53  ? 15.801  66.527  165.688 1.00 88.33  ? 53   ILE E CB  1 
ATOM   9285  C  CG1 . ILE E  1 53  ? 17.303  66.394  165.942 1.00 89.90  ? 53   ILE E CG1 1 
ATOM   9286  C  CG2 . ILE E  1 53  ? 14.975  65.664  166.648 1.00 88.73  ? 53   ILE E CG2 1 
ATOM   9287  C  CD1 . ILE E  1 53  ? 17.782  67.104  167.188 1.00 91.65  ? 53   ILE E CD1 1 
ATOM   9288  N  N   . GLU E  1 54  ? 17.262  66.530  162.605 1.00 86.44  ? 54   GLU E N   1 
ATOM   9289  C  CA  . GLU E  1 54  ? 18.038  67.337  161.673 1.00 88.36  ? 54   GLU E CA  1 
ATOM   9290  C  C   . GLU E  1 54  ? 17.083  67.626  160.532 1.00 88.79  ? 54   GLU E C   1 
ATOM   9291  O  O   . GLU E  1 54  ? 17.186  68.638  159.837 1.00 89.58  ? 54   GLU E O   1 
ATOM   9292  C  CB  . GLU E  1 54  ? 19.244  66.561  161.158 1.00 88.93  ? 54   GLU E CB  1 
ATOM   9293  C  CG  . GLU E  1 54  ? 20.270  66.273  162.230 1.00 93.72  ? 54   GLU E CG  1 
ATOM   9294  C  CD  . GLU E  1 54  ? 21.551  65.707  161.660 1.00 96.92  ? 54   GLU E CD  1 
ATOM   9295  O  OE1 . GLU E  1 54  ? 22.073  66.302  160.694 1.00 99.82  ? 54   GLU E OE1 1 
ATOM   9296  O  OE2 . GLU E  1 54  ? 22.042  64.677  162.177 1.00 98.03  ? 54   GLU E OE2 1 
ATOM   9297  N  N   . THR E  1 55  ? 16.140  66.711  160.355 1.00 89.02  ? 55   THR E N   1 
ATOM   9298  C  CA  . THR E  1 55  ? 15.130  66.843  159.325 1.00 89.33  ? 55   THR E CA  1 
ATOM   9299  C  C   . THR E  1 55  ? 14.030  67.737  159.863 1.00 87.99  ? 55   THR E C   1 
ATOM   9300  O  O   . THR E  1 55  ? 13.419  68.498  159.118 1.00 88.03  ? 55   THR E O   1 
ATOM   9301  C  CB  . THR E  1 55  ? 14.524  65.484  158.967 1.00 91.20  ? 55   THR E CB  1 
ATOM   9302  O  OG1 . THR E  1 55  ? 13.407  65.679  158.085 1.00 93.43  ? 55   THR E OG1 1 
ATOM   9303  C  CG2 . THR E  1 55  ? 14.077  64.753  160.232 1.00 91.19  ? 55   THR E CG2 1 
ATOM   9304  N  N   . LEU E  1 56  ? 13.780  67.636  161.164 1.00 87.28  ? 56   LEU E N   1 
ATOM   9305  C  CA  . LEU E  1 56  ? 12.758  68.451  161.798 1.00 87.21  ? 56   LEU E CA  1 
ATOM   9306  C  C   . LEU E  1 56  ? 13.098  69.920  161.566 1.00 87.26  ? 56   LEU E C   1 
ATOM   9307  O  O   . LEU E  1 56  ? 12.264  70.675  161.060 1.00 87.02  ? 56   LEU E O   1 
ATOM   9308  C  CB  . LEU E  1 56  ? 12.669  68.126  163.291 1.00 88.18  ? 56   LEU E CB  1 
ATOM   9309  C  CG  . LEU E  1 56  ? 12.367  66.646  163.583 1.00 91.23  ? 56   LEU E CG  1 
ATOM   9310  C  CD1 . LEU E  1 56  ? 12.136  66.458  165.071 1.00 91.36  ? 56   LEU E CD1 1 
ATOM   9311  C  CD2 . LEU E  1 56  ? 11.137  66.182  162.799 1.00 92.91  ? 56   LEU E CD2 1 
ATOM   9312  N  N   . CYS E  1 57  ? 14.318  70.334  161.920 1.00 87.12  ? 57   CYS E N   1 
ATOM   9313  C  CA  . CYS E  1 57  ? 14.705  71.720  161.667 1.00 86.20  ? 57   CYS E CA  1 
ATOM   9314  C  C   . CYS E  1 57  ? 15.035  71.836  160.182 1.00 84.88  ? 57   CYS E C   1 
ATOM   9315  O  O   . CYS E  1 57  ? 15.730  72.750  159.731 1.00 84.83  ? 57   CYS E O   1 
ATOM   9316  C  CB  . CYS E  1 57  ? 15.869  72.205  162.576 1.00 85.48  ? 57   CYS E CB  1 
ATOM   9317  S  SG  . CYS E  1 57  ? 17.395  71.233  162.720 1.00 84.55  ? 57   CYS E SG  1 
ATOM   9318  N  N   . GLY E  1 58  ? 14.511  70.867  159.435 1.00 83.98  ? 58   GLY E N   1 
ATOM   9319  C  CA  . GLY E  1 58  ? 14.644  70.852  157.995 1.00 81.54  ? 58   GLY E CA  1 
ATOM   9320  C  C   . GLY E  1 58  ? 13.472  71.747  157.641 1.00 80.85  ? 58   GLY E C   1 
ATOM   9321  O  O   . GLY E  1 58  ? 12.892  71.666  156.559 1.00 79.48  ? 58   GLY E O   1 
ATOM   9322  N  N   . VAL E  1 59  ? 13.121  72.587  158.619 1.00 79.90  ? 59   VAL E N   1 
ATOM   9323  C  CA  . VAL E  1 59  ? 12.046  73.574  158.542 1.00 76.96  ? 59   VAL E CA  1 
ATOM   9324  C  C   . VAL E  1 59  ? 12.668  74.817  157.908 1.00 76.25  ? 59   VAL E C   1 
ATOM   9325  O  O   . VAL E  1 59  ? 12.150  75.927  158.010 1.00 73.74  ? 59   VAL E O   1 
ATOM   9326  C  CB  . VAL E  1 59  ? 11.543  73.939  159.957 1.00 78.13  ? 59   VAL E CB  1 
ATOM   9327  C  CG1 . VAL E  1 59  ? 12.579  74.814  160.675 1.00 76.01  ? 59   VAL E CG1 1 
ATOM   9328  C  CG2 . VAL E  1 59  ? 10.202  74.638  159.877 1.00 79.04  ? 59   VAL E CG2 1 
ATOM   9329  N  N   . ASP E  1 60  ? 13.806  74.599  157.261 1.00 77.37  ? 60   ASP E N   1 
ATOM   9330  C  CA  . ASP E  1 60  ? 14.554  75.651  156.596 1.00 76.70  ? 60   ASP E CA  1 
ATOM   9331  C  C   . ASP E  1 60  ? 14.456  75.450  155.071 1.00 74.61  ? 60   ASP E C   1 
ATOM   9332  O  O   . ASP E  1 60  ? 14.276  76.412  154.319 1.00 74.82  ? 60   ASP E O   1 
ATOM   9333  C  CB  . ASP E  1 60  ? 16.014  75.593  157.069 1.00 79.14  ? 60   ASP E CB  1 
ATOM   9334  C  CG  . ASP E  1 60  ? 16.737  76.922  156.924 1.00 82.25  ? 60   ASP E CG  1 
ATOM   9335  O  OD1 . ASP E  1 60  ? 16.167  77.959  157.325 1.00 82.80  ? 60   ASP E OD1 1 
ATOM   9336  O  OD2 . ASP E  1 60  ? 17.882  76.932  156.423 1.00 85.31  ? 60   ASP E OD2 1 
ATOM   9337  N  N   . SER E  1 61  ? 14.552  74.192  154.639 1.00 69.61  ? 61   SER E N   1 
ATOM   9338  C  CA  . SER E  1 61  ? 14.482  73.808  153.225 1.00 65.31  ? 61   SER E CA  1 
ATOM   9339  C  C   . SER E  1 61  ? 15.825  73.911  152.529 1.00 62.48  ? 61   SER E C   1 
ATOM   9340  O  O   . SER E  1 61  ? 15.961  73.499  151.383 1.00 64.21  ? 61   SER E O   1 
ATOM   9341  C  CB  . SER E  1 61  ? 13.456  74.652  152.457 1.00 65.33  ? 61   SER E CB  1 
ATOM   9342  O  OG  . SER E  1 61  ? 12.166  74.058  152.469 1.00 68.09  ? 61   SER E OG  1 
ATOM   9343  N  N   . SER E  1 62  ? 16.817  74.452  153.223 1.00 58.93  ? 62   SER E N   1 
ATOM   9344  C  CA  . SER E  1 62  ? 18.149  74.609  152.654 1.00 57.18  ? 62   SER E CA  1 
ATOM   9345  C  C   . SER E  1 62  ? 18.993  73.354  152.747 1.00 53.55  ? 62   SER E C   1 
ATOM   9346  O  O   . SER E  1 62  ? 18.845  72.566  153.672 1.00 54.18  ? 62   SER E O   1 
ATOM   9347  C  CB  . SER E  1 62  ? 18.895  75.742  153.357 1.00 61.46  ? 62   SER E CB  1 
ATOM   9348  O  OG  . SER E  1 62  ? 20.294  75.644  153.129 1.00 63.88  ? 62   SER E OG  1 
ATOM   9349  N  N   . VAL E  1 63  ? 19.890  73.184  151.782 1.00 51.62  ? 63   VAL E N   1 
ATOM   9350  C  CA  . VAL E  1 63  ? 20.789  72.041  151.765 1.00 48.54  ? 63   VAL E CA  1 
ATOM   9351  C  C   . VAL E  1 63  ? 21.899  72.252  152.774 1.00 48.00  ? 63   VAL E C   1 
ATOM   9352  O  O   . VAL E  1 63  ? 22.425  71.287  153.328 1.00 50.39  ? 63   VAL E O   1 
ATOM   9353  C  CB  . VAL E  1 63  ? 21.467  71.844  150.396 1.00 47.80  ? 63   VAL E CB  1 
ATOM   9354  C  CG1 . VAL E  1 63  ? 20.616  70.996  149.510 1.00 45.14  ? 63   VAL E CG1 1 
ATOM   9355  C  CG2 . VAL E  1 63  ? 21.742  73.191  149.760 1.00 43.77  ? 63   VAL E CG2 1 
ATOM   9356  N  N   . ALA E  1 64  ? 22.276  73.508  153.000 1.00 45.78  ? 64   ALA E N   1 
ATOM   9357  C  CA  . ALA E  1 64  ? 23.346  73.800  153.955 1.00 45.66  ? 64   ALA E CA  1 
ATOM   9358  C  C   . ALA E  1 64  ? 23.017  73.131  155.289 1.00 44.18  ? 64   ALA E C   1 
ATOM   9359  O  O   . ALA E  1 64  ? 23.858  72.465  155.894 1.00 41.56  ? 64   ALA E O   1 
ATOM   9360  C  CB  . ALA E  1 64  ? 23.502  75.306  154.132 1.00 45.68  ? 64   ALA E CB  1 
ATOM   9361  N  N   . VAL E  1 65  ? 21.778  73.300  155.730 1.00 44.04  ? 65   VAL E N   1 
ATOM   9362  C  CA  . VAL E  1 65  ? 21.320  72.701  156.974 1.00 47.03  ? 65   VAL E CA  1 
ATOM   9363  C  C   . VAL E  1 65  ? 21.476  71.180  156.945 1.00 46.68  ? 65   VAL E C   1 
ATOM   9364  O  O   . VAL E  1 65  ? 21.995  70.574  157.879 1.00 46.43  ? 65   VAL E O   1 
ATOM   9365  C  CB  . VAL E  1 65  ? 19.848  73.053  157.220 1.00 49.47  ? 65   VAL E CB  1 
ATOM   9366  C  CG1 . VAL E  1 65  ? 19.287  72.192  158.340 1.00 49.41  ? 65   VAL E CG1 1 
ATOM   9367  C  CG2 . VAL E  1 65  ? 19.728  74.546  157.548 1.00 49.78  ? 65   VAL E CG2 1 
ATOM   9368  N  N   . SER E  1 66  ? 21.024  70.565  155.864 1.00 46.53  ? 66   SER E N   1 
ATOM   9369  C  CA  . SER E  1 66  ? 21.128  69.125  155.722 1.00 45.39  ? 66   SER E CA  1 
ATOM   9370  C  C   . SER E  1 66  ? 22.572  68.634  155.655 1.00 45.63  ? 66   SER E C   1 
ATOM   9371  O  O   . SER E  1 66  ? 22.929  67.685  156.351 1.00 47.86  ? 66   SER E O   1 
ATOM   9372  C  CB  . SER E  1 66  ? 20.384  68.673  154.473 1.00 44.27  ? 66   SER E CB  1 
ATOM   9373  O  OG  . SER E  1 66  ? 20.519  67.280  154.293 1.00 45.90  ? 66   SER E OG  1 
ATOM   9374  N  N   . SER E  1 67  ? 23.402  69.264  154.824 1.00 45.62  ? 67   SER E N   1 
ATOM   9375  C  CA  . SER E  1 67  ? 24.798  68.837  154.697 1.00 46.82  ? 67   SER E CA  1 
ATOM   9376  C  C   . SER E  1 67  ? 25.623  69.205  155.921 1.00 48.30  ? 67   SER E C   1 
ATOM   9377  O  O   . SER E  1 67  ? 26.535  68.470  156.309 1.00 49.72  ? 67   SER E O   1 
ATOM   9378  C  CB  . SER E  1 67  ? 25.446  69.430  153.439 1.00 47.01  ? 67   SER E CB  1 
ATOM   9379  O  OG  . SER E  1 67  ? 25.430  70.839  153.461 1.00 47.30  ? 67   SER E OG  1 
ATOM   9380  N  N   . GLY E  1 68  ? 25.305  70.350  156.523 1.00 48.03  ? 68   GLY E N   1 
ATOM   9381  C  CA  . GLY E  1 68  ? 26.016  70.767  157.715 1.00 45.60  ? 68   GLY E CA  1 
ATOM   9382  C  C   . GLY E  1 68  ? 25.727  69.737  158.786 1.00 46.52  ? 68   GLY E C   1 
ATOM   9383  O  O   . GLY E  1 68  ? 26.633  69.262  159.469 1.00 44.94  ? 68   GLY E O   1 
ATOM   9384  N  N   . GLY E  1 69  ? 24.449  69.384  158.906 1.00 46.21  ? 69   GLY E N   1 
ATOM   9385  C  CA  . GLY E  1 69  ? 24.018  68.405  159.881 1.00 47.45  ? 69   GLY E CA  1 
ATOM   9386  C  C   . GLY E  1 69  ? 24.611  67.022  159.672 1.00 50.09  ? 69   GLY E C   1 
ATOM   9387  O  O   . GLY E  1 69  ? 25.073  66.403  160.631 1.00 51.01  ? 69   GLY E O   1 
ATOM   9388  N  N   . GLU E  1 70  ? 24.593  66.521  158.439 1.00 50.55  ? 70   GLU E N   1 
ATOM   9389  C  CA  . GLU E  1 70  ? 25.154  65.204  158.187 1.00 52.98  ? 70   GLU E CA  1 
ATOM   9390  C  C   . GLU E  1 70  ? 26.637  65.227  158.556 1.00 53.04  ? 70   GLU E C   1 
ATOM   9391  O  O   . GLU E  1 70  ? 27.130  64.293  159.179 1.00 54.38  ? 70   GLU E O   1 
ATOM   9392  C  CB  . GLU E  1 70  ? 24.986  64.780  156.707 1.00 57.63  ? 70   GLU E CB  1 
ATOM   9393  C  CG  . GLU E  1 70  ? 25.459  63.322  156.435 1.00 62.67  ? 70   GLU E CG  1 
ATOM   9394  C  CD  . GLU E  1 70  ? 25.364  62.850  154.966 1.00 65.68  ? 70   GLU E CD  1 
ATOM   9395  O  OE1 . GLU E  1 70  ? 24.251  62.812  154.388 1.00 61.87  ? 70   GLU E OE1 1 
ATOM   9396  O  OE2 . GLU E  1 70  ? 26.418  62.491  154.392 1.00 67.31  ? 70   GLU E OE2 1 
ATOM   9397  N  N   . LEU E  1 71  ? 27.346  66.292  158.180 1.00 51.27  ? 71   LEU E N   1 
ATOM   9398  C  CA  . LEU E  1 71  ? 28.772  66.399  158.483 1.00 52.21  ? 71   LEU E CA  1 
ATOM   9399  C  C   . LEU E  1 71  ? 29.032  66.393  159.977 1.00 53.34  ? 71   LEU E C   1 
ATOM   9400  O  O   . LEU E  1 71  ? 30.022  65.832  160.446 1.00 52.23  ? 71   LEU E O   1 
ATOM   9401  C  CB  . LEU E  1 71  ? 29.361  67.676  157.889 1.00 51.11  ? 71   LEU E CB  1 
ATOM   9402  C  CG  . LEU E  1 71  ? 29.655  67.667  156.395 1.00 52.58  ? 71   LEU E CG  1 
ATOM   9403  C  CD1 . LEU E  1 71  ? 30.252  69.010  156.003 1.00 52.40  ? 71   LEU E CD1 1 
ATOM   9404  C  CD2 . LEU E  1 71  ? 30.614  66.537  156.059 1.00 46.90  ? 71   LEU E CD2 1 
ATOM   9405  N  N   . PHE E  1 72  ? 28.140  67.034  160.719 1.00 55.22  ? 72   PHE E N   1 
ATOM   9406  C  CA  . PHE E  1 72  ? 28.251  67.113  162.166 1.00 59.36  ? 72   PHE E CA  1 
ATOM   9407  C  C   . PHE E  1 72  ? 28.092  65.721  162.777 1.00 61.72  ? 72   PHE E C   1 
ATOM   9408  O  O   . PHE E  1 72  ? 29.036  65.176  163.360 1.00 61.42  ? 72   PHE E O   1 
ATOM   9409  C  CB  . PHE E  1 72  ? 27.176  68.061  162.711 1.00 61.34  ? 72   PHE E CB  1 
ATOM   9410  C  CG  . PHE E  1 72  ? 27.175  68.190  164.206 1.00 59.99  ? 72   PHE E CG  1 
ATOM   9411  C  CD1 . PHE E  1 72  ? 28.258  68.748  164.869 1.00 59.63  ? 72   PHE E CD1 1 
ATOM   9412  C  CD2 . PHE E  1 72  ? 26.087  67.745  164.951 1.00 59.69  ? 72   PHE E CD2 1 
ATOM   9413  C  CE1 . PHE E  1 72  ? 28.259  68.859  166.254 1.00 59.89  ? 72   PHE E CE1 1 
ATOM   9414  C  CE2 . PHE E  1 72  ? 26.078  67.851  166.338 1.00 59.31  ? 72   PHE E CE2 1 
ATOM   9415  C  CZ  . PHE E  1 72  ? 27.164  68.408  166.989 1.00 60.87  ? 72   PHE E CZ  1 
ATOM   9416  N  N   . LEU E  1 73  ? 26.899  65.148  162.630 1.00 63.73  ? 73   LEU E N   1 
ATOM   9417  C  CA  . LEU E  1 73  ? 26.607  63.825  163.168 1.00 67.12  ? 73   LEU E CA  1 
ATOM   9418  C  C   . LEU E  1 73  ? 27.680  62.800  162.812 1.00 69.34  ? 73   LEU E C   1 
ATOM   9419  O  O   . LEU E  1 73  ? 27.932  61.872  163.582 1.00 72.32  ? 73   LEU E O   1 
ATOM   9420  C  CB  . LEU E  1 73  ? 25.233  63.342  162.680 1.00 68.16  ? 73   LEU E CB  1 
ATOM   9421  C  CG  . LEU E  1 73  ? 24.830  61.893  163.007 1.00 70.88  ? 73   LEU E CG  1 
ATOM   9422  C  CD1 . LEU E  1 73  ? 23.315  61.762  162.981 1.00 71.85  ? 73   LEU E CD1 1 
ATOM   9423  C  CD2 . LEU E  1 73  ? 25.470  60.922  162.008 1.00 71.63  ? 73   LEU E CD2 1 
ATOM   9424  N  N   . ARG E  1 74  ? 28.310  62.961  161.651 1.00 69.85  ? 74   ARG E N   1 
ATOM   9425  C  CA  . ARG E  1 74  ? 29.356  62.034  161.229 1.00 70.43  ? 74   ARG E CA  1 
ATOM   9426  C  C   . ARG E  1 74  ? 30.648  62.280  161.996 1.00 69.23  ? 74   ARG E C   1 
ATOM   9427  O  O   . ARG E  1 74  ? 31.350  61.338  162.356 1.00 68.86  ? 74   ARG E O   1 
ATOM   9428  C  CB  . ARG E  1 74  ? 29.640  62.167  159.729 1.00 72.45  ? 74   ARG E CB  1 
ATOM   9429  C  CG  . ARG E  1 74  ? 28.536  61.682  158.803 1.00 76.57  ? 74   ARG E CG  1 
ATOM   9430  C  CD  . ARG E  1 74  ? 28.931  61.936  157.347 1.00 82.83  ? 74   ARG E CD  1 
ATOM   9431  N  NE  . ARG E  1 74  ? 27.902  61.536  156.391 1.00 86.14  ? 74   ARG E NE  1 
ATOM   9432  C  CZ  . ARG E  1 74  ? 27.499  60.282  156.204 1.00 89.03  ? 74   ARG E CZ  1 
ATOM   9433  N  NH1 . ARG E  1 74  ? 28.040  59.295  156.912 1.00 88.82  ? 74   ARG E NH1 1 
ATOM   9434  N  NH2 . ARG E  1 74  ? 26.553  60.012  155.309 1.00 89.12  ? 74   ARG E NH2 1 
ATOM   9435  N  N   . PHE E  1 75  ? 30.958  63.549  162.245 1.00 67.77  ? 75   PHE E N   1 
ATOM   9436  C  CA  . PHE E  1 75  ? 32.179  63.908  162.956 1.00 67.23  ? 75   PHE E CA  1 
ATOM   9437  C  C   . PHE E  1 75  ? 32.152  63.465  164.413 1.00 67.31  ? 75   PHE E C   1 
ATOM   9438  O  O   . PHE E  1 75  ? 33.177  63.074  164.981 1.00 65.63  ? 75   PHE E O   1 
ATOM   9439  C  CB  . PHE E  1 75  ? 32.397  65.416  162.890 1.00 67.27  ? 75   PHE E CB  1 
ATOM   9440  C  CG  . PHE E  1 75  ? 33.682  65.868  163.519 1.00 68.31  ? 75   PHE E CG  1 
ATOM   9441  C  CD1 . PHE E  1 75  ? 34.899  65.595  162.912 1.00 69.19  ? 75   PHE E CD1 1 
ATOM   9442  C  CD2 . PHE E  1 75  ? 33.676  66.564  164.721 1.00 70.63  ? 75   PHE E CD2 1 
ATOM   9443  C  CE1 . PHE E  1 75  ? 36.096  66.011  163.492 1.00 70.78  ? 75   PHE E CE1 1 
ATOM   9444  C  CE2 . PHE E  1 75  ? 34.869  66.987  165.311 1.00 71.53  ? 75   PHE E CE2 1 
ATOM   9445  C  CZ  . PHE E  1 75  ? 36.079  66.710  164.694 1.00 71.12  ? 75   PHE E CZ  1 
ATOM   9446  N  N   . ILE E  1 76  ? 30.972  63.536  165.016 1.00 67.41  ? 76   ILE E N   1 
ATOM   9447  C  CA  . ILE E  1 76  ? 30.809  63.144  166.405 1.00 69.00  ? 76   ILE E CA  1 
ATOM   9448  C  C   . ILE E  1 76  ? 30.523  61.648  166.513 1.00 72.30  ? 76   ILE E C   1 
ATOM   9449  O  O   . ILE E  1 76  ? 29.584  61.239  167.196 1.00 74.06  ? 76   ILE E O   1 
ATOM   9450  C  CB  . ILE E  1 76  ? 29.655  63.930  167.069 1.00 66.84  ? 76   ILE E CB  1 
ATOM   9451  C  CG1 . ILE E  1 76  ? 28.317  63.548  166.436 1.00 64.07  ? 76   ILE E CG1 1 
ATOM   9452  C  CG2 . ILE E  1 76  ? 29.877  65.425  166.892 1.00 66.34  ? 76   ILE E CG2 1 
ATOM   9453  C  CD1 . ILE E  1 76  ? 27.137  64.179  167.129 1.00 62.11  ? 76   ILE E CD1 1 
ATOM   9454  N  N   . SER E  1 77  ? 31.333  60.830  165.842 1.00 74.60  ? 77   SER E N   1 
ATOM   9455  C  CA  . SER E  1 77  ? 31.137  59.382  165.873 1.00 74.44  ? 77   SER E CA  1 
ATOM   9456  C  C   . SER E  1 77  ? 32.417  58.606  166.164 1.00 76.85  ? 77   SER E C   1 
ATOM   9457  O  O   . SER E  1 77  ? 33.492  58.961  165.678 1.00 76.35  ? 77   SER E O   1 
ATOM   9458  C  CB  . SER E  1 77  ? 30.521  58.917  164.558 1.00 71.56  ? 77   SER E CB  1 
ATOM   9459  O  OG  . SER E  1 77  ? 29.249  59.515  164.382 1.00 66.35  ? 77   SER E OG  1 
ATOM   9460  N  N   . LEU E  1 78  ? 32.277  57.540  166.958 1.00 80.51  ? 78   LEU E N   1 
ATOM   9461  C  CA  . LEU E  1 78  ? 33.394  56.685  167.378 1.00 82.22  ? 78   LEU E CA  1 
ATOM   9462  C  C   . LEU E  1 78  ? 34.475  57.507  168.063 1.00 82.16  ? 78   LEU E C   1 
ATOM   9463  O  O   . LEU E  1 78  ? 34.176  58.337  168.919 1.00 82.15  ? 78   LEU E O   1 
ATOM   9464  C  CB  . LEU E  1 78  ? 34.003  55.917  166.192 1.00 82.89  ? 78   LEU E CB  1 
ATOM   9465  C  CG  . LEU E  1 78  ? 33.425  54.537  165.829 1.00 83.05  ? 78   LEU E CG  1 
ATOM   9466  C  CD1 . LEU E  1 78  ? 34.185  53.957  164.636 1.00 80.72  ? 78   LEU E CD1 1 
ATOM   9467  C  CD2 . LEU E  1 78  ? 33.527  53.595  167.025 1.00 81.82  ? 78   LEU E CD2 1 
ATOM   9468  N  N   . SER E  1 87  ? 30.141  52.592  179.261 1.00 88.17  ? 87   SER E N   1 
ATOM   9469  C  CA  . SER E  1 87  ? 30.573  53.360  178.101 1.00 88.05  ? 87   SER E CA  1 
ATOM   9470  C  C   . SER E  1 87  ? 29.497  54.331  177.614 1.00 87.71  ? 87   SER E C   1 
ATOM   9471  O  O   . SER E  1 87  ? 29.618  54.894  176.531 1.00 87.94  ? 87   SER E O   1 
ATOM   9472  C  CB  . SER E  1 87  ? 30.963  52.422  176.951 1.00 89.11  ? 87   SER E CB  1 
ATOM   9473  O  OG  . SER E  1 87  ? 29.819  51.844  176.340 1.00 88.04  ? 87   SER E OG  1 
ATOM   9474  N  N   . LYS E  1 88  ? 28.440  54.523  178.398 1.00 87.24  ? 88   LYS E N   1 
ATOM   9475  C  CA  . LYS E  1 88  ? 27.391  55.456  178.000 1.00 86.71  ? 88   LYS E CA  1 
ATOM   9476  C  C   . LYS E  1 88  ? 27.927  56.863  178.268 1.00 87.92  ? 88   LYS E C   1 
ATOM   9477  O  O   . LYS E  1 88  ? 27.177  57.835  178.385 1.00 88.65  ? 88   LYS E O   1 
ATOM   9478  C  CB  . LYS E  1 88  ? 26.107  55.205  178.797 1.00 85.60  ? 88   LYS E CB  1 
ATOM   9479  C  CG  . LYS E  1 88  ? 24.955  56.104  178.387 1.00 83.57  ? 88   LYS E CG  1 
ATOM   9480  C  CD  . LYS E  1 88  ? 24.657  55.971  176.905 1.00 81.25  ? 88   LYS E CD  1 
ATOM   9481  C  CE  . LYS E  1 88  ? 23.760  57.098  176.435 1.00 82.15  ? 88   LYS E CE  1 
ATOM   9482  N  NZ  . LYS E  1 88  ? 23.358  56.943  175.011 1.00 81.05  ? 88   LYS E NZ  1 
ATOM   9483  N  N   . CYS E  1 89  ? 29.251  56.938  178.372 1.00 88.13  ? 89   CYS E N   1 
ATOM   9484  C  CA  . CYS E  1 89  ? 29.980  58.177  178.606 1.00 87.05  ? 89   CYS E CA  1 
ATOM   9485  C  C   . CYS E  1 89  ? 30.566  58.586  177.267 1.00 86.27  ? 89   CYS E C   1 
ATOM   9486  O  O   . CYS E  1 89  ? 31.513  59.373  177.196 1.00 86.77  ? 89   CYS E O   1 
ATOM   9487  C  CB  . CYS E  1 89  ? 31.114  57.939  179.604 1.00 89.12  ? 89   CYS E CB  1 
ATOM   9488  S  SG  . CYS E  1 89  ? 32.285  56.639  179.097 1.00 89.69  ? 89   CYS E SG  1 
ATOM   9489  N  N   . LYS E  1 90  ? 30.005  58.020  176.205 1.00 84.43  ? 90   LYS E N   1 
ATOM   9490  C  CA  . LYS E  1 90  ? 30.444  58.321  174.856 1.00 82.70  ? 90   LYS E CA  1 
ATOM   9491  C  C   . LYS E  1 90  ? 29.981  59.734  174.546 1.00 81.79  ? 90   LYS E C   1 
ATOM   9492  O  O   . LYS E  1 90  ? 29.790  60.095  173.390 1.00 83.45  ? 90   LYS E O   1 
ATOM   9493  C  CB  . LYS E  1 90  ? 29.831  57.337  173.856 1.00 81.88  ? 90   LYS E CB  1 
ATOM   9494  C  CG  . LYS E  1 90  ? 30.363  57.469  172.434 1.00 83.72  ? 90   LYS E CG  1 
ATOM   9495  C  CD  . LYS E  1 90  ? 31.845  57.106  172.348 1.00 85.95  ? 90   LYS E CD  1 
ATOM   9496  C  CE  . LYS E  1 90  ? 32.438  57.417  170.963 1.00 86.77  ? 90   LYS E CE  1 
ATOM   9497  N  NZ  . LYS E  1 90  ? 31.911  56.570  169.850 1.00 84.57  ? 90   LYS E NZ  1 
ATOM   9498  N  N   . LYS E  1 91  ? 29.781  60.526  175.596 1.00 79.84  ? 91   LYS E N   1 
ATOM   9499  C  CA  . LYS E  1 91  ? 29.370  61.908  175.435 1.00 75.07  ? 91   LYS E CA  1 
ATOM   9500  C  C   . LYS E  1 91  ? 30.628  62.714  175.151 1.00 74.67  ? 91   LYS E C   1 
ATOM   9501  O  O   . LYS E  1 91  ? 30.728  63.900  175.457 1.00 73.27  ? 91   LYS E O   1 
ATOM   9502  C  CB  . LYS E  1 91  ? 28.687  62.409  176.690 1.00 72.93  ? 91   LYS E CB  1 
ATOM   9503  C  CG  . LYS E  1 91  ? 27.321  63.001  176.421 1.00 71.74  ? 91   LYS E CG  1 
ATOM   9504  C  CD  . LYS E  1 91  ? 26.329  61.959  175.928 1.00 68.23  ? 91   LYS E CD  1 
ATOM   9505  C  CE  . LYS E  1 91  ? 24.917  62.533  175.921 1.00 64.63  ? 91   LYS E CE  1 
ATOM   9506  N  NZ  . LYS E  1 91  ? 23.884  61.497  175.689 1.00 65.57  ? 91   LYS E NZ  1 
ATOM   9507  N  N   . ILE E  1 92  ? 31.606  62.022  174.582 1.00 73.37  ? 92   ILE E N   1 
ATOM   9508  C  CA  . ILE E  1 92  ? 32.855  62.630  174.176 1.00 73.15  ? 92   ILE E CA  1 
ATOM   9509  C  C   . ILE E  1 92  ? 32.389  63.347  172.911 1.00 72.99  ? 92   ILE E C   1 
ATOM   9510  O  O   . ILE E  1 92  ? 33.054  64.233  172.374 1.00 71.03  ? 92   ILE E O   1 
ATOM   9511  C  CB  . ILE E  1 92  ? 33.883  61.554  173.791 1.00 72.74  ? 92   ILE E CB  1 
ATOM   9512  C  CG1 . ILE E  1 92  ? 33.464  60.205  174.375 1.00 73.67  ? 92   ILE E CG1 1 
ATOM   9513  C  CG2 . ILE E  1 92  ? 35.250  61.927  174.316 1.00 70.54  ? 92   ILE E CG2 1 
ATOM   9514  C  CD1 . ILE E  1 92  ? 34.334  59.045  173.930 1.00 75.92  ? 92   ILE E CD1 1 
HETATM 9515  N  N   . MSE E  1 93  ? 31.217  62.925  172.449 1.00 73.76  ? 93   MSE E N   1 
HETATM 9516  C  CA  . MSE E  1 93  ? 30.581  63.481  171.267 1.00 75.99  ? 93   MSE E CA  1 
HETATM 9517  C  C   . MSE E  1 93  ? 30.409  64.976  171.440 1.00 74.02  ? 93   MSE E C   1 
HETATM 9518  O  O   . MSE E  1 93  ? 30.677  65.757  170.525 1.00 74.07  ? 93   MSE E O   1 
HETATM 9519  C  CB  . MSE E  1 93  ? 29.211  62.834  171.055 1.00 80.46  ? 93   MSE E CB  1 
HETATM 9520  C  CG  . MSE E  1 93  ? 29.278  61.371  170.626 1.00 87.66  ? 93   MSE E CG  1 
HETATM 9521  SE SE  . MSE E  1 93  ? 27.542  60.511  170.601 1.00 97.56  ? 93   MSE E SE  1 
HETATM 9522  C  CE  . MSE E  1 93  ? 26.887  61.146  168.896 1.00 93.59  ? 93   MSE E CE  1 
ATOM   9523  N  N   . ILE E  1 94  ? 29.963  65.373  172.624 1.00 71.02  ? 94   ILE E N   1 
ATOM   9524  C  CA  . ILE E  1 94  ? 29.757  66.779  172.899 1.00 67.93  ? 94   ILE E CA  1 
ATOM   9525  C  C   . ILE E  1 94  ? 31.048  67.594  172.783 1.00 68.25  ? 94   ILE E C   1 
ATOM   9526  O  O   . ILE E  1 94  ? 31.022  68.731  172.311 1.00 68.66  ? 94   ILE E O   1 
ATOM   9527  C  CB  . ILE E  1 94  ? 29.122  66.975  174.288 1.00 65.30  ? 94   ILE E CB  1 
ATOM   9528  C  CG1 . ILE E  1 94  ? 27.743  66.308  174.314 1.00 62.05  ? 94   ILE E CG1 1 
ATOM   9529  C  CG2 . ILE E  1 94  ? 29.001  68.459  174.602 1.00 63.61  ? 94   ILE E CG2 1 
ATOM   9530  C  CD1 . ILE E  1 94  ? 26.969  66.526  175.594 1.00 57.08  ? 94   ILE E CD1 1 
ATOM   9531  N  N   . GLU E  1 95  ? 32.181  67.031  173.188 1.00 67.77  ? 95   GLU E N   1 
ATOM   9532  C  CA  . GLU E  1 95  ? 33.419  67.793  173.075 1.00 69.11  ? 95   GLU E CA  1 
ATOM   9533  C  C   . GLU E  1 95  ? 33.900  67.767  171.629 1.00 67.61  ? 95   GLU E C   1 
ATOM   9534  O  O   . GLU E  1 95  ? 34.659  68.640  171.198 1.00 67.17  ? 95   GLU E O   1 
ATOM   9535  C  CB  . GLU E  1 95  ? 34.496  67.263  174.039 1.00 71.76  ? 95   GLU E CB  1 
ATOM   9536  C  CG  . GLU E  1 95  ? 35.084  65.902  173.727 1.00 77.30  ? 95   GLU E CG  1 
ATOM   9537  C  CD  . GLU E  1 95  ? 35.994  65.398  174.849 1.00 81.88  ? 95   GLU E CD  1 
ATOM   9538  O  OE1 . GLU E  1 95  ? 36.794  64.468  174.597 1.00 83.02  ? 95   GLU E OE1 1 
ATOM   9539  O  OE2 . GLU E  1 95  ? 35.903  65.927  175.984 1.00 82.56  ? 95   GLU E OE2 1 
ATOM   9540  N  N   . ARG E  1 96  ? 33.442  66.765  170.882 1.00 64.78  ? 96   ARG E N   1 
ATOM   9541  C  CA  . ARG E  1 96  ? 33.783  66.644  169.472 1.00 63.38  ? 96   ARG E CA  1 
ATOM   9542  C  C   . ARG E  1 96  ? 32.961  67.713  168.767 1.00 60.85  ? 96   ARG E C   1 
ATOM   9543  O  O   . ARG E  1 96  ? 33.463  68.453  167.924 1.00 59.92  ? 96   ARG E O   1 
ATOM   9544  C  CB  . ARG E  1 96  ? 33.381  65.271  168.936 1.00 66.98  ? 96   ARG E CB  1 
ATOM   9545  C  CG  . ARG E  1 96  ? 34.074  64.104  169.597 1.00 71.83  ? 96   ARG E CG  1 
ATOM   9546  C  CD  . ARG E  1 96  ? 35.493  63.909  169.090 1.00 74.73  ? 96   ARG E CD  1 
ATOM   9547  N  NE  . ARG E  1 96  ? 36.424  63.642  170.188 1.00 81.40  ? 96   ARG E NE  1 
ATOM   9548  C  CZ  . ARG E  1 96  ? 36.239  62.732  171.147 1.00 82.19  ? 96   ARG E CZ  1 
ATOM   9549  N  NH1 . ARG E  1 96  ? 35.148  61.976  171.166 1.00 81.43  ? 96   ARG E NH1 1 
ATOM   9550  N  NH2 . ARG E  1 96  ? 37.150  62.585  172.102 1.00 81.17  ? 96   ARG E NH2 1 
ATOM   9551  N  N   . GLY E  1 97  ? 31.686  67.783  169.132 1.00 58.44  ? 97   GLY E N   1 
ATOM   9552  C  CA  . GLY E  1 97  ? 30.795  68.761  168.545 1.00 58.87  ? 97   GLY E CA  1 
ATOM   9553  C  C   . GLY E  1 97  ? 31.289  70.185  168.726 1.00 59.39  ? 97   GLY E C   1 
ATOM   9554  O  O   . GLY E  1 97  ? 31.170  71.009  167.825 1.00 59.68  ? 97   GLY E O   1 
ATOM   9555  N  N   . GLU E  1 98  ? 31.844  70.489  169.892 1.00 59.90  ? 98   GLU E N   1 
ATOM   9556  C  CA  . GLU E  1 98  ? 32.346  71.832  170.143 1.00 59.26  ? 98   GLU E CA  1 
ATOM   9557  C  C   . GLU E  1 98  ? 33.623  72.076  169.355 1.00 58.80  ? 98   GLU E C   1 
ATOM   9558  O  O   . GLU E  1 98  ? 33.943  73.212  169.009 1.00 58.52  ? 98   GLU E O   1 
ATOM   9559  C  CB  . GLU E  1 98  ? 32.588  72.034  171.639 1.00 59.47  ? 98   GLU E CB  1 
ATOM   9560  C  CG  . GLU E  1 98  ? 31.440  72.755  172.335 1.00 60.05  ? 98   GLU E CG  1 
ATOM   9561  C  CD  . GLU E  1 98  ? 31.065  72.134  173.667 1.00 60.16  ? 98   GLU E CD  1 
ATOM   9562  O  OE1 . GLU E  1 98  ? 31.961  71.910  174.507 1.00 58.35  ? 98   GLU E OE1 1 
ATOM   9563  O  OE2 . GLU E  1 98  ? 29.863  71.874  173.876 1.00 61.69  ? 98   GLU E OE2 1 
ATOM   9564  N  N   . LEU E  1 99  ? 34.349  71.000  169.073 1.00 58.36  ? 99   LEU E N   1 
ATOM   9565  C  CA  . LEU E  1 99  ? 35.580  71.097  168.304 1.00 56.55  ? 99   LEU E CA  1 
ATOM   9566  C  C   . LEU E  1 99  ? 35.197  71.428  166.873 1.00 56.43  ? 99   LEU E C   1 
ATOM   9567  O  O   . LEU E  1 99  ? 35.816  72.276  166.229 1.00 55.85  ? 99   LEU E O   1 
ATOM   9568  C  CB  . LEU E  1 99  ? 36.327  69.771  168.338 1.00 56.31  ? 99   LEU E CB  1 
ATOM   9569  C  CG  . LEU E  1 99  ? 37.527  69.682  167.397 1.00 59.13  ? 99   LEU E CG  1 
ATOM   9570  C  CD1 . LEU E  1 99  ? 38.547  70.784  167.708 1.00 54.47  ? 99   LEU E CD1 1 
ATOM   9571  C  CD2 . LEU E  1 99  ? 38.150  68.300  167.540 1.00 59.26  ? 99   LEU E CD2 1 
ATOM   9572  N  N   . PHE E  1 100 ? 34.157  70.752  166.395 1.00 54.67  ? 100  PHE E N   1 
ATOM   9573  C  CA  . PHE E  1 100 ? 33.641  70.934  165.042 1.00 53.97  ? 100  PHE E CA  1 
ATOM   9574  C  C   . PHE E  1 100 ? 33.014  72.318  164.865 1.00 52.32  ? 100  PHE E C   1 
ATOM   9575  O  O   . PHE E  1 100 ? 33.100  72.912  163.783 1.00 49.23  ? 100  PHE E O   1 
ATOM   9576  C  CB  . PHE E  1 100 ? 32.615  69.820  164.742 1.00 56.86  ? 100  PHE E CB  1 
ATOM   9577  C  CG  . PHE E  1 100 ? 31.943  69.926  163.387 1.00 58.80  ? 100  PHE E CG  1 
ATOM   9578  C  CD1 . PHE E  1 100 ? 30.852  70.779  163.192 1.00 59.74  ? 100  PHE E CD1 1 
ATOM   9579  C  CD2 . PHE E  1 100 ? 32.382  69.156  162.318 1.00 57.44  ? 100  PHE E CD2 1 
ATOM   9580  C  CE1 . PHE E  1 100 ? 30.214  70.856  161.955 1.00 56.86  ? 100  PHE E CE1 1 
ATOM   9581  C  CE2 . PHE E  1 100 ? 31.749  69.229  161.079 1.00 56.95  ? 100  PHE E CE2 1 
ATOM   9582  C  CZ  . PHE E  1 100 ? 30.664  70.080  160.899 1.00 56.41  ? 100  PHE E CZ  1 
ATOM   9583  N  N   . LEU E  1 101 ? 32.397  72.830  165.930 1.00 49.71  ? 101  LEU E N   1 
ATOM   9584  C  CA  . LEU E  1 101 ? 31.744  74.134  165.887 1.00 48.47  ? 101  LEU E CA  1 
ATOM   9585  C  C   . LEU E  1 101 ? 32.768  75.244  166.002 1.00 50.00  ? 101  LEU E C   1 
ATOM   9586  O  O   . LEU E  1 101 ? 32.556  76.361  165.523 1.00 51.70  ? 101  LEU E O   1 
ATOM   9587  C  CB  . LEU E  1 101 ? 30.737  74.261  167.017 1.00 46.35  ? 101  LEU E CB  1 
ATOM   9588  C  CG  . LEU E  1 101 ? 29.853  75.489  166.877 1.00 48.87  ? 101  LEU E CG  1 
ATOM   9589  C  CD1 . LEU E  1 101 ? 28.778  75.212  165.852 1.00 47.03  ? 101  LEU E CD1 1 
ATOM   9590  C  CD2 . LEU E  1 101 ? 29.238  75.835  168.223 1.00 52.38  ? 101  LEU E CD2 1 
ATOM   9591  N  N   . ARG E  1 102 ? 33.879  74.930  166.655 1.00 51.10  ? 102  ARG E N   1 
ATOM   9592  C  CA  . ARG E  1 102 ? 34.970  75.875  166.825 1.00 51.30  ? 102  ARG E CA  1 
ATOM   9593  C  C   . ARG E  1 102 ? 35.718  75.920  165.494 1.00 51.90  ? 102  ARG E C   1 
ATOM   9594  O  O   . ARG E  1 102 ? 36.089  76.987  165.012 1.00 51.94  ? 102  ARG E O   1 
ATOM   9595  C  CB  . ARG E  1 102 ? 35.870  75.402  167.976 1.00 52.26  ? 102  ARG E CB  1 
ATOM   9596  C  CG  . ARG E  1 102 ? 37.321  75.873  167.940 1.00 56.73  ? 102  ARG E CG  1 
ATOM   9597  C  CD  . ARG E  1 102 ? 38.059  75.646  169.290 1.00 57.48  ? 102  ARG E CD  1 
ATOM   9598  N  NE  . ARG E  1 102 ? 37.882  74.310  169.873 1.00 59.20  ? 102  ARG E NE  1 
ATOM   9599  C  CZ  . ARG E  1 102 ? 36.953  73.990  170.781 1.00 58.10  ? 102  ARG E CZ  1 
ATOM   9600  N  NH1 . ARG E  1 102 ? 36.103  74.910  171.226 1.00 55.26  ? 102  ARG E NH1 1 
ATOM   9601  N  NH2 . ARG E  1 102 ? 36.868  72.746  171.245 1.00 51.03  ? 102  ARG E NH2 1 
ATOM   9602  N  N   . ARG E  1 103 ? 35.895  74.751  164.886 1.00 52.88  ? 103  ARG E N   1 
ATOM   9603  C  CA  . ARG E  1 103 ? 36.587  74.624  163.608 1.00 53.69  ? 103  ARG E CA  1 
ATOM   9604  C  C   . ARG E  1 103 ? 35.883  75.308  162.435 1.00 53.19  ? 103  ARG E C   1 
ATOM   9605  O  O   . ARG E  1 103 ? 36.544  75.931  161.607 1.00 53.24  ? 103  ARG E O   1 
ATOM   9606  C  CB  . ARG E  1 103 ? 36.807  73.145  163.284 1.00 56.02  ? 103  ARG E CB  1 
ATOM   9607  C  CG  . ARG E  1 103 ? 38.252  72.687  163.406 1.00 62.93  ? 103  ARG E CG  1 
ATOM   9608  C  CD  . ARG E  1 103 ? 38.359  71.166  163.556 1.00 71.65  ? 103  ARG E CD  1 
ATOM   9609  N  NE  . ARG E  1 103 ? 39.672  70.667  163.147 1.00 79.67  ? 103  ARG E NE  1 
ATOM   9610  C  CZ  . ARG E  1 103 ? 40.090  70.617  161.880 1.00 84.59  ? 103  ARG E CZ  1 
ATOM   9611  N  NH1 . ARG E  1 103 ? 39.296  71.029  160.895 1.00 83.94  ? 103  ARG E NH1 1 
ATOM   9612  N  NH2 . ARG E  1 103 ? 41.309  70.166  161.592 1.00 84.23  ? 103  ARG E NH2 1 
ATOM   9613  N  N   . ILE E  1 104 ? 34.558  75.208  162.353 1.00 53.02  ? 104  ILE E N   1 
ATOM   9614  C  CA  . ILE E  1 104 ? 33.843  75.840  161.241 1.00 55.33  ? 104  ILE E CA  1 
ATOM   9615  C  C   . ILE E  1 104 ? 33.548  77.322  161.441 1.00 56.41  ? 104  ILE E C   1 
ATOM   9616  O  O   . ILE E  1 104 ? 32.999  77.965  160.554 1.00 58.00  ? 104  ILE E O   1 
ATOM   9617  C  CB  . ILE E  1 104 ? 32.484  75.129  160.897 1.00 53.89  ? 104  ILE E CB  1 
ATOM   9618  C  CG1 . ILE E  1 104 ? 31.464  75.329  162.013 1.00 55.40  ? 104  ILE E CG1 1 
ATOM   9619  C  CG2 . ILE E  1 104 ? 32.703  73.658  160.648 1.00 55.86  ? 104  ILE E CG2 1 
ATOM   9620  C  CD1 . ILE E  1 104 ? 30.767  76.678  161.980 1.00 56.98  ? 104  ILE E CD1 1 
ATOM   9621  N  N   . SER E  1 105 ? 33.896  77.872  162.597 1.00 58.88  ? 105  SER E N   1 
ATOM   9622  C  CA  . SER E  1 105 ? 33.637  79.292  162.841 1.00 60.42  ? 105  SER E CA  1 
ATOM   9623  C  C   . SER E  1 105 ? 34.828  80.148  162.393 1.00 59.59  ? 105  SER E C   1 
ATOM   9624  O  O   . SER E  1 105 ? 34.899  81.345  162.674 1.00 60.80  ? 105  SER E O   1 
ATOM   9625  C  CB  . SER E  1 105 ? 33.355  79.545  164.325 1.00 59.86  ? 105  SER E CB  1 
ATOM   9626  O  OG  . SER E  1 105 ? 34.570  79.675  165.042 1.00 61.21  ? 105  SER E OG  1 
ATOM   9627  N  N   . LEU E  1 106 ? 35.770  79.530  161.698 1.00 57.37  ? 106  LEU E N   1 
ATOM   9628  C  CA  . LEU E  1 106 ? 36.929  80.258  161.209 1.00 56.62  ? 106  LEU E CA  1 
ATOM   9629  C  C   . LEU E  1 106 ? 36.898  80.305  159.678 1.00 55.01  ? 106  LEU E C   1 
ATOM   9630  O  O   . LEU E  1 106 ? 37.650  81.055  159.048 1.00 54.08  ? 106  LEU E O   1 
ATOM   9631  C  CB  . LEU E  1 106 ? 38.212  79.577  161.710 1.00 56.91  ? 106  LEU E CB  1 
ATOM   9632  C  CG  . LEU E  1 106 ? 38.704  79.968  163.112 1.00 55.94  ? 106  LEU E CG  1 
ATOM   9633  C  CD1 . LEU E  1 106 ? 37.548  80.020  164.093 1.00 53.54  ? 106  LEU E CD1 1 
ATOM   9634  C  CD2 . LEU E  1 106 ? 39.758  78.977  163.565 1.00 54.20  ? 106  LEU E CD2 1 
ATOM   9635  N  N   . SER E  1 107 ? 35.994  79.512  159.106 1.00 52.21  ? 107  SER E N   1 
ATOM   9636  C  CA  . SER E  1 107 ? 35.827  79.386  157.664 1.00 50.98  ? 107  SER E CA  1 
ATOM   9637  C  C   . SER E  1 107 ? 35.711  80.690  156.881 1.00 51.00  ? 107  SER E C   1 
ATOM   9638  O  O   . SER E  1 107 ? 36.574  80.986  156.052 1.00 48.91  ? 107  SER E O   1 
ATOM   9639  C  CB  . SER E  1 107 ? 34.619  78.494  157.362 1.00 51.12  ? 107  SER E CB  1 
ATOM   9640  O  OG  . SER E  1 107 ? 34.806  77.189  157.884 1.00 48.63  ? 107  SER E OG  1 
ATOM   9641  N  N   . ARG E  1 108 ? 34.657  81.469  157.120 1.00 50.36  ? 108  ARG E N   1 
ATOM   9642  C  CA  . ARG E  1 108 ? 34.501  82.723  156.391 1.00 49.61  ? 108  ARG E CA  1 
ATOM   9643  C  C   . ARG E  1 108 ? 35.823  83.470  156.256 1.00 50.63  ? 108  ARG E C   1 
ATOM   9644  O  O   . ARG E  1 108 ? 36.252  83.787  155.145 1.00 49.82  ? 108  ARG E O   1 
ATOM   9645  C  CB  . ARG E  1 108 ? 33.485  83.625  157.074 1.00 50.32  ? 108  ARG E CB  1 
ATOM   9646  C  CG  . ARG E  1 108 ? 32.069  83.154  156.923 1.00 51.69  ? 108  ARG E CG  1 
ATOM   9647  C  CD  . ARG E  1 108 ? 31.116  84.145  157.535 1.00 51.61  ? 108  ARG E CD  1 
ATOM   9648  N  NE  . ARG E  1 108 ? 29.785  83.573  157.662 1.00 55.41  ? 108  ARG E NE  1 
ATOM   9649  C  CZ  . ARG E  1 108 ? 28.811  84.119  158.376 1.00 58.88  ? 108  ARG E CZ  1 
ATOM   9650  N  NH1 . ARG E  1 108 ? 29.019  85.254  159.027 1.00 61.41  ? 108  ARG E NH1 1 
ATOM   9651  N  NH2 . ARG E  1 108 ? 27.633  83.523  158.452 1.00 63.25  ? 108  ARG E NH2 1 
ATOM   9652  N  N   . ASN E  1 109 ? 36.474  83.748  157.381 1.00 50.88  ? 109  ASN E N   1 
ATOM   9653  C  CA  . ASN E  1 109 ? 37.744  84.460  157.340 1.00 51.14  ? 109  ASN E CA  1 
ATOM   9654  C  C   . ASN E  1 109 ? 38.745  83.737  156.467 1.00 49.51  ? 109  ASN E C   1 
ATOM   9655  O  O   . ASN E  1 109 ? 39.416  84.365  155.651 1.00 49.77  ? 109  ASN E O   1 
ATOM   9656  C  CB  . ASN E  1 109 ? 38.305  84.651  158.747 1.00 53.44  ? 109  ASN E CB  1 
ATOM   9657  C  CG  . ASN E  1 109 ? 37.614  85.780  159.496 1.00 56.55  ? 109  ASN E CG  1 
ATOM   9658  O  OD1 . ASN E  1 109 ? 37.734  85.891  160.717 1.00 60.80  ? 109  ASN E OD1 1 
ATOM   9659  N  ND2 . ASN E  1 109 ? 36.895  86.632  158.764 1.00 54.37  ? 109  ASN E ND2 1 
ATOM   9660  N  N   . LYS E  1 110 ? 38.847  82.422  156.622 1.00 46.78  ? 110  LYS E N   1 
ATOM   9661  C  CA  . LYS E  1 110 ? 39.771  81.658  155.793 1.00 48.43  ? 110  LYS E CA  1 
ATOM   9662  C  C   . LYS E  1 110 ? 39.548  82.024  154.327 1.00 49.06  ? 110  LYS E C   1 
ATOM   9663  O  O   . LYS E  1 110 ? 40.493  82.288  153.592 1.00 49.02  ? 110  LYS E O   1 
ATOM   9664  C  CB  . LYS E  1 110 ? 39.533  80.159  155.965 1.00 52.27  ? 110  LYS E CB  1 
ATOM   9665  C  CG  . LYS E  1 110 ? 39.877  79.595  157.329 1.00 54.88  ? 110  LYS E CG  1 
ATOM   9666  C  CD  . LYS E  1 110 ? 41.360  79.321  157.443 1.00 59.56  ? 110  LYS E CD  1 
ATOM   9667  C  CE  . LYS E  1 110 ? 41.620  78.018  158.198 1.00 63.00  ? 110  LYS E CE  1 
ATOM   9668  N  NZ  . LYS E  1 110 ? 41.102  76.815  157.469 1.00 60.34  ? 110  LYS E NZ  1 
ATOM   9669  N  N   . ILE E  1 111 ? 38.281  82.047  153.920 1.00 50.54  ? 111  ILE E N   1 
ATOM   9670  C  CA  . ILE E  1 111 ? 37.896  82.361  152.550 1.00 50.54  ? 111  ILE E CA  1 
ATOM   9671  C  C   . ILE E  1 111 ? 38.057  83.837  152.194 1.00 54.18  ? 111  ILE E C   1 
ATOM   9672  O  O   . ILE E  1 111 ? 38.590  84.171  151.133 1.00 53.85  ? 111  ILE E O   1 
ATOM   9673  C  CB  . ILE E  1 111 ? 36.421  81.992  152.279 1.00 46.43  ? 111  ILE E CB  1 
ATOM   9674  C  CG1 . ILE E  1 111 ? 36.139  80.560  152.718 1.00 41.99  ? 111  ILE E CG1 1 
ATOM   9675  C  CG2 . ILE E  1 111 ? 36.124  82.148  150.799 1.00 43.80  ? 111  ILE E CG2 1 
ATOM   9676  C  CD1 . ILE E  1 111 ? 34.678  80.214  152.718 1.00 37.11  ? 111  ILE E CD1 1 
ATOM   9677  N  N   . ALA E  1 112 ? 37.575  84.715  153.071 1.00 56.74  ? 112  ALA E N   1 
ATOM   9678  C  CA  . ALA E  1 112 ? 37.640  86.157  152.836 1.00 59.35  ? 112  ALA E CA  1 
ATOM   9679  C  C   . ALA E  1 112 ? 39.042  86.620  152.474 1.00 62.36  ? 112  ALA E C   1 
ATOM   9680  O  O   . ALA E  1 112 ? 39.212  87.651  151.816 1.00 66.02  ? 112  ALA E O   1 
ATOM   9681  C  CB  . ALA E  1 112 ? 37.139  86.920  154.061 1.00 55.72  ? 112  ALA E CB  1 
ATOM   9682  N  N   . ASP E  1 113 ? 40.048  85.860  152.890 1.00 63.53  ? 113  ASP E N   1 
ATOM   9683  C  CA  . ASP E  1 113 ? 41.422  86.237  152.589 1.00 66.74  ? 113  ASP E CA  1 
ATOM   9684  C  C   . ASP E  1 113 ? 42.132  85.244  151.686 1.00 65.51  ? 113  ASP E C   1 
ATOM   9685  O  O   . ASP E  1 113 ? 43.267  85.464  151.269 1.00 65.83  ? 113  ASP E O   1 
ATOM   9686  C  CB  . ASP E  1 113 ? 42.205  86.446  153.891 1.00 69.97  ? 113  ASP E CB  1 
ATOM   9687  C  CG  . ASP E  1 113 ? 41.875  87.779  154.558 1.00 70.76  ? 113  ASP E CG  1 
ATOM   9688  O  OD1 . ASP E  1 113 ? 42.239  88.831  153.981 1.00 69.42  ? 113  ASP E OD1 1 
ATOM   9689  O  OD2 . ASP E  1 113 ? 41.248  87.772  155.643 1.00 68.47  ? 113  ASP E OD2 1 
ATOM   9690  N  N   . LEU E  1 114 ? 41.448  84.153  151.373 1.00 64.88  ? 114  LEU E N   1 
ATOM   9691  C  CA  . LEU E  1 114 ? 42.007  83.132  150.503 1.00 62.54  ? 114  LEU E CA  1 
ATOM   9692  C  C   . LEU E  1 114 ? 41.864  83.568  149.047 1.00 63.70  ? 114  LEU E C   1 
ATOM   9693  O  O   . LEU E  1 114 ? 42.463  82.969  148.150 1.00 63.76  ? 114  LEU E O   1 
ATOM   9694  C  CB  . LEU E  1 114 ? 41.266  81.820  150.708 1.00 58.78  ? 114  LEU E CB  1 
ATOM   9695  C  CG  . LEU E  1 114 ? 42.139  80.582  150.799 1.00 54.14  ? 114  LEU E CG  1 
ATOM   9696  C  CD1 . LEU E  1 114 ? 41.239  79.363  150.808 1.00 53.34  ? 114  LEU E CD1 1 
ATOM   9697  C  CD2 . LEU E  1 114 ? 43.105  80.545  149.635 1.00 54.14  ? 114  LEU E CD2 1 
ATOM   9698  N  N   . CYS E  1 115 ? 41.061  84.611  148.824 1.00 64.63  ? 115  CYS E N   1 
ATOM   9699  C  CA  . CYS E  1 115 ? 40.813  85.140  147.482 1.00 64.65  ? 115  CYS E CA  1 
ATOM   9700  C  C   . CYS E  1 115 ? 40.946  86.654  147.394 1.00 64.11  ? 115  CYS E C   1 
ATOM   9701  O  O   . CYS E  1 115 ? 40.290  87.298  146.575 1.00 62.51  ? 115  CYS E O   1 
ATOM   9702  C  CB  . CYS E  1 115 ? 39.414  84.736  146.997 1.00 65.49  ? 115  CYS E CB  1 
ATOM   9703  S  SG  . CYS E  1 115 ? 38.022  85.290  148.000 1.00 61.35  ? 115  CYS E SG  1 
ATOM   9704  N  N   . HIS E  1 116 ? 41.791  87.223  148.244 1.00 65.10  ? 116  HIS E N   1 
ATOM   9705  C  CA  . HIS E  1 116 ? 41.992  88.662  148.237 1.00 63.36  ? 116  HIS E CA  1 
ATOM   9706  C  C   . HIS E  1 116 ? 42.731  89.006  146.949 1.00 61.38  ? 116  HIS E C   1 
ATOM   9707  O  O   . HIS E  1 116 ? 42.572  90.089  146.387 1.00 61.39  ? 116  HIS E O   1 
ATOM   9708  C  CB  . HIS E  1 116 ? 42.807  89.083  149.467 1.00 64.29  ? 116  HIS E CB  1 
ATOM   9709  C  CG  . HIS E  1 116 ? 44.211  88.558  149.475 1.00 66.93  ? 116  HIS E CG  1 
ATOM   9710  N  ND1 . HIS E  1 116 ? 45.200  89.056  148.652 1.00 68.52  ? 116  HIS E ND1 1 
ATOM   9711  C  CD2 . HIS E  1 116 ? 44.790  87.570  150.200 1.00 67.19  ? 116  HIS E CD2 1 
ATOM   9712  C  CE1 . HIS E  1 116 ? 46.325  88.398  148.869 1.00 67.18  ? 116  HIS E CE1 1 
ATOM   9713  N  NE2 . HIS E  1 116 ? 46.104  87.490  149.803 1.00 66.14  ? 116  HIS E NE2 1 
ATOM   9714  N  N   . THR E  1 117 ? 43.518  88.055  146.466 1.00 58.83  ? 117  THR E N   1 
ATOM   9715  C  CA  . THR E  1 117 ? 44.286  88.269  145.259 1.00 57.93  ? 117  THR E CA  1 
ATOM   9716  C  C   . THR E  1 117 ? 43.426  88.243  144.002 1.00 57.47  ? 117  THR E C   1 
ATOM   9717  O  O   . THR E  1 117 ? 43.817  88.791  142.973 1.00 59.69  ? 117  THR E O   1 
ATOM   9718  C  CB  . THR E  1 117 ? 45.421  87.224  145.127 1.00 59.36  ? 117  THR E CB  1 
ATOM   9719  O  OG1 . THR E  1 117 ? 46.567  87.850  144.537 1.00 60.30  ? 117  THR E OG1 1 
ATOM   9720  C  CG2 . THR E  1 117 ? 44.990  86.045  144.246 1.00 57.05  ? 117  THR E CG2 1 
ATOM   9721  N  N   . PHE E  1 118 ? 42.258  87.611  144.071 1.00 55.11  ? 118  PHE E N   1 
ATOM   9722  C  CA  . PHE E  1 118 ? 41.394  87.558  142.901 1.00 51.27  ? 118  PHE E CA  1 
ATOM   9723  C  C   . PHE E  1 118 ? 40.540  88.800  142.752 1.00 52.01  ? 118  PHE E C   1 
ATOM   9724  O  O   . PHE E  1 118 ? 40.023  89.081  141.671 1.00 54.33  ? 118  PHE E O   1 
ATOM   9725  C  CB  . PHE E  1 118 ? 40.528  86.305  142.921 1.00 47.18  ? 118  PHE E CB  1 
ATOM   9726  C  CG  . PHE E  1 118 ? 41.279  85.074  142.539 1.00 45.94  ? 118  PHE E CG  1 
ATOM   9727  C  CD1 . PHE E  1 118 ? 42.114  84.441  143.456 1.00 44.43  ? 118  PHE E CD1 1 
ATOM   9728  C  CD2 . PHE E  1 118 ? 41.226  84.594  141.234 1.00 44.79  ? 118  PHE E CD2 1 
ATOM   9729  C  CE1 . PHE E  1 118 ? 42.892  83.350  143.075 1.00 41.98  ? 118  PHE E CE1 1 
ATOM   9730  C  CE2 . PHE E  1 118 ? 41.999  83.504  140.842 1.00 42.08  ? 118  PHE E CE2 1 
ATOM   9731  C  CZ  . PHE E  1 118 ? 42.834  82.882  141.765 1.00 42.52  ? 118  PHE E CZ  1 
ATOM   9732  N  N   . ILE E  1 119 ? 40.389  89.546  143.838 1.00 50.21  ? 119  ILE E N   1 
ATOM   9733  C  CA  . ILE E  1 119 ? 39.629  90.778  143.779 1.00 50.43  ? 119  ILE E CA  1 
ATOM   9734  C  C   . ILE E  1 119 ? 40.659  91.842  143.437 1.00 51.44  ? 119  ILE E C   1 
ATOM   9735  O  O   . ILE E  1 119 ? 41.439  92.256  144.293 1.00 53.84  ? 119  ILE E O   1 
ATOM   9736  C  CB  . ILE E  1 119 ? 38.970  91.093  145.126 1.00 48.89  ? 119  ILE E CB  1 
ATOM   9737  C  CG1 . ILE E  1 119 ? 37.923  90.028  145.436 1.00 48.91  ? 119  ILE E CG1 1 
ATOM   9738  C  CG2 . ILE E  1 119 ? 38.333  92.457  145.085 1.00 46.03  ? 119  ILE E CG2 1 
ATOM   9739  C  CD1 . ILE E  1 119 ? 37.204  90.243  146.742 1.00 51.76  ? 119  ILE E CD1 1 
ATOM   9740  N  N   . LYS E  1 120 ? 40.671  92.267  142.176 1.00 50.38  ? 120  LYS E N   1 
ATOM   9741  C  CA  . LYS E  1 120 ? 41.635  93.255  141.717 1.00 47.81  ? 120  LYS E CA  1 
ATOM   9742  C  C   . LYS E  1 120 ? 41.155  94.689  141.807 1.00 46.53  ? 120  LYS E C   1 
ATOM   9743  O  O   . LYS E  1 120 ? 39.981  94.981  141.585 1.00 46.24  ? 120  LYS E O   1 
ATOM   9744  C  CB  . LYS E  1 120 ? 42.059  92.930  140.285 1.00 48.22  ? 120  LYS E CB  1 
ATOM   9745  C  CG  . LYS E  1 120 ? 42.867  91.638  140.194 1.00 52.46  ? 120  LYS E CG  1 
ATOM   9746  C  CD  . LYS E  1 120 ? 43.289  91.293  138.764 1.00 59.59  ? 120  LYS E CD  1 
ATOM   9747  C  CE  . LYS E  1 120 ? 42.127  90.757  137.910 1.00 62.14  ? 120  LYS E CE  1 
ATOM   9748  N  NZ  . LYS E  1 120 ? 42.543  90.416  136.505 1.00 58.81  ? 120  LYS E NZ  1 
ATOM   9749  N  N   . ASP E  1 121 ? 42.085  95.579  142.137 1.00 44.88  ? 121  ASP E N   1 
ATOM   9750  C  CA  . ASP E  1 121 ? 41.799  97.004  142.267 1.00 45.10  ? 121  ASP E CA  1 
ATOM   9751  C  C   . ASP E  1 121 ? 41.235  97.544  140.955 1.00 43.11  ? 121  ASP E C   1 
ATOM   9752  O  O   . ASP E  1 121 ? 41.722  97.206  139.884 1.00 44.07  ? 121  ASP E O   1 
ATOM   9753  C  CB  . ASP E  1 121 ? 43.081  97.760  142.628 1.00 48.21  ? 121  ASP E CB  1 
ATOM   9754  C  CG  . ASP E  1 121 ? 42.808  99.160  143.133 1.00 52.03  ? 121  ASP E CG  1 
ATOM   9755  O  OD1 . ASP E  1 121 ? 42.359  99.314  144.294 1.00 54.18  ? 121  ASP E OD1 1 
ATOM   9756  O  OD2 . ASP E  1 121 ? 43.032  100.111 142.361 1.00 56.14  ? 121  ASP E OD2 1 
ATOM   9757  N  N   . GLY E  1 122 ? 40.208  98.381  141.045 1.00 40.04  ? 122  GLY E N   1 
ATOM   9758  C  CA  . GLY E  1 122 ? 39.591  98.939  139.855 1.00 36.58  ? 122  GLY E CA  1 
ATOM   9759  C  C   . GLY E  1 122 ? 38.643  97.984  139.134 1.00 36.82  ? 122  GLY E C   1 
ATOM   9760  O  O   . GLY E  1 122 ? 38.228  98.248  138.007 1.00 36.83  ? 122  GLY E O   1 
ATOM   9761  N  N   . ALA E  1 123 ? 38.291  96.872  139.769 1.00 35.67  ? 123  ALA E N   1 
ATOM   9762  C  CA  . ALA E  1 123 ? 37.400  95.904  139.138 1.00 33.82  ? 123  ALA E CA  1 
ATOM   9763  C  C   . ALA E  1 123 ? 35.947  96.217  139.400 1.00 31.67  ? 123  ALA E C   1 
ATOM   9764  O  O   . ALA E  1 123 ? 35.612  96.913  140.349 1.00 32.42  ? 123  ALA E O   1 
ATOM   9765  C  CB  . ALA E  1 123 ? 37.704  94.507  139.635 1.00 33.71  ? 123  ALA E CB  1 
ATOM   9766  N  N   . THR E  1 124 ? 35.089  95.688  138.541 1.00 31.51  ? 124  THR E N   1 
ATOM   9767  C  CA  . THR E  1 124 ? 33.652  95.868  138.662 1.00 29.20  ? 124  THR E CA  1 
ATOM   9768  C  C   . THR E  1 124 ? 33.155  94.468  138.922 1.00 27.67  ? 124  THR E C   1 
ATOM   9769  O  O   . THR E  1 124 ? 33.328  93.573  138.091 1.00 29.29  ? 124  THR E O   1 
ATOM   9770  C  CB  . THR E  1 124 ? 33.050  96.418  137.353 1.00 31.70  ? 124  THR E CB  1 
ATOM   9771  O  OG1 . THR E  1 124 ? 33.708  97.648  137.012 1.00 33.77  ? 124  THR E OG1 1 
ATOM   9772  C  CG2 . THR E  1 124 ? 31.566  96.668  137.510 1.00 30.81  ? 124  THR E CG2 1 
ATOM   9773  N  N   . ILE E  1 125 ? 32.563  94.274  140.091 1.00 27.62  ? 125  ILE E N   1 
ATOM   9774  C  CA  . ILE E  1 125 ? 32.063  92.962  140.504 1.00 28.46  ? 125  ILE E CA  1 
ATOM   9775  C  C   . ILE E  1 125 ? 30.543  92.801  140.434 1.00 29.15  ? 125  ILE E C   1 
ATOM   9776  O  O   . ILE E  1 125 ? 29.793  93.712  140.799 1.00 28.61  ? 125  ILE E O   1 
ATOM   9777  C  CB  . ILE E  1 125 ? 32.491  92.667  141.963 1.00 28.33  ? 125  ILE E CB  1 
ATOM   9778  C  CG1 . ILE E  1 125 ? 34.012  92.649  142.069 1.00 27.57  ? 125  ILE E CG1 1 
ATOM   9779  C  CG2 . ILE E  1 125 ? 31.912  91.343  142.440 1.00 26.56  ? 125  ILE E CG2 1 
ATOM   9780  C  CD1 . ILE E  1 125 ? 34.495  92.466  143.495 1.00 29.22  ? 125  ILE E CD1 1 
ATOM   9781  N  N   . LEU E  1 126 ? 30.092  91.637  139.972 1.00 28.53  ? 126  LEU E N   1 
ATOM   9782  C  CA  . LEU E  1 126 ? 28.661  91.350  139.931 1.00 27.94  ? 126  LEU E CA  1 
ATOM   9783  C  C   . LEU E  1 126 ? 28.330  90.174  140.876 1.00 28.86  ? 126  LEU E C   1 
ATOM   9784  O  O   . LEU E  1 126 ? 29.029  89.161  140.878 1.00 25.28  ? 126  LEU E O   1 
ATOM   9785  C  CB  . LEU E  1 126 ? 28.222  90.999  138.506 1.00 26.53  ? 126  LEU E CB  1 
ATOM   9786  C  CG  . LEU E  1 126 ? 26.745  90.583  138.334 1.00 29.58  ? 126  LEU E CG  1 
ATOM   9787  C  CD1 . LEU E  1 126 ? 25.814  91.761  138.656 1.00 19.52  ? 126  LEU E CD1 1 
ATOM   9788  C  CD2 . LEU E  1 126 ? 26.503  90.084  136.906 1.00 26.52  ? 126  LEU E CD2 1 
ATOM   9789  N  N   . THR E  1 127 ? 27.293  90.322  141.700 1.00 30.56  ? 127  THR E N   1 
ATOM   9790  C  CA  . THR E  1 127 ? 26.866  89.235  142.592 1.00 35.35  ? 127  THR E CA  1 
ATOM   9791  C  C   . THR E  1 127 ? 25.370  89.116  142.506 1.00 35.86  ? 127  THR E C   1 
ATOM   9792  O  O   . THR E  1 127 ? 24.705  89.967  141.922 1.00 34.39  ? 127  THR E O   1 
ATOM   9793  C  CB  . THR E  1 127 ? 27.182  89.457  144.087 1.00 35.67  ? 127  THR E CB  1 
ATOM   9794  O  OG1 . THR E  1 127 ? 26.561  90.671  144.533 1.00 42.84  ? 127  THR E OG1 1 
ATOM   9795  C  CG2 . THR E  1 127 ? 28.676  89.524  144.318 1.00 42.76  ? 127  THR E CG2 1 
ATOM   9796  N  N   . HIS E  1 128 ? 24.851  88.060  143.123 1.00 37.50  ? 128  HIS E N   1 
ATOM   9797  C  CA  . HIS E  1 128 ? 23.427  87.776  143.126 1.00 37.68  ? 128  HIS E CA  1 
ATOM   9798  C  C   . HIS E  1 128 ? 22.916  87.670  144.547 1.00 37.17  ? 128  HIS E C   1 
ATOM   9799  O  O   . HIS E  1 128 ? 23.497  86.963  145.367 1.00 38.48  ? 128  HIS E O   1 
ATOM   9800  C  CB  . HIS E  1 128 ? 23.165  86.458  142.395 1.00 34.45  ? 128  HIS E CB  1 
ATOM   9801  C  CG  . HIS E  1 128 ? 21.720  86.073  142.320 1.00 36.70  ? 128  HIS E CG  1 
ATOM   9802  N  ND1 . HIS E  1 128 ? 20.753  86.905  141.800 1.00 38.75  ? 128  HIS E ND1 1 
ATOM   9803  C  CD2 . HIS E  1 128 ? 21.092  84.909  142.619 1.00 38.86  ? 128  HIS E CD2 1 
ATOM   9804  C  CE1 . HIS E  1 128 ? 19.592  86.270  141.775 1.00 38.96  ? 128  HIS E CE1 1 
ATOM   9805  N  NE2 . HIS E  1 128 ? 19.771  85.056  142.266 1.00 38.60  ? 128  HIS E NE2 1 
ATOM   9806  N  N   . ALA E  1 129 ? 21.841  88.395  144.833 1.00 36.03  ? 129  ALA E N   1 
ATOM   9807  C  CA  . ALA E  1 129 ? 21.213  88.350  146.139 1.00 35.36  ? 129  ALA E CA  1 
ATOM   9808  C  C   . ALA E  1 129 ? 22.129  88.671  147.317 1.00 36.93  ? 129  ALA E C   1 
ATOM   9809  O  O   . ALA E  1 129 ? 23.144  89.359  147.180 1.00 37.48  ? 129  ALA E O   1 
ATOM   9810  C  CB  . ALA E  1 129 ? 20.587  86.998  146.328 1.00 32.19  ? 129  ALA E CB  1 
ATOM   9811  N  N   . TYR E  1 130 ? 21.768  88.165  148.487 1.00 37.71  ? 130  TYR E N   1 
ATOM   9812  C  CA  . TYR E  1 130 ? 22.560  88.427  149.678 1.00 39.35  ? 130  TYR E CA  1 
ATOM   9813  C  C   . TYR E  1 130 ? 23.408  87.219  150.026 1.00 41.65  ? 130  TYR E C   1 
ATOM   9814  O  O   . TYR E  1 130 ? 22.981  86.078  149.855 1.00 45.97  ? 130  TYR E O   1 
ATOM   9815  C  CB  . TYR E  1 130 ? 21.640  88.762  150.850 1.00 35.46  ? 130  TYR E CB  1 
ATOM   9816  C  CG  . TYR E  1 130 ? 22.337  89.327  152.067 1.00 37.87  ? 130  TYR E CG  1 
ATOM   9817  C  CD1 . TYR E  1 130 ? 22.121  90.648  152.462 1.00 38.44  ? 130  TYR E CD1 1 
ATOM   9818  C  CD2 . TYR E  1 130 ? 23.207  88.546  152.831 1.00 38.50  ? 130  TYR E CD2 1 
ATOM   9819  C  CE1 . TYR E  1 130 ? 22.749  91.175  153.575 1.00 36.71  ? 130  TYR E CE1 1 
ATOM   9820  C  CE2 . TYR E  1 130 ? 23.843  89.068  153.946 1.00 38.02  ? 130  TYR E CE2 1 
ATOM   9821  C  CZ  . TYR E  1 130 ? 23.609  90.384  154.308 1.00 38.73  ? 130  TYR E CZ  1 
ATOM   9822  O  OH  . TYR E  1 130 ? 24.250  90.920  155.396 1.00 44.83  ? 130  TYR E OH  1 
ATOM   9823  N  N   . SER E  1 131 ? 24.621  87.470  150.504 1.00 41.93  ? 131  SER E N   1 
ATOM   9824  C  CA  . SER E  1 131 ? 25.501  86.387  150.904 1.00 39.61  ? 131  SER E CA  1 
ATOM   9825  C  C   . SER E  1 131 ? 26.414  86.842  152.011 1.00 38.01  ? 131  SER E C   1 
ATOM   9826  O  O   . SER E  1 131 ? 27.208  87.772  151.846 1.00 39.58  ? 131  SER E O   1 
ATOM   9827  C  CB  . SER E  1 131 ? 26.349  85.885  149.735 1.00 39.98  ? 131  SER E CB  1 
ATOM   9828  O  OG  . SER E  1 131 ? 27.299  84.924  150.185 1.00 38.77  ? 131  SER E OG  1 
ATOM   9829  N  N   . ARG E  1 132 ? 26.293  86.175  153.147 1.00 35.82  ? 132  ARG E N   1 
ATOM   9830  C  CA  . ARG E  1 132 ? 27.131  86.481  154.279 1.00 34.79  ? 132  ARG E CA  1 
ATOM   9831  C  C   . ARG E  1 132 ? 28.602  86.295  153.899 1.00 33.02  ? 132  ARG E C   1 
ATOM   9832  O  O   . ARG E  1 132 ? 29.442  87.108  154.250 1.00 30.24  ? 132  ARG E O   1 
ATOM   9833  C  CB  . ARG E  1 132 ? 26.732  85.581  155.441 1.00 38.31  ? 132  ARG E CB  1 
ATOM   9834  C  CG  . ARG E  1 132 ? 25.407  86.001  156.071 1.00 40.46  ? 132  ARG E CG  1 
ATOM   9835  C  CD  . ARG E  1 132 ? 24.876  84.963  157.037 1.00 42.02  ? 132  ARG E CD  1 
ATOM   9836  N  NE  . ARG E  1 132 ? 24.345  83.801  156.336 1.00 48.36  ? 132  ARG E NE  1 
ATOM   9837  C  CZ  . ARG E  1 132 ? 23.051  83.493  156.283 1.00 53.42  ? 132  ARG E CZ  1 
ATOM   9838  N  NH1 . ARG E  1 132 ? 22.161  84.271  156.903 1.00 48.19  ? 132  ARG E NH1 1 
ATOM   9839  N  NH2 . ARG E  1 132 ? 22.648  82.413  155.609 1.00 51.04  ? 132  ARG E NH2 1 
ATOM   9840  N  N   . VAL E  1 133 ? 28.908  85.244  153.147 1.00 36.24  ? 133  VAL E N   1 
ATOM   9841  C  CA  . VAL E  1 133 ? 30.292  84.993  152.743 1.00 36.97  ? 133  VAL E CA  1 
ATOM   9842  C  C   . VAL E  1 133 ? 30.878  85.962  151.702 1.00 38.30  ? 133  VAL E C   1 
ATOM   9843  O  O   . VAL E  1 133 ? 32.052  86.308  151.802 1.00 39.32  ? 133  VAL E O   1 
ATOM   9844  C  CB  . VAL E  1 133 ? 30.480  83.566  152.202 1.00 37.60  ? 133  VAL E CB  1 
ATOM   9845  C  CG1 . VAL E  1 133 ? 31.952  83.304  151.980 1.00 37.68  ? 133  VAL E CG1 1 
ATOM   9846  C  CG2 . VAL E  1 133 ? 29.902  82.557  153.158 1.00 34.23  ? 133  VAL E CG2 1 
ATOM   9847  N  N   . VAL E  1 134 ? 30.112  86.390  150.694 1.00 37.90  ? 134  VAL E N   1 
ATOM   9848  C  CA  . VAL E  1 134 ? 30.702  87.324  149.737 1.00 34.61  ? 134  VAL E CA  1 
ATOM   9849  C  C   . VAL E  1 134 ? 30.905  88.641  150.477 1.00 35.64  ? 134  VAL E C   1 
ATOM   9850  O  O   . VAL E  1 134 ? 31.915  89.324  150.274 1.00 33.45  ? 134  VAL E O   1 
ATOM   9851  C  CB  . VAL E  1 134 ? 29.836  87.542  148.428 1.00 31.79  ? 134  VAL E CB  1 
ATOM   9852  C  CG1 . VAL E  1 134 ? 29.550  86.213  147.771 1.00 26.94  ? 134  VAL E CG1 1 
ATOM   9853  C  CG2 . VAL E  1 134 ? 28.549  88.293  148.726 1.00 35.20  ? 134  VAL E CG2 1 
ATOM   9854  N  N   . LEU E  1 135 ? 29.964  88.980  151.362 1.00 35.54  ? 135  LEU E N   1 
ATOM   9855  C  CA  . LEU E  1 135 ? 30.071  90.216  152.147 1.00 38.24  ? 135  LEU E CA  1 
ATOM   9856  C  C   . LEU E  1 135 ? 31.448  90.296  152.839 1.00 39.80  ? 135  LEU E C   1 
ATOM   9857  O  O   . LEU E  1 135 ? 32.154  91.301  152.720 1.00 41.10  ? 135  LEU E O   1 
ATOM   9858  C  CB  . LEU E  1 135 ? 28.969  90.281  153.206 1.00 36.10  ? 135  LEU E CB  1 
ATOM   9859  C  CG  . LEU E  1 135 ? 28.400  91.670  153.504 1.00 37.01  ? 135  LEU E CG  1 
ATOM   9860  C  CD1 . LEU E  1 135 ? 27.635  91.645  154.818 1.00 31.94  ? 135  LEU E CD1 1 
ATOM   9861  C  CD2 . LEU E  1 135 ? 29.516  92.673  153.574 1.00 38.24  ? 135  LEU E CD2 1 
ATOM   9862  N  N   . ARG E  1 136 ? 31.826  89.239  153.555 1.00 39.20  ? 136  ARG E N   1 
ATOM   9863  C  CA  . ARG E  1 136 ? 33.113  89.208  154.228 1.00 42.12  ? 136  ARG E CA  1 
ATOM   9864  C  C   . ARG E  1 136 ? 34.245  89.312  153.221 1.00 42.94  ? 136  ARG E C   1 
ATOM   9865  O  O   . ARG E  1 136 ? 35.199  90.063  153.426 1.00 44.44  ? 136  ARG E O   1 
ATOM   9866  C  CB  . ARG E  1 136 ? 33.254  87.923  155.040 1.00 47.04  ? 136  ARG E CB  1 
ATOM   9867  C  CG  . ARG E  1 136 ? 32.456  87.944  156.338 1.00 57.08  ? 136  ARG E CG  1 
ATOM   9868  C  CD  . ARG E  1 136 ? 33.151  88.781  157.415 1.00 59.56  ? 136  ARG E CD  1 
ATOM   9869  N  NE  . ARG E  1 136 ? 33.945  87.953  158.324 1.00 61.70  ? 136  ARG E NE  1 
ATOM   9870  C  CZ  . ARG E  1 136 ? 33.427  87.165  159.266 1.00 63.68  ? 136  ARG E CZ  1 
ATOM   9871  N  NH1 . ARG E  1 136 ? 32.108  87.100  159.427 1.00 62.45  ? 136  ARG E NH1 1 
ATOM   9872  N  NH2 . ARG E  1 136 ? 34.225  86.442  160.050 1.00 60.91  ? 136  ARG E NH2 1 
ATOM   9873  N  N   . VAL E  1 137 ? 34.149  88.560  152.130 1.00 42.38  ? 137  VAL E N   1 
ATOM   9874  C  CA  . VAL E  1 137 ? 35.184  88.607  151.100 1.00 40.62  ? 137  VAL E CA  1 
ATOM   9875  C  C   . VAL E  1 137 ? 35.449  90.057  150.691 1.00 41.25  ? 137  VAL E C   1 
ATOM   9876  O  O   . VAL E  1 137 ? 36.588  90.516  150.745 1.00 41.33  ? 137  VAL E O   1 
ATOM   9877  C  CB  . VAL E  1 137 ? 34.774  87.796  149.842 1.00 39.67  ? 137  VAL E CB  1 
ATOM   9878  C  CG1 . VAL E  1 137 ? 35.733  88.083  148.690 1.00 32.13  ? 137  VAL E CG1 1 
ATOM   9879  C  CG2 . VAL E  1 137 ? 34.764  86.310  150.164 1.00 34.73  ? 137  VAL E CG2 1 
ATOM   9880  N  N   . LEU E  1 138 ? 34.385  90.765  150.302 1.00 42.08  ? 138  LEU E N   1 
ATOM   9881  C  CA  . LEU E  1 138 ? 34.458  92.168  149.870 1.00 41.12  ? 138  LEU E CA  1 
ATOM   9882  C  C   . LEU E  1 138 ? 34.854  93.087  151.011 1.00 41.99  ? 138  LEU E C   1 
ATOM   9883  O  O   . LEU E  1 138 ? 35.633  94.028  150.823 1.00 41.30  ? 138  LEU E O   1 
ATOM   9884  C  CB  . LEU E  1 138 ? 33.106  92.633  149.307 1.00 38.12  ? 138  LEU E CB  1 
ATOM   9885  C  CG  . LEU E  1 138 ? 32.528  91.807  148.155 1.00 36.42  ? 138  LEU E CG  1 
ATOM   9886  C  CD1 . LEU E  1 138 ? 31.209  92.394  147.700 1.00 38.49  ? 138  LEU E CD1 1 
ATOM   9887  C  CD2 . LEU E  1 138 ? 33.508  91.777  147.014 1.00 34.75  ? 138  LEU E CD2 1 
ATOM   9888  N  N   . GLU E  1 139 ? 34.296  92.820  152.190 1.00 43.57  ? 139  GLU E N   1 
ATOM   9889  C  CA  . GLU E  1 139 ? 34.589  93.605  153.385 1.00 45.60  ? 139  GLU E CA  1 
ATOM   9890  C  C   . GLU E  1 139 ? 36.082  93.513  153.641 1.00 44.78  ? 139  GLU E C   1 
ATOM   9891  O  O   . GLU E  1 139 ? 36.713  94.474  154.061 1.00 47.27  ? 139  GLU E O   1 
ATOM   9892  C  CB  . GLU E  1 139 ? 33.836  93.030  154.573 1.00 49.34  ? 139  GLU E CB  1 
ATOM   9893  C  CG  . GLU E  1 139 ? 33.908  93.848  155.835 1.00 54.86  ? 139  GLU E CG  1 
ATOM   9894  C  CD  . GLU E  1 139 ? 33.205  93.149  156.999 1.00 60.45  ? 139  GLU E CD  1 
ATOM   9895  O  OE1 . GLU E  1 139 ? 32.169  92.480  156.753 1.00 62.42  ? 139  GLU E OE1 1 
ATOM   9896  O  OE2 . GLU E  1 139 ? 33.679  93.277  158.153 1.00 56.69  ? 139  GLU E OE2 1 
ATOM   9897  N  N   . ALA E  1 140 ? 36.647  92.344  153.374 1.00 42.52  ? 140  ALA E N   1 
ATOM   9898  C  CA  . ALA E  1 140 ? 38.069  92.141  153.568 1.00 41.30  ? 140  ALA E CA  1 
ATOM   9899  C  C   . ALA E  1 140 ? 38.832  92.912  152.495 1.00 39.62  ? 140  ALA E C   1 
ATOM   9900  O  O   . ALA E  1 140 ? 39.937  93.392  152.727 1.00 40.66  ? 140  ALA E O   1 
ATOM   9901  C  CB  . ALA E  1 140 ? 38.393  90.658  153.493 1.00 38.30  ? 140  ALA E CB  1 
ATOM   9902  N  N   . ALA E  1 141 ? 38.219  93.039  151.325 1.00 40.39  ? 141  ALA E N   1 
ATOM   9903  C  CA  . ALA E  1 141 ? 38.824  93.741  150.203 1.00 40.00  ? 141  ALA E CA  1 
ATOM   9904  C  C   . ALA E  1 141 ? 38.896  95.253  150.398 1.00 41.65  ? 141  ALA E C   1 
ATOM   9905  O  O   . ALA E  1 141 ? 39.900  95.870  150.041 1.00 40.92  ? 141  ALA E O   1 
ATOM   9906  C  CB  . ALA E  1 141 ? 38.073  93.422  148.940 1.00 41.68  ? 141  ALA E CB  1 
ATOM   9907  N  N   . VAL E  1 142 ? 37.846  95.854  150.959 1.00 41.84  ? 142  VAL E N   1 
ATOM   9908  C  CA  . VAL E  1 142 ? 37.860  97.304  151.177 1.00 43.61  ? 142  VAL E CA  1 
ATOM   9909  C  C   . VAL E  1 142 ? 38.798  97.668  152.315 1.00 44.87  ? 142  VAL E C   1 
ATOM   9910  O  O   . VAL E  1 142 ? 39.517  98.662  152.234 1.00 46.56  ? 142  VAL E O   1 
ATOM   9911  C  CB  . VAL E  1 142 ? 36.465  97.874  151.511 1.00 42.08  ? 142  VAL E CB  1 
ATOM   9912  C  CG1 . VAL E  1 142 ? 35.444  97.323  150.541 1.00 46.45  ? 142  VAL E CG1 1 
ATOM   9913  C  CG2 . VAL E  1 142 ? 36.082  97.557  152.938 1.00 40.45  ? 142  VAL E CG2 1 
ATOM   9914  N  N   . ALA E  1 143 ? 38.799  96.855  153.368 1.00 44.14  ? 143  ALA E N   1 
ATOM   9915  C  CA  . ALA E  1 143 ? 39.655  97.106  154.514 1.00 41.68  ? 143  ALA E CA  1 
ATOM   9916  C  C   . ALA E  1 143 ? 41.098  96.818  154.151 1.00 41.23  ? 143  ALA E C   1 
ATOM   9917  O  O   . ALA E  1 143 ? 41.986  96.921  154.978 1.00 44.18  ? 143  ALA E O   1 
ATOM   9918  C  CB  . ALA E  1 143 ? 39.227  96.250  155.684 1.00 43.77  ? 143  ALA E CB  1 
ATOM   9919  N  N   . ALA E  1 144 ? 41.325  96.445  152.903 1.00 43.51  ? 144  ALA E N   1 
ATOM   9920  C  CA  . ALA E  1 144 ? 42.670  96.170  152.417 1.00 41.96  ? 144  ALA E CA  1 
ATOM   9921  C  C   . ALA E  1 144 ? 43.004  97.237  151.362 1.00 43.43  ? 144  ALA E C   1 
ATOM   9922  O  O   . ALA E  1 144 ? 43.962  97.103  150.598 1.00 42.97  ? 144  ALA E O   1 
ATOM   9923  C  CB  . ALA E  1 144 ? 42.731  94.777  151.813 1.00 32.80  ? 144  ALA E CB  1 
ATOM   9924  N  N   . LYS E  1 145 ? 42.183  98.287  151.325 1.00 44.96  ? 145  LYS E N   1 
ATOM   9925  C  CA  . LYS E  1 145 ? 42.345  99.412  150.403 1.00 46.60  ? 145  LYS E CA  1 
ATOM   9926  C  C   . LYS E  1 145 ? 42.126  99.128  148.920 1.00 45.16  ? 145  LYS E C   1 
ATOM   9927  O  O   . LYS E  1 145 ? 42.554  99.902  148.062 1.00 42.95  ? 145  LYS E O   1 
ATOM   9928  C  CB  . LYS E  1 145 ? 43.720  100.067 150.601 1.00 50.94  ? 145  LYS E CB  1 
ATOM   9929  C  CG  . LYS E  1 145 ? 43.862  100.822 151.919 1.00 54.83  ? 145  LYS E CG  1 
ATOM   9930  C  CD  . LYS E  1 145 ? 42.854  101.964 152.007 1.00 59.84  ? 145  LYS E CD  1 
ATOM   9931  C  CE  . LYS E  1 145 ? 42.993  102.735 153.312 1.00 63.04  ? 145  LYS E CE  1 
ATOM   9932  N  NZ  . LYS E  1 145 ? 42.162  103.981 153.328 1.00 63.91  ? 145  LYS E NZ  1 
ATOM   9933  N  N   . LYS E  1 146 ? 41.455  98.029  148.609 1.00 45.65  ? 146  LYS E N   1 
ATOM   9934  C  CA  . LYS E  1 146 ? 41.189  97.713  147.211 1.00 45.18  ? 146  LYS E CA  1 
ATOM   9935  C  C   . LYS E  1 146 ? 40.027  98.604  146.788 1.00 42.68  ? 146  LYS E C   1 
ATOM   9936  O  O   . LYS E  1 146 ? 39.072  98.778  147.540 1.00 41.46  ? 146  LYS E O   1 
ATOM   9937  C  CB  . LYS E  1 146 ? 40.795  96.245  147.053 1.00 47.90  ? 146  LYS E CB  1 
ATOM   9938  C  CG  . LYS E  1 146 ? 41.807  95.234  147.592 1.00 50.53  ? 146  LYS E CG  1 
ATOM   9939  C  CD  . LYS E  1 146 ? 42.711  94.637  146.508 1.00 49.19  ? 146  LYS E CD  1 
ATOM   9940  C  CE  . LYS E  1 146 ? 43.364  93.352  147.023 1.00 48.88  ? 146  LYS E CE  1 
ATOM   9941  N  NZ  . LYS E  1 146 ? 44.336  92.731  146.080 1.00 50.90  ? 146  LYS E NZ  1 
ATOM   9942  N  N   . ARG E  1 147 ? 40.119  99.173  145.592 1.00 40.60  ? 147  ARG E N   1 
ATOM   9943  C  CA  . ARG E  1 147 ? 39.075  100.046 145.075 1.00 37.35  ? 147  ARG E CA  1 
ATOM   9944  C  C   . ARG E  1 147 ? 38.259  99.329  144.017 1.00 36.64  ? 147  ARG E C   1 
ATOM   9945  O  O   . ARG E  1 147 ? 38.768  99.042  142.945 1.00 36.79  ? 147  ARG E O   1 
ATOM   9946  C  CB  . ARG E  1 147 ? 39.707  101.288 144.477 1.00 38.63  ? 147  ARG E CB  1 
ATOM   9947  C  CG  . ARG E  1 147 ? 40.343  102.183 145.506 1.00 39.73  ? 147  ARG E CG  1 
ATOM   9948  C  CD  . ARG E  1 147 ? 41.663  102.665 145.012 1.00 41.35  ? 147  ARG E CD  1 
ATOM   9949  N  NE  . ARG E  1 147 ? 41.560  103.217 143.674 1.00 47.09  ? 147  ARG E NE  1 
ATOM   9950  C  CZ  . ARG E  1 147 ? 42.612  103.470 142.904 1.00 52.39  ? 147  ARG E CZ  1 
ATOM   9951  N  NH1 . ARG E  1 147 ? 43.839  103.212 143.363 1.00 50.32  ? 147  ARG E NH1 1 
ATOM   9952  N  NH2 . ARG E  1 147 ? 42.440  103.969 141.681 1.00 51.51  ? 147  ARG E NH2 1 
ATOM   9953  N  N   . PHE E  1 148 ? 36.994  99.043  144.323 1.00 36.23  ? 148  PHE E N   1 
ATOM   9954  C  CA  . PHE E  1 148 ? 36.122  98.339  143.391 1.00 36.16  ? 148  PHE E CA  1 
ATOM   9955  C  C   . PHE E  1 148 ? 34.653  98.766  143.453 1.00 36.04  ? 148  PHE E C   1 
ATOM   9956  O  O   . PHE E  1 148 ? 34.198  99.380  144.418 1.00 34.88  ? 148  PHE E O   1 
ATOM   9957  C  CB  . PHE E  1 148 ? 36.200  96.839  143.643 1.00 36.21  ? 148  PHE E CB  1 
ATOM   9958  C  CG  . PHE E  1 148 ? 35.835  96.452  145.037 1.00 36.29  ? 148  PHE E CG  1 
ATOM   9959  C  CD1 . PHE E  1 148 ? 36.771  96.532  146.059 1.00 35.33  ? 148  PHE E CD1 1 
ATOM   9960  C  CD2 . PHE E  1 148 ? 34.553  96.012  145.333 1.00 36.86  ? 148  PHE E CD2 1 
ATOM   9961  C  CE1 . PHE E  1 148 ? 36.446  96.178  147.352 1.00 34.42  ? 148  PHE E CE1 1 
ATOM   9962  C  CE2 . PHE E  1 148 ? 34.214  95.654  146.629 1.00 40.40  ? 148  PHE E CE2 1 
ATOM   9963  C  CZ  . PHE E  1 148 ? 35.168  95.737  147.644 1.00 36.68  ? 148  PHE E CZ  1 
ATOM   9964  N  N   . SER E  1 149 ? 33.918  98.404  142.409 1.00 34.62  ? 149  SER E N   1 
ATOM   9965  C  CA  . SER E  1 149 ? 32.501  98.729  142.279 1.00 35.21  ? 149  SER E CA  1 
ATOM   9966  C  C   . SER E  1 149 ? 31.664  97.423  142.241 1.00 32.26  ? 149  SER E C   1 
ATOM   9967  O  O   . SER E  1 149 ? 32.178  96.348  141.911 1.00 26.19  ? 149  SER E O   1 
ATOM   9968  C  CB  . SER E  1 149 ? 32.308  99.543  140.994 1.00 34.63  ? 149  SER E CB  1 
ATOM   9969  O  OG  . SER E  1 149 ? 30.947  99.811  140.742 1.00 44.58  ? 149  SER E OG  1 
ATOM   9970  N  N   . VAL E  1 150 ? 30.379  97.512  142.569 1.00 28.42  ? 150  VAL E N   1 
ATOM   9971  C  CA  . VAL E  1 150 ? 29.556  96.315  142.567 1.00 27.09  ? 150  VAL E CA  1 
ATOM   9972  C  C   . VAL E  1 150 ? 28.154  96.463  141.995 1.00 26.77  ? 150  VAL E C   1 
ATOM   9973  O  O   . VAL E  1 150 ? 27.495  97.485  142.174 1.00 27.45  ? 150  VAL E O   1 
ATOM   9974  C  CB  . VAL E  1 150 ? 29.433  95.739  144.016 1.00 27.84  ? 150  VAL E CB  1 
ATOM   9975  C  CG1 . VAL E  1 150 ? 28.404  94.633  144.070 1.00 20.40  ? 150  VAL E CG1 1 
ATOM   9976  C  CG2 . VAL E  1 150 ? 30.785  95.207  144.484 1.00 27.09  ? 150  VAL E CG2 1 
ATOM   9977  N  N   . TYR E  1 151 ? 27.717  95.416  141.301 1.00 26.17  ? 151  TYR E N   1 
ATOM   9978  C  CA  . TYR E  1 151 ? 26.368  95.321  140.741 1.00 26.66  ? 151  TYR E CA  1 
ATOM   9979  C  C   . TYR E  1 151 ? 25.758  94.096  141.420 1.00 27.22  ? 151  TYR E C   1 
ATOM   9980  O  O   . TYR E  1 151 ? 26.398  93.042  141.488 1.00 27.19  ? 151  TYR E O   1 
ATOM   9981  C  CB  . TYR E  1 151 ? 26.385  95.067  139.223 1.00 27.71  ? 151  TYR E CB  1 
ATOM   9982  C  CG  . TYR E  1 151 ? 26.558  96.302  138.362 1.00 34.28  ? 151  TYR E CG  1 
ATOM   9983  C  CD1 . TYR E  1 151 ? 25.531  97.245  138.233 1.00 36.62  ? 151  TYR E CD1 1 
ATOM   9984  C  CD2 . TYR E  1 151 ? 27.761  96.544  137.695 1.00 34.88  ? 151  TYR E CD2 1 
ATOM   9985  C  CE1 . TYR E  1 151 ? 25.703  98.392  137.464 1.00 33.39  ? 151  TYR E CE1 1 
ATOM   9986  C  CE2 . TYR E  1 151 ? 27.941  97.679  136.930 1.00 34.10  ? 151  TYR E CE2 1 
ATOM   9987  C  CZ  . TYR E  1 151 ? 26.913  98.595  136.814 1.00 34.36  ? 151  TYR E CZ  1 
ATOM   9988  O  OH  . TYR E  1 151 ? 27.095  99.689  136.008 1.00 36.03  ? 151  TYR E OH  1 
ATOM   9989  N  N   . VAL E  1 152 ? 24.540  94.231  141.933 1.00 26.75  ? 152  VAL E N   1 
ATOM   9990  C  CA  . VAL E  1 152 ? 23.856  93.108  142.565 1.00 27.37  ? 152  VAL E CA  1 
ATOM   9991  C  C   . VAL E  1 152 ? 22.390  93.117  142.185 1.00 26.88  ? 152  VAL E C   1 
ATOM   9992  O  O   . VAL E  1 152 ? 21.747  94.162  142.207 1.00 28.59  ? 152  VAL E O   1 
ATOM   9993  C  CB  . VAL E  1 152 ? 23.991  93.115  144.144 1.00 30.18  ? 152  VAL E CB  1 
ATOM   9994  C  CG1 . VAL E  1 152 ? 23.426  94.398  144.759 1.00 20.21  ? 152  VAL E CG1 1 
ATOM   9995  C  CG2 . VAL E  1 152 ? 23.278  91.910  144.720 1.00 27.80  ? 152  VAL E CG2 1 
ATOM   9996  N  N   . THR E  1 153 ? 21.881  91.946  141.811 1.00 29.51  ? 153  THR E N   1 
ATOM   9997  C  CA  . THR E  1 153 ? 20.474  91.755  141.441 1.00 29.05  ? 153  THR E CA  1 
ATOM   9998  C  C   . THR E  1 153 ? 19.618  91.951  142.691 1.00 30.86  ? 153  THR E C   1 
ATOM   9999  O  O   . THR E  1 153 ? 20.071  91.652  143.802 1.00 30.85  ? 153  THR E O   1 
ATOM   10000 C  CB  . THR E  1 153 ? 20.237  90.325  140.943 1.00 29.93  ? 153  THR E CB  1 
ATOM   10001 O  OG1 . THR E  1 153 ? 20.857  89.418  141.861 1.00 31.36  ? 153  THR E OG1 1 
ATOM   10002 C  CG2 . THR E  1 153 ? 20.817  90.114  139.538 1.00 20.04  ? 153  THR E CG2 1 
ATOM   10003 N  N   . GLU E  1 154 ? 18.393  92.448  142.521 1.00 32.42  ? 154  GLU E N   1 
ATOM   10004 C  CA  . GLU E  1 154 ? 17.506  92.666  143.672 1.00 35.36  ? 154  GLU E CA  1 
ATOM   10005 C  C   . GLU E  1 154 ? 17.067  91.327  144.266 1.00 36.27  ? 154  GLU E C   1 
ATOM   10006 O  O   . GLU E  1 154 ? 16.805  91.216  145.466 1.00 38.50  ? 154  GLU E O   1 
ATOM   10007 C  CB  . GLU E  1 154 ? 16.274  93.525  143.295 1.00 32.48  ? 154  GLU E CB  1 
ATOM   10008 C  CG  . GLU E  1 154 ? 15.416  93.042  142.140 1.00 35.29  ? 154  GLU E CG  1 
ATOM   10009 C  CD  . GLU E  1 154 ? 14.098  93.820  142.009 1.00 40.80  ? 154  GLU E CD  1 
ATOM   10010 O  OE1 . GLU E  1 154 ? 14.078  95.041  142.289 1.00 39.43  ? 154  GLU E OE1 1 
ATOM   10011 O  OE2 . GLU E  1 154 ? 13.077  93.210  141.608 1.00 43.60  ? 154  GLU E OE2 1 
ATOM   10012 N  N   . SER E  1 155 ? 16.997  90.316  143.407 1.00 37.47  ? 155  SER E N   1 
ATOM   10013 C  CA  . SER E  1 155 ? 16.639  88.956  143.797 1.00 36.22  ? 155  SER E CA  1 
ATOM   10014 C  C   . SER E  1 155 ? 15.267  88.753  144.429 1.00 32.07  ? 155  SER E C   1 
ATOM   10015 O  O   . SER E  1 155 ? 15.134  88.734  145.647 1.00 28.65  ? 155  SER E O   1 
ATOM   10016 C  CB  . SER E  1 155 ? 17.717  88.383  144.729 1.00 36.51  ? 155  SER E CB  1 
ATOM   10017 O  OG  . SER E  1 155 ? 17.580  86.975  144.867 1.00 40.86  ? 155  SER E OG  1 
ATOM   10018 N  N   . GLN E  1 156 ? 14.257  88.581  143.585 1.00 31.69  ? 156  GLN E N   1 
ATOM   10019 C  CA  . GLN E  1 156 ? 12.891  88.322  144.029 1.00 30.45  ? 156  GLN E CA  1 
ATOM   10020 C  C   . GLN E  1 156 ? 12.847  86.942  144.712 1.00 32.85  ? 156  GLN E C   1 
ATOM   10021 O  O   . GLN E  1 156 ? 13.645  86.061  144.402 1.00 33.34  ? 156  GLN E O   1 
ATOM   10022 C  CB  . GLN E  1 156 ? 11.964  88.318  142.823 1.00 27.87  ? 156  GLN E CB  1 
ATOM   10023 C  CG  . GLN E  1 156 ? 11.866  89.643  142.103 1.00 29.05  ? 156  GLN E CG  1 
ATOM   10024 C  CD  . GLN E  1 156 ? 10.849  90.559  142.746 1.00 32.60  ? 156  GLN E CD  1 
ATOM   10025 O  OE1 . GLN E  1 156 ? 9.942   90.093  143.437 1.00 33.73  ? 156  GLN E OE1 1 
ATOM   10026 N  NE2 . GLN E  1 156 ? 10.975  91.860  142.507 1.00 25.91  ? 156  GLN E NE2 1 
ATOM   10027 N  N   . PRO E  1 157 ? 11.882  86.717  145.611 1.00 34.32  ? 157  PRO E N   1 
ATOM   10028 C  CA  . PRO E  1 157 ? 10.827  87.630  146.051 1.00 34.71  ? 157  PRO E CA  1 
ATOM   10029 C  C   . PRO E  1 157 ? 11.177  88.390  147.321 1.00 36.36  ? 157  PRO E C   1 
ATOM   10030 O  O   . PRO E  1 157 ? 10.546  89.395  147.638 1.00 38.02  ? 157  PRO E O   1 
ATOM   10031 C  CB  . PRO E  1 157 ? 9.629   86.703  146.266 1.00 31.91  ? 157  PRO E CB  1 
ATOM   10032 C  CG  . PRO E  1 157 ? 10.153  85.275  145.947 1.00 35.47  ? 157  PRO E CG  1 
ATOM   10033 C  CD  . PRO E  1 157 ? 11.634  85.371  146.135 1.00 32.54  ? 157  PRO E CD  1 
ATOM   10034 N  N   . ASP E  1 158 ? 12.172  87.908  148.056 1.00 37.50  ? 158  ASP E N   1 
ATOM   10035 C  CA  . ASP E  1 158 ? 12.568  88.572  149.295 1.00 40.07  ? 158  ASP E CA  1 
ATOM   10036 C  C   . ASP E  1 158 ? 13.366  89.857  149.090 1.00 40.47  ? 158  ASP E C   1 
ATOM   10037 O  O   . ASP E  1 158 ? 13.561  90.611  150.033 1.00 43.30  ? 158  ASP E O   1 
ATOM   10038 C  CB  . ASP E  1 158 ? 13.377  87.625  150.178 1.00 39.16  ? 158  ASP E CB  1 
ATOM   10039 C  CG  . ASP E  1 158 ? 14.404  86.839  149.396 1.00 44.74  ? 158  ASP E CG  1 
ATOM   10040 O  OD1 . ASP E  1 158 ? 14.810  87.292  148.305 1.00 48.45  ? 158  ASP E OD1 1 
ATOM   10041 O  OD2 . ASP E  1 158 ? 14.815  85.768  149.877 1.00 45.72  ? 158  ASP E OD2 1 
ATOM   10042 N  N   . LEU E  1 159 ? 13.820  90.114  147.869 1.00 40.01  ? 159  LEU E N   1 
ATOM   10043 C  CA  . LEU E  1 159 ? 14.599  91.321  147.603 1.00 37.89  ? 159  LEU E CA  1 
ATOM   10044 C  C   . LEU E  1 159 ? 15.820  91.355  148.507 1.00 35.70  ? 159  LEU E C   1 
ATOM   10045 O  O   . LEU E  1 159 ? 16.176  92.419  149.015 1.00 32.86  ? 159  LEU E O   1 
ATOM   10046 C  CB  . LEU E  1 159 ? 13.763  92.564  147.883 1.00 38.45  ? 159  LEU E CB  1 
ATOM   10047 C  CG  . LEU E  1 159 ? 12.538  92.785  147.007 1.00 41.15  ? 159  LEU E CG  1 
ATOM   10048 C  CD1 . LEU E  1 159 ? 11.811  94.029  147.472 1.00 41.53  ? 159  LEU E CD1 1 
ATOM   10049 C  CD2 . LEU E  1 159 ? 12.967  92.942  145.560 1.00 40.74  ? 159  LEU E CD2 1 
ATOM   10050 N  N   . SER E  1 160 ? 16.449  90.201  148.718 1.00 33.57  ? 160  SER E N   1 
ATOM   10051 C  CA  . SER E  1 160 ? 17.618  90.143  149.590 1.00 37.89  ? 160  SER E CA  1 
ATOM   10052 C  C   . SER E  1 160 ? 18.823  90.812  148.954 1.00 38.98  ? 160  SER E C   1 
ATOM   10053 O  O   . SER E  1 160 ? 19.798  91.137  149.627 1.00 41.54  ? 160  SER E O   1 
ATOM   10054 C  CB  . SER E  1 160 ? 17.943  88.697  149.990 1.00 36.41  ? 160  SER E CB  1 
ATOM   10055 O  OG  . SER E  1 160 ? 18.097  87.850  148.871 1.00 43.51  ? 160  SER E OG  1 
ATOM   10056 N  N   . GLY E  1 161 ? 18.757  91.029  147.649 1.00 38.86  ? 161  GLY E N   1 
ATOM   10057 C  CA  . GLY E  1 161 ? 19.853  91.714  146.989 1.00 37.11  ? 161  GLY E CA  1 
ATOM   10058 C  C   . GLY E  1 161 ? 19.893  93.177  147.414 1.00 35.66  ? 161  GLY E C   1 
ATOM   10059 O  O   . GLY E  1 161 ? 20.959  93.783  147.434 1.00 32.86  ? 161  GLY E O   1 
ATOM   10060 N  N   . LYS E  1 162 ? 18.732  93.752  147.740 1.00 37.85  ? 162  LYS E N   1 
ATOM   10061 C  CA  . LYS E  1 162 ? 18.657  95.149  148.184 1.00 38.19  ? 162  LYS E CA  1 
ATOM   10062 C  C   . LYS E  1 162 ? 19.318  95.279  149.537 1.00 38.88  ? 162  LYS E C   1 
ATOM   10063 O  O   . LYS E  1 162 ? 20.044  96.242  149.799 1.00 37.60  ? 162  LYS E O   1 
ATOM   10064 C  CB  . LYS E  1 162 ? 17.212  95.616  148.278 1.00 37.72  ? 162  LYS E CB  1 
ATOM   10065 C  CG  . LYS E  1 162 ? 16.566  95.759  146.921 1.00 45.41  ? 162  LYS E CG  1 
ATOM   10066 C  CD  . LYS E  1 162 ? 15.266  96.536  146.957 1.00 46.23  ? 162  LYS E CD  1 
ATOM   10067 C  CE  . LYS E  1 162 ? 14.691  96.644  145.550 1.00 49.98  ? 162  LYS E CE  1 
ATOM   10068 N  NZ  . LYS E  1 162 ? 13.370  97.328  145.499 1.00 55.83  ? 162  LYS E NZ  1 
ATOM   10069 N  N   . LYS E  1 163 ? 19.060  94.288  150.386 1.00 38.48  ? 163  LYS E N   1 
ATOM   10070 C  CA  . LYS E  1 163 ? 19.627  94.219  151.724 1.00 39.05  ? 163  LYS E CA  1 
ATOM   10071 C  C   . LYS E  1 163 ? 21.151  94.159  151.574 1.00 40.78  ? 163  LYS E C   1 
ATOM   10072 O  O   . LYS E  1 163 ? 21.894  94.815  152.322 1.00 42.07  ? 163  LYS E O   1 
ATOM   10073 C  CB  . LYS E  1 163 ? 19.094  92.964  152.409 1.00 40.30  ? 163  LYS E CB  1 
ATOM   10074 C  CG  . LYS E  1 163 ? 19.505  92.706  153.846 1.00 40.78  ? 163  LYS E CG  1 
ATOM   10075 C  CD  . LYS E  1 163 ? 18.932  91.345  154.224 1.00 48.55  ? 163  LYS E CD  1 
ATOM   10076 C  CE  . LYS E  1 163 ? 19.296  90.869  155.618 1.00 50.65  ? 163  LYS E CE  1 
ATOM   10077 N  NZ  . LYS E  1 163 ? 18.914  89.422  155.746 1.00 50.90  ? 163  LYS E NZ  1 
HETATM 10078 N  N   . MSE E  1 164 ? 21.603  93.381  150.594 1.00 38.40  ? 164  MSE E N   1 
HETATM 10079 C  CA  . MSE E  1 164 ? 23.022  93.231  150.313 1.00 39.13  ? 164  MSE E CA  1 
HETATM 10080 C  C   . MSE E  1 164 ? 23.608  94.570  149.879 1.00 39.92  ? 164  MSE E C   1 
HETATM 10081 O  O   . MSE E  1 164 ? 24.758  94.882  150.192 1.00 39.86  ? 164  MSE E O   1 
HETATM 10082 C  CB  . MSE E  1 164 ? 23.225  92.205  149.202 1.00 43.05  ? 164  MSE E CB  1 
HETATM 10083 C  CG  . MSE E  1 164 ? 24.674  91.954  148.816 1.00 46.56  ? 164  MSE E CG  1 
HETATM 10084 SE SE  . MSE E  1 164 ? 25.657  90.909  150.132 1.00 60.68  ? 164  MSE E SE  1 
HETATM 10085 C  CE  . MSE E  1 164 ? 27.414  91.682  149.908 1.00 59.39  ? 164  MSE E CE  1 
ATOM   10086 N  N   . ALA E  1 165 ? 22.808  95.355  149.157 1.00 40.44  ? 165  ALA E N   1 
ATOM   10087 C  CA  . ALA E  1 165 ? 23.228  96.665  148.655 1.00 41.43  ? 165  ALA E CA  1 
ATOM   10088 C  C   . ALA E  1 165 ? 23.413  97.688  149.771 1.00 42.69  ? 165  ALA E C   1 
ATOM   10089 O  O   . ALA E  1 165 ? 24.335  98.511  149.734 1.00 41.90  ? 165  ALA E O   1 
ATOM   10090 C  CB  . ALA E  1 165 ? 22.217  97.185  147.664 1.00 40.13  ? 165  ALA E CB  1 
ATOM   10091 N  N   . LYS E  1 166 ? 22.517  97.657  150.750 1.00 41.11  ? 166  LYS E N   1 
ATOM   10092 C  CA  . LYS E  1 166 ? 22.631  98.578  151.857 1.00 38.94  ? 166  LYS E CA  1 
ATOM   10093 C  C   . LYS E  1 166 ? 23.895  98.201  152.603 1.00 37.50  ? 166  LYS E C   1 
ATOM   10094 O  O   . LYS E  1 166 ? 24.653  99.073  153.024 1.00 36.94  ? 166  LYS E O   1 
ATOM   10095 C  CB  . LYS E  1 166 ? 21.411  98.475  152.770 1.00 37.47  ? 166  LYS E CB  1 
ATOM   10096 C  CG  . LYS E  1 166 ? 20.150  98.975  152.105 1.00 42.47  ? 166  LYS E CG  1 
ATOM   10097 C  CD  . LYS E  1 166 ? 18.937  98.893  153.010 1.00 47.73  ? 166  LYS E CD  1 
ATOM   10098 C  CE  . LYS E  1 166 ? 17.715  99.471  152.301 1.00 52.88  ? 166  LYS E CE  1 
ATOM   10099 N  NZ  . LYS E  1 166 ? 16.450  99.290  153.087 1.00 57.52  ? 166  LYS E NZ  1 
ATOM   10100 N  N   . ALA E  1 167 ? 24.137  96.900  152.731 1.00 32.25  ? 167  ALA E N   1 
ATOM   10101 C  CA  . ALA E  1 167 ? 25.308  96.429  153.445 1.00 31.00  ? 167  ALA E CA  1 
ATOM   10102 C  C   . ALA E  1 167 ? 26.605  96.885  152.797 1.00 33.00  ? 167  ALA E C   1 
ATOM   10103 O  O   . ALA E  1 167 ? 27.556  97.243  153.488 1.00 35.31  ? 167  ALA E O   1 
ATOM   10104 C  CB  . ALA E  1 167 ? 25.281  94.914  153.554 1.00 28.74  ? 167  ALA E CB  1 
ATOM   10105 N  N   . LEU E  1 168 ? 26.657  96.871  151.470 1.00 35.67  ? 168  LEU E N   1 
ATOM   10106 C  CA  . LEU E  1 168 ? 27.872  97.289  150.779 1.00 36.65  ? 168  LEU E CA  1 
ATOM   10107 C  C   . LEU E  1 168 ? 28.030  98.795  150.836 1.00 40.77  ? 168  LEU E C   1 
ATOM   10108 O  O   . LEU E  1 168 ? 29.151  99.310  150.811 1.00 43.67  ? 168  LEU E O   1 
ATOM   10109 C  CB  . LEU E  1 168 ? 27.859  96.812  149.335 1.00 31.08  ? 168  LEU E CB  1 
ATOM   10110 C  CG  . LEU E  1 168 ? 28.071  95.304  149.219 1.00 29.68  ? 168  LEU E CG  1 
ATOM   10111 C  CD1 . LEU E  1 168 ? 27.857  94.881  147.791 1.00 29.15  ? 168  LEU E CD1 1 
ATOM   10112 C  CD2 . LEU E  1 168 ? 29.458  94.935  149.685 1.00 24.05  ? 168  LEU E CD2 1 
ATOM   10113 N  N   . CYS E  1 169 ? 26.905  99.495  150.916 1.00 41.51  ? 169  CYS E N   1 
ATOM   10114 C  CA  . CYS E  1 169 ? 26.913  100.940 151.016 1.00 46.28  ? 169  CYS E CA  1 
ATOM   10115 C  C   . CYS E  1 169 ? 27.547  101.341 152.360 1.00 49.42  ? 169  CYS E C   1 
ATOM   10116 O  O   . CYS E  1 169 ? 28.330  102.292 152.434 1.00 50.39  ? 169  CYS E O   1 
ATOM   10117 C  CB  . CYS E  1 169 ? 25.480  101.473 150.908 1.00 49.45  ? 169  CYS E CB  1 
ATOM   10118 S  SG  . CYS E  1 169 ? 25.290  103.243 151.224 1.00 57.67  ? 169  CYS E SG  1 
ATOM   10119 N  N   . HIS E  1 170 ? 27.231  100.606 153.421 1.00 51.14  ? 170  HIS E N   1 
ATOM   10120 C  CA  . HIS E  1 170 ? 27.792  100.919 154.729 1.00 53.33  ? 170  HIS E CA  1 
ATOM   10121 C  C   . HIS E  1 170 ? 29.288  100.668 154.819 1.00 51.70  ? 170  HIS E C   1 
ATOM   10122 O  O   . HIS E  1 170 ? 29.930  101.089 155.772 1.00 51.29  ? 170  HIS E O   1 
ATOM   10123 C  CB  . HIS E  1 170 ? 27.044  100.159 155.819 1.00 56.61  ? 170  HIS E CB  1 
ATOM   10124 C  CG  . HIS E  1 170 ? 25.701  100.745 156.123 1.00 64.01  ? 170  HIS E CG  1 
ATOM   10125 N  ND1 . HIS E  1 170 ? 24.687  100.029 156.725 1.00 66.18  ? 170  HIS E ND1 1 
ATOM   10126 C  CD2 . HIS E  1 170 ? 25.195  101.978 155.875 1.00 64.73  ? 170  HIS E CD2 1 
ATOM   10127 C  CE1 . HIS E  1 170 ? 23.613  100.793 156.830 1.00 65.87  ? 170  HIS E CE1 1 
ATOM   10128 N  NE2 . HIS E  1 170 ? 23.895  101.980 156.321 1.00 66.39  ? 170  HIS E NE2 1 
ATOM   10129 N  N   . LEU E  1 171 ? 29.840  99.981  153.828 1.00 50.02  ? 171  LEU E N   1 
ATOM   10130 C  CA  . LEU E  1 171 ? 31.274  99.729  153.787 1.00 49.09  ? 171  LEU E CA  1 
ATOM   10131 C  C   . LEU E  1 171 ? 31.846  100.746 152.814 1.00 49.00  ? 171  LEU E C   1 
ATOM   10132 O  O   . LEU E  1 171 ? 33.009  100.678 152.422 1.00 48.28  ? 171  LEU E O   1 
ATOM   10133 C  CB  . LEU E  1 171 ? 31.563  98.331  153.263 1.00 50.74  ? 171  LEU E CB  1 
ATOM   10134 C  CG  . LEU E  1 171 ? 31.132  97.156  154.128 1.00 51.87  ? 171  LEU E CG  1 
ATOM   10135 C  CD1 . LEU E  1 171 ? 31.446  95.848  153.404 1.00 49.19  ? 171  LEU E CD1 1 
ATOM   10136 C  CD2 . LEU E  1 171 ? 31.865  97.234  155.463 1.00 52.56  ? 171  LEU E CD2 1 
ATOM   10137 N  N   . ASN E  1 172 ? 30.997  101.689 152.428 1.00 48.46  ? 172  ASN E N   1 
ATOM   10138 C  CA  . ASN E  1 172 ? 31.349  102.738 151.485 1.00 47.54  ? 172  ASN E CA  1 
ATOM   10139 C  C   . ASN E  1 172 ? 31.854  102.212 150.154 1.00 46.92  ? 172  ASN E C   1 
ATOM   10140 O  O   . ASN E  1 172 ? 32.793  102.753 149.570 1.00 48.46  ? 172  ASN E O   1 
ATOM   10141 C  CB  . ASN E  1 172 ? 32.350  103.712 152.105 1.00 49.10  ? 172  ASN E CB  1 
ATOM   10142 C  CG  . ASN E  1 172 ? 31.704  104.606 153.153 1.00 52.87  ? 172  ASN E CG  1 
ATOM   10143 O  OD1 . ASN E  1 172 ? 31.777  104.341 154.360 1.00 50.11  ? 172  ASN E OD1 1 
ATOM   10144 N  ND2 . ASN E  1 172 ? 31.038  105.661 152.691 1.00 52.93  ? 172  ASN E ND2 1 
ATOM   10145 N  N   . VAL E  1 173 ? 31.205  101.150 149.681 1.00 43.89  ? 173  VAL E N   1 
ATOM   10146 C  CA  . VAL E  1 173 ? 31.520  100.540 148.394 1.00 42.26  ? 173  VAL E CA  1 
ATOM   10147 C  C   . VAL E  1 173 ? 30.480  101.010 147.363 1.00 40.10  ? 173  VAL E C   1 
ATOM   10148 O  O   . VAL E  1 173 ? 29.281  100.924 147.601 1.00 38.33  ? 173  VAL E O   1 
ATOM   10149 C  CB  . VAL E  1 173 ? 31.461  99.003  148.482 1.00 42.97  ? 173  VAL E CB  1 
ATOM   10150 C  CG1 . VAL E  1 173 ? 31.615  98.390  147.107 1.00 40.18  ? 173  VAL E CG1 1 
ATOM   10151 C  CG2 . VAL E  1 173 ? 32.551  98.504  149.405 1.00 43.59  ? 173  VAL E CG2 1 
ATOM   10152 N  N   . PRO E  1 174 ? 30.928  101.534 146.213 1.00 36.65  ? 174  PRO E N   1 
ATOM   10153 C  CA  . PRO E  1 174 ? 29.923  101.970 145.245 1.00 36.13  ? 174  PRO E CA  1 
ATOM   10154 C  C   . PRO E  1 174 ? 29.116  100.745 144.818 1.00 36.63  ? 174  PRO E C   1 
ATOM   10155 O  O   . PRO E  1 174 ? 29.691  99.720  144.436 1.00 37.72  ? 174  PRO E O   1 
ATOM   10156 C  CB  . PRO E  1 174 ? 30.765  102.535 144.103 1.00 36.38  ? 174  PRO E CB  1 
ATOM   10157 C  CG  . PRO E  1 174 ? 32.015  103.010 144.796 1.00 34.56  ? 174  PRO E CG  1 
ATOM   10158 C  CD  . PRO E  1 174 ? 32.285  101.864 145.747 1.00 35.78  ? 174  PRO E CD  1 
ATOM   10159 N  N   . VAL E  1 175 ? 27.791  100.846 144.882 1.00 34.41  ? 175  VAL E N   1 
ATOM   10160 C  CA  . VAL E  1 175 ? 26.952  99.718  144.514 1.00 32.03  ? 175  VAL E CA  1 
ATOM   10161 C  C   . VAL E  1 175 ? 25.662  100.078 143.809 1.00 32.49  ? 175  VAL E C   1 
ATOM   10162 O  O   . VAL E  1 175 ? 24.947  100.989 144.217 1.00 32.48  ? 175  VAL E O   1 
ATOM   10163 C  CB  . VAL E  1 175 ? 26.589  98.857  145.752 1.00 29.79  ? 175  VAL E CB  1 
ATOM   10164 C  CG1 . VAL E  1 175 ? 25.991  99.719  146.841 1.00 29.37  ? 175  VAL E CG1 1 
ATOM   10165 C  CG2 . VAL E  1 175 ? 25.600  97.786  145.359 1.00 27.99  ? 175  VAL E CG2 1 
ATOM   10166 N  N   . THR E  1 176 ? 25.356  99.322  142.759 1.00 32.99  ? 176  THR E N   1 
ATOM   10167 C  CA  . THR E  1 176 ? 24.139  99.533  141.990 1.00 31.11  ? 176  THR E CA  1 
ATOM   10168 C  C   . THR E  1 176 ? 23.225  98.317  142.025 1.00 31.92  ? 176  THR E C   1 
ATOM   10169 O  O   . THR E  1 176 ? 23.683  97.183  141.877 1.00 33.82  ? 176  THR E O   1 
ATOM   10170 C  CB  . THR E  1 176 ? 24.454  99.829  140.521 1.00 29.60  ? 176  THR E CB  1 
ATOM   10171 O  OG1 . THR E  1 176 ? 25.163  101.062 140.424 1.00 30.72  ? 176  THR E OG1 1 
ATOM   10172 C  CG2 . THR E  1 176 ? 23.183  99.926  139.719 1.00 29.82  ? 176  THR E CG2 1 
ATOM   10173 N  N   . VAL E  1 177 ? 21.933  98.553  142.233 1.00 30.38  ? 177  VAL E N   1 
ATOM   10174 C  CA  . VAL E  1 177 ? 20.962  97.470  142.228 1.00 27.67  ? 177  VAL E CA  1 
ATOM   10175 C  C   . VAL E  1 177 ? 20.280  97.408  140.859 1.00 28.99  ? 177  VAL E C   1 
ATOM   10176 O  O   . VAL E  1 177 ? 19.928  98.432  140.268 1.00 28.06  ? 177  VAL E O   1 
ATOM   10177 C  CB  . VAL E  1 177 ? 19.914  97.658  143.317 1.00 24.43  ? 177  VAL E CB  1 
ATOM   10178 C  CG1 . VAL E  1 177 ? 18.779  96.663  143.123 1.00 26.08  ? 177  VAL E CG1 1 
ATOM   10179 C  CG2 . VAL E  1 177 ? 20.554  97.428  144.664 1.00 18.58  ? 177  VAL E CG2 1 
ATOM   10180 N  N   . VAL E  1 178 ? 20.110  96.197  140.349 1.00 28.73  ? 178  VAL E N   1 
ATOM   10181 C  CA  . VAL E  1 178 ? 19.486  96.005  139.048 1.00 27.45  ? 178  VAL E CA  1 
ATOM   10182 C  C   . VAL E  1 178 ? 18.459  94.876  139.133 1.00 29.58  ? 178  VAL E C   1 
ATOM   10183 O  O   . VAL E  1 178 ? 18.614  93.947  139.931 1.00 30.64  ? 178  VAL E O   1 
ATOM   10184 C  CB  . VAL E  1 178 ? 20.546  95.633  138.008 1.00 26.29  ? 178  VAL E CB  1 
ATOM   10185 C  CG1 . VAL E  1 178 ? 21.651  96.662  138.004 1.00 26.32  ? 178  VAL E CG1 1 
ATOM   10186 C  CG2 . VAL E  1 178 ? 21.135  94.257  138.328 1.00 28.00  ? 178  VAL E CG2 1 
ATOM   10187 N  N   . LEU E  1 179 ? 17.406  94.964  138.326 1.00 30.61  ? 179  LEU E N   1 
ATOM   10188 C  CA  . LEU E  1 179 ? 16.372  93.927  138.287 1.00 33.14  ? 179  LEU E CA  1 
ATOM   10189 C  C   . LEU E  1 179 ? 17.010  92.582  137.910 1.00 33.70  ? 179  LEU E C   1 
ATOM   10190 O  O   . LEU E  1 179 ? 18.054  92.552  137.256 1.00 33.72  ? 179  LEU E O   1 
ATOM   10191 C  CB  . LEU E  1 179 ? 15.312  94.292  137.241 1.00 32.35  ? 179  LEU E CB  1 
ATOM   10192 C  CG  . LEU E  1 179 ? 14.079  95.084  137.675 1.00 33.01  ? 179  LEU E CG  1 
ATOM   10193 C  CD1 . LEU E  1 179 ? 14.457  96.135  138.693 1.00 31.41  ? 179  LEU E CD1 1 
ATOM   10194 C  CD2 . LEU E  1 179 ? 13.432  95.704  136.453 1.00 31.97  ? 179  LEU E CD2 1 
ATOM   10195 N  N   . ASP E  1 180 ? 16.389  91.473  138.307 1.00 33.17  ? 180  ASP E N   1 
ATOM   10196 C  CA  . ASP E  1 180 ? 16.942  90.159  137.977 1.00 30.57  ? 180  ASP E CA  1 
ATOM   10197 C  C   . ASP E  1 180 ? 16.966  89.999  136.468 1.00 28.60  ? 180  ASP E C   1 
ATOM   10198 O  O   . ASP E  1 180 ? 17.824  89.317  135.921 1.00 30.38  ? 180  ASP E O   1 
ATOM   10199 C  CB  . ASP E  1 180 ? 16.103  89.023  138.574 1.00 35.28  ? 180  ASP E CB  1 
ATOM   10200 C  CG  . ASP E  1 180 ? 15.648  89.302  140.005 1.00 41.84  ? 180  ASP E CG  1 
ATOM   10201 O  OD1 . ASP E  1 180 ? 14.471  89.721  140.192 1.00 43.42  ? 180  ASP E OD1 1 
ATOM   10202 O  OD2 . ASP E  1 180 ? 16.472  89.106  140.934 1.00 38.72  ? 180  ASP E OD2 1 
ATOM   10203 N  N   . ALA E  1 181 ? 16.019  90.638  135.796 1.00 28.05  ? 181  ALA E N   1 
ATOM   10204 C  CA  . ALA E  1 181 ? 15.919  90.563  134.340 1.00 28.66  ? 181  ALA E CA  1 
ATOM   10205 C  C   . ALA E  1 181 ? 16.986  91.359  133.591 1.00 29.33  ? 181  ALA E C   1 
ATOM   10206 O  O   . ALA E  1 181 ? 17.045  91.296  132.359 1.00 28.09  ? 181  ALA E O   1 
ATOM   10207 C  CB  . ALA E  1 181 ? 14.547  91.032  133.898 1.00 28.11  ? 181  ALA E CB  1 
ATOM   10208 N  N   . ALA E  1 182 ? 17.827  92.090  134.329 1.00 28.11  ? 182  ALA E N   1 
ATOM   10209 C  CA  . ALA E  1 182 ? 18.862  92.930  133.723 1.00 28.90  ? 182  ALA E CA  1 
ATOM   10210 C  C   . ALA E  1 182 ? 20.285  92.352  133.732 1.00 28.02  ? 182  ALA E C   1 
ATOM   10211 O  O   . ALA E  1 182 ? 21.228  93.004  133.271 1.00 30.48  ? 182  ALA E O   1 
ATOM   10212 C  CB  . ALA E  1 182 ? 18.851  94.324  134.383 1.00 22.28  ? 182  ALA E CB  1 
ATOM   10213 N  N   . VAL E  1 183 ? 20.444  91.139  134.245 1.00 25.79  ? 183  VAL E N   1 
ATOM   10214 C  CA  . VAL E  1 183 ? 21.762  90.512  134.288 1.00 29.31  ? 183  VAL E CA  1 
ATOM   10215 C  C   . VAL E  1 183 ? 22.372  90.379  132.888 1.00 30.25  ? 183  VAL E C   1 
ATOM   10216 O  O   . VAL E  1 183 ? 23.491  90.830  132.664 1.00 33.29  ? 183  VAL E O   1 
ATOM   10217 C  CB  . VAL E  1 183 ? 21.694  89.131  134.953 1.00 28.03  ? 183  VAL E CB  1 
ATOM   10218 C  CG1 . VAL E  1 183 ? 23.016  88.440  134.846 1.00 28.01  ? 183  VAL E CG1 1 
ATOM   10219 C  CG2 . VAL E  1 183 ? 21.307  89.285  136.386 1.00 25.31  ? 183  VAL E CG2 1 
ATOM   10220 N  N   . GLY E  1 184 ? 21.649  89.769  131.951 1.00 27.38  ? 184  GLY E N   1 
ATOM   10221 C  CA  . GLY E  1 184 ? 22.171  89.650  130.599 1.00 29.74  ? 184  GLY E CA  1 
ATOM   10222 C  C   . GLY E  1 184 ? 22.665  90.987  130.039 1.00 30.67  ? 184  GLY E C   1 
ATOM   10223 O  O   . GLY E  1 184 ? 23.676  91.051  129.345 1.00 35.03  ? 184  GLY E O   1 
ATOM   10224 N  N   . TYR E  1 185 ? 21.935  92.049  130.359 1.00 29.46  ? 185  TYR E N   1 
ATOM   10225 C  CA  . TYR E  1 185 ? 22.198  93.431  129.949 1.00 29.07  ? 185  TYR E CA  1 
ATOM   10226 C  C   . TYR E  1 185 ? 23.414  94.130  130.590 1.00 32.14  ? 185  TYR E C   1 
ATOM   10227 O  O   . TYR E  1 185 ? 24.130  94.901  129.941 1.00 33.22  ? 185  TYR E O   1 
ATOM   10228 C  CB  . TYR E  1 185 ? 20.960  94.263  130.291 1.00 26.32  ? 185  TYR E CB  1 
ATOM   10229 C  CG  . TYR E  1 185 ? 21.146  95.768  130.246 1.00 22.98  ? 185  TYR E CG  1 
ATOM   10230 C  CD1 . TYR E  1 185 ? 20.863  96.494  129.083 1.00 23.35  ? 185  TYR E CD1 1 
ATOM   10231 C  CD2 . TYR E  1 185 ? 21.538  96.471  131.382 1.00 23.54  ? 185  TYR E CD2 1 
ATOM   10232 C  CE1 . TYR E  1 185 ? 20.955  97.887  129.058 1.00 28.87  ? 185  TYR E CE1 1 
ATOM   10233 C  CE2 . TYR E  1 185 ? 21.632  97.858  131.378 1.00 26.42  ? 185  TYR E CE2 1 
ATOM   10234 C  CZ  . TYR E  1 185 ? 21.333  98.565  130.214 1.00 30.70  ? 185  TYR E CZ  1 
ATOM   10235 O  OH  . TYR E  1 185 ? 21.364  99.940  130.222 1.00 31.75  ? 185  TYR E OH  1 
ATOM   10236 N  N   . ILE E  1 186 ? 23.604  93.888  131.881 1.00 29.40  ? 186  ILE E N   1 
ATOM   10237 C  CA  . ILE E  1 186 ? 24.662  94.519  132.642 1.00 27.88  ? 186  ILE E CA  1 
ATOM   10238 C  C   . ILE E  1 186 ? 25.993  93.745  132.600 1.00 30.56  ? 186  ILE E C   1 
ATOM   10239 O  O   . ILE E  1 186 ? 27.062  94.301  132.891 1.00 30.25  ? 186  ILE E O   1 
ATOM   10240 C  CB  . ILE E  1 186 ? 24.167  94.709  134.132 1.00 29.71  ? 186  ILE E CB  1 
ATOM   10241 C  CG1 . ILE E  1 186 ? 25.040  95.722  134.867 1.00 25.82  ? 186  ILE E CG1 1 
ATOM   10242 C  CG2 . ILE E  1 186 ? 24.128  93.374  134.872 1.00 21.30  ? 186  ILE E CG2 1 
ATOM   10243 C  CD1 . ILE E  1 186 ? 24.726  97.127  134.470 1.00 26.22  ? 186  ILE E CD1 1 
HETATM 10244 N  N   . MSE E  1 187 ? 25.926  92.474  132.216 1.00 30.04  ? 187  MSE E N   1 
HETATM 10245 C  CA  . MSE E  1 187 ? 27.107  91.615  132.179 1.00 32.61  ? 187  MSE E CA  1 
HETATM 10246 C  C   . MSE E  1 187 ? 28.342  92.210  131.517 1.00 32.31  ? 187  MSE E C   1 
HETATM 10247 O  O   . MSE E  1 187 ? 29.438  92.103  132.054 1.00 32.95  ? 187  MSE E O   1 
HETATM 10248 C  CB  . MSE E  1 187 ? 26.776  90.284  131.506 1.00 33.77  ? 187  MSE E CB  1 
HETATM 10249 C  CG  . MSE E  1 187 ? 27.881  89.226  131.630 1.00 41.31  ? 187  MSE E CG  1 
HETATM 10250 SE SE  . MSE E  1 187 ? 28.342  88.687  133.467 1.00 50.00  ? 187  MSE E SE  1 
HETATM 10251 C  CE  . MSE E  1 187 ? 26.653  87.887  133.995 1.00 40.02  ? 187  MSE E CE  1 
ATOM   10252 N  N   . GLU E  1 188 ? 28.167  92.831  130.355 1.00 33.93  ? 188  GLU E N   1 
ATOM   10253 C  CA  . GLU E  1 188 ? 29.294  93.410  129.644 1.00 34.92  ? 188  GLU E CA  1 
ATOM   10254 C  C   . GLU E  1 188 ? 30.042  94.455  130.455 1.00 35.60  ? 188  GLU E C   1 
ATOM   10255 O  O   . GLU E  1 188 ? 31.203  94.738  130.169 1.00 34.65  ? 188  GLU E O   1 
ATOM   10256 C  CB  . GLU E  1 188 ? 28.851  93.995  128.290 1.00 36.57  ? 188  GLU E CB  1 
ATOM   10257 C  CG  . GLU E  1 188 ? 27.664  94.962  128.307 1.00 39.53  ? 188  GLU E CG  1 
ATOM   10258 C  CD  . GLU E  1 188 ? 27.252  95.406  126.892 1.00 40.85  ? 188  GLU E CD  1 
ATOM   10259 O  OE1 . GLU E  1 188 ? 27.038  94.522  126.031 1.00 43.42  ? 188  GLU E OE1 1 
ATOM   10260 O  OE2 . GLU E  1 188 ? 27.140  96.629  126.638 1.00 37.67  ? 188  GLU E OE2 1 
ATOM   10261 N  N   . LYS E  1 189 ? 29.388  95.002  131.479 1.00 37.11  ? 189  LYS E N   1 
ATOM   10262 C  CA  . LYS E  1 189 ? 29.994  96.017  132.346 1.00 36.36  ? 189  LYS E CA  1 
ATOM   10263 C  C   . LYS E  1 189 ? 30.841  95.457  133.493 1.00 35.88  ? 189  LYS E C   1 
ATOM   10264 O  O   . LYS E  1 189 ? 31.606  96.186  134.103 1.00 39.45  ? 189  LYS E O   1 
ATOM   10265 C  CB  . LYS E  1 189 ? 28.916  96.902  132.962 1.00 35.37  ? 189  LYS E CB  1 
ATOM   10266 C  CG  . LYS E  1 189 ? 28.309  97.917  132.051 1.00 38.06  ? 189  LYS E CG  1 
ATOM   10267 C  CD  . LYS E  1 189 ? 27.392  98.824  132.868 1.00 43.47  ? 189  LYS E CD  1 
ATOM   10268 C  CE  . LYS E  1 189 ? 26.903  100.040 132.074 1.00 48.00  ? 189  LYS E CE  1 
ATOM   10269 N  NZ  . LYS E  1 189 ? 26.162  101.013 132.945 1.00 50.70  ? 189  LYS E NZ  1 
ATOM   10270 N  N   . ALA E  1 190 ? 30.703  94.174  133.800 1.00 36.09  ? 190  ALA E N   1 
ATOM   10271 C  CA  . ALA E  1 190 ? 31.459  93.592  134.903 1.00 36.69  ? 190  ALA E CA  1 
ATOM   10272 C  C   . ALA E  1 190 ? 32.749  92.888  134.481 1.00 37.32  ? 190  ALA E C   1 
ATOM   10273 O  O   . ALA E  1 190 ? 32.914  92.474  133.337 1.00 35.16  ? 190  ALA E O   1 
ATOM   10274 C  CB  . ALA E  1 190 ? 30.569  92.627  135.693 1.00 34.41  ? 190  ALA E CB  1 
ATOM   10275 N  N   . ASP E  1 191 ? 33.663  92.757  135.433 1.00 37.60  ? 191  ASP E N   1 
ATOM   10276 C  CA  . ASP E  1 191 ? 34.934  92.106  135.185 1.00 39.38  ? 191  ASP E CA  1 
ATOM   10277 C  C   . ASP E  1 191 ? 34.816  90.664  135.628 1.00 39.89  ? 191  ASP E C   1 
ATOM   10278 O  O   . ASP E  1 191 ? 35.426  89.771  135.039 1.00 40.69  ? 191  ASP E O   1 
ATOM   10279 C  CB  . ASP E  1 191 ? 36.048  92.807  135.965 1.00 41.79  ? 191  ASP E CB  1 
ATOM   10280 C  CG  . ASP E  1 191 ? 36.385  94.176  135.395 1.00 45.88  ? 191  ASP E CG  1 
ATOM   10281 O  OD1 . ASP E  1 191 ? 36.922  94.213  134.265 1.00 44.85  ? 191  ASP E OD1 1 
ATOM   10282 O  OD2 . ASP E  1 191 ? 36.110  95.210  136.063 1.00 47.70  ? 191  ASP E OD2 1 
ATOM   10283 N  N   . LEU E  1 192 ? 34.019  90.435  136.664 1.00 37.70  ? 192  LEU E N   1 
ATOM   10284 C  CA  . LEU E  1 192 ? 33.832  89.086  137.158 1.00 35.95  ? 192  LEU E CA  1 
ATOM   10285 C  C   . LEU E  1 192 ? 32.620  88.947  138.052 1.00 34.92  ? 192  LEU E C   1 
ATOM   10286 O  O   . LEU E  1 192 ? 32.046  89.926  138.534 1.00 37.51  ? 192  LEU E O   1 
ATOM   10287 C  CB  . LEU E  1 192 ? 35.057  88.627  137.935 1.00 36.82  ? 192  LEU E CB  1 
ATOM   10288 C  CG  . LEU E  1 192 ? 35.248  89.315  139.289 1.00 37.88  ? 192  LEU E CG  1 
ATOM   10289 C  CD1 . LEU E  1 192 ? 36.346  88.613  140.081 1.00 37.15  ? 192  LEU E CD1 1 
ATOM   10290 C  CD2 . LEU E  1 192 ? 35.589  90.778  139.062 1.00 38.49  ? 192  LEU E CD2 1 
ATOM   10291 N  N   . VAL E  1 193 ? 32.237  87.703  138.276 1.00 32.41  ? 193  VAL E N   1 
ATOM   10292 C  CA  . VAL E  1 193 ? 31.108  87.416  139.131 1.00 31.14  ? 193  VAL E CA  1 
ATOM   10293 C  C   . VAL E  1 193 ? 31.588  86.607  140.337 1.00 32.05  ? 193  VAL E C   1 
ATOM   10294 O  O   . VAL E  1 193 ? 32.397  85.668  140.194 1.00 28.02  ? 193  VAL E O   1 
ATOM   10295 C  CB  . VAL E  1 193 ? 30.021  86.604  138.378 1.00 29.16  ? 193  VAL E CB  1 
ATOM   10296 C  CG1 . VAL E  1 193 ? 28.911  86.241  139.333 1.00 26.71  ? 193  VAL E CG1 1 
ATOM   10297 C  CG2 . VAL E  1 193 ? 29.469  87.406  137.204 1.00 25.49  ? 193  VAL E CG2 1 
ATOM   10298 N  N   . ILE E  1 194 ? 31.106  87.000  141.517 1.00 31.27  ? 194  ILE E N   1 
ATOM   10299 C  CA  . ILE E  1 194 ? 31.419  86.315  142.770 1.00 32.28  ? 194  ILE E CA  1 
ATOM   10300 C  C   . ILE E  1 194 ? 30.074  85.962  143.383 1.00 32.45  ? 194  ILE E C   1 
ATOM   10301 O  O   . ILE E  1 194 ? 29.180  86.801  143.447 1.00 34.72  ? 194  ILE E O   1 
ATOM   10302 C  CB  . ILE E  1 194 ? 32.171  87.219  143.752 1.00 32.17  ? 194  ILE E CB  1 
ATOM   10303 C  CG1 . ILE E  1 194 ? 33.519  87.629  143.157 1.00 35.87  ? 194  ILE E CG1 1 
ATOM   10304 C  CG2 . ILE E  1 194 ? 32.363  86.497  145.076 1.00 30.13  ? 194  ILE E CG2 1 
ATOM   10305 C  CD1 . ILE E  1 194 ? 34.348  88.559  144.061 1.00 37.08  ? 194  ILE E CD1 1 
ATOM   10306 N  N   . VAL E  1 195 ? 29.929  84.735  143.859 1.00 32.56  ? 195  VAL E N   1 
ATOM   10307 C  CA  . VAL E  1 195 ? 28.652  84.305  144.425 1.00 29.80  ? 195  VAL E CA  1 
ATOM   10308 C  C   . VAL E  1 195 ? 28.783  83.286  145.549 1.00 29.58  ? 195  VAL E C   1 
ATOM   10309 O  O   . VAL E  1 195 ? 29.798  82.609  145.678 1.00 32.08  ? 195  VAL E O   1 
ATOM   10310 C  CB  . VAL E  1 195 ? 27.783  83.704  143.306 1.00 27.59  ? 195  VAL E CB  1 
ATOM   10311 C  CG1 . VAL E  1 195 ? 26.780  82.767  143.864 1.00 33.09  ? 195  VAL E CG1 1 
ATOM   10312 C  CG2 . VAL E  1 195 ? 27.075  84.817  142.549 1.00 30.14  ? 195  VAL E CG2 1 
ATOM   10313 N  N   . GLY E  1 196 ? 27.744  83.181  146.364 1.00 28.00  ? 196  GLY E N   1 
ATOM   10314 C  CA  . GLY E  1 196 ? 27.754  82.216  147.438 1.00 30.30  ? 196  GLY E CA  1 
ATOM   10315 C  C   . GLY E  1 196 ? 27.139  80.902  146.974 1.00 32.49  ? 196  GLY E C   1 
ATOM   10316 O  O   . GLY E  1 196 ? 26.782  80.735  145.817 1.00 34.30  ? 196  GLY E O   1 
ATOM   10317 N  N   . ALA E  1 197 ? 27.017  79.948  147.875 1.00 31.84  ? 197  ALA E N   1 
ATOM   10318 C  CA  . ALA E  1 197 ? 26.436  78.679  147.509 1.00 31.09  ? 197  ALA E CA  1 
ATOM   10319 C  C   . ALA E  1 197 ? 25.644  78.170  148.687 1.00 33.62  ? 197  ALA E C   1 
ATOM   10320 O  O   . ALA E  1 197 ? 26.095  78.247  149.831 1.00 29.71  ? 197  ALA E O   1 
ATOM   10321 C  CB  . ALA E  1 197 ? 27.532  77.678  147.154 1.00 33.79  ? 197  ALA E CB  1 
ATOM   10322 N  N   . GLU E  1 198 ? 24.448  77.668  148.414 1.00 35.12  ? 198  GLU E N   1 
ATOM   10323 C  CA  . GLU E  1 198 ? 23.649  77.115  149.480 1.00 34.94  ? 198  GLU E CA  1 
ATOM   10324 C  C   . GLU E  1 198 ? 24.140  75.681  149.612 1.00 34.43  ? 198  GLU E C   1 
ATOM   10325 O  O   . GLU E  1 198 ? 24.042  75.085  150.676 1.00 37.16  ? 198  GLU E O   1 
ATOM   10326 C  CB  . GLU E  1 198 ? 22.158  77.193  149.143 1.00 34.15  ? 198  GLU E CB  1 
ATOM   10327 C  CG  . GLU E  1 198 ? 21.415  78.136  150.089 1.00 40.12  ? 198  GLU E CG  1 
ATOM   10328 C  CD  . GLU E  1 198 ? 20.054  78.586  149.580 1.00 45.60  ? 198  GLU E CD  1 
ATOM   10329 O  OE1 . GLU E  1 198 ? 19.987  79.632  148.893 1.00 48.26  ? 198  GLU E OE1 1 
ATOM   10330 O  OE2 . GLU E  1 198 ? 19.050  77.895  149.871 1.00 50.72  ? 198  GLU E OE2 1 
ATOM   10331 N  N   . GLY E  1 199 ? 24.723  75.154  148.538 1.00 33.05  ? 199  GLY E N   1 
ATOM   10332 C  CA  . GLY E  1 199 ? 25.235  73.791  148.576 1.00 32.83  ? 199  GLY E CA  1 
ATOM   10333 C  C   . GLY E  1 199 ? 26.226  73.438  147.474 1.00 30.81  ? 199  GLY E C   1 
ATOM   10334 O  O   . GLY E  1 199 ? 25.949  73.645  146.304 1.00 32.91  ? 199  GLY E O   1 
ATOM   10335 N  N   . VAL E  1 200 ? 27.398  72.921  147.828 1.00 29.71  ? 200  VAL E N   1 
ATOM   10336 C  CA  . VAL E  1 200 ? 28.344  72.540  146.793 1.00 29.03  ? 200  VAL E CA  1 
ATOM   10337 C  C   . VAL E  1 200 ? 28.136  71.064  146.532 1.00 27.06  ? 200  VAL E C   1 
ATOM   10338 O  O   . VAL E  1 200 ? 28.345  70.234  147.394 1.00 29.03  ? 200  VAL E O   1 
ATOM   10339 C  CB  . VAL E  1 200 ? 29.787  72.807  147.193 1.00 29.86  ? 200  VAL E CB  1 
ATOM   10340 C  CG1 . VAL E  1 200 ? 30.707  72.388  146.048 1.00 28.67  ? 200  VAL E CG1 1 
ATOM   10341 C  CG2 . VAL E  1 200 ? 29.971  74.294  147.519 1.00 30.19  ? 200  VAL E CG2 1 
ATOM   10342 N  N   . VAL E  1 201 ? 27.700  70.762  145.323 1.00 29.57  ? 201  VAL E N   1 
ATOM   10343 C  CA  . VAL E  1 201 ? 27.373  69.416  144.902 1.00 30.87  ? 201  VAL E CA  1 
ATOM   10344 C  C   . VAL E  1 201 ? 28.562  68.537  144.502 1.00 30.96  ? 201  VAL E C   1 
ATOM   10345 O  O   . VAL E  1 201 ? 29.647  69.025  144.209 1.00 33.08  ? 201  VAL E O   1 
ATOM   10346 C  CB  . VAL E  1 201 ? 26.297  69.530  143.800 1.00 33.25  ? 201  VAL E CB  1 
ATOM   10347 C  CG1 . VAL E  1 201 ? 26.499  68.505  142.730 1.00 38.03  ? 201  VAL E CG1 1 
ATOM   10348 C  CG2 . VAL E  1 201 ? 24.915  69.417  144.450 1.00 29.81  ? 201  VAL E CG2 1 
ATOM   10349 N  N   . GLU E  1 202 ? 28.347  67.230  144.495 1.00 31.76  ? 202  GLU E N   1 
ATOM   10350 C  CA  . GLU E  1 202 ? 29.424  66.286  144.218 1.00 32.41  ? 202  GLU E CA  1 
ATOM   10351 C  C   . GLU E  1 202 ? 30.241  66.455  142.959 1.00 32.22  ? 202  GLU E C   1 
ATOM   10352 O  O   . GLU E  1 202 ? 31.382  66.008  142.904 1.00 33.46  ? 202  GLU E O   1 
ATOM   10353 C  CB  . GLU E  1 202 ? 28.893  64.862  144.280 1.00 33.08  ? 202  GLU E CB  1 
ATOM   10354 C  CG  . GLU E  1 202 ? 29.223  64.146  145.561 1.00 34.01  ? 202  GLU E CG  1 
ATOM   10355 C  CD  . GLU E  1 202 ? 28.299  62.970  145.818 1.00 36.76  ? 202  GLU E CD  1 
ATOM   10356 O  OE1 . GLU E  1 202 ? 28.028  62.196  144.877 1.00 37.28  ? 202  GLU E OE1 1 
ATOM   10357 O  OE2 . GLU E  1 202 ? 27.846  62.815  146.970 1.00 39.26  ? 202  GLU E OE2 1 
ATOM   10358 N  N   . ASN E  1 203 ? 29.679  67.081  141.937 1.00 32.47  ? 203  ASN E N   1 
ATOM   10359 C  CA  . ASN E  1 203 ? 30.436  67.266  140.703 1.00 27.93  ? 203  ASN E CA  1 
ATOM   10360 C  C   . ASN E  1 203 ? 31.067  68.636  140.663 1.00 28.30  ? 203  ASN E C   1 
ATOM   10361 O  O   . ASN E  1 203 ? 31.663  69.003  139.656 1.00 29.90  ? 203  ASN E O   1 
ATOM   10362 C  CB  . ASN E  1 203 ? 29.530  67.115  139.493 1.00 25.96  ? 203  ASN E CB  1 
ATOM   10363 C  CG  . ASN E  1 203 ? 28.475  68.198  139.415 1.00 30.07  ? 203  ASN E CG  1 
ATOM   10364 O  OD1 . ASN E  1 203 ? 28.373  69.065  140.291 1.00 34.65  ? 203  ASN E OD1 1 
ATOM   10365 N  ND2 . ASN E  1 203 ? 27.678  68.156  138.363 1.00 30.60  ? 203  ASN E ND2 1 
ATOM   10366 N  N   . GLY E  1 204 ? 30.917  69.402  141.743 1.00 26.10  ? 204  GLY E N   1 
ATOM   10367 C  CA  . GLY E  1 204 ? 31.479  70.739  141.759 1.00 28.96  ? 204  GLY E CA  1 
ATOM   10368 C  C   . GLY E  1 204 ? 30.476  71.819  141.375 1.00 30.46  ? 204  GLY E C   1 
ATOM   10369 O  O   . GLY E  1 204 ? 30.792  73.009  141.423 1.00 27.72  ? 204  GLY E O   1 
ATOM   10370 N  N   . GLY E  1 205 ? 29.279  71.411  140.958 1.00 31.18  ? 205  GLY E N   1 
ATOM   10371 C  CA  . GLY E  1 205 ? 28.245  72.382  140.636 1.00 29.17  ? 205  GLY E CA  1 
ATOM   10372 C  C   . GLY E  1 205 ? 27.716  72.928  141.962 1.00 27.09  ? 205  GLY E C   1 
ATOM   10373 O  O   . GLY E  1 205 ? 28.217  72.545  143.024 1.00 23.30  ? 205  GLY E O   1 
ATOM   10374 N  N   . ILE E  1 206 ? 26.719  73.807  141.927 1.00 25.55  ? 206  ILE E N   1 
ATOM   10375 C  CA  . ILE E  1 206 ? 26.172  74.362  143.179 1.00 28.68  ? 206  ILE E CA  1 
ATOM   10376 C  C   . ILE E  1 206 ? 24.670  74.658  143.188 1.00 30.27  ? 206  ILE E C   1 
ATOM   10377 O  O   . ILE E  1 206 ? 24.082  75.032  142.169 1.00 33.77  ? 206  ILE E O   1 
ATOM   10378 C  CB  . ILE E  1 206 ? 26.847  75.714  143.588 1.00 25.04  ? 206  ILE E CB  1 
ATOM   10379 C  CG1 . ILE E  1 206 ? 26.541  76.789  142.527 1.00 23.40  ? 206  ILE E CG1 1 
ATOM   10380 C  CG2 . ILE E  1 206 ? 28.332  75.525  143.815 1.00 18.63  ? 206  ILE E CG2 1 
ATOM   10381 C  CD1 . ILE E  1 206 ? 26.956  78.208  142.925 1.00 21.37  ? 206  ILE E CD1 1 
ATOM   10382 N  N   . ILE E  1 207 ? 24.060  74.509  144.357 1.00 28.46  ? 207  ILE E N   1 
ATOM   10383 C  CA  . ILE E  1 207 ? 22.651  74.834  144.520 1.00 31.26  ? 207  ILE E CA  1 
ATOM   10384 C  C   . ILE E  1 207 ? 22.660  76.235  145.131 1.00 31.96  ? 207  ILE E C   1 
ATOM   10385 O  O   . ILE E  1 207 ? 23.381  76.470  146.109 1.00 32.51  ? 207  ILE E O   1 
ATOM   10386 C  CB  . ILE E  1 207 ? 21.957  73.868  145.484 1.00 31.35  ? 207  ILE E CB  1 
ATOM   10387 C  CG1 . ILE E  1 207 ? 22.025  72.437  144.922 1.00 30.91  ? 207  ILE E CG1 1 
ATOM   10388 C  CG2 . ILE E  1 207 ? 20.509  74.331  145.714 1.00 30.17  ? 207  ILE E CG2 1 
ATOM   10389 C  CD1 . ILE E  1 207 ? 21.474  71.379  145.861 1.00 27.50  ? 207  ILE E CD1 1 
ATOM   10390 N  N   . ASN E  1 208 ? 21.881  77.162  144.568 1.00 29.98  ? 208  ASN E N   1 
ATOM   10391 C  CA  . ASN E  1 208 ? 21.873  78.540  145.084 1.00 27.78  ? 208  ASN E CA  1 
ATOM   10392 C  C   . ASN E  1 208 ? 20.590  79.308  144.789 1.00 24.17  ? 208  ASN E C   1 
ATOM   10393 O  O   . ASN E  1 208 ? 19.818  78.927  143.924 1.00 23.38  ? 208  ASN E O   1 
ATOM   10394 C  CB  . ASN E  1 208 ? 23.053  79.323  144.486 1.00 25.35  ? 208  ASN E CB  1 
ATOM   10395 C  CG  . ASN E  1 208 ? 23.470  80.509  145.347 1.00 26.66  ? 208  ASN E CG  1 
ATOM   10396 O  OD1 . ASN E  1 208 ? 23.770  81.600  144.838 1.00 25.72  ? 208  ASN E OD1 1 
ATOM   10397 N  ND2 . ASN E  1 208 ? 23.516  80.295  146.654 1.00 22.39  ? 208  ASN E ND2 1 
ATOM   10398 N  N   . LYS E  1 209 ? 20.390  80.411  145.498 1.00 23.85  ? 209  LYS E N   1 
ATOM   10399 C  CA  . LYS E  1 209 ? 19.210  81.243  145.305 1.00 25.54  ? 209  LYS E CA  1 
ATOM   10400 C  C   . LYS E  1 209 ? 18.836  81.258  143.827 1.00 26.38  ? 209  LYS E C   1 
ATOM   10401 O  O   . LYS E  1 209 ? 19.689  81.459  142.968 1.00 28.18  ? 209  LYS E O   1 
ATOM   10402 C  CB  . LYS E  1 209 ? 19.486  82.666  145.788 1.00 23.40  ? 209  LYS E CB  1 
ATOM   10403 C  CG  . LYS E  1 209 ? 18.315  83.620  145.651 1.00 22.92  ? 209  LYS E CG  1 
ATOM   10404 C  CD  . LYS E  1 209 ? 17.180  83.232  146.579 1.00 29.40  ? 209  LYS E CD  1 
ATOM   10405 C  CE  . LYS E  1 209 ? 15.983  84.162  146.424 1.00 29.83  ? 209  LYS E CE  1 
ATOM   10406 N  NZ  . LYS E  1 209 ? 16.294  85.550  146.885 1.00 36.46  ? 209  LYS E NZ  1 
ATOM   10407 N  N   . ILE E  1 210 ? 17.559  81.020  143.543 1.00 27.75  ? 210  ILE E N   1 
ATOM   10408 C  CA  . ILE E  1 210 ? 17.052  80.986  142.180 1.00 24.40  ? 210  ILE E CA  1 
ATOM   10409 C  C   . ILE E  1 210 ? 17.582  82.223  141.430 1.00 26.89  ? 210  ILE E C   1 
ATOM   10410 O  O   . ILE E  1 210 ? 17.497  83.351  141.932 1.00 26.28  ? 210  ILE E O   1 
ATOM   10411 C  CB  . ILE E  1 210 ? 15.492  80.937  142.203 1.00 22.19  ? 210  ILE E CB  1 
ATOM   10412 C  CG1 . ILE E  1 210 ? 14.943  80.803  140.782 1.00 23.29  ? 210  ILE E CG1 1 
ATOM   10413 C  CG2 . ILE E  1 210 ? 14.930  82.171  142.922 1.00 12.92  ? 210  ILE E CG2 1 
ATOM   10414 C  CD1 . ILE E  1 210 ? 15.374  79.537  140.064 1.00 19.69  ? 210  ILE E CD1 1 
ATOM   10415 N  N   . GLY E  1 211 ? 18.163  81.998  140.250 1.00 26.68  ? 211  GLY E N   1 
ATOM   10416 C  CA  . GLY E  1 211 ? 18.733  83.089  139.464 1.00 24.27  ? 211  GLY E CA  1 
ATOM   10417 C  C   . GLY E  1 211 ? 20.241  82.952  139.265 1.00 23.85  ? 211  GLY E C   1 
ATOM   10418 O  O   . GLY E  1 211 ? 20.821  83.576  138.386 1.00 22.70  ? 211  GLY E O   1 
ATOM   10419 N  N   . THR E  1 212 ? 20.886  82.125  140.080 1.00 22.88  ? 212  THR E N   1 
ATOM   10420 C  CA  . THR E  1 212 ? 22.325  81.931  139.981 1.00 23.94  ? 212  THR E CA  1 
ATOM   10421 C  C   . THR E  1 212 ? 22.729  81.302  138.670 1.00 25.16  ? 212  THR E C   1 
ATOM   10422 O  O   . THR E  1 212 ? 23.742  81.672  138.078 1.00 28.01  ? 212  THR E O   1 
ATOM   10423 C  CB  . THR E  1 212 ? 22.837  81.067  141.126 1.00 22.63  ? 212  THR E CB  1 
ATOM   10424 O  OG1 . THR E  1 212 ? 22.504  81.708  142.355 1.00 23.86  ? 212  THR E OG1 1 
ATOM   10425 C  CG2 . THR E  1 212 ? 24.344  80.899  141.048 1.00 18.60  ? 212  THR E CG2 1 
ATOM   10426 N  N   . ASN E  1 213 ? 21.930  80.344  138.227 1.00 27.96  ? 213  ASN E N   1 
ATOM   10427 C  CA  . ASN E  1 213 ? 22.161  79.648  136.975 1.00 29.94  ? 213  ASN E CA  1 
ATOM   10428 C  C   . ASN E  1 213 ? 22.276  80.625  135.788 1.00 31.97  ? 213  ASN E C   1 
ATOM   10429 O  O   . ASN E  1 213 ? 23.254  80.596  135.034 1.00 32.21  ? 213  ASN E O   1 
ATOM   10430 C  CB  . ASN E  1 213 ? 21.017  78.670  136.738 1.00 32.58  ? 213  ASN E CB  1 
ATOM   10431 C  CG  . ASN E  1 213 ? 21.184  77.890  135.469 1.00 35.14  ? 213  ASN E CG  1 
ATOM   10432 O  OD1 . ASN E  1 213 ? 22.072  77.032  135.360 1.00 35.89  ? 213  ASN E OD1 1 
ATOM   10433 N  ND2 . ASN E  1 213 ? 20.346  78.189  134.486 1.00 30.37  ? 213  ASN E ND2 1 
ATOM   10434 N  N   . GLN E  1 214 ? 21.273  81.487  135.631 1.00 33.19  ? 214  GLN E N   1 
ATOM   10435 C  CA  . GLN E  1 214 ? 21.238  82.480  134.551 1.00 31.44  ? 214  GLN E CA  1 
ATOM   10436 C  C   . GLN E  1 214 ? 22.462  83.371  134.513 1.00 31.50  ? 214  GLN E C   1 
ATOM   10437 O  O   . GLN E  1 214 ? 22.980  83.691  133.448 1.00 32.73  ? 214  GLN E O   1 
ATOM   10438 C  CB  . GLN E  1 214 ? 20.042  83.392  134.719 1.00 34.15  ? 214  GLN E CB  1 
ATOM   10439 C  CG  . GLN E  1 214 ? 18.770  82.905  134.131 1.00 35.49  ? 214  GLN E CG  1 
ATOM   10440 C  CD  . GLN E  1 214 ? 17.602  83.634  134.741 1.00 38.56  ? 214  GLN E CD  1 
ATOM   10441 O  OE1 . GLN E  1 214 ? 17.729  84.790  135.175 1.00 33.38  ? 214  GLN E OE1 1 
ATOM   10442 N  NE2 . GLN E  1 214 ? 16.452  82.969  134.786 1.00 38.32  ? 214  GLN E NE2 1 
HETATM 10443 N  N   . MSE E  1 215 ? 22.887  83.821  135.683 1.00 30.85  ? 215  MSE E N   1 
HETATM 10444 C  CA  . MSE E  1 215 ? 24.050  84.676  135.769 1.00 30.09  ? 215  MSE E CA  1 
HETATM 10445 C  C   . MSE E  1 215 ? 25.262  83.928  135.217 1.00 30.98  ? 215  MSE E C   1 
HETATM 10446 O  O   . MSE E  1 215 ? 26.019  84.443  134.390 1.00 29.72  ? 215  MSE E O   1 
HETATM 10447 C  CB  . MSE E  1 215 ? 24.287  85.043  137.217 1.00 29.05  ? 215  MSE E CB  1 
HETATM 10448 C  CG  . MSE E  1 215 ? 25.439  85.983  137.430 1.00 35.39  ? 215  MSE E CG  1 
HETATM 10449 SE SE  . MSE E  1 215 ? 25.273  86.889  139.141 1.00 46.74  ? 215  MSE E SE  1 
HETATM 10450 C  CE  . MSE E  1 215 ? 23.913  88.220  138.703 1.00 40.86  ? 215  MSE E CE  1 
ATOM   10451 N  N   . ALA E  1 216 ? 25.423  82.691  135.668 1.00 29.82  ? 216  ALA E N   1 
ATOM   10452 C  CA  . ALA E  1 216 ? 26.540  81.874  135.252 1.00 27.77  ? 216  ALA E CA  1 
ATOM   10453 C  C   . ALA E  1 216 ? 26.561  81.691  133.743 1.00 29.10  ? 216  ALA E C   1 
ATOM   10454 O  O   . ALA E  1 216 ? 27.618  81.791  133.118 1.00 31.95  ? 216  ALA E O   1 
ATOM   10455 C  CB  . ALA E  1 216 ? 26.477  80.535  135.960 1.00 27.90  ? 216  ALA E CB  1 
ATOM   10456 N  N   . VAL E  1 217 ? 25.397  81.442  133.152 1.00 28.45  ? 217  VAL E N   1 
ATOM   10457 C  CA  . VAL E  1 217 ? 25.318  81.254  131.714 1.00 27.19  ? 217  VAL E CA  1 
ATOM   10458 C  C   . VAL E  1 217 ? 25.693  82.537  130.960 1.00 31.35  ? 217  VAL E C   1 
ATOM   10459 O  O   . VAL E  1 217 ? 26.421  82.484  129.962 1.00 35.06  ? 217  VAL E O   1 
ATOM   10460 C  CB  . VAL E  1 217 ? 23.900  80.756  131.280 1.00 26.52  ? 217  VAL E CB  1 
ATOM   10461 C  CG1 . VAL E  1 217 ? 23.791  80.711  129.759 1.00 21.81  ? 217  VAL E CG1 1 
ATOM   10462 C  CG2 . VAL E  1 217 ? 23.648  79.350  131.822 1.00 16.31  ? 217  VAL E CG2 1 
ATOM   10463 N  N   . CYS E  1 218 ? 25.213  83.687  131.424 1.00 28.98  ? 218  CYS E N   1 
ATOM   10464 C  CA  . CYS E  1 218 ? 25.546  84.945  130.761 1.00 28.84  ? 218  CYS E CA  1 
ATOM   10465 C  C   . CYS E  1 218 ? 27.010  85.276  130.987 1.00 29.51  ? 218  CYS E C   1 
ATOM   10466 O  O   . CYS E  1 218 ? 27.609  86.014  130.205 1.00 30.21  ? 218  CYS E O   1 
ATOM   10467 C  CB  . CYS E  1 218 ? 24.681  86.101  131.279 1.00 31.65  ? 218  CYS E CB  1 
ATOM   10468 S  SG  . CYS E  1 218 ? 22.934  85.991  130.832 1.00 37.48  ? 218  CYS E SG  1 
ATOM   10469 N  N   . ALA E  1 219 ? 27.583  84.746  132.066 1.00 28.80  ? 219  ALA E N   1 
ATOM   10470 C  CA  . ALA E  1 219 ? 28.995  84.979  132.360 1.00 27.62  ? 219  ALA E CA  1 
ATOM   10471 C  C   . ALA E  1 219 ? 29.848  84.169  131.404 1.00 26.73  ? 219  ALA E C   1 
ATOM   10472 O  O   . ALA E  1 219 ? 30.793  84.682  130.836 1.00 29.13  ? 219  ALA E O   1 
ATOM   10473 C  CB  . ALA E  1 219 ? 29.312  84.588  133.769 1.00 26.30  ? 219  ALA E CB  1 
ATOM   10474 N  N   . LYS E  1 220 ? 29.500  82.903  131.222 1.00 25