data_3EDH
# 
_entry.id   3EDH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3EDH         
RCSB  RCSB049185   
WWPDB D_1000049185 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3EDG BMP-1                          unspecified 
PDB 3EDI 'Human TLL-1 catalytic domain' unspecified 
PDB 1dle astacin                        unspecified 
# 
_pdbx_database_status.entry_id                        3EDH 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-09-03 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Mac Sweeney, A.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the substrate specificity of bone morphogenetic protein 1/tolloid-like metalloproteases' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mac Sweeney, A.' 1 
primary 'Parrado, S.G.'   2 
primary 'Vinzenz, D.'     3 
primary 'Bernardi, A.'    4 
primary 'Hein, A.'        5 
primary 'Bodendorf, U.'   6 
primary 'Erbel, P.'       7 
primary 'Logel, C.'       8 
primary 'Gerhartz, B.'    9 
# 
_cell.length_a           53.499 
_cell.length_b           59.093 
_cell.length_c           69.451 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3EDH 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3EDH 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Bone morphogenetic protein 1' 22970.068 1   3.4.24.19 ? 'protease domain' ? 
2 non-polymer syn 'ACETYL GROUP'                 44.053    1   ?         ? ?                 ? 
3 non-polymer syn 'ZINC ION'                     65.409    2   ?         ? ?                 ? 
4 non-polymer syn 'DIMETHYL SULFOXIDE'           78.133    5   ?         ? ?                 ? 
5 water       nat water                          18.015    410 ?         ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BMP-1, Procollagen C-proteinase, PCP, Mammalian tolloid protein, mTld' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAIS
IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRG
IFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAIS
IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRG
IFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   THR n 
1 4   SER n 
1 5   ARG n 
1 6   PRO n 
1 7   GLU n 
1 8   ARG n 
1 9   VAL n 
1 10  TRP n 
1 11  PRO n 
1 12  ASP n 
1 13  GLY n 
1 14  VAL n 
1 15  ILE n 
1 16  PRO n 
1 17  PHE n 
1 18  VAL n 
1 19  ILE n 
1 20  GLY n 
1 21  GLY n 
1 22  ASN n 
1 23  PHE n 
1 24  THR n 
1 25  GLY n 
1 26  SER n 
1 27  GLN n 
1 28  ARG n 
1 29  ALA n 
1 30  VAL n 
1 31  PHE n 
1 32  ARG n 
1 33  GLN n 
1 34  ALA n 
1 35  MET n 
1 36  ARG n 
1 37  HIS n 
1 38  TRP n 
1 39  GLU n 
1 40  LYS n 
1 41  HIS n 
1 42  THR n 
1 43  CYS n 
1 44  VAL n 
1 45  THR n 
1 46  PHE n 
1 47  LEU n 
1 48  GLU n 
1 49  ARG n 
1 50  THR n 
1 51  ASP n 
1 52  GLU n 
1 53  ASP n 
1 54  SER n 
1 55  TYR n 
1 56  ILE n 
1 57  VAL n 
1 58  PHE n 
1 59  THR n 
1 60  TYR n 
1 61  ARG n 
1 62  PRO n 
1 63  CYS n 
1 64  GLY n 
1 65  CYS n 
1 66  CYS n 
1 67  SER n 
1 68  TYR n 
1 69  VAL n 
1 70  GLY n 
1 71  ARG n 
1 72  ARG n 
1 73  GLY n 
1 74  GLY n 
1 75  GLY n 
1 76  PRO n 
1 77  GLN n 
1 78  ALA n 
1 79  ILE n 
1 80  SER n 
1 81  ILE n 
1 82  GLY n 
1 83  LYS n 
1 84  ASN n 
1 85  CYS n 
1 86  ASP n 
1 87  LYS n 
1 88  PHE n 
1 89  GLY n 
1 90  ILE n 
1 91  VAL n 
1 92  VAL n 
1 93  HIS n 
1 94  GLU n 
1 95  LEU n 
1 96  GLY n 
1 97  HIS n 
1 98  VAL n 
1 99  VAL n 
1 100 GLY n 
1 101 PHE n 
1 102 TRP n 
1 103 HIS n 
1 104 GLU n 
1 105 HIS n 
1 106 THR n 
1 107 ARG n 
1 108 PRO n 
1 109 ASP n 
1 110 ARG n 
1 111 ASP n 
1 112 ARG n 
1 113 HIS n 
1 114 VAL n 
1 115 SER n 
1 116 ILE n 
1 117 VAL n 
1 118 ARG n 
1 119 GLU n 
1 120 ASN n 
1 121 ILE n 
1 122 GLN n 
1 123 PRO n 
1 124 GLY n 
1 125 GLN n 
1 126 GLU n 
1 127 TYR n 
1 128 ASN n 
1 129 PHE n 
1 130 LEU n 
1 131 LYS n 
1 132 MET n 
1 133 GLU n 
1 134 PRO n 
1 135 GLN n 
1 136 GLU n 
1 137 VAL n 
1 138 GLU n 
1 139 SER n 
1 140 LEU n 
1 141 GLY n 
1 142 GLU n 
1 143 THR n 
1 144 TYR n 
1 145 ASP n 
1 146 PHE n 
1 147 ASP n 
1 148 SER n 
1 149 ILE n 
1 150 MET n 
1 151 HIS n 
1 152 TYR n 
1 153 ALA n 
1 154 ARG n 
1 155 ASN n 
1 156 THR n 
1 157 PHE n 
1 158 SER n 
1 159 ARG n 
1 160 GLY n 
1 161 ILE n 
1 162 PHE n 
1 163 LEU n 
1 164 ASP n 
1 165 THR n 
1 166 ILE n 
1 167 VAL n 
1 168 PRO n 
1 169 LYS n 
1 170 TYR n 
1 171 GLU n 
1 172 VAL n 
1 173 ASN n 
1 174 GLY n 
1 175 VAL n 
1 176 LYS n 
1 177 PRO n 
1 178 PRO n 
1 179 ILE n 
1 180 GLY n 
1 181 GLN n 
1 182 ARG n 
1 183 THR n 
1 184 ARG n 
1 185 LEU n 
1 186 SER n 
1 187 LYS n 
1 188 GLY n 
1 189 ASP n 
1 190 ILE n 
1 191 ALA n 
1 192 GLN n 
1 193 ALA n 
1 194 ARG n 
1 195 LYS n 
1 196 LEU n 
1 197 TYR n 
1 198 LYS n 
1 199 CYS n 
1 200 PRO n 
1 201 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BMP1, PCOLC' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET24a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BMP1_HUMAN 
_struct_ref.pdbx_db_accession          P13497 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAIS
IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRG
IFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPA
;
_struct_ref.pdbx_align_begin           121 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3EDH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 201 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P13497 
_struct_ref_seq.db_align_beg                  121 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  321 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       200 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'       ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
DMS non-polymer         . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S'      78.133  
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'           ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3EDH 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   48.53 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    '5% DMSO, pH 7.5, vapor diffusion, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-10-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_wavelength_list        0.9999 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
# 
_reflns.entry_id                     3EDH 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            1.25 
_reflns.d_resolution_low             59.09 
_reflns.number_all                   61581 
_reflns.number_obs                   60273 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            0.083 
_reflns.pdbx_Rsym_value              0.066 
_reflns.pdbx_netI_over_sigmaI        15.5 
_reflns.B_iso_Wilson_estimate        15.7 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.25 
_reflns_shell.d_res_low              1.29 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.394 
_reflns_shell.meanI_over_sigI_obs    3.66 
_reflns_shell.pdbx_Rsym_value        0.500 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        5.75 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5271 
_reflns_shell.percent_possible_all   96.1 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3EDH 
_refine.ls_d_res_high                            1.250 
_refine.ls_d_res_low                             44.990 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.880 
_refine.ls_number_reflns_obs                     60271 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.142 
_refine.ls_R_factor_R_work                       0.140 
_refine.ls_wR_factor_R_work                      0.146 
_refine.ls_R_factor_R_free                       0.172 
_refine.ls_wR_factor_R_free                      0.179 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  3014 
_refine.B_iso_mean                               15.070 
_refine.aniso_B[1][1]                            0.570 
_refine.aniso_B[2][2]                            -0.390 
_refine.aniso_B[3][3]                            -0.180 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.971 
_refine.correlation_coeff_Fo_to_Fc_free          0.961 
_refine.overall_SU_R_Cruickshank_DPI             0.044 
_refine.overall_SU_R_free                        0.044 
_refine.pdbx_overall_ESU_R                       0.043 
_refine.pdbx_overall_ESU_R_Free                  0.043 
_refine.overall_SU_ML                            0.022 
_refine.overall_SU_B                             1.108 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.overall_FOM_work_R_set                   0.923 
_refine.B_iso_max                                52.96 
_refine.B_iso_min                                3.42 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.30 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      3EDI 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1693 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             410 
_refine_hist.number_atoms_total               2132 
_refine_hist.d_res_high                       1.250 
_refine_hist.d_res_low                        44.990 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1774 0.013  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2414 1.578  1.946  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   224  6.418  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   90   28.530 21.889 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   288  13.396 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   21   15.808 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           257  0.106  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1387 0.009  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            972  0.309  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1243 0.316  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    307  0.212  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      4    0.124  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   45   0.313  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 28   0.183  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1068 1.627  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1723 2.380  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              781  3.038  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             677  4.119  4.500  ? 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       1849 1.740  3.000  ? 'X-RAY DIFFRACTION' ? 
r_sphericity_free        412  6.683  3.000  ? 'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      1720 4.360  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.250 
_refine_ls_shell.d_res_low                        1.282 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.900 
_refine_ls_shell.number_reflns_R_work             4071 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.168 
_refine_ls_shell.R_factor_R_free                  0.215 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             214 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                4285 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3EDH 
_struct.title                     
'Crystal structure of bone morphogenetic protein 1 protease domain in complex with partially bound DMSO' 
_struct.pdbx_descriptor           'Bone morphogenetic protein 1 (E.C.3.4.24.19)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3EDH 
_struct_keywords.text            
;vicinal disulfide, Alternative splicing, Calcium, Chondrogenesis, Cleavage on pair of basic residues, Cytokine, Developmental protein, Differentiation, EGF-like domain, Glycoprotein, Growth factor, Hydrolase, Metal-binding, Metalloprotease, Osteogenesis, Polymorphism, Protease, Zinc, Zymogen
;
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 5   ? VAL A 9   ? ARG A 5   VAL A 9   5 ? 5  
HELX_P HELX_P2  2  TRP A 10  ? ASP A 12  ? TRP A 10  ASP A 12  5 ? 3  
HELX_P HELX_P3  3  THR A 24  ? THR A 42  ? THR A 23  THR A 41  1 ? 19 
HELX_P HELX_P4  4  GLY A 82  ? ASP A 86  ? GLY A 81  ASP A 85  5 ? 5  
HELX_P HELX_P5  5  LYS A 87  ? GLY A 100 ? LYS A 86  GLY A 99  1 ? 14 
HELX_P HELX_P6  6  HIS A 103 ? ARG A 107 ? HIS A 102 ARG A 106 5 ? 5  
HELX_P HELX_P7  7  ASP A 109 ? ARG A 112 ? ASP A 108 ARG A 111 5 ? 4  
HELX_P HELX_P8  8  ARG A 118 ? ILE A 121 ? ARG A 117 ILE A 120 5 ? 4  
HELX_P HELX_P9  9  GLN A 125 ? LEU A 130 ? GLN A 124 LEU A 129 5 ? 6  
HELX_P HELX_P10 10 GLU A 133 ? VAL A 137 ? GLU A 132 VAL A 134 5 ? 5  
HELX_P HELX_P11 11 SER A 186 ? TYR A 197 ? SER A 183 TYR A 194 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 43  SG  ? ? ? 1_555 A CYS 199 SG ? ? A CYS 42  A CYS 198 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf2  disulf ? ? A CYS 63  SG  ? ? ? 1_555 A CYS 85  SG ? ? A CYS 62  A CYS 84  1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf3  disulf ? ? A CYS 65  SG  ? ? ? 1_555 A CYS 66  SG ? ? A CYS 64  A CYS 65  1_555 ? ? ? ? ? ? ? 2.023 ? 
covale1  covale ? ? A ALA 1   N   ? ? ? 1_555 B ACE .   C  ? ? A ALA 1   A ACE 201 1_555 ? ? ? ? ? ? ? 1.389 ? 
metalc1  metalc ? ? A HIS 93  NE2 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 92  A ZN  210 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc2  metalc ? ? A HIS 97  NE2 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 96  A ZN  210 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc3  metalc ? ? A HIS 103 NE2 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 102 A ZN  210 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc4  metalc ? ? A GLN 192 NE2 ? ? ? 1_555 D ZN  .   ZN ? ? A GLN 189 A ZN  211 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc5  metalc ? ? B ACE .   O   ? ? ? 1_555 D ZN  .   ZN ? ? A ACE 201 A ZN  211 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc6  metalc ? ? C ZN  .   ZN  ? ? ? 1_555 G DMS .   O  A ? A ZN  210 A DMS 214 1_555 ? ? ? ? ? ? ? 1.863 ? 
metalc7  metalc ? ? C ZN  .   ZN  ? ? ? 1_555 G DMS .   O  B ? A ZN  210 A DMS 214 1_555 ? ? ? ? ? ? ? 1.830 ? 
metalc8  metalc ? ? C ZN  .   ZN  ? ? ? 1_555 G DMS .   S  A ? A ZN  210 A DMS 214 1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc9  metalc ? ? D ZN  .   ZN  ? ? ? 1_555 J HOH .   O  ? ? A ZN  211 A HOH 228 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc10 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 J HOH .   O  ? ? A ZN  211 A HOH 224 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc11 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 J HOH .   O  ? ? A ZN  211 A HOH 221 1_555 ? ? ? ? ? ? ? 2.386 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          CYS 
_struct_mon_prot_cis.label_seq_id           65 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           CYS 
_struct_mon_prot_cis.auth_seq_id            64 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   CYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    66 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    CYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     65 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       15.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 45  ? GLU A 48  ? THR A 44  GLU A 47  
A 2 VAL A 14  ? ILE A 19  ? VAL A 14  ILE A 19  
A 3 TYR A 55  ? TYR A 60  ? TYR A 54  TYR A 59  
A 4 PRO A 76  ? ILE A 81  ? PRO A 74  ILE A 79  
B 1 VAL A 114 ? ILE A 116 ? VAL A 113 ILE A 115 
B 2 ILE A 166 ? PRO A 168 ? ILE A 164 PRO A 166 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 45  ? O THR A 44  N ILE A 15  ? N ILE A 15  
A 2 3 N PRO A 16  ? N PRO A 16  O ILE A 56  ? O ILE A 55  
A 3 4 N THR A 59  ? N THR A 58  O ILE A 79  ? O ILE A 77  
B 1 2 N SER A 115 ? N SER A 114 O VAL A 167 ? O VAL A 165 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACE A 201' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ZN A 210'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 211'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE DMS A 212' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE DMS A 213' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE DMS A 214' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE DMS A 215' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE DMS A 216' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ALA A 1   ? ALA A 1   . ? 1_555 ? 
2  AC1 6  ALA A 2   ? ALA A 2   . ? 1_555 ? 
3  AC1 6  GLU A 104 ? GLU A 103 . ? 1_555 ? 
4  AC1 6  ARG A 107 ? ARG A 106 . ? 1_555 ? 
5  AC1 6  SER A 139 ? SER A 136 . ? 1_555 ? 
6  AC1 6  GLN A 192 ? GLN A 189 . ? 1_555 ? 
7  AC2 3  HIS A 93  ? HIS A 92  . ? 1_555 ? 
8  AC2 3  HIS A 97  ? HIS A 96  . ? 1_555 ? 
9  AC2 3  HIS A 103 ? HIS A 102 . ? 1_555 ? 
10 AC3 5  GLU A 104 ? GLU A 103 . ? 1_555 ? 
11 AC3 5  GLN A 192 ? GLN A 189 . ? 1_555 ? 
12 AC3 5  HOH J .   ? HOH A 221 . ? 1_555 ? 
13 AC3 5  HOH J .   ? HOH A 224 . ? 1_555 ? 
14 AC3 5  HOH J .   ? HOH A 228 . ? 1_555 ? 
15 AC4 7  LYS A 40  ? LYS A 39  . ? 1_555 ? 
16 AC4 7  HIS A 41  ? HIS A 40  . ? 1_555 ? 
17 AC4 7  ARG A 107 ? ARG A 106 . ? 4_455 ? 
18 AC4 7  ASP A 109 ? ASP A 108 . ? 4_455 ? 
19 AC4 7  GLU A 142 ? GLU A 139 . ? 4_455 ? 
20 AC4 7  HOH J .   ? HOH A 290 . ? 4_455 ? 
21 AC4 7  HOH J .   ? HOH A 581 . ? 4_455 ? 
22 AC5 5  ARG A 36  ? ARG A 35  . ? 1_555 ? 
23 AC5 5  LYS A 40  ? LYS A 39  . ? 1_555 ? 
24 AC5 5  LYS A 195 ? LYS A 192 . ? 4_455 ? 
25 AC5 5  HOH J .   ? HOH A 462 . ? 4_455 ? 
26 AC5 5  HOH J .   ? HOH A 594 . ? 1_555 ? 
27 AC6 10 CYS A 65  ? CYS A 64  . ? 1_555 ? 
28 AC6 10 HIS A 93  ? HIS A 92  . ? 1_555 ? 
29 AC6 10 GLU A 94  ? GLU A 93  . ? 1_555 ? 
30 AC6 10 HIS A 97  ? HIS A 96  . ? 1_555 ? 
31 AC6 10 HIS A 103 ? HIS A 102 . ? 1_555 ? 
32 AC6 10 HOH J .   ? HOH A 297 . ? 1_555 ? 
33 AC6 10 HOH J .   ? HOH A 306 . ? 1_555 ? 
34 AC6 10 HOH J .   ? HOH A 314 . ? 1_555 ? 
35 AC6 10 HOH J .   ? HOH A 604 . ? 1_555 ? 
36 AC6 10 HOH J .   ? HOH A 609 . ? 1_555 ? 
37 AC7 4  ASP A 51  ? ASP A 50  . ? 2_455 ? 
38 AC7 4  ARG A 182 ? ARG A 176 . ? 1_555 ? 
39 AC7 4  THR A 183 ? THR A 180 . ? 1_555 ? 
40 AC7 4  HOH J .   ? HOH A 536 . ? 1_555 ? 
41 AC8 4  ARG A 32  ? ARG A 31  . ? 1_555 ? 
42 AC8 4  GLU A 39  ? GLU A 38  . ? 1_555 ? 
43 AC8 4  PHE A 46  ? PHE A 45  . ? 1_555 ? 
44 AC8 4  HOH J .   ? HOH A 546 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3EDH 
_atom_sites.fract_transf_matrix[1][1]   0.018692 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016922 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014399 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? 7.517   5.243   -1.793  1.00 6.46  ? 1   ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? 7.887   4.221   -2.758  1.00 6.93  ? 1   ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? 6.899   4.156   -3.944  1.00 6.49  ? 1   ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? 6.295   3.121   -4.246  1.00 7.33  ? 1   ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? 8.035   2.863   -2.057  1.00 7.49  ? 1   ALA A CB  1 
ATOM   6    N  N   . ALA A 1 2   ? 6.755   5.300   -4.624  1.00 7.27  ? 2   ALA A N   1 
ATOM   7    C  CA  . ALA A 1 2   ? 5.874   5.387   -5.798  1.00 6.45  ? 2   ALA A CA  1 
ATOM   8    C  C   . ALA A 1 2   ? 6.509   4.690   -6.988  1.00 7.01  ? 2   ALA A C   1 
ATOM   9    O  O   . ALA A 1 2   ? 7.672   4.922   -7.318  1.00 7.65  ? 2   ALA A O   1 
ATOM   10   C  CB  . ALA A 1 2   ? 5.613   6.875   -6.153  1.00 8.74  ? 2   ALA A CB  1 
ATOM   11   N  N   . THR A 1 3   ? 5.739   3.846   -7.670  1.00 6.87  ? 3   THR A N   1 
ATOM   12   C  CA  . THR A 1 3   ? 6.259   3.194   -8.870  1.00 6.92  ? 3   THR A CA  1 
ATOM   13   C  C   . THR A 1 3   ? 6.775   4.219   -9.883  1.00 7.90  ? 3   THR A C   1 
ATOM   14   O  O   . THR A 1 3   ? 6.146   5.240   -10.158 1.00 8.18  ? 3   THR A O   1 
ATOM   15   C  CB  . THR A 1 3   ? 5.180   2.308   -9.547  1.00 7.46  ? 3   THR A CB  1 
ATOM   16   O  OG1 . THR A 1 3   ? 5.777   1.656   -10.677 1.00 8.34  ? 3   THR A OG1 1 
ATOM   17   C  CG2 . THR A 1 3   ? 3.954   3.090   -10.010 1.00 9.28  ? 3   THR A CG2 1 
ATOM   18   N  N   . SER A 1 4   ? 7.919   3.909   -10.495 1.00 8.54  ? 4   SER A N   1 
ATOM   19   C  CA  . SER A 1 4   ? 8.470   4.680   -11.595 1.00 8.79  ? 4   SER A CA  1 
ATOM   20   C  C   . SER A 1 4   ? 7.905   4.258   -12.943 1.00 9.04  ? 4   SER A C   1 
ATOM   21   O  O   . SER A 1 4   ? 8.289   4.864   -13.955 1.00 9.97  ? 4   SER A O   1 
ATOM   22   C  CB  . SER A 1 4   ? 9.986   4.421   -11.671 1.00 9.34  ? 4   SER A CB  1 
ATOM   23   O  OG  . SER A 1 4   ? 10.131  3.059   -11.979 1.00 10.37 ? 4   SER A OG  1 
ATOM   24   N  N   . ARG A 1 5   ? 7.091   3.208   -13.002 1.00 8.83  ? 5   ARG A N   1 
ATOM   25   C  CA  . ARG A 1 5   ? 6.744   2.558   -14.259 1.00 9.72  ? 5   ARG A CA  1 
ATOM   26   C  C   . ARG A 1 5   ? 5.449   3.174   -14.770 1.00 9.15  ? 5   ARG A C   1 
ATOM   27   O  O   . ARG A 1 5   ? 4.407   3.008   -14.147 1.00 10.14 ? 5   ARG A O   1 
ATOM   28   C  CB  . ARG A 1 5   ? 6.626   1.056   -14.024 1.00 10.76 ? 5   ARG A CB  1 
ATOM   29   C  CG  . ARG A 1 5   ? 7.905   0.377   -13.476 1.00 11.96 ? 5   ARG A CG  1 
ATOM   30   C  CD  . ARG A 1 5   ? 9.189   0.602   -14.378 1.00 13.79 ? 5   ARG A CD  1 
ATOM   31   N  NE  . ARG A 1 5   ? 10.317  -0.240  -13.962 1.00 15.12 ? 5   ARG A NE  1 
ATOM   32   C  CZ  . ARG A 1 5   ? 11.499  -0.330  -14.581 1.00 15.79 ? 5   ARG A CZ  1 
ATOM   33   N  NH1 . ARG A 1 5   ? 11.807  0.411   -15.636 1.00 15.84 ? 5   ARG A NH1 1 
ATOM   34   N  NH2 . ARG A 1 5   ? 12.419  -1.168  -14.120 1.00 16.82 ? 5   ARG A NH2 1 
ATOM   35   N  N   . PRO A 1 6   ? 5.502   3.917   -15.895 1.00 9.80  ? 6   PRO A N   1 
ATOM   36   C  CA  A PRO A 1 6   ? 4.284   4.635   -16.305 0.50 10.55 ? 6   PRO A CA  1 
ATOM   37   C  CA  B PRO A 1 6   ? 4.279   4.642   -16.286 0.50 10.97 ? 6   PRO A CA  1 
ATOM   38   C  C   . PRO A 1 6   ? 3.107   3.724   -16.597 1.00 11.00 ? 6   PRO A C   1 
ATOM   39   O  O   . PRO A 1 6   ? 1.951   4.137   -16.404 1.00 12.59 ? 6   PRO A O   1 
ATOM   40   C  CB  A PRO A 1 6   ? 4.736   5.383   -17.573 0.50 10.93 ? 6   PRO A CB  1 
ATOM   41   C  CB  B PRO A 1 6   ? 4.709   5.407   -17.553 0.50 11.60 ? 6   PRO A CB  1 
ATOM   42   C  CG  A PRO A 1 6   ? 6.226   5.569   -17.366 0.50 9.07  ? 6   PRO A CG  1 
ATOM   43   C  CG  B PRO A 1 6   ? 5.883   4.655   -18.076 0.50 12.25 ? 6   PRO A CG  1 
ATOM   44   C  CD  A PRO A 1 6   ? 6.657   4.264   -16.749 0.50 9.79  ? 6   PRO A CD  1 
ATOM   45   C  CD  B PRO A 1 6   ? 6.600   4.110   -16.865 0.50 10.47 ? 6   PRO A CD  1 
ATOM   46   N  N   . GLU A 1 7   ? 3.379   2.497   -17.046 1.00 11.54 ? 7   GLU A N   1 
ATOM   47   C  CA  . GLU A 1 7   ? 2.291   1.602   -17.387 1.00 13.09 ? 7   GLU A CA  1 
ATOM   48   C  C   . GLU A 1 7   ? 1.515   1.166   -16.141 1.00 12.48 ? 7   GLU A C   1 
ATOM   49   O  O   . GLU A 1 7   ? 0.374   0.673   -16.266 1.00 13.85 ? 7   GLU A O   1 
ATOM   50   C  CB  . GLU A 1 7   ? 2.767   0.372   -18.186 1.00 15.46 ? 7   GLU A CB  1 
ATOM   51   C  CG  . GLU A 1 7   ? 3.591   -0.624  -17.411 1.00 15.90 ? 7   GLU A CG  1 
ATOM   52   C  CD  . GLU A 1 7   ? 5.067   -0.265  -17.213 1.00 16.17 ? 7   GLU A CD  1 
ATOM   53   O  OE1 . GLU A 1 7   ? 5.493   0.899   -17.422 1.00 16.80 ? 7   GLU A OE1 1 
ATOM   54   O  OE2 . GLU A 1 7   ? 5.803   -1.173  -16.780 1.00 19.08 ? 7   GLU A OE2 1 
ATOM   55   N  N   . ARG A 1 8   ? 2.115   1.289   -14.952 1.00 11.59 ? 8   ARG A N   1 
ATOM   56   C  CA  . ARG A 1 8   ? 1.430   0.919   -13.700 1.00 11.15 ? 8   ARG A CA  1 
ATOM   57   C  C   . ARG A 1 8   ? 0.518   2.002   -13.166 1.00 10.53 ? 8   ARG A C   1 
ATOM   58   O  O   . ARG A 1 8   ? -0.238  1.736   -12.221 1.00 11.02 ? 8   ARG A O   1 
ATOM   59   C  CB  . ARG A 1 8   ? 2.452   0.507   -12.636 1.00 10.43 ? 8   ARG A CB  1 
ATOM   60   C  CG  . ARG A 1 8   ? 3.154   -0.816  -12.923 1.00 12.49 ? 8   ARG A CG  1 
ATOM   61   C  CD  . ARG A 1 8   ? 3.992   -1.188  -11.732 1.00 13.82 ? 8   ARG A CD  1 
ATOM   62   N  NE  . ARG A 1 8   ? 4.772   -2.422  -11.922 1.00 15.21 ? 8   ARG A NE  1 
ATOM   63   C  CZ  . ARG A 1 8   ? 4.784   -3.494  -11.127 1.00 13.47 ? 8   ARG A CZ  1 
ATOM   64   N  NH1 . ARG A 1 8   ? 4.026   -3.567  -10.043 1.00 12.50 ? 8   ARG A NH1 1 
ATOM   65   N  NH2 . ARG A 1 8   ? 5.607   -4.502  -11.415 1.00 16.98 ? 8   ARG A NH2 1 
ATOM   66   N  N   . VAL A 1 9   ? 0.541   3.196   -13.766 1.00 11.11 ? 9   VAL A N   1 
ATOM   67   C  CA  . VAL A 1 9   ? -0.348  4.285   -13.330 1.00 12.19 ? 9   VAL A CA  1 
ATOM   68   C  C   . VAL A 1 9   ? -1.687  4.121   -14.043 1.00 11.49 ? 9   VAL A C   1 
ATOM   69   O  O   . VAL A 1 9   ? -1.734  4.080   -15.287 1.00 14.30 ? 9   VAL A O   1 
ATOM   70   C  CB  . VAL A 1 9   ? 0.282   5.680   -13.629 1.00 13.48 ? 9   VAL A CB  1 
ATOM   71   C  CG1 . VAL A 1 9   ? -0.643  6.802   -13.197 1.00 15.17 ? 9   VAL A CG1 1 
ATOM   72   C  CG2 . VAL A 1 9   ? 1.638   5.774   -12.920 1.00 15.94 ? 9   VAL A CG2 1 
ATOM   73   N  N   . TRP A 1 10  ? -2.790  3.998   -13.304 1.00 10.24 ? 10  TRP A N   1 
ATOM   74   C  CA  . TRP A 1 10  ? -4.100  3.784   -13.925 1.00 9.73  ? 10  TRP A CA  1 
ATOM   75   C  C   . TRP A 1 10  ? -4.449  5.008   -14.821 1.00 10.63 ? 10  TRP A C   1 
ATOM   76   O  O   . TRP A 1 10  ? -4.442  6.145   -14.349 1.00 11.31 ? 10  TRP A O   1 
ATOM   77   C  CB  . TRP A 1 10  ? -5.173  3.621   -12.851 1.00 9.59  ? 10  TRP A CB  1 
ATOM   78   C  CG  . TRP A 1 10  ? -5.016  2.330   -12.082 1.00 8.30  ? 10  TRP A CG  1 
ATOM   79   C  CD1 . TRP A 1 10  ? -4.206  2.124   -10.988 1.00 8.13  ? 10  TRP A CD1 1 
ATOM   80   C  CD2 . TRP A 1 10  ? -5.684  1.084   -12.339 1.00 8.80  ? 10  TRP A CD2 1 
ATOM   81   N  NE1 . TRP A 1 10  ? -4.332  0.828   -10.556 1.00 7.47  ? 10  TRP A NE1 1 
ATOM   82   C  CE2 . TRP A 1 10  ? -5.211  0.162   -11.374 1.00 8.41  ? 10  TRP A CE2 1 
ATOM   83   C  CE3 . TRP A 1 10  ? -6.621  0.648   -13.299 1.00 9.19  ? 10  TRP A CE3 1 
ATOM   84   C  CZ2 . TRP A 1 10  ? -5.655  -1.163  -11.323 1.00 9.06  ? 10  TRP A CZ2 1 
ATOM   85   C  CZ3 . TRP A 1 10  ? -7.058  -0.650  -13.261 1.00 10.02 ? 10  TRP A CZ3 1 
ATOM   86   C  CH2 . TRP A 1 10  ? -6.607  -1.538  -12.274 1.00 9.47  ? 10  TRP A CH2 1 
ATOM   87   N  N   A PRO A 1 11  ? -4.863  4.758   -16.088 0.60 12.14 ? 11  PRO A N   1 
ATOM   88   N  N   B PRO A 1 11  ? -4.634  4.792   -16.138 0.40 11.20 ? 11  PRO A N   1 
ATOM   89   C  CA  A PRO A 1 11  ? -5.216  5.851   -17.033 0.60 12.74 ? 11  PRO A CA  1 
ATOM   90   C  CA  B PRO A 1 11  ? -4.958  5.950   -16.997 0.40 11.56 ? 11  PRO A CA  1 
ATOM   91   C  C   A PRO A 1 11  ? -6.237  6.814   -16.456 0.60 12.75 ? 11  PRO A C   1 
ATOM   92   C  C   B PRO A 1 11  ? -6.133  6.793   -16.504 0.40 12.24 ? 11  PRO A C   1 
ATOM   93   O  O   A PRO A 1 11  ? -7.293  6.388   -15.990 0.60 13.27 ? 11  PRO A O   1 
ATOM   94   O  O   B PRO A 1 11  ? -7.184  6.261   -16.163 0.40 12.56 ? 11  PRO A O   1 
ATOM   95   C  CB  A PRO A 1 11  ? -5.814  5.101   -18.236 0.60 13.22 ? 11  PRO A CB  1 
ATOM   96   C  CB  B PRO A 1 11  ? -5.272  5.301   -18.348 0.40 11.96 ? 11  PRO A CB  1 
ATOM   97   C  CG  A PRO A 1 11  ? -5.148  3.785   -18.206 0.60 15.07 ? 11  PRO A CG  1 
ATOM   98   C  CG  B PRO A 1 11  ? -4.456  4.073   -18.357 0.40 10.61 ? 11  PRO A CG  1 
ATOM   99   C  CD  A PRO A 1 11  ? -4.956  3.437   -16.733 0.60 12.88 ? 11  PRO A CD  1 
ATOM   100  C  CD  B PRO A 1 11  ? -4.463  3.557   -16.931 0.40 10.62 ? 11  PRO A CD  1 
ATOM   101  N  N   . ASP A 1 12  ? -5.908  8.104   -16.470 1.00 13.36 ? 12  ASP A N   1 
ATOM   102  C  CA  . ASP A 1 12  ? -6.829  9.114   -16.008 1.00 14.56 ? 12  ASP A CA  1 
ATOM   103  C  C   . ASP A 1 12  ? -7.188  8.968   -14.540 1.00 13.24 ? 12  ASP A C   1 
ATOM   104  O  O   . ASP A 1 12  ? -8.129  9.610   -14.088 1.00 13.65 ? 12  ASP A O   1 
ATOM   105  C  CB  . ASP A 1 12  ? -8.115  9.173   -16.878 1.00 16.98 ? 12  ASP A CB  1 
ATOM   106  C  CG  . ASP A 1 12  ? -7.830  9.431   -18.337 1.00 22.39 ? 12  ASP A CG  1 
ATOM   107  O  OD1 . ASP A 1 12  ? -6.997  10.315  -18.612 1.00 27.33 ? 12  ASP A OD1 1 
ATOM   108  O  OD2 . ASP A 1 12  ? -8.432  8.749   -19.191 1.00 28.08 ? 12  ASP A OD2 1 
ATOM   109  N  N   . GLY A 1 13  ? -6.444  8.127   -13.809 1.00 12.20 ? 13  GLY A N   1 
ATOM   110  C  CA  . GLY A 1 13  ? -6.759  7.871   -12.401 1.00 11.07 ? 13  GLY A CA  1 
ATOM   111  C  C   . GLY A 1 13  ? -7.991  7.024   -12.178 1.00 9.64  ? 13  GLY A C   1 
ATOM   112  O  O   . GLY A 1 13  ? -8.453  6.900   -11.050 1.00 10.50 ? 13  GLY A O   1 
ATOM   113  N  N   . VAL A 1 14  ? -8.529  6.445   -13.252 1.00 10.47 ? 14  VAL A N   1 
ATOM   114  C  CA  . VAL A 1 14  ? -9.766  5.665   -13.147 1.00 10.83 ? 14  VAL A CA  1 
ATOM   115  C  C   . VAL A 1 14  ? -9.484  4.198   -12.844 1.00 9.97  ? 14  VAL A C   1 
ATOM   116  O  O   . VAL A 1 14  ? -8.760  3.529   -13.590 1.00 11.18 ? 14  VAL A O   1 
ATOM   117  C  CB  . VAL A 1 14  ? -10.597 5.779   -14.448 1.00 11.80 ? 14  VAL A CB  1 
ATOM   118  C  CG1 . VAL A 1 14  ? -11.851 4.902   -14.337 1.00 15.45 ? 14  VAL A CG1 1 
ATOM   119  C  CG2 . VAL A 1 14  ? -10.999 7.253   -14.677 1.00 13.56 ? 14  VAL A CG2 1 
ATOM   120  N  N   . ILE A 1 15  ? -10.041 3.726   -11.718 1.00 9.97  ? 15  ILE A N   1 
ATOM   121  C  CA  . ILE A 1 15  ? -9.789  2.341   -11.273 1.00 9.22  ? 15  ILE A CA  1 
ATOM   122  C  C   . ILE A 1 15  ? -11.126 1.614   -11.197 1.00 8.78  ? 15  ILE A C   1 
ATOM   123  O  O   . ILE A 1 15  ? -11.901 1.789   -10.240 1.00 9.74  ? 15  ILE A O   1 
ATOM   124  C  CB  . ILE A 1 15  ? -9.074  2.337   -9.907  1.00 9.05  ? 15  ILE A CB  1 
ATOM   125  C  CG1 . ILE A 1 15  ? -7.813  3.228   -9.974  1.00 10.11 ? 15  ILE A CG1 1 
ATOM   126  C  CG2 . ILE A 1 15  ? -8.770  0.887   -9.528  1.00 9.11  ? 15  ILE A CG2 1 
ATOM   127  C  CD1 . ILE A 1 15  ? -7.035  3.326   -8.668  1.00 12.32 ? 15  ILE A CD1 1 
ATOM   128  N  N   . PRO A 1 16  ? -11.426 0.791   -12.210 1.00 8.95  ? 16  PRO A N   1 
ATOM   129  C  CA  . PRO A 1 16  ? -12.668 0.015   -12.126 1.00 9.48  ? 16  PRO A CA  1 
ATOM   130  C  C   . PRO A 1 16  ? -12.529 -1.079  -11.074 1.00 8.34  ? 16  PRO A C   1 
ATOM   131  O  O   . PRO A 1 16  ? -11.439 -1.617  -10.855 1.00 8.42  ? 16  PRO A O   1 
ATOM   132  C  CB  . PRO A 1 16  ? -12.805 -0.600  -13.529 1.00 10.71 ? 16  PRO A CB  1 
ATOM   133  C  CG  . PRO A 1 16  ? -11.827 0.167   -14.383 1.00 11.88 ? 16  PRO A CG  1 
ATOM   134  C  CD  . PRO A 1 16  ? -10.689 0.556   -13.463 1.00 10.82 ? 16  PRO A CD  1 
ATOM   135  N  N   . PHE A 1 17  ? -13.648 -1.434  -10.454 1.00 9.36  ? 17  PHE A N   1 
ATOM   136  C  CA  . PHE A 1 17  ? -13.623 -2.419  -9.353  1.00 9.38  ? 17  PHE A CA  1 
ATOM   137  C  C   . PHE A 1 17  ? -14.837 -3.334  -9.380  1.00 8.93  ? 17  PHE A C   1 
ATOM   138  O  O   . PHE A 1 17  ? -15.940 -2.966  -9.856  1.00 9.95  ? 17  PHE A O   1 
ATOM   139  C  CB  . PHE A 1 17  ? -13.527 -1.709  -7.975  1.00 9.67  ? 17  PHE A CB  1 
ATOM   140  C  CG  . PHE A 1 17  ? -14.808 -1.043  -7.552  1.00 9.47  ? 17  PHE A CG  1 
ATOM   141  C  CD1 . PHE A 1 17  ? -15.052 0.298   -7.879  1.00 10.01 ? 17  PHE A CD1 1 
ATOM   142  C  CD2 . PHE A 1 17  ? -15.770 -1.749  -6.818  1.00 9.79  ? 17  PHE A CD2 1 
ATOM   143  C  CE1 . PHE A 1 17  ? -16.236 0.919   -7.507  1.00 10.97 ? 17  PHE A CE1 1 
ATOM   144  C  CE2 . PHE A 1 17  ? -16.958 -1.121  -6.440  1.00 10.54 ? 17  PHE A CE2 1 
ATOM   145  C  CZ  . PHE A 1 17  ? -17.180 0.232   -6.785  1.00 11.43 ? 17  PHE A CZ  1 
ATOM   146  N  N   . VAL A 1 18  ? -14.641 -4.512  -8.799  1.00 8.58  ? 18  VAL A N   1 
ATOM   147  C  CA  . VAL A 1 18  ? -15.690 -5.471  -8.504  1.00 9.43  ? 18  VAL A CA  1 
ATOM   148  C  C   . VAL A 1 18  ? -15.553 -5.833  -7.026  1.00 8.68  ? 18  VAL A C   1 
ATOM   149  O  O   . VAL A 1 18  ? -14.440 -6.032  -6.537  1.00 8.66  ? 18  VAL A O   1 
ATOM   150  C  CB  . VAL A 1 18  ? -15.505 -6.742  -9.358  1.00 9.85  ? 18  VAL A CB  1 
ATOM   151  C  CG1 . VAL A 1 18  ? -16.450 -7.876  -8.901  1.00 11.98 ? 18  VAL A CG1 1 
ATOM   152  C  CG2 . VAL A 1 18  ? -15.814 -6.398  -10.818 1.00 11.90 ? 18  VAL A CG2 1 
ATOM   153  N  N   . ILE A 1 19  ? -16.676 -5.914  -6.312  1.00 9.00  ? 19  ILE A N   1 
ATOM   154  C  CA  . ILE A 1 19  ? -16.672 -6.460  -4.963  1.00 9.80  ? 19  ILE A CA  1 
ATOM   155  C  C   . ILE A 1 19  ? -17.128 -7.910  -5.082  1.00 9.60  ? 19  ILE A C   1 
ATOM   156  O  O   . ILE A 1 19  ? -18.214 -8.198  -5.603  1.00 10.18 ? 19  ILE A O   1 
ATOM   157  C  CB  . ILE A 1 19  ? -17.592 -5.691  -3.997  1.00 10.32 ? 19  ILE A CB  1 
ATOM   158  C  CG1 . ILE A 1 19  ? -17.074 -4.240  -3.869  1.00 11.54 ? 19  ILE A CG1 1 
ATOM   159  C  CG2 . ILE A 1 19  ? -17.614 -6.393  -2.654  1.00 11.43 ? 19  ILE A CG2 1 
ATOM   160  C  CD1 . ILE A 1 19  ? -17.990 -3.303  -3.100  1.00 13.87 ? 19  ILE A CD1 1 
ATOM   161  N  N   . GLY A 1 20  ? -16.284 -8.842  -4.645  1.00 9.33  ? 20  GLY A N   1 
ATOM   162  C  CA  . GLY A 1 20  ? -16.582 -10.265 -4.749  1.00 9.25  ? 20  GLY A CA  1 
ATOM   163  C  C   . GLY A 1 20  ? -17.657 -10.700 -3.775  1.00 8.84  ? 20  GLY A C   1 
ATOM   164  O  O   . GLY A 1 20  ? -18.210 -9.904  -2.990  1.00 9.43  ? 20  GLY A O   1 
ATOM   165  N  N   . GLY A 1 21  ? -17.944 -12.002 -3.818  1.00 8.94  ? 21  GLY A N   1 
ATOM   166  C  CA  . GLY A 1 21  ? -18.899 -12.564 -2.909  1.00 9.43  ? 21  GLY A CA  1 
ATOM   167  C  C   . GLY A 1 21  ? -18.324 -12.843 -1.530  1.00 8.74  ? 21  GLY A C   1 
ATOM   168  O  O   . GLY A 1 21  ? -17.139 -12.679 -1.255  1.00 9.60  ? 21  GLY A O   1 
ATOM   169  N  N   . ASN A 1 22  A -19.227 -13.254 -0.637  1.00 9.29  ? 21  ASN A N   1 
ATOM   170  C  CA  . ASN A 1 22  A -18.896 -13.733 0.677   1.00 10.50 ? 21  ASN A CA  1 
ATOM   171  C  C   . ASN A 1 22  A -18.584 -12.677 1.716   1.00 9.94  ? 21  ASN A C   1 
ATOM   172  O  O   . ASN A 1 22  A -18.049 -13.015 2.777   1.00 11.44 ? 21  ASN A O   1 
ATOM   173  C  CB  . ASN A 1 22  A -17.771 -14.778 0.644   1.00 10.67 ? 21  ASN A CB  1 
ATOM   174  C  CG  . ASN A 1 22  A -17.961 -15.880 1.694   1.00 12.27 ? 21  ASN A CG  1 
ATOM   175  O  OD1 . ASN A 1 22  A -19.088 -16.275 1.987   1.00 14.62 ? 21  ASN A OD1 1 
ATOM   176  N  ND2 . ASN A 1 22  A -16.857 -16.428 2.196   1.00 13.23 ? 21  ASN A ND2 1 
ATOM   177  N  N   . PHE A 1 23  ? -18.907 -11.417 1.410   1.00 9.42  ? 22  PHE A N   1 
ATOM   178  C  CA  . PHE A 1 23  ? -18.693 -10.356 2.392   1.00 10.71 ? 22  PHE A CA  1 
ATOM   179  C  C   . PHE A 1 23  ? -20.006 -9.965  3.021   1.00 11.54 ? 22  PHE A C   1 
ATOM   180  O  O   . PHE A 1 23  ? -21.059 -10.121 2.422   1.00 13.25 ? 22  PHE A O   1 
ATOM   181  C  CB  . PHE A 1 23  ? -18.043 -9.144  1.724   1.00 10.07 ? 22  PHE A CB  1 
ATOM   182  C  CG  . PHE A 1 23  ? -16.647 -9.419  1.249   1.00 9.14  ? 22  PHE A CG  1 
ATOM   183  C  CD1 . PHE A 1 23  ? -16.343 -9.395  -0.126  1.00 9.82  ? 22  PHE A CD1 1 
ATOM   184  C  CD2 . PHE A 1 23  ? -15.627 -9.681  2.175   1.00 10.26 ? 22  PHE A CD2 1 
ATOM   185  C  CE1 . PHE A 1 23  ? -15.033 -9.609  -0.559  1.00 9.69  ? 22  PHE A CE1 1 
ATOM   186  C  CE2 . PHE A 1 23  ? -14.303 -9.910  1.739   1.00 10.61 ? 22  PHE A CE2 1 
ATOM   187  C  CZ  . PHE A 1 23  ? -14.021 -9.880  0.357   1.00 10.65 ? 22  PHE A CZ  1 
ATOM   188  N  N   . THR A 1 24  ? -19.937 -9.394  4.209   1.00 12.66 ? 23  THR A N   1 
ATOM   189  C  CA  . THR A 1 24  ? -21.150 -8.883  4.833   1.00 12.79 ? 23  THR A CA  1 
ATOM   190  C  C   . THR A 1 24  ? -21.416 -7.475  4.280   1.00 12.77 ? 23  THR A C   1 
ATOM   191  O  O   . THR A 1 24  ? -20.535 -6.808  3.718   1.00 12.32 ? 23  THR A O   1 
ATOM   192  C  CB  . THR A 1 24  ? -20.955 -8.774  6.368   1.00 14.54 ? 23  THR A CB  1 
ATOM   193  O  OG1 . THR A 1 24  ? -19.920 -7.828  6.631   1.00 15.29 ? 23  THR A OG1 1 
ATOM   194  C  CG2 . THR A 1 24  ? -20.577 -10.124 7.016   1.00 15.96 ? 23  THR A CG2 1 
ATOM   195  N  N   . GLY A 1 25  ? -22.623 -6.982  4.494   1.00 14.15 ? 24  GLY A N   1 
ATOM   196  C  CA  . GLY A 1 25  ? -22.948 -5.623  4.069   1.00 14.19 ? 24  GLY A CA  1 
ATOM   197  C  C   . GLY A 1 25  ? -22.038 -4.584  4.722   1.00 13.99 ? 24  GLY A C   1 
ATOM   198  O  O   . GLY A 1 25  ? -21.638 -3.592  4.084   1.00 14.06 ? 24  GLY A O   1 
ATOM   199  N  N   . SER A 1 26  ? -21.665 -4.810  5.976   1.00 13.72 ? 25  SER A N   1 
ATOM   200  C  CA  A SER A 1 26  ? -20.762 -3.881  6.655   0.50 14.52 ? 25  SER A CA  1 
ATOM   201  C  CA  B SER A 1 26  ? -20.732 -3.942  6.705   0.50 14.60 ? 25  SER A CA  1 
ATOM   202  C  C   . SER A 1 26  ? -19.364 -3.914  6.023   1.00 13.67 ? 25  SER A C   1 
ATOM   203  O  O   . SER A 1 26  ? -18.757 -2.859  5.834   1.00 13.60 ? 25  SER A O   1 
ATOM   204  C  CB  A SER A 1 26  ? -20.719 -4.146  8.162   0.50 15.66 ? 25  SER A CB  1 
ATOM   205  C  CB  B SER A 1 26  ? -20.580 -4.434  8.149   0.50 15.78 ? 25  SER A CB  1 
ATOM   206  O  OG  A SER A 1 26  ? -19.643 -3.468  8.784   0.50 18.63 ? 25  SER A OG  1 
ATOM   207  O  OG  B SER A 1 26  ? -21.789 -4.260  8.872   0.50 18.37 ? 25  SER A OG  1 
ATOM   208  N  N   . GLN A 1 27  ? -18.869 -5.096  5.665   1.00 12.61 ? 26  GLN A N   1 
ATOM   209  C  CA  . GLN A 1 27  ? -17.567 -5.171  5.010   1.00 11.15 ? 26  GLN A CA  1 
ATOM   210  C  C   . GLN A 1 27  ? -17.596 -4.447  3.673   1.00 9.88  ? 26  GLN A C   1 
ATOM   211  O  O   . GLN A 1 27  ? -16.656 -3.715  3.356   1.00 9.54  ? 26  GLN A O   1 
ATOM   212  C  CB  . GLN A 1 27  ? -17.166 -6.627  4.803   1.00 10.94 ? 26  GLN A CB  1 
ATOM   213  C  CG  . GLN A 1 27  ? -16.664 -7.271  6.091   1.00 13.18 ? 26  GLN A CG  1 
ATOM   214  C  CD  . GLN A 1 27  ? -16.346 -8.737  5.908   1.00 12.58 ? 26  GLN A CD  1 
ATOM   215  O  OE1 . GLN A 1 27  ? -15.306 -9.225  6.382   1.00 18.24 ? 26  GLN A OE1 1 
ATOM   216  N  NE2 . GLN A 1 27  ? -17.242 -9.454  5.264   1.00 10.87 ? 26  GLN A NE2 1 
ATOM   217  N  N   . ARG A 1 28  ? -18.659 -4.645  2.898   1.00 9.91  ? 27  ARG A N   1 
ATOM   218  C  CA  . ARG A 1 28  ? -18.773 -3.974  1.618   1.00 9.46  ? 27  ARG A CA  1 
ATOM   219  C  C   . ARG A 1 28  ? -18.790 -2.457  1.788   1.00 10.10 ? 27  ARG A C   1 
ATOM   220  O  O   . ARG A 1 28  ? -18.173 -1.722  1.016   1.00 10.24 ? 27  ARG A O   1 
ATOM   221  C  CB  . ARG A 1 28  ? -19.984 -4.453  0.812   1.00 10.38 ? 27  ARG A CB  1 
ATOM   222  C  CG  . ARG A 1 28  ? -19.838 -5.953  0.469   1.00 10.92 ? 27  ARG A CG  1 
ATOM   223  C  CD  . ARG A 1 28  ? -20.765 -6.388  -0.633  1.00 14.74 ? 27  ARG A CD  1 
ATOM   224  N  NE  . ARG A 1 28  ? -22.134 -6.176  -0.214  1.00 16.82 ? 27  ARG A NE  1 
ATOM   225  C  CZ  . ARG A 1 28  ? -22.850 -7.077  0.457   1.00 17.69 ? 27  ARG A CZ  1 
ATOM   226  N  NH1 . ARG A 1 28  ? -22.308 -8.257  0.758   1.00 19.35 ? 27  ARG A NH1 1 
ATOM   227  N  NH2 . ARG A 1 28  ? -24.104 -6.793  0.830   1.00 20.38 ? 27  ARG A NH2 1 
ATOM   228  N  N   . ALA A 1 29  ? -19.507 -1.989  2.811   1.00 10.66 ? 28  ALA A N   1 
ATOM   229  C  CA  . ALA A 1 29  ? -19.573 -0.555  3.087   1.00 11.04 ? 28  ALA A CA  1 
ATOM   230  C  C   . ALA A 1 29  ? -18.182 -0.011  3.436   1.00 9.98  ? 28  ALA A C   1 
ATOM   231  O  O   . ALA A 1 29  ? -17.861 1.110   3.039   1.00 10.67 ? 28  ALA A O   1 
ATOM   232  C  CB  . ALA A 1 29  ? -20.577 -0.295  4.194   1.00 12.69 ? 28  ALA A CB  1 
ATOM   233  N  N   . VAL A 1 30  ? -17.351 -0.783  4.147   1.00 9.40  ? 29  VAL A N   1 
ATOM   234  C  CA  . VAL A 1 30  ? -16.009 -0.360  4.450   1.00 9.47  ? 29  VAL A CA  1 
ATOM   235  C  C   . VAL A 1 30  ? -15.169 -0.269  3.164   1.00 8.84  ? 29  VAL A C   1 
ATOM   236  O  O   . VAL A 1 30  ? -14.362 0.667   3.018   1.00 8.95  ? 29  VAL A O   1 
ATOM   237  C  CB  . VAL A 1 30  ? -15.339 -1.322  5.465   1.00 10.46 ? 29  VAL A CB  1 
ATOM   238  C  CG1 . VAL A 1 30  ? -13.874 -1.056  5.575   1.00 11.39 ? 29  VAL A CG1 1 
ATOM   239  C  CG2 . VAL A 1 30  ? -16.019 -1.238  6.838   1.00 13.83 ? 29  VAL A CG2 1 
ATOM   240  N  N   . PHE A 1 31  ? -15.372 -1.177  2.205   1.00 8.99  ? 30  PHE A N   1 
ATOM   241  C  CA  . PHE A 1 31  ? -14.594 -1.059  0.969   1.00 8.46  ? 30  PHE A CA  1 
ATOM   242  C  C   . PHE A 1 31  ? -14.941 0.255   0.286   1.00 8.01  ? 30  PHE A C   1 
ATOM   243  O  O   . PHE A 1 31  ? -14.062 0.969   -0.220  1.00 8.27  ? 30  PHE A O   1 
ATOM   244  C  CB  . PHE A 1 31  ? -14.886 -2.215  0.005   1.00 9.51  ? 30  PHE A CB  1 
ATOM   245  C  CG  . PHE A 1 31  ? -14.665 -3.582  0.572   1.00 9.18  ? 30  PHE A CG  1 
ATOM   246  C  CD1 . PHE A 1 31  ? -13.740 -3.807  1.576   1.00 10.39 ? 30  PHE A CD1 1 
ATOM   247  C  CD2 . PHE A 1 31  ? -15.355 -4.669  0.036   1.00 10.48 ? 30  PHE A CD2 1 
ATOM   248  C  CE1 . PHE A 1 31  ? -13.555 -5.103  2.091   1.00 11.74 ? 30  PHE A CE1 1 
ATOM   249  C  CE2 . PHE A 1 31  ? -15.159 -5.947  0.550   1.00 10.95 ? 30  PHE A CE2 1 
ATOM   250  C  CZ  . PHE A 1 31  ? -14.264 -6.157  1.556   1.00 11.37 ? 30  PHE A CZ  1 
ATOM   251  N  N   . ARG A 1 32  ? -16.234 0.564   0.214   1.00 8.71  ? 31  ARG A N   1 
ATOM   252  C  CA  . ARG A 1 32  ? -16.635 1.826   -0.399  1.00 10.09 ? 31  ARG A CA  1 
ATOM   253  C  C   . ARG A 1 32  ? -16.129 3.040   0.362   1.00 8.58  ? 31  ARG A C   1 
ATOM   254  O  O   . ARG A 1 32  ? -15.709 4.014   -0.245  1.00 9.87  ? 31  ARG A O   1 
ATOM   255  C  CB  . ARG A 1 32  ? -18.151 1.864   -0.593  1.00 11.03 ? 31  ARG A CB  1 
ATOM   256  C  CG  . ARG A 1 32  ? -18.603 0.736   -1.557  1.00 12.71 ? 31  ARG A CG  1 
ATOM   257  C  CD  . ARG A 1 32  ? -20.109 0.795   -1.828  1.00 15.71 ? 31  ARG A CD  1 
ATOM   258  N  NE  . ARG A 1 32  ? -20.519 -0.232  -2.804  1.00 20.99 ? 31  ARG A NE  1 
ATOM   259  C  CZ  . ARG A 1 32  ? -20.440 -0.085  -4.126  1.00 21.82 ? 31  ARG A CZ  1 
ATOM   260  N  NH1 . ARG A 1 32  ? -20.016 1.070   -4.653  1.00 23.59 ? 31  ARG A NH1 1 
ATOM   261  N  NH2 . ARG A 1 32  ? -20.858 -1.069  -4.929  1.00 24.14 ? 31  ARG A NH2 1 
ATOM   262  N  N   . GLN A 1 33  ? -16.105 2.959   1.680   1.00 9.31  ? 32  GLN A N   1 
ATOM   263  C  CA  . GLN A 1 33  ? -15.581 4.043   2.487   1.00 9.36  ? 32  GLN A CA  1 
ATOM   264  C  C   . GLN A 1 33  ? -14.092 4.271   2.204   1.00 8.32  ? 32  GLN A C   1 
ATOM   265  O  O   . GLN A 1 33  ? -13.643 5.403   2.124   1.00 8.18  ? 32  GLN A O   1 
ATOM   266  C  CB  . GLN A 1 33  ? -15.776 3.692   3.962   1.00 10.34 ? 32  GLN A CB  1 
ATOM   267  C  CG  . GLN A 1 33  ? -15.510 4.771   4.940   1.00 12.67 ? 32  GLN A CG  1 
ATOM   268  C  CD  . GLN A 1 33  ? -15.498 4.206   6.366   1.00 15.34 ? 32  GLN A CD  1 
ATOM   269  O  OE1 . GLN A 1 33  ? -15.594 2.982   6.605   1.00 15.88 ? 32  GLN A OE1 1 
ATOM   270  N  NE2 . GLN A 1 33  ? -15.414 5.111   7.332   1.00 18.84 ? 32  GLN A NE2 1 
ATOM   271  N  N   . ALA A 1 34  ? -13.343 3.195   2.056   1.00 7.47  ? 33  ALA A N   1 
ATOM   272  C  CA  . ALA A 1 34  ? -11.920 3.291   1.772   1.00 7.37  ? 33  ALA A CA  1 
ATOM   273  C  C   . ALA A 1 34  ? -11.672 3.886   0.390   1.00 7.24  ? 33  ALA A C   1 
ATOM   274  O  O   . ALA A 1 34  ? -10.778 4.730   0.213   1.00 7.69  ? 33  ALA A O   1 
ATOM   275  C  CB  . ALA A 1 34  ? -11.305 1.904   1.903   1.00 7.89  ? 33  ALA A CB  1 
ATOM   276  N  N   . MET A 1 35  ? -12.480 3.485   -0.597  1.00 7.46  ? 34  MET A N   1 
ATOM   277  C  CA  . MET A 1 35  ? -12.372 4.069   -1.938  1.00 8.07  ? 34  MET A CA  1 
ATOM   278  C  C   . MET A 1 35  ? -12.745 5.544   -1.884  1.00 8.22  ? 34  MET A C   1 
ATOM   279  O  O   . MET A 1 35  ? -12.039 6.368   -2.483  1.00 8.10  ? 34  MET A O   1 
ATOM   280  C  CB  . MET A 1 35  ? -13.239 3.290   -2.949  1.00 8.87  ? 34  MET A CB  1 
ATOM   281  C  CG  . MET A 1 35  ? -12.662 1.916   -3.244  1.00 9.26  ? 34  MET A CG  1 
ATOM   282  S  SD  . MET A 1 35  ? -13.539 1.052   -4.572  1.00 9.63  ? 34  MET A SD  1 
ATOM   283  C  CE  . MET A 1 35  ? -14.922 0.412   -3.645  1.00 9.86  ? 34  MET A CE  1 
ATOM   284  N  N   . ARG A 1 36  ? -13.803 5.899   -1.139  1.00 8.15  ? 35  ARG A N   1 
ATOM   285  C  CA  . ARG A 1 36  ? -14.148 7.324   -1.044  1.00 9.14  ? 35  ARG A CA  1 
ATOM   286  C  C   . ARG A 1 36  ? -13.033 8.131   -0.405  1.00 8.26  ? 35  ARG A C   1 
ATOM   287  O  O   . ARG A 1 36  ? -12.830 9.298   -0.747  1.00 8.70  ? 35  ARG A O   1 
ATOM   288  C  CB  . ARG A 1 36  ? -15.423 7.543   -0.255  1.00 10.58 ? 35  ARG A CB  1 
ATOM   289  C  CG  . ARG A 1 36  ? -16.690 7.173   -0.996  1.00 11.76 ? 35  ARG A CG  1 
ATOM   290  C  CD  . ARG A 1 36  ? -17.966 7.700   -0.289  1.00 14.19 ? 35  ARG A CD  1 
ATOM   291  N  NE  . ARG A 1 36  ? -18.081 7.342   1.129   1.00 15.83 ? 35  ARG A NE  1 
ATOM   292  C  CZ  . ARG A 1 36  ? -18.578 6.191   1.603   1.00 15.52 ? 35  ARG A CZ  1 
ATOM   293  N  NH1 . ARG A 1 36  ? -19.017 5.248   0.776   1.00 17.39 ? 35  ARG A NH1 1 
ATOM   294  N  NH2 . ARG A 1 36  ? -18.629 5.992   2.925   1.00 17.21 ? 35  ARG A NH2 1 
ATOM   295  N  N   . HIS A 1 37  ? -12.310 7.543   0.548   1.00 7.88  ? 36  HIS A N   1 
ATOM   296  C  CA  . HIS A 1 37  ? -11.233 8.259   1.217   1.00 7.00  ? 36  HIS A CA  1 
ATOM   297  C  C   . HIS A 1 37  ? -10.146 8.645   0.225   1.00 7.04  ? 36  HIS A C   1 
ATOM   298  O  O   . HIS A 1 37  ? -9.684  9.798   0.187   1.00 7.78  ? 36  HIS A O   1 
ATOM   299  C  CB  . HIS A 1 37  ? -10.677 7.381   2.348   1.00 7.69  ? 36  HIS A CB  1 
ATOM   300  C  CG  . HIS A 1 37  ? -9.659  8.059   3.193   1.00 7.78  ? 36  HIS A CG  1 
ATOM   301  N  ND1 . HIS A 1 37  ? -8.322  7.722   3.285   1.00 9.97  ? 36  HIS A ND1 1 
ATOM   302  C  CD2 . HIS A 1 37  ? -9.847  9.087   4.047   1.00 5.94  ? 36  HIS A CD2 1 
ATOM   303  C  CE1 . HIS A 1 37  ? -7.724  8.521   4.181   1.00 6.11  ? 36  HIS A CE1 1 
ATOM   304  N  NE2 . HIS A 1 37  ? -8.634  9.373   4.632   1.00 10.51 ? 36  HIS A NE2 1 
ATOM   305  N  N   . TRP A 1 38  ? -9.749  7.700   -0.625  1.00 6.73  ? 37  TRP A N   1 
ATOM   306  C  CA  . TRP A 1 38  ? -8.809  8.018   -1.691  1.00 8.03  ? 37  TRP A CA  1 
ATOM   307  C  C   . TRP A 1 38  ? -9.385  9.085   -2.637  1.00 8.16  ? 37  TRP A C   1 
ATOM   308  O  O   . TRP A 1 38  ? -8.658  9.993   -3.060  1.00 9.10  ? 37  TRP A O   1 
ATOM   309  C  CB  . TRP A 1 38  ? -8.495  6.730   -2.475  1.00 8.22  ? 37  TRP A CB  1 
ATOM   310  C  CG  . TRP A 1 38  ? -7.332  6.003   -1.873  1.00 6.69  ? 37  TRP A CG  1 
ATOM   311  C  CD1 . TRP A 1 38  ? -7.362  4.953   -0.998  1.00 7.88  ? 37  TRP A CD1 1 
ATOM   312  C  CD2 . TRP A 1 38  ? -5.963  6.299   -2.097  1.00 7.07  ? 37  TRP A CD2 1 
ATOM   313  N  NE1 . TRP A 1 38  ? -6.056  4.574   -0.651  1.00 7.76  ? 37  TRP A NE1 1 
ATOM   314  C  CE2 . TRP A 1 38  ? -5.184  5.388   -1.327  1.00 7.39  ? 37  TRP A CE2 1 
ATOM   315  C  CE3 . TRP A 1 38  ? -5.302  7.274   -2.848  1.00 8.45  ? 37  TRP A CE3 1 
ATOM   316  C  CZ2 . TRP A 1 38  ? -3.776  5.443   -1.294  1.00 8.70  ? 37  TRP A CZ2 1 
ATOM   317  C  CZ3 . TRP A 1 38  ? -3.921  7.295   -2.845  1.00 10.13 ? 37  TRP A CZ3 1 
ATOM   318  C  CH2 . TRP A 1 38  ? -3.174  6.402   -2.067  1.00 8.73  ? 37  TRP A CH2 1 
ATOM   319  N  N   . GLU A 1 39  ? -10.663 8.965   -3.000  1.00 9.05  ? 38  GLU A N   1 
ATOM   320  C  CA  . GLU A 1 39  ? -11.261 9.929   -3.925  1.00 9.73  ? 38  GLU A CA  1 
ATOM   321  C  C   . GLU A 1 39  ? -11.339 11.342  -3.399  1.00 9.95  ? 38  GLU A C   1 
ATOM   322  O  O   . GLU A 1 39  ? -11.242 12.288  -4.164  1.00 11.14 ? 38  GLU A O   1 
ATOM   323  C  CB  . GLU A 1 39  ? -12.677 9.514   -4.306  1.00 10.49 ? 38  GLU A CB  1 
ATOM   324  C  CG  . GLU A 1 39  ? -12.741 8.250   -5.137  1.00 11.80 ? 38  GLU A CG  1 
ATOM   325  C  CD  . GLU A 1 39  ? -14.160 7.911   -5.557  1.00 13.91 ? 38  GLU A CD  1 
ATOM   326  O  OE1 . GLU A 1 39  ? -15.129 8.318   -4.879  1.00 17.86 ? 38  GLU A OE1 1 
ATOM   327  O  OE2 . GLU A 1 39  ? -14.311 7.179   -6.537  1.00 16.19 ? 38  GLU A OE2 1 
ATOM   328  N  N   . LYS A 1 40  ? -11.599 11.501  -2.103  1.00 9.38  ? 39  LYS A N   1 
ATOM   329  C  CA  . LYS A 1 40  ? -11.771 12.860  -1.600  1.00 10.86 ? 39  LYS A CA  1 
ATOM   330  C  C   . LYS A 1 40  ? -10.478 13.630  -1.443  1.00 9.40  ? 39  LYS A C   1 
ATOM   331  O  O   . LYS A 1 40  ? -10.509 14.852  -1.351  1.00 10.88 ? 39  LYS A O   1 
ATOM   332  C  CB  . LYS A 1 40  ? -12.623 12.875  -0.351  1.00 11.91 ? 39  LYS A CB  1 
ATOM   333  C  CG  . LYS A 1 40  ? -11.982 12.302  0.830   1.00 11.36 ? 39  LYS A CG  1 
ATOM   334  C  CD  . LYS A 1 40  ? -12.989 12.281  2.021   1.00 13.85 ? 39  LYS A CD  1 
ATOM   335  C  CE  . LYS A 1 40  ? -14.089 11.239  1.895   1.00 13.34 ? 39  LYS A CE  1 
ATOM   336  N  NZ  . LYS A 1 40  ? -15.002 11.305  3.072   1.00 15.77 ? 39  LYS A NZ  1 
ATOM   337  N  N   . HIS A 1 41  ? -9.344  12.928  -1.442  1.00 9.66  ? 40  HIS A N   1 
ATOM   338  C  CA  . HIS A 1 41  ? -8.051  13.546  -1.209  1.00 9.96  ? 40  HIS A CA  1 
ATOM   339  C  C   . HIS A 1 41  ? -7.186  13.614  -2.445  1.00 10.33 ? 40  HIS A C   1 
ATOM   340  O  O   . HIS A 1 41  ? -6.191  14.336  -2.422  1.00 11.09 ? 40  HIS A O   1 
ATOM   341  C  CB  . HIS A 1 41  ? -7.316  12.792  -0.091  1.00 10.76 ? 40  HIS A CB  1 
ATOM   342  C  CG  . HIS A 1 41  ? -7.896  13.064  1.257   1.00 9.24  ? 40  HIS A CG  1 
ATOM   343  N  ND1 . HIS A 1 41  ? -8.541  12.130  2.037   1.00 13.05 ? 40  HIS A ND1 1 
ATOM   344  C  CD2 . HIS A 1 41  ? -7.974  14.238  1.928   1.00 9.15  ? 40  HIS A CD2 1 
ATOM   345  C  CE1 . HIS A 1 41  ? -8.964  12.716  3.159   1.00 10.06 ? 40  HIS A CE1 1 
ATOM   346  N  NE2 . HIS A 1 41  ? -8.629  13.994  3.107   1.00 13.88 ? 40  HIS A NE2 1 
ATOM   347  N  N   . THR A 1 42  ? -7.557  12.876  -3.497  1.00 10.64 ? 41  THR A N   1 
ATOM   348  C  CA  . THR A 1 42  ? -6.728  12.796  -4.702  1.00 11.11 ? 41  THR A CA  1 
ATOM   349  C  C   . THR A 1 42  ? -7.619  12.790  -5.932  1.00 11.98 ? 41  THR A C   1 
ATOM   350  O  O   . THR A 1 42  ? -8.842  12.757  -5.811  1.00 13.64 ? 41  THR A O   1 
ATOM   351  C  CB  . THR A 1 42  ? -5.871  11.484  -4.742  1.00 11.20 ? 41  THR A CB  1 
ATOM   352  O  OG1 . THR A 1 42  ? -6.722  10.358  -5.015  1.00 11.11 ? 41  THR A OG1 1 
ATOM   353  C  CG2 . THR A 1 42  ? -5.099  11.252  -3.444  1.00 10.79 ? 41  THR A CG2 1 
ATOM   354  N  N   . CYS A 1 43  ? -7.020  12.725  -7.122  1.00 12.19 ? 42  CYS A N   1 
ATOM   355  C  CA  . CYS A 1 43  ? -7.831  12.697  -8.319  1.00 12.28 ? 42  CYS A CA  1 
ATOM   356  C  C   . CYS A 1 43  ? -8.102  11.284  -8.804  1.00 11.59 ? 42  CYS A C   1 
ATOM   357  O  O   . CYS A 1 43  ? -8.630  11.124  -9.907  1.00 13.49 ? 42  CYS A O   1 
ATOM   358  C  CB  . CYS A 1 43  ? -7.213  13.551  -9.430  1.00 13.53 ? 42  CYS A CB  1 
ATOM   359  S  SG  . CYS A 1 43  ? -5.625  13.108  -10.041 1.00 15.44 ? 42  CYS A SG  1 
ATOM   360  N  N   . VAL A 1 44  ? -7.760  10.265  -8.018  1.00 11.12 ? 43  VAL A N   1 
ATOM   361  C  CA  A VAL A 1 44  ? -8.111  8.902   -8.326  0.50 10.57 ? 43  VAL A CA  1 
ATOM   362  C  CA  B VAL A 1 44  ? -8.144  8.921   -8.435  0.50 11.36 ? 43  VAL A CA  1 
ATOM   363  C  C   . VAL A 1 44  ? -9.639  8.742   -8.209  1.00 11.06 ? 43  VAL A C   1 
ATOM   364  O  O   . VAL A 1 44  ? -10.249 9.304   -7.294  1.00 10.74 ? 43  VAL A O   1 
ATOM   365  C  CB  A VAL A 1 44  ? -7.405  7.992   -7.305  0.50 10.27 ? 43  VAL A CB  1 
ATOM   366  C  CB  B VAL A 1 44  ? -7.348  7.765   -7.756  0.50 12.21 ? 43  VAL A CB  1 
ATOM   367  C  CG1 A VAL A 1 44  ? -7.856  6.564   -7.464  0.50 10.64 ? 43  VAL A CG1 1 
ATOM   368  C  CG1 B VAL A 1 44  ? -5.839  7.898   -7.995  0.50 11.96 ? 43  VAL A CG1 1 
ATOM   369  C  CG2 A VAL A 1 44  ? -5.867  8.090   -7.456  0.50 10.94 ? 43  VAL A CG2 1 
ATOM   370  C  CG2 B VAL A 1 44  ? -7.692  7.643   -6.290  0.50 15.05 ? 43  VAL A CG2 1 
ATOM   371  N  N   . THR A 1 45  ? -10.247 7.952   -9.088  1.00 10.46 ? 44  THR A N   1 
ATOM   372  C  CA  . THR A 1 45  ? -11.671 7.639   -8.987  1.00 10.66 ? 44  THR A CA  1 
ATOM   373  C  C   . THR A 1 45  ? -11.883 6.150   -9.147  1.00 10.61 ? 44  THR A C   1 
ATOM   374  O  O   . THR A 1 45  ? -11.153 5.488   -9.877  1.00 12.22 ? 44  THR A O   1 
ATOM   375  C  CB  . THR A 1 45  ? -12.554 8.386   -10.030 1.00 12.17 ? 44  THR A CB  1 
ATOM   376  O  OG1 . THR A 1 45  ? -12.041 8.149   -11.343 1.00 14.31 ? 44  THR A OG1 1 
ATOM   377  C  CG2 . THR A 1 45  ? -12.549 9.870   -9.740  1.00 13.81 ? 44  THR A CG2 1 
ATOM   378  N  N   . PHE A 1 46  ? -12.870 5.642   -8.441  1.00 10.52 ? 45  PHE A N   1 
ATOM   379  C  CA  . PHE A 1 46  ? -13.196 4.217   -8.505  1.00 10.89 ? 45  PHE A CA  1 
ATOM   380  C  C   . PHE A 1 46  ? -14.552 4.066   -9.174  1.00 11.88 ? 45  PHE A C   1 
ATOM   381  O  O   . PHE A 1 46  ? -15.509 4.779   -8.830  1.00 14.27 ? 45  PHE A O   1 
ATOM   382  C  CB  . PHE A 1 46  ? -13.247 3.615   -7.102  1.00 10.42 ? 45  PHE A CB  1 
ATOM   383  C  CG  . PHE A 1 46  ? -11.901 3.538   -6.460  1.00 8.85  ? 45  PHE A CG  1 
ATOM   384  C  CD1 . PHE A 1 46  ? -11.075 2.447   -6.699  1.00 9.67  ? 45  PHE A CD1 1 
ATOM   385  C  CD2 . PHE A 1 46  ? -11.418 4.588   -5.702  1.00 10.09 ? 45  PHE A CD2 1 
ATOM   386  C  CE1 . PHE A 1 46  ? -9.822  2.380   -6.154  1.00 10.01 ? 45  PHE A CE1 1 
ATOM   387  C  CE2 . PHE A 1 46  ? -10.157 4.528   -5.137  1.00 11.33 ? 45  PHE A CE2 1 
ATOM   388  C  CZ  . PHE A 1 46  ? -9.354  3.419   -5.367  1.00 11.09 ? 45  PHE A CZ  1 
ATOM   389  N  N   . LEU A 1 47  ? -14.633 3.157   -10.138 1.00 11.48 ? 46  LEU A N   1 
ATOM   390  C  CA  . LEU A 1 47  ? -15.797 3.038   -11.005 1.00 14.14 ? 46  LEU A CA  1 
ATOM   391  C  C   . LEU A 1 47  ? -16.285 1.585   -10.949 1.00 12.57 ? 46  LEU A C   1 
ATOM   392  O  O   . LEU A 1 47  ? -15.484 0.687   -11.104 1.00 12.02 ? 46  LEU A O   1 
ATOM   393  C  CB  . LEU A 1 47  ? -15.379 3.372   -12.443 1.00 16.78 ? 46  LEU A CB  1 
ATOM   394  C  CG  . LEU A 1 47  ? -16.398 3.290   -13.580 1.00 18.83 ? 46  LEU A CG  1 
ATOM   395  C  CD1 . LEU A 1 47  ? -17.487 4.287   -13.377 1.00 21.13 ? 46  LEU A CD1 1 
ATOM   396  C  CD2 . LEU A 1 47  ? -15.672 3.610   -14.881 1.00 18.93 ? 46  LEU A CD2 1 
ATOM   397  N  N   . GLU A 1 48  ? -17.583 1.333   -10.816 1.00 13.50 ? 47  GLU A N   1 
ATOM   398  C  CA  . GLU A 1 48  ? -18.052 -0.044  -10.848 1.00 15.05 ? 47  GLU A CA  1 
ATOM   399  C  C   . GLU A 1 48  ? -17.717 -0.635  -12.228 1.00 14.25 ? 47  GLU A C   1 
ATOM   400  O  O   . GLU A 1 48  ? -18.089 -0.065  -13.277 1.00 14.85 ? 47  GLU A O   1 
ATOM   401  C  CB  . GLU A 1 48  ? -19.569 -0.135  -10.649 1.00 16.75 ? 47  GLU A CB  1 
ATOM   402  C  CG  . GLU A 1 48  ? -20.137 0.713   -9.524  1.00 22.75 ? 47  GLU A CG  1 
ATOM   403  C  CD  . GLU A 1 48  ? -20.274 0.002   -8.194  1.00 28.58 ? 47  GLU A CD  1 
ATOM   404  O  OE1 . GLU A 1 48  ? -20.262 -1.248  -8.141  1.00 31.89 ? 47  GLU A OE1 1 
ATOM   405  O  OE2 . GLU A 1 48  ? -20.421 0.725   -7.183  1.00 33.57 ? 47  GLU A OE2 1 
ATOM   406  N  N   . ARG A 1 49  ? -17.041 -1.776  -12.247 1.00 13.22 ? 48  ARG A N   1 
ATOM   407  C  CA  . ARG A 1 49  ? -16.570 -2.345  -13.507 1.00 13.63 ? 48  ARG A CA  1 
ATOM   408  C  C   . ARG A 1 49  ? -17.735 -2.845  -14.352 1.00 14.64 ? 48  ARG A C   1 
ATOM   409  O  O   . ARG A 1 49  ? -18.681 -3.410  -13.826 1.00 16.13 ? 48  ARG A O   1 
ATOM   410  C  CB  . ARG A 1 49  ? -15.578 -3.483  -13.219 1.00 13.32 ? 48  ARG A CB  1 
ATOM   411  C  CG  . ARG A 1 49  ? -14.863 -4.017  -14.449 1.00 13.41 ? 48  ARG A CG  1 
ATOM   412  C  CD  . ARG A 1 49  ? -15.433 -5.376  -14.844 1.00 14.14 ? 48  ARG A CD  1 
ATOM   413  N  NE  . ARG A 1 49  ? -14.740 -5.855  -16.047 1.00 15.65 ? 48  ARG A NE  1 
ATOM   414  C  CZ  . ARG A 1 49  ? -14.983 -7.024  -16.640 1.00 16.29 ? 48  ARG A CZ  1 
ATOM   415  N  NH1 . ARG A 1 49  ? -15.937 -7.819  -16.181 1.00 17.72 ? 48  ARG A NH1 1 
ATOM   416  N  NH2 . ARG A 1 49  ? -14.298 -7.368  -17.716 1.00 17.56 ? 48  ARG A NH2 1 
ATOM   417  N  N   . THR A 1 50  ? -17.617 -2.623  -15.651 1.00 16.24 ? 49  THR A N   1 
ATOM   418  C  CA  . THR A 1 50  ? -18.594 -3.173  -16.606 1.00 16.49 ? 49  THR A CA  1 
ATOM   419  C  C   . THR A 1 50  ? -17.860 -4.178  -17.489 1.00 16.64 ? 49  THR A C   1 
ATOM   420  O  O   . THR A 1 50  ? -17.910 -5.400  -17.225 1.00 16.61 ? 49  THR A O   1 
ATOM   421  C  CB  . THR A 1 50  ? -19.283 -2.053  -17.425 1.00 17.55 ? 49  THR A CB  1 
ATOM   422  O  OG1 . THR A 1 50  ? -18.304 -1.128  -17.916 1.00 18.60 ? 49  THR A OG1 1 
ATOM   423  C  CG2 . THR A 1 50  ? -20.292 -1.293  -16.537 1.00 18.20 ? 49  THR A CG2 1 
ATOM   424  N  N   . ASP A 1 51  ? -17.116 -3.685  -18.477 1.00 15.58 ? 50  ASP A N   1 
ATOM   425  C  CA  . ASP A 1 51  ? -16.377 -4.575  -19.364 1.00 16.28 ? 50  ASP A CA  1 
ATOM   426  C  C   . ASP A 1 51  ? -14.920 -4.200  -19.485 1.00 16.81 ? 50  ASP A C   1 
ATOM   427  O  O   . ASP A 1 51  ? -14.240 -4.655  -20.407 1.00 18.85 ? 50  ASP A O   1 
ATOM   428  C  CB  . ASP A 1 51  ? -17.038 -4.653  -20.751 1.00 16.62 ? 50  ASP A CB  1 
ATOM   429  C  CG  . ASP A 1 51  ? -16.922 -3.362  -21.538 1.00 16.82 ? 50  ASP A CG  1 
ATOM   430  O  OD1 . ASP A 1 51  ? -16.532 -2.319  -20.979 1.00 17.69 ? 50  ASP A OD1 1 
ATOM   431  O  OD2 . ASP A 1 51  ? -17.247 -3.390  -22.754 1.00 17.17 ? 50  ASP A OD2 1 
ATOM   432  N  N   . GLU A 1 52  ? -14.411 -3.382  -18.553 1.00 16.70 ? 51  GLU A N   1 
ATOM   433  C  CA  . GLU A 1 52  ? -13.007 -2.973  -18.658 1.00 17.02 ? 51  GLU A CA  1 
ATOM   434  C  C   . GLU A 1 52  ? -12.146 -4.214  -18.500 1.00 18.14 ? 51  GLU A C   1 
ATOM   435  O  O   . GLU A 1 52  ? -12.459 -5.101  -17.688 1.00 17.16 ? 51  GLU A O   1 
ATOM   436  C  CB  . GLU A 1 52  ? -12.619 -1.985  -17.549 1.00 17.38 ? 51  GLU A CB  1 
ATOM   437  C  CG  . GLU A 1 52  ? -13.250 -0.616  -17.675 1.00 18.60 ? 51  GLU A CG  1 
ATOM   438  C  CD  . GLU A 1 52  ? -14.567 -0.496  -16.957 1.00 17.46 ? 51  GLU A CD  1 
ATOM   439  O  OE1 . GLU A 1 52  ? -15.193 -1.544  -16.652 1.00 16.20 ? 51  GLU A OE1 1 
ATOM   440  O  OE2 . GLU A 1 52  ? -14.982 0.664   -16.690 1.00 21.61 ? 51  GLU A OE2 1 
ATOM   441  N  N   . ASP A 1 53  ? -11.048 -4.274  -19.234 1.00 19.02 ? 52  ASP A N   1 
ATOM   442  C  CA  . ASP A 1 53  ? -10.214 -5.454  -19.170 1.00 20.00 ? 52  ASP A CA  1 
ATOM   443  C  C   . ASP A 1 53  ? -9.466  -5.568  -17.848 1.00 19.00 ? 52  ASP A C   1 
ATOM   444  O  O   . ASP A 1 53  ? -9.385  -6.648  -17.288 1.00 19.87 ? 52  ASP A O   1 
ATOM   445  C  CB  . ASP A 1 53  ? -9.238  -5.487  -20.333 1.00 22.27 ? 52  ASP A CB  1 
ATOM   446  C  CG  . ASP A 1 53  ? -8.526  -6.796  -20.433 1.00 27.11 ? 52  ASP A CG  1 
ATOM   447  O  OD1 . ASP A 1 53  ? -9.212  -7.828  -20.641 1.00 33.02 ? 52  ASP A OD1 1 
ATOM   448  O  OD2 . ASP A 1 53  ? -7.285  -6.800  -20.299 1.00 31.75 ? 52  ASP A OD2 1 
ATOM   449  N  N   . SER A 1 54  ? -8.959  -4.433  -17.366 1.00 16.91 ? 53  SER A N   1 
ATOM   450  C  CA  . SER A 1 54  ? -8.199  -4.364  -16.109 1.00 15.27 ? 53  SER A CA  1 
ATOM   451  C  C   . SER A 1 54  ? -9.025  -3.693  -15.013 1.00 13.07 ? 53  SER A C   1 
ATOM   452  O  O   . SER A 1 54  ? -9.606  -2.623  -15.219 1.00 12.23 ? 53  SER A O   1 
ATOM   453  C  CB  . SER A 1 54  ? -6.892  -3.596  -16.301 1.00 18.03 ? 53  SER A CB  1 
ATOM   454  O  OG  . SER A 1 54  ? -6.078  -4.242  -17.261 1.00 24.18 ? 53  SER A OG  1 
ATOM   455  N  N   . TYR A 1 55  ? -9.027  -4.310  -13.839 1.00 10.72 ? 54  TYR A N   1 
ATOM   456  C  CA  . TYR A 1 55  ? -9.820  -3.836  -12.746 1.00 8.86  ? 54  TYR A CA  1 
ATOM   457  C  C   . TYR A 1 55  ? -9.373  -4.542  -11.495 1.00 8.53  ? 54  TYR A C   1 
ATOM   458  O  O   . TYR A 1 55  ? -8.721  -5.577  -11.563 1.00 9.42  ? 54  TYR A O   1 
ATOM   459  C  CB  . TYR A 1 55  ? -11.301 -4.093  -13.042 1.00 10.20 ? 54  TYR A CB  1 
ATOM   460  C  CG  . TYR A 1 55  ? -11.696 -5.532  -13.317 1.00 10.56 ? 54  TYR A CG  1 
ATOM   461  C  CD1 . TYR A 1 55  ? -11.531 -6.103  -14.587 1.00 11.86 ? 54  TYR A CD1 1 
ATOM   462  C  CD2 . TYR A 1 55  ? -12.341 -6.295  -12.330 1.00 10.65 ? 54  TYR A CD2 1 
ATOM   463  C  CE1 . TYR A 1 55  ? -11.970 -7.397  -14.851 1.00 14.07 ? 54  TYR A CE1 1 
ATOM   464  C  CE2 . TYR A 1 55  ? -12.762 -7.601  -12.612 1.00 13.05 ? 54  TYR A CE2 1 
ATOM   465  C  CZ  . TYR A 1 55  ? -12.571 -8.130  -13.864 1.00 13.64 ? 54  TYR A CZ  1 
ATOM   466  O  OH  . TYR A 1 55  ? -13.024 -9.411  -14.113 1.00 15.16 ? 54  TYR A OH  1 
ATOM   467  N  N   . ILE A 1 56  ? -9.763  -3.983  -10.357 1.00 8.22  ? 55  ILE A N   1 
ATOM   468  C  CA  . ILE A 1 56  ? -9.489  -4.622  -9.069  1.00 7.64  ? 55  ILE A CA  1 
ATOM   469  C  C   . ILE A 1 56  ? -10.686 -5.389  -8.569  1.00 6.98  ? 55  ILE A C   1 
ATOM   470  O  O   . ILE A 1 56  ? -11.840 -5.053  -8.868  1.00 7.89  ? 55  ILE A O   1 
ATOM   471  C  CB  . ILE A 1 56  ? -9.015  -3.572  -8.025  1.00 7.78  ? 55  ILE A CB  1 
ATOM   472  C  CG1 . ILE A 1 56  ? -10.169 -2.656  -7.606  1.00 8.04  ? 55  ILE A CG1 1 
ATOM   473  C  CG2 . ILE A 1 56  ? -7.777  -2.814  -8.534  1.00 9.16  ? 55  ILE A CG2 1 
ATOM   474  C  CD1 . ILE A 1 56  ? -9.819  -1.668  -6.463  1.00 9.67  ? 55  ILE A CD1 1 
ATOM   475  N  N   . VAL A 1 57  ? -10.407 -6.423  -7.783  1.00 7.01  ? 56  VAL A N   1 
ATOM   476  C  CA  . VAL A 1 57  ? -11.508 -7.241  -7.246  1.00 7.93  ? 56  VAL A CA  1 
ATOM   477  C  C   . VAL A 1 57  ? -11.267 -7.432  -5.756  1.00 6.61  ? 56  VAL A C   1 
ATOM   478  O  O   . VAL A 1 57  ? -10.266 -8.027  -5.342  1.00 7.43  ? 56  VAL A O   1 
ATOM   479  C  CB  . VAL A 1 57  ? -11.565 -8.648  -7.945  1.00 8.20  ? 56  VAL A CB  1 
ATOM   480  C  CG1 . VAL A 1 57  ? -12.751 -9.425  -7.449  1.00 9.72  ? 56  VAL A CG1 1 
ATOM   481  C  CG2 . VAL A 1 57  ? -11.562 -8.500  -9.445  1.00 10.74 ? 56  VAL A CG2 1 
ATOM   482  N  N   . PHE A 1 58  ? -12.185 -6.934  -4.927  1.00 7.23  ? 57  PHE A N   1 
ATOM   483  C  CA  . PHE A 1 58  ? -12.114 -7.173  -3.474  1.00 7.10  ? 57  PHE A CA  1 
ATOM   484  C  C   . PHE A 1 58  ? -12.523 -8.650  -3.307  1.00 7.46  ? 57  PHE A C   1 
ATOM   485  O  O   . PHE A 1 58  ? -13.639 -9.038  -3.674  1.00 8.31  ? 57  PHE A O   1 
ATOM   486  C  CB  . PHE A 1 58  ? -13.084 -6.256  -2.717  1.00 8.06  ? 57  PHE A CB  1 
ATOM   487  C  CG  . PHE A 1 58  ? -12.739 -4.795  -2.815  1.00 7.77  ? 57  PHE A CG  1 
ATOM   488  C  CD1 . PHE A 1 58  ? -11.923 -4.205  -1.871  1.00 8.61  ? 57  PHE A CD1 1 
ATOM   489  C  CD2 . PHE A 1 58  ? -13.186 -4.034  -3.884  1.00 8.53  ? 57  PHE A CD2 1 
ATOM   490  C  CE1 . PHE A 1 58  ? -11.612 -2.840  -1.967  1.00 10.07 ? 57  PHE A CE1 1 
ATOM   491  C  CE2 . PHE A 1 58  ? -12.867 -2.704  -3.989  1.00 8.41  ? 57  PHE A CE2 1 
ATOM   492  C  CZ  . PHE A 1 58  ? -12.058 -2.107  -3.031  1.00 8.48  ? 57  PHE A CZ  1 
ATOM   493  N  N   . THR A 1 59  ? -11.585 -9.471  -2.846  1.00 7.59  ? 58  THR A N   1 
ATOM   494  C  CA  . THR A 1 59  ? -11.689 -10.937 -2.976  1.00 7.63  ? 58  THR A CA  1 
ATOM   495  C  C   . THR A 1 59  ? -11.578 -11.557 -1.606  1.00 7.27  ? 58  THR A C   1 
ATOM   496  O  O   . THR A 1 59  ? -10.586 -11.356 -0.895  1.00 8.64  ? 58  THR A O   1 
ATOM   497  C  CB  . THR A 1 59  ? -10.511 -11.448 -3.857  1.00 8.22  ? 58  THR A CB  1 
ATOM   498  O  OG1 . THR A 1 59  ? -10.592 -10.858 -5.163  1.00 8.23  ? 58  THR A OG1 1 
ATOM   499  C  CG2 . THR A 1 59  ? -10.552 -12.953 -4.020  1.00 8.87  ? 58  THR A CG2 1 
ATOM   500  N  N   . TYR A 1 60  ? -12.585 -12.362 -1.241  1.00 7.81  ? 59  TYR A N   1 
ATOM   501  C  CA  . TYR A 1 60  ? -12.526 -13.090 0.022   1.00 8.51  ? 59  TYR A CA  1 
ATOM   502  C  C   . TYR A 1 60  ? -11.448 -14.152 -0.102  1.00 10.05 ? 59  TYR A C   1 
ATOM   503  O  O   . TYR A 1 60  ? -11.536 -15.038 -0.966  1.00 10.94 ? 59  TYR A O   1 
ATOM   504  C  CB  . TYR A 1 60  ? -13.889 -13.733 0.277   1.00 9.15  ? 59  TYR A CB  1 
ATOM   505  C  CG  . TYR A 1 60  ? -13.949 -14.491 1.577   1.00 10.69 ? 59  TYR A CG  1 
ATOM   506  C  CD1 . TYR A 1 60  ? -14.454 -13.886 2.715   1.00 13.14 ? 59  TYR A CD1 1 
ATOM   507  C  CD2 . TYR A 1 60  ? -13.474 -15.810 1.677   1.00 11.35 ? 59  TYR A CD2 1 
ATOM   508  C  CE1 . TYR A 1 60  ? -14.521 -14.576 3.940   1.00 15.63 ? 59  TYR A CE1 1 
ATOM   509  C  CE2 . TYR A 1 60  ? -13.542 -16.516 2.877   1.00 13.64 ? 59  TYR A CE2 1 
ATOM   510  C  CZ  . TYR A 1 60  ? -14.054 -15.902 3.998   1.00 14.62 ? 59  TYR A CZ  1 
ATOM   511  O  OH  . TYR A 1 60  ? -14.121 -16.597 5.196   1.00 19.21 ? 59  TYR A OH  1 
ATOM   512  N  N   . ARG A 1 61  ? -10.428 -14.044 0.734   1.00 11.24 ? 60  ARG A N   1 
ATOM   513  C  CA  A ARG A 1 61  ? -9.203  -14.833 0.623   0.50 14.17 ? 60  ARG A CA  1 
ATOM   514  C  CA  B ARG A 1 61  ? -9.208  -14.837 0.628   0.50 13.79 ? 60  ARG A CA  1 
ATOM   515  C  C   . ARG A 1 61  ? -8.449  -14.699 1.949   1.00 14.49 ? 60  ARG A C   1 
ATOM   516  O  O   . ARG A 1 61  ? -8.756  -13.822 2.755   1.00 15.51 ? 60  ARG A O   1 
ATOM   517  C  CB  A ARG A 1 61  ? -8.316  -14.292 -0.534  0.50 14.34 ? 60  ARG A CB  1 
ATOM   518  C  CB  B ARG A 1 61  ? -8.325  -14.292 -0.523  0.50 14.00 ? 60  ARG A CB  1 
ATOM   519  C  CG  A ARG A 1 61  ? -8.343  -15.112 -1.807  0.50 16.17 ? 60  ARG A CG  1 
ATOM   520  C  CG  B ARG A 1 61  ? -8.228  -15.177 -1.743  0.50 15.19 ? 60  ARG A CG  1 
ATOM   521  C  CD  A ARG A 1 61  ? -7.360  -14.583 -2.876  0.50 17.77 ? 60  ARG A CD  1 
ATOM   522  C  CD  B ARG A 1 61  ? -7.361  -14.520 -2.824  0.50 16.29 ? 60  ARG A CD  1 
ATOM   523  N  NE  A ARG A 1 61  ? -7.560  -15.300 -4.138  0.50 22.38 ? 60  ARG A NE  1 
ATOM   524  N  NE  B ARG A 1 61  ? -5.932  -14.533 -2.523  0.50 17.12 ? 60  ARG A NE  1 
ATOM   525  C  CZ  A ARG A 1 61  ? -6.981  -15.019 -5.308  0.50 25.45 ? 60  ARG A CZ  1 
ATOM   526  C  CZ  B ARG A 1 61  ? -4.995  -14.019 -3.321  0.50 22.13 ? 60  ARG A CZ  1 
ATOM   527  N  NH1 A ARG A 1 61  ? -6.130  -14.005 -5.443  0.50 27.32 ? 60  ARG A NH1 1 
ATOM   528  N  NH1 B ARG A 1 61  ? -5.332  -13.417 -4.464  0.50 23.49 ? 60  ARG A NH1 1 
ATOM   529  N  NH2 A ARG A 1 61  ? -7.265  -15.770 -6.364  0.50 27.59 ? 60  ARG A NH2 1 
ATOM   530  N  NH2 B ARG A 1 61  ? -3.716  -14.075 -2.962  0.50 24.58 ? 60  ARG A NH2 1 
ATOM   531  N  N   . PRO A 1 62  ? -7.447  -15.582 2.194   1.00 15.26 ? 61  PRO A N   1 
ATOM   532  C  CA  . PRO A 1 62  ? -6.665  -15.422 3.423   1.00 15.23 ? 61  PRO A CA  1 
ATOM   533  C  C   . PRO A 1 62  ? -5.911  -14.104 3.408   1.00 15.99 ? 61  PRO A C   1 
ATOM   534  O  O   . PRO A 1 62  ? -5.517  -13.625 2.351   1.00 15.85 ? 61  PRO A O   1 
ATOM   535  C  CB  . PRO A 1 62  ? -5.666  -16.601 3.389   1.00 16.60 ? 61  PRO A CB  1 
ATOM   536  C  CG  . PRO A 1 62  ? -6.254  -17.567 2.378   1.00 16.51 ? 61  PRO A CG  1 
ATOM   537  C  CD  . PRO A 1 62  ? -7.034  -16.758 1.403   1.00 15.65 ? 61  PRO A CD  1 
ATOM   538  N  N   . CYS A 1 63  ? -5.685  -13.544 4.585   1.00 15.83 ? 62  CYS A N   1 
ATOM   539  C  CA  . CYS A 1 63  ? -4.898  -12.326 4.696   1.00 16.25 ? 62  CYS A CA  1 
ATOM   540  C  C   . CYS A 1 63  ? -3.456  -12.640 4.342   1.00 17.18 ? 62  CYS A C   1 
ATOM   541  O  O   . CYS A 1 63  ? -2.953  -13.732 4.619   1.00 18.53 ? 62  CYS A O   1 
ATOM   542  C  CB  . CYS A 1 63  ? -4.979  -11.766 6.121   1.00 17.19 ? 62  CYS A CB  1 
ATOM   543  S  SG  . CYS A 1 63  ? -6.665  -11.341 6.601   1.00 19.46 ? 62  CYS A SG  1 
ATOM   544  N  N   . GLY A 1 64  ? -2.800  -11.681 3.714   1.00 18.14 ? 63  GLY A N   1 
ATOM   545  C  CA  . GLY A 1 64  ? -1.363  -11.746 3.507   1.00 19.14 ? 63  GLY A CA  1 
ATOM   546  C  C   . GLY A 1 64  ? -0.995  -11.128 2.189   1.00 19.27 ? 63  GLY A C   1 
ATOM   547  O  O   . GLY A 1 64  ? -1.744  -11.237 1.201   1.00 20.99 ? 63  GLY A O   1 
ATOM   548  N  N   . CYS A 1 65  ? 0.159   -10.472 2.190   0.50 17.39 ? 64  CYS A N   1 
ATOM   549  C  CA  . CYS A 1 65  ? 0.762   -9.840  1.019   0.50 15.97 ? 64  CYS A CA  1 
ATOM   550  C  C   . CYS A 1 65  ? 0.869   -10.850 -0.138  0.50 15.16 ? 64  CYS A C   1 
ATOM   551  O  O   . CYS A 1 65  ? 1.080   -12.041 0.105   0.50 15.51 ? 64  CYS A O   1 
ATOM   552  C  CB  . CYS A 1 65  ? 2.127   -9.303  1.448   0.50 16.29 ? 64  CYS A CB  1 
ATOM   553  S  SG  . CYS A 1 65  ? 2.805   -7.930  0.522   0.50 15.48 ? 64  CYS A SG  1 
ATOM   554  N  N   . CYS A 1 66  ? 0.729   -10.405 -1.390  0.50 13.72 ? 65  CYS A N   1 
ATOM   555  C  CA  . CYS A 1 66  ? 0.808   -9.002  -1.770  0.50 13.57 ? 65  CYS A CA  1 
ATOM   556  C  C   . CYS A 1 66  ? -0.182  -8.666  -2.865  0.50 13.15 ? 65  CYS A C   1 
ATOM   557  O  O   . CYS A 1 66  ? -0.339  -9.399  -3.855  0.50 13.80 ? 65  CYS A O   1 
ATOM   558  C  CB  . CYS A 1 66  ? 2.201   -8.682  -2.307  0.50 12.79 ? 65  CYS A CB  1 
ATOM   559  S  SG  . CYS A 1 66  ? 3.520   -8.885  -1.112  0.50 14.96 ? 65  CYS A SG  1 
ATOM   560  N  N   . SER A 1 67  ? -0.840  -7.534  -2.691  1.00 14.90 ? 66  SER A N   1 
ATOM   561  C  CA  . SER A 1 67  ? -1.585  -6.905  -3.752  1.00 14.25 ? 66  SER A CA  1 
ATOM   562  C  C   . SER A 1 67  ? -0.591  -6.437  -4.805  1.00 14.09 ? 66  SER A C   1 
ATOM   563  O  O   . SER A 1 67  ? 0.487   -5.891  -4.489  1.00 15.56 ? 66  SER A O   1 
ATOM   564  C  CB  . SER A 1 67  ? -2.348  -5.704  -3.220  1.00 14.60 ? 66  SER A CB  1 
ATOM   565  O  OG  . SER A 1 67  ? -3.427  -6.092  -2.370  1.00 15.84 ? 66  SER A OG  1 
ATOM   566  N  N   . TYR A 1 68  ? -0.953  -6.618  -6.053  1.00 12.42 ? 67  TYR A N   1 
ATOM   567  C  CA  . TYR A 1 68  ? -0.178  -6.050  -7.123  1.00 11.42 ? 67  TYR A CA  1 
ATOM   568  C  C   . TYR A 1 68  ? -0.082  -4.543  -6.918  1.00 10.14 ? 67  TYR A C   1 
ATOM   569  O  O   . TYR A 1 68  ? -1.047  -3.902  -6.501  1.00 10.99 ? 67  TYR A O   1 
ATOM   570  C  CB  . TYR A 1 68  ? -0.852  -6.380  -8.440  1.00 12.46 ? 67  TYR A CB  1 
ATOM   571  C  CG  . TYR A 1 68  ? 0.073   -6.176  -9.605  1.00 13.18 ? 67  TYR A CG  1 
ATOM   572  C  CD1 . TYR A 1 68  ? 0.906   -7.216  -10.066 1.00 13.96 ? 67  TYR A CD1 1 
ATOM   573  C  CD2 . TYR A 1 68  ? 0.126   -4.944  -10.264 1.00 13.65 ? 67  TYR A CD2 1 
ATOM   574  C  CE1 . TYR A 1 68  ? 1.781   -6.996  -11.163 1.00 14.64 ? 67  TYR A CE1 1 
ATOM   575  C  CE2 . TYR A 1 68  ? 0.991   -4.716  -11.336 1.00 13.81 ? 67  TYR A CE2 1 
ATOM   576  C  CZ  . TYR A 1 68  ? 1.796   -5.744  -11.789 1.00 14.55 ? 67  TYR A CZ  1 
ATOM   577  O  OH  . TYR A 1 68  ? 2.645   -5.538  -12.855 1.00 17.49 ? 67  TYR A OH  1 
ATOM   578  N  N   . VAL A 1 69  ? 1.066   -3.993  -7.265  1.00 9.99  ? 68  VAL A N   1 
ATOM   579  C  CA  . VAL A 1 69  ? 1.298   -2.562  -7.110  1.00 8.71  ? 68  VAL A CA  1 
ATOM   580  C  C   . VAL A 1 69  ? 1.054   -1.863  -8.440  1.00 9.49  ? 68  VAL A C   1 
ATOM   581  O  O   . VAL A 1 69  ? 1.741   -2.128  -9.431  1.00 10.34 ? 68  VAL A O   1 
ATOM   582  C  CB  . VAL A 1 69  ? 2.701   -2.271  -6.544  1.00 8.99  ? 68  VAL A CB  1 
ATOM   583  C  CG1 . VAL A 1 69  ? 3.018   -0.784  -6.575  1.00 8.30  ? 68  VAL A CG1 1 
ATOM   584  C  CG2 . VAL A 1 69  ? 2.805   -2.787  -5.128  1.00 10.81 ? 68  VAL A CG2 1 
ATOM   585  N  N   . GLY A 1 70  ? 0.083   -0.957  -8.467  1.00 8.91  ? 69  GLY A N   1 
ATOM   586  C  CA  . GLY A 1 70  ? -0.292  -0.330  -9.726  1.00 9.17  ? 69  GLY A CA  1 
ATOM   587  C  C   . GLY A 1 70  ? -1.190  -1.209  -10.568 1.00 8.43  ? 69  GLY A C   1 
ATOM   588  O  O   . GLY A 1 70  ? -1.699  -2.244  -10.113 1.00 9.30  ? 69  GLY A O   1 
ATOM   589  N  N   . ARG A 1 71  ? -1.366  -0.791  -11.811 1.00 9.02  ? 70  ARG A N   1 
ATOM   590  C  CA  . ARG A 1 71  ? -2.251  -1.490  -12.719 1.00 10.26 ? 70  ARG A CA  1 
ATOM   591  C  C   . ARG A 1 71  ? -1.518  -2.660  -13.355 1.00 11.43 ? 70  ARG A C   1 
ATOM   592  O  O   . ARG A 1 71  ? -0.518  -2.439  -14.046 1.00 12.47 ? 70  ARG A O   1 
ATOM   593  C  CB  . ARG A 1 71  ? -2.709  -0.530  -13.805 1.00 10.82 ? 70  ARG A CB  1 
ATOM   594  C  CG  . ARG A 1 71  ? -3.679  -1.090  -14.797 1.00 12.54 ? 70  ARG A CG  1 
ATOM   595  C  CD  . ARG A 1 71  ? -3.973  -0.035  -15.840 1.00 14.94 ? 70  ARG A CD  1 
ATOM   596  N  NE  . ARG A 1 71  ? -4.931  -0.464  -16.861 1.00 19.22 ? 70  ARG A NE  1 
ATOM   597  C  CZ  . ARG A 1 71  ? -4.597  -1.170  -17.943 1.00 19.90 ? 70  ARG A CZ  1 
ATOM   598  N  NH1 . ARG A 1 71  ? -3.344  -1.555  -18.111 1.00 19.76 ? 70  ARG A NH1 1 
ATOM   599  N  NH2 . ARG A 1 71  ? -5.524  -1.528  -18.841 1.00 22.31 ? 70  ARG A NH2 1 
ATOM   600  N  N   . ARG A 1 72  ? -1.978  -3.891  -13.100 1.00 13.24 ? 71  ARG A N   1 
ATOM   601  C  CA  . ARG A 1 72  ? -1.343  -5.069  -13.709 1.00 15.90 ? 71  ARG A CA  1 
ATOM   602  C  C   . ARG A 1 72  ? -1.598  -5.111  -15.200 1.00 16.61 ? 71  ARG A C   1 
ATOM   603  O  O   . ARG A 1 72  ? -0.659  -5.327  -15.990 1.00 17.85 ? 71  ARG A O   1 
ATOM   604  C  CB  . ARG A 1 72  ? -1.830  -6.360  -13.050 1.00 16.85 ? 71  ARG A CB  1 
ATOM   605  C  CG  . ARG A 1 72  ? -1.051  -7.568  -13.638 1.00 20.43 ? 71  ARG A CG  1 
ATOM   606  C  CD  . ARG A 1 72  ? -1.008  -8.729  -12.693 1.00 24.89 ? 71  ARG A CD  1 
ATOM   607  N  NE  . ARG A 1 72  ? -2.348  -9.240  -12.459 1.00 25.76 ? 71  ARG A NE  1 
ATOM   608  C  CZ  . ARG A 1 72  ? -2.632  -10.222 -11.608 1.00 28.77 ? 71  ARG A CZ  1 
ATOM   609  N  NH1 . ARG A 1 72  ? -1.656  -10.791 -10.904 1.00 31.84 ? 71  ARG A NH1 1 
ATOM   610  N  NH2 . ARG A 1 72  ? -3.890  -10.628 -11.452 1.00 29.68 ? 71  ARG A NH2 1 
ATOM   611  N  N   . GLY A 1 73  ? -2.852  -4.889  -15.564 1.00 17.11 ? 72  GLY A N   1 
ATOM   612  C  CA  . GLY A 1 73  ? -3.247  -4.910  -16.970 1.00 18.39 ? 72  GLY A CA  1 
ATOM   613  C  C   . GLY A 1 73  ? -3.488  -6.330  -17.439 1.00 19.24 ? 72  GLY A C   1 
ATOM   614  O  O   . GLY A 1 73  ? -3.038  -7.308  -16.827 1.00 21.16 ? 72  GLY A O   1 
ATOM   615  N  N   . GLY A 1 74  A -4.242  -6.447  -18.520 1.00 20.21 ? 72  GLY A N   1 
ATOM   616  C  CA  . GLY A 1 74  A -4.531  -7.750  -19.116 1.00 20.62 ? 72  GLY A CA  1 
ATOM   617  C  C   . GLY A 1 74  A -5.511  -8.613  -18.345 1.00 19.68 ? 72  GLY A C   1 
ATOM   618  O  O   . GLY A 1 74  A -5.672  -9.808  -18.650 1.00 21.04 ? 72  GLY A O   1 
ATOM   619  N  N   . GLY A 1 75  ? -6.176  -8.037  -17.337 1.00 17.39 ? 73  GLY A N   1 
ATOM   620  C  CA  . GLY A 1 75  ? -7.149  -8.799  -16.567 1.00 15.98 ? 73  GLY A CA  1 
ATOM   621  C  C   . GLY A 1 75  ? -7.329  -8.245  -15.160 1.00 14.65 ? 73  GLY A C   1 
ATOM   622  O  O   . GLY A 1 75  ? -6.776  -7.202  -14.799 1.00 14.92 ? 73  GLY A O   1 
ATOM   623  N  N   . PRO A 1 76  ? -8.118  -8.927  -14.347 1.00 13.92 ? 74  PRO A N   1 
ATOM   624  C  CA  . PRO A 1 76  ? -8.368  -8.532  -12.958 1.00 13.47 ? 74  PRO A CA  1 
ATOM   625  C  C   . PRO A 1 76  ? -7.139  -8.680  -12.061 1.00 11.92 ? 74  PRO A C   1 
ATOM   626  O  O   . PRO A 1 76  ? -6.234  -9.472  -12.346 1.00 13.37 ? 74  PRO A O   1 
ATOM   627  C  CB  . PRO A 1 76  ? -9.454  -9.510  -12.524 1.00 14.83 ? 74  PRO A CB  1 
ATOM   628  C  CG  . PRO A 1 76  ? -9.179  -10.742 -13.370 1.00 14.74 ? 74  PRO A CG  1 
ATOM   629  C  CD  . PRO A 1 76  ? -8.804  -10.172 -14.725 1.00 14.59 ? 74  PRO A CD  1 
ATOM   630  N  N   . GLN A 1 77  ? -7.147  -7.938  -10.964 1.00 9.90  ? 75  GLN A N   1 
ATOM   631  C  CA  . GLN A 1 77  ? -6.145  -8.118  -9.933  1.00 9.56  ? 75  GLN A CA  1 
ATOM   632  C  C   . GLN A 1 77  ? -6.871  -8.082  -8.576  1.00 8.81  ? 75  GLN A C   1 
ATOM   633  O  O   . GLN A 1 77  ? -7.728  -7.227  -8.346  1.00 10.50 ? 75  GLN A O   1 
ATOM   634  C  CB  . GLN A 1 77  ? -5.019  -7.077  -10.044 1.00 11.63 ? 75  GLN A CB  1 
ATOM   635  C  CG  . GLN A 1 77  ? -5.491  -5.666  -9.847  1.00 10.82 ? 75  GLN A CG  1 
ATOM   636  C  CD  . GLN A 1 77  ? -4.475  -4.649  -10.309 1.00 12.26 ? 75  GLN A CD  1 
ATOM   637  O  OE1 . GLN A 1 77  ? -4.291  -4.451  -11.510 1.00 12.79 ? 75  GLN A OE1 1 
ATOM   638  N  NE2 . GLN A 1 77  ? -3.783  -4.023  -9.365  1.00 12.66 ? 75  GLN A NE2 1 
ATOM   639  N  N   . ALA A 1 78  ? -6.539  -9.042  -7.722  1.00 8.93  ? 76  ALA A N   1 
ATOM   640  C  CA  . ALA A 1 78  ? -7.270  -9.249  -6.499  1.00 8.79  ? 76  ALA A CA  1 
ATOM   641  C  C   . ALA A 1 78  ? -6.658  -8.495  -5.346  1.00 8.95  ? 76  ALA A C   1 
ATOM   642  O  O   . ALA A 1 78  ? -5.438  -8.467  -5.194  1.00 10.75 ? 76  ALA A O   1 
ATOM   643  C  CB  . ALA A 1 78  ? -7.269  -10.723 -6.171  1.00 10.31 ? 76  ALA A CB  1 
ATOM   644  N  N   . ILE A 1 79  ? -7.540  -7.949  -4.515  1.00 9.74  ? 77  ILE A N   1 
ATOM   645  C  CA  . ILE A 1 79  ? -7.143  -7.489  -3.174  1.00 9.94  ? 77  ILE A CA  1 
ATOM   646  C  C   . ILE A 1 79  ? -7.709  -8.514  -2.203  1.00 9.34  ? 77  ILE A C   1 
ATOM   647  O  O   . ILE A 1 79  ? -8.927  -8.704  -2.131  1.00 9.84  ? 77  ILE A O   1 
ATOM   648  C  CB  . ILE A 1 79  ? -7.779  -6.140  -2.828  1.00 11.20 ? 77  ILE A CB  1 
ATOM   649  C  CG1 . ILE A 1 79  ? -7.400  -5.075  -3.857  1.00 12.42 ? 77  ILE A CG1 1 
ATOM   650  C  CG2 . ILE A 1 79  ? -7.343  -5.725  -1.426  1.00 13.38 ? 77  ILE A CG2 1 
ATOM   651  C  CD1 . ILE A 1 79  ? -8.007  -3.735  -3.482  1.00 16.49 ? 77  ILE A CD1 1 
ATOM   652  N  N   . SER A 1 80  ? -6.833  -9.201  -1.486  1.00 9.90  ? 78  SER A N   1 
ATOM   653  C  CA  . SER A 1 80  ? -7.253  -10.269 -0.580  1.00 11.23 ? 78  SER A CA  1 
ATOM   654  C  C   . SER A 1 80  ? -7.743  -9.704  0.713   1.00 11.80 ? 78  SER A C   1 
ATOM   655  O  O   . SER A 1 80  ? -6.983  -9.021  1.417   1.00 14.65 ? 78  SER A O   1 
ATOM   656  C  CB  . SER A 1 80  ? -6.081  -11.191 -0.298  1.00 12.51 ? 78  SER A CB  1 
ATOM   657  O  OG  . SER A 1 80  ? -5.720  -11.932 -1.459  1.00 15.96 ? 78  SER A OG  1 
ATOM   658  N  N   . ILE A 1 81  ? -8.978  -10.028 1.078   1.00 10.67 ? 79  ILE A N   1 
ATOM   659  C  CA  A ILE A 1 81  ? -9.576  -9.534  2.299   0.30 11.02 ? 79  ILE A CA  1 
ATOM   660  C  CA  B ILE A 1 81  ? -9.621  -9.515  2.296   0.70 11.42 ? 79  ILE A CA  1 
ATOM   661  C  C   . ILE A 1 81  ? -10.211 -10.704 3.072   1.00 11.10 ? 79  ILE A C   1 
ATOM   662  O  O   . ILE A 1 81  ? -10.915 -11.550 2.510   1.00 11.56 ? 79  ILE A O   1 
ATOM   663  C  CB  A ILE A 1 81  ? -10.572 -8.404  1.986   0.30 11.03 ? 79  ILE A CB  1 
ATOM   664  C  CB  B ILE A 1 81  ? -10.778 -8.547  2.002   0.70 11.81 ? 79  ILE A CB  1 
ATOM   665  C  CG1 A ILE A 1 81  ? -9.803  -7.189  1.436   0.30 10.97 ? 79  ILE A CG1 1 
ATOM   666  C  CG1 B ILE A 1 81  ? -10.372 -7.427  1.033   0.70 14.61 ? 79  ILE A CG1 1 
ATOM   667  C  CG2 A ILE A 1 81  ? -11.407 -8.041  3.225   0.30 11.81 ? 79  ILE A CG2 1 
ATOM   668  C  CG2 B ILE A 1 81  ? -11.317 -7.958  3.336   0.70 12.93 ? 79  ILE A CG2 1 
ATOM   669  C  CD1 A ILE A 1 81  ? -10.587 -6.358  0.459   0.30 12.85 ? 79  ILE A CD1 1 
ATOM   670  C  CD1 B ILE A 1 81  ? -9.542  -6.322  1.643   0.70 17.65 ? 79  ILE A CD1 1 
ATOM   671  N  N   . GLY A 1 82  ? -9.902  -10.712 4.451   1.00 14.73 ? 81  GLY A N   1 
ATOM   672  C  CA  . GLY A 1 82  ? -10.637 -11.706 5.234   1.00 16.45 ? 81  GLY A CA  1 
ATOM   673  C  C   . GLY A 1 82  ? -10.830 -11.091 6.592   1.00 17.88 ? 81  GLY A C   1 
ATOM   674  O  O   . GLY A 1 82  ? -10.465 -9.943  6.834   1.00 16.15 ? 81  GLY A O   1 
ATOM   675  N  N   . LYS A 1 83  ? -11.398 -11.875 7.501   1.00 19.87 ? 82  LYS A N   1 
ATOM   676  C  CA  . LYS A 1 83  ? -11.604 -11.412 8.881   1.00 22.40 ? 82  LYS A CA  1 
ATOM   677  C  C   . LYS A 1 83  ? -10.351 -10.806 9.500   1.00 21.40 ? 82  LYS A C   1 
ATOM   678  O  O   . LYS A 1 83  ? -10.436 -9.823  10.216  1.00 24.37 ? 82  LYS A O   1 
ATOM   679  C  CB  . LYS A 1 83  ? -12.173 -12.524 9.771   1.00 23.87 ? 82  LYS A CB  1 
ATOM   680  C  CG  . LYS A 1 83  ? -13.639 -12.344 10.046  1.00 29.03 ? 82  LYS A CG  1 
ATOM   681  C  CD  . LYS A 1 83  ? -14.475 -12.681 8.822   1.00 32.67 ? 82  LYS A CD  1 
ATOM   682  C  CE  . LYS A 1 83  ? -15.644 -11.727 8.692   1.00 34.77 ? 82  LYS A CE  1 
ATOM   683  N  NZ  . LYS A 1 83  ? -16.766 -12.067 9.596   1.00 36.42 ? 82  LYS A NZ  1 
ATOM   684  N  N   . ASN A 1 84  ? -9.174  -11.357 9.257   1.00 21.39 ? 83  ASN A N   1 
ATOM   685  C  CA  . ASN A 1 84  ? -8.037  -10.676 9.915   1.00 23.38 ? 83  ASN A CA  1 
ATOM   686  C  C   . ASN A 1 84  ? -7.707  -9.217  9.465   1.00 20.15 ? 83  ASN A C   1 
ATOM   687  O  O   . ASN A 1 84  ? -6.873  -8.543  10.084  1.00 19.36 ? 83  ASN A O   1 
ATOM   688  C  CB  . ASN A 1 84  ? -6.788  -11.566 9.896   1.00 25.83 ? 83  ASN A CB  1 
ATOM   689  C  CG  . ASN A 1 84  ? -6.213  -11.833 11.285  1.00 30.50 ? 83  ASN A CG  1 
ATOM   690  O  OD1 . ASN A 1 84  ? -6.470  -11.101 12.254  1.00 37.07 ? 83  ASN A OD1 1 
ATOM   691  N  ND2 . ASN A 1 84  ? -5.418  -12.897 11.383  1.00 34.73 ? 83  ASN A ND2 1 
ATOM   692  N  N   . CYS A 1 85  ? -8.353  -8.712  8.404   1.00 16.01 ? 84  CYS A N   1 
ATOM   693  C  CA  . CYS A 1 85  ? -7.670  -7.709  7.587   1.00 15.36 ? 84  CYS A CA  1 
ATOM   694  C  C   . CYS A 1 85  ? -8.670  -7.035  6.682   1.00 13.53 ? 84  CYS A C   1 
ATOM   695  O  O   . CYS A 1 85  ? -8.479  -6.915  5.471   1.00 15.26 ? 84  CYS A O   1 
ATOM   696  C  CB  . CYS A 1 85  ? -6.537  -8.352  6.772   1.00 15.89 ? 84  CYS A CB  1 
ATOM   697  S  SG  . CYS A 1 85  ? -6.978  -9.592  5.588   1.00 15.87 ? 84  CYS A SG  1 
ATOM   698  N  N   . ASP A 1 86  ? -9.720  -6.535  7.296   1.00 12.00 ? 85  ASP A N   1 
ATOM   699  C  CA  . ASP A 1 86  ? -10.818 -5.930  6.595   1.00 12.26 ? 85  ASP A CA  1 
ATOM   700  C  C   . ASP A 1 86  ? -11.184 -4.521  7.077   1.00 11.15 ? 85  ASP A C   1 
ATOM   701  O  O   . ASP A 1 86  ? -12.082 -3.917  6.534   1.00 12.12 ? 85  ASP A O   1 
ATOM   702  C  CB  . ASP A 1 86  ? -12.027 -6.864  6.606   1.00 13.68 ? 85  ASP A CB  1 
ATOM   703  C  CG  . ASP A 1 86  ? -12.597 -7.095  7.990   1.00 15.23 ? 85  ASP A CG  1 
ATOM   704  O  OD1 . ASP A 1 86  ? -11.966 -6.691  8.988   1.00 15.71 ? 85  ASP A OD1 1 
ATOM   705  O  OD2 . ASP A 1 86  ? -13.692 -7.685  8.098   1.00 19.00 ? 85  ASP A OD2 1 
ATOM   706  N  N   . LYS A 1 87  ? -10.467 -3.994  8.051   1.00 10.18 ? 86  LYS A N   1 
ATOM   707  C  CA  . LYS A 1 87  ? -10.810 -2.670  8.574   1.00 10.47 ? 86  LYS A CA  1 
ATOM   708  C  C   . LYS A 1 87  ? -10.477 -1.594  7.560   1.00 8.38  ? 86  LYS A C   1 
ATOM   709  O  O   . LYS A 1 87  ? -9.588  -1.769  6.709   1.00 8.13  ? 86  LYS A O   1 
ATOM   710  C  CB  . LYS A 1 87  ? -10.050 -2.383  9.855   1.00 12.42 ? 86  LYS A CB  1 
ATOM   711  C  CG  . LYS A 1 87  ? -10.579 -3.118  11.076  1.00 16.34 ? 86  LYS A CG  1 
ATOM   712  C  CD  . LYS A 1 87  ? -9.681  -2.864  12.287  1.00 20.95 ? 86  LYS A CD  1 
ATOM   713  C  CE  . LYS A 1 87  ? -10.301 -3.423  13.563  1.00 26.58 ? 86  LYS A CE  1 
ATOM   714  N  NZ  . LYS A 1 87  ? -9.539  -2.937  14.757  1.00 31.03 ? 86  LYS A NZ  1 
ATOM   715  N  N   . PHE A 1 88  ? -11.129 -0.444  7.716   1.00 8.67  ? 87  PHE A N   1 
ATOM   716  C  CA  . PHE A 1 88  ? -10.964 0.731   6.856   1.00 8.39  ? 87  PHE A CA  1 
ATOM   717  C  C   . PHE A 1 88  ? -9.499  1.013   6.527   1.00 7.89  ? 87  PHE A C   1 
ATOM   718  O  O   . PHE A 1 88  ? -9.129  1.088   5.373   1.00 7.62  ? 87  PHE A O   1 
ATOM   719  C  CB  . PHE A 1 88  ? -11.651 1.927   7.506   1.00 9.05  ? 87  PHE A CB  1 
ATOM   720  C  CG  . PHE A 1 88  ? -11.359 3.233   6.833   1.00 8.02  ? 87  PHE A CG  1 
ATOM   721  C  CD1 . PHE A 1 88  ? -10.346 4.053   7.320   1.00 8.83  ? 87  PHE A CD1 1 
ATOM   722  C  CD2 . PHE A 1 88  ? -12.056 3.647   5.693   1.00 9.08  ? 87  PHE A CD2 1 
ATOM   723  C  CE1 . PHE A 1 88  ? -10.070 5.300   6.730   1.00 8.91  ? 87  PHE A CE1 1 
ATOM   724  C  CE2 . PHE A 1 88  ? -11.797 4.894   5.124   1.00 9.63  ? 87  PHE A CE2 1 
ATOM   725  C  CZ  . PHE A 1 88  ? -10.779 5.698   5.617   1.00 8.57  ? 87  PHE A CZ  1 
ATOM   726  N  N   . GLY A 1 89  ? -8.658  1.149   7.553   1.00 7.65  ? 88  GLY A N   1 
ATOM   727  C  CA  . GLY A 1 89  ? -7.269  1.552   7.320   1.00 7.77  ? 88  GLY A CA  1 
ATOM   728  C  C   . GLY A 1 89  ? -6.451  0.527   6.592   1.00 7.21  ? 88  GLY A C   1 
ATOM   729  O  O   . GLY A 1 89  ? -5.556  0.859   5.786   1.00 7.38  ? 88  GLY A O   1 
ATOM   730  N  N   . ILE A 1 90  ? -6.743  -0.747  6.844   1.00 7.32  ? 89  ILE A N   1 
ATOM   731  C  CA  A ILE A 1 90  ? -6.097  -1.848  6.118   0.52 7.21  ? 89  ILE A CA  1 
ATOM   732  C  CA  C ILE A 1 90  ? -6.042  -1.805  6.096   0.47 7.26  ? 89  ILE A CA  1 
ATOM   733  C  C   . ILE A 1 90  ? -6.466  -1.778  4.631   1.00 6.42  ? 89  ILE A C   1 
ATOM   734  O  O   . ILE A 1 90  ? -5.641  -1.931  3.740   1.00 6.43  ? 89  ILE A O   1 
ATOM   735  C  CB  A ILE A 1 90  ? -6.567  -3.199  6.734   0.52 7.86  ? 89  ILE A CB  1 
ATOM   736  C  CB  C ILE A 1 90  ? -6.300  -3.191  6.691   0.47 8.50  ? 89  ILE A CB  1 
ATOM   737  C  CG1 A ILE A 1 90  ? -6.094  -3.302  8.199   0.52 9.45  ? 89  ILE A CG1 1 
ATOM   738  C  CG1 C ILE A 1 90  ? -5.846  -3.199  8.147   0.47 9.72  ? 89  ILE A CG1 1 
ATOM   739  C  CG2 A ILE A 1 90  ? -6.125  -4.395  5.886   0.52 8.82  ? 89  ILE A CG2 1 
ATOM   740  C  CG2 C ILE A 1 90  ? -5.529  -4.261  5.916   0.47 8.61  ? 89  ILE A CG2 1 
ATOM   741  C  CD1 A ILE A 1 90  ? -4.621  -2.940  8.460   0.52 10.38 ? 89  ILE A CD1 1 
ATOM   742  C  CD1 C ILE A 1 90  ? -6.120  -4.497  8.828   0.47 12.91 ? 89  ILE A CD1 1 
ATOM   743  N  N   . VAL A 1 91  ? -7.757  -1.556  4.360   1.00 6.65  ? 90  VAL A N   1 
ATOM   744  C  CA  . VAL A 1 91  ? -8.204  -1.458  2.975   1.00 6.99  ? 90  VAL A CA  1 
ATOM   745  C  C   . VAL A 1 91  ? -7.583  -0.223  2.304   1.00 6.45  ? 90  VAL A C   1 
ATOM   746  O  O   . VAL A 1 91  ? -7.188  -0.270  1.138   1.00 6.35  ? 90  VAL A O   1 
ATOM   747  C  CB  . VAL A 1 91  ? -9.760  -1.502  2.869   1.00 7.36  ? 90  VAL A CB  1 
ATOM   748  C  CG1 . VAL A 1 91  ? -10.186 -1.391  1.386   1.00 8.14  ? 90  VAL A CG1 1 
ATOM   749  C  CG2 . VAL A 1 91  ? -10.298 -2.802  3.514   1.00 9.92  ? 90  VAL A CG2 1 
ATOM   750  N  N   . VAL A 1 92  ? -7.498  0.903   3.020   1.00 6.35  ? 91  VAL A N   1 
ATOM   751  C  CA  . VAL A 1 92  ? -6.868  2.086   2.447   1.00 6.78  ? 91  VAL A CA  1 
ATOM   752  C  C   . VAL A 1 92  ? -5.425  1.776   2.088   1.00 5.56  ? 91  VAL A C   1 
ATOM   753  O  O   . VAL A 1 92  ? -4.950  2.198   1.017   1.00 6.01  ? 91  VAL A O   1 
ATOM   754  C  CB  . VAL A 1 92  ? -6.985  3.289   3.434   1.00 6.40  ? 91  VAL A CB  1 
ATOM   755  C  CG1 . VAL A 1 92  ? -6.155  4.470   2.992   1.00 7.00  ? 91  VAL A CG1 1 
ATOM   756  C  CG2 . VAL A 1 92  ? -8.449  3.731   3.555   1.00 8.37  ? 91  VAL A CG2 1 
ATOM   757  N  N   . HIS A 1 93  ? -4.710  1.053   2.941   1.00 5.98  ? 92  HIS A N   1 
ATOM   758  C  CA  . HIS A 1 93  ? -3.342  0.611   2.642   1.00 6.02  ? 92  HIS A CA  1 
ATOM   759  C  C   . HIS A 1 93  ? -3.278  -0.241  1.378   1.00 4.96  ? 92  HIS A C   1 
ATOM   760  O  O   . HIS A 1 93  ? -2.447  -0.013  0.496   1.00 5.76  ? 92  HIS A O   1 
ATOM   761  C  CB  . HIS A 1 93  ? -2.795  -0.192  3.840   1.00 5.94  ? 92  HIS A CB  1 
ATOM   762  C  CG  . HIS A 1 93  ? -1.480  -0.876  3.610   1.00 5.79  ? 92  HIS A CG  1 
ATOM   763  N  ND1 . HIS A 1 93  ? -0.281  -0.372  4.067   1.00 6.30  ? 92  HIS A ND1 1 
ATOM   764  C  CD2 . HIS A 1 93  ? -1.170  -2.043  2.977   1.00 6.45  ? 92  HIS A CD2 1 
ATOM   765  C  CE1 . HIS A 1 93  ? 0.698   -1.197  3.718   1.00 7.01  ? 92  HIS A CE1 1 
ATOM   766  N  NE2 . HIS A 1 93  ? 0.196   -2.219  3.053   1.00 6.36  ? 92  HIS A NE2 1 
ATOM   767  N  N   . GLU A 1 94  ? -4.178  -1.222  1.259   1.00 5.49  ? 93  GLU A N   1 
ATOM   768  C  CA  . GLU A 1 94  ? -4.159  -2.076  0.072   1.00 6.33  ? 93  GLU A CA  1 
ATOM   769  C  C   . GLU A 1 94  ? -4.489  -1.269  -1.178  1.00 5.98  ? 93  GLU A C   1 
ATOM   770  O  O   . GLU A 1 94  ? -3.901  -1.508  -2.238  1.00 6.19  ? 93  GLU A O   1 
ATOM   771  C  CB  . GLU A 1 94  ? -5.170  -3.222  0.218   1.00 7.44  ? 93  GLU A CB  1 
ATOM   772  C  CG  . GLU A 1 94  ? -4.769  -4.259  1.322   1.00 8.43  ? 93  GLU A CG  1 
ATOM   773  C  CD  . GLU A 1 94  ? -3.380  -4.842  1.160   1.00 9.33  ? 93  GLU A CD  1 
ATOM   774  O  OE1 . GLU A 1 94  ? -2.921  -5.026  0.031   1.00 12.66 ? 93  GLU A OE1 1 
ATOM   775  O  OE2 . GLU A 1 94  ? -2.767  -5.142  2.201   1.00 14.94 ? 93  GLU A OE2 1 
ATOM   776  N  N   . LEU A 1 95  ? -5.379  -0.281  -1.079  1.00 5.81  ? 94  LEU A N   1 
ATOM   777  C  CA  . LEU A 1 95  ? -5.636  0.583   -2.206  1.00 5.51  ? 94  LEU A CA  1 
ATOM   778  C  C   . LEU A 1 95  ? -4.430  1.465   -2.515  1.00 5.38  ? 94  LEU A C   1 
ATOM   779  O  O   . LEU A 1 95  ? -4.215  1.819   -3.683  1.00 6.49  ? 94  LEU A O   1 
ATOM   780  C  CB  . LEU A 1 95  ? -6.919  1.410   -1.978  1.00 6.70  ? 94  LEU A CB  1 
ATOM   781  C  CG  . LEU A 1 95  ? -8.212  0.602   -1.941  1.00 6.89  ? 94  LEU A CG  1 
ATOM   782  C  CD1 . LEU A 1 95  ? -9.356  1.474   -1.444  1.00 8.49  ? 94  LEU A CD1 1 
ATOM   783  C  CD2 . LEU A 1 95  ? -8.531  0.032   -3.312  1.00 8.37  ? 94  LEU A CD2 1 
ATOM   784  N  N   . GLY A 1 96  ? -3.574  1.758   -1.522  1.00 5.19  ? 95  GLY A N   1 
ATOM   785  C  CA  . GLY A 1 96  ? -2.300  2.414   -1.819  1.00 5.60  ? 95  GLY A CA  1 
ATOM   786  C  C   . GLY A 1 96  ? -1.451  1.564   -2.721  1.00 5.47  ? 95  GLY A C   1 
ATOM   787  O  O   . GLY A 1 96  ? -0.785  2.073   -3.648  1.00 6.04  ? 95  GLY A O   1 
ATOM   788  N  N   . HIS A 1 97  ? -1.422  0.246   -2.486  1.00 5.60  ? 96  HIS A N   1 
ATOM   789  C  CA  . HIS A 1 97  ? -0.711  -0.636  -3.436  1.00 5.12  ? 96  HIS A CA  1 
ATOM   790  C  C   . HIS A 1 97  ? -1.368  -0.524  -4.807  1.00 5.89  ? 96  HIS A C   1 
ATOM   791  O  O   . HIS A 1 97  ? -0.667  -0.333  -5.798  1.00 6.09  ? 96  HIS A O   1 
ATOM   792  C  CB  . HIS A 1 97  ? -0.711  -2.095  -2.965  1.00 6.05  ? 96  HIS A CB  1 
ATOM   793  C  CG  . HIS A 1 97  ? 0.146   -2.333  -1.765  1.00 5.75  ? 96  HIS A CG  1 
ATOM   794  N  ND1 . HIS A 1 97  ? 1.471   -1.928  -1.687  1.00 6.19  ? 96  HIS A ND1 1 
ATOM   795  C  CD2 . HIS A 1 97  ? -0.113  -3.007  -0.617  1.00 5.48  ? 96  HIS A CD2 1 
ATOM   796  C  CE1 . HIS A 1 97  ? 1.971   -2.358  -0.533  1.00 6.05  ? 96  HIS A CE1 1 
ATOM   797  N  NE2 . HIS A 1 97  ? 1.031   -3.016  0.137   1.00 6.06  ? 96  HIS A NE2 1 
ATOM   798  N  N   . VAL A 1 98  ? -2.702  -0.643  -4.909  1.00 6.08  ? 97  VAL A N   1 
ATOM   799  C  CA  . VAL A 1 98  ? -3.356  -0.570  -6.201  1.00 6.60  ? 97  VAL A CA  1 
ATOM   800  C  C   . VAL A 1 98  ? -3.006  0.690   -6.962  1.00 7.03  ? 97  VAL A C   1 
ATOM   801  O  O   . VAL A 1 98  ? -2.772  0.642   -8.169  1.00 7.41  ? 97  VAL A O   1 
ATOM   802  C  CB  . VAL A 1 98  ? -4.881  -0.575  -5.961  1.00 7.53  ? 97  VAL A CB  1 
ATOM   803  C  CG1 . VAL A 1 98  ? -5.655  -0.197  -7.228  1.00 8.36  ? 97  VAL A CG1 1 
ATOM   804  C  CG2 . VAL A 1 98  ? -5.340  -1.970  -5.481  1.00 8.61  ? 97  VAL A CG2 1 
ATOM   805  N  N   . VAL A 1 99  ? -2.959  1.835   -6.275  1.00 6.57  ? 98  VAL A N   1 
ATOM   806  C  CA  A VAL A 1 99  ? -2.676  3.141   -6.860  0.60 8.18  ? 98  VAL A CA  1 
ATOM   807  C  CA  B VAL A 1 99  ? -2.696  3.050   -7.040  0.40 7.49  ? 98  VAL A CA  1 
ATOM   808  C  C   . VAL A 1 99  ? -1.250  3.203   -7.458  1.00 7.95  ? 98  VAL A C   1 
ATOM   809  O  O   . VAL A 1 99  ? -0.960  3.962   -8.387  1.00 8.01  ? 98  VAL A O   1 
ATOM   810  C  CB  A VAL A 1 99  ? -2.959  4.235   -5.764  0.60 8.93  ? 98  VAL A CB  1 
ATOM   811  C  CB  B VAL A 1 99  ? -3.171  4.336   -6.376  0.40 7.58  ? 98  VAL A CB  1 
ATOM   812  C  CG1 A VAL A 1 99  ? -2.372  5.588   -6.078  0.60 11.51 ? 98  VAL A CG1 1 
ATOM   813  C  CG1 B VAL A 1 99  ? -4.679  4.246   -6.015  0.40 8.43  ? 98  VAL A CG1 1 
ATOM   814  C  CG2 A VAL A 1 99  ? -4.475  4.391   -5.529  0.60 9.29  ? 98  VAL A CG2 1 
ATOM   815  C  CG2 B VAL A 1 99  ? -2.274  4.711   -5.189  0.40 6.79  ? 98  VAL A CG2 1 
ATOM   816  N  N   . GLY A 1 100 ? -0.330  2.459   -6.849  1.00 7.30  ? 99  GLY A N   1 
ATOM   817  C  CA  . GLY A 1 100 ? 1.049   2.423   -7.321  1.00 7.04  ? 99  GLY A CA  1 
ATOM   818  C  C   . GLY A 1 100 ? 2.124   2.610   -6.279  1.00 6.15  ? 99  GLY A C   1 
ATOM   819  O  O   . GLY A 1 100 ? 3.261   2.907   -6.647  1.00 7.98  ? 99  GLY A O   1 
ATOM   820  N  N   . PHE A 1 101 ? 1.820   2.392   -4.991  1.00 6.31  ? 100 PHE A N   1 
ATOM   821  C  CA  A PHE A 1 101 ? 2.828   2.488   -3.943  0.70 6.04  ? 100 PHE A CA  1 
ATOM   822  C  CA  B PHE A 1 101 ? 2.797   2.523   -3.904  0.30 5.81  ? 100 PHE A CA  1 
ATOM   823  C  C   . PHE A 1 101 ? 3.287   1.144   -3.440  1.00 5.79  ? 100 PHE A C   1 
ATOM   824  O  O   . PHE A 1 101 ? 2.457   0.321   -3.053  1.00 6.21  ? 100 PHE A O   1 
ATOM   825  C  CB  A PHE A 1 101 ? 2.317   3.302   -2.770  0.70 6.38  ? 100 PHE A CB  1 
ATOM   826  C  CB  B PHE A 1 101 ? 2.185   3.211   -2.665  0.30 5.77  ? 100 PHE A CB  1 
ATOM   827  C  CG  A PHE A 1 101 ? 2.070   4.724   -3.122  0.70 7.33  ? 100 PHE A CG  1 
ATOM   828  C  CG  B PHE A 1 101 ? 1.887   4.699   -2.821  0.30 5.41  ? 100 PHE A CG  1 
ATOM   829  C  CD1 A PHE A 1 101 ? 0.807   5.171   -3.477  0.70 9.53  ? 100 PHE A CD1 1 
ATOM   830  C  CD1 B PHE A 1 101 ? 2.445   5.473   -3.839  0.30 7.48  ? 100 PHE A CD1 1 
ATOM   831  C  CD2 A PHE A 1 101 ? 3.135   5.611   -3.195  0.70 7.70  ? 100 PHE A CD2 1 
ATOM   832  C  CD2 B PHE A 1 101 ? 1.069   5.341   -1.892  0.30 4.65  ? 100 PHE A CD2 1 
ATOM   833  C  CE1 A PHE A 1 101 ? 0.615   6.503   -3.839  0.70 9.88  ? 100 PHE A CE1 1 
ATOM   834  C  CE1 B PHE A 1 101 ? 2.142   6.853   -3.942  0.30 6.14  ? 100 PHE A CE1 1 
ATOM   835  C  CE2 A PHE A 1 101 ? 2.939   6.939   -3.531  0.70 9.97  ? 100 PHE A CE2 1 
ATOM   836  C  CE2 B PHE A 1 101 ? 0.778   6.723   -1.997  0.30 7.09  ? 100 PHE A CE2 1 
ATOM   837  C  CZ  A PHE A 1 101 ? 1.693   7.364   -3.855  0.70 9.62  ? 100 PHE A CZ  1 
ATOM   838  C  CZ  B PHE A 1 101 ? 1.333   7.468   -3.007  0.30 4.90  ? 100 PHE A CZ  1 
ATOM   839  N  N   . TRP A 1 102 ? 4.617   0.965   -3.374  1.00 5.94  ? 101 TRP A N   1 
ATOM   840  C  CA  . TRP A 1 102 ? 5.207   -0.109  -2.600  1.00 5.90  ? 101 TRP A CA  1 
ATOM   841  C  C   . TRP A 1 102 ? 5.259   0.324   -1.124  1.00 6.01  ? 101 TRP A C   1 
ATOM   842  O  O   . TRP A 1 102 ? 4.895   1.453   -0.776  1.00 6.35  ? 101 TRP A O   1 
ATOM   843  C  CB  . TRP A 1 102 ? 6.618   -0.422  -3.144  1.00 6.77  ? 101 TRP A CB  1 
ATOM   844  C  CG  . TRP A 1 102 ? 6.631   -0.763  -4.610  1.00 6.70  ? 101 TRP A CG  1 
ATOM   845  C  CD1 . TRP A 1 102 ? 6.803   0.095   -5.665  1.00 8.28  ? 101 TRP A CD1 1 
ATOM   846  C  CD2 . TRP A 1 102 ? 6.465   -2.074  -5.176  1.00 6.88  ? 101 TRP A CD2 1 
ATOM   847  N  NE1 . TRP A 1 102 ? 6.718   -0.608  -6.861  1.00 8.55  ? 101 TRP A NE1 1 
ATOM   848  C  CE2 . TRP A 1 102 ? 6.530   -1.939  -6.582  1.00 7.80  ? 101 TRP A CE2 1 
ATOM   849  C  CE3 . TRP A 1 102 ? 6.271   -3.341  -4.628  1.00 7.58  ? 101 TRP A CE3 1 
ATOM   850  C  CZ2 . TRP A 1 102 ? 6.419   -3.031  -7.450  1.00 8.65  ? 101 TRP A CZ2 1 
ATOM   851  C  CZ3 . TRP A 1 102 ? 6.149   -4.427  -5.496  1.00 9.05  ? 101 TRP A CZ3 1 
ATOM   852  C  CH2 . TRP A 1 102 ? 6.244   -4.265  -6.890  1.00 9.03  ? 101 TRP A CH2 1 
ATOM   853  N  N   . HIS A 1 103 ? 5.729   -0.567  -0.244  1.00 6.16  ? 102 HIS A N   1 
ATOM   854  C  CA  . HIS A 1 103 ? 5.910   -0.162  1.152   1.00 6.17  ? 102 HIS A CA  1 
ATOM   855  C  C   . HIS A 1 103 ? 6.919   0.957   1.322   1.00 6.15  ? 102 HIS A C   1 
ATOM   856  O  O   . HIS A 1 103 ? 7.954   0.947   0.644   1.00 6.41  ? 102 HIS A O   1 
ATOM   857  C  CB  . HIS A 1 103 ? 6.323   -1.380  1.992   1.00 6.49  ? 102 HIS A CB  1 
ATOM   858  C  CG  . HIS A 1 103 ? 5.195   -2.353  2.123   1.00 6.17  ? 102 HIS A CG  1 
ATOM   859  N  ND1 . HIS A 1 103 ? 5.356   -3.718  2.020   1.00 6.76  ? 102 HIS A ND1 1 
ATOM   860  C  CD2 . HIS A 1 103 ? 3.862   -2.155  2.304   1.00 6.10  ? 102 HIS A CD2 1 
ATOM   861  C  CE1 . HIS A 1 103 ? 4.179   -4.315  2.158   1.00 6.71  ? 102 HIS A CE1 1 
ATOM   862  N  NE2 . HIS A 1 103 ? 3.251   -3.384  2.331   1.00 6.19  ? 102 HIS A NE2 1 
ATOM   863  N  N   . GLU A 1 104 ? 6.645   1.928   2.206   1.00 6.18  ? 103 GLU A N   1 
ATOM   864  C  CA  . GLU A 1 104 ? 7.558   3.065   2.356   1.00 6.69  ? 103 GLU A CA  1 
ATOM   865  C  C   . GLU A 1 104 ? 8.977   2.645   2.681   1.00 6.22  ? 103 GLU A C   1 
ATOM   866  O  O   . GLU A 1 104 ? 9.912   3.233   2.163   1.00 6.60  ? 103 GLU A O   1 
ATOM   867  C  CB  . GLU A 1 104 ? 6.997   4.013   3.426   1.00 6.95  ? 103 GLU A CB  1 
ATOM   868  C  CG  . GLU A 1 104 ? 7.613   5.408   3.401   1.00 6.87  ? 103 GLU A CG  1 
ATOM   869  C  CD  . GLU A 1 104 ? 7.044   6.306   2.282   1.00 6.78  ? 103 GLU A CD  1 
ATOM   870  O  OE1 . GLU A 1 104 ? 6.164   5.850   1.501   1.00 8.05  ? 103 GLU A OE1 1 
ATOM   871  O  OE2 . GLU A 1 104 ? 7.460   7.496   2.231   1.00 6.20  ? 103 GLU A OE2 1 
ATOM   872  N  N   . HIS A 1 105 ? 9.129   1.628   3.523   1.00 6.24  ? 104 HIS A N   1 
ATOM   873  C  CA  . HIS A 1 105 ? 10.457  1.206   3.933   1.00 6.69  ? 104 HIS A CA  1 
ATOM   874  C  C   . HIS A 1 105 ? 11.292  0.580   2.816   1.00 6.47  ? 104 HIS A C   1 
ATOM   875  O  O   . HIS A 1 105 ? 12.460  0.252   3.043   1.00 7.80  ? 104 HIS A O   1 
ATOM   876  C  CB  . HIS A 1 105 ? 10.401  0.241   5.145   1.00 8.08  ? 104 HIS A CB  1 
ATOM   877  C  CG  . HIS A 1 105 ? 9.980   -1.144  4.783   1.00 7.16  ? 104 HIS A CG  1 
ATOM   878  N  ND1 . HIS A 1 105 ? 8.660   -1.478  4.584   1.00 8.05  ? 104 HIS A ND1 1 
ATOM   879  C  CD2 . HIS A 1 105 ? 10.707  -2.267  4.545   1.00 8.61  ? 104 HIS A CD2 1 
ATOM   880  C  CE1 . HIS A 1 105 ? 8.594   -2.753  4.258   1.00 9.35  ? 104 HIS A CE1 1 
ATOM   881  N  NE2 . HIS A 1 105 ? 9.818   -3.252  4.218   1.00 8.50  ? 104 HIS A NE2 1 
ATOM   882  N  N   . THR A 1 106 ? 10.668  0.347   1.658   1.00 6.22  ? 105 THR A N   1 
ATOM   883  C  CA  . THR A 1 106 ? 11.366  -0.228  0.530   1.00 7.29  ? 105 THR A CA  1 
ATOM   884  C  C   . THR A 1 106 ? 11.838  0.833   -0.452  1.00 6.49  ? 105 THR A C   1 
ATOM   885  O  O   . THR A 1 106 ? 12.441  0.507   -1.484  1.00 7.59  ? 105 THR A O   1 
ATOM   886  C  CB  . THR A 1 106 ? 10.525  -1.297  -0.205  1.00 7.25  ? 105 THR A CB  1 
ATOM   887  O  OG1 . THR A 1 106 ? 9.504   -0.685  -1.006  1.00 7.97  ? 105 THR A OG1 1 
ATOM   888  C  CG2 . THR A 1 106 ? 9.936   -2.301  0.738   1.00 9.19  ? 105 THR A CG2 1 
ATOM   889  N  N   . ARG A 1 107 ? 11.644  2.112   -0.144  1.00 6.60  ? 106 ARG A N   1 
ATOM   890  C  CA  . ARG A 1 107 ? 12.250  3.142   -0.990  1.00 7.69  ? 106 ARG A CA  1 
ATOM   891  C  C   . ARG A 1 107 ? 13.741  2.898   -1.145  1.00 7.29  ? 106 ARG A C   1 
ATOM   892  O  O   . ARG A 1 107 ? 14.418  2.554   -0.187  1.00 7.87  ? 106 ARG A O   1 
ATOM   893  C  CB  . ARG A 1 107 ? 12.102  4.547   -0.358  1.00 7.51  ? 106 ARG A CB  1 
ATOM   894  C  CG  . ARG A 1 107 ? 10.701  5.109   -0.450  1.00 7.32  ? 106 ARG A CG  1 
ATOM   895  C  CD  . ARG A 1 107 ? 10.480  6.361   0.383   1.00 6.92  ? 106 ARG A CD  1 
ATOM   896  N  NE  . ARG A 1 107 ? 11.433  7.436   0.076   1.00 7.25  ? 106 ARG A NE  1 
ATOM   897  C  CZ  . ARG A 1 107 ? 11.121  8.700   -0.235  1.00 7.41  ? 106 ARG A CZ  1 
ATOM   898  N  NH1 . ARG A 1 107 ? 9.851   9.093   -0.375  1.00 7.63  ? 106 ARG A NH1 1 
ATOM   899  N  NH2 . ARG A 1 107 ? 12.097  9.575   -0.394  1.00 8.36  ? 106 ARG A NH2 1 
ATOM   900  N  N   . PRO A 1 108 ? 14.292  3.161   -2.334  1.00 7.98  ? 107 PRO A N   1 
ATOM   901  C  CA  . PRO A 1 108 ? 15.726  2.987   -2.534  1.00 8.87  ? 107 PRO A CA  1 
ATOM   902  C  C   . PRO A 1 108 ? 16.575  3.831   -1.609  1.00 9.78  ? 107 PRO A C   1 
ATOM   903  O  O   . PRO A 1 108 ? 17.709  3.436   -1.355  1.00 11.14 ? 107 PRO A O   1 
ATOM   904  C  CB  . PRO A 1 108 ? 15.943  3.372   -4.010  1.00 10.79 ? 107 PRO A CB  1 
ATOM   905  C  CG  . PRO A 1 108 ? 14.651  3.109   -4.654  1.00 12.08 ? 107 PRO A CG  1 
ATOM   906  C  CD  . PRO A 1 108 ? 13.576  3.417   -3.599  1.00 10.20 ? 107 PRO A CD  1 
ATOM   907  N  N   . ASP A 1 109 ? 16.048  4.954   -1.093  1.00 9.29  ? 108 ASP A N   1 
ATOM   908  C  CA  . ASP A 1 109 ? 16.792  5.796   -0.157  1.00 10.00 ? 108 ASP A CA  1 
ATOM   909  C  C   . ASP A 1 109 ? 16.518  5.472   1.308   1.00 10.00 ? 108 ASP A C   1 
ATOM   910  O  O   . ASP A 1 109 ? 16.917  6.226   2.202   1.00 10.02 ? 108 ASP A O   1 
ATOM   911  C  CB  . ASP A 1 109 ? 16.496  7.292   -0.407  1.00 11.14 ? 108 ASP A CB  1 
ATOM   912  C  CG  . ASP A 1 109 ? 15.078  7.695   -0.012  1.00 12.97 ? 108 ASP A CG  1 
ATOM   913  O  OD1 . ASP A 1 109 ? 14.216  6.829   0.171   1.00 13.01 ? 108 ASP A OD1 1 
ATOM   914  O  OD2 . ASP A 1 109 ? 14.829  8.908   0.164   1.00 17.73 ? 108 ASP A OD2 1 
ATOM   915  N  N   . ARG A 1 110 ? 15.857  4.348   1.572   1.00 8.60  ? 109 ARG A N   1 
ATOM   916  C  CA  . ARG A 1 110 ? 15.357  4.127   2.931   1.00 7.70  ? 109 ARG A CA  1 
ATOM   917  C  C   . ARG A 1 110 ? 16.428  4.057   4.020   1.00 9.07  ? 109 ARG A C   1 
ATOM   918  O  O   . ARG A 1 110 ? 16.133  4.319   5.167   1.00 8.59  ? 109 ARG A O   1 
ATOM   919  C  CB  . ARG A 1 110 ? 14.501  2.848   2.976   1.00 7.88  ? 109 ARG A CB  1 
ATOM   920  C  CG  . ARG A 1 110 ? 15.277  1.548   2.748   1.00 8.63  ? 109 ARG A CG  1 
ATOM   921  C  CD  . ARG A 1 110 ? 15.569  0.832   4.060   1.00 8.29  ? 109 ARG A CD  1 
ATOM   922  N  NE  . ARG A 1 110 ? 16.320  -0.411  3.882   1.00 8.59  ? 109 ARG A NE  1 
ATOM   923  C  CZ  . ARG A 1 110 ? 15.759  -1.593  3.584   1.00 7.82  ? 109 ARG A CZ  1 
ATOM   924  N  NH1 . ARG A 1 110 ? 14.441  -1.724  3.397   1.00 8.35  ? 109 ARG A NH1 1 
ATOM   925  N  NH2 . ARG A 1 110 ? 16.551  -2.659  3.502   1.00 8.51  ? 109 ARG A NH2 1 
ATOM   926  N  N   . ASP A 1 111 ? 17.662  3.669   3.663   1.00 9.54  ? 110 ASP A N   1 
ATOM   927  C  CA  . ASP A 1 111 ? 18.709  3.480   4.684   1.00 10.27 ? 110 ASP A CA  1 
ATOM   928  C  C   . ASP A 1 111 ? 19.110  4.783   5.345   1.00 10.55 ? 110 ASP A C   1 
ATOM   929  O  O   . ASP A 1 111 ? 19.683  4.759   6.413   1.00 13.20 ? 110 ASP A O   1 
ATOM   930  C  CB  . ASP A 1 111 ? 19.908  2.746   4.086   1.00 12.30 ? 110 ASP A CB  1 
ATOM   931  C  CG  . ASP A 1 111 ? 19.595  1.289   3.758   1.00 14.87 ? 110 ASP A CG  1 
ATOM   932  O  OD1 . ASP A 1 111 ? 18.896  0.608   4.529   1.00 14.14 ? 110 ASP A OD1 1 
ATOM   933  O  OD2 . ASP A 1 111 ? 20.047  0.833   2.690   1.00 20.77 ? 110 ASP A OD2 1 
ATOM   934  N  N   . ARG A 1 112 ? 18.800  5.913   4.739   1.00 9.77  ? 111 ARG A N   1 
ATOM   935  C  CA  A ARG A 1 112 ? 19.059  7.180   5.394   0.50 11.02 ? 111 ARG A CA  1 
ATOM   936  C  CA  B ARG A 1 112 ? 19.007  7.219   5.351   0.50 11.38 ? 111 ARG A CA  1 
ATOM   937  C  C   . ARG A 1 112 ? 18.009  7.508   6.461   1.00 10.34 ? 111 ARG A C   1 
ATOM   938  O  O   . ARG A 1 112 ? 18.200  8.406   7.287   1.00 12.12 ? 111 ARG A O   1 
ATOM   939  C  CB  A ARG A 1 112 ? 19.115  8.296   4.343   0.50 12.96 ? 111 ARG A CB  1 
ATOM   940  C  CB  B ARG A 1 112 ? 18.871  8.302   4.267   0.50 13.29 ? 111 ARG A CB  1 
ATOM   941  C  CG  A ARG A 1 112 ? 19.693  9.572   4.874   0.50 13.81 ? 111 ARG A CG  1 
ATOM   942  C  CG  B ARG A 1 112 ? 20.171  8.534   3.523   0.50 16.49 ? 111 ARG A CG  1 
ATOM   943  C  CD  A ARG A 1 112 ? 20.202  10.446  3.764   0.50 15.95 ? 111 ARG A CD  1 
ATOM   944  C  CD  B ARG A 1 112 ? 19.984  9.357   2.271   0.50 21.28 ? 111 ARG A CD  1 
ATOM   945  N  NE  A ARG A 1 112 ? 19.138  10.904  2.888   0.50 17.12 ? 111 ARG A NE  1 
ATOM   946  N  NE  B ARG A 1 112 ? 18.909  10.339  2.345   0.50 21.19 ? 111 ARG A NE  1 
ATOM   947  C  CZ  A ARG A 1 112 ? 18.395  11.997  3.067   0.50 17.75 ? 111 ARG A CZ  1 
ATOM   948  C  CZ  B ARG A 1 112 ? 18.861  11.363  3.197   0.50 20.70 ? 111 ARG A CZ  1 
ATOM   949  N  NH1 A ARG A 1 112 ? 18.568  12.782  4.126   0.50 16.17 ? 111 ARG A NH1 1 
ATOM   950  N  NH1 B ARG A 1 112 ? 19.822  11.537  4.087   0.50 23.03 ? 111 ARG A NH1 1 
ATOM   951  N  NH2 A ARG A 1 112 ? 17.465  12.298  2.164   0.50 13.34 ? 111 ARG A NH2 1 
ATOM   952  N  NH2 B ARG A 1 112 ? 17.836  12.208  3.160   0.50 20.89 ? 111 ARG A NH2 1 
ATOM   953  N  N   . HIS A 1 113 ? 16.889  6.794   6.426   1.00 8.54  ? 112 HIS A N   1 
ATOM   954  C  CA  . HIS A 1 113 ? 15.750  7.168   7.224   1.00 7.96  ? 112 HIS A CA  1 
ATOM   955  C  C   . HIS A 1 113 ? 15.426  6.159   8.302   1.00 8.35  ? 112 HIS A C   1 
ATOM   956  O  O   . HIS A 1 113 ? 14.921  6.536   9.359   1.00 8.62  ? 112 HIS A O   1 
ATOM   957  C  CB  . HIS A 1 113 ? 14.556  7.380   6.290   1.00 8.78  ? 112 HIS A CB  1 
ATOM   958  C  CG  . HIS A 1 113 ? 14.817  8.466   5.305   1.00 9.16  ? 112 HIS A CG  1 
ATOM   959  N  ND1 . HIS A 1 113 ? 15.119  8.281   3.966   1.00 11.11 ? 112 HIS A ND1 1 
ATOM   960  C  CD2 . HIS A 1 113 ? 14.884  9.799   5.523   1.00 7.54  ? 112 HIS A CD2 1 
ATOM   961  C  CE1 . HIS A 1 113 ? 15.344  9.467   3.404   1.00 8.23  ? 112 HIS A CE1 1 
ATOM   962  N  NE2 . HIS A 1 113 ? 15.190  10.395  4.327   1.00 11.65 ? 112 HIS A NE2 1 
ATOM   963  N  N   . VAL A 1 114 ? 15.624  4.873   8.008   1.00 7.95  ? 113 VAL A N   1 
ATOM   964  C  CA  . VAL A 1 114 ? 15.357  3.812   8.983   1.00 9.06  ? 113 VAL A CA  1 
ATOM   965  C  C   . VAL A 1 114 ? 16.478  2.820   9.024   1.00 8.85  ? 113 VAL A C   1 
ATOM   966  O  O   . VAL A 1 114 ? 17.127  2.556   8.007   1.00 10.33 ? 113 VAL A O   1 
ATOM   967  C  CB  . VAL A 1 114 ? 14.025  3.033   8.677   1.00 8.77  ? 113 VAL A CB  1 
ATOM   968  C  CG1 . VAL A 1 114 ? 12.805  3.938   8.878   1.00 9.45  ? 113 VAL A CG1 1 
ATOM   969  C  CG2 . VAL A 1 114 ? 14.044  2.385   7.274   1.00 9.55  ? 113 VAL A CG2 1 
ATOM   970  N  N   . SER A 1 115 ? 16.708  2.252   10.205  1.00 8.97  ? 114 SER A N   1 
ATOM   971  C  CA  A SER A 1 115 ? 17.529  1.046   10.364  0.70 9.66  ? 114 SER A CA  1 
ATOM   972  C  CA  B SER A 1 115 ? 17.524  1.072   10.339  0.30 9.57  ? 114 SER A CA  1 
ATOM   973  C  C   . SER A 1 115 ? 16.640  -0.176  10.284  1.00 9.33  ? 114 SER A C   1 
ATOM   974  O  O   . SER A 1 115 ? 15.623  -0.243  10.959  1.00 9.74  ? 114 SER A O   1 
ATOM   975  C  CB  A SER A 1 115 ? 18.227  1.018   11.724  0.70 10.98 ? 114 SER A CB  1 
ATOM   976  C  CB  B SER A 1 115 ? 18.265  1.134   11.663  0.30 10.20 ? 114 SER A CB  1 
ATOM   977  O  OG  A SER A 1 115 ? 19.114  2.105   11.881  0.70 14.00 ? 114 SER A OG  1 
ATOM   978  O  OG  B SER A 1 115 ? 19.137  0.046   11.788  0.30 11.60 ? 114 SER A OG  1 
ATOM   979  N  N   . ILE A 1 116 ? 17.061  -1.160  9.503   1.00 10.03 ? 115 ILE A N   1 
ATOM   980  C  CA  . ILE A 1 116 ? 16.438  -2.483  9.473   1.00 9.83  ? 115 ILE A CA  1 
ATOM   981  C  C   . ILE A 1 116 ? 17.255  -3.337  10.416  1.00 10.11 ? 115 ILE A C   1 
ATOM   982  O  O   . ILE A 1 116 ? 18.476  -3.541  10.210  1.00 11.45 ? 115 ILE A O   1 
ATOM   983  C  CB  . ILE A 1 116 ? 16.481  -3.096  8.054   1.00 10.51 ? 115 ILE A CB  1 
ATOM   984  C  CG1 . ILE A 1 116 ? 15.789  -2.206  7.036   1.00 13.31 ? 115 ILE A CG1 1 
ATOM   985  C  CG2 . ILE A 1 116 ? 15.864  -4.467  8.108   1.00 10.69 ? 115 ILE A CG2 1 
ATOM   986  C  CD1 . ILE A 1 116 ? 14.419  -1.701  7.384   1.00 13.11 ? 115 ILE A CD1 1 
ATOM   987  N  N   . VAL A 1 117 ? 16.594  -3.820  11.461  1.00 9.12  ? 116 VAL A N   1 
ATOM   988  C  CA  . VAL A 1 117 ? 17.315  -4.514  12.524  1.00 9.81  ? 116 VAL A CA  1 
ATOM   989  C  C   . VAL A 1 117 ? 17.288  -6.014  12.232  1.00 9.35  ? 116 VAL A C   1 
ATOM   990  O  O   . VAL A 1 117 ? 16.348  -6.738  12.620  1.00 9.43  ? 116 VAL A O   1 
ATOM   991  C  CB  . VAL A 1 117 ? 16.719  -4.196  13.909  1.00 9.55  ? 116 VAL A CB  1 
ATOM   992  C  CG1 . VAL A 1 117 ? 17.648  -4.715  14.969  1.00 10.83 ? 116 VAL A CG1 1 
ATOM   993  C  CG2 . VAL A 1 117 ? 16.524  -2.652  14.100  1.00 11.19 ? 116 VAL A CG2 1 
ATOM   994  N  N   . ARG A 1 118 ? 18.283  -6.469  11.473  1.00 10.18 ? 117 ARG A N   1 
ATOM   995  C  CA  . ARG A 1 118 ? 18.254  -7.821  10.933  1.00 11.35 ? 117 ARG A CA  1 
ATOM   996  C  C   . ARG A 1 118 ? 18.225  -8.877  11.995  1.00 10.55 ? 117 ARG A C   1 
ATOM   997  O  O   . ARG A 1 118 ? 17.633  -9.957  11.775  1.00 11.94 ? 117 ARG A O   1 
ATOM   998  C  CB  . ARG A 1 118 ? 19.413  -8.025  9.963   1.00 12.29 ? 117 ARG A CB  1 
ATOM   999  C  CG  . ARG A 1 118 ? 19.251  -7.114  8.758   1.00 15.96 ? 117 ARG A CG  1 
ATOM   1000 C  CD  . ARG A 1 118 ? 20.247  -7.292  7.661   1.00 20.61 ? 117 ARG A CD  1 
ATOM   1001 N  NE  . ARG A 1 118 ? 19.846  -6.295  6.672   1.00 23.48 ? 117 ARG A NE  1 
ATOM   1002 C  CZ  . ARG A 1 118 ? 18.791  -6.388  5.857   1.00 24.88 ? 117 ARG A CZ  1 
ATOM   1003 N  NH1 . ARG A 1 118 ? 17.999  -7.470  5.826   1.00 24.98 ? 117 ARG A NH1 1 
ATOM   1004 N  NH2 . ARG A 1 118 ? 18.546  -5.375  5.060   1.00 23.59 ? 117 ARG A NH2 1 
ATOM   1005 N  N   . GLU A 1 119 ? 18.862  -8.583  13.135  1.00 10.91 ? 118 GLU A N   1 
ATOM   1006 C  CA  . GLU A 1 119 ? 18.868  -9.488  14.284  1.00 12.12 ? 118 GLU A CA  1 
ATOM   1007 C  C   . GLU A 1 119 ? 17.487  -9.867  14.745  1.00 12.30 ? 118 GLU A C   1 
ATOM   1008 O  O   . GLU A 1 119 ? 17.291  -10.879 15.414  1.00 13.51 ? 118 GLU A O   1 
ATOM   1009 C  CB  . GLU A 1 119 ? 19.671  -8.891  15.460  1.00 12.96 ? 118 GLU A CB  1 
ATOM   1010 C  CG  . GLU A 1 119 ? 21.169  -8.762  15.162  1.00 15.85 ? 118 GLU A CG  1 
ATOM   1011 C  CD  . GLU A 1 119 ? 21.580  -7.531  14.377  1.00 16.28 ? 118 GLU A CD  1 
ATOM   1012 O  OE1 . GLU A 1 119 ? 20.723  -6.729  13.929  1.00 15.61 ? 118 GLU A OE1 1 
ATOM   1013 O  OE2 . GLU A 1 119 ? 22.815  -7.335  14.237  1.00 21.67 ? 118 GLU A OE2 1 
ATOM   1014 N  N   . ASN A 1 120 ? 16.496  -9.026  14.441  1.00 10.28 ? 119 ASN A N   1 
ATOM   1015 C  CA  . ASN A 1 120 ? 15.154  -9.222  14.989  1.00 10.32 ? 119 ASN A CA  1 
ATOM   1016 C  C   . ASN A 1 120 ? 14.144  -9.772  13.982  1.00 9.97  ? 119 ASN A C   1 
ATOM   1017 O  O   . ASN A 1 120 ? 13.024  -10.027 14.369  1.00 10.56 ? 119 ASN A O   1 
ATOM   1018 C  CB  . ASN A 1 120 ? 14.630  -7.925  15.627  1.00 9.77  ? 119 ASN A CB  1 
ATOM   1019 C  CG  . ASN A 1 120 ? 15.405  -7.579  16.873  1.00 10.55 ? 119 ASN A CG  1 
ATOM   1020 O  OD1 . ASN A 1 120 ? 16.028  -8.457  17.469  1.00 12.41 ? 119 ASN A OD1 1 
ATOM   1021 N  ND2 . ASN A 1 120 ? 15.384  -6.318  17.261  1.00 9.74  ? 119 ASN A ND2 1 
ATOM   1022 N  N   . ILE A 1 121 ? 14.524  -9.945  12.726  1.00 9.40  ? 120 ILE A N   1 
ATOM   1023 C  CA  . ILE A 1 121 ? 13.543  -10.385 11.720  1.00 9.06  ? 120 ILE A CA  1 
ATOM   1024 C  C   . ILE A 1 121 ? 13.242  -11.885 11.915  1.00 9.43  ? 120 ILE A C   1 
ATOM   1025 O  O   . ILE A 1 121 ? 14.185  -12.686 11.979  1.00 10.20 ? 120 ILE A O   1 
ATOM   1026 C  CB  . ILE A 1 121 ? 14.033  -10.112 10.304  1.00 8.81  ? 120 ILE A CB  1 
ATOM   1027 C  CG1 . ILE A 1 121 ? 14.264  -8.601  10.095  1.00 9.77  ? 120 ILE A CG1 1 
ATOM   1028 C  CG2 . ILE A 1 121 ? 13.030  -10.675 9.307   1.00 9.86  ? 120 ILE A CG2 1 
ATOM   1029 C  CD1 . ILE A 1 121 ? 15.002  -8.294  8.805   1.00 10.37 ? 120 ILE A CD1 1 
ATOM   1030 N  N   . GLN A 1 122 ? 11.950  -12.246 11.955  1.00 9.60  ? 121 GLN A N   1 
ATOM   1031 C  CA  . GLN A 1 122 ? 11.578  -13.651 11.965  1.00 10.76 ? 121 GLN A CA  1 
ATOM   1032 C  C   . GLN A 1 122 ? 12.300  -14.408 10.851  1.00 10.17 ? 121 GLN A C   1 
ATOM   1033 O  O   . GLN A 1 122 ? 12.243  -14.017 9.693   1.00 9.18  ? 121 GLN A O   1 
ATOM   1034 C  CB  . GLN A 1 122 ? 10.087  -13.757 11.708  1.00 11.32 ? 121 GLN A CB  1 
ATOM   1035 C  CG  . GLN A 1 122 ? 9.159   -13.360 12.841  1.00 15.75 ? 121 GLN A CG  1 
ATOM   1036 C  CD  . GLN A 1 122 ? 7.705   -13.224 12.383  1.00 15.86 ? 121 GLN A CD  1 
ATOM   1037 O  OE1 . GLN A 1 122 ? 7.285   -13.927 11.436  1.00 18.97 ? 121 GLN A OE1 1 
ATOM   1038 N  NE2 . GLN A 1 122 ? 6.909   -12.353 13.075  1.00 15.72 ? 121 GLN A NE2 1 
ATOM   1039 N  N   . PRO A 1 123 ? 12.938  -15.547 11.176  1.00 10.83 ? 122 PRO A N   1 
ATOM   1040 C  CA  . PRO A 1 123 ? 13.558  -16.348 10.112  1.00 10.96 ? 122 PRO A CA  1 
ATOM   1041 C  C   . PRO A 1 123 ? 12.606  -16.654 8.973   1.00 10.38 ? 122 PRO A C   1 
ATOM   1042 O  O   . PRO A 1 123 ? 11.489  -17.124 9.219   1.00 12.05 ? 122 PRO A O   1 
ATOM   1043 C  CB  . PRO A 1 123 ? 13.965  -17.629 10.853  1.00 11.87 ? 122 PRO A CB  1 
ATOM   1044 C  CG  . PRO A 1 123 ? 14.264  -17.144 12.256  1.00 13.05 ? 122 PRO A CG  1 
ATOM   1045 C  CD  . PRO A 1 123 ? 13.177  -16.117 12.515  1.00 12.63 ? 122 PRO A CD  1 
ATOM   1046 N  N   . GLY A 1 124 ? 13.051  -16.389 7.745   1.00 9.67  ? 123 GLY A N   1 
ATOM   1047 C  CA  . GLY A 1 124 ? 12.242  -16.663 6.588   1.00 10.61 ? 123 GLY A CA  1 
ATOM   1048 C  C   . GLY A 1 124 ? 11.395  -15.491 6.137   1.00 9.65  ? 123 GLY A C   1 
ATOM   1049 O  O   . GLY A 1 124 ? 10.715  -15.573 5.117   1.00 10.41 ? 123 GLY A O   1 
ATOM   1050 N  N   . GLN A 1 125 ? 11.421  -14.385 6.888   1.00 8.91  ? 124 GLN A N   1 
ATOM   1051 C  CA  . GLN A 1 125 ? 10.620  -13.190 6.563   1.00 9.16  ? 124 GLN A CA  1 
ATOM   1052 C  C   . GLN A 1 125 ? 11.485  -12.000 6.120   1.00 7.97  ? 124 GLN A C   1 
ATOM   1053 O  O   . GLN A 1 125 ? 10.995  -10.888 5.947   1.00 7.81  ? 124 GLN A O   1 
ATOM   1054 C  CB  . GLN A 1 125 ? 9.727   -12.822 7.752   1.00 8.79  ? 124 GLN A CB  1 
ATOM   1055 C  CG  . GLN A 1 125 ? 8.714   -13.956 8.081   1.00 11.53 ? 124 GLN A CG  1 
ATOM   1056 C  CD  . GLN A 1 125 ? 7.777   -14.234 6.913   1.00 11.84 ? 124 GLN A CD  1 
ATOM   1057 O  OE1 . GLN A 1 125 ? 7.297   -13.310 6.261   1.00 13.64 ? 124 GLN A OE1 1 
ATOM   1058 N  NE2 . GLN A 1 125 ? 7.485   -15.511 6.660   1.00 14.20 ? 124 GLN A NE2 1 
ATOM   1059 N  N   . GLU A 1 126 ? 12.762  -12.261 5.873   1.00 7.60  ? 125 GLU A N   1 
ATOM   1060 C  CA  . GLU A 1 126 ? 13.708  -11.227 5.488   1.00 8.10  ? 125 GLU A CA  1 
ATOM   1061 C  C   . GLU A 1 126 ? 13.337  -10.540 4.188   1.00 7.77  ? 125 GLU A C   1 
ATOM   1062 O  O   . GLU A 1 126 ? 13.552  -9.328  4.048   1.00 7.77  ? 125 GLU A O   1 
ATOM   1063 C  CB  . GLU A 1 126 ? 15.129  -11.804 5.353   1.00 9.47  ? 125 GLU A CB  1 
ATOM   1064 C  CG  . GLU A 1 126 ? 15.669  -12.562 6.601   1.00 10.99 ? 125 GLU A CG  1 
ATOM   1065 C  CD  . GLU A 1 126 ? 15.164  -14.019 6.734   1.00 10.36 ? 125 GLU A CD  1 
ATOM   1066 O  OE1 . GLU A 1 126 ? 14.458  -14.527 5.850   1.00 11.12 ? 125 GLU A OE1 1 
ATOM   1067 O  OE2 . GLU A 1 126 ? 15.515  -14.673 7.740   1.00 12.69 ? 125 GLU A OE2 1 
ATOM   1068 N  N   . TYR A 1 127 ? 12.759  -11.290 3.260   1.00 8.28  ? 126 TYR A N   1 
ATOM   1069 C  CA  . TYR A 1 127 ? 12.391  -10.742 1.971   1.00 8.39  ? 126 TYR A CA  1 
ATOM   1070 C  C   . TYR A 1 127 ? 11.477  -9.522  2.082   1.00 8.10  ? 126 TYR A C   1 
ATOM   1071 O  O   . TYR A 1 127 ? 11.479  -8.668  1.207   1.00 8.58  ? 126 TYR A O   1 
ATOM   1072 C  CB  . TYR A 1 127 ? 11.729  -11.830 1.087   1.00 8.98  ? 126 TYR A CB  1 
ATOM   1073 C  CG  . TYR A 1 127 ? 10.387  -12.233 1.568   1.00 9.13  ? 126 TYR A CG  1 
ATOM   1074 C  CD1 . TYR A 1 127 ? 10.240  -13.212 2.532   1.00 9.65  ? 126 TYR A CD1 1 
ATOM   1075 C  CD2 . TYR A 1 127 ? 9.245   -11.612 1.081   1.00 9.67  ? 126 TYR A CD2 1 
ATOM   1076 C  CE1 . TYR A 1 127 ? 8.970   -13.563 2.993   1.00 10.57 ? 126 TYR A CE1 1 
ATOM   1077 C  CE2 . TYR A 1 127 ? 7.984   -11.945 1.551   1.00 11.42 ? 126 TYR A CE2 1 
ATOM   1078 C  CZ  . TYR A 1 127 ? 7.844   -12.929 2.510   1.00 11.93 ? 126 TYR A CZ  1 
ATOM   1079 O  OH  . TYR A 1 127 ? 6.603   -13.285 3.016   1.00 14.57 ? 126 TYR A OH  1 
ATOM   1080 N  N   . ASN A 1 128 ? 10.700  -9.427  3.152   1.00 7.52  ? 127 ASN A N   1 
ATOM   1081 C  CA  . ASN A 1 128 ? 9.770   -8.305  3.324   1.00 7.57  ? 127 ASN A CA  1 
ATOM   1082 C  C   . ASN A 1 128 ? 10.481  -6.973  3.496   1.00 6.77  ? 127 ASN A C   1 
ATOM   1083 O  O   . ASN A 1 128 ? 9.867   -5.926  3.384   1.00 7.79  ? 127 ASN A O   1 
ATOM   1084 C  CB  . ASN A 1 128 ? 8.890   -8.528  4.559   1.00 8.32  ? 127 ASN A CB  1 
ATOM   1085 C  CG  . ASN A 1 128 ? 7.931   -9.669  4.394   1.00 8.59  ? 127 ASN A CG  1 
ATOM   1086 O  OD1 . ASN A 1 128 ? 6.979   -9.579  3.609   1.00 9.96  ? 127 ASN A OD1 1 
ATOM   1087 N  ND2 . ASN A 1 128 ? 8.192   -10.764 5.108   1.00 9.62  ? 127 ASN A ND2 1 
ATOM   1088 N  N   . PHE A 1 129 ? 11.780  -7.024  3.779   1.00 6.30  ? 128 PHE A N   1 
ATOM   1089 C  CA  . PHE A 1 129 ? 12.585  -5.834  4.053   1.00 6.85  ? 128 PHE A CA  1 
ATOM   1090 C  C   . PHE A 1 129 ? 13.464  -5.419  2.889   1.00 7.44  ? 128 PHE A C   1 
ATOM   1091 O  O   . PHE A 1 129 ? 14.154  -4.444  2.981   1.00 8.61  ? 128 PHE A O   1 
ATOM   1092 C  CB  . PHE A 1 129 ? 13.374  -6.027  5.343   1.00 7.37  ? 128 PHE A CB  1 
ATOM   1093 C  CG  . PHE A 1 129 ? 12.465  -6.223  6.514   1.00 6.76  ? 128 PHE A CG  1 
ATOM   1094 C  CD1 . PHE A 1 129 ? 12.013  -7.493  6.851   1.00 7.58  ? 128 PHE A CD1 1 
ATOM   1095 C  CD2 . PHE A 1 129 ? 12.010  -5.145  7.250   1.00 7.86  ? 128 PHE A CD2 1 
ATOM   1096 C  CE1 . PHE A 1 129 ? 11.132  -7.703  7.876   1.00 8.28  ? 128 PHE A CE1 1 
ATOM   1097 C  CE2 . PHE A 1 129 ? 11.124  -5.331  8.313   1.00 9.07  ? 128 PHE A CE2 1 
ATOM   1098 C  CZ  . PHE A 1 129 ? 10.694  -6.588  8.626   1.00 8.68  ? 128 PHE A CZ  1 
ATOM   1099 N  N   . LEU A 1 130 ? 13.390  -6.137  1.770   1.00 7.84  ? 129 LEU A N   1 
ATOM   1100 C  CA  . LEU A 1 130 ? 14.206  -5.797  0.599   1.00 8.69  ? 129 LEU A CA  1 
ATOM   1101 C  C   . LEU A 1 130 ? 13.811  -4.423  0.068   1.00 8.63  ? 129 LEU A C   1 
ATOM   1102 O  O   . LEU A 1 130 ? 12.623  -4.123  -0.076  1.00 9.37  ? 129 LEU A O   1 
ATOM   1103 C  CB  . LEU A 1 130 ? 13.982  -6.800  -0.524  1.00 9.68  ? 129 LEU A CB  1 
ATOM   1104 C  CG  . LEU A 1 130 ? 14.561  -8.182  -0.258  1.00 10.61 ? 129 LEU A CG  1 
ATOM   1105 C  CD1 . LEU A 1 130 ? 13.974  -9.164  -1.261  1.00 12.70 ? 129 LEU A CD1 1 
ATOM   1106 C  CD2 . LEU A 1 130 ? 16.126  -8.117  -0.349  1.00 12.98 ? 129 LEU A CD2 1 
ATOM   1107 N  N   . LYS A 1 131 ? 14.820  -3.626  -0.262  1.00 8.71  ? 130 LYS A N   1 
ATOM   1108 C  CA  . LYS A 1 131 ? 14.575  -2.371  -0.997  1.00 9.37  ? 130 LYS A CA  1 
ATOM   1109 C  C   . LYS A 1 131 ? 14.151  -2.656  -2.424  1.00 9.15  ? 130 LYS A C   1 
ATOM   1110 O  O   . LYS A 1 131 ? 14.595  -3.645  -3.040  1.00 10.42 ? 130 LYS A O   1 
ATOM   1111 C  CB  . LYS A 1 131 ? 15.850  -1.517  -1.100  1.00 11.42 ? 130 LYS A CB  1 
ATOM   1112 C  CG  . LYS A 1 131 ? 16.356  -1.013  0.234   1.00 13.55 ? 130 LYS A CG  1 
ATOM   1113 C  CD  . LYS A 1 131 ? 17.541  -0.047  0.031   1.00 14.86 ? 130 LYS A CD  1 
ATOM   1114 C  CE  . LYS A 1 131 ? 18.800  -0.740  -0.401  1.00 18.54 ? 130 LYS A CE  1 
ATOM   1115 N  NZ  . LYS A 1 131 ? 19.991  0.181   -0.280  1.00 24.41 ? 130 LYS A NZ  1 
ATOM   1116 N  N   . MET A 1 132 ? 13.337  -1.760  -2.976  1.00 8.45  ? 131 MET A N   1 
ATOM   1117 C  CA  . MET A 1 132 ? 13.107  -1.770  -4.405  1.00 8.88  ? 131 MET A CA  1 
ATOM   1118 C  C   . MET A 1 132 ? 14.407  -1.321  -5.080  1.00 9.64  ? 131 MET A C   1 
ATOM   1119 O  O   . MET A 1 132 ? 15.158  -0.468  -4.579  1.00 10.17 ? 131 MET A O   1 
ATOM   1120 C  CB  . MET A 1 132 ? 12.029  -0.755  -4.750  1.00 9.29  ? 131 MET A CB  1 
ATOM   1121 C  CG  . MET A 1 132 ? 10.678  -1.098  -4.118  1.00 9.90  ? 131 MET A CG  1 
ATOM   1122 S  SD  . MET A 1 132 ? 10.112  -2.778  -4.445  1.00 12.43 ? 131 MET A SD  1 
ATOM   1123 C  CE  . MET A 1 132 ? 9.768   -2.636  -6.216  1.00 13.08 ? 131 MET A CE  1 
ATOM   1124 N  N   . GLU A 1 133 ? 14.651  -1.867  -6.260  1.00 9.81  ? 132 GLU A N   1 
ATOM   1125 C  CA  . GLU A 1 133 ? 15.746  -1.369  -7.091  1.00 10.70 ? 132 GLU A CA  1 
ATOM   1126 C  C   . GLU A 1 133 ? 15.489  0.077   -7.468  1.00 10.16 ? 132 GLU A C   1 
ATOM   1127 O  O   . GLU A 1 133 ? 14.334  0.492   -7.624  1.00 9.75  ? 132 GLU A O   1 
ATOM   1128 C  CB  . GLU A 1 133 ? 15.891  -2.216  -8.354  1.00 12.62 ? 132 GLU A CB  1 
ATOM   1129 C  CG  . GLU A 1 133 ? 16.416  -3.619  -8.031  1.00 17.26 ? 132 GLU A CG  1 
ATOM   1130 C  CD  . GLU A 1 133 ? 17.730  -3.575  -7.264  1.00 25.85 ? 132 GLU A CD  1 
ATOM   1131 O  OE1 . GLU A 1 133 ? 18.760  -3.151  -7.848  1.00 29.35 ? 132 GLU A OE1 1 
ATOM   1132 O  OE2 . GLU A 1 133 ? 17.734  -3.945  -6.063  1.00 29.88 ? 132 GLU A OE2 1 
ATOM   1133 N  N   . PRO A 1 134 A 16.555  0.870   -7.680  1.00 10.05 ? 132 PRO A N   1 
ATOM   1134 C  CA  . PRO A 1 134 A 16.336  2.293   -7.897  1.00 10.42 ? 132 PRO A CA  1 
ATOM   1135 C  C   . PRO A 1 134 A 15.551  2.597   -9.147  1.00 9.67  ? 132 PRO A C   1 
ATOM   1136 O  O   . PRO A 1 134 A 14.844  3.592   -9.176  1.00 10.59 ? 132 PRO A O   1 
ATOM   1137 C  CB  . PRO A 1 134 A 17.749  2.893   -7.959  1.00 12.19 ? 132 PRO A CB  1 
ATOM   1138 C  CG  . PRO A 1 134 A 18.655  1.767   -8.009  1.00 14.66 ? 132 PRO A CG  1 
ATOM   1139 C  CD  . PRO A 1 134 A 17.981  0.519   -7.587  1.00 12.35 ? 132 PRO A CD  1 
ATOM   1140 N  N   . GLN A 1 135 B 15.613  1.717   -10.153 1.00 9.52  ? 132 GLN A N   1 
ATOM   1141 C  CA  . GLN A 1 135 B 14.846  1.939   -11.373 1.00 9.52  ? 132 GLN A CA  1 
ATOM   1142 C  C   . GLN A 1 135 B 13.357  1.703   -11.211 1.00 8.51  ? 132 GLN A C   1 
ATOM   1143 O  O   . GLN A 1 135 B 12.595  2.011   -12.142 1.00 10.43 ? 132 GLN A O   1 
ATOM   1144 C  CB  . GLN A 1 135 B 15.376  1.045   -12.505 1.00 10.40 ? 132 GLN A CB  1 
ATOM   1145 C  CG  . GLN A 1 135 B 16.779  1.381   -12.900 1.00 12.88 ? 132 GLN A CG  1 
ATOM   1146 C  CD  . GLN A 1 135 B 17.841  0.718   -12.089 1.00 13.63 ? 132 GLN A CD  1 
ATOM   1147 O  OE1 . GLN A 1 135 B 17.601  0.003   -11.099 1.00 13.98 ? 132 GLN A OE1 1 
ATOM   1148 N  NE2 . GLN A 1 135 B 19.076  0.943   -12.531 1.00 17.12 ? 132 GLN A NE2 1 
ATOM   1149 N  N   . GLU A 1 136 ? 12.944  1.119   -10.087 1.00 8.61  ? 133 GLU A N   1 
ATOM   1150 C  CA  . GLU A 1 136 ? 11.549  0.749   -9.899  1.00 8.91  ? 133 GLU A CA  1 
ATOM   1151 C  C   . GLU A 1 136 ? 10.742  1.787   -9.139  1.00 8.05  ? 133 GLU A C   1 
ATOM   1152 O  O   . GLU A 1 136 ? 9.524   1.668   -9.076  1.00 8.30  ? 133 GLU A O   1 
ATOM   1153 C  CB  . GLU A 1 136 ? 11.442  -0.571  -9.133  1.00 10.72 ? 133 GLU A CB  1 
ATOM   1154 C  CG  . GLU A 1 136 ? 12.125  -1.763  -9.769  1.00 12.98 ? 133 GLU A CG  1 
ATOM   1155 C  CD  . GLU A 1 136 ? 11.695  -2.057  -11.167 1.00 15.78 ? 133 GLU A CD  1 
ATOM   1156 O  OE1 . GLU A 1 136 ? 10.564  -1.731  -11.589 1.00 17.07 ? 133 GLU A OE1 1 
ATOM   1157 O  OE2 . GLU A 1 136 ? 12.518  -2.654  -11.891 1.00 21.36 ? 133 GLU A OE2 1 
ATOM   1158 N  N   . VAL A 1 137 ? 11.391  2.766   -8.535  1.00 7.84  ? 134 VAL A N   1 
ATOM   1159 C  CA  . VAL A 1 137 ? 10.709  3.761   -7.693  1.00 8.51  ? 134 VAL A CA  1 
ATOM   1160 C  C   . VAL A 1 137 ? 11.202  5.145   -8.104  1.00 8.68  ? 134 VAL A C   1 
ATOM   1161 O  O   . VAL A 1 137 ? 12.390  5.350   -8.342  1.00 10.61 ? 134 VAL A O   1 
ATOM   1162 C  CB  . VAL A 1 137 ? 10.992  3.517   -6.189  1.00 8.45  ? 134 VAL A CB  1 
ATOM   1163 C  CG1 . VAL A 1 137 ? 10.606  4.768   -5.329  1.00 9.19  ? 134 VAL A CG1 1 
ATOM   1164 C  CG2 . VAL A 1 137 ? 10.245  2.296   -5.693  1.00 10.62 ? 134 VAL A CG2 1 
ATOM   1165 N  N   . GLU A 1 138 ? 10.271  6.085   -8.176  1.00 8.88  ? 135 GLU A N   1 
ATOM   1166 C  CA  . GLU A 1 138 ? 10.628  7.504   -8.405  1.00 9.53  ? 135 GLU A CA  1 
ATOM   1167 C  C   . GLU A 1 138 ? 9.758   8.254   -7.388  1.00 8.90  ? 135 GLU A C   1 
ATOM   1168 O  O   . GLU A 1 138 ? 8.530   8.279   -7.497  1.00 9.52  ? 135 GLU A O   1 
ATOM   1169 C  CB  . GLU A 1 138 ? 10.352  7.920   -9.872  1.00 11.96 ? 135 GLU A CB  1 
ATOM   1170 C  CG  . GLU A 1 138 ? 10.383  9.427   -10.132 1.00 15.19 ? 135 GLU A CG  1 
ATOM   1171 C  CD  . GLU A 1 138 ? 11.576  10.123  -9.489  1.00 19.41 ? 135 GLU A CD  1 
ATOM   1172 O  OE1 . GLU A 1 138 ? 12.747  9.765   -9.752  1.00 23.40 ? 135 GLU A OE1 1 
ATOM   1173 O  OE2 . GLU A 1 138 ? 11.367  11.069  -8.741  1.00 20.01 ? 135 GLU A OE2 1 
ATOM   1174 N  N   . SER A 1 139 ? 10.415  8.839   -6.388  1.00 9.21  ? 136 SER A N   1 
ATOM   1175 C  CA  . SER A 1 139 ? 9.685   9.420   -5.287  1.00 8.93  ? 136 SER A CA  1 
ATOM   1176 C  C   . SER A 1 139 ? 9.085   10.793  -5.551  1.00 8.67  ? 136 SER A C   1 
ATOM   1177 O  O   . SER A 1 139 ? 8.374   11.317  -4.682  1.00 9.24  ? 136 SER A O   1 
ATOM   1178 C  CB  . SER A 1 139 ? 10.576  9.470   -4.051  1.00 9.37  ? 136 SER A CB  1 
ATOM   1179 O  OG  . SER A 1 139 ? 10.867  8.138   -3.604  1.00 9.54  ? 136 SER A OG  1 
ATOM   1180 N  N   . LEU A 1 140 ? 9.344   11.366  -6.726  1.00 9.42  ? 137 LEU A N   1 
ATOM   1181 C  CA  . LEU A 1 140 ? 8.672   12.593  -7.138  1.00 10.25 ? 137 LEU A CA  1 
ATOM   1182 C  C   . LEU A 1 140 ? 9.039   13.752  -6.221  1.00 9.61  ? 137 LEU A C   1 
ATOM   1183 O  O   . LEU A 1 140 ? 8.235   14.661  -6.021  1.00 10.65 ? 137 LEU A O   1 
ATOM   1184 C  CB  . LEU A 1 140 ? 7.151   12.375  -7.252  1.00 11.93 ? 137 LEU A CB  1 
ATOM   1185 C  CG  . LEU A 1 140 ? 6.738   11.243  -8.183  1.00 13.93 ? 137 LEU A CG  1 
ATOM   1186 C  CD1 . LEU A 1 140 ? 5.350   10.749  -7.850  1.00 17.53 ? 137 LEU A CD1 1 
ATOM   1187 C  CD2 . LEU A 1 140 ? 6.932   11.656  -9.639  1.00 19.71 ? 137 LEU A CD2 1 
ATOM   1188 N  N   . GLY A 1 141 ? 10.257  13.740  -5.699  1.00 10.28 ? 138 GLY A N   1 
ATOM   1189 C  CA  . GLY A 1 141 ? 10.740  14.849  -4.882  1.00 10.81 ? 138 GLY A CA  1 
ATOM   1190 C  C   . GLY A 1 141 ? 10.211  14.825  -3.471  1.00 10.00 ? 138 GLY A C   1 
ATOM   1191 O  O   . GLY A 1 141 ? 10.468  15.750  -2.709  1.00 12.13 ? 138 GLY A O   1 
ATOM   1192 N  N   . GLU A 1 142 ? 9.469   13.782  -3.105  1.00 8.93  ? 139 GLU A N   1 
ATOM   1193 C  CA  . GLU A 1 142 ? 8.839   13.705  -1.787  1.00 8.20  ? 139 GLU A CA  1 
ATOM   1194 C  C   . GLU A 1 142 ? 9.736   13.020  -0.772  1.00 8.64  ? 139 GLU A C   1 
ATOM   1195 O  O   . GLU A 1 142 ? 10.367  11.982  -1.066  1.00 8.94  ? 139 GLU A O   1 
ATOM   1196 C  CB  . GLU A 1 142 ? 7.505   12.948  -1.890  1.00 8.59  ? 139 GLU A CB  1 
ATOM   1197 C  CG  . GLU A 1 142 ? 6.401   13.710  -2.690  1.00 10.60 ? 139 GLU A CG  1 
ATOM   1198 C  CD  . GLU A 1 142 ? 5.956   14.969  -1.974  1.00 11.22 ? 139 GLU A CD  1 
ATOM   1199 O  OE1 . GLU A 1 142 ? 5.580   14.856  -0.813  1.00 11.74 ? 139 GLU A OE1 1 
ATOM   1200 O  OE2 . GLU A 1 142 ? 6.051   16.087  -2.526  1.00 13.70 ? 139 GLU A OE2 1 
ATOM   1201 N  N   . THR A 1 143 ? 9.792   13.574  0.429   1.00 9.01  ? 140 THR A N   1 
ATOM   1202 C  CA  . THR A 1 143 ? 10.599  13.022  1.503   1.00 9.49  ? 140 THR A CA  1 
ATOM   1203 C  C   . THR A 1 143 ? 10.021  11.708  2.033   1.00 7.87  ? 140 THR A C   1 
ATOM   1204 O  O   . THR A 1 143 ? 8.821   11.463  1.953   1.00 8.26  ? 140 THR A O   1 
ATOM   1205 C  CB  . THR A 1 143 ? 10.719  14.021  2.687   1.00 11.46 ? 140 THR A CB  1 
ATOM   1206 O  OG1 . THR A 1 143 ? 9.404   14.403  3.120   1.00 14.58 ? 140 THR A OG1 1 
ATOM   1207 C  CG2 . THR A 1 143 ? 11.455  15.279  2.263   1.00 13.95 ? 140 THR A CG2 1 
ATOM   1208 N  N   . TYR A 1 144 ? 10.899  10.879  2.589   1.00 7.66  ? 141 TYR A N   1 
ATOM   1209 C  CA  . TYR A 1 144 ? 10.527  9.633   3.264   1.00 7.74  ? 141 TYR A CA  1 
ATOM   1210 C  C   . TYR A 1 144 ? 9.483   9.973   4.330   1.00 7.37  ? 141 TYR A C   1 
ATOM   1211 O  O   . TYR A 1 144 ? 9.731   10.850  5.159   1.00 8.61  ? 141 TYR A O   1 
ATOM   1212 C  CB  . TYR A 1 144 ? 11.798  9.047   3.870   1.00 7.88  ? 141 TYR A CB  1 
ATOM   1213 C  CG  . TYR A 1 144 ? 11.597  7.670   4.431   1.00 6.57  ? 141 TYR A CG  1 
ATOM   1214 C  CD1 . TYR A 1 144 ? 11.000  7.472   5.670   1.00 7.55  ? 141 TYR A CD1 1 
ATOM   1215 C  CD2 . TYR A 1 144 ? 11.972  6.554   3.704   1.00 6.83  ? 141 TYR A CD2 1 
ATOM   1216 C  CE1 . TYR A 1 144 ? 10.787  6.182   6.169   1.00 7.24  ? 141 TYR A CE1 1 
ATOM   1217 C  CE2 . TYR A 1 144 ? 11.761  5.259   4.173   1.00 6.97  ? 141 TYR A CE2 1 
ATOM   1218 C  CZ  . TYR A 1 144 ? 11.167  5.097   5.417   1.00 6.76  ? 141 TYR A CZ  1 
ATOM   1219 O  OH  . TYR A 1 144 ? 10.956  3.821   5.870   1.00 7.59  ? 141 TYR A OH  1 
ATOM   1220 N  N   . ASP A 1 145 ? 8.353   9.256   4.324   1.00 6.58  ? 142 ASP A N   1 
ATOM   1221 C  CA  . ASP A 1 145 ? 7.200   9.623   5.142   1.00 6.60  ? 142 ASP A CA  1 
ATOM   1222 C  C   . ASP A 1 145 ? 6.938   8.584   6.205   1.00 6.48  ? 142 ASP A C   1 
ATOM   1223 O  O   . ASP A 1 145 ? 6.334   7.531   5.946   1.00 6.77  ? 142 ASP A O   1 
ATOM   1224 C  CB  . ASP A 1 145 ? 6.033   9.762   4.195   1.00 7.04  ? 142 ASP A CB  1 
ATOM   1225 C  CG  . ASP A 1 145 ? 4.753   10.194  4.851   1.00 7.51  ? 142 ASP A CG  1 
ATOM   1226 O  OD1 . ASP A 1 145 ? 4.737   10.586  6.050   1.00 8.26  ? 142 ASP A OD1 1 
ATOM   1227 O  OD2 . ASP A 1 145 ? 3.705   10.108  4.145   1.00 7.00  ? 142 ASP A OD2 1 
ATOM   1228 N  N   . PHE A 1 146 ? 7.375   8.881   7.425   1.00 6.50  ? 143 PHE A N   1 
ATOM   1229 C  CA  . PHE A 1 146 ? 7.142   7.972   8.542   1.00 6.99  ? 143 PHE A CA  1 
ATOM   1230 C  C   . PHE A 1 146 ? 5.675   7.778   8.848   1.00 7.27  ? 143 PHE A C   1 
ATOM   1231 O  O   . PHE A 1 146 ? 5.298   6.741   9.382   1.00 8.01  ? 143 PHE A O   1 
ATOM   1232 C  CB  . PHE A 1 146 ? 7.858   8.492   9.794   1.00 7.73  ? 143 PHE A CB  1 
ATOM   1233 C  CG  . PHE A 1 146 ? 9.351   8.574   9.640   1.00 7.99  ? 143 PHE A CG  1 
ATOM   1234 C  CD1 . PHE A 1 146 ? 9.947   9.808   9.449   1.00 8.92  ? 143 PHE A CD1 1 
ATOM   1235 C  CD2 . PHE A 1 146 ? 10.155  7.436   9.630   1.00 8.05  ? 143 PHE A CD2 1 
ATOM   1236 C  CE1 . PHE A 1 146 ? 11.344  9.919   9.332   1.00 10.89 ? 143 PHE A CE1 1 
ATOM   1237 C  CE2 . PHE A 1 146 ? 11.539  7.546   9.518   1.00 8.83  ? 143 PHE A CE2 1 
ATOM   1238 C  CZ  . PHE A 1 146 ? 12.131  8.792   9.352   1.00 10.29 ? 143 PHE A CZ  1 
ATOM   1239 N  N   . ASP A 1 147 ? 4.865   8.780   8.515   1.00 7.58  ? 144 ASP A N   1 
ATOM   1240 C  CA  A ASP A 1 147 ? 3.431   8.709   8.815   0.60 7.52  ? 144 ASP A CA  1 
ATOM   1241 C  CA  B ASP A 1 147 ? 3.414   8.772   8.779   0.40 7.18  ? 144 ASP A CA  1 
ATOM   1242 C  C   . ASP A 1 147 ? 2.633   8.022   7.702   1.00 6.46  ? 144 ASP A C   1 
ATOM   1243 O  O   . ASP A 1 147 ? 1.428   7.900   7.799   1.00 6.96  ? 144 ASP A O   1 
ATOM   1244 C  CB  A ASP A 1 147 ? 2.880   10.093  9.077   0.60 8.56  ? 144 ASP A CB  1 
ATOM   1245 C  CB  B ASP A 1 147 ? 2.882   10.204  8.854   0.40 7.90  ? 144 ASP A CB  1 
ATOM   1246 C  CG  A ASP A 1 147 ? 1.573   10.045  9.756   0.60 11.31 ? 144 ASP A CG  1 
ATOM   1247 C  CG  B ASP A 1 147 ? 3.162   10.873  10.183  0.40 8.64  ? 144 ASP A CG  1 
ATOM   1248 O  OD1 A ASP A 1 147 ? 0.667   10.769  9.326   0.60 11.78 ? 144 ASP A OD1 1 
ATOM   1249 O  OD1 B ASP A 1 147 ? 3.273   10.191  11.219  0.40 11.28 ? 144 ASP A OD1 1 
ATOM   1250 O  OD2 A ASP A 1 147 ? 1.445   9.291   10.735  0.60 13.00 ? 144 ASP A OD2 1 
ATOM   1251 O  OD2 B ASP A 1 147 ? 3.190   12.118  10.191  0.40 10.29 ? 144 ASP A OD2 1 
ATOM   1252 N  N   . SER A 1 148 ? 3.293   7.539   6.653   1.00 6.36  ? 145 SER A N   1 
ATOM   1253 C  CA  . SER A 1 148 ? 2.550   6.928   5.544   1.00 6.10  ? 145 SER A CA  1 
ATOM   1254 C  C   . SER A 1 148 ? 1.690   5.764   5.972   1.00 6.29  ? 145 SER A C   1 
ATOM   1255 O  O   . SER A 1 148 ? 2.130   4.921   6.776   1.00 6.21  ? 145 SER A O   1 
ATOM   1256 C  CB  . SER A 1 148 ? 3.551   6.431   4.495   1.00 6.37  ? 145 SER A CB  1 
ATOM   1257 O  OG  . SER A 1 148 ? 2.892   5.791   3.425   1.00 6.55  ? 145 SER A OG  1 
ATOM   1258 N  N   . ILE A 1 149 ? 0.504   5.652   5.363   1.00 6.27  ? 146 ILE A N   1 
ATOM   1259 C  CA  . ILE A 1 149 ? -0.305  4.449   5.513   1.00 7.33  ? 146 ILE A CA  1 
ATOM   1260 C  C   . ILE A 1 149 ? 0.425   3.224   4.959   1.00 6.57  ? 146 ILE A C   1 
ATOM   1261 O  O   . ILE A 1 149 ? -0.013  2.107   5.210   1.00 6.01  ? 146 ILE A O   1 
ATOM   1262 C  CB  . ILE A 1 149 ? -1.677  4.646   4.771   1.00 9.43  ? 146 ILE A CB  1 
ATOM   1263 C  CG1 . ILE A 1 149 ? -2.745  3.657   5.215   1.00 12.44 ? 146 ILE A CG1 1 
ATOM   1264 C  CG2 . ILE A 1 149 ? -1.555  4.564   3.249   1.00 12.24 ? 146 ILE A CG2 1 
ATOM   1265 C  CD1 . ILE A 1 149 ? -3.663  4.109   6.227   1.00 13.36 ? 146 ILE A CD1 1 
ATOM   1266 N  N   . MET A 1 150 ? 1.500   3.448   4.173   1.00 5.93  ? 147 MET A N   1 
ATOM   1267 C  CA  . MET A 1 150 ? 2.287   2.356   3.585   1.00 6.00  ? 147 MET A CA  1 
ATOM   1268 C  C   . MET A 1 150 ? 3.511   1.980   4.424   1.00 5.17  ? 147 MET A C   1 
ATOM   1269 O  O   . MET A 1 150 ? 4.312   1.137   3.988   1.00 6.30  ? 147 MET A O   1 
ATOM   1270 C  CB  . MET A 1 150 ? 2.763   2.750   2.190   1.00 7.01  ? 147 MET A CB  1 
ATOM   1271 C  CG  . MET A 1 150 ? 1.651   3.224   1.243   1.00 6.73  ? 147 MET A CG  1 
ATOM   1272 S  SD  . MET A 1 150 ? 0.222   2.129   1.119   1.00 7.12  ? 147 MET A SD  1 
ATOM   1273 C  CE  . MET A 1 150 ? 0.939   0.667   0.343   1.00 8.55  ? 147 MET A CE  1 
ATOM   1274 N  N   . HIS A 1 151 ? 3.650   2.574   5.609   1.00 5.70  ? 148 HIS A N   1 
ATOM   1275 C  CA  . HIS A 1 151 ? 4.819   2.307   6.440   1.00 6.52  ? 148 HIS A CA  1 
ATOM   1276 C  C   . HIS A 1 151 ? 4.518   1.172   7.401   1.00 6.02  ? 148 HIS A C   1 
ATOM   1277 O  O   . HIS A 1 151 ? 3.518   1.205   8.099   1.00 7.23  ? 148 HIS A O   1 
ATOM   1278 C  CB  . HIS A 1 151 ? 5.262   3.573   7.227   1.00 6.61  ? 148 HIS A CB  1 
ATOM   1279 C  CG  . HIS A 1 151 ? 6.709   3.538   7.589   1.00 6.46  ? 148 HIS A CG  1 
ATOM   1280 N  ND1 . HIS A 1 151 ? 7.250   2.615   8.476   1.00 7.04  ? 148 HIS A ND1 1 
ATOM   1281 C  CD2 . HIS A 1 151 ? 7.757   4.265   7.117   1.00 6.51  ? 148 HIS A CD2 1 
ATOM   1282 C  CE1 . HIS A 1 151 ? 8.567   2.790   8.530   1.00 7.16  ? 148 HIS A CE1 1 
ATOM   1283 N  NE2 . HIS A 1 151 ? 8.904   3.778   7.708   1.00 7.14  ? 148 HIS A NE2 1 
ATOM   1284 N  N   . TYR A 1 152 ? 5.454   0.229   7.499   1.00 6.52  ? 149 TYR A N   1 
ATOM   1285 C  CA  . TYR A 1 152 ? 5.330   -0.845  8.497   1.00 6.27  ? 149 TYR A CA  1 
ATOM   1286 C  C   . TYR A 1 152 ? 5.446   -0.294  9.900   1.00 6.24  ? 149 TYR A C   1 
ATOM   1287 O  O   . TYR A 1 152 ? 6.016   0.766   10.132  1.00 6.91  ? 149 TYR A O   1 
ATOM   1288 C  CB  . TYR A 1 152 ? 6.512   -1.813  8.305   1.00 7.61  ? 149 TYR A CB  1 
ATOM   1289 C  CG  . TYR A 1 152 ? 6.384   -2.936  7.323   1.00 8.20  ? 149 TYR A CG  1 
ATOM   1290 C  CD1 . TYR A 1 152 ? 5.319   -3.067  6.472   1.00 8.39  ? 149 TYR A CD1 1 
ATOM   1291 C  CD2 . TYR A 1 152 ? 7.422   -3.882  7.279   1.00 9.36  ? 149 TYR A CD2 1 
ATOM   1292 C  CE1 . TYR A 1 152 ? 5.260   -4.188  5.566   1.00 10.64 ? 149 TYR A CE1 1 
ATOM   1293 C  CE2 . TYR A 1 152 ? 7.378   -4.960  6.410   1.00 10.60 ? 149 TYR A CE2 1 
ATOM   1294 C  CZ  . TYR A 1 152 ? 6.311   -5.094  5.548   1.00 9.99  ? 149 TYR A CZ  1 
ATOM   1295 O  OH  . TYR A 1 152 ? 6.301   -6.168  4.684   1.00 12.76 ? 149 TYR A OH  1 
ATOM   1296 N  N   . ALA A 1 153 ? 4.882   -1.006  10.849  1.00 6.22  ? 150 ALA A N   1 
ATOM   1297 C  CA  . ALA A 1 153 ? 5.103   -0.720  12.262  1.00 6.75  ? 150 ALA A CA  1 
ATOM   1298 C  C   . ALA A 1 153 ? 6.516   -1.117  12.698  1.00 7.34  ? 150 ALA A C   1 
ATOM   1299 O  O   . ALA A 1 153 ? 7.256   -1.788  11.977  1.00 8.33  ? 150 ALA A O   1 
ATOM   1300 C  CB  . ALA A 1 153 ? 4.081   -1.480  13.080  1.00 7.38  ? 150 ALA A CB  1 
ATOM   1301 N  N   . ARG A 1 154 ? 6.894   -0.717  13.907  1.00 6.73  ? 151 ARG A N   1 
ATOM   1302 C  CA  . ARG A 1 154 ? 8.239   -0.880  14.388  1.00 7.01  ? 151 ARG A CA  1 
ATOM   1303 C  C   . ARG A 1 154 ? 8.668   -2.341  14.576  1.00 7.23  ? 151 ARG A C   1 
ATOM   1304 O  O   . ARG A 1 154 ? 9.851   -2.641  14.582  1.00 8.04  ? 151 ARG A O   1 
ATOM   1305 C  CB  . ARG A 1 154 ? 8.403   -0.134  15.719  1.00 8.24  ? 151 ARG A CB  1 
ATOM   1306 C  CG  . ARG A 1 154 ? 7.546   -0.695  16.865  1.00 8.18  ? 151 ARG A CG  1 
ATOM   1307 C  CD  . ARG A 1 154 ? 7.481   0.240   18.073  1.00 8.79  ? 151 ARG A CD  1 
ATOM   1308 N  NE  . ARG A 1 154 ? 8.822   0.371   18.616  1.00 10.23 ? 151 ARG A NE  1 
ATOM   1309 C  CZ  . ARG A 1 154 ? 9.193   1.331   19.469  1.00 11.35 ? 151 ARG A CZ  1 
ATOM   1310 N  NH1 . ARG A 1 154 ? 8.303   2.186   19.937  1.00 12.95 ? 151 ARG A NH1 1 
ATOM   1311 N  NH2 . ARG A 1 154 ? 10.456  1.396   19.877  1.00 12.22 ? 151 ARG A NH2 1 
ATOM   1312 N  N   . ASN A 1 155 ? 7.692   -3.234  14.750  1.00 6.64  ? 152 ASN A N   1 
ATOM   1313 C  CA  . ASN A 1 155 ? 7.945   -4.646  15.082  1.00 6.81  ? 152 ASN A CA  1 
ATOM   1314 C  C   . ASN A 1 155 ? 7.305   -5.590  14.089  1.00 6.84  ? 152 ASN A C   1 
ATOM   1315 O  O   . ASN A 1 155 ? 7.089   -6.766  14.383  1.00 8.09  ? 152 ASN A O   1 
ATOM   1316 C  CB  . ASN A 1 155 ? 7.480   -4.959  16.516  1.00 8.03  ? 152 ASN A CB  1 
ATOM   1317 C  CG  . ASN A 1 155 ? 6.006   -4.727  16.696  1.00 8.37  ? 152 ASN A CG  1 
ATOM   1318 O  OD1 . ASN A 1 155 ? 5.319   -4.313  15.750  1.00 9.26  ? 152 ASN A OD1 1 
ATOM   1319 N  ND2 . ASN A 1 155 ? 5.490   -5.015  17.900  1.00 10.64 ? 152 ASN A ND2 1 
ATOM   1320 N  N   . THR A 1 156 ? 7.020   -5.114  12.879  1.00 7.30  ? 153 THR A N   1 
ATOM   1321 C  CA  A THR A 1 156 ? 6.435   -5.956  11.865  0.60 7.71  ? 153 THR A CA  1 
ATOM   1322 C  CA  B THR A 1 156 ? 6.432   -6.028  11.899  0.40 9.06  ? 153 THR A CA  1 
ATOM   1323 C  C   . THR A 1 156 ? 7.429   -7.090  11.534  1.00 7.85  ? 153 THR A C   1 
ATOM   1324 O  O   . THR A 1 156 ? 8.633   -6.826  11.338  1.00 8.99  ? 153 THR A O   1 
ATOM   1325 C  CB  A THR A 1 156 ? 6.016   -5.054  10.635  0.60 8.16  ? 153 THR A CB  1 
ATOM   1326 C  CB  B THR A 1 156 ? 6.105   -5.382  10.571  0.40 10.95 ? 153 THR A CB  1 
ATOM   1327 O  OG1 A THR A 1 156 ? 5.051   -4.106  11.085  0.60 7.57  ? 153 THR A OG1 1 
ATOM   1328 O  OG1 B THR A 1 156 ? 7.302   -5.345  9.779   0.40 15.46 ? 153 THR A OG1 1 
ATOM   1329 C  CG2 A THR A 1 156 ? 5.357   -5.904  9.521   0.60 6.96  ? 153 THR A CG2 1 
ATOM   1330 C  CG2 B THR A 1 156 ? 5.502   -4.034  10.776  0.40 9.33  ? 153 THR A CG2 1 
ATOM   1331 N  N   . PHE A 1 157 ? 6.926   -8.325  11.452  1.00 8.42  ? 154 PHE A N   1 
ATOM   1332 C  CA  . PHE A 1 157 ? 7.750   -9.507  11.158  1.00 8.78  ? 154 PHE A CA  1 
ATOM   1333 C  C   . PHE A 1 157 ? 8.880   -9.705  12.156  1.00 9.38  ? 154 PHE A C   1 
ATOM   1334 O  O   . PHE A 1 157 ? 9.886   -10.352 11.835  1.00 9.54  ? 154 PHE A O   1 
ATOM   1335 C  CB  . PHE A 1 157 ? 8.279   -9.544  9.712   1.00 9.29  ? 154 PHE A CB  1 
ATOM   1336 C  CG  . PHE A 1 157 ? 7.187   -9.668  8.705   1.00 8.95  ? 154 PHE A CG  1 
ATOM   1337 C  CD1 . PHE A 1 157 ? 6.391   -10.810 8.685   1.00 11.57 ? 154 PHE A CD1 1 
ATOM   1338 C  CD2 . PHE A 1 157 ? 6.930   -8.644  7.805   1.00 11.14 ? 154 PHE A CD2 1 
ATOM   1339 C  CE1 . PHE A 1 157 ? 5.376   -10.930 7.752   1.00 13.32 ? 154 PHE A CE1 1 
ATOM   1340 C  CE2 . PHE A 1 157 ? 5.887   -8.757  6.883   1.00 11.73 ? 154 PHE A CE2 1 
ATOM   1341 C  CZ  . PHE A 1 157 ? 5.122   -9.876  6.874   1.00 13.07 ? 154 PHE A CZ  1 
ATOM   1342 N  N   . SER A 1 158 ? 8.714   -9.208  13.385  1.00 9.91  ? 155 SER A N   1 
ATOM   1343 C  CA  . SER A 1 158 ? 9.748   -9.422  14.408  1.00 9.88  ? 155 SER A CA  1 
ATOM   1344 C  C   . SER A 1 158 ? 9.619   -10.764 15.102  1.00 10.92 ? 155 SER A C   1 
ATOM   1345 O  O   . SER A 1 158 ? 8.510   -11.342 15.189  1.00 12.11 ? 155 SER A O   1 
ATOM   1346 C  CB  . SER A 1 158 ? 9.623   -8.392  15.499  1.00 10.01 ? 155 SER A CB  1 
ATOM   1347 O  OG  . SER A 1 158 ? 10.715  -8.556  16.388  1.00 9.68  ? 155 SER A OG  1 
ATOM   1348 N  N   . ARG A 1 159 ? 10.757  -11.220 15.641  1.00 11.37 ? 156 ARG A N   1 
ATOM   1349 C  CA  A ARG A 1 159 ? 10.892  -12.346 16.585  0.50 12.96 ? 156 ARG A CA  1 
ATOM   1350 C  CA  B ARG A 1 159 ? 10.764  -12.389 16.501  0.50 12.53 ? 156 ARG A CA  1 
ATOM   1351 C  C   . ARG A 1 159 ? 10.197  -12.090 17.904  1.00 12.88 ? 156 ARG A C   1 
ATOM   1352 O  O   . ARG A 1 159 ? 9.925   -13.016 18.682  1.00 14.43 ? 156 ARG A O   1 
ATOM   1353 C  CB  A ARG A 1 159 ? 12.359  -12.552 16.962  0.50 13.49 ? 156 ARG A CB  1 
ATOM   1354 C  CB  B ARG A 1 159 ? 12.167  -12.995 16.564  0.50 12.06 ? 156 ARG A CB  1 
ATOM   1355 C  CG  A ARG A 1 159 ? 13.212  -13.214 15.945  0.50 15.87 ? 156 ARG A CG  1 
ATOM   1356 C  CG  B ARG A 1 159 ? 13.223  -12.051 17.121  0.50 12.85 ? 156 ARG A CG  1 
ATOM   1357 C  CD  A ARG A 1 159 ? 14.548  -13.592 16.598  0.50 16.63 ? 156 ARG A CD  1 
ATOM   1358 C  CD  B ARG A 1 159 ? 14.585  -12.712 17.045  0.50 17.94 ? 156 ARG A CD  1 
ATOM   1359 N  NE  A ARG A 1 159 ? 15.396  -12.456 16.947  0.50 15.55 ? 156 ARG A NE  1 
ATOM   1360 N  NE  B ARG A 1 159 ? 14.988  -13.148 18.373  0.50 25.64 ? 156 ARG A NE  1 
ATOM   1361 C  CZ  A ARG A 1 159 ? 15.806  -12.124 18.176  0.50 15.52 ? 156 ARG A CZ  1 
ATOM   1362 C  CZ  B ARG A 1 159 ? 15.755  -12.423 19.182  0.50 27.48 ? 156 ARG A CZ  1 
ATOM   1363 N  NH1 A ARG A 1 159 ? 15.493  -12.865 19.265  0.50 16.71 ? 156 ARG A NH1 1 
ATOM   1364 N  NH1 B ARG A 1 159 ? 16.203  -11.242 18.783  0.50 30.13 ? 156 ARG A NH1 1 
ATOM   1365 N  NH2 A ARG A 1 159 ? 16.586  -11.066 18.323  0.50 20.12 ? 156 ARG A NH2 1 
ATOM   1366 N  NH2 B ARG A 1 159 ? 16.077  -12.880 20.381  0.50 29.69 ? 156 ARG A NH2 1 
ATOM   1367 N  N   . GLY A 1 160 ? 10.004  -10.820 18.244  1.00 11.77 ? 157 GLY A N   1 
ATOM   1368 C  CA  . GLY A 1 160 ? 9.494   -10.501 19.561  1.00 13.34 ? 157 GLY A CA  1 
ATOM   1369 C  C   . GLY A 1 160 ? 8.695   -9.248  19.472  1.00 12.20 ? 157 GLY A C   1 
ATOM   1370 O  O   . GLY A 1 160 ? 9.077   -8.271  18.798  1.00 11.94 ? 157 GLY A O   1 
ATOM   1371 N  N   . ILE A 1 161 ? 7.563   -9.090  20.343  1.00 12.49 ? 159 ILE A N   1 
ATOM   1372 C  CA  . ILE A 1 161 ? 6.757   -7.899  20.292  1.00 13.05 ? 159 ILE A CA  1 
ATOM   1373 C  C   . ILE A 1 161 ? 7.570   -6.661  20.633  1.00 11.54 ? 159 ILE A C   1 
ATOM   1374 O  O   . ILE A 1 161 ? 7.289   -5.584  20.088  1.00 12.15 ? 159 ILE A O   1 
ATOM   1375 C  CB  . ILE A 1 161 ? 5.532   -8.031  21.212  1.00 14.36 ? 159 ILE A CB  1 
ATOM   1376 C  CG1 . ILE A 1 161 ? 4.561   -6.880  20.942  1.00 18.04 ? 159 ILE A CG1 1 
ATOM   1377 C  CG2 . ILE A 1 161 ? 5.952   -8.190  22.668  1.00 17.85 ? 159 ILE A CG2 1 
ATOM   1378 C  CD1 . ILE A 1 161 ? 3.153   -7.106  21.417  1.00 22.51 ? 159 ILE A CD1 1 
ATOM   1379 N  N   . PHE A 1 162 ? 8.554   -6.793  21.531  1.00 10.91 ? 160 PHE A N   1 
ATOM   1380 C  CA  . PHE A 1 162 ? 9.359   -5.625  21.944  1.00 10.34 ? 160 PHE A CA  1 
ATOM   1381 C  C   . PHE A 1 162 ? 10.708  -5.555  21.280  1.00 9.85  ? 160 PHE A C   1 
ATOM   1382 O  O   . PHE A 1 162 ? 11.593  -4.832  21.728  1.00 10.64 ? 160 PHE A O   1 
ATOM   1383 C  CB  . PHE A 1 162 ? 9.487   -5.553  23.469  1.00 12.07 ? 160 PHE A CB  1 
ATOM   1384 C  CG  . PHE A 1 162 ? 8.180   -5.361  24.154  1.00 13.99 ? 160 PHE A CG  1 
ATOM   1385 C  CD1 . PHE A 1 162 ? 7.365   -4.280  23.832  1.00 15.82 ? 160 PHE A CD1 1 
ATOM   1386 C  CD2 . PHE A 1 162 ? 7.776   -6.253  25.154  1.00 17.75 ? 160 PHE A CD2 1 
ATOM   1387 C  CE1 . PHE A 1 162 ? 6.140   -4.091  24.472  1.00 16.59 ? 160 PHE A CE1 1 
ATOM   1388 C  CE2 . PHE A 1 162 ? 6.553   -6.080  25.796  1.00 19.14 ? 160 PHE A CE2 1 
ATOM   1389 C  CZ  . PHE A 1 162 ? 5.744   -5.004  25.457  1.00 18.01 ? 160 PHE A CZ  1 
ATOM   1390 N  N   . LEU A 1 163 ? 10.887  -6.306  20.203  1.00 9.54  ? 161 LEU A N   1 
ATOM   1391 C  CA  . LEU A 1 163 ? 12.112  -6.281  19.428  1.00 10.06 ? 161 LEU A CA  1 
ATOM   1392 C  C   . LEU A 1 163 ? 11.817  -5.595  18.112  1.00 9.70  ? 161 LEU A C   1 
ATOM   1393 O  O   . LEU A 1 163 ? 11.136  -6.133  17.225  1.00 11.12 ? 161 LEU A O   1 
ATOM   1394 C  CB  . LEU A 1 163 ? 12.673  -7.687  19.203  1.00 10.42 ? 161 LEU A CB  1 
ATOM   1395 C  CG  . LEU A 1 163 ? 13.225  -8.336  20.482  1.00 11.58 ? 161 LEU A CG  1 
ATOM   1396 C  CD1 . LEU A 1 163 ? 13.483  -9.829  20.274  1.00 15.83 ? 161 LEU A CD1 1 
ATOM   1397 C  CD2 . LEU A 1 163 ? 14.455  -7.628  21.051  1.00 12.14 ? 161 LEU A CD2 1 
ATOM   1398 N  N   . ASP A 1 164 ? 12.332  -4.401  17.955  1.00 8.46  ? 162 ASP A N   1 
ATOM   1399 C  CA  . ASP A 1 164 ? 12.025  -3.635  16.746  1.00 8.59  ? 162 ASP A CA  1 
ATOM   1400 C  C   . ASP A 1 164 ? 12.752  -4.201  15.528  1.00 8.06  ? 162 ASP A C   1 
ATOM   1401 O  O   . ASP A 1 164 ? 13.922  -4.581  15.600  1.00 9.88  ? 162 ASP A O   1 
ATOM   1402 C  CB  . ASP A 1 164 ? 12.502  -2.200  16.912  1.00 8.99  ? 162 ASP A CB  1 
ATOM   1403 C  CG  . ASP A 1 164 ? 11.702  -1.402  17.900  1.00 10.20 ? 162 ASP A CG  1 
ATOM   1404 O  OD1 . ASP A 1 164 ? 10.571  -1.827  18.254  1.00 10.35 ? 162 ASP A OD1 1 
ATOM   1405 O  OD2 . ASP A 1 164 ? 12.193  -0.294  18.240  1.00 12.37 ? 162 ASP A OD2 1 
ATOM   1406 N  N   . THR A 1 165 ? 12.042  -4.259  14.409  1.00 7.76  ? 163 THR A N   1 
ATOM   1407 C  CA  . THR A 1 165 ? 12.669  -4.555  13.139  1.00 7.12  ? 163 THR A CA  1 
ATOM   1408 C  C   . THR A 1 165 ? 12.951  -3.298  12.326  1.00 7.26  ? 163 THR A C   1 
ATOM   1409 O  O   . THR A 1 165 ? 13.792  -3.348  11.427  1.00 7.68  ? 163 THR A O   1 
ATOM   1410 C  CB  . THR A 1 165 ? 11.808  -5.513  12.315  1.00 8.06  ? 163 THR A CB  1 
ATOM   1411 O  OG1 . THR A 1 165 ? 10.471  -5.019  12.334  1.00 8.20  ? 163 THR A OG1 1 
ATOM   1412 C  CG2 . THR A 1 165 ? 11.888  -6.929  12.844  1.00 9.30  ? 163 THR A CG2 1 
ATOM   1413 N  N   . ILE A 1 166 ? 12.283  -2.175  12.646  1.00 7.55  ? 164 ILE A N   1 
ATOM   1414 C  CA  . ILE A 1 166 ? 12.502  -0.935  11.916  1.00 8.58  ? 164 ILE A CA  1 
ATOM   1415 C  C   . ILE A 1 166 ? 12.602  0.178   12.942  1.00 8.36  ? 164 ILE A C   1 
ATOM   1416 O  O   . ILE A 1 166 ? 11.719  0.331   13.800  1.00 9.23  ? 164 ILE A O   1 
ATOM   1417 C  CB  . ILE A 1 166 ? 11.360  -0.630  10.951  1.00 8.33  ? 164 ILE A CB  1 
ATOM   1418 C  CG1 . ILE A 1 166 ? 11.238  -1.727  9.903   1.00 10.82 ? 164 ILE A CG1 1 
ATOM   1419 C  CG2 . ILE A 1 166 ? 11.588  0.730   10.275  1.00 9.69  ? 164 ILE A CG2 1 
ATOM   1420 C  CD1 . ILE A 1 166 ? 9.966   -1.548  8.988   1.00 13.25 ? 164 ILE A CD1 1 
ATOM   1421 N  N   . VAL A 1 167 ? 13.679  0.956   12.845  1.00 9.04  ? 165 VAL A N   1 
ATOM   1422 C  CA  . VAL A 1 167 ? 13.933  2.052   13.783  1.00 9.69  ? 165 VAL A CA  1 
ATOM   1423 C  C   . VAL A 1 167 ? 14.244  3.326   13.012  1.00 8.95  ? 165 VAL A C   1 
ATOM   1424 O  O   . VAL A 1 167 ? 15.253  3.416   12.335  1.00 9.57  ? 165 VAL A O   1 
ATOM   1425 C  CB  . VAL A 1 167 ? 15.102  1.725   14.743  1.00 10.47 ? 165 VAL A CB  1 
ATOM   1426 C  CG1 . VAL A 1 167 ? 15.251  2.863   15.770  1.00 13.26 ? 165 VAL A CG1 1 
ATOM   1427 C  CG2 . VAL A 1 167 ? 14.882  0.407   15.452  1.00 12.17 ? 165 VAL A CG2 1 
ATOM   1428 N  N   . PRO A 1 168 ? 13.378  4.333   13.125  1.00 9.02  ? 166 PRO A N   1 
ATOM   1429 C  CA  . PRO A 1 168 ? 13.688  5.634   12.491  1.00 10.26 ? 166 PRO A CA  1 
ATOM   1430 C  C   . PRO A 1 168 ? 15.019  6.188   12.961  1.00 10.82 ? 166 PRO A C   1 
ATOM   1431 O  O   . PRO A 1 168 ? 15.392  6.026   14.140  1.00 11.95 ? 166 PRO A O   1 
ATOM   1432 C  CB  . PRO A 1 168 ? 12.541  6.538   12.965  1.00 11.11 ? 166 PRO A CB  1 
ATOM   1433 C  CG  . PRO A 1 168 ? 11.361  5.565   13.104  1.00 11.86 ? 166 PRO A CG  1 
ATOM   1434 C  CD  . PRO A 1 168 ? 12.054  4.350   13.767  1.00 10.05 ? 166 PRO A CD  1 
ATOM   1435 N  N   . LYS A 1 169 ? 15.750  6.811   12.049  1.00 10.70 ? 167 LYS A N   1 
ATOM   1436 C  CA  . LYS A 1 169 ? 17.116  7.231   12.366  1.00 12.29 ? 167 LYS A CA  1 
ATOM   1437 C  C   . LYS A 1 169 ? 17.211  8.630   12.966  1.00 12.66 ? 167 LYS A C   1 
ATOM   1438 O  O   . LYS A 1 169 ? 18.289  9.032   13.433  1.00 14.88 ? 167 LYS A O   1 
ATOM   1439 C  CB  . LYS A 1 169 ? 18.006  7.131   11.123  1.00 12.26 ? 167 LYS A CB  1 
ATOM   1440 C  CG  . LYS A 1 169 ? 18.371  5.690   10.788  1.00 13.71 ? 167 LYS A CG  1 
ATOM   1441 C  CD  . LYS A 1 169 ? 19.454  5.630   9.699   1.00 15.84 ? 167 LYS A CD  1 
ATOM   1442 C  CE  . LYS A 1 169 ? 20.046  4.226   9.579   1.00 16.53 ? 167 LYS A CE  1 
ATOM   1443 N  NZ  . LYS A 1 169 ? 21.155  4.220   8.575   1.00 18.52 ? 167 LYS A NZ  1 
ATOM   1444 N  N   . TYR A 1 170 ? 16.129  9.384   13.002  1.00 13.54 ? 168 TYR A N   1 
ATOM   1445 C  CA  . TYR A 1 170 ? 16.169  10.783  13.494  1.00 14.40 ? 168 TYR A CA  1 
ATOM   1446 C  C   . TYR A 1 170 ? 14.776  11.195  13.957  1.00 15.58 ? 168 TYR A C   1 
ATOM   1447 O  O   . TYR A 1 170 ? 13.806  10.497  13.675  1.00 15.77 ? 168 TYR A O   1 
ATOM   1448 C  CB  . TYR A 1 170 ? 16.715  11.746  12.406  1.00 13.92 ? 168 TYR A CB  1 
ATOM   1449 C  CG  . TYR A 1 170 ? 15.980  11.649  11.091  1.00 13.01 ? 168 TYR A CG  1 
ATOM   1450 C  CD1 . TYR A 1 170 ? 14.787  12.315  10.868  1.00 13.43 ? 168 TYR A CD1 1 
ATOM   1451 C  CD2 . TYR A 1 170 ? 16.520  10.887  10.056  1.00 11.87 ? 168 TYR A CD2 1 
ATOM   1452 C  CE1 . TYR A 1 170 ? 14.146  12.214  9.650   1.00 12.68 ? 168 TYR A CE1 1 
ATOM   1453 C  CE2 . TYR A 1 170 ? 15.871  10.766  8.820   1.00 11.37 ? 168 TYR A CE2 1 
ATOM   1454 C  CZ  . TYR A 1 170 ? 14.679  11.418  8.628   1.00 11.56 ? 168 TYR A CZ  1 
ATOM   1455 O  OH  . TYR A 1 170 ? 13.989  11.322  7.449   1.00 13.47 ? 168 TYR A OH  1 
ATOM   1456 N  N   . GLU A 1 171 A 14.697  12.322  14.682  1.00 16.73 ? 168 GLU A N   1 
ATOM   1457 C  CA  . GLU A 1 171 A 13.424  12.905  15.123  1.00 17.90 ? 168 GLU A CA  1 
ATOM   1458 C  C   . GLU A 1 171 A 12.810  13.843  14.103  1.00 18.45 ? 168 GLU A C   1 
ATOM   1459 O  O   . GLU A 1 171 A 13.505  14.381  13.233  1.00 18.49 ? 168 GLU A O   1 
ATOM   1460 C  CB  . GLU A 1 171 A 13.595  13.615  16.468  1.00 18.74 ? 168 GLU A CB  1 
ATOM   1461 C  CG  . GLU A 1 171 A 14.056  12.656  17.551  1.00 22.33 ? 168 GLU A CG  1 
ATOM   1462 C  CD  . GLU A 1 171 A 14.060  13.237  18.944  1.00 27.98 ? 168 GLU A CD  1 
ATOM   1463 O  OE1 . GLU A 1 171 A 14.485  12.502  19.861  1.00 32.07 ? 168 GLU A OE1 1 
ATOM   1464 O  OE2 . GLU A 1 171 A 13.658  14.405  19.123  1.00 31.73 ? 168 GLU A OE2 1 
ATOM   1465 N  N   . VAL A 1 172 B 11.495  14.022  14.191  1.00 20.00 ? 168 VAL A N   1 
ATOM   1466 C  CA  . VAL A 1 172 B 10.740  14.902  13.317  1.00 22.50 ? 168 VAL A CA  1 
ATOM   1467 C  C   . VAL A 1 172 B 9.879   15.761  14.224  1.00 24.22 ? 168 VAL A C   1 
ATOM   1468 O  O   . VAL A 1 172 B 9.089   15.222  15.006  1.00 25.19 ? 168 VAL A O   1 
ATOM   1469 C  CB  . VAL A 1 172 B 9.825   14.096  12.382  1.00 22.74 ? 168 VAL A CB  1 
ATOM   1470 C  CG1 . VAL A 1 172 B 8.943   15.025  11.545  1.00 24.00 ? 168 VAL A CG1 1 
ATOM   1471 C  CG2 . VAL A 1 172 B 10.678  13.206  11.500  1.00 21.01 ? 168 VAL A CG2 1 
ATOM   1472 N  N   . ASN A 1 173 C 10.034  17.080  14.121  1.00 26.24 ? 168 ASN A N   1 
ATOM   1473 C  CA  . ASN A 1 173 C 9.342   18.036  15.000  1.00 28.22 ? 168 ASN A CA  1 
ATOM   1474 C  C   . ASN A 1 173 C 9.474   17.701  16.478  1.00 28.10 ? 168 ASN A C   1 
ATOM   1475 O  O   . ASN A 1 173 C 8.511   17.782  17.257  1.00 29.91 ? 168 ASN A O   1 
ATOM   1476 C  CB  . ASN A 1 173 C 7.892   18.231  14.572  1.00 29.32 ? 168 ASN A CB  1 
ATOM   1477 C  CG  . ASN A 1 173 C 7.784   19.008  13.277  1.00 32.40 ? 168 ASN A CG  1 
ATOM   1478 O  OD1 . ASN A 1 173 C 8.291   20.134  13.169  1.00 36.45 ? 168 ASN A OD1 1 
ATOM   1479 N  ND2 . ASN A 1 173 C 7.140   18.412  12.280  1.00 34.77 ? 168 ASN A ND2 1 
ATOM   1480 N  N   . GLY A 1 174 D 10.689  17.330  16.851  1.00 27.15 ? 168 GLY A N   1 
ATOM   1481 C  CA  . GLY A 1 174 D 11.049  17.130  18.231  1.00 26.97 ? 168 GLY A CA  1 
ATOM   1482 C  C   . GLY A 1 174 D 10.593  15.826  18.840  1.00 25.84 ? 168 GLY A C   1 
ATOM   1483 O  O   . GLY A 1 174 D 10.727  15.641  20.051  1.00 26.54 ? 168 GLY A O   1 
ATOM   1484 N  N   . VAL A 1 175 ? 10.071  14.897  18.027  1.00 24.63 ? 169 VAL A N   1 
ATOM   1485 C  CA  . VAL A 1 175 ? 9.731   13.557  18.550  1.00 23.09 ? 169 VAL A CA  1 
ATOM   1486 C  C   . VAL A 1 175 ? 10.230  12.414  17.652  1.00 21.37 ? 169 VAL A C   1 
ATOM   1487 O  O   . VAL A 1 175 ? 10.380  12.581  16.438  1.00 19.99 ? 169 VAL A O   1 
ATOM   1488 C  CB  . VAL A 1 175 ? 8.201   13.368  18.863  1.00 23.80 ? 169 VAL A CB  1 
ATOM   1489 C  CG1 . VAL A 1 175 ? 7.721   14.399  19.892  1.00 23.68 ? 169 VAL A CG1 1 
ATOM   1490 C  CG2 . VAL A 1 175 ? 7.343   13.427  17.610  1.00 25.13 ? 169 VAL A CG2 1 
ATOM   1491 N  N   . LYS A 1 176 ? 10.527  11.274  18.272  1.00 20.06 ? 170 LYS A N   1 
ATOM   1492 C  CA  . LYS A 1 176 ? 10.718  10.020  17.551  1.00 19.35 ? 170 LYS A CA  1 
ATOM   1493 C  C   . LYS A 1 176 ? 9.460   9.732   16.729  1.00 17.81 ? 170 LYS A C   1 
ATOM   1494 O  O   . LYS A 1 176 ? 8.354   9.653   17.301  1.00 19.15 ? 170 LYS A O   1 
ATOM   1495 C  CB  . LYS A 1 176 ? 10.953  8.900   18.547  1.00 21.15 ? 170 LYS A CB  1 
ATOM   1496 N  N   . PRO A 1 177 ? 9.597   9.606   15.387  1.00 14.90 ? 171 PRO A N   1 
ATOM   1497 C  CA  . PRO A 1 177 ? 8.377   9.501   14.598  1.00 13.60 ? 171 PRO A CA  1 
ATOM   1498 C  C   . PRO A 1 177 ? 7.703   8.146   14.779  1.00 12.66 ? 171 PRO A C   1 
ATOM   1499 O  O   . PRO A 1 177 ? 8.347   7.111   14.583  1.00 13.16 ? 171 PRO A O   1 
ATOM   1500 C  CB  . PRO A 1 177 ? 8.848   9.689   13.154  1.00 14.28 ? 171 PRO A CB  1 
ATOM   1501 C  CG  . PRO A 1 177 ? 10.302  9.452   13.161  1.00 15.39 ? 171 PRO A CG  1 
ATOM   1502 C  CD  . PRO A 1 177 ? 10.821  9.594   14.562  1.00 13.93 ? 171 PRO A CD  1 
ATOM   1503 N  N   . PRO A 1 178 ? 6.428   8.139   15.169  1.00 12.50 ? 172 PRO A N   1 
ATOM   1504 C  CA  . PRO A 1 178 ? 5.691   6.879   15.221  1.00 11.47 ? 172 PRO A CA  1 
ATOM   1505 C  C   . PRO A 1 178 ? 5.490   6.337   13.813  1.00 10.64 ? 172 PRO A C   1 
ATOM   1506 O  O   . PRO A 1 178 ? 5.299   7.107   12.874  1.00 11.69 ? 172 PRO A O   1 
ATOM   1507 C  CB  . PRO A 1 178 ? 4.327   7.275   15.786  1.00 13.11 ? 172 PRO A CB  1 
ATOM   1508 C  CG  . PRO A 1 178 ? 4.229   8.767   15.590  1.00 16.79 ? 172 PRO A CG  1 
ATOM   1509 C  CD  . PRO A 1 178 ? 5.616   9.286   15.632  1.00 14.58 ? 172 PRO A CD  1 
ATOM   1510 N  N   . ILE A 1 179 ? 5.556   5.019   13.683  1.00 8.50  ? 173 ILE A N   1 
ATOM   1511 C  CA  . ILE A 1 179 ? 5.388   4.382   12.364  1.00 7.64  ? 173 ILE A CA  1 
ATOM   1512 C  C   . ILE A 1 179 ? 4.326   3.295   12.447  1.00 7.57  ? 173 ILE A C   1 
ATOM   1513 O  O   . ILE A 1 179 ? 4.144   2.641   13.470  1.00 7.97  ? 173 ILE A O   1 
ATOM   1514 C  CB  . ILE A 1 179 ? 6.713   3.824   11.840  1.00 7.50  ? 173 ILE A CB  1 
ATOM   1515 C  CG1 . ILE A 1 179 ? 7.434   2.948   12.884  1.00 8.21  ? 173 ILE A CG1 1 
ATOM   1516 C  CG2 . ILE A 1 179 ? 7.635   4.953   11.374  1.00 9.64  ? 173 ILE A CG2 1 
ATOM   1517 C  CD1 . ILE A 1 179 ? 8.640   2.182   12.289  1.00 8.79  ? 173 ILE A CD1 1 
ATOM   1518 N  N   . GLY A 1 180 ? 3.628   3.087   11.336  1.00 7.18  ? 174 GLY A N   1 
ATOM   1519 C  CA  . GLY A 1 180 ? 2.691   1.960   11.221  1.00 7.91  ? 174 GLY A CA  1 
ATOM   1520 C  C   . GLY A 1 180 ? 1.228   2.315   11.373  1.00 8.33  ? 174 GLY A C   1 
ATOM   1521 O  O   . GLY A 1 180 ? 0.409   1.413   11.451  1.00 9.49  ? 174 GLY A O   1 
ATOM   1522 N  N   . GLN A 1 181 ? 0.864   3.614   11.348  1.00 8.14  ? 175 GLN A N   1 
ATOM   1523 C  CA  . GLN A 1 181 ? -0.541  3.952   11.496  1.00 8.76  ? 175 GLN A CA  1 
ATOM   1524 C  C   . GLN A 1 181 ? -1.375  3.385   10.353  1.00 8.74  ? 175 GLN A C   1 
ATOM   1525 O  O   . GLN A 1 181 ? -0.949  3.359   9.186   1.00 8.39  ? 175 GLN A O   1 
ATOM   1526 C  CB  . GLN A 1 181 ? -0.754  5.468   11.593  1.00 9.23  ? 175 GLN A CB  1 
ATOM   1527 C  CG  . GLN A 1 181 ? -0.383  6.259   10.303  1.00 8.76  ? 175 GLN A CG  1 
ATOM   1528 C  CD  . GLN A 1 181 ? -1.527  6.378   9.332   1.00 7.65  ? 175 GLN A CD  1 
ATOM   1529 O  OE1 . GLN A 1 181 ? -2.691  6.207   9.712   1.00 8.69  ? 175 GLN A OE1 1 
ATOM   1530 N  NE2 . GLN A 1 181 ? -1.217  6.770   8.088   1.00 8.02  ? 175 GLN A NE2 1 
ATOM   1531 N  N   . ARG A 1 182 ? -2.575  2.926   10.680  1.00 9.30  ? 176 ARG A N   1 
ATOM   1532 C  CA  . ARG A 1 182 ? -3.565  2.443   9.703   1.00 8.53  ? 176 ARG A CA  1 
ATOM   1533 C  C   . ARG A 1 182 ? -4.901  3.081   9.982   1.00 8.70  ? 176 ARG A C   1 
ATOM   1534 O  O   . ARG A 1 182 ? -5.954  2.451   10.076  1.00 10.03 ? 176 ARG A O   1 
ATOM   1535 C  CB  . ARG A 1 182 ? -3.660  0.922   9.676   1.00 9.31  ? 176 ARG A CB  1 
ATOM   1536 C  CG  . ARG A 1 182 ? -2.384  0.199   9.285   1.00 8.54  ? 176 ARG A CG  1 
ATOM   1537 C  CD  . ARG A 1 182 ? -2.052  0.483   7.797   1.00 9.73  ? 176 ARG A CD  1 
ATOM   1538 N  NE  . ARG A 1 182 ? -0.883  -0.273  7.328   1.00 8.50  ? 176 ARG A NE  1 
ATOM   1539 C  CZ  . ARG A 1 182 ? 0.378   0.124   7.508   1.00 8.29  ? 176 ARG A CZ  1 
ATOM   1540 N  NH1 . ARG A 1 182 ? 0.678   1.309   8.065   1.00 8.77  ? 176 ARG A NH1 1 
ATOM   1541 N  NH2 . ARG A 1 182 ? 1.380   -0.639  7.080   1.00 9.10  ? 176 ARG A NH2 1 
ATOM   1542 N  N   . THR A 1 183 ? -4.835  4.487   10.106  1.00 9.08  ? 180 THR A N   1 
ATOM   1543 C  CA  A THR A 1 183 ? -6.086  5.205   10.349  0.50 10.20 ? 180 THR A CA  1 
ATOM   1544 C  CA  B THR A 1 183 ? -6.008  5.310   10.417  0.50 9.07  ? 180 THR A CA  1 
ATOM   1545 C  C   . THR A 1 183 ? -6.506  6.068   9.169   1.00 9.12  ? 180 THR A C   1 
ATOM   1546 O  O   . THR A 1 183 ? -7.707  6.142   8.883   1.00 9.79  ? 180 THR A O   1 
ATOM   1547 C  CB  A THR A 1 183 ? -6.004  6.072   11.590  0.50 11.22 ? 180 THR A CB  1 
ATOM   1548 C  CB  B THR A 1 183 ? -5.669  6.303   11.556  0.50 8.66  ? 180 THR A CB  1 
ATOM   1549 O  OG1 A THR A 1 183 ? -4.861  6.915   11.490  0.50 16.68 ? 180 THR A OG1 1 
ATOM   1550 O  OG1 B THR A 1 183 ? -5.301  5.565   12.714  0.50 10.07 ? 180 THR A OG1 1 
ATOM   1551 C  CG2 A THR A 1 183 ? -5.863  5.211   12.759  0.50 9.12  ? 180 THR A CG2 1 
ATOM   1552 C  CG2 B THR A 1 183 ? -6.882  7.153   11.889  0.50 8.59  ? 180 THR A CG2 1 
ATOM   1553 N  N   . ARG A 1 184 ? -5.568  6.678   8.451   1.00 8.37  ? 181 ARG A N   1 
ATOM   1554 C  CA  . ARG A 1 184 ? -5.961  7.539   7.329   1.00 8.97  ? 181 ARG A CA  1 
ATOM   1555 C  C   . ARG A 1 184 ? -4.733  7.806   6.473   1.00 7.48  ? 181 ARG A C   1 
ATOM   1556 O  O   . ARG A 1 184 ? -3.599  7.685   6.936   1.00 8.62  ? 181 ARG A O   1 
ATOM   1557 C  CB  . ARG A 1 184 ? -6.568  8.867   7.852   1.00 10.08 ? 181 ARG A CB  1 
ATOM   1558 C  CG  . ARG A 1 184 ? -5.502  9.833   8.444   1.00 11.60 ? 181 ARG A CG  1 
ATOM   1559 C  CD  . ARG A 1 184 ? -4.872  9.495   9.771   1.00 16.71 ? 181 ARG A CD  1 
ATOM   1560 N  NE  . ARG A 1 184 ? -3.920  10.510  10.307  1.00 18.34 ? 181 ARG A NE  1 
ATOM   1561 C  CZ  . ARG A 1 184 ? -2.622  10.591  9.985   1.00 19.08 ? 181 ARG A CZ  1 
ATOM   1562 N  NH1 . ARG A 1 184 ? -2.078  9.795   9.054   1.00 18.11 ? 181 ARG A NH1 1 
ATOM   1563 N  NH2 . ARG A 1 184 ? -1.868  11.525  10.538  1.00 19.92 ? 181 ARG A NH2 1 
ATOM   1564 N  N   . LEU A 1 185 ? -4.941  8.266   5.250   1.00 7.04  ? 182 LEU A N   1 
ATOM   1565 C  CA  . LEU A 1 185 ? -3.820  8.705   4.426   1.00 7.46  ? 182 LEU A CA  1 
ATOM   1566 C  C   . LEU A 1 185 ? -3.055  9.822   5.112   1.00 7.61  ? 182 LEU A C   1 
ATOM   1567 O  O   . LEU A 1 185 ? -3.660  10.734  5.693   1.00 8.14  ? 182 LEU A O   1 
ATOM   1568 C  CB  . LEU A 1 185 ? -4.314  9.191   3.069   1.00 8.08  ? 182 LEU A CB  1 
ATOM   1569 C  CG  . LEU A 1 185 ? -4.896  8.100   2.175   1.00 7.65  ? 182 LEU A CG  1 
ATOM   1570 C  CD1 . LEU A 1 185 ? -5.653  8.709   0.996   1.00 9.56  ? 182 LEU A CD1 1 
ATOM   1571 C  CD2 . LEU A 1 185 ? -3.778  7.192   1.688   1.00 9.17  ? 182 LEU A CD2 1 
ATOM   1572 N  N   . SER A 1 186 ? -1.725  9.791   5.065   1.00 6.81  ? 183 SER A N   1 
ATOM   1573 C  CA  . SER A 1 186 ? -0.936  10.898  5.588   1.00 7.17  ? 183 SER A CA  1 
ATOM   1574 C  C   . SER A 1 186 ? -0.937  12.064  4.606   1.00 7.31  ? 183 SER A C   1 
ATOM   1575 O  O   . SER A 1 186 ? -1.257  11.914  3.412   1.00 7.23  ? 183 SER A O   1 
ATOM   1576 C  CB  . SER A 1 186 ? 0.495   10.450  5.849   1.00 7.86  ? 183 SER A CB  1 
ATOM   1577 O  OG  . SER A 1 186 ? 1.114   10.190  4.604   1.00 7.17  ? 183 SER A OG  1 
ATOM   1578 N  N   . LYS A 1 187 ? -0.547  13.228  5.104   1.00 8.54  ? 184 LYS A N   1 
ATOM   1579 C  CA  . LYS A 1 187 ? -0.338  14.354  4.221   1.00 9.76  ? 184 LYS A CA  1 
ATOM   1580 C  C   . LYS A 1 187 ? 0.639   14.003  3.121   1.00 8.27  ? 184 LYS A C   1 
ATOM   1581 O  O   . LYS A 1 187 ? 0.462   14.388  1.974   1.00 8.69  ? 184 LYS A O   1 
ATOM   1582 C  CB  . LYS A 1 187 ? 0.197   15.552  5.005   1.00 11.76 ? 184 LYS A CB  1 
ATOM   1583 C  CG  . LYS A 1 187 ? -0.793  16.087  6.028   1.00 17.77 ? 184 LYS A CG  1 
ATOM   1584 C  CD  . LYS A 1 187 ? -0.258  17.376  6.637   1.00 24.13 ? 184 LYS A CD  1 
ATOM   1585 C  CE  . LYS A 1 187 ? -1.243  17.983  7.621   1.00 28.45 ? 184 LYS A CE  1 
ATOM   1586 N  NZ  . LYS A 1 187 ? -2.650  17.855  7.116   1.00 31.24 ? 184 LYS A NZ  1 
ATOM   1587 N  N   . GLY A 1 188 ? 1.684   13.255  3.469   1.00 7.81  ? 185 GLY A N   1 
ATOM   1588 C  CA  . GLY A 1 188 ? 2.675   12.872  2.461   1.00 7.68  ? 185 GLY A CA  1 
ATOM   1589 C  C   . GLY A 1 188 ? 2.121   11.893  1.453   1.00 6.54  ? 185 GLY A C   1 
ATOM   1590 O  O   . GLY A 1 188 ? 2.466   11.973  0.256   1.00 7.48  ? 185 GLY A O   1 
ATOM   1591 N  N   . ASP A 1 189 ? 1.284   10.937  1.882   1.00 6.76  ? 186 ASP A N   1 
ATOM   1592 C  CA  . ASP A 1 189 ? 0.692   9.985   0.931   1.00 6.31  ? 186 ASP A CA  1 
ATOM   1593 C  C   . ASP A 1 189 ? -0.131  10.762  -0.089  1.00 6.57  ? 186 ASP A C   1 
ATOM   1594 O  O   . ASP A 1 189 ? -0.107  10.486  -1.295  1.00 7.29  ? 186 ASP A O   1 
ATOM   1595 C  CB  . ASP A 1 189 ? -0.272  9.058   1.646   1.00 7.20  ? 186 ASP A CB  1 
ATOM   1596 C  CG  . ASP A 1 189 ? 0.394   8.048   2.542   1.00 7.76  ? 186 ASP A CG  1 
ATOM   1597 O  OD1 . ASP A 1 189 ? 1.516   7.599   2.224   1.00 7.80  ? 186 ASP A OD1 1 
ATOM   1598 O  OD2 . ASP A 1 189 ? -0.264  7.648   3.548   1.00 8.74  ? 186 ASP A OD2 1 
ATOM   1599 N  N   . ILE A 1 190 ? -0.932  11.726  0.398   1.00 6.90  ? 187 ILE A N   1 
ATOM   1600 C  CA  . ILE A 1 190 ? -1.787  12.512  -0.477  1.00 7.36  ? 187 ILE A CA  1 
ATOM   1601 C  C   . ILE A 1 190 ? -0.956  13.366  -1.433  1.00 7.55  ? 187 ILE A C   1 
ATOM   1602 O  O   . ILE A 1 190 ? -1.213  13.396  -2.642  1.00 8.51  ? 187 ILE A O   1 
ATOM   1603 C  CB  . ILE A 1 190 ? -2.725  13.367  0.409   1.00 8.21  ? 187 ILE A CB  1 
ATOM   1604 C  CG1 . ILE A 1 190 ? -3.761  12.461  1.112   1.00 9.01  ? 187 ILE A CG1 1 
ATOM   1605 C  CG2 . ILE A 1 190 ? -3.437  14.411  -0.432  1.00 8.37  ? 187 ILE A CG2 1 
ATOM   1606 C  CD1 . ILE A 1 190 ? -4.438  13.096  2.321   1.00 10.23 ? 187 ILE A CD1 1 
ATOM   1607 N  N   . ALA A 1 191 ? 0.040   14.072  -0.907  1.00 8.10  ? 188 ALA A N   1 
ATOM   1608 C  CA  . ALA A 1 191 ? 0.874   14.940  -1.752  1.00 8.23  ? 188 ALA A CA  1 
ATOM   1609 C  C   . ALA A 1 191 ? 1.554   14.112  -2.852  1.00 7.90  ? 188 ALA A C   1 
ATOM   1610 O  O   . ALA A 1 191 ? 1.611   14.512  -4.017  1.00 8.63  ? 188 ALA A O   1 
ATOM   1611 C  CB  . ALA A 1 191 ? 1.919   15.642  -0.902  1.00 9.82  ? 188 ALA A CB  1 
ATOM   1612 N  N   . GLN A 1 192 ? 2.040   12.930  -2.493  1.00 7.44  ? 189 GLN A N   1 
ATOM   1613 C  CA  . GLN A 1 192 ? 2.778   12.120  -3.437  1.00 7.60  ? 189 GLN A CA  1 
ATOM   1614 C  C   . GLN A 1 192 ? 1.842   11.475  -4.459  1.00 7.40  ? 189 GLN A C   1 
ATOM   1615 O  O   . GLN A 1 192 ? 2.200   11.383  -5.646  1.00 8.19  ? 189 GLN A O   1 
ATOM   1616 C  CB  . GLN A 1 192 ? 3.607   11.089  -2.668  1.00 7.11  ? 189 GLN A CB  1 
ATOM   1617 C  CG  . GLN A 1 192 ? 4.627   10.406  -3.513  1.00 7.39  ? 189 GLN A CG  1 
ATOM   1618 C  CD  . GLN A 1 192 ? 5.566   9.557   -2.685  1.00 7.06  ? 189 GLN A CD  1 
ATOM   1619 O  OE1 . GLN A 1 192 ? 6.799   9.465   -2.988  1.00 10.56 ? 189 GLN A OE1 1 
ATOM   1620 N  NE2 . GLN A 1 192 ? 5.047   8.977   -1.645  1.00 4.86  ? 189 GLN A NE2 1 
ATOM   1621 N  N   . ALA A 1 193 ? 0.678   10.999  -4.002  1.00 7.31  ? 190 ALA A N   1 
ATOM   1622 C  CA  . ALA A 1 193 ? -0.292  10.433  -4.943  1.00 7.33  ? 190 ALA A CA  1 
ATOM   1623 C  C   . ALA A 1 193 ? -0.770  11.471  -5.960  1.00 8.07  ? 190 ALA A C   1 
ATOM   1624 O  O   . ALA A 1 193 ? -0.965  11.169  -7.146  1.00 8.39  ? 190 ALA A O   1 
ATOM   1625 C  CB  . ALA A 1 193 ? -1.481  9.850   -4.194  1.00 8.18  ? 190 ALA A CB  1 
ATOM   1626 N  N   . ARG A 1 194 ? -0.925  12.718  -5.500  1.00 8.04  ? 191 ARG A N   1 
ATOM   1627 C  CA  . ARG A 1 194 ? -1.345  13.783  -6.417  1.00 8.97  ? 191 ARG A CA  1 
ATOM   1628 C  C   . ARG A 1 194 ? -0.249  14.030  -7.468  1.00 9.42  ? 191 ARG A C   1 
ATOM   1629 O  O   . ARG A 1 194 ? -0.556  14.240  -8.640  1.00 11.46 ? 191 ARG A O   1 
ATOM   1630 C  CB  . ARG A 1 194 ? -1.603  15.065  -5.633  1.00 9.88  ? 191 ARG A CB  1 
ATOM   1631 C  CG  . ARG A 1 194 ? -2.911  14.996  -4.823  1.00 10.06 ? 191 ARG A CG  1 
ATOM   1632 C  CD  . ARG A 1 194 ? -2.989  16.244  -3.970  1.00 11.80 ? 191 ARG A CD  1 
ATOM   1633 N  NE  . ARG A 1 194 ? -4.161  16.224  -3.130  1.00 14.02 ? 191 ARG A NE  1 
ATOM   1634 C  CZ  . ARG A 1 194 ? -4.384  17.076  -2.138  1.00 14.33 ? 191 ARG A CZ  1 
ATOM   1635 N  NH1 . ARG A 1 194 ? -3.522  18.051  -1.858  1.00 17.26 ? 191 ARG A NH1 1 
ATOM   1636 N  NH2 . ARG A 1 194 ? -5.493  16.945  -1.412  1.00 13.68 ? 191 ARG A NH2 1 
ATOM   1637 N  N   . LYS A 1 195 ? 1.033   13.967  -7.094  1.00 9.24  ? 192 LYS A N   1 
ATOM   1638 C  CA  . LYS A 1 195 ? 2.107   14.091  -8.091  1.00 10.70 ? 192 LYS A CA  1 
ATOM   1639 C  C   . LYS A 1 195 ? 2.115   12.909  -9.031  1.00 10.79 ? 192 LYS A C   1 
ATOM   1640 O  O   . LYS A 1 195 ? 2.279   13.074  -10.246 1.00 11.48 ? 192 LYS A O   1 
ATOM   1641 C  CB  . LYS A 1 195 ? 3.464   14.244  -7.407  1.00 10.48 ? 192 LYS A CB  1 
ATOM   1642 C  CG  . LYS A 1 195 ? 3.702   15.630  -6.763  1.00 10.86 ? 192 LYS A CG  1 
ATOM   1643 C  CD  . LYS A 1 195 ? 5.039   15.635  -6.025  1.00 12.90 ? 192 LYS A CD  1 
ATOM   1644 C  CE  . LYS A 1 195 ? 5.534   17.068  -5.734  1.00 14.29 ? 192 LYS A CE  1 
ATOM   1645 N  NZ  . LYS A 1 195 ? 6.822   16.989  -4.992  1.00 14.83 ? 192 LYS A NZ  1 
ATOM   1646 N  N   . LEU A 1 196 ? 1.934   11.701  -8.493  1.00 9.69  ? 193 LEU A N   1 
ATOM   1647 C  CA  . LEU A 1 196 ? 1.983   10.483  -9.329  1.00 10.32 ? 193 LEU A CA  1 
ATOM   1648 C  C   . LEU A 1 196 ? 0.894   10.503  -10.405 1.00 10.72 ? 193 LEU A C   1 
ATOM   1649 O  O   . LEU A 1 196 ? 1.132   10.089  -11.550 1.00 12.09 ? 193 LEU A O   1 
ATOM   1650 C  CB  . LEU A 1 196 ? 1.826   9.261   -8.434  1.00 9.67  ? 193 LEU A CB  1 
ATOM   1651 C  CG  . LEU A 1 196 ? 1.830   7.905   -9.116  1.00 10.19 ? 193 LEU A CG  1 
ATOM   1652 C  CD1 . LEU A 1 196 ? 3.182   7.687   -9.833  1.00 12.72 ? 193 LEU A CD1 1 
ATOM   1653 C  CD2 . LEU A 1 196 ? 1.617   6.820   -8.059  1.00 11.53 ? 193 LEU A CD2 1 
ATOM   1654 N  N   . TYR A 1 197 ? -0.296  10.994  -10.045 1.00 10.47 ? 194 TYR A N   1 
ATOM   1655 C  CA  . TYR A 1 197 ? -1.433  11.044  -10.961 1.00 11.41 ? 194 TYR A CA  1 
ATOM   1656 C  C   . TYR A 1 197 ? -1.591  12.394  -11.666 1.00 12.76 ? 194 TYR A C   1 
ATOM   1657 O  O   . TYR A 1 197 ? -2.581  12.623  -12.369 1.00 15.15 ? 194 TYR A O   1 
ATOM   1658 C  CB  . TYR A 1 197 ? -2.724  10.626  -10.219 1.00 11.09 ? 194 TYR A CB  1 
ATOM   1659 C  CG  . TYR A 1 197 ? -2.764  9.110   -10.192 1.00 10.05 ? 194 TYR A CG  1 
ATOM   1660 C  CD1 . TYR A 1 197 ? -2.075  8.397   -9.202  1.00 9.82  ? 194 TYR A CD1 1 
ATOM   1661 C  CD2 . TYR A 1 197 ? -3.391  8.372   -11.200 1.00 9.92  ? 194 TYR A CD2 1 
ATOM   1662 C  CE1 . TYR A 1 197 ? -2.007  7.014   -9.208  1.00 8.39  ? 194 TYR A CE1 1 
ATOM   1663 C  CE2 . TYR A 1 197 ? -3.323  7.007   -11.221 1.00 9.91  ? 194 TYR A CE2 1 
ATOM   1664 C  CZ  . TYR A 1 197 ? -2.634  6.329   -10.223 1.00 8.22  ? 194 TYR A CZ  1 
ATOM   1665 O  OH  . TYR A 1 197 ? -2.537  4.943   -10.286 1.00 8.94  ? 194 TYR A OH  1 
ATOM   1666 N  N   . LYS A 1 198 ? -0.590  13.253  -11.505 1.00 12.76 ? 195 LYS A N   1 
ATOM   1667 C  CA  . LYS A 1 198 ? -0.554  14.554  -12.207 1.00 15.31 ? 195 LYS A CA  1 
ATOM   1668 C  C   . LYS A 1 198 ? -1.867  15.253  -11.950 1.00 15.35 ? 195 LYS A C   1 
ATOM   1669 O  O   . LYS A 1 198 ? -2.409  16.002  -12.784 1.00 16.22 ? 195 LYS A O   1 
ATOM   1670 C  CB  . LYS A 1 198 ? -0.263  14.377  -13.716 1.00 16.07 ? 195 LYS A CB  1 
ATOM   1671 C  CG  . LYS A 1 198 ? 1.102   13.785  -13.980 1.00 18.35 ? 195 LYS A CG  1 
ATOM   1672 C  CD  . LYS A 1 198 ? 1.372   13.664  -15.482 1.00 20.41 ? 195 LYS A CD  1 
ATOM   1673 C  CE  . LYS A 1 198 ? 2.713   12.991  -15.722 1.00 27.29 ? 195 LYS A CE  1 
ATOM   1674 N  NZ  . LYS A 1 198 ? 3.830   13.846  -15.269 1.00 30.49 ? 195 LYS A NZ  1 
ATOM   1675 N  N   . CYS A 1 199 ? -2.430  15.265  -10.594 1.00 13.77 ? 198 CYS A N   1 
ATOM   1676 C  CA  . CYS A 1 199 ? -3.631  15.962  -10.207 1.00 15.17 ? 198 CYS A CA  1 
ATOM   1677 C  C   . CYS A 1 199 ? -3.287  17.447  -10.303 1.00 17.88 ? 198 CYS A C   1 
ATOM   1678 O  O   . CYS A 1 199 ? -2.213  17.868  -9.854  1.00 18.70 ? 198 CYS A O   1 
ATOM   1679 C  CB  . CYS A 1 199 ? -4.085  15.519  -8.810  1.00 14.34 ? 198 CYS A CB  1 
ATOM   1680 S  SG  . CYS A 1 199 ? -4.272  13.730  -8.636  1.00 13.51 ? 198 CYS A SG  1 
ATOM   1681 N  N   . PRO A 1 200 ? -4.172  18.247  -10.918 1.00 19.67 ? 199 PRO A N   1 
ATOM   1682 C  CA  . PRO A 1 200 ? -3.854  19.676  -11.037 1.00 21.27 ? 199 PRO A CA  1 
ATOM   1683 C  C   . PRO A 1 200 ? -3.564  20.304  -9.667  1.00 22.88 ? 199 PRO A C   1 
ATOM   1684 O  O   . PRO A 1 200 ? -4.271  20.030  -8.684  1.00 22.68 ? 199 PRO A O   1 
ATOM   1685 C  CB  . PRO A 1 200 ? -5.114  20.255  -11.685 1.00 21.43 ? 199 PRO A CB  1 
ATOM   1686 C  CG  . PRO A 1 200 ? -5.718  19.109  -12.427 1.00 22.14 ? 199 PRO A CG  1 
ATOM   1687 C  CD  . PRO A 1 200 ? -5.459  17.908  -11.544 1.00 20.35 ? 199 PRO A CD  1 
ATOM   1688 N  N   . ALA A 1 201 ? -2.512  21.113  -9.602  1.00 25.19 ? 200 ALA A N   1 
ATOM   1689 C  CA  . ALA A 1 201 ? -2.160  21.822  -8.378  1.00 27.74 ? 200 ALA A CA  1 
ATOM   1690 C  C   . ALA A 1 201 ? -3.106  23.012  -8.163  1.00 28.85 ? 200 ALA A C   1 
ATOM   1691 O  O   . ALA A 1 201 ? -3.399  23.450  -7.038  1.00 30.73 ? 200 ALA A O   1 
ATOM   1692 C  CB  . ALA A 1 201 ? -0.705  22.290  -8.456  1.00 28.09 ? 200 ALA A CB  1 
ATOM   1693 O  OXT . ALA A 1 201 ? -3.625  23.554  -9.134  1.00 29.02 ? 200 ALA A OXT 1 
HETATM 1694 C  C   . ACE B 2 .   ? 7.890   6.580   -1.852  1.00 6.81  ? 201 ACE A C   1 
HETATM 1695 O  O   . ACE B 2 .   ? 7.560   7.378   -1.018  1.00 7.45  ? 201 ACE A O   1 
HETATM 1696 C  CH3 . ACE B 2 .   ? 8.602   6.899   -2.990  1.00 3.42  ? 201 ACE A CH3 1 
HETATM 1697 ZN ZN  . ZN  C 3 .   ? 1.238   -3.666  2.085   1.00 6.95  ? 210 ZN  A ZN  1 
HETATM 1698 ZN ZN  . ZN  D 3 .   ? 5.820   7.985   0.386   0.50 5.24  ? 211 ZN  A ZN  1 
HETATM 1699 S  S   . DMS E 4 .   ? -12.968 16.313  1.467   1.00 15.52 ? 212 DMS A S   1 
HETATM 1700 O  O   . DMS E 4 .   ? -11.354 15.888  2.036   1.00 19.73 ? 212 DMS A O   1 
HETATM 1701 C  C1  . DMS E 4 .   ? -13.675 17.111  2.900   1.00 17.32 ? 212 DMS A C1  1 
HETATM 1702 C  C2  . DMS E 4 .   ? -12.778 17.653  0.364   1.00 16.96 ? 212 DMS A C2  1 
HETATM 1703 S  S   . DMS F 4 .   ? -17.680 9.410   4.282   1.00 24.57 ? 213 DMS A S   1 
HETATM 1704 O  O   . DMS F 4 .   ? -16.990 9.357   2.651   1.00 25.17 ? 213 DMS A O   1 
HETATM 1705 C  C1  . DMS F 4 .   ? -16.938 10.825  5.129   1.00 22.32 ? 213 DMS A C1  1 
HETATM 1706 C  C2  . DMS F 4 .   ? -19.374 9.953   4.183   1.00 22.42 ? 213 DMS A C2  1 
HETATM 1707 S  S   A DMS G 4 .   ? 0.650   -6.147  3.599   0.35 12.26 ? 214 DMS A S   1 
HETATM 1708 S  S   B DMS G 4 .   ? 0.087   -6.241  3.544   0.35 16.32 ? 214 DMS A S   1 
HETATM 1709 O  O   A DMS G 4 .   ? 1.140   -5.526  2.063   0.35 8.86  ? 214 DMS A O   1 
HETATM 1710 O  O   B DMS G 4 .   ? 0.485   -5.334  2.102   0.35 12.30 ? 214 DMS A O   1 
HETATM 1711 C  C1  A DMS G 4 .   ? -0.167  -4.960  4.663   0.35 11.33 ? 214 DMS A C1  1 
HETATM 1712 C  C1  B DMS G 4 .   ? 1.549   -7.216  3.946   0.35 9.07  ? 214 DMS A C1  1 
HETATM 1713 C  C2  A DMS G 4 .   ? -0.843  -7.042  3.110   0.35 7.52  ? 214 DMS A C2  1 
HETATM 1714 C  C2  B DMS G 4 .   ? 0.273   -5.163  4.962   0.35 14.37 ? 214 DMS A C2  1 
HETATM 1715 S  S   . DMS H 4 .   ? -4.954  1.624   13.274  1.00 19.30 ? 215 DMS A S   1 
HETATM 1716 O  O   . DMS H 4 .   ? -4.614  1.167   14.954  1.00 22.00 ? 215 DMS A O   1 
HETATM 1717 C  C1  . DMS H 4 .   ? -6.651  2.222   13.374  1.00 19.82 ? 215 DMS A C1  1 
HETATM 1718 C  C2  . DMS H 4 .   ? -3.998  3.104   13.098  1.00 14.77 ? 215 DMS A C2  1 
HETATM 1719 S  S   . DMS I 4 .   ? -16.806 3.653   -4.764  0.50 14.16 ? 216 DMS A S   1 
HETATM 1720 O  O   . DMS I 4 .   ? -18.121 3.092   -3.694  0.50 16.74 ? 216 DMS A O   1 
HETATM 1721 C  C1  . DMS I 4 .   ? -17.647 4.190   -6.276  0.50 15.79 ? 216 DMS A C1  1 
HETATM 1722 C  C2  . DMS I 4 .   ? -16.216 5.237   -4.128  0.50 15.15 ? 216 DMS A C2  1 
HETATM 1723 O  O   . HOH J 5 .   ? 3.067   5.110   9.416   1.00 7.50  ? 217 HOH A O   1 
HETATM 1724 O  O   . HOH J 5 .   ? 7.564   -0.102  -9.600  1.00 8.57  ? 218 HOH A O   1 
HETATM 1725 O  O   . HOH J 5 .   ? 5.047   4.118   -0.166  1.00 7.96  ? 219 HOH A O   1 
HETATM 1726 O  O   . HOH J 5 .   ? 6.146   -3.209  -0.977  1.00 9.65  ? 220 HOH A O   1 
HETATM 1727 O  O   . HOH J 5 .   ? 6.759   10.168  0.601   1.00 7.88  ? 221 HOH A O   1 
HETATM 1728 O  O   . HOH J 5 .   ? 6.875   0.421   5.084   1.00 8.10  ? 222 HOH A O   1 
HETATM 1729 O  O   . HOH J 5 .   ? -14.870 -12.583 -2.844  1.00 8.54  ? 223 HOH A O   1 
HETATM 1730 O  O   . HOH J 5 .   ? 4.010   8.768   1.743   1.00 7.32  ? 224 HOH A O   1 
HETATM 1731 O  O   . HOH J 5 .   ? 5.187   12.477  0.417   1.00 8.62  ? 225 HOH A O   1 
HETATM 1732 O  O   . HOH J 5 .   ? 5.183   1.123   15.437  1.00 9.10  ? 226 HOH A O   1 
HETATM 1733 O  O   . HOH J 5 .   ? 7.686   -5.251  1.659   1.00 10.06 ? 227 HOH A O   1 
HETATM 1734 O  O   . HOH J 5 .   ? 4.000   6.619   -0.349  1.00 8.84  ? 228 HOH A O   1 
HETATM 1735 O  O   . HOH J 5 .   ? -13.297 -15.387 -3.207  1.00 9.78  ? 229 HOH A O   1 
HETATM 1736 O  O   . HOH J 5 .   ? 11.459  1.611   16.273  1.00 11.54 ? 230 HOH A O   1 
HETATM 1737 O  O   . HOH J 5 .   ? 12.886  3.409   -14.509 1.00 12.05 ? 231 HOH A O   1 
HETATM 1738 O  O   . HOH J 5 .   ? -11.415 11.792  -6.997  1.00 13.64 ? 232 HOH A O   1 
HETATM 1739 O  O   . HOH J 5 .   ? 3.300   -5.674  -8.131  1.00 13.52 ? 233 HOH A O   1 
HETATM 1740 O  O   . HOH J 5 .   ? 3.066   12.823  5.963   1.00 9.48  ? 234 HOH A O   1 
HETATM 1741 O  O   . HOH J 5 .   ? 6.739   7.882   -9.613  1.00 13.59 ? 235 HOH A O   1 
HETATM 1742 O  O   . HOH J 5 .   ? -13.393 -0.353  9.532   1.00 14.48 ? 236 HOH A O   1 
HETATM 1743 O  O   . HOH J 5 .   ? 6.309   3.531   16.198  1.00 11.74 ? 237 HOH A O   1 
HETATM 1744 O  O   . HOH J 5 .   ? -7.966  -17.774 -4.612  1.00 12.13 ? 238 HOH A O   1 
HETATM 1745 O  O   . HOH J 5 .   ? 16.095  -13.532 10.066  1.00 12.61 ? 239 HOH A O   1 
HETATM 1746 O  O   . HOH J 5 .   ? 19.026  3.454   1.073   1.00 14.70 ? 240 HOH A O   1 
HETATM 1747 O  O   . HOH J 5 .   ? 16.116  -8.223  3.407   1.00 11.32 ? 241 HOH A O   1 
HETATM 1748 O  O   . HOH J 5 .   ? 6.465   13.176  2.835   1.00 14.31 ? 242 HOH A O   1 
HETATM 1749 O  O   . HOH J 5 .   ? -20.096 -9.909  -0.886  1.00 11.81 ? 243 HOH A O   1 
HETATM 1750 O  O   . HOH J 5 .   ? 10.518  4.438   -15.465 1.00 12.67 ? 244 HOH A O   1 
HETATM 1751 O  O   . HOH J 5 .   ? 16.419  -17.210 7.552   1.00 13.76 ? 245 HOH A O   1 
HETATM 1752 O  O   . HOH J 5 .   ? 13.370  5.704   -10.978 1.00 14.57 ? 246 HOH A O   1 
HETATM 1753 O  O   . HOH J 5 .   ? -11.255 -17.778 -0.720  1.00 13.88 ? 247 HOH A O   1 
HETATM 1754 O  O   . HOH J 5 .   ? 17.702  -4.417  0.346   1.00 15.50 ? 248 HOH A O   1 
HETATM 1755 O  O   . HOH J 5 .   ? 17.167  -5.663  2.901   1.00 14.24 ? 249 HOH A O   1 
HETATM 1756 O  O   . HOH J 5 .   ? -3.512  -7.618  -6.793  1.00 14.89 ? 250 HOH A O   1 
HETATM 1757 O  O   . HOH J 5 .   ? -9.927  9.828   -12.002 1.00 14.59 ? 251 HOH A O   1 
HETATM 1758 O  O   . HOH J 5 .   ? 2.740   -2.813  9.650   1.00 18.55 ? 252 HOH A O   1 
HETATM 1759 O  O   . HOH J 5 .   ? 13.396  6.972   -3.156  1.00 16.12 ? 253 HOH A O   1 
HETATM 1760 O  O   . HOH J 5 .   ? -17.313 -1.353  -24.341 1.00 13.99 ? 254 HOH A O   1 
HETATM 1761 O  O   . HOH J 5 .   ? 8.340   -3.074  19.463  1.00 16.65 ? 255 HOH A O   1 
HETATM 1762 O  O   . HOH J 5 .   ? 1.431   17.274  -4.294  1.00 17.14 ? 256 HOH A O   1 
HETATM 1763 O  O   . HOH J 5 .   ? 18.197  -10.137 6.977   1.00 18.76 ? 257 HOH A O   1 
HETATM 1764 O  O   . HOH J 5 .   ? 17.634  -11.322 9.412   1.00 14.65 ? 258 HOH A O   1 
HETATM 1765 O  O   . HOH J 5 .   ? 10.266  2.220   -17.042 1.00 16.55 ? 259 HOH A O   1 
HETATM 1766 O  O   . HOH J 5 .   ? 17.786  -0.155  -4.078  1.00 15.31 ? 260 HOH A O   1 
HETATM 1767 O  O   . HOH J 5 .   ? 1.706   -5.304  -2.195  1.00 14.45 ? 261 HOH A O   1 
HETATM 1768 O  O   . HOH J 5 .   ? 2.489   6.532   12.201  1.00 21.78 ? 262 HOH A O   1 
HETATM 1769 O  O   . HOH J 5 .   ? -19.759 3.073   2.601   1.00 16.00 ? 263 HOH A O   1 
HETATM 1770 O  O   . HOH J 5 .   ? -19.174 -5.178  -7.510  1.00 18.18 ? 264 HOH A O   1 
HETATM 1771 O  O   . HOH J 5 .   ? -1.118  16.698  1.453   1.00 17.91 ? 265 HOH A O   1 
HETATM 1772 O  O   . HOH J 5 .   ? 19.369  -2.121  3.745   1.00 19.49 ? 266 HOH A O   1 
HETATM 1773 O  O   . HOH J 5 .   ? 13.007  -4.036  -7.126  1.00 18.28 ? 267 HOH A O   1 
HETATM 1774 O  O   . HOH J 5 .   ? -7.933  3.595   -16.041 1.00 18.69 ? 268 HOH A O   1 
HETATM 1775 O  O   . HOH J 5 .   ? -10.468 11.939  5.448   1.00 16.08 ? 269 HOH A O   1 
HETATM 1776 O  O   . HOH J 5 .   ? -7.070  -0.058  10.366  1.00 15.96 ? 270 HOH A O   1 
HETATM 1777 O  O   . HOH J 5 .   ? -14.393 -4.685  5.308   1.00 17.31 ? 271 HOH A O   1 
HETATM 1778 O  O   . HOH J 5 .   ? -8.724  -5.646  9.989   1.00 18.11 ? 272 HOH A O   1 
HETATM 1779 O  O   . HOH J 5 .   ? -0.080  13.316  7.965   1.00 18.27 ? 273 HOH A O   1 
HETATM 1780 O  O   . HOH J 5 .   ? 11.760  12.324  6.225   1.00 17.19 ? 274 HOH A O   1 
HETATM 1781 O  O   . HOH J 5 .   ? -6.607  16.607  1.354   1.00 19.19 ? 275 HOH A O   1 
HETATM 1782 O  O   . HOH J 5 .   ? -6.660  -6.827  3.245   1.00 18.09 ? 276 HOH A O   1 
HETATM 1783 O  O   . HOH J 5 .   ? 6.389   12.078  8.591   1.00 16.38 ? 277 HOH A O   1 
HETATM 1784 O  O   . HOH J 5 .   ? 10.019  -9.046  22.659  1.00 16.33 ? 278 HOH A O   1 
HETATM 1785 O  O   . HOH J 5 .   ? -12.649 9.462   4.500   1.00 14.69 ? 279 HOH A O   1 
HETATM 1786 O  O   . HOH J 5 .   ? 4.270   -5.187  -1.231  1.00 16.27 ? 280 HOH A O   1 
HETATM 1787 O  O   . HOH J 5 .   ? 17.390  -10.413 2.360   1.00 14.12 ? 281 HOH A O   1 
HETATM 1788 O  O   . HOH J 5 .   ? 8.362   -4.461  -2.215  1.00 15.19 ? 282 HOH A O   1 
HETATM 1789 O  O   . HOH J 5 .   ? 10.104  -8.178  -1.108  1.00 15.54 ? 283 HOH A O   1 
HETATM 1790 O  O   . HOH J 5 .   ? -3.751  -4.754  -6.707  1.00 16.44 ? 284 HOH A O   1 
HETATM 1791 O  O   . HOH J 5 .   ? 8.060   1.092   -18.290 1.00 21.84 ? 285 HOH A O   1 
HETATM 1792 O  O   . HOH J 5 .   ? 6.484   -7.833  1.509   1.00 16.51 ? 286 HOH A O   1 
HETATM 1793 O  O   . HOH J 5 .   ? 10.057  -5.486  -0.283  1.00 17.73 ? 287 HOH A O   1 
HETATM 1794 O  O   . HOH J 5 .   ? -16.914 -5.555  -24.177 1.00 17.67 ? 288 HOH A O   1 
HETATM 1795 O  O   . HOH J 5 .   ? -15.236 1.665   8.988   1.00 16.02 ? 289 HOH A O   1 
HETATM 1796 O  O   . HOH J 5 .   ? 13.626  11.874  2.195   1.00 17.66 ? 290 HOH A O   1 
HETATM 1797 O  O   . HOH J 5 .   ? -4.070  -8.593  -1.770  1.00 19.17 ? 291 HOH A O   1 
HETATM 1798 O  O   . HOH J 5 .   ? 8.221   -2.482  -10.685 1.00 19.06 ? 292 HOH A O   1 
HETATM 1799 O  O   . HOH J 5 .   ? -17.181 -12.247 5.295   1.00 18.44 ? 293 HOH A O   1 
HETATM 1800 O  O   . HOH J 5 .   ? -19.236 -9.924  -7.586  1.00 20.55 ? 294 HOH A O   1 
HETATM 1801 O  O   . HOH J 5 .   ? -17.561 0.658   -15.996 1.00 19.96 ? 295 HOH A O   1 
HETATM 1802 O  O   . HOH J 5 .   ? 5.388   2.280   19.957  1.00 18.36 ? 296 HOH A O   1 
HETATM 1803 O  O   . HOH J 5 .   ? 1.522   -3.298  6.227   1.00 20.25 ? 297 HOH A O   1 
HETATM 1804 O  O   . HOH J 5 .   ? 8.022   15.796  0.896   1.00 18.63 ? 298 HOH A O   1 
HETATM 1805 O  O   . HOH J 5 .   ? 4.868   5.879   -12.714 1.00 20.93 ? 299 HOH A O   1 
HETATM 1806 O  O   . HOH J 5 .   ? 14.409  8.055   -10.698 1.00 19.79 ? 300 HOH A O   1 
HETATM 1807 O  O   . HOH J 5 .   ? -8.883  -11.698 -9.859  1.00 18.83 ? 301 HOH A O   1 
HETATM 1808 O  O   . HOH J 5 .   ? -5.867  -1.989  11.836  1.00 20.07 ? 302 HOH A O   1 
HETATM 1809 O  O   . HOH J 5 .   ? 9.096   -17.546 7.716   1.00 19.93 ? 303 HOH A O   1 
HETATM 1810 O  O   . HOH J 5 .   ? 6.664   9.014   -11.958 1.00 21.79 ? 304 HOH A O   1 
HETATM 1811 O  O   . HOH J 5 .   ? -4.797  -9.025  2.792   1.00 20.79 ? 305 HOH A O   1 
HETATM 1812 O  O   . HOH J 5 .   ? -0.367  -6.325  -0.230  1.00 18.03 ? 306 HOH A O   1 
HETATM 1813 O  O   . HOH J 5 .   ? -10.123 -18.036 1.931   1.00 21.61 ? 307 HOH A O   1 
HETATM 1814 O  O   . HOH J 5 .   ? 12.524  12.111  -6.352  1.00 18.65 ? 308 HOH A O   1 
HETATM 1815 O  O   . HOH J 5 .   ? -0.618  18.497  -2.817  1.00 19.94 ? 309 HOH A O   1 
HETATM 1816 O  O   . HOH J 5 .   ? -5.189  -5.088  -13.991 1.00 17.84 ? 310 HOH A O   1 
HETATM 1817 O  O   . HOH J 5 .   ? 4.232   -8.849  11.856  1.00 18.27 ? 311 HOH A O   1 
HETATM 1818 O  O   . HOH J 5 .   ? -23.232 -6.434  7.901   1.00 21.43 ? 312 HOH A O   1 
HETATM 1819 O  O   . HOH J 5 .   ? 5.313   9.846   12.205  1.00 22.01 ? 313 HOH A O   1 
HETATM 1820 O  O   . HOH J 5 .   ? 4.002   -7.241  3.742   1.00 17.17 ? 314 HOH A O   1 
HETATM 1821 O  O   . HOH J 5 .   ? 0.763   -1.352  10.969  1.00 17.45 ? 315 HOH A O   1 
HETATM 1822 O  O   . HOH J 5 .   ? -23.172 -2.494  2.148   1.00 21.57 ? 316 HOH A O   1 
HETATM 1823 O  O   . HOH J 5 .   ? -4.309  13.812  5.722   1.00 19.34 ? 317 HOH A O   1 
HETATM 1824 O  O   . HOH J 5 .   ? 3.659   -0.232  17.143  1.00 20.75 ? 318 HOH A O   1 
HETATM 1825 O  O   . HOH J 5 .   ? 9.136   3.329   16.176  1.00 24.42 ? 319 HOH A O   1 
HETATM 1826 O  O   . HOH J 5 .   ? 19.138  0.908   7.083   1.00 22.06 ? 320 HOH A O   1 
HETATM 1827 O  O   . HOH J 5 .   ? -1.790  -2.807  6.545   1.00 21.60 ? 321 HOH A O   1 
HETATM 1828 O  O   . HOH J 5 .   ? 15.137  -2.615  -12.383 1.00 23.07 ? 322 HOH A O   1 
HETATM 1829 O  O   . HOH J 5 .   ? 15.328  5.805   -7.389  1.00 21.09 ? 323 HOH A O   1 
HETATM 1830 O  O   . HOH J 5 .   ? -22.008 -0.698  0.499   1.00 29.29 ? 324 HOH A O   1 
HETATM 1831 O  O   . HOH J 5 .   ? -17.763 -7.795  -13.719 1.00 24.87 ? 325 HOH A O   1 
HETATM 1832 O  O   . HOH J 5 .   ? -15.328 -4.622  8.146   1.00 22.59 ? 326 HOH A O   1 
HETATM 1833 O  O   . HOH J 5 .   ? -0.767  -1.659  -16.727 1.00 18.53 ? 327 HOH A O   1 
HETATM 1834 O  O   . HOH J 5 .   ? 5.212   4.581   18.435  1.00 21.45 ? 328 HOH A O   1 
HETATM 1835 O  O   . HOH J 5 .   ? 20.233  6.087   1.366   1.00 29.28 ? 329 HOH A O   1 
HETATM 1836 O  O   . HOH J 5 .   ? 19.204  1.855   -3.153  1.00 20.96 ? 330 HOH A O   1 
HETATM 1837 O  O   . HOH J 5 .   ? 2.351   13.796  8.404   1.00 18.34 ? 331 HOH A O   1 
HETATM 1838 O  O   . HOH J 5 .   ? -9.422  -0.392  -16.828 1.00 24.93 ? 332 HOH A O   1 
HETATM 1839 O  O   . HOH J 5 .   ? -14.512 -2.840  9.978   1.00 20.53 ? 333 HOH A O   1 
HETATM 1840 O  O   . HOH J 5 .   ? -15.018 -0.134  -23.227 1.00 24.15 ? 334 HOH A O   1 
HETATM 1841 O  O   . HOH J 5 .   ? -18.628 -3.219  -9.061  1.00 21.66 ? 335 HOH A O   1 
HETATM 1842 O  O   . HOH J 5 .   ? -9.509  -10.413 13.224  1.00 28.51 ? 336 HOH A O   1 
HETATM 1843 O  O   . HOH J 5 .   ? 7.426   -8.683  -0.895  1.00 15.93 ? 337 HOH A O   1 
HETATM 1844 O  O   . HOH J 5 .   ? 6.491   -6.638  -2.527  1.00 16.23 ? 338 HOH A O   1 
HETATM 1845 O  O   . HOH J 5 .   ? -3.252  -1.741  12.236  1.00 20.72 ? 339 HOH A O   1 
HETATM 1846 O  O   . HOH J 5 .   ? 4.332   8.039   -13.962 1.00 23.03 ? 340 HOH A O   1 
HETATM 1847 O  O   . HOH J 5 .   ? 17.027  -4.786  -3.412  1.00 25.54 ? 341 HOH A O   1 
HETATM 1848 O  O   . HOH J 5 .   ? -12.441 -10.444 -16.368 1.00 23.37 ? 342 HOH A O   1 
HETATM 1849 O  O   . HOH J 5 .   ? 3.029   -6.946  -5.607  1.00 22.53 ? 343 HOH A O   1 
HETATM 1850 O  O   . HOH J 5 .   ? -10.586 15.086  -4.939  1.00 18.95 ? 344 HOH A O   1 
HETATM 1851 O  O   . HOH J 5 .   ? -19.336 3.448   -9.966  1.00 28.90 ? 345 HOH A O   1 
HETATM 1852 O  O   . HOH J 5 .   ? -7.398  -19.849 -0.455  1.00 23.00 ? 346 HOH A O   1 
HETATM 1853 O  O   . HOH J 5 .   ? 6.722   -11.467 21.573  1.00 21.90 ? 347 HOH A O   1 
HETATM 1854 O  O   . HOH J 5 .   ? -6.281  11.730  5.303   1.00 21.48 ? 348 HOH A O   1 
HETATM 1855 O  O   . HOH J 5 .   ? -19.406 -0.623  7.567   1.00 25.57 ? 349 HOH A O   1 
HETATM 1856 O  O   . HOH J 5 .   ? 17.943  3.665   13.723  1.00 24.54 ? 350 HOH A O   1 
HETATM 1857 O  O   . HOH J 5 .   ? 4.716   14.627  4.745   1.00 21.53 ? 351 HOH A O   1 
HETATM 1858 O  O   . HOH J 5 .   ? -3.753  18.770  -6.376  1.00 28.97 ? 352 HOH A O   1 
HETATM 1859 O  O   . HOH J 5 .   ? 10.107  -18.313 11.256  1.00 24.13 ? 353 HOH A O   1 
HETATM 1860 O  O   . HOH J 5 .   ? 1.163   6.583   -17.203 1.00 23.15 ? 354 HOH A O   1 
HETATM 1861 O  O   . HOH J 5 .   ? 17.021  13.913  15.241  1.00 23.78 ? 355 HOH A O   1 
HETATM 1862 O  O   . HOH J 5 .   ? 8.996   -4.989  -9.430  1.00 26.09 ? 356 HOH A O   1 
HETATM 1863 O  O   . HOH J 5 .   ? 8.558   7.691   -13.562 1.00 27.03 ? 357 HOH A O   1 
HETATM 1864 O  O   . HOH J 5 .   ? 19.665  -1.198  8.169   1.00 24.13 ? 358 HOH A O   1 
HETATM 1865 O  O   . HOH J 5 .   ? 3.349   16.334  2.941   1.00 24.68 ? 359 HOH A O   1 
HETATM 1866 O  O   . HOH J 5 .   ? 4.554   -13.617 5.730   1.00 25.05 ? 360 HOH A O   1 
HETATM 1867 O  O   . HOH J 5 .   ? -1.533  6.155   -17.150 1.00 24.41 ? 361 HOH A O   1 
HETATM 1868 O  O   . HOH J 5 .   ? -8.778  -1.963  -18.929 1.00 24.73 ? 362 HOH A O   1 
HETATM 1869 O  O   . HOH J 5 .   ? -24.554 -8.797  5.768   1.00 26.78 ? 363 HOH A O   1 
HETATM 1870 O  O   . HOH J 5 .   ? 4.738   16.955  0.788   1.00 22.06 ? 364 HOH A O   1 
HETATM 1871 O  O   . HOH J 5 .   ? -22.027 1.871   1.194   1.00 27.42 ? 365 HOH A O   1 
HETATM 1872 O  O   . HOH J 5 .   ? 13.243  8.575   -6.349  1.00 25.29 ? 366 HOH A O   1 
HETATM 1873 O  O   . HOH J 5 .   ? 2.105   -3.585  -14.850 1.00 27.02 ? 367 HOH A O   1 
HETATM 1874 O  O   . HOH J 5 .   ? 4.199   18.127  -2.531  1.00 20.38 ? 368 HOH A O   1 
HETATM 1875 O  O   . HOH J 5 .   ? -16.320 -19.342 3.096   1.00 25.60 ? 369 HOH A O   1 
HETATM 1876 O  O   . HOH J 5 .   ? -4.979  -11.311 -8.775  1.00 23.03 ? 370 HOH A O   1 
HETATM 1877 O  O   . HOH J 5 .   ? 8.882   -3.464  10.846  1.00 22.51 ? 371 HOH A O   1 
HETATM 1878 O  O   . HOH J 5 .   ? 13.616  -15.641 18.999  1.00 33.28 ? 372 HOH A O   1 
HETATM 1879 O  O   . HOH J 5 .   ? 3.000   -2.898  16.277  1.00 22.31 ? 373 HOH A O   1 
HETATM 1880 O  O   . HOH J 5 .   ? 15.949  -13.003 13.947  1.00 25.46 ? 374 HOH A O   1 
HETATM 1881 O  O   . HOH J 5 .   ? -6.566  -14.992 6.950   1.00 25.12 ? 375 HOH A O   1 
HETATM 1882 O  O   . HOH J 5 .   ? 5.543   -2.893  -14.828 1.00 25.72 ? 376 HOH A O   1 
HETATM 1883 O  O   . HOH J 5 .   ? -9.132  -13.983 -11.431 1.00 21.08 ? 377 HOH A O   1 
HETATM 1884 O  O   . HOH J 5 .   ? 18.918  -2.214  -10.448 1.00 22.97 ? 378 HOH A O   1 
HETATM 1885 O  O   . HOH J 5 .   ? -6.588  -4.665  11.457  1.00 23.85 ? 379 HOH A O   1 
HETATM 1886 O  O   . HOH J 5 .   ? -11.223 13.747  -9.033  1.00 22.47 ? 380 HOH A O   1 
HETATM 1887 O  O   . HOH J 5 .   ? -1.530  2.021   -17.456 1.00 33.61 ? 381 HOH A O   1 
HETATM 1888 O  O   . HOH J 5 .   ? 20.250  2.245   -14.127 1.00 25.48 ? 382 HOH A O   1 
HETATM 1889 O  O   . HOH J 5 .   ? 5.162   -15.871 4.683   1.00 28.19 ? 383 HOH A O   1 
HETATM 1890 O  O   . HOH J 5 .   ? -21.895 -2.834  -2.243  1.00 34.98 ? 384 HOH A O   1 
HETATM 1891 O  O   . HOH J 5 .   ? 4.775   -11.045 3.107   1.00 24.24 ? 385 HOH A O   1 
HETATM 1892 O  O   . HOH J 5 .   ? 11.247  4.044   17.249  1.00 28.48 ? 386 HOH A O   1 
HETATM 1893 O  O   . HOH J 5 .   ? 20.921  -5.177  11.517  1.00 25.16 ? 387 HOH A O   1 
HETATM 1894 O  O   . HOH J 5 .   ? -18.341 1.957   6.510   1.00 40.03 ? 388 HOH A O   1 
HETATM 1895 O  O   . HOH J 5 .   ? 20.379  7.177   14.087  1.00 24.56 ? 389 HOH A O   1 
HETATM 1896 O  O   . HOH J 5 .   ? 2.727   -4.564  18.773  1.00 26.13 ? 390 HOH A O   1 
HETATM 1897 O  O   . HOH J 5 .   ? -3.741  16.881  2.489   1.00 26.74 ? 391 HOH A O   1 
HETATM 1898 O  O   . HOH J 5 .   ? 16.699  13.883  7.670   1.00 22.22 ? 392 HOH A O   1 
HETATM 1899 O  O   . HOH J 5 .   ? 20.624  -8.805  18.741  1.00 24.05 ? 393 HOH A O   1 
HETATM 1900 O  O   . HOH J 5 .   ? 13.513  16.048  10.987  1.00 24.34 ? 394 HOH A O   1 
HETATM 1901 O  O   . HOH J 5 .   ? -9.971  -14.102 -14.261 1.00 26.63 ? 395 HOH A O   1 
HETATM 1902 O  O   . HOH J 5 .   ? 1.915   8.604   -15.922 1.00 32.60 ? 396 HOH A O   1 
HETATM 1903 O  O   . HOH J 5 .   ? 0.945   18.569  -6.529  1.00 27.13 ? 397 HOH A O   1 
HETATM 1904 O  O   . HOH J 5 .   ? -7.213  1.126   -17.126 1.00 22.37 ? 398 HOH A O   1 
HETATM 1905 O  O   . HOH J 5 .   ? 19.334  -8.330  -1.891  1.00 26.82 ? 399 HOH A O   1 
HETATM 1906 O  O   . HOH J 5 .   ? -6.444  5.577   15.330  1.00 26.71 ? 400 HOH A O   1 
HETATM 1907 O  O   . HOH J 5 .   ? -2.747  -9.463  -8.929  1.00 23.86 ? 401 HOH A O   1 
HETATM 1908 O  O   . HOH J 5 .   ? -8.615  12.091  7.418   1.00 31.41 ? 402 HOH A O   1 
HETATM 1909 O  O   . HOH J 5 .   ? -20.567 -18.605 1.809   1.00 25.20 ? 403 HOH A O   1 
HETATM 1910 O  O   . HOH J 5 .   ? 17.988  15.187  12.781  1.00 30.12 ? 404 HOH A O   1 
HETATM 1911 O  O   . HOH J 5 .   ? -4.392  19.730  0.223   1.00 29.97 ? 405 HOH A O   1 
HETATM 1912 O  O   . HOH J 5 .   ? -7.414  16.750  -8.396  1.00 24.72 ? 406 HOH A O   1 
HETATM 1913 O  O   . HOH J 5 .   ? -3.177  9.176   -17.171 1.00 39.12 ? 407 HOH A O   1 
HETATM 1914 O  O   . HOH J 5 .   ? -2.420  -8.849  0.368   1.00 25.82 ? 408 HOH A O   1 
HETATM 1915 O  O   . HOH J 5 .   ? 5.468   -8.517  16.499  1.00 23.07 ? 409 HOH A O   1 
HETATM 1916 O  O   . HOH J 5 .   ? -5.010  -6.364  9.956   1.00 31.16 ? 410 HOH A O   1 
HETATM 1917 O  O   . HOH J 5 .   ? 0.563   10.247  -14.318 1.00 24.96 ? 411 HOH A O   1 
HETATM 1918 O  O   . HOH J 5 .   ? -4.200  -8.554  -14.462 1.00 31.21 ? 412 HOH A O   1 
HETATM 1919 O  O   . HOH J 5 .   ? -20.972 -14.179 3.903   1.00 29.39 ? 413 HOH A O   1 
HETATM 1920 O  O   . HOH J 5 .   ? -22.447 -10.931 -1.643  1.00 27.56 ? 414 HOH A O   1 
HETATM 1921 O  O   . HOH J 5 .   ? -15.256 10.846  -1.561  1.00 20.41 ? 415 HOH A O   1 
HETATM 1922 O  O   . HOH J 5 .   ? 3.941   12.069  -12.408 1.00 34.73 ? 416 HOH A O   1 
HETATM 1923 O  O   . HOH J 5 .   ? -4.514  11.128  -13.548 1.00 31.23 ? 417 HOH A O   1 
HETATM 1924 O  O   . HOH J 5 .   ? -3.861  -10.675 9.390   1.00 47.17 ? 418 HOH A O   1 
HETATM 1925 O  O   . HOH J 5 .   ? -15.685 -9.720  -13.109 1.00 25.92 ? 419 HOH A O   1 
HETATM 1926 O  O   . HOH J 5 .   ? -1.378  -3.111  10.739  1.00 27.55 ? 420 HOH A O   1 
HETATM 1927 O  O   . HOH J 5 .   ? -15.369 7.948   6.559   1.00 27.47 ? 421 HOH A O   1 
HETATM 1928 O  O   . HOH J 5 .   ? -18.587 -7.514  -18.914 1.00 31.38 ? 422 HOH A O   1 
HETATM 1929 O  O   . HOH J 5 .   ? 4.218   -11.652 12.434  1.00 29.06 ? 423 HOH A O   1 
HETATM 1930 O  O   . HOH J 5 .   ? -10.640 -9.083  -18.093 1.00 31.04 ? 424 HOH A O   1 
HETATM 1931 O  O   . HOH J 5 .   ? -10.961 -2.412  -21.403 1.00 36.72 ? 425 HOH A O   1 
HETATM 1932 O  O   . HOH J 5 .   ? 14.103  -16.470 15.987  1.00 30.89 ? 426 HOH A O   1 
HETATM 1933 O  O   . HOH J 5 .   ? -11.587 -14.620 6.733   1.00 36.55 ? 427 HOH A O   1 
HETATM 1934 O  O   . HOH J 5 .   ? 5.205   -7.855  -4.504  1.00 24.91 ? 428 HOH A O   1 
HETATM 1935 O  O   . HOH J 5 .   ? -2.930  8.257   12.467  1.00 34.69 ? 429 HOH A O   1 
HETATM 1936 O  O   . HOH J 5 .   ? 19.929  -1.827  13.760  1.00 36.65 ? 430 HOH A O   1 
HETATM 1937 O  O   . HOH J 5 .   ? 8.714   5.191   16.511  1.00 29.88 ? 431 HOH A O   1 
HETATM 1938 O  O   . HOH J 5 .   ? 0.875   7.615   14.344  1.00 28.31 ? 432 HOH A O   1 
HETATM 1939 O  O   . HOH J 5 .   ? 20.149  -3.493  6.037   1.00 32.34 ? 433 HOH A O   1 
HETATM 1940 O  O   . HOH J 5 .   ? -1.653  18.355  -7.211  1.00 31.01 ? 434 HOH A O   1 
HETATM 1941 O  O   . HOH J 5 .   ? 5.566   -6.951  -9.907  1.00 31.83 ? 435 HOH A O   1 
HETATM 1942 O  O   . HOH J 5 .   ? 6.047   11.565  -16.231 1.00 37.14 ? 436 HOH A O   1 
HETATM 1943 O  O   . HOH J 5 .   ? -13.860 11.742  5.565   1.00 27.04 ? 437 HOH A O   1 
HETATM 1944 O  O   . HOH J 5 .   ? -14.230 7.040   -12.617 1.00 28.23 ? 438 HOH A O   1 
HETATM 1945 O  O   . HOH J 5 .   ? -10.491 13.177  -11.007 1.00 30.42 ? 439 HOH A O   1 
HETATM 1946 O  O   . HOH J 5 .   ? 18.174  -8.997  18.930  1.00 26.44 ? 440 HOH A O   1 
HETATM 1947 O  O   . HOH J 5 .   ? -14.780 7.345   -15.301 1.00 27.02 ? 441 HOH A O   1 
HETATM 1948 O  O   . HOH J 5 .   ? -6.002  16.086  -5.880  1.00 25.29 ? 442 HOH A O   1 
HETATM 1949 O  O   . HOH J 5 .   ? 11.211  -15.989 15.421  1.00 33.74 ? 443 HOH A O   1 
HETATM 1950 O  O   . HOH J 5 .   ? -6.994  -1.372  14.425  1.00 34.67 ? 444 HOH A O   1 
HETATM 1951 O  O   . HOH J 5 .   ? 18.688  -5.677  -1.729  1.00 27.03 ? 445 HOH A O   1 
HETATM 1952 O  O   . HOH J 5 .   ? 0.917   2.581   14.923  1.00 35.51 ? 446 HOH A O   1 
HETATM 1953 O  O   . HOH J 5 .   ? -19.404 -4.354  -11.313 1.00 30.71 ? 447 HOH A O   1 
HETATM 1954 O  O   . HOH J 5 .   ? -7.301  15.817  -11.696 1.00 39.52 ? 448 HOH A O   1 
HETATM 1955 O  O   . HOH J 5 .   ? -15.827 10.866  -4.034  1.00 27.26 ? 449 HOH A O   1 
HETATM 1956 O  O   . HOH J 5 .   ? 19.252  -12.644 16.412  1.00 28.45 ? 450 HOH A O   1 
HETATM 1957 O  O   . HOH J 5 .   ? 10.196  11.240  21.065  1.00 31.16 ? 451 HOH A O   1 
HETATM 1958 O  O   . HOH J 5 .   ? 20.254  7.974   -0.403  1.00 34.65 ? 452 HOH A O   1 
HETATM 1959 O  O   . HOH J 5 .   ? -21.172 -8.477  -4.254  1.00 38.25 ? 453 HOH A O   1 
HETATM 1960 O  O   . HOH J 5 .   ? 2.681   -4.948  11.988  1.00 31.20 ? 454 HOH A O   1 
HETATM 1961 O  O   . HOH J 5 .   ? 2.996   16.425  9.025   1.00 39.42 ? 455 HOH A O   1 
HETATM 1962 O  O   . HOH J 5 .   ? -20.189 1.565   -13.782 1.00 26.54 ? 456 HOH A O   1 
HETATM 1963 O  O   . HOH J 5 .   ? 5.558   2.939   22.784  1.00 29.35 ? 457 HOH A O   1 
HETATM 1964 O  O   . HOH J 5 .   ? 17.486  7.008   -3.703  1.00 32.32 ? 458 HOH A O   1 
HETATM 1965 O  O   . HOH J 5 .   ? -21.859 -13.743 -1.646  1.00 26.86 ? 459 HOH A O   1 
HETATM 1966 O  O   . HOH J 5 .   ? -24.493 -9.465  2.613   1.00 28.93 ? 460 HOH A O   1 
HETATM 1967 O  O   . HOH J 5 .   ? -13.903 2.674   -17.934 1.00 34.25 ? 461 HOH A O   1 
HETATM 1968 O  O   . HOH J 5 .   ? 8.564   17.636  -7.406  1.00 30.08 ? 462 HOH A O   1 
HETATM 1969 O  O   . HOH J 5 .   ? -0.678  9.408   12.488  1.00 31.97 ? 463 HOH A O   1 
HETATM 1970 O  O   . HOH J 5 .   ? -3.103  20.586  -4.567  1.00 43.87 ? 464 HOH A O   1 
HETATM 1971 O  O   . HOH J 5 .   ? 7.741   -16.538 10.991  1.00 30.30 ? 465 HOH A O   1 
HETATM 1972 O  O   . HOH J 5 .   ? 3.705   15.241  -11.244 1.00 28.97 ? 466 HOH A O   1 
HETATM 1973 O  O   . HOH J 5 .   ? 7.119   9.059   19.428  1.00 33.78 ? 467 HOH A O   1 
HETATM 1974 O  O   . HOH J 5 .   ? 11.772  -6.358  -3.555  1.00 35.24 ? 468 HOH A O   1 
HETATM 1975 O  O   . HOH J 5 .   ? -3.431  -13.575 0.676   1.00 34.61 ? 469 HOH A O   1 
HETATM 1976 O  O   . HOH J 5 .   ? 18.907  -2.766  -4.017  1.00 31.03 ? 470 HOH A O   1 
HETATM 1977 O  O   . HOH J 5 .   ? 0.568   17.493  -9.215  1.00 47.58 ? 471 HOH A O   1 
HETATM 1978 O  O   . HOH J 5 .   ? -20.920 -3.900  -5.485  1.00 37.38 ? 472 HOH A O   1 
HETATM 1979 O  O   . HOH J 5 .   ? 16.723  9.772   16.803  1.00 44.52 ? 473 HOH A O   1 
HETATM 1980 O  O   . HOH J 5 .   ? 22.413  5.842   2.899   1.00 37.24 ? 474 HOH A O   1 
HETATM 1981 O  O   . HOH J 5 .   ? -8.990  -12.320 12.792  1.00 30.19 ? 475 HOH A O   1 
HETATM 1982 O  O   . HOH J 5 .   ? 6.221   -10.505 17.206  1.00 37.79 ? 476 HOH A O   1 
HETATM 1983 O  O   . HOH J 5 .   ? -3.111  -6.868  6.493   1.00 35.80 ? 477 HOH A O   1 
HETATM 1984 O  O   . HOH J 5 .   ? -14.268 11.865  -6.944  1.00 35.32 ? 478 HOH A O   1 
HETATM 1985 O  O   . HOH J 5 .   ? -9.450  5.723   -18.045 1.00 34.80 ? 479 HOH A O   1 
HETATM 1986 O  O   . HOH J 5 .   ? -22.253 -12.263 1.234   1.00 28.59 ? 480 HOH A O   1 
HETATM 1987 O  O   . HOH J 5 .   ? -11.451 0.218   -21.042 1.00 41.56 ? 481 HOH A O   1 
HETATM 1988 O  O   . HOH J 5 .   ? -10.252 -15.582 4.651   1.00 36.94 ? 482 HOH A O   1 
HETATM 1989 O  O   . HOH J 5 .   ? 15.167  8.192   -8.246  1.00 32.46 ? 483 HOH A O   1 
HETATM 1990 O  O   . HOH J 5 .   ? -4.063  -3.879  -3.067  1.00 36.02 ? 484 HOH A O   1 
HETATM 1991 O  O   . HOH J 5 .   ? -10.482 8.018   11.633  1.00 28.00 ? 485 HOH A O   1 
HETATM 1992 O  O   . HOH J 5 .   ? 1.548   -9.413  -6.636  1.00 40.21 ? 486 HOH A O   1 
HETATM 1993 O  O   . HOH J 5 .   ? 17.612  -15.077 17.873  1.00 39.94 ? 487 HOH A O   1 
HETATM 1994 O  O   . HOH J 5 .   ? 4.086   -3.248  21.332  1.00 40.90 ? 488 HOH A O   1 
HETATM 1995 O  O   . HOH J 5 .   ? 7.920   6.286   18.863  1.00 29.57 ? 489 HOH A O   1 
HETATM 1996 O  O   . HOH J 5 .   ? -3.615  25.329  -5.603  1.00 39.52 ? 490 HOH A O   1 
HETATM 1997 O  O   . HOH J 5 .   ? 8.373   -1.476  -17.190 1.00 30.06 ? 491 HOH A O   1 
HETATM 1998 O  O   . HOH J 5 .   ? 5.961   15.590  -9.806  1.00 31.23 ? 492 HOH A O   1 
HETATM 1999 O  O   . HOH J 5 .   ? -17.676 7.667   -15.475 1.00 37.48 ? 493 HOH A O   1 
HETATM 2000 O  O   . HOH J 5 .   ? -9.350  -0.189  14.436  1.00 31.95 ? 494 HOH A O   1 
HETATM 2001 O  O   . HOH J 5 .   ? -14.243 5.329   -17.414 1.00 32.66 ? 495 HOH A O   1 
HETATM 2002 O  O   . HOH J 5 .   ? -4.281  -10.941 -3.776  1.00 30.20 ? 496 HOH A O   1 
HETATM 2003 O  O   . HOH J 5 .   ? -12.840 -4.564  -23.619 1.00 25.86 ? 497 HOH A O   1 
HETATM 2004 O  O   . HOH J 5 .   ? -22.252 -0.398  7.667   1.00 35.91 ? 498 HOH A O   1 
HETATM 2005 O  O   . HOH J 5 .   ? -13.966 -11.890 5.791   1.00 39.31 ? 499 HOH A O   1 
HETATM 2006 O  O   . HOH J 5 .   ? -19.255 2.720   -16.503 1.00 39.20 ? 500 HOH A O   1 
HETATM 2007 O  O   . HOH J 5 .   ? 8.834   4.338   21.742  1.00 29.10 ? 501 HOH A O   1 
HETATM 2008 O  O   . HOH J 5 .   ? -9.623  -5.133  16.675  1.00 37.59 ? 502 HOH A O   1 
HETATM 2009 O  O   . HOH J 5 .   ? 21.986  2.026   7.311   1.00 37.89 ? 503 HOH A O   1 
HETATM 2010 O  O   . HOH J 5 .   ? 18.860  5.337   15.340  1.00 38.29 ? 504 HOH A O   1 
HETATM 2011 O  O   . HOH J 5 .   ? -5.503  -17.029 -2.696  1.00 31.92 ? 505 HOH A O   1 
HETATM 2012 O  O   . HOH J 5 .   ? 17.239  15.899  17.052  1.00 38.99 ? 506 HOH A O   1 
HETATM 2013 O  O   . HOH J 5 .   ? 8.269   13.315  5.004   1.00 28.37 ? 507 HOH A O   1 
HETATM 2014 O  O   . HOH J 5 .   ? 4.737   -14.022 10.045  1.00 43.86 ? 508 HOH A O   1 
HETATM 2015 O  O   . HOH J 5 .   ? 2.933   6.208   18.968  1.00 33.23 ? 509 HOH A O   1 
HETATM 2016 O  O   . HOH J 5 .   ? -17.524 -4.900  9.022   1.00 40.35 ? 510 HOH A O   1 
HETATM 2017 O  O   . HOH J 5 .   ? 21.963  -2.218  -0.081  1.00 36.77 ? 511 HOH A O   1 
HETATM 2018 O  O   . HOH J 5 .   ? 20.742  -2.248  11.624  1.00 39.69 ? 512 HOH A O   1 
HETATM 2019 O  O   . HOH J 5 .   ? 21.604  -0.144  -11.134 1.00 43.95 ? 513 HOH A O   1 
HETATM 2020 O  O   . HOH J 5 .   ? -14.789 -8.916  10.158  1.00 35.83 ? 514 HOH A O   1 
HETATM 2021 O  O   . HOH J 5 .   ? -4.877  14.098  -13.592 1.00 32.02 ? 515 HOH A O   1 
HETATM 2022 O  O   . HOH J 5 .   ? 9.752   13.331  8.073   1.00 35.61 ? 516 HOH A O   1 
HETATM 2023 O  O   . HOH J 5 .   ? -2.316  1.914   -19.822 1.00 47.90 ? 517 HOH A O   1 
HETATM 2024 O  O   . HOH J 5 .   ? 16.610  -5.879  -9.215  1.00 42.30 ? 518 HOH A O   1 
HETATM 2025 O  O   . HOH J 5 .   ? -20.718 3.349   -7.407  1.00 43.39 ? 519 HOH A O   1 
HETATM 2026 O  O   . HOH J 5 .   ? -7.403  10.775  12.191  1.00 43.93 ? 520 HOH A O   1 
HETATM 2027 O  O   . HOH J 5 .   ? -14.088 -19.391 4.862   1.00 32.53 ? 521 HOH A O   1 
HETATM 2028 O  O   . HOH J 5 .   ? -21.709 3.862   -0.940  1.00 43.55 ? 522 HOH A O   1 
HETATM 2029 O  O   . HOH J 5 .   ? 11.273  4.756   20.012  1.00 45.43 ? 523 HOH A O   1 
HETATM 2030 O  O   . HOH J 5 .   ? 17.727  6.192   -6.059  1.00 38.53 ? 524 HOH A O   1 
HETATM 2031 O  O   . HOH J 5 .   ? -1.314  17.556  -0.964  1.00 32.54 ? 525 HOH A O   1 
HETATM 2032 O  O   . HOH J 5 .   ? 3.955   0.042   19.668  1.00 33.51 ? 526 HOH A O   1 
HETATM 2033 O  O   . HOH J 5 .   ? -1.618  15.198  9.404   1.00 35.81 ? 527 HOH A O   1 
HETATM 2034 O  O   . HOH J 5 .   ? -5.526  -4.476  -19.973 1.00 43.74 ? 528 HOH A O   1 
HETATM 2035 O  O   . HOH J 5 .   ? -21.225 1.985   -18.222 1.00 34.17 ? 529 HOH A O   1 
HETATM 2036 O  O   . HOH J 5 .   ? 13.903  -5.493  -9.396  1.00 42.11 ? 530 HOH A O   1 
HETATM 2037 O  O   . HOH J 5 .   ? -17.637 0.177   9.705   1.00 33.64 ? 531 HOH A O   1 
HETATM 2038 O  O   . HOH J 5 .   ? -9.247  -11.794 -17.916 1.00 41.35 ? 532 HOH A O   1 
HETATM 2039 O  O   . HOH J 5 .   ? -9.731  8.539   14.196  1.00 38.13 ? 533 HOH A O   1 
HETATM 2040 O  O   . HOH J 5 .   ? -14.939 -10.238 -18.087 1.00 39.63 ? 534 HOH A O   1 
HETATM 2041 O  O   . HOH J 5 .   ? -12.886 -7.183  -20.703 1.00 32.88 ? 535 HOH A O   1 
HETATM 2042 O  O   . HOH J 5 .   ? -2.155  4.215   14.841  1.00 28.88 ? 536 HOH A O   1 
HETATM 2043 O  O   . HOH J 5 .   ? -8.993  -20.020 3.639   1.00 37.97 ? 537 HOH A O   1 
HETATM 2044 O  O   . HOH J 5 .   ? 0.399   -2.763  -18.904 1.00 30.24 ? 538 HOH A O   1 
HETATM 2045 O  O   . HOH J 5 .   ? -4.140  -15.602 -0.875  1.00 41.61 ? 539 HOH A O   1 
HETATM 2046 O  O   . HOH J 5 .   ? 6.705   12.494  13.554  1.00 37.87 ? 540 HOH A O   1 
HETATM 2047 O  O   . HOH J 5 .   ? -22.019 -7.325  10.142  1.00 43.69 ? 541 HOH A O   1 
HETATM 2048 O  O   . HOH J 5 .   ? -11.387 8.779   -17.979 1.00 40.93 ? 542 HOH A O   1 
HETATM 2049 O  O   . HOH J 5 .   ? -4.938  -10.667 -20.904 1.00 45.62 ? 543 HOH A O   1 
HETATM 2050 O  O   . HOH J 5 .   ? 2.430   11.196  -18.660 1.00 51.22 ? 544 HOH A O   1 
HETATM 2051 O  O   . HOH J 5 .   ? -5.550  17.945  -5.959  1.00 31.95 ? 545 HOH A O   1 
HETATM 2052 O  O   . HOH J 5 .   ? -19.504 5.034   -2.124  1.00 22.51 ? 546 HOH A O   1 
HETATM 2053 O  O   . HOH J 5 .   ? 13.534  14.107  4.590   1.00 27.42 ? 547 HOH A O   1 
HETATM 2054 O  O   . HOH J 5 .   ? 2.766   -6.773  7.033   1.00 34.27 ? 548 HOH A O   1 
HETATM 2055 O  O   . HOH J 5 .   ? 9.028   15.510  6.155   1.00 42.84 ? 549 HOH A O   1 
HETATM 2056 O  O   . HOH J 5 .   ? 2.729   -11.747 4.463   1.00 28.78 ? 550 HOH A O   1 
HETATM 2057 O  O   . HOH J 5 .   ? -1.367  -4.378  8.465   1.00 29.97 ? 551 HOH A O   1 
HETATM 2058 O  O   . HOH J 5 .   ? 5.257   -18.267 6.487   1.00 39.01 ? 552 HOH A O   1 
HETATM 2059 O  O   . HOH J 5 .   ? -4.350  1.968   -21.539 1.00 46.40 ? 553 HOH A O   1 
HETATM 2060 O  O   . HOH J 5 .   ? -17.417 -2.249  10.535  1.00 42.36 ? 554 HOH A O   1 
HETATM 2061 O  O   . HOH J 5 .   ? 9.860   -11.621 23.049  1.00 48.39 ? 555 HOH A O   1 
HETATM 2062 O  O   . HOH J 5 .   ? 1.815   -4.756  8.490   1.00 34.32 ? 556 HOH A O   1 
HETATM 2063 O  O   . HOH J 5 .   ? -20.250 -7.452  -8.939  1.00 42.16 ? 557 HOH A O   1 
HETATM 2064 O  O   . HOH J 5 .   ? -8.800  -13.739 8.346   1.00 30.17 ? 558 HOH A O   1 
HETATM 2065 O  O   . HOH J 5 .   ? -9.654  -4.928  -24.328 1.00 52.96 ? 559 HOH A O   1 
HETATM 2066 O  O   . HOH J 5 .   ? 1.424   -10.725 -11.314 1.00 36.46 ? 560 HOH A O   1 
HETATM 2067 O  O   . HOH J 5 .   ? 23.257  7.937   2.251   1.00 35.81 ? 561 HOH A O   1 
HETATM 2068 O  O   . HOH J 5 .   ? -8.582  -10.050 -19.637 1.00 47.13 ? 562 HOH A O   1 
HETATM 2069 O  O   . HOH J 5 .   ? 2.884   13.366  12.422  1.00 43.11 ? 563 HOH A O   1 
HETATM 2070 O  O   . HOH J 5 .   ? 8.177   15.949  -9.153  1.00 42.22 ? 564 HOH A O   1 
HETATM 2071 O  O   . HOH J 5 .   ? 4.477   -7.642  -13.453 1.00 37.75 ? 565 HOH A O   1 
HETATM 2072 O  O   . HOH J 5 .   ? -21.367 -2.910  -13.419 1.00 50.14 ? 566 HOH A O   1 
HETATM 2073 O  O   . HOH J 5 .   ? 24.701  -8.252  15.674  1.00 30.28 ? 567 HOH A O   1 
HETATM 2074 O  O   . HOH J 5 .   ? -19.333 7.471   -3.790  1.00 33.29 ? 568 HOH A O   1 
HETATM 2075 O  O   . HOH J 5 .   ? 12.052  -12.727 21.932  1.00 37.83 ? 569 HOH A O   1 
HETATM 2076 O  O   . HOH J 5 .   ? -21.724 -4.791  -17.386 1.00 36.89 ? 570 HOH A O   1 
HETATM 2077 O  O   . HOH J 5 .   ? -9.675  16.577  5.250   1.00 41.56 ? 571 HOH A O   1 
HETATM 2078 O  O   . HOH J 5 .   ? 18.858  1.229   15.022  1.00 44.54 ? 572 HOH A O   1 
HETATM 2079 O  O   . HOH J 5 .   ? -8.687  -7.517  13.923  1.00 47.17 ? 573 HOH A O   1 
HETATM 2080 O  O   . HOH J 5 .   ? -24.316 -0.055  -1.996  1.00 44.84 ? 574 HOH A O   1 
HETATM 2081 O  O   . HOH J 5 .   ? -10.168 9.945   8.348   1.00 46.84 ? 575 HOH A O   1 
HETATM 2082 O  O   . HOH J 5 .   ? 1.605   5.348   14.531  1.00 39.47 ? 576 HOH A O   1 
HETATM 2083 O  O   . HOH J 5 .   ? -16.022 8.206   -8.314  1.00 47.16 ? 577 HOH A O   1 
HETATM 2084 O  O   . HOH J 5 .   ? -21.986 -19.060 4.018   1.00 30.37 ? 578 HOH A O   1 
HETATM 2085 O  O   . HOH J 5 .   ? -2.687  9.065   -14.617 1.00 49.63 ? 579 HOH A O   1 
HETATM 2086 O  O   . HOH J 5 .   ? 9.609   -6.454  -4.989  1.00 35.31 ? 580 HOH A O   1 
HETATM 2087 O  O   . HOH J 5 .   ? 16.296  10.596  0.749   1.00 30.04 ? 581 HOH A O   1 
HETATM 2088 O  O   . HOH J 5 .   ? -12.428 8.875   8.319   1.00 28.45 ? 582 HOH A O   1 
HETATM 2089 O  O   . HOH J 5 .   ? 2.249   3.757   16.238  1.00 40.67 ? 583 HOH A O   1 
HETATM 2090 O  O   . HOH J 5 .   ? 6.664   11.925  11.093  1.00 39.84 ? 584 HOH A O   1 
HETATM 2091 O  O   . HOH J 5 .   ? 14.260  -5.467  -5.273  1.00 46.59 ? 585 HOH A O   1 
HETATM 2092 O  O   . HOH J 5 .   ? 0.436   -1.980  14.481  1.00 47.47 ? 586 HOH A O   1 
HETATM 2093 O  O   . HOH J 5 .   ? -3.554  -15.705 6.534   1.00 46.23 ? 587 HOH A O   1 
HETATM 2094 O  O   . HOH J 5 .   ? -19.156 9.903   -3.092  1.00 35.95 ? 588 HOH A O   1 
HETATM 2095 O  O   . HOH J 5 .   ? 21.579  2.019   0.728   1.00 44.42 ? 589 HOH A O   1 
HETATM 2096 O  O   . HOH J 5 .   ? 24.007  -3.697  14.318  1.00 31.17 ? 590 HOH A O   1 
HETATM 2097 O  O   . HOH J 5 .   ? -16.323 6.914   -10.873 1.00 35.34 ? 591 HOH A O   1 
HETATM 2098 O  O   . HOH J 5 .   ? 16.635  6.663   16.597  1.00 32.85 ? 592 HOH A O   1 
HETATM 2099 O  O   . HOH J 5 .   ? -4.195  -6.897  3.974   1.00 22.96 ? 593 HOH A O   1 
HETATM 2100 O  O   . HOH J 5 .   ? -14.493 7.833   3.321   1.00 13.70 ? 594 HOH A O   1 
HETATM 2101 O  O   . HOH J 5 .   ? -1.846  0.430   12.967  1.00 18.81 ? 595 HOH A O   1 
HETATM 2102 O  O   . HOH J 5 .   ? -22.127 6.994   2.193   1.00 40.16 ? 596 HOH A O   1 
HETATM 2103 O  O   . HOH J 5 .   ? 3.193   -9.991  -13.686 1.00 38.93 ? 597 HOH A O   1 
HETATM 2104 O  O   . HOH J 5 .   ? -6.861  19.450  -8.652  1.00 24.73 ? 598 HOH A O   1 
HETATM 2105 O  O   . HOH J 5 .   ? 13.493  6.342   16.282  1.00 30.47 ? 599 HOH A O   1 
HETATM 2106 O  O   . HOH J 5 .   ? -19.122 11.223  1.255   1.00 29.74 ? 600 HOH A O   1 
HETATM 2107 O  O   . HOH J 5 .   ? 22.114  -5.147  4.656   1.00 42.52 ? 601 HOH A O   1 
HETATM 2108 O  O   . HOH J 5 .   ? -16.994 11.662  0.480   1.00 34.19 ? 602 HOH A O   1 
HETATM 2109 O  O   . HOH J 5 .   ? -24.596 -4.300  0.693   1.00 40.56 ? 603 HOH A O   1 
HETATM 2110 O  O   . HOH J 5 .   ? -2.432  -4.817  4.976   1.00 32.17 ? 604 HOH A O   1 
HETATM 2111 O  O   . HOH J 5 .   ? -2.723  -10.826 -1.240  1.00 28.43 ? 605 HOH A O   1 
HETATM 2112 O  O   . HOH J 5 .   ? 18.483  -11.604 22.114  1.00 36.13 ? 606 HOH A O   1 
HETATM 2113 O  O   . HOH J 5 .   ? 7.773   12.711  15.544  1.00 39.06 ? 607 HOH A O   1 
HETATM 2114 O  O   . HOH J 5 .   ? -2.701  -8.815  5.161   1.00 37.19 ? 608 HOH A O   1 
HETATM 2115 O  O   . HOH J 5 .   ? 1.006   -9.732  5.044   1.00 32.09 ? 609 HOH A O   1 
HETATM 2116 O  O   . HOH J 5 .   ? 14.111  6.256   -5.755  1.00 38.56 ? 610 HOH A O   1 
HETATM 2117 O  O   . HOH J 5 .   ? 1.750   15.794  -11.455 1.00 40.25 ? 611 HOH A O   1 
HETATM 2118 O  O   . HOH J 5 .   ? -0.318  -10.529 -8.276  1.00 36.49 ? 612 HOH A O   1 
HETATM 2119 O  O   . HOH J 5 .   ? -1.379  -9.802  6.205   1.00 36.03 ? 613 HOH A O   1 
HETATM 2120 O  O   . HOH J 5 .   ? 10.100  -15.600 17.986  1.00 37.08 ? 614 HOH A O   1 
HETATM 2121 O  O   . HOH J 5 .   ? 11.050  13.697  -9.439  1.00 35.08 ? 615 HOH A O   1 
HETATM 2122 O  O   . HOH J 5 .   ? -9.129  2.019   -15.902 1.00 33.41 ? 616 HOH A O   1 
HETATM 2123 O  O   . HOH J 5 .   ? -11.046 2.816   -17.464 1.00 39.74 ? 617 HOH A O   1 
HETATM 2124 O  O   . HOH J 5 .   ? 14.629  9.619   -3.014  1.00 36.50 ? 618 HOH A O   1 
HETATM 2125 O  O   . HOH J 5 .   ? 20.871  -7.353  3.495   1.00 43.34 ? 619 HOH A O   1 
HETATM 2126 O  O   . HOH J 5 .   ? -17.629 8.134   -5.633  1.00 31.10 ? 620 HOH A O   1 
HETATM 2127 O  O   . HOH J 5 .   ? -20.337 10.226  -0.769  1.00 31.59 ? 621 HOH A O   1 
HETATM 2128 O  O   . HOH J 5 .   ? -18.271 -10.138 9.651   1.00 44.15 ? 622 HOH A O   1 
HETATM 2129 O  O   . HOH J 5 .   ? -11.971 -6.478  11.579  1.00 34.65 ? 623 HOH A O   1 
HETATM 2130 O  O   . HOH J 5 .   ? 13.760  9.108   16.240  1.00 32.51 ? 624 HOH A O   1 
HETATM 2131 O  O   . HOH J 5 .   ? 4.563   -11.502 0.621   1.00 41.89 ? 625 HOH A O   1 
HETATM 2132 O  O   . HOH J 5 .   ? -13.565 -3.945  12.351  1.00 39.92 ? 626 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ALA A 1   ? 0.0885 0.0620 0.0948 -0.0034 0.0204  -0.0046 1   ALA A N   
2    C  CA  . ALA A 1   ? 0.0864 0.0865 0.0902 0.0219  0.0002  -0.0022 1   ALA A CA  
3    C  C   . ALA A 1   ? 0.0760 0.0916 0.0790 0.0023  0.0227  -0.0024 1   ALA A C   
4    O  O   . ALA A 1   ? 0.0787 0.0925 0.1074 -0.0054 0.0124  0.0000  1   ALA A O   
5    C  CB  . ALA A 1   ? 0.1072 0.0713 0.1061 0.0125  0.0104  0.0085  1   ALA A CB  
6    N  N   . ALA A 2   ? 0.0931 0.1012 0.0818 0.0090  0.0123  0.0050  2   ALA A N   
7    C  CA  . ALA A 2   ? 0.0661 0.1037 0.0751 0.0157  0.0130  0.0000  2   ALA A CA  
8    C  C   . ALA A 2   ? 0.0700 0.1085 0.0878 -0.0086 0.0282  0.0027  2   ALA A C   
9    O  O   . ALA A 2   ? 0.0877 0.1099 0.0928 -0.0016 0.0244  0.0126  2   ALA A O   
10   C  CB  . ALA A 2   ? 0.1094 0.1144 0.1081 0.0069  0.0117  0.0081  2   ALA A CB  
11   N  N   . THR A 3   ? 0.0725 0.1124 0.0761 -0.0033 0.0188  -0.0118 3   THR A N   
12   C  CA  . THR A 3   ? 0.0638 0.1104 0.0886 -0.0150 0.0334  -0.0036 3   THR A CA  
13   C  C   . THR A 3   ? 0.0953 0.1145 0.0903 0.0021  0.0285  0.0001  3   THR A C   
14   O  O   . THR A 3   ? 0.0981 0.1156 0.0970 0.0123  0.0119  0.0093  3   THR A O   
15   C  CB  . THR A 3   ? 0.0727 0.1319 0.0786 -0.0148 0.0253  -0.0004 3   THR A CB  
16   O  OG1 . THR A 3   ? 0.1161 0.1248 0.0756 -0.0101 0.0252  -0.0040 3   THR A OG1 
17   C  CG2 . THR A 3   ? 0.1056 0.1500 0.0970 0.0037  -0.0038 0.0012  3   THR A CG2 
18   N  N   . SER A 4   ? 0.0994 0.1302 0.0948 -0.0105 0.0383  -0.0050 4   SER A N   
19   C  CA  . SER A 4   ? 0.1079 0.1334 0.0925 -0.0068 0.0310  0.0154  4   SER A CA  
20   C  C   . SER A 4   ? 0.1053 0.1359 0.1022 0.0023  0.0300  0.0045  4   SER A C   
21   O  O   . SER A 4   ? 0.1316 0.1447 0.1025 -0.0008 0.0414  0.0124  4   SER A O   
22   C  CB  . SER A 4   ? 0.1104 0.1350 0.1092 -0.0162 0.0218  0.0106  4   SER A CB  
23   O  OG  . SER A 4   ? 0.1012 0.1552 0.1374 0.0073  0.0361  0.0217  4   SER A OG  
24   N  N   . ARG A 5   ? 0.1140 0.1320 0.0892 0.0036  0.0326  0.0080  5   ARG A N   
25   C  CA  . ARG A 5   ? 0.1304 0.1447 0.0941 0.0010  0.0291  0.0068  5   ARG A CA  
26   C  C   . ARG A 5   ? 0.1186 0.1502 0.0788 -0.0064 0.0282  0.0028  5   ARG A C   
27   O  O   . ARG A 5   ? 0.1225 0.1708 0.0917 -0.0169 0.0290  0.0036  5   ARG A O   
28   C  CB  . ARG A 5   ? 0.1562 0.1489 0.1034 -0.0051 0.0229  0.0020  5   ARG A CB  
29   C  CG  . ARG A 5   ? 0.1801 0.1712 0.1028 0.0161  0.0268  0.0153  5   ARG A CG  
30   C  CD  . ARG A 5   ? 0.1900 0.2057 0.1281 0.0254  0.0175  -0.0016 5   ARG A CD  
31   N  NE  . ARG A 5   ? 0.1887 0.2053 0.1804 0.0021  0.0130  0.0134  5   ARG A NE  
32   C  CZ  . ARG A 5   ? 0.2045 0.2013 0.1941 0.0176  0.0221  0.0073  5   ARG A CZ  
33   N  NH1 . ARG A 5   ? 0.2361 0.1803 0.1852 0.0212  0.0390  0.0109  5   ARG A NH1 
34   N  NH2 . ARG A 5   ? 0.1724 0.2403 0.2265 -0.0012 -0.0025 0.0056  5   ARG A NH2 
35   N  N   . PRO A 6   ? 0.1157 0.1568 0.0996 0.0003  0.0295  0.0145  6   PRO A N   
36   C  CA  A PRO A 6   ? 0.1258 0.1687 0.1060 0.0031  0.0221  0.0127  6   PRO A CA  
37   C  CA  B PRO A 6   ? 0.1321 0.1755 0.1089 0.0051  0.0209  0.0132  6   PRO A CA  
38   C  C   . PRO A 6   ? 0.1353 0.1783 0.1041 0.0083  0.0263  0.0073  6   PRO A C   
39   O  O   . PRO A 6   ? 0.1430 0.2040 0.1312 0.0104  0.0115  0.0183  6   PRO A O   
40   C  CB  A PRO A 6   ? 0.1251 0.1777 0.1123 0.0021  0.0200  0.0229  6   PRO A CB  
41   C  CB  B PRO A 6   ? 0.1395 0.1856 0.1157 0.0037  0.0190  0.0227  6   PRO A CB  
42   C  CG  A PRO A 6   ? 0.1075 0.1249 0.1121 -0.0132 0.0256  0.0092  6   PRO A CG  
43   C  CG  B PRO A 6   ? 0.1563 0.1830 0.1259 0.0103  0.0127  0.0140  6   PRO A CG  
44   C  CD  A PRO A 6   ? 0.1079 0.1632 0.1007 -0.0010 0.0301  0.0216  6   PRO A CD  
45   C  CD  B PRO A 6   ? 0.1160 0.1719 0.1096 -0.0007 0.0293  0.0226  6   PRO A CD  
46   N  N   . GLU A 7   ? 0.1508 0.1903 0.0973 -0.0173 0.0256  -0.0019 7   GLU A N   
47   C  CA  . GLU A 7   ? 0.1780 0.2034 0.1159 -0.0233 0.0202  -0.0184 7   GLU A CA  
48   C  C   . GLU A 7   ? 0.1596 0.1989 0.1155 -0.0275 0.0227  -0.0108 7   GLU A C   
49   O  O   . GLU A 7   ? 0.1570 0.2340 0.1351 -0.0526 0.0139  -0.0255 7   GLU A O   
50   C  CB  . GLU A 7   ? 0.2170 0.2153 0.1550 -0.0233 0.0245  -0.0261 7   GLU A CB  
51   C  CG  . GLU A 7   ? 0.2219 0.2105 0.1715 -0.0234 0.0240  -0.0186 7   GLU A CG  
52   C  CD  . GLU A 7   ? 0.2208 0.2271 0.1664 -0.0009 0.0379  -0.0258 7   GLU A CD  
53   O  OE1 . GLU A 7   ? 0.2340 0.2203 0.1838 0.0010  0.0161  -0.0250 7   GLU A OE1 
54   O  OE2 . GLU A 7   ? 0.2839 0.2318 0.2090 0.0032  0.0192  -0.0284 7   GLU A OE2 
55   N  N   . ARG A 8   ? 0.1555 0.1785 0.1063 -0.0220 0.0200  -0.0228 8   ARG A N   
56   C  CA  . ARG A 8   ? 0.1472 0.1577 0.1187 -0.0173 0.0251  -0.0161 8   ARG A CA  
57   C  C   . ARG A 8   ? 0.1318 0.1511 0.1171 -0.0213 0.0184  -0.0114 8   ARG A C   
58   O  O   . ARG A 8   ? 0.1434 0.1531 0.1218 -0.0299 0.0445  -0.0052 8   ARG A O   
59   C  CB  . ARG A 8   ? 0.1379 0.1457 0.1127 -0.0280 0.0313  -0.0060 8   ARG A CB  
60   C  CG  . ARG A 8   ? 0.1600 0.1471 0.1672 -0.0158 0.0054  -0.0174 8   ARG A CG  
61   C  CD  . ARG A 8   ? 0.1946 0.1574 0.1729 -0.0028 0.0117  0.0181  8   ARG A CD  
62   N  NE  . ARG A 8   ? 0.1913 0.1841 0.2023 0.0056  0.0415  0.0068  8   ARG A NE  
63   C  CZ  . ARG A 8   ? 0.1857 0.1538 0.1724 0.0081  0.0185  -0.0182 8   ARG A CZ  
64   N  NH1 . ARG A 8   ? 0.1430 0.1731 0.1585 -0.0071 0.0097  -0.0237 8   ARG A NH1 
65   N  NH2 . ARG A 8   ? 0.2079 0.2150 0.2221 0.0183  0.0401  -0.0300 8   ARG A NH2 
66   N  N   . VAL A 9   ? 0.1505 0.1521 0.1194 -0.0156 0.0146  -0.0193 9   VAL A N   
67   C  CA  . VAL A 9   ? 0.1590 0.1544 0.1494 -0.0101 0.0149  0.0035  9   VAL A CA  
68   C  C   . VAL A 9   ? 0.1493 0.1662 0.1210 -0.0026 0.0098  0.0035  9   VAL A C   
69   O  O   . VAL A 9   ? 0.1876 0.2266 0.1288 -0.0064 0.0247  0.0132  9   VAL A O   
70   C  CB  . VAL A 9   ? 0.1616 0.1580 0.1924 -0.0154 0.0204  -0.0055 9   VAL A CB  
71   C  CG1 . VAL A 9   ? 0.2040 0.1655 0.2070 -0.0100 0.0382  0.0107  9   VAL A CG1 
72   C  CG2 . VAL A 9   ? 0.1869 0.2001 0.2183 -0.0367 0.0100  -0.0124 9   VAL A CG2 
73   N  N   . TRP A 10  ? 0.1289 0.1414 0.1186 0.0024  -0.0012 0.0092  10  TRP A N   
74   C  CA  . TRP A 10  ? 0.1291 0.1398 0.1008 -0.0072 -0.0040 0.0157  10  TRP A CA  
75   C  C   . TRP A 10  ? 0.1553 0.1467 0.1017 -0.0011 -0.0030 0.0126  10  TRP A C   
76   O  O   . TRP A 10  ? 0.1715 0.1479 0.1101 -0.0134 -0.0117 0.0189  10  TRP A O   
77   C  CB  . TRP A 10  ? 0.1240 0.1443 0.0958 0.0057  -0.0020 0.0087  10  TRP A CB  
78   C  CG  . TRP A 10  ? 0.1012 0.1317 0.0821 -0.0070 -0.0121 0.0024  10  TRP A CG  
79   C  CD1 . TRP A 10  ? 0.0957 0.1442 0.0687 0.0053  0.0033  0.0020  10  TRP A CD1 
80   C  CD2 . TRP A 10  ? 0.1129 0.1407 0.0805 0.0008  -0.0025 -0.0151 10  TRP A CD2 
81   N  NE1 . TRP A 10  ? 0.0723 0.1297 0.0815 -0.0089 0.0002  0.0110  10  TRP A NE1 
82   C  CE2 . TRP A 10  ? 0.1078 0.1304 0.0813 0.0066  -0.0004 0.0036  10  TRP A CE2 
83   C  CE3 . TRP A 10  ? 0.1376 0.1256 0.0859 -0.0099 -0.0136 -0.0199 10  TRP A CE3 
84   C  CZ2 . TRP A 10  ? 0.1189 0.1379 0.0871 -0.0050 0.0081  -0.0019 10  TRP A CZ2 
85   C  CZ3 . TRP A 10  ? 0.1210 0.1647 0.0949 -0.0061 -0.0045 -0.0083 10  TRP A CZ3 
86   C  CH2 . TRP A 10  ? 0.1109 0.1497 0.0989 0.0008  0.0073  -0.0006 10  TRP A CH2 
87   N  N   A PRO A 11  ? 0.1892 0.1613 0.1107 0.0029  -0.0096 0.0203  11  PRO A N   
88   N  N   B PRO A 11  ? 0.1675 0.1512 0.1067 -0.0034 -0.0063 0.0146  11  PRO A N   
89   C  CA  A PRO A 11  ? 0.1948 0.1765 0.1126 0.0047  -0.0029 0.0235  11  PRO A CA  
90   C  CA  B PRO A 11  ? 0.1699 0.1608 0.1086 -0.0026 -0.0011 0.0191  11  PRO A CA  
91   C  C   A PRO A 11  ? 0.1999 0.1692 0.1151 0.0061  -0.0062 0.0281  11  PRO A C   
92   C  C   B PRO A 11  ? 0.1866 0.1617 0.1166 0.0033  -0.0051 0.0240  11  PRO A C   
93   O  O   A PRO A 11  ? 0.2057 0.1739 0.1245 0.0021  -0.0114 0.0228  11  PRO A O   
94   O  O   B PRO A 11  ? 0.1898 0.1606 0.1266 -0.0002 -0.0113 0.0225  11  PRO A O   
95   C  CB  A PRO A 11  ? 0.1986 0.1880 0.1156 -0.0031 0.0010  0.0210  11  PRO A CB  
96   C  CB  B PRO A 11  ? 0.1754 0.1692 0.1094 -0.0070 -0.0030 0.0144  11  PRO A CB  
97   C  CG  A PRO A 11  ? 0.2250 0.2107 0.1367 0.0056  -0.0131 0.0182  11  PRO A CG  
98   C  CG  B PRO A 11  ? 0.1334 0.1668 0.1027 -0.0151 0.0003  0.0178  11  PRO A CG  
99   C  CD  A PRO A 11  ? 0.1993 0.1715 0.1185 -0.0002 -0.0126 0.0155  11  PRO A CD  
100  C  CD  B PRO A 11  ? 0.1519 0.1494 0.1019 -0.0081 -0.0046 0.0109  11  PRO A CD  
101  N  N   . ASP A 12  ? 0.2062 0.1730 0.1281 0.0048  -0.0042 0.0298  12  ASP A N   
102  C  CA  . ASP A 12  ? 0.2222 0.1739 0.1570 0.0116  0.0005  0.0300  12  ASP A CA  
103  C  C   . ASP A 12  ? 0.1997 0.1522 0.1511 0.0143  -0.0008 0.0292  12  ASP A C   
104  O  O   . ASP A 12  ? 0.2098 0.1526 0.1559 0.0209  -0.0029 0.0355  12  ASP A O   
105  C  CB  . ASP A 12  ? 0.2529 0.2123 0.1800 0.0137  -0.0085 0.0251  12  ASP A CB  
106  C  CG  . ASP A 12  ? 0.3145 0.2881 0.2479 -0.0067 -0.0011 0.0203  12  ASP A CG  
107  O  OD1 . ASP A 12  ? 0.4012 0.3269 0.3102 -0.0268 0.0132  0.0623  12  ASP A OD1 
108  O  OD2 . ASP A 12  ? 0.3808 0.3637 0.3222 -0.0110 -0.0181 0.0007  12  ASP A OD2 
109  N  N   . GLY A 13  ? 0.1824 0.1368 0.1443 0.0064  -0.0153 0.0305  13  GLY A N   
110  C  CA  . GLY A 13  ? 0.1591 0.1259 0.1353 -0.0045 -0.0084 0.0273  13  GLY A CA  
111  C  C   . GLY A 13  ? 0.1444 0.1119 0.1098 0.0058  -0.0155 0.0369  13  GLY A C   
112  O  O   . GLY A 13  ? 0.1512 0.1373 0.1102 0.0116  -0.0164 0.0263  13  GLY A O   
113  N  N   . VAL A 14  ? 0.1528 0.1236 0.1212 -0.0011 -0.0196 0.0338  14  VAL A N   
114  C  CA  . VAL A 14  ? 0.1590 0.1287 0.1238 0.0048  -0.0204 0.0288  14  VAL A CA  
115  C  C   . VAL A 14  ? 0.1593 0.1257 0.0939 0.0114  -0.0152 0.0192  14  VAL A C   
116  O  O   . VAL A 14  ? 0.1595 0.1572 0.1078 0.0117  0.0021  0.0298  14  VAL A O   
117  C  CB  . VAL A 14  ? 0.1747 0.1466 0.1269 0.0044  -0.0246 0.0245  14  VAL A CB  
118  C  CG1 . VAL A 14  ? 0.2073 0.1961 0.1835 -0.0092 -0.0278 0.0204  14  VAL A CG1 
119  C  CG2 . VAL A 14  ? 0.1897 0.1630 0.1625 0.0197  -0.0283 0.0367  14  VAL A CG2 
120  N  N   . ILE A 15  ? 0.1546 0.1141 0.1099 0.0074  -0.0091 0.0296  15  ILE A N   
121  C  CA  . ILE A 15  ? 0.1382 0.1158 0.0964 0.0029  -0.0148 0.0124  15  ILE A CA  
122  C  C   . ILE A 15  ? 0.1263 0.1106 0.0966 0.0080  -0.0113 0.0087  15  ILE A C   
123  O  O   . ILE A 15  ? 0.1288 0.1393 0.1019 0.0043  -0.0142 0.0006  15  ILE A O   
124  C  CB  . ILE A 15  ? 0.1277 0.1183 0.0978 -0.0006 -0.0073 0.0182  15  ILE A CB  
125  C  CG1 . ILE A 15  ? 0.1315 0.1462 0.1062 -0.0027 0.0128  0.0020  15  ILE A CG1 
126  C  CG2 . ILE A 15  ? 0.1225 0.1111 0.1123 0.0146  -0.0138 0.0027  15  ILE A CG2 
127  C  CD1 . ILE A 15  ? 0.1623 0.1644 0.1411 -0.0049 -0.0185 0.0156  15  ILE A CD1 
128  N  N   . PRO A 16  ? 0.1277 0.1236 0.0887 0.0056  -0.0073 0.0100  16  PRO A N   
129  C  CA  . PRO A 16  ? 0.1390 0.1260 0.0951 -0.0107 -0.0203 0.0129  16  PRO A CA  
130  C  C   . PRO A 16  ? 0.1251 0.1008 0.0910 -0.0006 -0.0173 0.0030  16  PRO A C   
131  O  O   . PRO A 16  ? 0.1170 0.1032 0.0995 -0.0016 -0.0242 0.0069  16  PRO A O   
132  C  CB  . PRO A 16  ? 0.1538 0.1515 0.1016 -0.0122 -0.0345 0.0092  16  PRO A CB  
133  C  CG  . PRO A 16  ? 0.1764 0.1583 0.1163 -0.0096 -0.0165 0.0089  16  PRO A CG  
134  C  CD  . PRO A 16  ? 0.1457 0.1582 0.1070 -0.0023 0.0055  0.0016  16  PRO A CD  
135  N  N   . PHE A 17  ? 0.1399 0.1133 0.1022 -0.0155 -0.0196 -0.0021 17  PHE A N   
136  C  CA  . PHE A 17  ? 0.1416 0.1271 0.0876 -0.0133 -0.0277 0.0001  17  PHE A CA  
137  C  C   . PHE A 17  ? 0.1204 0.1292 0.0895 -0.0046 -0.0257 -0.0014 17  PHE A C   
138  O  O   . PHE A 17  ? 0.1220 0.1486 0.1074 -0.0048 -0.0368 -0.0011 17  PHE A O   
139  C  CB  . PHE A 17  ? 0.1292 0.1369 0.1014 -0.0005 -0.0353 0.0002  17  PHE A CB  
140  C  CG  . PHE A 17  ? 0.1245 0.1257 0.1094 0.0001  -0.0399 -0.0029 17  PHE A CG  
141  C  CD1 . PHE A 17  ? 0.1183 0.1420 0.1199 0.0170  -0.0457 -0.0081 17  PHE A CD1 
142  C  CD2 . PHE A 17  ? 0.1275 0.1443 0.0999 0.0000  -0.0152 -0.0117 17  PHE A CD2 
143  C  CE1 . PHE A 17  ? 0.1218 0.1538 0.1409 0.0053  -0.0240 -0.0119 17  PHE A CE1 
144  C  CE2 . PHE A 17  ? 0.1447 0.1326 0.1232 0.0238  -0.0189 -0.0301 17  PHE A CE2 
145  C  CZ  . PHE A 17  ? 0.1335 0.1617 0.1388 -0.0006 -0.0246 -0.0142 17  PHE A CZ  
146  N  N   . VAL A 18  ? 0.1220 0.1165 0.0875 -0.0108 -0.0134 0.0002  18  VAL A N   
147  C  CA  . VAL A 18  ? 0.1206 0.1289 0.1086 -0.0131 -0.0224 0.0004  18  VAL A CA  
148  C  C   . VAL A 18  ? 0.1047 0.1256 0.0992 -0.0100 -0.0051 0.0002  18  VAL A C   
149  O  O   . VAL A 18  ? 0.0919 0.1317 0.1054 -0.0087 -0.0136 0.0020  18  VAL A O   
150  C  CB  . VAL A 18  ? 0.1327 0.1335 0.1079 -0.0288 -0.0218 -0.0110 18  VAL A CB  
151  C  CG1 . VAL A 18  ? 0.1638 0.1435 0.1477 -0.0322 -0.0135 -0.0150 18  VAL A CG1 
152  C  CG2 . VAL A 18  ? 0.1723 0.1693 0.1105 -0.0141 -0.0111 -0.0093 18  VAL A CG2 
153  N  N   . ILE A 19  ? 0.0922 0.1327 0.1169 -0.0018 -0.0015 0.0004  19  ILE A N   
154  C  CA  . ILE A 19  ? 0.1174 0.1282 0.1268 -0.0093 0.0062  -0.0040 19  ILE A CA  
155  C  C   . ILE A 19  ? 0.1129 0.1225 0.1293 -0.0155 0.0058  -0.0050 19  ILE A C   
156  O  O   . ILE A 19  ? 0.1095 0.1141 0.1631 -0.0044 0.0007  -0.0042 19  ILE A O   
157  C  CB  . ILE A 19  ? 0.1267 0.1226 0.1428 -0.0116 0.0180  0.0012  19  ILE A CB  
158  C  CG1 . ILE A 19  ? 0.1585 0.1170 0.1628 -0.0096 0.0273  -0.0161 19  ILE A CG1 
159  C  CG2 . ILE A 19  ? 0.1492 0.1560 0.1288 -0.0146 0.0289  -0.0094 19  ILE A CG2 
160  C  CD1 . ILE A 19  ? 0.2059 0.1544 0.1667 0.0096  0.0366  -0.0092 19  ILE A CD1 
161  N  N   . GLY A 20  ? 0.1107 0.1143 0.1296 -0.0155 0.0061  0.0021  20  GLY A N   
162  C  CA  . GLY A 20  ? 0.1055 0.1219 0.1241 -0.0048 0.0149  -0.0063 20  GLY A CA  
163  C  C   . GLY A 20  ? 0.0954 0.1101 0.1302 -0.0085 0.0092  -0.0107 20  GLY A C   
164  O  O   . GLY A 20  ? 0.0984 0.1240 0.1358 -0.0018 0.0014  -0.0209 20  GLY A O   
165  N  N   . GLY A 21  ? 0.1043 0.1021 0.1332 -0.0115 0.0084  -0.0076 21  GLY A N   
166  C  CA  . GLY A 21  ? 0.1119 0.1233 0.1228 -0.0122 0.0081  -0.0051 21  GLY A CA  
167  C  C   . GLY A 21  ? 0.0940 0.1097 0.1284 -0.0051 0.0045  -0.0117 21  GLY A C   
168  O  O   . GLY A 21  ? 0.1126 0.1232 0.1288 -0.0012 0.0048  -0.0111 21  GLY A O   
169  N  N   . ASN A 22  A 0.1115 0.1157 0.1257 -0.0129 0.0218  -0.0239 21  ASN A N   
170  C  CA  . ASN A 22  A 0.1330 0.1293 0.1366 -0.0178 0.0175  -0.0156 21  ASN A CA  
171  C  C   . ASN A 22  A 0.1245 0.1128 0.1403 -0.0092 0.0142  -0.0119 21  ASN A C   
172  O  O   . ASN A 22  A 0.1689 0.1183 0.1474 -0.0148 0.0206  -0.0125 21  ASN A O   
173  C  CB  . ASN A 22  A 0.1480 0.1215 0.1358 -0.0151 0.0193  0.0026  21  ASN A CB  
174  C  CG  . ASN A 22  A 0.1630 0.1581 0.1450 -0.0190 0.0248  -0.0074 21  ASN A CG  
175  O  OD1 . ASN A 22  A 0.2082 0.1479 0.1992 -0.0269 0.0397  -0.0026 21  ASN A OD1 
176  N  ND2 . ASN A 22  A 0.1997 0.1502 0.1528 -0.0132 0.0038  0.0200  21  ASN A ND2 
177  N  N   . PHE A 23  ? 0.0943 0.1147 0.1486 -0.0099 0.0234  -0.0254 22  PHE A N   
178  C  CA  . PHE A 23  ? 0.1203 0.1230 0.1636 -0.0177 0.0222  -0.0285 22  PHE A CA  
179  C  C   . PHE A 23  ? 0.1208 0.1472 0.1703 -0.0154 0.0239  -0.0271 22  PHE A C   
180  O  O   . PHE A 23  ? 0.1260 0.1842 0.1933 -0.0038 0.0191  -0.0422 22  PHE A O   
181  C  CB  . PHE A 23  ? 0.1138 0.1025 0.1661 0.0000  0.0218  -0.0127 22  PHE A CB  
182  C  CG  . PHE A 23  ? 0.1025 0.1029 0.1418 -0.0114 0.0280  -0.0115 22  PHE A CG  
183  C  CD1 . PHE A 23  ? 0.1247 0.0968 0.1513 -0.0217 0.0146  -0.0238 22  PHE A CD1 
184  C  CD2 . PHE A 23  ? 0.1054 0.1175 0.1667 -0.0072 0.0138  -0.0129 22  PHE A CD2 
185  C  CE1 . PHE A 23  ? 0.1257 0.1074 0.1349 -0.0276 0.0309  -0.0131 22  PHE A CE1 
186  C  CE2 . PHE A 23  ? 0.1141 0.1172 0.1717 -0.0109 0.0264  -0.0148 22  PHE A CE2 
187  C  CZ  . PHE A 23  ? 0.1407 0.1000 0.1636 -0.0140 0.0103  -0.0290 22  PHE A CZ  
188  N  N   . THR A 24  ? 0.1439 0.1563 0.1808 -0.0246 0.0393  -0.0221 23  THR A N   
189  C  CA  . THR A 24  ? 0.1513 0.1466 0.1878 -0.0216 0.0530  -0.0166 23  THR A CA  
190  C  C   . THR A 24  ? 0.1396 0.1428 0.2029 -0.0092 0.0484  -0.0198 23  THR A C   
191  O  O   . THR A 24  ? 0.1325 0.1377 0.1979 -0.0299 0.0570  -0.0162 23  THR A O   
192  C  CB  . THR A 24  ? 0.1950 0.1638 0.1937 -0.0145 0.0392  -0.0220 23  THR A CB  
193  O  OG1 . THR A 24  ? 0.2296 0.1776 0.1736 -0.0305 0.0531  -0.0359 23  THR A OG1 
194  C  CG2 . THR A 24  ? 0.2320 0.1751 0.1993 -0.0060 0.0574  -0.0101 23  THR A CG2 
195  N  N   . GLY A 25  ? 0.1480 0.1559 0.2334 -0.0014 0.0527  -0.0254 24  GLY A N   
196  C  CA  . GLY A 25  ? 0.1522 0.1528 0.2339 0.0000  0.0508  -0.0225 24  GLY A CA  
197  C  C   . GLY A 25  ? 0.1574 0.1555 0.2184 0.0008  0.0493  -0.0170 24  GLY A C   
198  O  O   . GLY A 25  ? 0.1474 0.1407 0.2462 -0.0118 0.0613  -0.0182 24  GLY A O   
199  N  N   . SER A 26  ? 0.1619 0.1614 0.1979 -0.0034 0.0601  -0.0265 25  SER A N   
200  C  CA  A SER A 26  ? 0.1809 0.1831 0.1877 -0.0100 0.0429  -0.0188 25  SER A CA  
201  C  CA  B SER A 26  ? 0.1767 0.1872 0.1908 -0.0068 0.0439  -0.0199 25  SER A CA  
202  C  C   . SER A 26  ? 0.1758 0.1640 0.1793 -0.0044 0.0470  -0.0203 25  SER A C   
203  O  O   . SER A 26  ? 0.1803 0.1566 0.1796 -0.0211 0.0508  -0.0244 25  SER A O   
204  C  CB  A SER A 26  ? 0.1978 0.2036 0.1935 -0.0130 0.0448  -0.0127 25  SER A CB  
205  C  CB  B SER A 26  ? 0.1941 0.2067 0.1984 -0.0085 0.0427  -0.0175 25  SER A CB  
206  O  OG  A SER A 26  ? 0.2449 0.2330 0.2298 -0.0195 0.0222  -0.0147 25  SER A OG  
207  O  OG  B SER A 26  ? 0.1935 0.2526 0.2519 0.0058  0.0387  -0.0121 25  SER A OG  
208  N  N   . GLN A 27  ? 0.1652 0.1463 0.1675 -0.0089 0.0385  -0.0244 26  GLN A N   
209  C  CA  . GLN A 27  ? 0.1375 0.1328 0.1530 -0.0036 0.0296  -0.0149 26  GLN A CA  
210  C  C   . GLN A 27  ? 0.1133 0.1310 0.1309 -0.0103 0.0219  -0.0244 26  GLN A C   
211  O  O   . GLN A 27  ? 0.0923 0.1282 0.1419 -0.0093 0.0176  -0.0150 26  GLN A O   
212  C  CB  . GLN A 27  ? 0.1417 0.1301 0.1436 -0.0053 0.0152  -0.0084 26  GLN A CB  
213  C  CG  . GLN A 27  ? 0.2116 0.1423 0.1467 -0.0020 0.0096  -0.0011 26  GLN A CG  
214  C  CD  . GLN A 27  ? 0.1765 0.1546 0.1467 0.0007  -0.0053 0.0013  26  GLN A CD  
215  O  OE1 . GLN A 27  ? 0.2523 0.1900 0.2506 0.0088  -0.0184 -0.0061 26  GLN A OE1 
216  N  NE2 . GLN A 27  ? 0.1626 0.1195 0.1309 -0.0055 0.0249  -0.0052 26  GLN A NE2 
217  N  N   . ARG A 28  ? 0.0974 0.1350 0.1438 -0.0063 0.0241  -0.0153 27  ARG A N   
218  C  CA  . ARG A 28  ? 0.0826 0.1323 0.1445 -0.0067 0.0178  -0.0206 27  ARG A CA  
219  C  C   . ARG A 28  ? 0.0829 0.1303 0.1705 -0.0138 0.0223  -0.0103 27  ARG A C   
220  O  O   . ARG A 28  ? 0.0777 0.1327 0.1786 -0.0023 0.0120  0.0014  27  ARG A O   
221  C  CB  . ARG A 28  ? 0.0913 0.1411 0.1619 -0.0168 0.0148  -0.0292 27  ARG A CB  
222  C  CG  . ARG A 28  ? 0.1035 0.1390 0.1722 -0.0017 0.0175  -0.0307 27  ARG A CG  
223  C  CD  . ARG A 28  ? 0.1574 0.2014 0.2012 -0.0022 -0.0035 -0.0304 27  ARG A CD  
224  N  NE  . ARG A 28  ? 0.1606 0.1992 0.2790 -0.0146 -0.0083 -0.0395 27  ARG A NE  
225  C  CZ  . ARG A 28  ? 0.1891 0.2246 0.2583 -0.0074 -0.0015 -0.0163 27  ARG A CZ  
226  N  NH1 . ARG A 28  ? 0.2365 0.2277 0.2709 -0.0169 -0.0009 -0.0193 27  ARG A NH1 
227  N  NH2 . ARG A 28  ? 0.2091 0.2666 0.2984 -0.0172 0.0053  -0.0228 27  ARG A NH2 
228  N  N   . ALA A 29  ? 0.0958 0.1300 0.1792 -0.0105 0.0259  -0.0150 28  ALA A N   
229  C  CA  . ALA A 29  ? 0.0875 0.1452 0.1865 -0.0057 0.0240  -0.0168 28  ALA A CA  
230  C  C   . ALA A 29  ? 0.0856 0.1306 0.1629 -0.0021 0.0137  -0.0138 28  ALA A C   
231  O  O   . ALA A 29  ? 0.0883 0.1406 0.1762 -0.0114 0.0149  0.0000  28  ALA A O   
232  C  CB  . ALA A 29  ? 0.1181 0.1557 0.2081 -0.0052 0.0351  -0.0126 28  ALA A CB  
233  N  N   . VAL A 30  ? 0.0865 0.1292 0.1412 -0.0119 0.0110  -0.0151 29  VAL A N   
234  C  CA  . VAL A 30  ? 0.1000 0.1301 0.1295 -0.0152 0.0058  -0.0029 29  VAL A CA  
235  C  C   . VAL A 30  ? 0.0897 0.1275 0.1184 -0.0080 0.0007  -0.0048 29  VAL A C   
236  O  O   . VAL A 30  ? 0.0906 0.1139 0.1356 -0.0185 0.0000  -0.0009 29  VAL A O   
237  C  CB  . VAL A 30  ? 0.1167 0.1470 0.1336 -0.0081 -0.0073 -0.0028 29  VAL A CB  
238  C  CG1 . VAL A 30  ? 0.1352 0.1438 0.1534 -0.0049 -0.0138 0.0018  29  VAL A CG1 
239  C  CG2 . VAL A 30  ? 0.1959 0.1799 0.1495 -0.0290 0.0126  0.0010  29  VAL A CG2 
240  N  N   . PHE A 31  ? 0.0874 0.1261 0.1280 0.0011  -0.0030 -0.0128 30  PHE A N   
241  C  CA  . PHE A 31  ? 0.0874 0.1059 0.1278 -0.0035 0.0000  -0.0022 30  PHE A CA  
242  C  C   . PHE A 31  ? 0.0807 0.1031 0.1204 -0.0049 -0.0021 -0.0071 30  PHE A C   
243  O  O   . PHE A 31  ? 0.0753 0.1033 0.1356 -0.0134 -0.0007 -0.0020 30  PHE A O   
244  C  CB  . PHE A 31  ? 0.0998 0.1104 0.1509 -0.0023 0.0064  -0.0123 30  PHE A CB  
245  C  CG  . PHE A 31  ? 0.0795 0.1277 0.1413 -0.0205 0.0072  -0.0108 30  PHE A CG  
246  C  CD1 . PHE A 31  ? 0.1154 0.0992 0.1800 -0.0146 -0.0016 -0.0098 30  PHE A CD1 
247  C  CD2 . PHE A 31  ? 0.1087 0.1283 0.1611 -0.0098 0.0334  -0.0228 30  PHE A CD2 
248  C  CE1 . PHE A 31  ? 0.1396 0.1137 0.1927 0.0014  -0.0086 -0.0049 30  PHE A CE1 
249  C  CE2 . PHE A 31  ? 0.1185 0.1232 0.1742 -0.0024 0.0259  -0.0237 30  PHE A CE2 
250  C  CZ  . PHE A 31  ? 0.1589 0.0969 0.1761 0.0145  0.0224  -0.0258 30  PHE A CZ  
251  N  N   . ARG A 32  ? 0.0744 0.1166 0.1399 0.0022  -0.0070 -0.0031 31  ARG A N   
252  C  CA  . ARG A 32  ? 0.0927 0.1259 0.1648 -0.0015 -0.0181 0.0012  31  ARG A CA  
253  C  C   . ARG A 32  ? 0.0629 0.1218 0.1412 0.0001  -0.0054 0.0002  31  ARG A C   
254  O  O   . ARG A 32  ? 0.0940 0.1153 0.1654 -0.0054 -0.0056 0.0121  31  ARG A O   
255  C  CB  . ARG A 32  ? 0.0959 0.1476 0.1754 -0.0152 -0.0292 0.0033  31  ARG A CB  
256  C  CG  . ARG A 32  ? 0.1269 0.1541 0.2015 -0.0175 -0.0381 -0.0062 31  ARG A CG  
257  C  CD  . ARG A 32  ? 0.1507 0.2142 0.2320 -0.0300 -0.0383 -0.0012 31  ARG A CD  
258  N  NE  . ARG A 32  ? 0.2296 0.2798 0.2878 -0.0117 -0.0402 -0.0207 31  ARG A NE  
259  C  CZ  . ARG A 32  ? 0.2580 0.2819 0.2890 -0.0126 -0.0144 -0.0259 31  ARG A CZ  
260  N  NH1 . ARG A 32  ? 0.2491 0.3372 0.3100 -0.0203 -0.0063 -0.0250 31  ARG A NH1 
261  N  NH2 . ARG A 32  ? 0.2775 0.3177 0.3219 -0.0123 -0.0253 -0.0428 31  ARG A NH2 
262  N  N   . GLN A 33  ? 0.0885 0.1176 0.1474 0.0160  0.0030  0.0021  32  GLN A N   
263  C  CA  . GLN A 33  ? 0.0892 0.1302 0.1361 -0.0014 0.0168  -0.0065 32  GLN A CA  
264  C  C   . GLN A 33  ? 0.0921 0.1063 0.1177 -0.0003 0.0085  0.0001  32  GLN A C   
265  O  O   . GLN A 33  ? 0.0851 0.0926 0.1329 0.0004  0.0125  -0.0040 32  GLN A O   
266  C  CB  . GLN A 33  ? 0.1229 0.1239 0.1460 0.0003  0.0185  -0.0092 32  GLN A CB  
267  C  CG  . GLN A 33  ? 0.1497 0.1608 0.1706 -0.0138 0.0141  -0.0187 32  GLN A CG  
268  C  CD  . GLN A 33  ? 0.2138 0.1916 0.1771 0.0124  0.0192  -0.0143 32  GLN A CD  
269  O  OE1 . GLN A 33  ? 0.2269 0.1916 0.1848 0.0246  0.0281  0.0004  32  GLN A OE1 
270  N  NE2 . GLN A 33  ? 0.2811 0.2394 0.1953 0.0228  -0.0024 -0.0444 32  GLN A NE2 
271  N  N   . ALA A 34  ? 0.0780 0.1040 0.1017 0.0121  -0.0015 -0.0064 33  ALA A N   
272  C  CA  . ALA A 34  ? 0.0833 0.0909 0.1057 0.0070  -0.0017 -0.0006 33  ALA A CA  
273  C  C   . ALA A 34  ? 0.0772 0.1020 0.0957 0.0040  -0.0025 -0.0060 33  ALA A C   
274  O  O   . ALA A 34  ? 0.0736 0.1043 0.1141 -0.0025 -0.0018 0.0038  33  ALA A O   
275  C  CB  . ALA A 34  ? 0.0975 0.0873 0.1148 0.0163  -0.0039 0.0063  33  ALA A CB  
276  N  N   . MET A 35  ? 0.0730 0.1114 0.0989 0.0059  -0.0059 -0.0051 34  MET A N   
277  C  CA  . MET A 35  ? 0.1026 0.1068 0.0970 0.0043  -0.0094 -0.0064 34  MET A CA  
278  C  C   . MET A 35  ? 0.0936 0.1070 0.1115 0.0052  -0.0053 -0.0016 34  MET A C   
279  O  O   . MET A 35  ? 0.1038 0.1022 0.1016 -0.0017 -0.0003 -0.0061 34  MET A O   
280  C  CB  . MET A 35  ? 0.1016 0.1278 0.1076 0.0002  -0.0079 -0.0078 34  MET A CB  
281  C  CG  . MET A 35  ? 0.1161 0.1300 0.1058 -0.0088 -0.0263 -0.0101 34  MET A CG  
282  S  SD  . MET A 35  ? 0.1290 0.1226 0.1141 -0.0110 -0.0196 -0.0039 34  MET A SD  
283  C  CE  . MET A 35  ? 0.1153 0.1253 0.1340 -0.0109 -0.0055 -0.0212 34  MET A CE  
284  N  N   . ARG A 36  ? 0.0951 0.0990 0.1153 0.0138  -0.0067 -0.0159 35  ARG A N   
285  C  CA  . ARG A 36  ? 0.1077 0.1046 0.1350 0.0079  -0.0023 -0.0174 35  ARG A CA  
286  C  C   . ARG A 36  ? 0.0943 0.1008 0.1187 0.0081  0.0064  -0.0081 35  ARG A C   
287  O  O   . ARG A 36  ? 0.1014 0.0916 0.1375 -0.0016 -0.0064 0.0049  35  ARG A O   
288  C  CB  . ARG A 36  ? 0.1044 0.1382 0.1592 -0.0069 0.0005  -0.0045 35  ARG A CB  
289  C  CG  . ARG A 36  ? 0.1401 0.1395 0.1670 -0.0055 0.0025  0.0020  35  ARG A CG  
290  C  CD  . ARG A 36  ? 0.1498 0.1739 0.2152 0.0124  0.0094  -0.0170 35  ARG A CD  
291  N  NE  . ARG A 36  ? 0.1801 0.1741 0.2471 0.0158  0.0070  -0.0027 35  ARG A NE  
292  C  CZ  . ARG A 36  ? 0.1508 0.2010 0.2377 0.0164  0.0097  -0.0002 35  ARG A CZ  
293  N  NH1 . ARG A 36  ? 0.1810 0.1973 0.2822 0.0247  0.0230  -0.0176 35  ARG A NH1 
294  N  NH2 . ARG A 36  ? 0.2050 0.1922 0.2564 0.0615  0.0336  -0.0011 35  ARG A NH2 
295  N  N   . HIS A 37  ? 0.0762 0.1023 0.1206 0.0154  -0.0075 -0.0079 36  HIS A N   
296  C  CA  . HIS A 37  ? 0.0467 0.0961 0.1232 0.0057  0.0112  -0.0021 36  HIS A CA  
297  C  C   . HIS A 37  ? 0.0585 0.0942 0.1149 0.0063  0.0012  -0.0044 36  HIS A C   
298  O  O   . HIS A 37  ? 0.0771 0.0834 0.1349 0.0033  0.0083  -0.0078 36  HIS A O   
299  C  CB  . HIS A 37  ? 0.0801 0.1033 0.1087 0.0092  0.0091  -0.0083 36  HIS A CB  
300  C  CG  . HIS A 37  ? 0.0656 0.1221 0.1077 -0.0049 -0.0192 0.0129  36  HIS A CG  
301  N  ND1 . HIS A 37  ? 0.1016 0.1267 0.1503 -0.0094 -0.0113 -0.0067 36  HIS A ND1 
302  C  CD2 . HIS A 37  ? 0.0630 0.0762 0.0864 0.0241  -0.0082 -0.0174 36  HIS A CD2 
303  C  CE1 . HIS A 37  ? 0.0306 0.0917 0.1096 0.0188  -0.0028 -0.0133 36  HIS A CE1 
304  N  NE2 . HIS A 37  ? 0.1059 0.1414 0.1518 0.0256  -0.0080 -0.0130 36  HIS A NE2 
305  N  N   . TRP A 38  ? 0.0749 0.0841 0.0965 0.0152  0.0024  -0.0110 37  TRP A N   
306  C  CA  . TRP A 38  ? 0.1038 0.0889 0.1121 0.0198  0.0131  -0.0021 37  TRP A CA  
307  C  C   . TRP A 38  ? 0.1090 0.0923 0.1087 0.0011  0.0011  0.0004  37  TRP A C   
308  O  O   . TRP A 38  ? 0.1088 0.1106 0.1263 -0.0022 0.0143  0.0099  37  TRP A O   
309  C  CB  . TRP A 38  ? 0.1159 0.0942 0.1019 0.0117  -0.0056 -0.0119 37  TRP A CB  
310  C  CG  . TRP A 38  ? 0.0821 0.0831 0.0890 0.0002  0.0010  -0.0060 37  TRP A CG  
311  C  CD1 . TRP A 38  ? 0.1075 0.0956 0.0961 0.0034  0.0066  -0.0100 37  TRP A CD1 
312  C  CD2 . TRP A 38  ? 0.0913 0.0827 0.0945 0.0104  0.0196  -0.0107 37  TRP A CD2 
313  N  NE1 . TRP A 38  ? 0.0998 0.0897 0.1054 0.0025  0.0072  -0.0036 37  TRP A NE1 
314  C  CE2 . TRP A 38  ? 0.0928 0.0934 0.0946 0.0104  0.0068  -0.0128 37  TRP A CE2 
315  C  CE3 . TRP A 38  ? 0.1025 0.1057 0.1127 -0.0116 0.0174  0.0033  37  TRP A CE3 
316  C  CZ2 . TRP A 38  ? 0.1002 0.1040 0.1264 0.0059  0.0125  -0.0195 37  TRP A CZ2 
317  C  CZ3 . TRP A 38  ? 0.1108 0.1411 0.1328 -0.0013 0.0208  -0.0009 37  TRP A CZ3 
318  C  CH2 . TRP A 38  ? 0.0967 0.1164 0.1183 0.0022  0.0260  -0.0224 37  TRP A CH2 
319  N  N   . GLU A 39  ? 0.1163 0.1123 0.1150 0.0187  -0.0090 0.0023  38  GLU A N   
320  C  CA  . GLU A 39  ? 0.1345 0.1035 0.1317 0.0078  -0.0130 0.0053  38  GLU A CA  
321  C  C   . GLU A 39  ? 0.1197 0.1118 0.1466 0.0089  -0.0058 0.0093  38  GLU A C   
322  O  O   . GLU A 39  ? 0.1534 0.1087 0.1612 0.0079  0.0067  0.0251  38  GLU A O   
323  C  CB  . GLU A 39  ? 0.1357 0.1188 0.1438 0.0183  -0.0117 0.0078  38  GLU A CB  
324  C  CG  . GLU A 39  ? 0.1598 0.1356 0.1530 0.0192  -0.0187 -0.0132 38  GLU A CG  
325  C  CD  . GLU A 39  ? 0.1497 0.1874 0.1913 0.0213  -0.0012 -0.0343 38  GLU A CD  
326  O  OE1 . GLU A 39  ? 0.1839 0.2493 0.2451 0.0026  0.0203  -0.0636 38  GLU A OE1 
327  O  OE2 . GLU A 39  ? 0.1642 0.2408 0.2101 0.0251  -0.0119 -0.0476 38  GLU A OE2 
328  N  N   . LYS A 40  ? 0.1105 0.1021 0.1436 0.0134  -0.0012 -0.0083 39  LYS A N   
329  C  CA  . LYS A 40  ? 0.1157 0.1194 0.1773 0.0108  0.0088  -0.0094 39  LYS A CA  
330  C  C   . LYS A 40  ? 0.0927 0.1096 0.1546 0.0184  0.0051  -0.0107 39  LYS A C   
331  O  O   . LYS A 40  ? 0.1031 0.1060 0.2039 0.0097  -0.0060 -0.0021 39  LYS A O   
332  C  CB  . LYS A 40  ? 0.1393 0.1391 0.1741 0.0022  0.0039  -0.0163 39  LYS A CB  
333  C  CG  . LYS A 40  ? 0.1034 0.1567 0.1712 0.0227  0.0049  -0.0017 39  LYS A CG  
334  C  CD  . LYS A 40  ? 0.1686 0.1685 0.1890 0.0181  0.0179  0.0092  39  LYS A CD  
335  C  CE  . LYS A 40  ? 0.1494 0.1590 0.1982 0.0148  0.0333  0.0017  39  LYS A CE  
336  N  NZ  . LYS A 40  ? 0.1982 0.1695 0.2312 0.0285  0.0388  0.0203  39  LYS A NZ  
337  N  N   . HIS A 41  ? 0.0953 0.1237 0.1477 0.0253  -0.0089 -0.0065 40  HIS A N   
338  C  CA  . HIS A 41  ? 0.0934 0.1348 0.1499 0.0193  -0.0033 -0.0164 40  HIS A CA  
339  C  C   . HIS A 41  ? 0.0989 0.1369 0.1566 0.0124  -0.0088 -0.0177 40  HIS A C   
340  O  O   . HIS A 41  ? 0.1098 0.1247 0.1867 -0.0005 0.0040  -0.0133 40  HIS A O   
341  C  CB  . HIS A 41  ? 0.0960 0.1530 0.1597 0.0142  0.0009  -0.0017 40  HIS A CB  
342  C  CG  . HIS A 41  ? 0.0790 0.1379 0.1341 0.0276  -0.0285 -0.0138 40  HIS A CG  
343  N  ND1 . HIS A 41  ? 0.1617 0.1735 0.1606 0.0242  0.0048  -0.0291 40  HIS A ND1 
344  C  CD2 . HIS A 41  ? 0.1029 0.0958 0.1487 0.0341  -0.0273 -0.0271 40  HIS A CD2 
345  C  CE1 . HIS A 41  ? 0.1025 0.1328 0.1468 0.0199  -0.0002 -0.0275 40  HIS A CE1 
346  N  NE2 . HIS A 41  ? 0.1462 0.1926 0.1885 0.0151  -0.0128 -0.0177 40  HIS A NE2 
347  N  N   . THR A 42  ? 0.1220 0.1326 0.1493 0.0132  0.0099  -0.0170 41  THR A N   
348  C  CA  . THR A 42  ? 0.1218 0.1489 0.1514 0.0115  0.0093  -0.0108 41  THR A CA  
349  C  C   . THR A 42  ? 0.1377 0.1571 0.1601 -0.0020 0.0076  0.0002  41  THR A C   
350  O  O   . THR A 42  ? 0.1469 0.1929 0.1784 0.0215  0.0026  0.0048  41  THR A O   
351  C  CB  . THR A 42  ? 0.1352 0.1232 0.1672 0.0004  0.0019  -0.0173 41  THR A CB  
352  O  OG1 . THR A 42  ? 0.1333 0.1440 0.1447 -0.0055 0.0131  0.0004  41  THR A OG1 
353  C  CG2 . THR A 42  ? 0.1164 0.1243 0.1692 0.0007  0.0000  -0.0218 41  THR A CG2 
354  N  N   . CYS A 43  ? 0.1589 0.1496 0.1545 0.0005  -0.0004 0.0072  42  CYS A N   
355  C  CA  . CYS A 43  ? 0.1738 0.1380 0.1545 -0.0129 -0.0040 0.0128  42  CYS A CA  
356  C  C   . CYS A 43  ? 0.1658 0.1254 0.1490 -0.0120 -0.0156 0.0162  42  CYS A C   
357  O  O   . CYS A 43  ? 0.2104 0.1478 0.1541 -0.0083 -0.0423 0.0172  42  CYS A O   
358  C  CB  . CYS A 43  ? 0.1817 0.1463 0.1857 -0.0037 0.0012  0.0229  42  CYS A CB  
359  S  SG  . CYS A 43  ? 0.1932 0.1972 0.1962 0.0066  0.0071  0.0418  42  CYS A SG  
360  N  N   . VAL A 44  ? 0.1580 0.1241 0.1401 -0.0054 -0.0001 0.0121  43  VAL A N   
361  C  CA  A VAL A 44  ? 0.1476 0.1190 0.1349 0.0036  0.0003  0.0125  43  VAL A CA  
362  C  CA  B VAL A 44  ? 0.1572 0.1340 0.1401 0.0011  0.0028  0.0109  43  VAL A CA  
363  C  C   . VAL A 44  ? 0.1545 0.1229 0.1428 0.0042  0.0065  0.0149  43  VAL A C   
364  O  O   . VAL A 44  ? 0.1398 0.1235 0.1448 0.0070  -0.0039 0.0036  43  VAL A O   
365  C  CB  A VAL A 44  ? 0.1386 0.1189 0.1325 0.0008  0.0012  0.0179  43  VAL A CB  
366  C  CB  B VAL A 44  ? 0.1612 0.1515 0.1510 -0.0007 -0.0002 0.0138  43  VAL A CB  
367  C  CG1 A VAL A 44  ? 0.1473 0.1062 0.1507 0.0128  -0.0076 0.0198  43  VAL A CG1 
368  C  CG1 B VAL A 44  ? 0.1558 0.1570 0.1416 0.0083  0.0103  0.0054  43  VAL A CG1 
369  C  CG2 A VAL A 44  ? 0.1373 0.1396 0.1387 0.0029  0.0036  0.0092  43  VAL A CG2 
370  C  CG2 B VAL A 44  ? 0.2005 0.2037 0.1675 0.0016  0.0084  0.0049  43  VAL A CG2 
371  N  N   . THR A 45  ? 0.1370 0.1250 0.1353 0.0097  -0.0066 0.0139  44  THR A N   
372  C  CA  . THR A 45  ? 0.1478 0.1278 0.1291 0.0079  -0.0143 0.0195  44  THR A CA  
373  C  C   . THR A 45  ? 0.1466 0.1223 0.1341 0.0105  -0.0001 0.0061  44  THR A C   
374  O  O   . THR A 45  ? 0.1600 0.1418 0.1625 0.0048  0.0188  -0.0014 44  THR A O   
375  C  CB  . THR A 45  ? 0.1570 0.1457 0.1593 0.0195  -0.0185 0.0204  44  THR A CB  
376  O  OG1 . THR A 45  ? 0.2156 0.1699 0.1580 0.0039  -0.0234 0.0293  44  THR A OG1 
377  C  CG2 . THR A 45  ? 0.1932 0.1350 0.1966 0.0074  -0.0231 0.0188  44  THR A CG2 
378  N  N   . PHE A 46  ? 0.1436 0.1235 0.1323 0.0098  -0.0079 0.0142  45  PHE A N   
379  C  CA  . PHE A 46  ? 0.1500 0.1324 0.1314 0.0023  -0.0097 0.0079  45  PHE A CA  
380  C  C   . PHE A 46  ? 0.1507 0.1528 0.1479 0.0065  -0.0135 0.0013  45  PHE A C   
381  O  O   . PHE A 46  ? 0.1465 0.1918 0.2037 0.0110  -0.0206 -0.0049 45  PHE A O   
382  C  CB  . PHE A 46  ? 0.1412 0.1357 0.1189 -0.0027 -0.0024 0.0038  45  PHE A CB  
383  C  CG  . PHE A 46  ? 0.1208 0.1099 0.1055 -0.0060 -0.0047 0.0062  45  PHE A CG  
384  C  CD1 . PHE A 46  ? 0.1503 0.1121 0.1049 0.0145  -0.0018 0.0197  45  PHE A CD1 
385  C  CD2 . PHE A 46  ? 0.1622 0.1218 0.0991 -0.0103 0.0149  -0.0055 45  PHE A CD2 
386  C  CE1 . PHE A 46  ? 0.1529 0.1337 0.0935 -0.0115 -0.0081 0.0034  45  PHE A CE1 
387  C  CE2 . PHE A 46  ? 0.1850 0.1408 0.1046 -0.0148 -0.0144 0.0098  45  PHE A CE2 
388  C  CZ  . PHE A 46  ? 0.1764 0.1464 0.0986 -0.0091 -0.0154 0.0208  45  PHE A CZ  
389  N  N   . LEU A 47  ? 0.1479 0.1482 0.1400 0.0018  -0.0373 0.0073  46  LEU A N   
390  C  CA  . LEU A 47  ? 0.1805 0.1810 0.1758 0.0056  -0.0406 0.0075  46  LEU A CA  
391  C  C   . LEU A 47  ? 0.1548 0.1656 0.1570 0.0031  -0.0341 -0.0004 46  LEU A C   
392  O  O   . LEU A 47  ? 0.1378 0.1639 0.1551 0.0274  -0.0387 0.0069  46  LEU A O   
393  C  CB  . LEU A 47  ? 0.2246 0.2144 0.1983 -0.0061 -0.0265 0.0035  46  LEU A CB  
394  C  CG  . LEU A 47  ? 0.2288 0.2482 0.2382 -0.0119 -0.0219 0.0086  46  LEU A CG  
395  C  CD1 . LEU A 47  ? 0.2410 0.2791 0.2825 0.0174  -0.0270 0.0110  46  LEU A CD1 
396  C  CD2 . LEU A 47  ? 0.2569 0.2524 0.2098 0.0052  -0.0203 0.0146  46  LEU A CD2 
397  N  N   . GLU A 48  ? 0.1477 0.1988 0.1664 0.0044  -0.0498 0.0020  47  GLU A N   
398  C  CA  . GLU A 48  ? 0.1657 0.2161 0.1898 -0.0017 -0.0371 -0.0085 47  GLU A CA  
399  C  C   . GLU A 48  ? 0.1752 0.2043 0.1618 0.0038  -0.0448 -0.0039 47  GLU A C   
400  O  O   . GLU A 48  ? 0.2014 0.2141 0.1486 0.0055  -0.0602 0.0061  47  GLU A O   
401  C  CB  . GLU A 48  ? 0.1776 0.2439 0.2148 -0.0079 -0.0324 -0.0062 47  GLU A CB  
402  C  CG  . GLU A 48  ? 0.2615 0.3072 0.2957 0.0084  -0.0060 -0.0220 47  GLU A CG  
403  C  CD  . GLU A 48  ? 0.3491 0.3740 0.3627 0.0029  -0.0113 0.0024  47  GLU A CD  
404  O  OE1 . GLU A 48  ? 0.3975 0.3916 0.4225 0.0071  -0.0128 -0.0023 47  GLU A OE1 
405  O  OE2 . GLU A 48  ? 0.4104 0.4492 0.4156 0.0043  0.0002  -0.0195 47  GLU A OE2 
406  N  N   . ARG A 49  ? 0.1675 0.1914 0.1432 -0.0015 -0.0433 -0.0057 48  ARG A N   
407  C  CA  . ARG A 49  ? 0.1709 0.2113 0.1357 0.0032  -0.0470 0.0010  48  ARG A CA  
408  C  C   . ARG A 49  ? 0.1785 0.2249 0.1528 -0.0087 -0.0393 0.0004  48  ARG A C   
409  O  O   . ARG A 49  ? 0.1910 0.2572 0.1646 -0.0242 -0.0596 0.0089  48  ARG A O   
410  C  CB  . ARG A 49  ? 0.1655 0.1922 0.1484 -0.0004 -0.0360 -0.0034 48  ARG A CB  
411  C  CG  . ARG A 49  ? 0.1728 0.1909 0.1456 -0.0162 -0.0425 -0.0079 48  ARG A CG  
412  C  CD  . ARG A 49  ? 0.2113 0.1718 0.1541 -0.0149 -0.0140 0.0056  48  ARG A CD  
413  N  NE  . ARG A 49  ? 0.2530 0.1916 0.1498 0.0018  -0.0411 -0.0178 48  ARG A NE  
414  C  CZ  . ARG A 49  ? 0.2429 0.2075 0.1684 -0.0085 -0.0315 -0.0050 48  ARG A CZ  
415  N  NH1 . ARG A 49  ? 0.2634 0.2043 0.2053 -0.0110 -0.0221 -0.0125 48  ARG A NH1 
416  N  NH2 . ARG A 49  ? 0.2515 0.2251 0.1904 -0.0066 -0.0407 -0.0280 48  ARG A NH2 
417  N  N   . THR A 50  ? 0.2069 0.2426 0.1675 -0.0131 -0.0493 -0.0020 49  THR A N   
418  C  CA  . THR A 50  ? 0.2058 0.2502 0.1706 -0.0090 -0.0576 0.0044  49  THR A CA  
419  C  C   . THR A 50  ? 0.2211 0.2466 0.1645 -0.0181 -0.0558 0.0013  49  THR A C   
420  O  O   . THR A 50  ? 0.2256 0.2473 0.1582 -0.0214 -0.0659 0.0060  49  THR A O   
421  C  CB  . THR A 50  ? 0.2125 0.2586 0.1957 0.0036  -0.0489 0.0027  49  THR A CB  
422  O  OG1 . THR A 50  ? 0.2603 0.2631 0.1830 0.0014  -0.0422 0.0139  49  THR A OG1 
423  C  CG2 . THR A 50  ? 0.2064 0.2888 0.1964 0.0060  -0.0642 -0.0199 49  THR A CG2 
424  N  N   . ASP A 51  ? 0.2108 0.2384 0.1427 -0.0078 -0.0505 -0.0019 50  ASP A N   
425  C  CA  . ASP A 51  ? 0.2313 0.2511 0.1359 -0.0102 -0.0399 -0.0071 50  ASP A CA  
426  C  C   . ASP A 51  ? 0.2419 0.2438 0.1530 -0.0053 -0.0229 -0.0128 50  ASP A C   
427  O  O   . ASP A 51  ? 0.2841 0.2902 0.1417 -0.0113 -0.0280 -0.0195 50  ASP A O   
428  C  CB  . ASP A 51  ? 0.2338 0.2518 0.1458 -0.0088 -0.0383 0.0015  50  ASP A CB  
429  C  CG  . ASP A 51  ? 0.2484 0.2374 0.1533 -0.0045 -0.0409 -0.0080 50  ASP A CG  
430  O  OD1 . ASP A 51  ? 0.2544 0.2349 0.1828 -0.0456 -0.0527 0.0154  50  ASP A OD1 
431  O  OD2 . ASP A 51  ? 0.2502 0.2627 0.1396 -0.0088 -0.0497 -0.0011 50  ASP A OD2 
432  N  N   . GLU A 52  ? 0.2533 0.2516 0.1295 -0.0047 -0.0445 -0.0070 51  GLU A N   
433  C  CA  . GLU A 52  ? 0.2629 0.2415 0.1421 -0.0097 -0.0251 -0.0209 51  GLU A CA  
434  C  C   . GLU A 52  ? 0.2773 0.2515 0.1604 -0.0092 -0.0176 -0.0205 51  GLU A C   
435  O  O   . GLU A 52  ? 0.2633 0.2510 0.1374 -0.0121 -0.0273 -0.0219 51  GLU A O   
436  C  CB  . GLU A 52  ? 0.2830 0.2369 0.1402 -0.0110 -0.0312 -0.0276 51  GLU A CB  
437  C  CG  . GLU A 52  ? 0.2783 0.2534 0.1749 0.0023  -0.0285 0.0051  51  GLU A CG  
438  C  CD  . GLU A 52  ? 0.2756 0.2275 0.1602 -0.0055 -0.0283 0.0132  51  GLU A CD  
439  O  OE1 . GLU A 52  ? 0.2679 0.2183 0.1290 -0.0107 -0.0458 0.0103  51  GLU A OE1 
440  O  OE2 . GLU A 52  ? 0.3164 0.2557 0.2490 0.0104  0.0035  0.0204  51  GLU A OE2 
441  N  N   . ASP A 53  ? 0.2931 0.2705 0.1591 -0.0031 -0.0136 -0.0219 52  ASP A N   
442  C  CA  . ASP A 53  ? 0.3055 0.2791 0.1752 0.0016  -0.0057 -0.0161 52  ASP A CA  
443  C  C   . ASP A 53  ? 0.2956 0.2597 0.1666 -0.0021 -0.0059 -0.0128 52  ASP A C   
444  O  O   . ASP A 53  ? 0.3173 0.2564 0.1813 0.0038  -0.0080 -0.0293 52  ASP A O   
445  C  CB  . ASP A 53  ? 0.3237 0.3097 0.2127 0.0026  0.0044  -0.0123 52  ASP A CB  
446  C  CG  . ASP A 53  ? 0.3656 0.3422 0.3220 0.0036  -0.0032 -0.0117 52  ASP A CG  
447  O  OD1 . ASP A 53  ? 0.4299 0.3930 0.4318 -0.0140 0.0018  -0.0056 52  ASP A OD1 
448  O  OD2 . ASP A 53  ? 0.3869 0.4144 0.4048 -0.0006 0.0080  -0.0042 52  ASP A OD2 
449  N  N   . SER A 54  ? 0.2711 0.2297 0.1415 -0.0043 0.0032  -0.0061 53  SER A N   
450  C  CA  . SER A 54  ? 0.2274 0.2148 0.1378 -0.0018 0.0094  0.0015  53  SER A CA  
451  C  C   . SER A 54  ? 0.2003 0.1774 0.1189 -0.0024 -0.0032 -0.0012 53  SER A C   
452  O  O   . SER A 54  ? 0.1889 0.1773 0.0984 -0.0069 -0.0149 0.0043  53  SER A O   
453  C  CB  . SER A 54  ? 0.2555 0.2522 0.1772 -0.0031 0.0276  0.0116  53  SER A CB  
454  O  OG  . SER A 54  ? 0.3014 0.3500 0.2672 0.0232  0.0494  0.0152  53  SER A OG  
455  N  N   . TYR A 55  ? 0.1541 0.1578 0.0952 -0.0150 -0.0008 -0.0065 54  TYR A N   
456  C  CA  . TYR A 55  ? 0.1257 0.1182 0.0925 -0.0093 -0.0140 -0.0015 54  TYR A CA  
457  C  C   . TYR A 55  ? 0.1189 0.1194 0.0857 -0.0029 -0.0078 0.0034  54  TYR A C   
458  O  O   . TYR A 55  ? 0.1524 0.1179 0.0876 0.0127  -0.0104 0.0028  54  TYR A O   
459  C  CB  . TYR A 55  ? 0.1517 0.1260 0.1098 -0.0149 -0.0194 -0.0007 54  TYR A CB  
460  C  CG  . TYR A 55  ? 0.1663 0.1338 0.1009 -0.0169 -0.0232 -0.0062 54  TYR A CG  
461  C  CD1 . TYR A 55  ? 0.1644 0.1691 0.1171 -0.0172 -0.0188 -0.0108 54  TYR A CD1 
462  C  CD2 . TYR A 55  ? 0.1385 0.1449 0.1210 -0.0248 -0.0283 -0.0065 54  TYR A CD2 
463  C  CE1 . TYR A 55  ? 0.2157 0.1719 0.1470 -0.0152 -0.0279 -0.0134 54  TYR A CE1 
464  C  CE2 . TYR A 55  ? 0.1965 0.1712 0.1280 -0.0394 -0.0341 -0.0087 54  TYR A CE2 
465  C  CZ  . TYR A 55  ? 0.1926 0.1573 0.1683 -0.0481 -0.0286 -0.0224 54  TYR A CZ  
466  O  OH  . TYR A 55  ? 0.2341 0.1478 0.1941 -0.0415 -0.0405 -0.0106 54  TYR A OH  
467  N  N   . ILE A 56  ? 0.1134 0.1169 0.0819 -0.0046 -0.0097 0.0060  55  ILE A N   
468  C  CA  . ILE A 56  ? 0.0943 0.1046 0.0912 -0.0140 -0.0054 0.0039  55  ILE A CA  
469  C  C   . ILE A 56  ? 0.0768 0.0997 0.0887 -0.0051 -0.0017 0.0000  55  ILE A C   
470  O  O   . ILE A 56  ? 0.0824 0.1064 0.1108 0.0037  -0.0037 -0.0100 55  ILE A O   
471  C  CB  . ILE A 56  ? 0.0822 0.1090 0.1044 -0.0087 -0.0175 0.0084  55  ILE A CB  
472  C  CG1 . ILE A 56  ? 0.0985 0.1160 0.0908 -0.0141 -0.0220 -0.0062 55  ILE A CG1 
473  C  CG2 . ILE A 56  ? 0.0936 0.1101 0.1441 -0.0130 -0.0005 -0.0010 55  ILE A CG2 
474  C  CD1 . ILE A 56  ? 0.1376 0.1289 0.1007 -0.0140 -0.0180 -0.0206 55  ILE A CD1 
475  N  N   . VAL A 57  ? 0.0877 0.0925 0.0861 -0.0150 0.0026  -0.0042 56  VAL A N   
476  C  CA  . VAL A 57  ? 0.0994 0.1015 0.1004 -0.0155 0.0071  -0.0042 56  VAL A CA  
477  C  C   . VAL A 57  ? 0.0807 0.0816 0.0886 -0.0112 -0.0028 0.0068  56  VAL A C   
478  O  O   . VAL A 57  ? 0.0800 0.0936 0.1087 -0.0103 0.0073  0.0091  56  VAL A O   
479  C  CB  . VAL A 57  ? 0.1151 0.1011 0.0954 -0.0189 0.0120  -0.0065 56  VAL A CB  
480  C  CG1 . VAL A 57  ? 0.1208 0.1211 0.1272 -0.0414 -0.0015 -0.0080 56  VAL A CG1 
481  C  CG2 . VAL A 57  ? 0.1662 0.1302 0.1116 -0.0068 0.0121  -0.0183 56  VAL A CG2 
482  N  N   . PHE A 58  ? 0.0909 0.0866 0.0971 -0.0198 0.0070  -0.0045 57  PHE A N   
483  C  CA  . PHE A 58  ? 0.0920 0.0910 0.0866 -0.0050 0.0025  0.0059  57  PHE A CA  
484  C  C   . PHE A 58  ? 0.0971 0.0969 0.0891 -0.0176 -0.0076 -0.0015 57  PHE A C   
485  O  O   . PHE A 58  ? 0.0906 0.1103 0.1146 -0.0200 -0.0074 0.0034  57  PHE A O   
486  C  CB  . PHE A 58  ? 0.0905 0.1080 0.1077 0.0027  0.0063  -0.0100 57  PHE A CB  
487  C  CG  . PHE A 58  ? 0.0939 0.1100 0.0911 0.0006  0.0053  -0.0118 57  PHE A CG  
488  C  CD1 . PHE A 58  ? 0.0989 0.1324 0.0958 -0.0043 0.0052  -0.0154 57  PHE A CD1 
489  C  CD2 . PHE A 58  ? 0.0931 0.1135 0.1174 -0.0020 -0.0049 -0.0116 57  PHE A CD2 
490  C  CE1 . PHE A 58  ? 0.1389 0.1240 0.1196 -0.0147 -0.0059 -0.0263 57  PHE A CE1 
491  C  CE2 . PHE A 58  ? 0.0946 0.1109 0.1138 -0.0119 -0.0047 -0.0146 57  PHE A CE2 
492  C  CZ  . PHE A 58  ? 0.0905 0.1305 0.1011 -0.0069 0.0040  -0.0164 57  PHE A CZ  
493  N  N   . THR A 59  ? 0.1036 0.0909 0.0938 -0.0166 -0.0007 0.0016  58  THR A N   
494  C  CA  . THR A 59  ? 0.1005 0.0939 0.0956 -0.0059 0.0065  0.0007  58  THR A CA  
495  C  C   . THR A 59  ? 0.0841 0.0919 0.1000 -0.0115 -0.0078 -0.0020 58  THR A C   
496  O  O   . THR A 59  ? 0.0866 0.1126 0.1291 -0.0151 -0.0133 0.0006  58  THR A O   
497  C  CB  . THR A 59  ? 0.1086 0.1038 0.0999 -0.0075 0.0053  0.0001  58  THR A CB  
498  O  OG1 . THR A 59  ? 0.1085 0.0999 0.1042 -0.0057 0.0075  0.0102  58  THR A OG1 
499  C  CG2 . THR A 59  ? 0.1201 0.0924 0.1245 -0.0063 0.0134  0.0060  58  THR A CG2 
500  N  N   . TYR A 60  ? 0.0967 0.0954 0.1045 -0.0154 0.0068  -0.0014 59  TYR A N   
501  C  CA  . TYR A 60  ? 0.1054 0.1035 0.1144 -0.0217 0.0118  0.0008  59  TYR A CA  
502  C  C   . TYR A 60  ? 0.1297 0.1238 0.1283 -0.0157 0.0009  0.0000  59  TYR A C   
503  O  O   . TYR A 60  ? 0.1580 0.1201 0.1376 -0.0080 -0.0016 -0.0107 59  TYR A O   
504  C  CB  . TYR A 60  ? 0.1155 0.1046 0.1275 -0.0420 0.0223  0.0084  59  TYR A CB  
505  C  CG  . TYR A 60  ? 0.1443 0.1353 0.1263 -0.0224 0.0196  0.0109  59  TYR A CG  
506  C  CD1 . TYR A 60  ? 0.1982 0.1677 0.1332 -0.0241 0.0211  0.0049  59  TYR A CD1 
507  C  CD2 . TYR A 60  ? 0.1815 0.1208 0.1287 -0.0313 0.0159  0.0271  59  TYR A CD2 
508  C  CE1 . TYR A 60  ? 0.2548 0.1859 0.1532 0.0066  0.0210  0.0228  59  TYR A CE1 
509  C  CE2 . TYR A 60  ? 0.2022 0.1513 0.1648 -0.0250 0.0098  0.0263  59  TYR A CE2 
510  C  CZ  . TYR A 60  ? 0.2303 0.1740 0.1510 -0.0150 0.0284  0.0384  59  TYR A CZ  
511  O  OH  . TYR A 60  ? 0.3276 0.2256 0.1764 -0.0081 0.0178  0.0447  59  TYR A OH  
512  N  N   . ARG A 61  ? 0.1356 0.1393 0.1521 -0.0070 -0.0030 0.0121  60  ARG A N   
513  C  CA  A ARG A 61  ? 0.1694 0.1806 0.1881 0.0039  -0.0045 0.0041  60  ARG A CA  
514  C  CA  B ARG A 61  ? 0.1659 0.1760 0.1819 0.0031  -0.0047 0.0033  60  ARG A CA  
515  C  C   . ARG A 61  ? 0.1766 0.1774 0.1964 0.0168  -0.0125 0.0070  60  ARG A C   
516  O  O   . ARG A 61  ? 0.1915 0.1857 0.2120 0.0242  -0.0330 0.0124  60  ARG A O   
517  C  CB  A ARG A 61  ? 0.1670 0.1868 0.1909 0.0030  -0.0062 0.0037  60  ARG A CB  
518  C  CB  B ARG A 61  ? 0.1636 0.1831 0.1850 0.0024  -0.0068 0.0030  60  ARG A CB  
519  C  CG  A ARG A 61  ? 0.2002 0.2137 0.2001 0.0009  -0.0013 0.0013  60  ARG A CG  
520  C  CG  B ARG A 61  ? 0.1862 0.2027 0.1881 0.0009  -0.0069 0.0019  60  ARG A CG  
521  C  CD  A ARG A 61  ? 0.2073 0.2383 0.2294 -0.0030 0.0059  0.0010  60  ARG A CD  
522  C  CD  B ARG A 61  ? 0.1983 0.2178 0.2027 -0.0068 0.0041  -0.0060 60  ARG A CD  
523  N  NE  A ARG A 61  ? 0.2807 0.2859 0.2837 -0.0034 -0.0039 -0.0136 60  ARG A NE  
524  N  NE  B ARG A 61  ? 0.2085 0.2093 0.2327 -0.0044 0.0144  -0.0008 60  ARG A NE  
525  C  CZ  A ARG A 61  ? 0.3176 0.3273 0.3221 -0.0065 0.0042  -0.0007 60  ARG A CZ  
526  C  CZ  B ARG A 61  ? 0.2750 0.2936 0.2720 -0.0074 0.0156  0.0076  60  ARG A CZ  
527  N  NH1 A ARG A 61  ? 0.3304 0.3451 0.3623 -0.0077 -0.0076 0.0101  60  ARG A NH1 
528  N  NH1 B ARG A 61  ? 0.2994 0.3076 0.2853 -0.0051 -0.0015 0.0061  60  ARG A NH1 
529  N  NH2 A ARG A 61  ? 0.3391 0.3484 0.3605 -0.0047 0.0007  -0.0118 60  ARG A NH2 
530  N  NH2 B ARG A 61  ? 0.2983 0.3210 0.3145 -0.0012 -0.0002 0.0010  60  ARG A NH2 
531  N  N   . PRO A 62  ? 0.1840 0.1801 0.2156 0.0184  -0.0195 0.0006  61  PRO A N   
532  C  CA  . PRO A 62  ? 0.1814 0.1749 0.2221 0.0183  -0.0241 -0.0014 61  PRO A CA  
533  C  C   . PRO A 62  ? 0.2021 0.1842 0.2211 0.0165  -0.0152 0.0017  61  PRO A C   
534  O  O   . PRO A 62  ? 0.2077 0.1855 0.2090 0.0092  -0.0227 0.0052  61  PRO A O   
535  C  CB  . PRO A 62  ? 0.2015 0.1853 0.2437 0.0213  -0.0223 -0.0056 61  PRO A CB  
536  C  CG  . PRO A 62  ? 0.1937 0.1884 0.2451 0.0074  -0.0387 0.0006  61  PRO A CG  
537  C  CD  . PRO A 62  ? 0.1944 0.1904 0.2096 0.0205  -0.0185 -0.0067 61  PRO A CD  
538  N  N   . CYS A 63  ? 0.1992 0.1923 0.2096 0.0178  -0.0158 0.0010  62  CYS A N   
539  C  CA  . CYS A 63  ? 0.1961 0.2053 0.2160 0.0140  -0.0062 -0.0046 62  CYS A CA  
540  C  C   . CYS A 63  ? 0.2021 0.2151 0.2353 0.0093  -0.0079 0.0022  62  CYS A C   
541  O  O   . CYS A 63  ? 0.2215 0.2234 0.2590 0.0122  -0.0088 0.0100  62  CYS A O   
542  C  CB  . CYS A 63  ? 0.2056 0.2298 0.2174 0.0093  -0.0041 -0.0078 62  CYS A CB  
543  S  SG  . CYS A 63  ? 0.2419 0.2574 0.2402 0.0006  0.0144  -0.0279 62  CYS A SG  
544  N  N   . GLY A 64  ? 0.2054 0.2362 0.2473 0.0011  0.0014  0.0064  63  GLY A N   
545  C  CA  . GLY A 64  ? 0.2180 0.2592 0.2499 0.0009  0.0027  0.0153  63  GLY A CA  
546  C  C   . GLY A 64  ? 0.2272 0.2661 0.2388 -0.0059 -0.0045 0.0132  63  GLY A C   
547  O  O   . GLY A 64  ? 0.2498 0.3062 0.2413 -0.0139 -0.0037 0.0085  63  GLY A O   
548  N  N   . CYS A 65  ? 0.2087 0.2339 0.2178 -0.0031 0.0042  0.0073  64  CYS A N   
549  C  CA  . CYS A 65  ? 0.2004 0.2084 0.1978 0.0008  0.0017  0.0035  64  CYS A CA  
550  C  C   . CYS A 65  ? 0.1941 0.1858 0.1958 0.0030  -0.0005 0.0030  64  CYS A C   
551  O  O   . CYS A 65  ? 0.1986 0.1851 0.2055 0.0066  0.0049  0.0033  64  CYS A O   
552  C  CB  . CYS A 65  ? 0.2011 0.2102 0.2074 -0.0041 0.0025  0.0000  64  CYS A CB  
553  S  SG  . CYS A 65  ? 0.1843 0.2063 0.1974 0.0083  0.0046  -0.0061 64  CYS A SG  
554  N  N   . CYS A 66  ? 0.1754 0.1609 0.1849 0.0010  0.0038  0.0018  65  CYS A N   
555  C  CA  . CYS A 66  ? 0.1677 0.1690 0.1786 0.0062  -0.0013 0.0013  65  CYS A CA  
556  C  C   . CYS A 66  ? 0.1734 0.1634 0.1626 0.0001  0.0006  -0.0053 65  CYS A C   
557  O  O   . CYS A 66  ? 0.1888 0.1737 0.1617 0.0035  -0.0132 -0.0143 65  CYS A O   
558  C  CB  . CYS A 66  ? 0.1573 0.1608 0.1678 0.0139  0.0022  -0.0046 65  CYS A CB  
559  S  SG  . CYS A 66  ? 0.1660 0.2012 0.2011 0.0151  0.0096  0.0122  65  CYS A SG  
560  N  N   . SER A 67  ? 0.1789 0.1910 0.1962 -0.0045 0.0002  0.0130  66  SER A N   
561  C  CA  . SER A 67  ? 0.1821 0.1952 0.1639 -0.0179 0.0017  0.0030  66  SER A CA  
562  C  C   . SER A 67  ? 0.1715 0.1881 0.1756 -0.0262 0.0000  0.0100  66  SER A C   
563  O  O   . SER A 67  ? 0.1819 0.2229 0.1863 -0.0390 -0.0123 0.0099  66  SER A O   
564  C  CB  . SER A 67  ? 0.1881 0.1985 0.1680 -0.0172 0.0140  0.0065  66  SER A CB  
565  O  OG  . SER A 67  ? 0.2060 0.2091 0.1865 -0.0273 0.0294  0.0006  66  SER A OG  
566  N  N   . TYR A 68  ? 0.1542 0.1509 0.1666 -0.0263 0.0148  -0.0036 67  TYR A N   
567  C  CA  . TYR A 68  ? 0.1499 0.1323 0.1515 -0.0147 0.0142  -0.0092 67  TYR A CA  
568  C  C   . TYR A 68  ? 0.1117 0.1239 0.1495 -0.0142 0.0118  -0.0133 67  TYR A C   
569  O  O   . TYR A 68  ? 0.1023 0.1428 0.1723 -0.0052 0.0265  -0.0035 67  TYR A O   
570  C  CB  . TYR A 68  ? 0.1583 0.1457 0.1692 -0.0236 -0.0002 -0.0282 67  TYR A CB  
571  C  CG  . TYR A 68  ? 0.1612 0.1668 0.1728 -0.0083 -0.0015 -0.0345 67  TYR A CG  
572  C  CD1 . TYR A 68  ? 0.1637 0.1799 0.1865 -0.0153 0.0194  -0.0202 67  TYR A CD1 
573  C  CD2 . TYR A 68  ? 0.1684 0.1817 0.1683 -0.0165 -0.0055 -0.0295 67  TYR A CD2 
574  C  CE1 . TYR A 68  ? 0.1841 0.1893 0.1828 -0.0064 0.0248  -0.0253 67  TYR A CE1 
575  C  CE2 . TYR A 68  ? 0.1719 0.1846 0.1680 -0.0088 -0.0015 -0.0361 67  TYR A CE2 
576  C  CZ  . TYR A 68  ? 0.1728 0.1977 0.1824 -0.0097 0.0171  -0.0243 67  TYR A CZ  
577  O  OH  . TYR A 68  ? 0.2042 0.2631 0.1973 -0.0053 0.0309  -0.0357 67  TYR A OH  
578  N  N   . VAL A 69  ? 0.1153 0.1199 0.1443 -0.0189 0.0157  -0.0167 68  VAL A N   
579  C  CA  . VAL A 69  ? 0.1002 0.1138 0.1167 -0.0092 0.0095  -0.0066 68  VAL A CA  
580  C  C   . VAL A 69  ? 0.1296 0.1317 0.0989 -0.0038 0.0107  -0.0221 68  VAL A C   
581  O  O   . VAL A 69  ? 0.1199 0.1658 0.1069 0.0039  0.0250  -0.0404 68  VAL A O   
582  C  CB  . VAL A 69  ? 0.1095 0.1128 0.1192 -0.0009 -0.0004 -0.0153 68  VAL A CB  
583  C  CG1 . VAL A 69  ? 0.0945 0.0946 0.1260 -0.0003 0.0063  -0.0169 68  VAL A CG1 
584  C  CG2 . VAL A 69  ? 0.1165 0.1527 0.1414 0.0161  0.0108  -0.0061 68  VAL A CG2 
585  N  N   . GLY A 70  ? 0.1128 0.1270 0.0984 -0.0088 0.0106  -0.0065 69  GLY A N   
586  C  CA  . GLY A 70  ? 0.1121 0.1447 0.0914 -0.0192 -0.0005 -0.0130 69  GLY A CA  
587  C  C   . GLY A 70  ? 0.0979 0.1273 0.0947 -0.0166 0.0220  -0.0074 69  GLY A C   
588  O  O   . GLY A 70  ? 0.1358 0.1284 0.0891 -0.0342 0.0102  -0.0093 69  GLY A O   
589  N  N   . ARG A 71  ? 0.1075 0.1462 0.0889 -0.0138 0.0099  -0.0180 70  ARG A N   
590  C  CA  . ARG A 71  ? 0.1245 0.1545 0.1106 -0.0083 -0.0024 -0.0233 70  ARG A CA  
591  C  C   . ARG A 71  ? 0.1392 0.1739 0.1212 -0.0089 -0.0007 -0.0239 70  ARG A C   
592  O  O   . ARG A 71  ? 0.1591 0.1829 0.1316 0.0040  0.0185  -0.0221 70  ARG A O   
593  C  CB  . ARG A 71  ? 0.1383 0.1584 0.1142 -0.0114 -0.0027 -0.0159 70  ARG A CB  
594  C  CG  . ARG A 71  ? 0.1699 0.1846 0.1219 -0.0035 -0.0302 -0.0110 70  ARG A CG  
595  C  CD  . ARG A 71  ? 0.2014 0.2093 0.1567 -0.0136 -0.0325 0.0022  70  ARG A CD  
596  N  NE  . ARG A 71  ? 0.2687 0.2595 0.2020 -0.0157 -0.0248 -0.0068 70  ARG A NE  
597  C  CZ  . ARG A 71  ? 0.2733 0.2874 0.1952 -0.0181 -0.0320 -0.0170 70  ARG A CZ  
598  N  NH1 . ARG A 71  ? 0.2853 0.2912 0.1742 -0.0204 -0.0110 -0.0092 70  ARG A NH1 
599  N  NH2 . ARG A 71  ? 0.2888 0.3280 0.2309 -0.0356 -0.0415 -0.0223 70  ARG A NH2 
600  N  N   . ARG A 72  ? 0.1772 0.1740 0.1518 -0.0044 -0.0023 -0.0282 71  ARG A N   
601  C  CA  . ARG A 72  ? 0.2253 0.1973 0.1814 -0.0086 -0.0040 -0.0315 71  ARG A CA  
602  C  C   . ARG A 72  ? 0.2430 0.2000 0.1880 -0.0138 0.0125  -0.0398 71  ARG A C   
603  O  O   . ARG A 72  ? 0.2563 0.2419 0.1800 -0.0185 0.0182  -0.0455 71  ARG A O   
604  C  CB  . ARG A 72  ? 0.2384 0.1937 0.2081 -0.0019 0.0011  -0.0305 71  ARG A CB  
605  C  CG  . ARG A 72  ? 0.2901 0.2278 0.2581 -0.0007 0.0018  -0.0377 71  ARG A CG  
606  C  CD  . ARG A 72  ? 0.3326 0.3008 0.3121 -0.0037 -0.0100 -0.0074 71  ARG A CD  
607  N  NE  . ARG A 72  ? 0.3256 0.3270 0.3259 -0.0088 0.0164  -0.0047 71  ARG A NE  
608  C  CZ  . ARG A 72  ? 0.3741 0.3692 0.3496 -0.0025 0.0038  0.0053  71  ARG A CZ  
609  N  NH1 . ARG A 72  ? 0.3966 0.4117 0.4012 0.0125  -0.0013 0.0132  71  ARG A NH1 
610  N  NH2 . ARG A 72  ? 0.3674 0.3883 0.3721 0.0097  0.0108  0.0001  71  ARG A NH2 
611  N  N   . GLY A 73  ? 0.2687 0.2065 0.1746 -0.0202 -0.0023 -0.0429 72  GLY A N   
612  C  CA  . GLY A 73  ? 0.2731 0.2396 0.1858 -0.0256 -0.0039 -0.0405 72  GLY A CA  
613  C  C   . GLY A 73  ? 0.2785 0.2426 0.2100 -0.0253 -0.0035 -0.0304 72  GLY A C   
614  O  O   . GLY A 73  ? 0.2970 0.2737 0.2333 -0.0121 -0.0005 -0.0476 72  GLY A O   
615  N  N   . GLY A 74  A 0.2915 0.2672 0.2089 -0.0264 0.0005  -0.0279 72  GLY A N   
616  C  CA  . GLY A 74  A 0.2946 0.2643 0.2243 -0.0287 0.0158  -0.0333 72  GLY A CA  
617  C  C   . GLY A 74  A 0.2861 0.2492 0.2123 -0.0310 0.0183  -0.0347 72  GLY A C   
618  O  O   . GLY A 74  A 0.3016 0.2628 0.2347 -0.0308 0.0275  -0.0432 72  GLY A O   
619  N  N   . GLY A 75  ? 0.2593 0.2271 0.1741 -0.0292 0.0198  -0.0331 73  GLY A N   
620  C  CA  . GLY A 75  ? 0.2521 0.2009 0.1540 -0.0255 0.0151  -0.0344 73  GLY A CA  
621  C  C   . GLY A 75  ? 0.2248 0.1818 0.1499 -0.0223 0.0146  -0.0342 73  GLY A C   
622  O  O   . GLY A 75  ? 0.2407 0.1733 0.1526 -0.0463 0.0003  -0.0202 73  GLY A O   
623  N  N   . PRO A 76  ? 0.2103 0.1658 0.1527 -0.0159 0.0133  -0.0325 74  PRO A N   
624  C  CA  . PRO A 76  ? 0.1967 0.1699 0.1449 -0.0023 0.0113  -0.0326 74  PRO A CA  
625  C  C   . PRO A 76  ? 0.1586 0.1474 0.1469 0.0038  0.0204  -0.0210 74  PRO A C   
626  O  O   . PRO A 76  ? 0.1936 0.1485 0.1657 0.0133  0.0217  -0.0452 74  PRO A O   
627  C  CB  . PRO A 76  ? 0.2100 0.1877 0.1655 0.0008  0.0151  -0.0331 74  PRO A CB  
628  C  CG  . PRO A 76  ? 0.2135 0.1864 0.1600 -0.0230 0.0355  -0.0301 74  PRO A CG  
629  C  CD  . PRO A 76  ? 0.2122 0.1895 0.1526 -0.0322 0.0091  -0.0265 74  PRO A CD  
630  N  N   . GLN A 77  ? 0.1305 0.1251 0.1202 -0.0046 0.0092  -0.0129 75  GLN A N   
631  C  CA  . GLN A 77  ? 0.1133 0.1319 0.1177 -0.0045 0.0136  0.0081  75  GLN A CA  
632  C  C   . GLN A 77  ? 0.1034 0.1191 0.1122 0.0000  0.0088  -0.0029 75  GLN A C   
633  O  O   . GLN A 77  ? 0.1183 0.1343 0.1462 0.0179  0.0314  0.0206  75  GLN A O   
634  C  CB  . GLN A 77  ? 0.1376 0.1523 0.1519 -0.0039 0.0198  0.0068  75  GLN A CB  
635  C  CG  . GLN A 77  ? 0.1494 0.1361 0.1253 -0.0119 0.0100  -0.0073 75  GLN A CG  
636  C  CD  . GLN A 77  ? 0.1589 0.1458 0.1611 -0.0061 0.0069  -0.0101 75  GLN A CD  
637  O  OE1 . GLN A 77  ? 0.1601 0.1585 0.1673 -0.0416 -0.0008 0.0016  75  GLN A OE1 
638  N  NE2 . GLN A 77  ? 0.1553 0.1347 0.1908 -0.0120 0.0162  -0.0088 75  GLN A NE2 
639  N  N   . ALA A 78  ? 0.0992 0.1265 0.1133 0.0005  0.0065  0.0018  76  ALA A N   
640  C  CA  . ALA A 78  ? 0.1020 0.1302 0.1016 -0.0067 -0.0027 -0.0022 76  ALA A CA  
641  C  C   . ALA A 78  ? 0.0850 0.1326 0.1222 -0.0091 -0.0029 -0.0020 76  ALA A C   
642  O  O   . ALA A 78  ? 0.0905 0.1779 0.1400 -0.0060 -0.0050 -0.0057 76  ALA A O   
643  C  CB  . ALA A 78  ? 0.1180 0.1409 0.1325 -0.0004 0.0115  0.0183  76  ALA A CB  
644  N  N   . ILE A 79  ? 0.1159 0.1424 0.1116 -0.0059 0.0080  -0.0050 77  ILE A N   
645  C  CA  . ILE A 79  ? 0.1230 0.1321 0.1223 -0.0104 0.0037  -0.0044 77  ILE A CA  
646  C  C   . ILE A 79  ? 0.0996 0.1415 0.1138 -0.0163 0.0017  -0.0072 77  ILE A C   
647  O  O   . ILE A 79  ? 0.0957 0.1575 0.1203 -0.0390 0.0018  0.0012  77  ILE A O   
648  C  CB  . ILE A 79  ? 0.1544 0.1308 0.1403 -0.0094 0.0100  -0.0003 77  ILE A CB  
649  C  CG1 . ILE A 79  ? 0.1528 0.1326 0.1863 -0.0035 0.0387  0.0144  77  ILE A CG1 
650  C  CG2 . ILE A 79  ? 0.1673 0.1593 0.1817 -0.0334 -0.0018 -0.0270 77  ILE A CG2 
651  C  CD1 . ILE A 79  ? 0.2029 0.1460 0.2776 0.0143  0.0318  0.0261  77  ILE A CD1 
652  N  N   . SER A 80  ? 0.1083 0.1373 0.1305 -0.0162 0.0013  0.0006  78  SER A N   
653  C  CA  . SER A 80  ? 0.1312 0.1563 0.1391 -0.0165 -0.0018 0.0033  78  SER A CA  
654  C  C   . SER A 80  ? 0.1312 0.1717 0.1453 -0.0171 0.0065  -0.0038 78  SER A C   
655  O  O   . SER A 80  ? 0.1693 0.2208 0.1663 -0.0431 0.0215  -0.0345 78  SER A O   
656  C  CB  . SER A 80  ? 0.1530 0.1569 0.1653 -0.0063 -0.0029 0.0076  78  SER A CB  
657  O  OG  . SER A 80  ? 0.1968 0.1829 0.2265 0.0083  0.0392  0.0039  78  SER A OG  
658  N  N   . ILE A 81  ? 0.1216 0.1590 0.1246 -0.0067 0.0130  0.0002  79  ILE A N   
659  C  CA  A ILE A 81  ? 0.1314 0.1575 0.1295 -0.0068 0.0103  0.0063  79  ILE A CA  
660  C  CA  B ILE A 81  ? 0.1438 0.1626 0.1273 -0.0029 0.0168  0.0127  79  ILE A CA  
661  C  C   . ILE A 81  ? 0.1266 0.1520 0.1428 -0.0047 0.0065  0.0145  79  ILE A C   
662  O  O   . ILE A 81  ? 0.1506 0.1477 0.1410 -0.0170 0.0115  -0.0035 79  ILE A O   
663  C  CB  A ILE A 81  ? 0.1282 0.1582 0.1326 -0.0003 0.0163  0.0055  79  ILE A CB  
664  C  CB  B ILE A 81  ? 0.1486 0.1673 0.1326 0.0106  0.0259  0.0050  79  ILE A CB  
665  C  CG1 A ILE A 81  ? 0.1434 0.1589 0.1143 -0.0133 0.0028  0.0015  79  ILE A CG1 
666  C  CG1 B ILE A 81  ? 0.2241 0.1863 0.1444 0.0009  0.0266  0.0110  79  ILE A CG1 
667  C  CG2 A ILE A 81  ? 0.1480 0.1705 0.1302 0.0036  0.0191  -0.0013 79  ILE A CG2 
668  C  CG2 B ILE A 81  ? 0.1725 0.1881 0.1305 0.0168  0.0399  0.0028  79  ILE A CG2 
669  C  CD1 A ILE A 81  ? 0.1630 0.1767 0.1483 0.0143  0.0086  0.0082  79  ILE A CD1 
670  C  CD1 B ILE A 81  ? 0.2655 0.2166 0.1885 -0.0192 0.0116  0.0063  79  ILE A CD1 
671  N  N   . GLY A 82  ? 0.2036 0.2120 0.1439 -0.0444 -0.0038 0.0367  81  GLY A N   
672  C  CA  . GLY A 82  ? 0.2483 0.2173 0.1591 -0.0424 0.0130  0.0420  81  GLY A CA  
673  C  C   . GLY A 82  ? 0.2612 0.2372 0.1810 -0.0302 0.0088  0.0310  81  GLY A C   
674  O  O   . GLY A 82  ? 0.2492 0.2257 0.1386 -0.0247 0.0012  0.0344  81  GLY A O   
675  N  N   . LYS A 83  ? 0.2868 0.2666 0.2016 -0.0306 0.0135  0.0435  82  LYS A N   
676  C  CA  . LYS A 83  ? 0.3179 0.2963 0.2365 -0.0201 0.0070  0.0340  82  LYS A CA  
677  C  C   . LYS A 83  ? 0.3195 0.2827 0.2108 -0.0182 0.0093  0.0411  82  LYS A C   
678  O  O   . LYS A 83  ? 0.3719 0.3122 0.2417 -0.0190 0.0128  0.0447  82  LYS A O   
679  C  CB  . LYS A 83  ? 0.3262 0.3153 0.2651 -0.0226 0.0097  0.0275  82  LYS A CB  
680  C  CG  . LYS A 83  ? 0.3624 0.3813 0.3593 -0.0044 0.0016  0.0139  82  LYS A CG  
681  C  CD  . LYS A 83  ? 0.4178 0.4364 0.3868 -0.0047 -0.0099 0.0049  82  LYS A CD  
682  C  CE  . LYS A 83  ? 0.4308 0.4499 0.4401 0.0038  -0.0038 0.0086  82  LYS A CE  
683  N  NZ  . LYS A 83  ? 0.4632 0.4813 0.4392 -0.0044 0.0019  0.0076  82  LYS A NZ  
684  N  N   . ASN A 84  ? 0.3134 0.2908 0.2085 -0.0201 -0.0051 0.0398  83  ASN A N   
685  C  CA  . ASN A 84  ? 0.3177 0.2999 0.2706 -0.0072 -0.0131 0.0206  83  ASN A CA  
686  C  C   . ASN A 84  ? 0.2743 0.2598 0.2312 0.0015  -0.0201 0.0165  83  ASN A C   
687  O  O   . ASN A 84  ? 0.2901 0.2288 0.2165 0.0123  -0.0394 0.0158  83  ASN A O   
688  C  CB  . ASN A 84  ? 0.3457 0.3269 0.3088 0.0018  -0.0048 0.0122  83  ASN A CB  
689  C  CG  . ASN A 84  ? 0.4061 0.3910 0.3615 0.0059  -0.0153 0.0065  83  ASN A CG  
690  O  OD1 . ASN A 84  ? 0.4904 0.4755 0.4423 0.0099  0.0010  -0.0182 83  ASN A OD1 
691  N  ND2 . ASN A 84  ? 0.4474 0.4264 0.4457 0.0214  -0.0071 0.0024  83  ASN A ND2 
692  N  N   . CYS A 85  ? 0.2244 0.1937 0.1900 0.0112  -0.0062 0.0181  84  CYS A N   
693  C  CA  . CYS A 85  ? 0.1964 0.2092 0.1780 0.0087  0.0038  0.0028  84  CYS A CA  
694  C  C   . CYS A 85  ? 0.1779 0.1900 0.1460 -0.0015 0.0041  0.0007  84  CYS A C   
695  O  O   . CYS A 85  ? 0.1667 0.2560 0.1570 0.0025  0.0237  0.0048  84  CYS A O   
696  C  CB  . CYS A 85  ? 0.2028 0.2104 0.1902 0.0075  -0.0013 -0.0069 84  CYS A CB  
697  S  SG  . CYS A 85  ? 0.1751 0.2192 0.2085 0.0328  -0.0046 -0.0280 84  CYS A SG  
698  N  N   . ASP A 86  ? 0.1752 0.1549 0.1256 0.0000  0.0110  0.0070  85  ASP A N   
699  C  CA  . ASP A 86  ? 0.1688 0.1561 0.1408 0.0046  0.0060  -0.0029 85  ASP A CA  
700  C  C   . ASP A 86  ? 0.1614 0.1310 0.1312 -0.0079 0.0130  0.0027  85  ASP A C   
701  O  O   . ASP A 86  ? 0.1660 0.1389 0.1555 0.0000  0.0121  0.0106  85  ASP A O   
702  C  CB  . ASP A 86  ? 0.1936 0.1762 0.1497 -0.0036 0.0061  0.0075  85  ASP A CB  
703  C  CG  . ASP A 86  ? 0.1986 0.1918 0.1882 0.0021  -0.0030 0.0041  85  ASP A CG  
704  O  OD1 . ASP A 86  ? 0.2083 0.2251 0.1634 -0.0322 0.0018  0.0129  85  ASP A OD1 
705  O  OD2 . ASP A 86  ? 0.2323 0.2664 0.2229 -0.0423 0.0121  0.0169  85  ASP A OD2 
706  N  N   . LYS A 87  ? 0.1440 0.1282 0.1143 -0.0144 0.0198  0.0092  86  LYS A N   
707  C  CA  . LYS A 87  ? 0.1591 0.1241 0.1144 -0.0079 0.0151  0.0070  86  LYS A CA  
708  C  C   . LYS A 87  ? 0.1235 0.1046 0.0902 -0.0066 0.0266  -0.0094 86  LYS A C   
709  O  O   . LYS A 87  ? 0.0950 0.1279 0.0857 -0.0004 0.0279  -0.0074 86  LYS A O   
710  C  CB  . LYS A 87  ? 0.1860 0.1631 0.1225 -0.0107 0.0100  0.0081  86  LYS A CB  
711  C  CG  . LYS A 87  ? 0.2470 0.2130 0.1607 -0.0049 0.0170  0.0098  86  LYS A CG  
712  C  CD  . LYS A 87  ? 0.2841 0.2793 0.2323 -0.0161 -0.0138 0.0017  86  LYS A CD  
713  C  CE  . LYS A 87  ? 0.3557 0.3542 0.2997 -0.0062 0.0105  0.0150  86  LYS A CE  
714  N  NZ  . LYS A 87  ? 0.4023 0.4058 0.3706 -0.0021 -0.0081 -0.0086 86  LYS A NZ  
715  N  N   . PHE A 88  ? 0.1234 0.0928 0.1129 0.0002  0.0183  -0.0075 87  PHE A N   
716  C  CA  . PHE A 88  ? 0.1011 0.1115 0.1062 -0.0028 0.0134  -0.0033 87  PHE A CA  
717  C  C   . PHE A 88  ? 0.0965 0.1077 0.0953 0.0057  0.0181  -0.0023 87  PHE A C   
718  O  O   . PHE A 88  ? 0.0981 0.1073 0.0841 -0.0063 0.0169  -0.0085 87  PHE A O   
719  C  CB  . PHE A 88  ? 0.1053 0.1237 0.1146 -0.0037 0.0275  -0.0052 87  PHE A CB  
720  C  CG  . PHE A 88  ? 0.0910 0.1163 0.0971 -0.0044 0.0218  -0.0093 87  PHE A CG  
721  C  CD1 . PHE A 88  ? 0.0798 0.1240 0.1317 0.0022  0.0135  -0.0219 87  PHE A CD1 
722  C  CD2 . PHE A 88  ? 0.0534 0.1515 0.1400 0.0118  0.0227  -0.0012 87  PHE A CD2 
723  C  CE1 . PHE A 88  ? 0.0946 0.1351 0.1085 0.0042  0.0228  -0.0163 87  PHE A CE1 
724  C  CE2 . PHE A 88  ? 0.1083 0.1325 0.1252 0.0048  0.0091  -0.0229 87  PHE A CE2 
725  C  CZ  . PHE A 88  ? 0.0920 0.1181 0.1155 0.0159  0.0152  -0.0152 87  PHE A CZ  
726  N  N   . GLY A 89  ? 0.0874 0.1178 0.0853 0.0061  0.0099  -0.0071 88  GLY A N   
727  C  CA  . GLY A 89  ? 0.0913 0.1096 0.0942 0.0083  0.0141  -0.0076 88  GLY A CA  
728  C  C   . GLY A 89  ? 0.0967 0.1116 0.0654 0.0006  0.0060  -0.0101 88  GLY A C   
729  O  O   . GLY A 89  ? 0.0948 0.1180 0.0675 -0.0035 0.0124  -0.0043 88  GLY A O   
730  N  N   . ILE A 90  ? 0.0998 0.0984 0.0797 -0.0011 0.0041  -0.0084 89  ILE A N   
731  C  CA  A ILE A 90  ? 0.0994 0.0948 0.0797 0.0008  0.0032  0.0015  89  ILE A CA  
732  C  CA  C ILE A 90  ? 0.1031 0.0929 0.0798 0.0056  0.0043  -0.0016 89  ILE A CA  
733  C  C   . ILE A 90  ? 0.0815 0.0892 0.0732 0.0006  0.0061  -0.0017 89  ILE A C   
734  O  O   . ILE A 90  ? 0.0709 0.0996 0.0736 0.0049  0.0156  0.0022  89  ILE A O   
735  C  CB  A ILE A 90  ? 0.0930 0.1066 0.0989 -0.0075 -0.0071 0.0171  89  ILE A CB  
736  C  CB  C ILE A 90  ? 0.1109 0.1069 0.1049 0.0053  0.0025  0.0069  89  ILE A CB  
737  C  CG1 A ILE A 90  ? 0.1172 0.1338 0.1080 -0.0005 -0.0069 0.0301  89  ILE A CG1 
738  C  CG1 C ILE A 90  ? 0.1198 0.1286 0.1210 0.0086  -0.0016 0.0153  89  ILE A CG1 
739  C  CG2 A ILE A 90  ? 0.0921 0.1174 0.1257 -0.0157 0.0112  0.0113  89  ILE A CG2 
740  C  CG2 C ILE A 90  ? 0.1200 0.0948 0.1124 0.0132  -0.0019 0.0032  89  ILE A CG2 
741  C  CD1 A ILE A 90  ? 0.1240 0.1550 0.1152 0.0039  -0.0222 0.0266  89  ILE A CD1 
742  C  CD1 C ILE A 90  ? 0.1695 0.1456 0.1752 -0.0051 0.0035  0.0148  89  ILE A CD1 
743  N  N   . VAL A 91  ? 0.0884 0.0920 0.0722 0.0017  -0.0026 0.0027  90  VAL A N   
744  C  CA  . VAL A 91  ? 0.0794 0.0981 0.0878 -0.0019 -0.0027 -0.0022 90  VAL A CA  
745  C  C   . VAL A 91  ? 0.0781 0.0793 0.0876 0.0101  0.0046  0.0030  90  VAL A C   
746  O  O   . VAL A 91  ? 0.0663 0.1042 0.0705 -0.0049 0.0173  -0.0014 90  VAL A O   
747  C  CB  . VAL A 91  ? 0.0711 0.1124 0.0958 0.0006  -0.0111 0.0013  90  VAL A CB  
748  C  CG1 . VAL A 91  ? 0.0949 0.1205 0.0939 0.0063  -0.0153 -0.0054 90  VAL A CG1 
749  C  CG2 . VAL A 91  ? 0.1227 0.1370 0.1169 -0.0279 0.0108  0.0095  90  VAL A CG2 
750  N  N   . VAL A 92  ? 0.0784 0.0762 0.0865 0.0054  0.0116  -0.0032 91  VAL A N   
751  C  CA  . VAL A 92  ? 0.0913 0.0813 0.0847 0.0091  0.0165  -0.0047 91  VAL A CA  
752  C  C   . VAL A 92  ? 0.0783 0.0726 0.0603 0.0104  0.0081  -0.0110 91  VAL A C   
753  O  O   . VAL A 92  ? 0.0835 0.0772 0.0675 0.0053  0.0044  -0.0049 91  VAL A O   
754  C  CB  . VAL A 92  ? 0.0799 0.0725 0.0906 0.0149  0.0171  -0.0168 91  VAL A CB  
755  C  CG1 . VAL A 92  ? 0.0767 0.0985 0.0907 0.0009  -0.0005 0.0053  91  VAL A CG1 
756  C  CG2 . VAL A 92  ? 0.0898 0.1026 0.1256 0.0355  0.0276  -0.0115 91  VAL A CG2 
757  N  N   . HIS A 93  ? 0.0622 0.0881 0.0767 0.0090  0.0007  -0.0013 92  HIS A N   
758  C  CA  . HIS A 93  ? 0.0714 0.0904 0.0668 0.0028  0.0030  -0.0015 92  HIS A CA  
759  C  C   . HIS A 93  ? 0.0586 0.0768 0.0530 0.0032  -0.0031 0.0060  92  HIS A C   
760  O  O   . HIS A 93  ? 0.0629 0.0949 0.0608 -0.0003 0.0074  0.0023  92  HIS A O   
761  C  CB  . HIS A 93  ? 0.0731 0.0891 0.0632 0.0038  -0.0032 0.0014  92  HIS A CB  
762  C  CG  . HIS A 93  ? 0.0499 0.0971 0.0729 0.0045  -0.0051 0.0134  92  HIS A CG  
763  N  ND1 . HIS A 93  ? 0.0677 0.0913 0.0801 -0.0084 -0.0089 -0.0020 92  HIS A ND1 
764  C  CD2 . HIS A 93  ? 0.0756 0.0741 0.0952 0.0100  0.0140  0.0061  92  HIS A CD2 
765  C  CE1 . HIS A 93  ? 0.0909 0.0915 0.0838 0.0173  -0.0092 -0.0043 92  HIS A CE1 
766  N  NE2 . HIS A 93  ? 0.0899 0.0750 0.0765 0.0257  0.0178  0.0022  92  HIS A NE2 
767  N  N   . GLU A 94  ? 0.0536 0.0814 0.0734 0.0033  -0.0167 -0.0061 93  GLU A N   
768  C  CA  . GLU A 94  ? 0.0759 0.0926 0.0719 0.0006  -0.0103 -0.0063 93  GLU A CA  
769  C  C   . GLU A 94  ? 0.0718 0.0802 0.0752 0.0020  -0.0053 -0.0032 93  GLU A C   
770  O  O   . GLU A 94  ? 0.0699 0.0917 0.0733 0.0038  0.0129  -0.0089 93  GLU A O   
771  C  CB  . GLU A 94  ? 0.0870 0.0946 0.1010 -0.0054 -0.0029 -0.0011 93  GLU A CB  
772  C  CG  . GLU A 94  ? 0.0975 0.1176 0.1050 0.0078  0.0064  0.0034  93  GLU A CG  
773  C  CD  . GLU A 94  ? 0.1351 0.0947 0.1245 0.0126  0.0010  0.0112  93  GLU A CD  
774  O  OE1 . GLU A 94  ? 0.1798 0.1201 0.1810 0.0235  0.0538  -0.0029 93  GLU A OE1 
775  O  OE2 . GLU A 94  ? 0.1745 0.2118 0.1812 0.0155  -0.0297 -0.0039 93  GLU A OE2 
776  N  N   . LEU A 95  ? 0.0690 0.0870 0.0644 0.0049  -0.0027 -0.0006 94  LEU A N   
777  C  CA  . LEU A 95  ? 0.0632 0.0784 0.0676 0.0101  0.0028  -0.0004 94  LEU A CA  
778  C  C   . LEU A 95  ? 0.0473 0.0844 0.0727 0.0121  0.0016  0.0007  94  LEU A C   
779  O  O   . LEU A 95  ? 0.0744 0.1084 0.0635 -0.0041 0.0061  -0.0040 94  LEU A O   
780  C  CB  . LEU A 95  ? 0.0685 0.1014 0.0845 -0.0021 0.0067  0.0033  94  LEU A CB  
781  C  CG  . LEU A 95  ? 0.0583 0.1210 0.0821 0.0101  -0.0028 -0.0010 94  LEU A CG  
782  C  CD1 . LEU A 95  ? 0.0745 0.1376 0.1105 0.0236  -0.0024 0.0093  94  LEU A CD1 
783  C  CD2 . LEU A 95  ? 0.0997 0.1352 0.0832 -0.0245 -0.0033 -0.0033 94  LEU A CD2 
784  N  N   . GLY A 96  ? 0.0576 0.0723 0.0672 0.0005  -0.0020 -0.0026 95  GLY A N   
785  C  CA  . GLY A 96  ? 0.0578 0.0835 0.0714 0.0039  0.0058  -0.0054 95  GLY A CA  
786  C  C   . GLY A 96  ? 0.0572 0.0789 0.0715 0.0027  0.0015  -0.0056 95  GLY A C   
787  O  O   . GLY A 96  ? 0.0612 0.0914 0.0768 0.0074  0.0198  0.0048  95  GLY A O   
788  N  N   . HIS A 97  ? 0.0644 0.0644 0.0838 0.0107  -0.0004 -0.0103 96  HIS A N   
789  C  CA  . HIS A 97  ? 0.0566 0.0666 0.0711 0.0098  -0.0034 -0.0045 96  HIS A CA  
790  C  C   . HIS A 97  ? 0.0691 0.0904 0.0641 0.0030  -0.0051 -0.0046 96  HIS A C   
791  O  O   . HIS A 97  ? 0.0734 0.0987 0.0591 0.0029  0.0115  -0.0026 96  HIS A O   
792  C  CB  . HIS A 97  ? 0.0778 0.0605 0.0914 0.0102  -0.0041 -0.0017 96  HIS A CB  
793  C  CG  . HIS A 97  ? 0.0632 0.0890 0.0661 0.0120  -0.0124 -0.0031 96  HIS A CG  
794  N  ND1 . HIS A 97  ? 0.0611 0.0913 0.0826 0.0154  -0.0084 -0.0071 96  HIS A ND1 
795  C  CD2 . HIS A 97  ? 0.0705 0.0725 0.0649 0.0139  -0.0072 -0.0086 96  HIS A CD2 
796  C  CE1 . HIS A 97  ? 0.0650 0.0732 0.0913 -0.0022 0.0080  -0.0052 96  HIS A CE1 
797  N  NE2 . HIS A 97  ? 0.0845 0.0845 0.0611 0.0104  -0.0078 0.0067  96  HIS A NE2 
798  N  N   . VAL A 98  ? 0.0620 0.0951 0.0739 0.0035  -0.0105 0.0017  97  VAL A N   
799  C  CA  . VAL A 98  ? 0.0636 0.1039 0.0831 -0.0081 -0.0222 0.0054  97  VAL A CA  
800  C  C   . VAL A 98  ? 0.0771 0.1036 0.0860 0.0017  -0.0131 0.0038  97  VAL A C   
801  O  O   . VAL A 98  ? 0.0824 0.1333 0.0657 -0.0018 -0.0068 0.0019  97  VAL A O   
802  C  CB  . VAL A 98  ? 0.0703 0.1263 0.0893 -0.0135 -0.0140 0.0126  97  VAL A CB  
803  C  CG1 . VAL A 98  ? 0.1066 0.1102 0.1007 -0.0001 -0.0273 0.0063  97  VAL A CG1 
804  C  CG2 . VAL A 98  ? 0.0954 0.1259 0.1057 -0.0061 -0.0205 0.0166  97  VAL A CG2 
805  N  N   . VAL A 99  ? 0.0715 0.0949 0.0832 -0.0001 -0.0092 0.0080  98  VAL A N   
806  C  CA  A VAL A 99  ? 0.0910 0.1174 0.1022 -0.0029 -0.0018 0.0134  98  VAL A CA  
807  C  CA  B VAL A 99  ? 0.0888 0.1047 0.0911 -0.0012 0.0006  0.0088  98  VAL A CA  
808  C  C   . VAL A 99  ? 0.0997 0.1102 0.0919 -0.0086 0.0030  0.0074  98  VAL A C   
809  O  O   . VAL A 99  ? 0.1031 0.1106 0.0905 -0.0060 0.0111  0.0251  98  VAL A O   
810  C  CB  A VAL A 99  ? 0.1032 0.1224 0.1137 -0.0024 -0.0097 0.0063  98  VAL A CB  
811  C  CB  B VAL A 99  ? 0.0977 0.1032 0.0871 -0.0006 -0.0054 0.0069  98  VAL A CB  
812  C  CG1 A VAL A 99  ? 0.1442 0.1451 0.1479 -0.0119 0.0050  0.0031  98  VAL A CG1 
813  C  CG1 B VAL A 99  ? 0.0943 0.1170 0.1086 0.0020  0.0092  0.0072  98  VAL A CG1 
814  C  CG2 A VAL A 99  ? 0.1085 0.1482 0.0963 0.0053  0.0047  0.0000  98  VAL A CG2 
815  C  CG2 B VAL A 99  ? 0.0787 0.1129 0.0661 -0.0011 0.0035  -0.0168 98  VAL A CG2 
816  N  N   . GLY A 100 ? 0.0816 0.1122 0.0836 -0.0019 -0.0006 0.0038  99  GLY A N   
817  C  CA  . GLY A 100 ? 0.0714 0.1153 0.0805 -0.0025 0.0134  0.0068  99  GLY A CA  
818  C  C   . GLY A 100 ? 0.0742 0.0890 0.0702 0.0040  0.0110  0.0026  99  GLY A C   
819  O  O   . GLY A 100 ? 0.0858 0.1246 0.0925 -0.0103 0.0261  0.0082  99  GLY A O   
820  N  N   . PHE A 101 ? 0.0758 0.0941 0.0699 0.0005  0.0065  0.0036  100 PHE A N   
821  C  CA  A PHE A 101 ? 0.0631 0.0833 0.0829 0.0047  -0.0016 0.0021  100 PHE A CA  
822  C  CA  B PHE A 101 ? 0.0637 0.0822 0.0749 0.0044  0.0021  0.0021  100 PHE A CA  
823  C  C   . PHE A 101 ? 0.0687 0.0814 0.0696 0.0029  0.0073  0.0065  100 PHE A C   
824  O  O   . PHE A 101 ? 0.0648 0.0837 0.0873 0.0038  0.0180  0.0059  100 PHE A O   
825  C  CB  A PHE A 101 ? 0.0812 0.0762 0.0848 0.0128  0.0034  -0.0027 100 PHE A CB  
826  C  CB  B PHE A 101 ? 0.0709 0.0786 0.0694 0.0099  -0.0006 -0.0014 100 PHE A CB  
827  C  CG  A PHE A 101 ? 0.0839 0.0846 0.1097 0.0076  0.0039  0.0023  100 PHE A CG  
828  C  CG  B PHE A 101 ? 0.0586 0.0766 0.0701 0.0069  -0.0026 0.0024  100 PHE A CG  
829  C  CD1 A PHE A 101 ? 0.1107 0.1018 0.1493 0.0212  -0.0161 0.0067  100 PHE A CD1 
830  C  CD1 B PHE A 101 ? 0.0996 0.0873 0.0971 0.0003  0.0032  0.0151  100 PHE A CD1 
831  C  CD2 A PHE A 101 ? 0.1158 0.0743 0.1022 -0.0060 0.0010  -0.0052 100 PHE A CD2 
832  C  CD2 B PHE A 101 ? 0.0416 0.0791 0.0560 0.0054  0.0094  0.0034  100 PHE A CD2 
833  C  CE1 A PHE A 101 ? 0.1047 0.1037 0.1670 0.0215  -0.0288 -0.0047 100 PHE A CE1 
834  C  CE1 B PHE A 101 ? 0.0550 0.0895 0.0888 0.0260  0.0080  0.0081  100 PHE A CE1 
835  C  CE2 A PHE A 101 ? 0.1443 0.0835 0.1509 0.0035  -0.0240 0.0045  100 PHE A CE2 
836  C  CE2 B PHE A 101 ? 0.0843 0.0984 0.0867 0.0072  -0.0015 0.0163  100 PHE A CE2 
837  C  CZ  A PHE A 101 ? 0.1247 0.0988 0.1418 0.0118  -0.0039 0.0150  100 PHE A CZ  
838  C  CZ  B PHE A 101 ? 0.0309 0.0858 0.0692 -0.0017 -0.0047 0.0000  100 PHE A CZ  
839  N  N   . TRP A 102 ? 0.0675 0.0792 0.0789 0.0128  -0.0001 -0.0070 101 TRP A N   
840  C  CA  . TRP A 102 ? 0.0762 0.0668 0.0810 0.0091  0.0062  -0.0049 101 TRP A CA  
841  C  C   . TRP A 102 ? 0.0717 0.0727 0.0839 0.0094  -0.0010 -0.0032 101 TRP A C   
842  O  O   . TRP A 102 ? 0.0808 0.0733 0.0869 0.0133  0.0006  0.0016  101 TRP A O   
843  C  CB  . TRP A 102 ? 0.0803 0.0872 0.0895 0.0053  0.0148  -0.0082 101 TRP A CB  
844  C  CG  . TRP A 102 ? 0.0843 0.0777 0.0923 0.0011  0.0093  -0.0061 101 TRP A CG  
845  C  CD1 . TRP A 102 ? 0.1043 0.0972 0.1130 0.0016  0.0185  -0.0076 101 TRP A CD1 
846  C  CD2 . TRP A 102 ? 0.0850 0.0800 0.0960 0.0003  0.0119  -0.0021 101 TRP A CD2 
847  N  NE1 . TRP A 102 ? 0.1139 0.0865 0.1242 0.0026  0.0152  -0.0202 101 TRP A NE1 
848  C  CE2 . TRP A 102 ? 0.0838 0.1009 0.1115 0.0045  0.0106  -0.0197 101 TRP A CE2 
849  C  CE3 . TRP A 102 ? 0.0842 0.0844 0.1194 0.0008  0.0005  -0.0073 101 TRP A CE3 
850  C  CZ2 . TRP A 102 ? 0.1050 0.1074 0.1159 0.0024  0.0065  -0.0189 101 TRP A CZ2 
851  C  CZ3 . TRP A 102 ? 0.1200 0.0974 0.1263 0.0036  0.0017  -0.0095 101 TRP A CZ3 
852  C  CH2 . TRP A 102 ? 0.1209 0.0980 0.1241 0.0058  0.0113  -0.0175 101 TRP A CH2 
853  N  N   . HIS A 103 ? 0.0769 0.0722 0.0846 0.0061  -0.0036 -0.0018 102 HIS A N   
854  C  CA  . HIS A 103 ? 0.0855 0.0682 0.0805 0.0084  -0.0062 0.0022  102 HIS A CA  
855  C  C   . HIS A 103 ? 0.0873 0.0743 0.0718 0.0073  0.0000  0.0039  102 HIS A C   
856  O  O   . HIS A 103 ? 0.0710 0.0936 0.0787 0.0123  0.0120  -0.0042 102 HIS A O   
857  C  CB  . HIS A 103 ? 0.0814 0.0676 0.0973 0.0229  -0.0065 0.0030  102 HIS A CB  
858  C  CG  . HIS A 103 ? 0.0741 0.0685 0.0917 -0.0078 -0.0135 0.0015  102 HIS A CG  
859  N  ND1 . HIS A 103 ? 0.0820 0.0833 0.0913 -0.0038 -0.0083 -0.0009 102 HIS A ND1 
860  C  CD2 . HIS A 103 ? 0.0715 0.0821 0.0779 -0.0122 0.0009  0.0136  102 HIS A CD2 
861  C  CE1 . HIS A 103 ? 0.0707 0.0763 0.1079 -0.0047 -0.0091 0.0000  102 HIS A CE1 
862  N  NE2 . HIS A 103 ? 0.0622 0.0910 0.0819 -0.0132 0.0016  0.0097  102 HIS A NE2 
863  N  N   . GLU A 104 ? 0.0764 0.0714 0.0868 0.0058  -0.0047 -0.0111 103 GLU A N   
864  C  CA  . GLU A 104 ? 0.0839 0.0737 0.0965 0.0101  -0.0012 -0.0048 103 GLU A CA  
865  C  C   . GLU A 104 ? 0.0745 0.0662 0.0954 0.0102  0.0157  -0.0049 103 GLU A C   
866  O  O   . GLU A 104 ? 0.0688 0.0784 0.1034 0.0048  0.0091  0.0075  103 GLU A O   
867  C  CB  . GLU A 104 ? 0.0900 0.0822 0.0916 -0.0041 0.0043  -0.0207 103 GLU A CB  
868  C  CG  . GLU A 104 ? 0.1037 0.0695 0.0876 0.0008  -0.0006 -0.0051 103 GLU A CG  
869  C  CD  . GLU A 104 ? 0.0727 0.0935 0.0912 0.0059  0.0120  -0.0064 103 GLU A CD  
870  O  OE1 . GLU A 104 ? 0.1013 0.0700 0.1344 -0.0020 -0.0348 0.0043  103 GLU A OE1 
871  O  OE2 . GLU A 104 ? 0.0688 0.0782 0.0886 -0.0042 0.0014  -0.0030 103 GLU A OE2 
872  N  N   . HIS A 105 ? 0.0714 0.0747 0.0908 0.0144  -0.0030 0.0007  104 HIS A N   
873  C  CA  . HIS A 105 ? 0.0671 0.0842 0.1025 0.0070  -0.0036 0.0018  104 HIS A CA  
874  C  C   . HIS A 105 ? 0.0625 0.0756 0.1077 0.0013  -0.0054 0.0044  104 HIS A C   
875  O  O   . HIS A 105 ? 0.0729 0.0829 0.1404 0.0117  0.0009  0.0007  104 HIS A O   
876  C  CB  . HIS A 105 ? 0.1117 0.0910 0.1043 -0.0038 -0.0074 0.0044  104 HIS A CB  
877  C  CG  . HIS A 105 ? 0.0674 0.0911 0.1135 0.0131  -0.0054 0.0048  104 HIS A CG  
878  N  ND1 . HIS A 105 ? 0.0740 0.1169 0.1147 0.0048  -0.0047 0.0189  104 HIS A ND1 
879  C  CD2 . HIS A 105 ? 0.0989 0.0928 0.1351 0.0096  -0.0077 0.0182  104 HIS A CD2 
880  C  CE1 . HIS A 105 ? 0.0974 0.1067 0.1511 -0.0015 -0.0059 0.0145  104 HIS A CE1 
881  N  NE2 . HIS A 105 ? 0.0807 0.1001 0.1420 -0.0031 -0.0021 0.0219  104 HIS A NE2 
882  N  N   . THR A 106 ? 0.0617 0.0813 0.0930 0.0024  0.0155  -0.0019 105 THR A N   
883  C  CA  . THR A 106 ? 0.0774 0.0994 0.1001 0.0085  0.0145  -0.0011 105 THR A CA  
884  C  C   . THR A 106 ? 0.0680 0.0892 0.0891 0.0059  0.0158  0.0028  105 THR A C   
885  O  O   . THR A 106 ? 0.0862 0.0980 0.1041 0.0082  0.0297  -0.0045 105 THR A O   
886  C  CB  . THR A 106 ? 0.0907 0.0833 0.1014 -0.0003 0.0174  -0.0055 105 THR A CB  
887  O  OG1 . THR A 106 ? 0.0824 0.1089 0.1114 -0.0060 0.0082  -0.0138 105 THR A OG1 
888  C  CG2 . THR A 106 ? 0.1105 0.1108 0.1276 -0.0008 0.0277  0.0043  105 THR A CG2 
889  N  N   . ARG A 107 ? 0.0700 0.0795 0.1013 0.0001  0.0015  0.0042  106 ARG A N   
890  C  CA  . ARG A 107 ? 0.0847 0.0888 0.1187 0.0063  0.0239  -0.0009 106 ARG A CA  
891  C  C   . ARG A 107 ? 0.0787 0.0867 0.1114 0.0062  0.0185  -0.0035 106 ARG A C   
892  O  O   . ARG A 107 ? 0.0868 0.0997 0.1125 -0.0047 0.0126  0.0121  106 ARG A O   
893  C  CB  . ARG A 107 ? 0.0776 0.0822 0.1253 0.0194  0.0096  -0.0059 106 ARG A CB  
894  C  CG  . ARG A 107 ? 0.0733 0.0820 0.1225 0.0187  0.0108  0.0034  106 ARG A CG  
895  C  CD  . ARG A 107 ? 0.0628 0.0811 0.1190 -0.0089 0.0019  -0.0023 106 ARG A CD  
896  N  NE  . ARG A 107 ? 0.0827 0.0708 0.1217 -0.0060 0.0238  0.0138  106 ARG A NE  
897  C  CZ  . ARG A 107 ? 0.1027 0.0662 0.1125 -0.0089 0.0130  0.0015  106 ARG A CZ  
898  N  NH1 . ARG A 107 ? 0.0901 0.0902 0.1093 0.0095  0.0064  -0.0109 106 ARG A NH1 
899  N  NH2 . ARG A 107 ? 0.1022 0.0673 0.1480 -0.0131 0.0178  0.0138  106 ARG A NH2 
900  N  N   . PRO A 108 ? 0.0739 0.1164 0.1126 0.0037  0.0258  0.0073  107 PRO A N   
901  C  CA  . PRO A 108 ? 0.0815 0.1355 0.1198 0.0049  0.0351  0.0104  107 PRO A CA  
902  C  C   . PRO A 108 ? 0.0933 0.1406 0.1376 0.0033  0.0269  0.0152  107 PRO A C   
903  O  O   . PRO A 108 ? 0.0867 0.1563 0.1800 -0.0018 0.0167  -0.0003 107 PRO A O   
904  C  CB  . PRO A 108 ? 0.1101 0.1732 0.1266 -0.0084 0.0296  0.0120  107 PRO A CB  
905  C  CG  . PRO A 108 ? 0.1144 0.2131 0.1312 0.0075  0.0290  0.0065  107 PRO A CG  
906  C  CD  . PRO A 108 ? 0.1152 0.1518 0.1203 0.0064  0.0299  0.0106  107 PRO A CD  
907  N  N   . ASP A 109 ? 0.0884 0.1213 0.1433 -0.0136 0.0327  0.0034  108 ASP A N   
908  C  CA  . ASP A 109 ? 0.1021 0.1149 0.1629 -0.0131 0.0216  0.0097  108 ASP A CA  
909  C  C   . ASP A 109 ? 0.1032 0.1142 0.1626 -0.0111 0.0143  0.0059  108 ASP A C   
910  O  O   . ASP A 109 ? 0.0849 0.1218 0.1738 -0.0284 0.0184  -0.0017 108 ASP A O   
911  C  CB  . ASP A 109 ? 0.1145 0.1249 0.1839 -0.0024 0.0221  0.0303  108 ASP A CB  
912  C  CG  . ASP A 109 ? 0.1152 0.1326 0.2448 -0.0105 0.0014  0.0218  108 ASP A CG  
913  O  OD1 . ASP A 109 ? 0.0808 0.1127 0.3006 -0.0143 0.0184  0.0150  108 ASP A OD1 
914  O  OD2 . ASP A 109 ? 0.1655 0.1546 0.3534 -0.0044 0.0162  0.0176  108 ASP A OD2 
915  N  N   . ARG A 110 ? 0.0769 0.0964 0.1532 -0.0093 0.0256  0.0091  109 ARG A N   
916  C  CA  . ARG A 110 ? 0.0596 0.0961 0.1368 -0.0180 0.0094  0.0024  109 ARG A CA  
917  C  C   . ARG A 110 ? 0.0936 0.0931 0.1578 -0.0158 0.0014  0.0033  109 ARG A C   
918  O  O   . ARG A 110 ? 0.1014 0.0974 0.1272 -0.0072 -0.0168 -0.0004 109 ARG A O   
919  C  CB  . ARG A 110 ? 0.0720 0.0807 0.1466 0.0041  0.0000  0.0037  109 ARG A CB  
920  C  CG  . ARG A 110 ? 0.0915 0.0939 0.1424 0.0212  -0.0109 0.0036  109 ARG A CG  
921  C  CD  . ARG A 110 ? 0.0879 0.1005 0.1264 0.0137  -0.0184 -0.0011 109 ARG A CD  
922  N  NE  . ARG A 110 ? 0.1058 0.0950 0.1253 0.0133  0.0037  0.0036  109 ARG A NE  
923  C  CZ  . ARG A 110 ? 0.0806 0.0879 0.1283 -0.0016 -0.0009 0.0128  109 ARG A CZ  
924  N  NH1 . ARG A 110 ? 0.0737 0.1268 0.1165 0.0019  0.0000  0.0027  109 ARG A NH1 
925  N  NH2 . ARG A 110 ? 0.0969 0.0882 0.1380 0.0272  -0.0087 -0.0048 109 ARG A NH2 
926  N  N   . ASP A 111 ? 0.0914 0.1139 0.1572 -0.0034 -0.0103 -0.0065 110 ASP A N   
927  C  CA  . ASP A 111 ? 0.0887 0.1252 0.1763 -0.0015 -0.0203 -0.0063 110 ASP A CA  
928  C  C   . ASP A 111 ? 0.1009 0.1264 0.1735 0.0062  -0.0205 -0.0008 110 ASP A C   
929  O  O   . ASP A 111 ? 0.1386 0.1807 0.1820 0.0062  -0.0459 -0.0011 110 ASP A O   
930  C  CB  . ASP A 111 ? 0.1070 0.1503 0.2098 0.0075  -0.0017 -0.0104 110 ASP A CB  
931  C  CG  . ASP A 111 ? 0.1711 0.1811 0.2128 0.0053  -0.0159 -0.0042 110 ASP A CG  
932  O  OD1 . ASP A 111 ? 0.1429 0.1561 0.2382 0.0055  -0.0328 -0.0133 110 ASP A OD1 
933  O  OD2 . ASP A 111 ? 0.2800 0.2209 0.2880 0.0096  0.0054  -0.0315 110 ASP A OD2 
934  N  N   . ARG A 112 ? 0.0912 0.1182 0.1617 -0.0059 -0.0041 -0.0033 111 ARG A N   
935  C  CA  A ARG A 112 ? 0.1215 0.1260 0.1711 -0.0182 0.0045  0.0007  111 ARG A CA  
936  C  CA  B ARG A 112 ? 0.1234 0.1316 0.1774 -0.0178 0.0033  -0.0004 111 ARG A CA  
937  C  C   . ARG A 112 ? 0.1076 0.1250 0.1601 -0.0129 -0.0072 -0.0006 111 ARG A C   
938  O  O   . ARG A 112 ? 0.1178 0.1478 0.1946 -0.0359 0.0019  -0.0189 111 ARG A O   
939  C  CB  A ARG A 112 ? 0.1602 0.1459 0.1861 -0.0259 0.0105  0.0017  111 ARG A CB  
940  C  CB  B ARG A 112 ? 0.1578 0.1522 0.1948 -0.0212 0.0008  -0.0010 111 ARG A CB  
941  C  CG  A ARG A 112 ? 0.1744 0.1523 0.1978 -0.0204 0.0075  -0.0013 111 ARG A CG  
942  C  CG  B ARG A 112 ? 0.1954 0.1921 0.2390 -0.0215 0.0106  0.0003  111 ARG A CG  
943  C  CD  A ARG A 112 ? 0.2256 0.1735 0.2067 -0.0174 0.0068  0.0204  111 ARG A CD  
944  C  CD  B ARG A 112 ? 0.2625 0.2634 0.2825 -0.0112 -0.0066 0.0065  111 ARG A CD  
945  N  NE  A ARG A 112 ? 0.1901 0.2199 0.2401 -0.0039 0.0025  0.0041  111 ARG A NE  
946  N  NE  B ARG A 112 ? 0.2561 0.2567 0.2920 -0.0178 0.0184  0.0035  111 ARG A NE  
947  C  CZ  A ARG A 112 ? 0.2095 0.2165 0.2484 -0.0086 0.0089  0.0136  111 ARG A CZ  
948  C  CZ  B ARG A 112 ? 0.2436 0.2578 0.2850 0.0000  0.0070  0.0000  111 ARG A CZ  
949  N  NH1 A ARG A 112 ? 0.1957 0.2250 0.1936 0.0065  -0.0107 0.0169  111 ARG A NH1 
950  N  NH1 B ARG A 112 ? 0.2889 0.2795 0.3066 0.0004  0.0143  -0.0006 111 ARG A NH1 
951  N  NH2 A ARG A 112 ? 0.1303 0.1621 0.2144 0.0063  0.0091  0.0152  111 ARG A NH2 
952  N  NH2 B ARG A 112 ? 0.2550 0.2451 0.2933 -0.0219 0.0271  0.0018  111 ARG A NH2 
953  N  N   . HIS A 113 ? 0.0772 0.0988 0.1485 -0.0185 -0.0129 0.0096  112 HIS A N   
954  C  CA  . HIS A 113 ? 0.0914 0.0907 0.1203 -0.0006 -0.0048 0.0010  112 HIS A CA  
955  C  C   . HIS A 113 ? 0.0905 0.1023 0.1242 -0.0048 -0.0077 0.0044  112 HIS A C   
956  O  O   . HIS A 113 ? 0.0848 0.1074 0.1353 -0.0160 -0.0060 -0.0025 112 HIS A O   
957  C  CB  . HIS A 113 ? 0.0937 0.1148 0.1248 -0.0011 -0.0028 0.0171  112 HIS A CB  
958  C  CG  . HIS A 113 ? 0.1119 0.1099 0.1260 -0.0017 -0.0019 0.0199  112 HIS A CG  
959  N  ND1 . HIS A 113 ? 0.0999 0.1362 0.1859 -0.0214 0.0036  0.0157  112 HIS A ND1 
960  C  CD2 . HIS A 113 ? 0.0722 0.0718 0.1423 -0.0197 -0.0255 0.0021  112 HIS A CD2 
961  C  CE1 . HIS A 113 ? 0.0744 0.1111 0.1272 -0.0255 0.0038  0.0170  112 HIS A CE1 
962  N  NE2 . HIS A 113 ? 0.1138 0.1424 0.1864 -0.0158 -0.0148 0.0479  112 HIS A NE2 
963  N  N   . VAL A 114 ? 0.0879 0.0841 0.1300 -0.0104 -0.0120 0.0104  113 VAL A N   
964  C  CA  . VAL A 114 ? 0.1038 0.1027 0.1375 -0.0153 -0.0131 0.0063  113 VAL A CA  
965  C  C   . VAL A 114 ? 0.1154 0.1003 0.1205 -0.0120 -0.0086 -0.0021 113 VAL A C   
966  O  O   . VAL A 114 ? 0.1220 0.1345 0.1358 0.0062  0.0108  0.0106  113 VAL A O   
967  C  CB  . VAL A 114 ? 0.1017 0.0991 0.1322 -0.0094 -0.0177 -0.0101 113 VAL A CB  
968  C  CG1 . VAL A 114 ? 0.0998 0.1052 0.1540 -0.0083 -0.0065 0.0000  113 VAL A CG1 
969  C  CG2 . VAL A 114 ? 0.1132 0.1133 0.1363 -0.0289 -0.0041 -0.0040 113 VAL A CG2 
970  N  N   . SER A 115 ? 0.1043 0.1072 0.1292 -0.0051 -0.0186 0.0028  114 SER A N   
971  C  CA  A SER A 115 ? 0.1076 0.1165 0.1428 -0.0040 -0.0209 -0.0035 114 SER A CA  
972  C  CA  B SER A 115 ? 0.1109 0.1153 0.1373 -0.0030 -0.0102 -0.0015 114 SER A CA  
973  C  C   . SER A 115 ? 0.1112 0.1152 0.1281 -0.0034 -0.0116 0.0031  114 SER A C   
974  O  O   . SER A 115 ? 0.1042 0.1181 0.1477 -0.0063 -0.0017 -0.0050 114 SER A O   
975  C  CB  A SER A 115 ? 0.1337 0.1303 0.1531 -0.0068 -0.0277 -0.0009 114 SER A CB  
976  C  CB  B SER A 115 ? 0.1224 0.1230 0.1420 -0.0047 -0.0124 -0.0002 114 SER A CB  
977  O  OG  A SER A 115 ? 0.1424 0.1809 0.2086 -0.0272 -0.0461 -0.0011 114 SER A OG  
978  O  OG  B SER A 115 ? 0.1347 0.1366 0.1693 0.0047  -0.0025 -0.0037 114 SER A OG  
979  N  N   . ILE A 116 ? 0.1090 0.1303 0.1417 -0.0108 0.0078  -0.0001 115 ILE A N   
980  C  CA  . ILE A 116 ? 0.1131 0.1321 0.1281 -0.0082 -0.0103 -0.0120 115 ILE A CA  
981  C  C   . ILE A 116 ? 0.1048 0.1367 0.1424 0.0038  -0.0008 -0.0120 115 ILE A C   
982  O  O   . ILE A 116 ? 0.1048 0.1568 0.1733 0.0044  -0.0042 -0.0023 115 ILE A O   
983  C  CB  . ILE A 116 ? 0.1289 0.1422 0.1281 -0.0102 -0.0049 -0.0094 115 ILE A CB  
984  C  CG1 . ILE A 116 ? 0.1666 0.1739 0.1652 0.0034  -0.0159 0.0014  115 ILE A CG1 
985  C  CG2 . ILE A 116 ? 0.1298 0.1392 0.1371 -0.0139 -0.0209 -0.0131 115 ILE A CG2 
986  C  CD1 . ILE A 116 ? 0.1491 0.1717 0.1771 0.0050  -0.0172 -0.0001 115 ILE A CD1 
987  N  N   . VAL A 117 ? 0.1026 0.1228 0.1210 0.0057  -0.0213 -0.0048 116 VAL A N   
988  C  CA  . VAL A 117 ? 0.1218 0.1336 0.1171 0.0119  -0.0242 -0.0044 116 VAL A CA  
989  C  C   . VAL A 117 ? 0.1017 0.1421 0.1113 0.0120  -0.0141 -0.0070 116 VAL A C   
990  O  O   . VAL A 117 ? 0.0956 0.1323 0.1301 0.0130  -0.0258 -0.0050 116 VAL A O   
991  C  CB  . VAL A 117 ? 0.1205 0.1314 0.1108 0.0152  -0.0216 0.0027  116 VAL A CB  
992  C  CG1 . VAL A 117 ? 0.1248 0.1577 0.1288 -0.0008 -0.0425 0.0113  116 VAL A CG1 
993  C  CG2 . VAL A 117 ? 0.1469 0.1377 0.1404 0.0053  -0.0195 -0.0280 116 VAL A CG2 
994  N  N   . ARG A 118 ? 0.0992 0.1557 0.1318 0.0156  -0.0190 -0.0145 117 ARG A N   
995  C  CA  . ARG A 118 ? 0.1346 0.1487 0.1478 0.0089  -0.0041 -0.0069 117 ARG A CA  
996  C  C   . ARG A 118 ? 0.1243 0.1371 0.1394 0.0145  -0.0140 -0.0157 117 ARG A C   
997  O  O   . ARG A 118 ? 0.1518 0.1358 0.1660 0.0016  -0.0147 -0.0184 117 ARG A O   
998  C  CB  . ARG A 118 ? 0.1527 0.1584 0.1559 0.0111  0.0088  -0.0067 117 ARG A CB  
999  C  CG  . ARG A 118 ? 0.2151 0.1992 0.1918 0.0047  0.0154  0.0100  117 ARG A CG  
1000 C  CD  . ARG A 118 ? 0.2969 0.2694 0.2166 0.0109  0.0155  0.0100  117 ARG A CD  
1001 N  NE  . ARG A 118 ? 0.3310 0.2979 0.2630 0.0078  -0.0250 0.0212  117 ARG A NE  
1002 C  CZ  . ARG A 118 ? 0.3295 0.3171 0.2984 0.0025  -0.0133 0.0056  117 ARG A CZ  
1003 N  NH1 . ARG A 118 ? 0.3659 0.3021 0.2808 0.0018  -0.0302 -0.0062 117 ARG A NH1 
1004 N  NH2 . ARG A 118 ? 0.3262 0.2852 0.2847 0.0034  -0.0076 0.0066  117 ARG A NH2 
1005 N  N   . GLU A 119 ? 0.1224 0.1443 0.1478 0.0237  -0.0136 -0.0158 118 GLU A N   
1006 C  CA  . GLU A 119 ? 0.1443 0.1624 0.1537 0.0198  -0.0149 -0.0038 118 GLU A CA  
1007 C  C   . GLU A 119 ? 0.1479 0.1715 0.1476 0.0184  -0.0225 0.0109  118 GLU A C   
1008 O  O   . GLU A 119 ? 0.1559 0.1611 0.1961 0.0406  -0.0102 0.0156  118 GLU A O   
1009 C  CB  . GLU A 119 ? 0.1382 0.1938 0.1601 0.0107  -0.0289 0.0048  118 GLU A CB  
1010 C  CG  . GLU A 119 ? 0.1663 0.2378 0.1978 0.0162  -0.0006 -0.0169 118 GLU A CG  
1011 C  CD  . GLU A 119 ? 0.1712 0.2396 0.2074 0.0055  -0.0014 -0.0396 118 GLU A CD  
1012 O  OE1 . GLU A 119 ? 0.1639 0.2204 0.2085 -0.0038 -0.0208 -0.0359 118 GLU A OE1 
1013 O  OE2 . GLU A 119 ? 0.1704 0.3429 0.3098 -0.0148 -0.0035 -0.0389 118 GLU A OE2 
1014 N  N   . ASN A 120 ? 0.1223 0.1345 0.1336 0.0261  -0.0248 -0.0068 119 ASN A N   
1015 C  CA  . ASN A 120 ? 0.1382 0.1330 0.1207 0.0218  -0.0177 -0.0029 119 ASN A CA  
1016 C  C   . ASN A 120 ? 0.1260 0.1301 0.1224 0.0269  -0.0204 -0.0001 119 ASN A C   
1017 O  O   . ASN A 120 ? 0.1266 0.1298 0.1445 0.0155  -0.0205 0.0050  119 ASN A O   
1018 C  CB  . ASN A 120 ? 0.1403 0.1253 0.1056 0.0221  -0.0311 -0.0152 119 ASN A CB  
1019 C  CG  . ASN A 120 ? 0.1283 0.1675 0.1049 0.0339  -0.0283 0.0133  119 ASN A CG  
1020 O  OD1 . ASN A 120 ? 0.1760 0.1821 0.1133 0.0630  -0.0364 0.0012  119 ASN A OD1 
1021 N  ND2 . ASN A 120 ? 0.1002 0.1600 0.1095 0.0079  -0.0145 -0.0098 119 ASN A ND2 
1022 N  N   . ILE A 121 ? 0.1117 0.1145 0.1305 0.0215  -0.0237 -0.0049 120 ILE A N   
1023 C  CA  . ILE A 121 ? 0.1061 0.1114 0.1265 0.0096  -0.0165 -0.0069 120 ILE A CA  
1024 C  C   . ILE A 121 ? 0.1132 0.1213 0.1236 0.0124  -0.0143 -0.0107 120 ILE A C   
1025 O  O   . ILE A 121 ? 0.1306 0.1208 0.1361 0.0205  -0.0048 -0.0056 120 ILE A O   
1026 C  CB  . ILE A 121 ? 0.1045 0.1042 0.1260 0.0079  -0.0258 -0.0006 120 ILE A CB  
1027 C  CG1 . ILE A 121 ? 0.1162 0.1115 0.1435 0.0092  -0.0168 0.0004  120 ILE A CG1 
1028 C  CG2 . ILE A 121 ? 0.1250 0.1271 0.1223 -0.0055 -0.0371 -0.0214 120 ILE A CG2 
1029 C  CD1 . ILE A 121 ? 0.1276 0.1410 0.1253 0.0015  -0.0093 0.0107  120 ILE A CD1 
1030 N  N   . GLN A 122 ? 0.1316 0.1130 0.1201 0.0153  -0.0009 -0.0063 121 GLN A N   
1031 C  CA  . GLN A 122 ? 0.1473 0.1311 0.1302 0.0099  0.0023  -0.0181 121 GLN A CA  
1032 C  C   . GLN A 122 ? 0.1582 0.1055 0.1224 0.0152  0.0003  -0.0054 121 GLN A C   
1033 O  O   . GLN A 122 ? 0.1310 0.1080 0.1098 0.0098  -0.0050 -0.0140 121 GLN A O   
1034 C  CB  . GLN A 122 ? 0.1370 0.1489 0.1440 0.0042  0.0124  -0.0069 121 GLN A CB  
1035 C  CG  . GLN A 122 ? 0.1908 0.2127 0.1948 -0.0015 0.0118  -0.0136 121 GLN A CG  
1036 C  CD  . GLN A 122 ? 0.1786 0.2189 0.2048 -0.0070 0.0132  -0.0336 121 GLN A CD  
1037 O  OE1 . GLN A 122 ? 0.2197 0.2917 0.2093 -0.0495 0.0042  -0.0473 121 GLN A OE1 
1038 N  NE2 . GLN A 122 ? 0.1909 0.2005 0.2058 -0.0225 0.0142  -0.0485 121 GLN A NE2 
1039 N  N   . PRO A 123 ? 0.1718 0.1108 0.1289 0.0239  -0.0049 -0.0045 122 PRO A N   
1040 C  CA  . PRO A 123 ? 0.1736 0.1164 0.1265 0.0336  -0.0161 -0.0046 122 PRO A CA  
1041 C  C   . PRO A 123 ? 0.1673 0.1035 0.1235 0.0139  -0.0101 -0.0068 122 PRO A C   
1042 O  O   . PRO A 123 ? 0.1957 0.1228 0.1392 -0.0041 -0.0084 -0.0059 122 PRO A O   
1043 C  CB  . PRO A 123 ? 0.1885 0.1162 0.1462 0.0385  -0.0094 0.0000  122 PRO A CB  
1044 C  CG  . PRO A 123 ? 0.1994 0.1380 0.1585 0.0411  -0.0215 0.0002  122 PRO A CG  
1045 C  CD  . PRO A 123 ? 0.1949 0.1383 0.1464 0.0328  -0.0174 -0.0051 122 PRO A CD  
1046 N  N   . GLY A 124 ? 0.1629 0.0887 0.1155 0.0267  -0.0087 -0.0062 123 GLY A N   
1047 C  CA  . GLY A 124 ? 0.1771 0.1041 0.1218 0.0120  -0.0137 -0.0074 123 GLY A CA  
1048 C  C   . GLY A 124 ? 0.1580 0.0981 0.1105 0.0068  -0.0059 -0.0055 123 GLY A C   
1049 O  O   . GLY A 124 ? 0.1716 0.0944 0.1293 0.0021  -0.0077 -0.0195 123 GLY A O   
1050 N  N   . GLN A 125 ? 0.1337 0.0805 0.1244 0.0084  -0.0039 -0.0100 124 GLN A N   
1051 C  CA  . GLN A 125 ? 0.1294 0.0907 0.1277 0.0064  0.0023  -0.0104 124 GLN A CA  
1052 C  C   . GLN A 125 ? 0.1050 0.0875 0.1103 0.0061  -0.0078 -0.0130 124 GLN A C   
1053 O  O   . GLN A 125 ? 0.0917 0.0838 0.1213 0.0074  -0.0061 -0.0139 124 GLN A O   
1054 C  CB  . GLN A 125 ? 0.1019 0.1162 0.1157 0.0092  0.0022  -0.0022 124 GLN A CB  
1055 C  CG  . GLN A 125 ? 0.1322 0.1472 0.1585 -0.0086 0.0030  0.0047  124 GLN A CG  
1056 C  CD  . GLN A 125 ? 0.1328 0.1404 0.1766 -0.0219 0.0066  -0.0040 124 GLN A CD  
1057 O  OE1 . GLN A 125 ? 0.1643 0.1582 0.1954 -0.0328 -0.0133 0.0117  124 GLN A OE1 
1058 N  NE2 . GLN A 125 ? 0.1742 0.1531 0.2119 -0.0291 0.0104  -0.0204 124 GLN A NE2 
1059 N  N   . GLU A 126 ? 0.0915 0.0834 0.1138 0.0031  0.0086  -0.0006 125 GLU A N   
1060 C  CA  . GLU A 126 ? 0.0941 0.0925 0.1212 0.0080  0.0009  0.0052  125 GLU A CA  
1061 C  C   . GLU A 126 ? 0.0940 0.0897 0.1114 0.0096  0.0047  0.0026  125 GLU A C   
1062 O  O   . GLU A 126 ? 0.0949 0.0685 0.1317 0.0117  0.0075  -0.0004 125 GLU A O   
1063 C  CB  . GLU A 126 ? 0.1003 0.1236 0.1355 0.0190  -0.0066 0.0030  125 GLU A CB  
1064 C  CG  . GLU A 126 ? 0.1474 0.1236 0.1465 0.0033  -0.0209 0.0130  125 GLU A CG  
1065 C  CD  . GLU A 126 ? 0.1566 0.1052 0.1315 0.0311  -0.0124 -0.0038 125 GLU A CD  
1066 O  OE1 . GLU A 126 ? 0.1373 0.1182 0.1671 0.0265  -0.0077 -0.0124 125 GLU A OE1 
1067 O  OE2 . GLU A 126 ? 0.2100 0.1310 0.1411 0.0296  0.0017  -0.0089 125 GLU A OE2 
1068 N  N   . TYR A 127 ? 0.1032 0.1030 0.1082 0.0123  -0.0017 -0.0093 126 TYR A N   
1069 C  CA  . TYR A 127 ? 0.1234 0.0863 0.1087 0.0124  -0.0041 -0.0090 126 TYR A CA  
1070 C  C   . TYR A 127 ? 0.1079 0.0924 0.1074 0.0173  -0.0052 -0.0104 126 TYR A C   
1071 O  O   . TYR A 127 ? 0.1253 0.0944 0.1061 0.0266  -0.0017 -0.0038 126 TYR A O   
1072 C  CB  . TYR A 127 ? 0.1325 0.0936 0.1149 0.0058  -0.0083 -0.0139 126 TYR A CB  
1073 C  CG  . TYR A 127 ? 0.1228 0.0894 0.1345 -0.0010 -0.0227 -0.0151 126 TYR A CG  
1074 C  CD1 . TYR A 127 ? 0.1465 0.0881 0.1322 -0.0120 -0.0184 -0.0135 126 TYR A CD1 
1075 C  CD2 . TYR A 127 ? 0.1324 0.0881 0.1467 0.0102  -0.0170 -0.0266 126 TYR A CD2 
1076 C  CE1 . TYR A 127 ? 0.1232 0.1271 0.1512 -0.0214 -0.0249 -0.0306 126 TYR A CE1 
1077 C  CE2 . TYR A 127 ? 0.1467 0.1205 0.1665 -0.0020 -0.0211 -0.0344 126 TYR A CE2 
1078 C  CZ  . TYR A 127 ? 0.1405 0.1334 0.1795 -0.0167 -0.0045 -0.0197 126 TYR A CZ  
1079 O  OH  . TYR A 127 ? 0.1435 0.1798 0.2302 -0.0222 0.0030  -0.0016 126 TYR A OH  
1080 N  N   . ASN A 128 ? 0.0865 0.0838 0.1154 0.0118  -0.0059 -0.0099 127 ASN A N   
1081 C  CA  . ASN A 128 ? 0.0912 0.0770 0.1192 0.0165  -0.0067 -0.0160 127 ASN A CA  
1082 C  C   . ASN A 128 ? 0.0731 0.0738 0.1104 0.0139  -0.0123 -0.0055 127 ASN A C   
1083 O  O   . ASN A 128 ? 0.0745 0.0832 0.1383 0.0186  -0.0211 -0.0072 127 ASN A O   
1084 C  CB  . ASN A 128 ? 0.1010 0.0899 0.1250 -0.0007 0.0063  -0.0068 127 ASN A CB  
1085 C  CG  . ASN A 128 ? 0.1121 0.0829 0.1314 0.0170  -0.0092 -0.0201 127 ASN A CG  
1086 O  OD1 . ASN A 128 ? 0.1073 0.1160 0.1551 0.0001  0.0046  -0.0027 127 ASN A OD1 
1087 N  ND2 . ASN A 128 ? 0.1234 0.1044 0.1377 0.0047  0.0143  -0.0035 127 ASN A ND2 
1088 N  N   . PHE A 129 ? 0.0548 0.0747 0.1098 0.0088  -0.0035 0.0004  128 PHE A N   
1089 C  CA  . PHE A 129 ? 0.0860 0.0802 0.0939 -0.0032 -0.0089 0.0057  128 PHE A CA  
1090 C  C   . PHE A 129 ? 0.0813 0.0883 0.1129 0.0069  0.0039  -0.0023 128 PHE A C   
1091 O  O   . PHE A 129 ? 0.1035 0.0879 0.1356 -0.0082 0.0065  -0.0025 128 PHE A O   
1092 C  CB  . PHE A 129 ? 0.0707 0.1112 0.0978 -0.0007 -0.0182 -0.0102 128 PHE A CB  
1093 C  CG  . PHE A 129 ? 0.0771 0.0901 0.0895 0.0015  -0.0233 -0.0057 128 PHE A CG  
1094 C  CD1 . PHE A 129 ? 0.0763 0.0934 0.1182 0.0011  0.0005  -0.0033 128 PHE A CD1 
1095 C  CD2 . PHE A 129 ? 0.0815 0.1137 0.1032 0.0025  -0.0051 -0.0216 128 PHE A CD2 
1096 C  CE1 . PHE A 129 ? 0.0779 0.1212 0.1154 -0.0032 -0.0039 -0.0157 128 PHE A CE1 
1097 C  CE2 . PHE A 129 ? 0.1144 0.1169 0.1130 0.0256  -0.0045 -0.0085 128 PHE A CE2 
1098 C  CZ  . PHE A 129 ? 0.1197 0.1237 0.0863 0.0033  -0.0142 0.0025  128 PHE A CZ  
1099 N  N   . LEU A 130 ? 0.0935 0.1070 0.0973 0.0207  0.0051  0.0079  129 LEU A N   
1100 C  CA  . LEU A 130 ? 0.1107 0.1057 0.1135 0.0222  0.0125  0.0171  129 LEU A CA  
1101 C  C   . LEU A 130 ? 0.0905 0.1107 0.1267 0.0195  0.0170  0.0207  129 LEU A C   
1102 O  O   . LEU A 130 ? 0.0957 0.1204 0.1397 0.0174  0.0154  0.0232  129 LEU A O   
1103 C  CB  . LEU A 130 ? 0.1291 0.1282 0.1104 0.0275  0.0166  0.0075  129 LEU A CB  
1104 C  CG  . LEU A 130 ? 0.1423 0.1141 0.1465 0.0252  0.0110  0.0067  129 LEU A CG  
1105 C  CD1 . LEU A 130 ? 0.1450 0.1751 0.1624 0.0156  -0.0013 -0.0186 129 LEU A CD1 
1106 C  CD2 . LEU A 130 ? 0.1473 0.1477 0.1980 0.0392  0.0301  0.0107  129 LEU A CD2 
1107 N  N   . LYS A 131 ? 0.1032 0.1075 0.1199 0.0219  0.0235  0.0223  130 LYS A N   
1108 C  CA  . LYS A 131 ? 0.1239 0.1090 0.1230 0.0092  0.0167  0.0141  130 LYS A CA  
1109 C  C   . LYS A 131 ? 0.1258 0.1109 0.1107 0.0193  0.0253  0.0078  130 LYS A C   
1110 O  O   . LYS A 131 ? 0.1419 0.1218 0.1320 0.0269  0.0317  0.0095  130 LYS A O   
1111 C  CB  . LYS A 131 ? 0.1531 0.1377 0.1431 -0.0061 0.0105  0.0102  130 LYS A CB  
1112 C  CG  . LYS A 131 ? 0.1717 0.1795 0.1634 -0.0037 0.0147  0.0037  130 LYS A CG  
1113 C  CD  . LYS A 131 ? 0.1781 0.1812 0.2051 -0.0118 -0.0086 -0.0031 130 LYS A CD  
1114 C  CE  . LYS A 131 ? 0.1939 0.2609 0.2494 -0.0108 -0.0013 0.0061  130 LYS A CE  
1115 N  NZ  . LYS A 131 ? 0.2536 0.3292 0.3443 -0.0215 0.0117  0.0067  130 LYS A NZ  
1116 N  N   . MET A 132 ? 0.1107 0.1149 0.0951 0.0106  0.0293  0.0151  131 MET A N   
1117 C  CA  . MET A 132 ? 0.1134 0.1200 0.1040 0.0125  0.0257  0.0210  131 MET A CA  
1118 C  C   . MET A 132 ? 0.1318 0.1202 0.1142 0.0105  0.0261  0.0149  131 MET A C   
1119 O  O   . MET A 132 ? 0.1211 0.1415 0.1238 0.0046  0.0357  0.0011  131 MET A O   
1120 C  CB  . MET A 132 ? 0.1153 0.1301 0.1074 0.0152  0.0317  0.0105  131 MET A CB  
1121 C  CG  . MET A 132 ? 0.1177 0.1424 0.1157 -0.0131 0.0400  0.0122  131 MET A CG  
1122 S  SD  . MET A 132 ? 0.1149 0.1638 0.1933 -0.0140 0.0061  0.0340  131 MET A SD  
1123 C  CE  . MET A 132 ? 0.1284 0.2168 0.1518 0.0084  0.0080  -0.0036 131 MET A CE  
1124 N  N   . GLU A 133 ? 0.1311 0.1295 0.1120 0.0176  0.0338  0.0114  132 GLU A N   
1125 C  CA  . GLU A 133 ? 0.1174 0.1652 0.1238 0.0166  0.0400  0.0055  132 GLU A CA  
1126 C  C   . GLU A 133 ? 0.1114 0.1622 0.1122 0.0087  0.0280  0.0060  132 GLU A C   
1127 O  O   . GLU A 133 ? 0.1078 0.1613 0.1011 0.0175  0.0270  0.0173  132 GLU A O   
1128 C  CB  . GLU A 133 ? 0.1528 0.1826 0.1440 0.0167  0.0165  -0.0084 132 GLU A CB  
1129 C  CG  . GLU A 133 ? 0.2176 0.2156 0.2225 0.0406  0.0285  -0.0084 132 GLU A CG  
1130 C  CD  . GLU A 133 ? 0.3183 0.3335 0.3304 0.0129  -0.0025 0.0039  132 GLU A CD  
1131 O  OE1 . GLU A 133 ? 0.3571 0.3818 0.3763 0.0106  0.0129  0.0135  132 GLU A OE1 
1132 O  OE2 . GLU A 133 ? 0.3929 0.3884 0.3537 0.0080  0.0011  0.0142  132 GLU A OE2 
1133 N  N   . PRO A 134 A 0.0947 0.1776 0.1095 0.0095  0.0223  0.0183  132 PRO A N   
1134 C  CA  . PRO A 134 A 0.1183 0.1720 0.1055 0.0001  0.0240  0.0057  132 PRO A CA  
1135 C  C   . PRO A 134 A 0.1192 0.1489 0.0993 0.0028  0.0197  0.0039  132 PRO A C   
1136 O  O   . PRO A 134 A 0.1574 0.1384 0.1066 0.0161  0.0279  -0.0114 132 PRO A O   
1137 C  CB  . PRO A 134 A 0.1309 0.1823 0.1497 0.0000  0.0127  0.0035  132 PRO A CB  
1138 C  CG  . PRO A 134 A 0.1434 0.2155 0.1980 -0.0007 0.0093  0.0151  132 PRO A CG  
1139 C  CD  . PRO A 134 A 0.1170 0.2050 0.1471 0.0085  0.0262  0.0144  132 PRO A CD  
1140 N  N   . GLN A 135 B 0.1106 0.1588 0.0921 0.0108  0.0328  -0.0098 132 GLN A N   
1141 C  CA  . GLN A 135 B 0.1096 0.1554 0.0966 0.0002  0.0306  -0.0050 132 GLN A CA  
1142 C  C   . GLN A 135 B 0.0991 0.1287 0.0955 0.0047  0.0297  -0.0001 132 GLN A C   
1143 O  O   . GLN A 135 B 0.1268 0.1815 0.0880 0.0100  0.0302  0.0126  132 GLN A O   
1144 C  CB  . GLN A 135 B 0.1251 0.1743 0.0958 -0.0029 0.0367  -0.0175 132 GLN A CB  
1145 C  CG  . GLN A 135 B 0.1409 0.2293 0.1191 -0.0060 0.0356  -0.0185 132 GLN A CG  
1146 C  CD  . GLN A 135 B 0.1315 0.2293 0.1568 0.0002  0.0557  -0.0258 132 GLN A CD  
1147 O  OE1 . GLN A 135 B 0.1320 0.2364 0.1628 0.0571  0.0109  -0.0278 132 GLN A OE1 
1148 N  NE2 . GLN A 135 B 0.1299 0.2725 0.2478 0.0111  0.0503  -0.0541 132 GLN A NE2 
1149 N  N   . GLU A 136 ? 0.1154 0.1163 0.0955 0.0053  0.0289  0.0022  133 GLU A N   
1150 C  CA  . GLU A 136 ? 0.1197 0.1096 0.1092 -0.0020 0.0233  -0.0044 133 GLU A CA  
1151 C  C   . GLU A 136 ? 0.1101 0.1089 0.0868 -0.0081 0.0300  0.0109  133 GLU A C   
1152 O  O   . GLU A 136 ? 0.0865 0.1184 0.1101 -0.0134 0.0262  -0.0008 133 GLU A O   
1153 C  CB  . GLU A 136 ? 0.1461 0.1170 0.1442 0.0095  0.0180  -0.0023 133 GLU A CB  
1154 C  CG  . GLU A 136 ? 0.1710 0.1564 0.1657 0.0236  0.0046  -0.0001 133 GLU A CG  
1155 C  CD  . GLU A 136 ? 0.2306 0.1912 0.1777 0.0240  0.0229  -0.0047 133 GLU A CD  
1156 O  OE1 . GLU A 136 ? 0.2281 0.2210 0.1991 -0.0128 -0.0223 -0.0273 133 GLU A OE1 
1157 O  OE2 . GLU A 136 ? 0.3144 0.2514 0.2457 0.0410  0.0306  -0.0347 133 GLU A OE2 
1158 N  N   . VAL A 137 ? 0.1004 0.1119 0.0855 -0.0010 0.0290  0.0008  134 VAL A N   
1159 C  CA  . VAL A 137 ? 0.1259 0.1021 0.0953 -0.0039 0.0207  -0.0003 134 VAL A CA  
1160 C  C   . VAL A 137 ? 0.1154 0.1114 0.1027 -0.0115 0.0422  -0.0061 134 VAL A C   
1161 O  O   . VAL A 137 ? 0.1173 0.1378 0.1476 -0.0237 0.0478  -0.0144 134 VAL A O   
1162 C  CB  . VAL A 137 ? 0.1207 0.1190 0.0811 0.0023  0.0215  0.0013  134 VAL A CB  
1163 C  CG1 . VAL A 137 ? 0.1265 0.1187 0.1037 0.0158  0.0248  -0.0168 134 VAL A CG1 
1164 C  CG2 . VAL A 137 ? 0.1544 0.1134 0.1355 0.0030  0.0200  0.0178  134 VAL A CG2 
1165 N  N   . GLU A 138 ? 0.1362 0.0890 0.1120 -0.0062 0.0406  0.0020  135 GLU A N   
1166 C  CA  . GLU A 138 ? 0.1423 0.1078 0.1121 -0.0025 0.0448  -0.0005 135 GLU A CA  
1167 C  C   . GLU A 138 ? 0.1364 0.0936 0.1082 0.0087  0.0326  0.0040  135 GLU A C   
1168 O  O   . GLU A 138 ? 0.1336 0.1056 0.1225 0.0045  0.0235  -0.0051 135 GLU A O   
1169 C  CB  . GLU A 138 ? 0.1968 0.1298 0.1277 0.0017  0.0352  0.0025  135 GLU A CB  
1170 C  CG  . GLU A 138 ? 0.2378 0.1768 0.1625 0.0132  0.0434  0.0143  135 GLU A CG  
1171 C  CD  . GLU A 138 ? 0.2609 0.2322 0.2444 -0.0128 0.0430  0.0223  135 GLU A CD  
1172 O  OE1 . GLU A 138 ? 0.2841 0.2668 0.3379 -0.0027 0.0567  -0.0203 135 GLU A OE1 
1173 O  OE2 . GLU A 138 ? 0.2594 0.2648 0.2361 -0.0163 0.0833  0.0191  135 GLU A OE2 
1174 N  N   . SER A 139 ? 0.1255 0.1124 0.1119 0.0059  0.0348  0.0058  136 SER A N   
1175 C  CA  . SER A 139 ? 0.1162 0.0961 0.1270 0.0002  0.0426  0.0043  136 SER A CA  
1176 C  C   . SER A 139 ? 0.1092 0.0932 0.1270 -0.0151 0.0368  0.0064  136 SER A C   
1177 O  O   . SER A 139 ? 0.1176 0.0950 0.1385 -0.0134 0.0444  -0.0043 136 SER A O   
1178 C  CB  . SER A 139 ? 0.1101 0.1113 0.1342 -0.0074 0.0352  0.0113  136 SER A CB  
1179 O  OG  . SER A 139 ? 0.1020 0.1212 0.1391 -0.0027 0.0228  -0.0076 136 SER A OG  
1180 N  N   . LEU A 140 ? 0.1319 0.1032 0.1226 -0.0023 0.0264  0.0069  137 LEU A N   
1181 C  CA  . LEU A 140 ? 0.1445 0.1038 0.1410 -0.0073 0.0148  0.0006  137 LEU A CA  
1182 C  C   . LEU A 140 ? 0.1338 0.1011 0.1300 -0.0050 0.0148  -0.0015 137 LEU A C   
1183 O  O   . LEU A 140 ? 0.1538 0.0887 0.1620 -0.0018 0.0091  0.0058  137 LEU A O   
1184 C  CB  . LEU A 140 ? 0.1638 0.1365 0.1527 -0.0044 -0.0098 -0.0149 137 LEU A CB  
1185 C  CG  . LEU A 140 ? 0.1979 0.1413 0.1899 -0.0242 -0.0100 -0.0123 137 LEU A CG  
1186 C  CD1 . LEU A 140 ? 0.1981 0.2089 0.2590 -0.0060 -0.0028 -0.0523 137 LEU A CD1 
1187 C  CD2 . LEU A 140 ? 0.2991 0.2314 0.2184 0.0012  -0.0144 -0.0204 137 LEU A CD2 
1188 N  N   . GLY A 141 ? 0.1376 0.1019 0.1509 -0.0204 0.0153  0.0116  138 GLY A N   
1189 C  CA  . GLY A 141 ? 0.1488 0.1046 0.1570 -0.0232 0.0244  0.0077  138 GLY A CA  
1190 C  C   . GLY A 141 ? 0.1322 0.0901 0.1573 -0.0239 0.0201  0.0084  138 GLY A C   
1191 O  O   . GLY A 141 ? 0.1731 0.1118 0.1759 -0.0547 0.0275  0.0020  138 GLY A O   
1192 N  N   . GLU A 142 ? 0.1126 0.0871 0.1394 -0.0189 0.0254  0.0179  139 GLU A N   
1193 C  CA  . GLU A 142 ? 0.0938 0.0872 0.1303 -0.0071 0.0160  0.0093  139 GLU A CA  
1194 C  C   . GLU A 142 ? 0.0890 0.0991 0.1402 -0.0059 0.0026  0.0056  139 GLU A C   
1195 O  O   . GLU A 142 ? 0.0993 0.0912 0.1490 0.0067  0.0125  0.0094  139 GLU A O   
1196 C  CB  . GLU A 142 ? 0.0962 0.0970 0.1330 -0.0177 0.0074  0.0137  139 GLU A CB  
1197 C  CG  . GLU A 142 ? 0.1201 0.1165 0.1659 0.0126  0.0121  0.0089  139 GLU A CG  
1198 C  CD  . GLU A 142 ? 0.1511 0.1397 0.1354 0.0013  0.0004  0.0091  139 GLU A CD  
1199 O  OE1 . GLU A 142 ? 0.1840 0.1431 0.1186 0.0286  0.0169  0.0177  139 GLU A OE1 
1200 O  OE2 . GLU A 142 ? 0.1877 0.1451 0.1876 -0.0045 0.0119  0.0277  139 GLU A OE2 
1201 N  N   . THR A 143 ? 0.0993 0.1047 0.1382 0.0040  0.0160  0.0092  140 THR A N   
1202 C  CA  . THR A 143 ? 0.1127 0.1117 0.1359 -0.0142 0.0105  0.0170  140 THR A CA  
1203 C  C   . THR A 143 ? 0.0889 0.0929 0.1170 -0.0127 0.0048  0.0051  140 THR A C   
1204 O  O   . THR A 143 ? 0.0913 0.0871 0.1352 -0.0063 -0.0024 0.0001  140 THR A O   
1205 C  CB  . THR A 143 ? 0.1412 0.1118 0.1824 -0.0382 -0.0073 0.0100  140 THR A CB  
1206 O  OG1 . THR A 143 ? 0.2040 0.1616 0.1883 0.0033  -0.0005 -0.0055 140 THR A OG1 
1207 C  CG2 . THR A 143 ? 0.1726 0.1405 0.2165 -0.0580 -0.0207 0.0246  140 THR A CG2 
1208 N  N   . TYR A 144 ? 0.0686 0.1034 0.1191 -0.0097 0.0039  0.0146  141 TYR A N   
1209 C  CA  . TYR A 144 ? 0.0628 0.1049 0.1261 -0.0008 0.0018  0.0149  141 TYR A CA  
1210 C  C   . TYR A 144 ? 0.0673 0.0919 0.1207 -0.0020 -0.0075 -0.0037 141 TYR A C   
1211 O  O   . TYR A 144 ? 0.0862 0.1089 0.1320 -0.0111 -0.0047 -0.0209 141 TYR A O   
1212 C  CB  . TYR A 144 ? 0.0618 0.1078 0.1296 -0.0005 -0.0006 0.0192  141 TYR A CB  
1213 C  CG  . TYR A 144 ? 0.0510 0.0754 0.1232 0.0124  -0.0079 0.0031  141 TYR A CG  
1214 C  CD1 . TYR A 144 ? 0.0845 0.0931 0.1093 -0.0070 -0.0200 -0.0081 141 TYR A CD1 
1215 C  CD2 . TYR A 144 ? 0.0428 0.0995 0.1170 0.0131  -0.0083 -0.0045 141 TYR A CD2 
1216 C  CE1 . TYR A 144 ? 0.0684 0.0924 0.1141 -0.0180 -0.0157 -0.0132 141 TYR A CE1 
1217 C  CE2 . TYR A 144 ? 0.0567 0.1058 0.1023 -0.0136 0.0070  -0.0038 141 TYR A CE2 
1218 C  CZ  . TYR A 144 ? 0.0536 0.0964 0.1066 -0.0156 -0.0055 -0.0052 141 TYR A CZ  
1219 O  OH  . TYR A 144 ? 0.0839 0.0821 0.1224 -0.0097 0.0003  -0.0086 141 TYR A OH  
1220 N  N   . ASP A 145 ? 0.0701 0.0769 0.1026 0.0000  -0.0020 0.0022  142 ASP A N   
1221 C  CA  . ASP A 145 ? 0.0813 0.0889 0.0803 0.0065  0.0005  -0.0039 142 ASP A CA  
1222 C  C   . ASP A 145 ? 0.0683 0.0907 0.0871 0.0037  -0.0021 -0.0092 142 ASP A C   
1223 O  O   . ASP A 145 ? 0.0705 0.0972 0.0892 -0.0034 0.0034  -0.0065 142 ASP A O   
1224 C  CB  . ASP A 145 ? 0.0700 0.1026 0.0947 0.0093  -0.0008 0.0024  142 ASP A CB  
1225 C  CG  . ASP A 145 ? 0.0950 0.0892 0.1009 0.0016  -0.0031 0.0164  142 ASP A CG  
1226 O  OD1 . ASP A 145 ? 0.0889 0.1104 0.1143 -0.0010 0.0029  -0.0046 142 ASP A OD1 
1227 O  OD2 . ASP A 145 ? 0.0669 0.0947 0.1042 0.0081  0.0122  0.0022  142 ASP A OD2 
1228 N  N   . PHE A 146 ? 0.0737 0.0872 0.0859 -0.0073 -0.0060 -0.0042 143 PHE A N   
1229 C  CA  . PHE A 146 ? 0.0693 0.1100 0.0863 -0.0057 -0.0085 0.0004  143 PHE A CA  
1230 C  C   . PHE A 146 ? 0.0848 0.1039 0.0873 -0.0078 -0.0032 -0.0057 143 PHE A C   
1231 O  O   . PHE A 146 ? 0.0730 0.1209 0.1102 -0.0119 -0.0109 0.0101  143 PHE A O   
1232 C  CB  . PHE A 146 ? 0.0923 0.1073 0.0939 -0.0151 -0.0125 -0.0069 143 PHE A CB  
1233 C  CG  . PHE A 146 ? 0.1000 0.0972 0.1061 -0.0035 -0.0080 -0.0198 143 PHE A CG  
1234 C  CD1 . PHE A 146 ? 0.0702 0.1087 0.1599 -0.0096 -0.0126 -0.0167 143 PHE A CD1 
1235 C  CD2 . PHE A 146 ? 0.0819 0.1164 0.1075 -0.0197 -0.0151 -0.0118 143 PHE A CD2 
1236 C  CE1 . PHE A 146 ? 0.1086 0.1315 0.1734 -0.0160 -0.0007 -0.0229 143 PHE A CE1 
1237 C  CE2 . PHE A 146 ? 0.0700 0.1372 0.1282 -0.0065 -0.0146 -0.0235 143 PHE A CE2 
1238 C  CZ  . PHE A 146 ? 0.1036 0.1327 0.1545 -0.0131 -0.0253 -0.0180 143 PHE A CZ  
1239 N  N   . ASP A 147 ? 0.0880 0.1094 0.0903 0.0051  -0.0052 -0.0060 144 ASP A N   
1240 C  CA  A ASP A 147 ? 0.0910 0.1025 0.0919 0.0087  0.0070  -0.0120 144 ASP A CA  
1241 C  CA  B ASP A 147 ? 0.0864 0.0960 0.0902 0.0088  0.0027  -0.0108 144 ASP A CA  
1242 C  C   . ASP A 147 ? 0.0785 0.0873 0.0795 0.0108  0.0046  -0.0042 144 ASP A C   
1243 O  O   . ASP A 147 ? 0.0697 0.0957 0.0990 -0.0009 0.0055  -0.0068 144 ASP A O   
1244 C  CB  A ASP A 147 ? 0.1115 0.1078 0.1059 0.0144  -0.0021 -0.0062 144 ASP A CB  
1245 C  CB  B ASP A 147 ? 0.0957 0.1016 0.1026 0.0159  -0.0041 -0.0118 144 ASP A CB  
1246 C  CG  A ASP A 147 ? 0.1628 0.1313 0.1355 0.0108  0.0146  -0.0003 144 ASP A CG  
1247 C  CG  B ASP A 147 ? 0.1259 0.0908 0.1112 0.0118  -0.0074 -0.0080 144 ASP A CG  
1248 O  OD1 A ASP A 147 ? 0.1364 0.1738 0.1373 0.0149  0.0181  0.0012  144 ASP A OD1 
1249 O  OD1 B ASP A 147 ? 0.1820 0.1245 0.1219 0.0093  -0.0086 -0.0225 144 ASP A OD1 
1250 O  OD2 A ASP A 147 ? 0.1643 0.1792 0.1502 0.0166  0.0370  0.0089  144 ASP A OD2 
1251 O  OD2 B ASP A 147 ? 0.1813 0.0892 0.1203 0.0087  -0.0236 -0.0116 144 ASP A OD2 
1252 N  N   . SER A 148 ? 0.0802 0.0849 0.0764 -0.0011 -0.0081 -0.0043 145 SER A N   
1253 C  CA  . SER A 148 ? 0.0718 0.0909 0.0689 -0.0021 -0.0002 0.0025  145 SER A CA  
1254 C  C   . SER A 148 ? 0.0742 0.0844 0.0801 0.0105  0.0052  0.0007  145 SER A C   
1255 O  O   . SER A 148 ? 0.0817 0.0817 0.0725 0.0123  -0.0056 0.0032  145 SER A O   
1256 C  CB  . SER A 148 ? 0.0928 0.0885 0.0605 0.0108  0.0080  -0.0011 145 SER A CB  
1257 O  OG  . SER A 148 ? 0.0674 0.1013 0.0799 0.0001  0.0056  -0.0090 145 SER A OG  
1258 N  N   . ILE A 149 ? 0.0693 0.0767 0.0922 0.0061  0.0036  -0.0104 146 ILE A N   
1259 C  CA  . ILE A 149 ? 0.0768 0.0746 0.1268 0.0138  0.0106  -0.0084 146 ILE A CA  
1260 C  C   . ILE A 149 ? 0.0802 0.0780 0.0914 -0.0012 -0.0030 -0.0015 146 ILE A C   
1261 O  O   . ILE A 149 ? 0.0529 0.0861 0.0892 -0.0029 0.0028  -0.0099 146 ILE A O   
1262 C  CB  . ILE A 149 ? 0.0792 0.1021 0.1770 0.0194  0.0059  0.0032  146 ILE A CB  
1263 C  CG1 . ILE A 149 ? 0.0907 0.1371 0.2448 0.0085  0.0267  -0.0028 146 ILE A CG1 
1264 C  CG2 . ILE A 149 ? 0.1374 0.1259 0.2019 0.0256  -0.0121 -0.0276 146 ILE A CG2 
1265 C  CD1 . ILE A 149 ? 0.2382 0.1284 0.1410 -0.0086 0.0631  0.0004  146 ILE A CD1 
1266 N  N   . MET A 150 ? 0.0681 0.0802 0.0770 0.0160  -0.0008 -0.0055 147 MET A N   
1267 C  CA  . MET A 150 ? 0.0728 0.0830 0.0718 0.0144  0.0009  0.0043  147 MET A CA  
1268 C  C   . MET A 150 ? 0.0669 0.0743 0.0552 0.0067  0.0031  0.0043  147 MET A C   
1269 O  O   . MET A 150 ? 0.0709 0.0829 0.0855 0.0216  0.0053  -0.0016 147 MET A O   
1270 C  CB  . MET A 150 ? 0.0854 0.1028 0.0780 0.0160  -0.0014 0.0119  147 MET A CB  
1271 C  CG  . MET A 150 ? 0.0717 0.0836 0.1002 0.0012  -0.0120 0.0201  147 MET A CG  
1272 S  SD  . MET A 150 ? 0.0843 0.0950 0.0912 0.0096  -0.0191 -0.0040 147 MET A SD  
1273 C  CE  . MET A 150 ? 0.1283 0.0786 0.1177 0.0270  -0.0121 -0.0085 147 MET A CE  
1274 N  N   . HIS A 151 ? 0.0653 0.0821 0.0690 0.0048  -0.0083 0.0012  148 HIS A N   
1275 C  CA  . HIS A 151 ? 0.0718 0.0885 0.0872 0.0040  -0.0071 0.0030  148 HIS A CA  
1276 C  C   . HIS A 151 ? 0.0607 0.0980 0.0697 0.0059  -0.0028 0.0000  148 HIS A C   
1277 O  O   . HIS A 151 ? 0.0802 0.1169 0.0773 0.0138  0.0126  0.0089  148 HIS A O   
1278 C  CB  . HIS A 151 ? 0.0707 0.0900 0.0903 -0.0080 -0.0078 -0.0004 148 HIS A CB  
1279 C  CG  . HIS A 151 ? 0.0625 0.0964 0.0866 0.0079  -0.0194 -0.0081 148 HIS A CG  
1280 N  ND1 . HIS A 151 ? 0.0711 0.1058 0.0903 0.0130  -0.0165 0.0022  148 HIS A ND1 
1281 C  CD2 . HIS A 151 ? 0.0516 0.1087 0.0868 -0.0050 -0.0152 -0.0158 148 HIS A CD2 
1282 C  CE1 . HIS A 151 ? 0.0577 0.1035 0.1108 -0.0131 0.0063  0.0029  148 HIS A CE1 
1283 N  NE2 . HIS A 151 ? 0.0640 0.1034 0.1037 -0.0124 -0.0055 -0.0037 148 HIS A NE2 
1284 N  N   . TYR A 152 ? 0.0843 0.0929 0.0703 0.0104  -0.0086 0.0105  149 TYR A N   
1285 C  CA  . TYR A 152 ? 0.0813 0.0981 0.0586 0.0125  0.0045  0.0046  149 TYR A CA  
1286 C  C   . TYR A 152 ? 0.0805 0.0942 0.0623 0.0047  -0.0006 -0.0012 149 TYR A C   
1287 O  O   . TYR A 152 ? 0.0980 0.0928 0.0718 0.0010  -0.0041 -0.0044 149 TYR A O   
1288 C  CB  . TYR A 152 ? 0.0978 0.1060 0.0852 0.0137  -0.0062 -0.0049 149 TYR A CB  
1289 C  CG  . TYR A 152 ? 0.1172 0.1204 0.0741 0.0162  0.0062  0.0060  149 TYR A CG  
1290 C  CD1 . TYR A 152 ? 0.1227 0.1085 0.0874 0.0024  0.0083  -0.0047 149 TYR A CD1 
1291 C  CD2 . TYR A 152 ? 0.1269 0.1124 0.1164 0.0085  0.0051  -0.0080 149 TYR A CD2 
1292 C  CE1 . TYR A 152 ? 0.1501 0.1535 0.1005 0.0202  0.0021  -0.0187 149 TYR A CE1 
1293 C  CE2 . TYR A 152 ? 0.1428 0.1369 0.1229 0.0060  0.0188  -0.0156 149 TYR A CE2 
1294 C  CZ  . TYR A 152 ? 0.1525 0.1191 0.1079 -0.0020 0.0103  -0.0158 149 TYR A CZ  
1295 O  OH  . TYR A 152 ? 0.1845 0.1476 0.1525 0.0268  0.0086  -0.0422 149 TYR A OH  
1296 N  N   . ALA A 153 ? 0.0893 0.0895 0.0572 0.0035  -0.0063 0.0050  150 ALA A N   
1297 C  CA  . ALA A 153 ? 0.0830 0.1212 0.0520 0.0119  -0.0137 0.0115  150 ALA A CA  
1298 C  C   . ALA A 153 ? 0.0979 0.1111 0.0696 0.0120  -0.0118 -0.0013 150 ALA A C   
1299 O  O   . ALA A 153 ? 0.1039 0.1328 0.0798 0.0225  -0.0081 -0.0130 150 ALA A O   
1300 C  CB  . ALA A 153 ? 0.0926 0.1231 0.0646 -0.0014 -0.0031 0.0040  150 ALA A CB  
1301 N  N   . ARG A 154 ? 0.0920 0.0984 0.0651 0.0030  -0.0297 0.0007  151 ARG A N   
1302 C  CA  . ARG A 154 ? 0.0904 0.1002 0.0757 0.0089  -0.0214 -0.0048 151 ARG A CA  
1303 C  C   . ARG A 154 ? 0.0963 0.0897 0.0885 0.0018  -0.0137 -0.0116 151 ARG A C   
1304 O  O   . ARG A 154 ? 0.0980 0.1081 0.0992 0.0132  -0.0049 0.0075  151 ARG A O   
1305 C  CB  . ARG A 154 ? 0.1075 0.1179 0.0876 -0.0018 -0.0122 -0.0159 151 ARG A CB  
1306 C  CG  . ARG A 154 ? 0.1268 0.1092 0.0748 0.0047  -0.0030 -0.0020 151 ARG A CG  
1307 C  CD  . ARG A 154 ? 0.1147 0.1272 0.0921 0.0129  -0.0188 -0.0123 151 ARG A CD  
1308 N  NE  . ARG A 154 ? 0.1364 0.1594 0.0928 0.0225  -0.0325 -0.0173 151 ARG A NE  
1309 C  CZ  . ARG A 154 ? 0.1468 0.1495 0.1347 0.0288  -0.0273 -0.0242 151 ARG A CZ  
1310 N  NH1 . ARG A 154 ? 0.1753 0.1730 0.1438 0.0296  -0.0180 -0.0556 151 ARG A NH1 
1311 N  NH2 . ARG A 154 ? 0.1709 0.1559 0.1374 0.0199  -0.0533 -0.0336 151 ARG A NH2 
1312 N  N   . ASN A 155 ? 0.0947 0.0819 0.0755 0.0105  -0.0153 0.0064  152 ASN A N   
1313 C  CA  . ASN A 155 ? 0.0978 0.0828 0.0779 0.0005  -0.0113 -0.0030 152 ASN A CA  
1314 C  C   . ASN A 155 ? 0.0780 0.1036 0.0782 0.0034  -0.0092 0.0030  152 ASN A C   
1315 O  O   . ASN A 155 ? 0.1168 0.0929 0.0975 0.0005  -0.0193 0.0115  152 ASN A O   
1316 C  CB  . ASN A 155 ? 0.1031 0.1175 0.0845 0.0086  -0.0049 0.0000  152 ASN A CB  
1317 C  CG  . ASN A 155 ? 0.1065 0.1426 0.0689 -0.0122 -0.0030 -0.0041 152 ASN A CG  
1318 O  OD1 . ASN A 155 ? 0.0891 0.1776 0.0849 0.0055  -0.0188 0.0105  152 ASN A OD1 
1319 N  ND2 . ASN A 155 ? 0.1588 0.1575 0.0880 -0.0144 0.0151  0.0194  152 ASN A ND2 
1320 N  N   . THR A 156 ? 0.0893 0.1070 0.0809 -0.0053 -0.0114 -0.0004 153 THR A N   
1321 C  CA  A THR A 156 ? 0.1016 0.1150 0.0763 0.0043  -0.0159 -0.0096 153 THR A CA  
1322 C  CA  B THR A 156 ? 0.1142 0.1314 0.0984 -0.0040 -0.0100 -0.0069 153 THR A CA  
1323 C  C   . THR A 156 ? 0.0966 0.1134 0.0882 -0.0063 -0.0133 -0.0087 153 THR A C   
1324 O  O   . THR A 156 ? 0.0923 0.1297 0.1194 -0.0127 -0.0049 -0.0213 153 THR A O   
1325 C  CB  A THR A 156 ? 0.1259 0.1142 0.0698 0.0124  -0.0108 -0.0125 153 THR A CB  
1326 C  CB  B THR A 156 ? 0.1446 0.1592 0.1121 -0.0005 -0.0092 -0.0030 153 THR A CB  
1327 O  OG1 A THR A 156 ? 0.1046 0.1001 0.0828 0.0216  -0.0121 -0.0071 153 THR A OG1 
1328 O  OG1 B THR A 156 ? 0.1863 0.2251 0.1757 -0.0099 -0.0081 -0.0037 153 THR A OG1 
1329 C  CG2 A THR A 156 ? 0.1087 0.1198 0.0358 0.0202  -0.0266 -0.0131 153 THR A CG2 
1330 C  CG2 B THR A 156 ? 0.1263 0.1404 0.0875 -0.0083 0.0043  0.0077  153 THR A CG2 
1331 N  N   . PHE A 157 ? 0.1130 0.1137 0.0929 -0.0119 -0.0108 -0.0136 154 PHE A N   
1332 C  CA  . PHE A 157 ? 0.1179 0.1215 0.0940 -0.0078 -0.0171 -0.0240 154 PHE A CA  
1333 C  C   . PHE A 157 ? 0.1259 0.1241 0.1062 -0.0061 -0.0174 -0.0172 154 PHE A C   
1334 O  O   . PHE A 157 ? 0.1408 0.1039 0.1177 0.0183  -0.0258 -0.0248 154 PHE A O   
1335 C  CB  . PHE A 157 ? 0.1265 0.1407 0.0857 -0.0084 -0.0119 -0.0075 154 PHE A CB  
1336 C  CG  . PHE A 157 ? 0.1206 0.1381 0.0811 0.0102  -0.0037 -0.0048 154 PHE A CG  
1337 C  CD1 . PHE A 157 ? 0.1432 0.1722 0.1241 -0.0037 -0.0241 -0.0232 154 PHE A CD1 
1338 C  CD2 . PHE A 157 ? 0.1691 0.1704 0.0836 0.0255  0.0033  -0.0068 154 PHE A CD2 
1339 C  CE1 . PHE A 157 ? 0.1857 0.1933 0.1267 -0.0166 -0.0296 -0.0241 154 PHE A CE1 
1340 C  CE2 . PHE A 157 ? 0.1435 0.1826 0.1196 0.0334  0.0138  -0.0073 154 PHE A CE2 
1341 C  CZ  . PHE A 157 ? 0.1583 0.2081 0.1299 0.0107  -0.0177 -0.0127 154 PHE A CZ  
1342 N  N   . SER A 158 ? 0.1402 0.1311 0.1051 -0.0053 -0.0250 -0.0083 155 SER A N   
1343 C  CA  . SER A 158 ? 0.1474 0.1246 0.1032 -0.0023 -0.0315 0.0024  155 SER A CA  
1344 C  C   . SER A 158 ? 0.1606 0.1304 0.1238 -0.0090 -0.0208 0.0038  155 SER A C   
1345 O  O   . SER A 158 ? 0.1657 0.1381 0.1563 -0.0151 -0.0166 0.0170  155 SER A O   
1346 C  CB  . SER A 158 ? 0.1327 0.1333 0.1140 -0.0049 -0.0428 -0.0002 155 SER A CB  
1347 O  OG  . SER A 158 ? 0.1134 0.1537 0.1006 0.0090  -0.0277 0.0138  155 SER A OG  
1348 N  N   . ARG A 159 ? 0.1807 0.1263 0.1250 0.0056  -0.0103 0.0125  156 ARG A N   
1349 C  CA  A ARG A 159 ? 0.1980 0.1428 0.1513 0.0015  -0.0055 0.0121  156 ARG A CA  
1350 C  CA  B ARG A 159 ? 0.1902 0.1346 0.1510 0.0040  -0.0083 0.0115  156 ARG A CA  
1351 C  C   . ARG A 159 ? 0.2044 0.1351 0.1499 -0.0026 -0.0060 0.0103  156 ARG A C   
1352 O  O   . ARG A 159 ? 0.2383 0.1373 0.1725 -0.0046 0.0097  0.0286  156 ARG A O   
1353 C  CB  A ARG A 159 ? 0.2059 0.1449 0.1616 0.0110  -0.0070 0.0259  156 ARG A CB  
1354 C  CB  B ARG A 159 ? 0.1832 0.1117 0.1631 0.0067  -0.0156 0.0144  156 ARG A CB  
1355 C  CG  A ARG A 159 ? 0.2398 0.1794 0.1837 0.0036  0.0042  0.0143  156 ARG A CG  
1356 C  CG  B ARG A 159 ? 0.1774 0.1363 0.1744 0.0151  -0.0139 0.0141  156 ARG A CG  
1357 C  CD  A ARG A 159 ? 0.2364 0.1968 0.1984 0.0157  0.0045  0.0068  156 ARG A CD  
1358 C  CD  B ARG A 159 ? 0.2130 0.1979 0.2705 0.0112  -0.0068 0.0117  156 ARG A CD  
1359 N  NE  A ARG A 159 ? 0.2117 0.1799 0.1991 0.0213  0.0093  0.0313  156 ARG A NE  
1360 N  NE  B ARG A 159 ? 0.3278 0.3301 0.3161 0.0030  -0.0124 0.0005  156 ARG A NE  
1361 C  CZ  A ARG A 159 ? 0.1991 0.2005 0.1901 0.0013  0.0055  0.0186  156 ARG A CZ  
1362 C  CZ  B ARG A 159 ? 0.3415 0.3485 0.3541 -0.0010 -0.0063 -0.0130 156 ARG A CZ  
1363 N  NH1 A ARG A 159 ? 0.2067 0.2469 0.1811 0.0166  0.0071  0.0102  156 ARG A NH1 
1364 N  NH1 B ARG A 159 ? 0.3880 0.3717 0.3848 0.0029  0.0125  0.0037  156 ARG A NH1 
1365 N  NH2 A ARG A 159 ? 0.2748 0.2424 0.2472 0.0084  0.0237  0.0016  156 ARG A NH2 
1366 N  NH2 B ARG A 159 ? 0.3765 0.3833 0.3683 -0.0007 0.0025  -0.0034 156 ARG A NH2 
1367 N  N   . GLY A 160 ? 0.1915 0.1301 0.1256 -0.0026 -0.0129 0.0051  157 GLY A N   
1368 C  CA  . GLY A 160 ? 0.2161 0.1531 0.1374 -0.0070 -0.0097 0.0062  157 GLY A CA  
1369 C  C   . GLY A 160 ? 0.1961 0.1305 0.1367 -0.0273 -0.0195 -0.0117 157 GLY A C   
1370 O  O   . GLY A 160 ? 0.1960 0.1279 0.1295 -0.0234 -0.0098 0.0027  157 GLY A O   
1371 N  N   . ILE A 161 ? 0.1744 0.1650 0.1349 -0.0252 -0.0089 0.0012  159 ILE A N   
1372 C  CA  . ILE A 161 ? 0.1721 0.1833 0.1401 -0.0163 -0.0059 -0.0014 159 ILE A CA  
1373 C  C   . ILE A 161 ? 0.1636 0.1588 0.1158 -0.0205 -0.0189 0.0025  159 ILE A C   
1374 O  O   . ILE A 161 ? 0.1806 0.1667 0.1144 -0.0161 -0.0258 0.0165  159 ILE A O   
1375 C  CB  . ILE A 161 ? 0.1746 0.2135 0.1575 -0.0183 0.0013  0.0009  159 ILE A CB  
1376 C  CG1 . ILE A 161 ? 0.2069 0.2375 0.2409 -0.0033 0.0062  0.0070  159 ILE A CG1 
1377 C  CG2 . ILE A 161 ? 0.2273 0.2665 0.1842 -0.0139 -0.0037 0.0006  159 ILE A CG2 
1378 C  CD1 . ILE A 161 ? 0.2543 0.3163 0.2845 -0.0197 0.0288  0.0026  159 ILE A CD1 
1379 N  N   . PHE A 162 ? 0.1527 0.1651 0.0968 -0.0141 -0.0096 0.0036  160 PHE A N   
1380 C  CA  . PHE A 162 ? 0.1451 0.1563 0.0913 -0.0102 -0.0312 0.0034  160 PHE A CA  
1381 C  C   . PHE A 162 ? 0.1376 0.1367 0.0999 -0.0021 -0.0292 -0.0022 160 PHE A C   
1382 O  O   . PHE A 162 ? 0.1433 0.1545 0.1061 -0.0041 -0.0459 -0.0136 160 PHE A O   
1383 C  CB  . PHE A 162 ? 0.1723 0.1857 0.1003 -0.0128 -0.0118 -0.0024 160 PHE A CB  
1384 C  CG  . PHE A 162 ? 0.1850 0.2135 0.1328 -0.0191 -0.0144 -0.0030 160 PHE A CG  
1385 C  CD1 . PHE A 162 ? 0.1806 0.2517 0.1687 -0.0120 -0.0091 -0.0162 160 PHE A CD1 
1386 C  CD2 . PHE A 162 ? 0.2225 0.2514 0.2004 -0.0173 0.0111  0.0061  160 PHE A CD2 
1387 C  CE1 . PHE A 162 ? 0.2098 0.2400 0.1803 -0.0229 -0.0001 -0.0292 160 PHE A CE1 
1388 C  CE2 . PHE A 162 ? 0.2348 0.2758 0.2163 -0.0169 0.0222  -0.0051 160 PHE A CE2 
1389 C  CZ  . PHE A 162 ? 0.2271 0.2703 0.1866 -0.0080 0.0218  -0.0152 160 PHE A CZ  
1390 N  N   . LEU A 163 ? 0.1555 0.1279 0.0790 0.0112  -0.0340 0.0109  161 LEU A N   
1391 C  CA  . LEU A 163 ? 0.1609 0.1312 0.0897 0.0072  -0.0240 0.0133  161 LEU A CA  
1392 C  C   . LEU A 163 ? 0.1464 0.1323 0.0896 0.0001  -0.0321 0.0113  161 LEU A C   
1393 O  O   . LEU A 163 ? 0.1824 0.1473 0.0927 -0.0146 -0.0589 0.0058  161 LEU A O   
1394 C  CB  . LEU A 163 ? 0.1592 0.1354 0.1010 0.0162  -0.0341 0.0206  161 LEU A CB  
1395 C  CG  . LEU A 163 ? 0.1505 0.1566 0.1327 -0.0060 -0.0201 0.0354  161 LEU A CG  
1396 C  CD1 . LEU A 163 ? 0.2217 0.1774 0.2023 0.0150  -0.0281 0.0236  161 LEU A CD1 
1397 C  CD2 . LEU A 163 ? 0.1230 0.2004 0.1376 -0.0073 -0.0351 0.0140  161 LEU A CD2 
1398 N  N   . ASP A 164 ? 0.1121 0.1156 0.0937 -0.0027 -0.0243 0.0080  162 ASP A N   
1399 C  CA  . ASP A 164 ? 0.1146 0.1192 0.0924 0.0002  -0.0306 0.0046  162 ASP A CA  
1400 C  C   . ASP A 164 ? 0.0825 0.1243 0.0993 0.0150  -0.0317 0.0106  162 ASP A C   
1401 O  O   . ASP A 164 ? 0.0927 0.1835 0.0992 0.0263  -0.0284 0.0082  162 ASP A O   
1402 C  CB  . ASP A 164 ? 0.1142 0.1186 0.1086 -0.0012 -0.0338 -0.0092 162 ASP A CB  
1403 C  CG  . ASP A 164 ? 0.1468 0.1205 0.1201 0.0106  -0.0369 -0.0059 162 ASP A CG  
1404 O  OD1 . ASP A 164 ? 0.1512 0.1325 0.1093 0.0111  -0.0008 -0.0064 162 ASP A OD1 
1405 O  OD2 . ASP A 164 ? 0.1656 0.1542 0.1499 0.0000  -0.0350 -0.0336 162 ASP A OD2 
1406 N  N   . THR A 165 ? 0.0944 0.1110 0.0892 -0.0048 -0.0179 0.0099  163 THR A N   
1407 C  CA  . THR A 165 ? 0.0773 0.1007 0.0923 -0.0156 -0.0154 -0.0005 163 THR A CA  
1408 C  C   . THR A 165 ? 0.0854 0.0998 0.0905 -0.0024 -0.0187 -0.0064 163 THR A C   
1409 O  O   . THR A 165 ? 0.0793 0.1112 0.1010 0.0010  -0.0112 0.0065  163 THR A O   
1410 C  CB  . THR A 165 ? 0.0887 0.1004 0.1169 -0.0047 -0.0140 -0.0074 163 THR A CB  
1411 O  OG1 . THR A 165 ? 0.0754 0.1228 0.1132 0.0071  -0.0135 -0.0066 163 THR A OG1 
1412 C  CG2 . THR A 165 ? 0.1314 0.1052 0.1167 0.0059  -0.0093 -0.0028 163 THR A CG2 
1413 N  N   . ILE A 166 ? 0.0894 0.0894 0.1080 -0.0016 -0.0295 0.0065  164 ILE A N   
1414 C  CA  . ILE A 166 ? 0.1016 0.1020 0.1223 -0.0127 -0.0257 0.0021  164 ILE A CA  
1415 C  C   . ILE A 166 ? 0.0994 0.0909 0.1271 -0.0105 -0.0064 -0.0060 164 ILE A C   
1416 O  O   . ILE A 166 ? 0.1106 0.1151 0.1248 -0.0282 0.0092  -0.0102 164 ILE A O   
1417 C  CB  . ILE A 166 ? 0.0890 0.1020 0.1254 -0.0061 -0.0279 0.0146  164 ILE A CB  
1418 C  CG1 . ILE A 166 ? 0.1384 0.1291 0.1434 0.0019  -0.0552 -0.0006 164 ILE A CG1 
1419 C  CG2 . ILE A 166 ? 0.1358 0.1021 0.1303 -0.0023 -0.0179 0.0273  164 ILE A CG2 
1420 C  CD1 . ILE A 166 ? 0.1467 0.1735 0.1831 0.0055  -0.0533 0.0028  164 ILE A CD1 
1421 N  N   . VAL A 167 ? 0.1082 0.1085 0.1266 -0.0174 -0.0178 -0.0025 165 VAL A N   
1422 C  CA  . VAL A 167 ? 0.1260 0.1113 0.1308 -0.0167 -0.0244 0.0007  165 VAL A CA  
1423 C  C   . VAL A 167 ? 0.1079 0.1075 0.1246 -0.0240 -0.0201 -0.0057 165 VAL A C   
1424 O  O   . VAL A 167 ? 0.1015 0.1290 0.1328 -0.0136 -0.0052 -0.0039 165 VAL A O   
1425 C  CB  . VAL A 167 ? 0.1545 0.1133 0.1299 -0.0140 -0.0299 -0.0091 165 VAL A CB  
1426 C  CG1 . VAL A 167 ? 0.1740 0.1711 0.1588 -0.0160 -0.0318 -0.0112 165 VAL A CG1 
1427 C  CG2 . VAL A 167 ? 0.1604 0.1361 0.1659 -0.0048 -0.0242 0.0026  165 VAL A CG2 
1428 N  N   . PRO A 168 ? 0.1173 0.1060 0.1192 -0.0199 -0.0076 -0.0033 166 PRO A N   
1429 C  CA  . PRO A 168 ? 0.1312 0.1088 0.1496 -0.0222 -0.0078 -0.0019 166 PRO A CA  
1430 C  C   . PRO A 168 ? 0.1459 0.1267 0.1383 -0.0325 -0.0152 -0.0127 166 PRO A C   
1431 O  O   . PRO A 168 ? 0.1653 0.1464 0.1422 -0.0465 -0.0161 -0.0143 166 PRO A O   
1432 C  CB  . PRO A 168 ? 0.1490 0.1136 0.1595 -0.0096 -0.0095 -0.0059 166 PRO A CB  
1433 C  CG  . PRO A 168 ? 0.1420 0.1192 0.1892 0.0137  0.0135  0.0135  166 PRO A CG  
1434 C  CD  . PRO A 168 ? 0.1163 0.1114 0.1541 -0.0003 -0.0042 0.0036  166 PRO A CD  
1435 N  N   . LYS A 169 ? 0.1401 0.1211 0.1453 -0.0436 -0.0145 -0.0223 167 LYS A N   
1436 C  CA  . LYS A 169 ? 0.1464 0.1495 0.1710 -0.0417 -0.0107 -0.0295 167 LYS A CA  
1437 C  C   . LYS A 169 ? 0.1568 0.1486 0.1755 -0.0472 -0.0117 -0.0311 167 LYS A C   
1438 O  O   . LYS A 169 ? 0.1655 0.1957 0.2039 -0.0663 -0.0315 -0.0389 167 LYS A O   
1439 C  CB  . LYS A 169 ? 0.1541 0.1457 0.1659 -0.0257 -0.0011 -0.0268 167 LYS A CB  
1440 C  CG  . LYS A 169 ? 0.1829 0.1456 0.1922 -0.0100 -0.0009 -0.0316 167 LYS A CG  
1441 C  CD  . LYS A 169 ? 0.2296 0.1779 0.1943 0.0129  0.0069  -0.0123 167 LYS A CD  
1442 C  CE  . LYS A 169 ? 0.2229 0.1860 0.2190 -0.0013 -0.0113 -0.0174 167 LYS A CE  
1443 N  NZ  . LYS A 169 ? 0.2041 0.2552 0.2441 0.0181  -0.0172 -0.0109 167 LYS A NZ  
1444 N  N   . TYR A 170 ? 0.1815 0.1426 0.1903 -0.0434 -0.0168 -0.0374 168 TYR A N   
1445 C  CA  . TYR A 170 ? 0.1971 0.1426 0.2074 -0.0409 -0.0029 -0.0332 168 TYR A CA  
1446 C  C   . TYR A 170 ? 0.2126 0.1623 0.2168 -0.0454 0.0026  -0.0389 168 TYR A C   
1447 O  O   . TYR A 170 ? 0.2031 0.1574 0.2386 -0.0414 0.0161  -0.0492 168 TYR A O   
1448 C  CB  . TYR A 170 ? 0.1927 0.1486 0.1873 -0.0343 -0.0088 -0.0367 168 TYR A CB  
1449 C  CG  . TYR A 170 ? 0.1502 0.1499 0.1939 -0.0481 -0.0008 -0.0306 168 TYR A CG  
1450 C  CD1 . TYR A 170 ? 0.1710 0.1373 0.2019 -0.0468 0.0136  0.0001  168 TYR A CD1 
1451 C  CD2 . TYR A 170 ? 0.1669 0.1094 0.1746 -0.0302 0.0172  -0.0118 168 TYR A CD2 
1452 C  CE1 . TYR A 170 ? 0.1520 0.1397 0.1897 -0.0361 0.0091  -0.0144 168 TYR A CE1 
1453 C  CE2 . TYR A 170 ? 0.1474 0.1055 0.1789 -0.0272 0.0003  -0.0151 168 TYR A CE2 
1454 C  CZ  . TYR A 170 ? 0.1665 0.1061 0.1664 -0.0116 0.0033  -0.0013 168 TYR A CZ  
1455 O  OH  . TYR A 170 ? 0.1688 0.1513 0.1915 -0.0207 0.0075  -0.0064 168 TYR A OH  
1456 N  N   . GLU A 171 A 0.2316 0.1695 0.2344 -0.0247 0.0132  -0.0441 168 GLU A N   
1457 C  CA  . GLU A 171 A 0.2518 0.1867 0.2416 -0.0250 0.0172  -0.0437 168 GLU A CA  
1458 C  C   . GLU A 171 A 0.2611 0.1896 0.2503 -0.0173 0.0251  -0.0366 168 GLU A C   
1459 O  O   . GLU A 171 A 0.2625 0.1710 0.2688 -0.0272 0.0442  -0.0349 168 GLU A O   
1460 C  CB  . GLU A 171 A 0.2686 0.1958 0.2476 -0.0146 0.0160  -0.0483 168 GLU A CB  
1461 C  CG  . GLU A 171 A 0.3200 0.2541 0.2743 -0.0042 0.0029  -0.0301 168 GLU A CG  
1462 C  CD  . GLU A 171 A 0.3793 0.3554 0.3284 0.0017  0.0018  -0.0281 168 GLU A CD  
1463 O  OE1 . GLU A 171 A 0.4442 0.3959 0.3785 -0.0002 -0.0007 -0.0092 168 GLU A OE1 
1464 O  OE2 . GLU A 171 A 0.4255 0.3733 0.4065 -0.0028 0.0019  -0.0234 168 GLU A OE2 
1465 N  N   . VAL A 172 B 0.2683 0.2189 0.2726 -0.0151 0.0319  -0.0273 168 VAL A N   
1466 C  CA  . VAL A 172 B 0.2843 0.2662 0.3042 -0.0010 0.0312  -0.0179 168 VAL A CA  
1467 C  C   . VAL A 172 B 0.3064 0.2894 0.3241 -0.0005 0.0333  -0.0154 168 VAL A C   
1468 O  O   . VAL A 172 B 0.3141 0.3036 0.3391 -0.0012 0.0443  -0.0112 168 VAL A O   
1469 C  CB  . VAL A 172 B 0.2876 0.2754 0.3009 0.0033  0.0288  -0.0129 168 VAL A CB  
1470 C  CG1 . VAL A 172 B 0.2895 0.2911 0.3311 0.0054  0.0172  -0.0035 168 VAL A CG1 
1471 C  CG2 . VAL A 172 B 0.2546 0.2465 0.2970 -0.0002 0.0281  -0.0186 168 VAL A CG2 
1472 N  N   . ASN A 173 C 0.3371 0.3109 0.3489 0.0058  0.0313  -0.0146 168 ASN A N   
1473 C  CA  . ASN A 173 C 0.3633 0.3421 0.3667 0.0052  0.0213  -0.0153 168 ASN A CA  
1474 C  C   . ASN A 173 C 0.3640 0.3393 0.3641 0.0003  0.0226  -0.0139 168 ASN A C   
1475 O  O   . ASN A 173 C 0.3819 0.3713 0.3832 -0.0009 0.0330  -0.0048 168 ASN A O   
1476 C  CB  . ASN A 173 C 0.3734 0.3526 0.3878 0.0082  0.0188  -0.0122 168 ASN A CB  
1477 C  CG  . ASN A 173 C 0.4147 0.4042 0.4120 0.0063  0.0069  -0.0036 168 ASN A CG  
1478 O  OD1 . ASN A 173 C 0.4543 0.4532 0.4773 -0.0098 0.0001  -0.0049 168 ASN A OD1 
1479 N  ND2 . ASN A 173 C 0.4348 0.4346 0.4514 0.0011  -0.0018 -0.0188 168 ASN A ND2 
1480 N  N   . GLY A 174 D 0.3619 0.3225 0.3471 -0.0080 0.0133  -0.0147 168 GLY A N   
1481 C  CA  . GLY A 174 D 0.3622 0.3244 0.3381 -0.0125 0.0080  -0.0174 168 GLY A CA  
1482 C  C   . GLY A 174 D 0.3548 0.3086 0.3182 -0.0186 0.0023  -0.0241 168 GLY A C   
1483 O  O   . GLY A 174 D 0.3685 0.3169 0.3230 -0.0236 0.0007  -0.0344 168 GLY A O   
1484 N  N   . VAL A 175 ? 0.3363 0.2958 0.3036 -0.0200 0.0066  -0.0284 169 VAL A N   
1485 C  CA  . VAL A 175 ? 0.3112 0.2871 0.2790 -0.0182 0.0092  -0.0208 169 VAL A CA  
1486 C  C   . VAL A 175 ? 0.2905 0.2648 0.2565 -0.0291 -0.0062 -0.0217 169 VAL A C   
1487 O  O   . VAL A 175 ? 0.2879 0.2307 0.2410 -0.0443 0.0070  -0.0153 169 VAL A O   
1488 C  CB  . VAL A 175 ? 0.3142 0.3030 0.2868 -0.0108 0.0086  -0.0224 169 VAL A CB  
1489 C  CG1 . VAL A 175 ? 0.3081 0.3145 0.2771 -0.0091 0.0218  -0.0280 169 VAL A CG1 
1490 C  CG2 . VAL A 175 ? 0.3176 0.3313 0.3057 -0.0125 0.0082  -0.0160 169 VAL A CG2 
1491 N  N   . LYS A 176 ? 0.2801 0.2466 0.2355 -0.0365 -0.0091 -0.0277 170 LYS A N   
1492 C  CA  . LYS A 176 ? 0.2595 0.2430 0.2324 -0.0294 -0.0147 -0.0205 170 LYS A CA  
1493 C  C   . LYS A 176 ? 0.2374 0.2342 0.2050 -0.0288 -0.0108 -0.0254 170 LYS A C   
1494 O  O   . LYS A 176 ? 0.2590 0.2587 0.2099 -0.0463 -0.0062 -0.0401 170 LYS A O   
1495 C  CB  . LYS A 176 ? 0.2796 0.2691 0.2547 -0.0148 -0.0135 -0.0051 170 LYS A CB  
1496 N  N   . PRO A 177 ? 0.2101 0.1852 0.1705 -0.0264 -0.0096 -0.0257 171 PRO A N   
1497 C  CA  . PRO A 177 ? 0.1934 0.1588 0.1644 -0.0130 -0.0036 -0.0257 171 PRO A CA  
1498 C  C   . PRO A 177 ? 0.1908 0.1431 0.1469 -0.0123 -0.0027 -0.0285 171 PRO A C   
1499 O  O   . PRO A 177 ? 0.1952 0.1420 0.1627 -0.0005 -0.0071 -0.0412 171 PRO A O   
1500 C  CB  . PRO A 177 ? 0.1990 0.1702 0.1730 -0.0149 0.0032  -0.0250 171 PRO A CB  
1501 C  CG  . PRO A 177 ? 0.2021 0.2189 0.1637 0.0030  -0.0136 -0.0186 171 PRO A CG  
1502 C  CD  . PRO A 177 ? 0.1908 0.1808 0.1574 -0.0246 -0.0293 -0.0277 171 PRO A CD  
1503 N  N   . PRO A 178 ? 0.1903 0.1260 0.1586 0.0005  0.0066  -0.0464 172 PRO A N   
1504 C  CA  . PRO A 178 ? 0.1616 0.1389 0.1351 -0.0039 0.0017  -0.0363 172 PRO A CA  
1505 C  C   . PRO A 178 ? 0.1541 0.1339 0.1160 0.0040  -0.0096 -0.0177 172 PRO A C   
1506 O  O   . PRO A 178 ? 0.1837 0.1301 0.1303 0.0140  -0.0050 -0.0138 172 PRO A O   
1507 C  CB  . PRO A 178 ? 0.1753 0.1680 0.1546 -0.0050 0.0048  -0.0422 172 PRO A CB  
1508 C  CG  . PRO A 178 ? 0.2026 0.2021 0.2331 -0.0046 0.0231  -0.0236 172 PRO A CG  
1509 C  CD  . PRO A 178 ? 0.1875 0.1617 0.2046 0.0027  0.0162  -0.0392 172 PRO A CD  
1510 N  N   . ILE A 179 ? 0.1144 0.1105 0.0978 0.0015  -0.0057 -0.0308 173 ILE A N   
1511 C  CA  . ILE A 179 ? 0.1014 0.1023 0.0865 0.0072  -0.0041 -0.0123 173 ILE A CA  
1512 C  C   . ILE A 179 ? 0.0880 0.1088 0.0905 0.0107  -0.0024 -0.0067 173 ILE A C   
1513 O  O   . ILE A 179 ? 0.0880 0.1357 0.0788 0.0002  -0.0017 0.0020  173 ILE A O   
1514 C  CB  . ILE A 179 ? 0.0880 0.0982 0.0985 0.0046  -0.0148 -0.0115 173 ILE A CB  
1515 C  CG1 . ILE A 179 ? 0.1020 0.0999 0.1098 0.0040  -0.0205 -0.0005 173 ILE A CG1 
1516 C  CG2 . ILE A 179 ? 0.1169 0.1111 0.1381 -0.0104 -0.0219 -0.0013 173 ILE A CG2 
1517 C  CD1 . ILE A 179 ? 0.1115 0.0943 0.1279 0.0134  0.0031  -0.0040 173 ILE A CD1 
1518 N  N   . GLY A 180 ? 0.0774 0.1066 0.0886 0.0053  -0.0082 -0.0107 174 GLY A N   
1519 C  CA  . GLY A 180 ? 0.0894 0.1052 0.1059 0.0090  0.0001  -0.0092 174 GLY A CA  
1520 C  C   . GLY A 180 ? 0.1035 0.1181 0.0945 0.0157  0.0040  -0.0022 174 GLY A C   
1521 O  O   . GLY A 180 ? 0.1073 0.1335 0.1198 0.0039  0.0040  0.0140  174 GLY A O   
1522 N  N   . GLN A 181 ? 0.0920 0.1228 0.0944 0.0259  -0.0038 0.0022  175 GLN A N   
1523 C  CA  . GLN A 181 ? 0.0958 0.1289 0.1079 0.0218  0.0005  -0.0112 175 GLN A CA  
1524 C  C   . GLN A 181 ? 0.1132 0.1288 0.0898 0.0155  0.0036  -0.0021 175 GLN A C   
1525 O  O   . GLN A 181 ? 0.1010 0.1154 0.1021 0.0080  0.0162  -0.0116 175 GLN A O   
1526 C  CB  . GLN A 181 ? 0.0978 0.1407 0.1118 0.0277  -0.0004 0.0049  175 GLN A CB  
1527 C  CG  . GLN A 181 ? 0.0999 0.1333 0.0994 0.0055  -0.0081 -0.0008 175 GLN A CG  
1528 C  CD  . GLN A 181 ? 0.0552 0.1196 0.1158 0.0179  0.0150  -0.0048 175 GLN A CD  
1529 O  OE1 . GLN A 181 ? 0.0928 0.1393 0.0979 0.0157  0.0186  0.0178  175 GLN A OE1 
1530 N  NE2 . GLN A 181 ? 0.1054 0.1134 0.0857 0.0017  0.0125  -0.0045 175 GLN A NE2 
1531 N  N   . ARG A 182 ? 0.1144 0.1512 0.0874 0.0098  0.0076  0.0018  176 ARG A N   
1532 C  CA  . ARG A 182 ? 0.0911 0.1341 0.0989 0.0048  0.0114  0.0052  176 ARG A CA  
1533 C  C   . ARG A 182 ? 0.0993 0.1499 0.0811 0.0023  0.0144  0.0078  176 ARG A C   
1534 O  O   . ARG A 182 ? 0.1145 0.1452 0.1213 -0.0059 0.0135  0.0010  176 ARG A O   
1535 C  CB  . ARG A 182 ? 0.0978 0.1394 0.1164 0.0061  0.0115  0.0044  176 ARG A CB  
1536 C  CG  . ARG A 182 ? 0.0941 0.1345 0.0956 0.0167  0.0105  0.0004  176 ARG A CG  
1537 C  CD  . ARG A 182 ? 0.1038 0.1667 0.0990 0.0136  0.0181  -0.0001 176 ARG A CD  
1538 N  NE  . ARG A 182 ? 0.0934 0.1391 0.0903 0.0011  0.0079  -0.0007 176 ARG A NE  
1539 C  CZ  . ARG A 182 ? 0.0893 0.1395 0.0858 -0.0093 0.0037  -0.0178 176 ARG A CZ  
1540 N  NH1 . ARG A 182 ? 0.0925 0.1455 0.0952 0.0007  0.0018  -0.0050 176 ARG A NH1 
1541 N  NH2 . ARG A 182 ? 0.1089 0.1400 0.0967 0.0205  0.0125  -0.0186 176 ARG A NH2 
1542 N  N   . THR A 183 ? 0.0812 0.1692 0.0944 0.0038  0.0316  0.0203  180 THR A N   
1543 C  CA  A THR A 183 ? 0.1053 0.1677 0.1144 0.0066  0.0133  0.0105  180 THR A CA  
1544 C  CA  B THR A 183 ? 0.0944 0.1563 0.0940 0.0110  0.0162  0.0024  180 THR A CA  
1545 C  C   . THR A 183 ? 0.0894 0.1603 0.0967 0.0056  0.0122  0.0053  180 THR A C   
1546 O  O   . THR A 183 ? 0.0811 0.1855 0.1053 0.0074  0.0143  0.0231  180 THR A O   
1547 C  CB  A THR A 183 ? 0.1327 0.1796 0.1136 0.0076  0.0161  0.0134  180 THR A CB  
1548 C  CB  B THR A 183 ? 0.0832 0.1555 0.0904 0.0000  0.0148  0.0027  180 THR A CB  
1549 O  OG1 A THR A 183 ? 0.1846 0.2274 0.2217 0.0031  0.0055  0.0132  180 THR A OG1 
1550 O  OG1 B THR A 183 ? 0.1043 0.1932 0.0849 0.0183  0.0208  0.0139  180 THR A OG1 
1551 C  CG2 A THR A 183 ? 0.0878 0.1641 0.0945 -0.0086 0.0121  0.0253  180 THR A CG2 
1552 C  CG2 B THR A 183 ? 0.1112 0.1213 0.0939 0.0429  0.0154  -0.0220 180 THR A CG2 
1553 N  N   . ARG A 184 ? 0.0909 0.1401 0.0868 0.0070  0.0107  0.0163  181 ARG A N   
1554 C  CA  . ARG A 184 ? 0.0908 0.1463 0.1036 0.0089  0.0144  0.0120  181 ARG A CA  
1555 C  C   . ARG A 184 ? 0.0598 0.1279 0.0962 0.0030  0.0150  0.0070  181 ARG A C   
1556 O  O   . ARG A 184 ? 0.0584 0.1607 0.1083 0.0076  0.0095  0.0217  181 ARG A O   
1557 C  CB  . ARG A 184 ? 0.1077 0.1614 0.1137 0.0232  0.0246  0.0116  181 ARG A CB  
1558 C  CG  . ARG A 184 ? 0.1540 0.1482 0.1385 0.0332  0.0230  -0.0267 181 ARG A CG  
1559 C  CD  . ARG A 184 ? 0.1992 0.2219 0.2137 0.0064  0.0077  0.0029  181 ARG A CD  
1560 N  NE  . ARG A 184 ? 0.2209 0.2550 0.2209 0.0030  0.0252  -0.0262 181 ARG A NE  
1561 C  CZ  . ARG A 184 ? 0.2259 0.2707 0.2280 -0.0208 0.0498  -0.0304 181 ARG A CZ  
1562 N  NH1 . ARG A 184 ? 0.2761 0.2523 0.1596 0.0237  -0.0068 -0.0229 181 ARG A NH1 
1563 N  NH2 . ARG A 184 ? 0.2525 0.2690 0.2353 -0.0087 0.0532  -0.0444 181 ARG A NH2 
1564 N  N   . LEU A 185 ? 0.0678 0.1069 0.0928 0.0066  0.0114  0.0044  182 LEU A N   
1565 C  CA  . LEU A 185 ? 0.0841 0.1110 0.0881 -0.0026 0.0008  0.0063  182 LEU A CA  
1566 C  C   . LEU A 185 ? 0.0833 0.1035 0.1020 0.0073  -0.0067 0.0019  182 LEU A C   
1567 O  O   . LEU A 185 ? 0.0824 0.1179 0.1087 0.0155  0.0031  -0.0197 182 LEU A O   
1568 C  CB  . LEU A 185 ? 0.0976 0.1142 0.0950 0.0059  -0.0087 0.0097  182 LEU A CB  
1569 C  CG  . LEU A 185 ? 0.0904 0.1156 0.0846 0.0118  0.0100  -0.0051 182 LEU A CG  
1570 C  CD1 . LEU A 185 ? 0.1068 0.1481 0.1083 0.0114  -0.0184 0.0199  182 LEU A CD1 
1571 C  CD2 . LEU A 185 ? 0.0988 0.1394 0.1101 0.0276  -0.0081 -0.0040 182 LEU A CD2 
1572 N  N   . SER A 186 ? 0.0708 0.1074 0.0806 -0.0009 -0.0005 0.0099  183 SER A N   
1573 C  CA  . SER A 186 ? 0.0791 0.0945 0.0985 0.0138  0.0007  -0.0036 183 SER A CA  
1574 C  C   . SER A 186 ? 0.0889 0.0887 0.0998 0.0161  0.0126  -0.0065 183 SER A C   
1575 O  O   . SER A 186 ? 0.0701 0.0978 0.1068 0.0067  0.0016  -0.0066 183 SER A O   
1576 C  CB  . SER A 186 ? 0.0804 0.1164 0.1016 0.0137  0.0088  -0.0026 183 SER A CB  
1577 O  OG  . SER A 186 ? 0.0839 0.1089 0.0795 0.0186  0.0067  -0.0048 183 SER A OG  
1578 N  N   . LYS A 187 ? 0.1045 0.0901 0.1296 0.0097  0.0076  -0.0097 184 LYS A N   
1579 C  CA  . LYS A 187 ? 0.1367 0.1000 0.1339 0.0024  0.0155  -0.0056 184 LYS A CA  
1580 C  C   . LYS A 187 ? 0.1020 0.0918 0.1205 -0.0083 -0.0049 -0.0054 184 LYS A C   
1581 O  O   . LYS A 187 ? 0.1122 0.0960 0.1219 0.0133  0.0017  -0.0006 184 LYS A O   
1582 C  CB  . LYS A 187 ? 0.1674 0.1219 0.1571 0.0001  0.0339  -0.0100 184 LYS A CB  
1583 C  CG  . LYS A 187 ? 0.2221 0.2148 0.2379 0.0000  0.0348  -0.0096 184 LYS A CG  
1584 C  CD  . LYS A 187 ? 0.3272 0.2731 0.3162 -0.0034 0.0053  -0.0312 184 LYS A CD  
1585 C  CE  . LYS A 187 ? 0.3520 0.3611 0.3677 0.0129  0.0102  -0.0275 184 LYS A CE  
1586 N  NZ  . LYS A 187 ? 0.3657 0.4089 0.4121 0.0060  -0.0037 -0.0173 184 LYS A NZ  
1587 N  N   . GLY A 188 ? 0.0956 0.0889 0.1119 0.0016  0.0010  -0.0014 185 GLY A N   
1588 C  CA  . GLY A 188 ? 0.0815 0.0982 0.1121 0.0001  -0.0092 -0.0092 185 GLY A CA  
1589 C  C   . GLY A 188 ? 0.0678 0.0849 0.0957 0.0103  -0.0071 0.0091  185 GLY A C   
1590 O  O   . GLY A 188 ? 0.0872 0.1019 0.0948 0.0098  0.0043  0.0150  185 GLY A O   
1591 N  N   . ASP A 189 ? 0.0731 0.0735 0.1101 0.0145  0.0021  -0.0038 186 ASP A N   
1592 C  CA  . ASP A 189 ? 0.0687 0.0777 0.0932 0.0090  -0.0080 0.0128  186 ASP A CA  
1593 C  C   . ASP A 189 ? 0.0641 0.0888 0.0967 0.0136  0.0034  0.0075  186 ASP A C   
1594 O  O   . ASP A 189 ? 0.0807 0.0991 0.0971 0.0009  0.0028  0.0101  186 ASP A O   
1595 C  CB  . ASP A 189 ? 0.0749 0.0927 0.1058 0.0101  -0.0059 0.0240  186 ASP A CB  
1596 C  CG  . ASP A 189 ? 0.0680 0.1211 0.1055 0.0078  0.0031  0.0061  186 ASP A CG  
1597 O  OD1 . ASP A 189 ? 0.0816 0.0984 0.1163 0.0168  0.0016  0.0049  186 ASP A OD1 
1598 O  OD2 . ASP A 189 ? 0.0996 0.1151 0.1172 -0.0066 0.0084  0.0052  186 ASP A OD2 
1599 N  N   . ILE A 190 ? 0.0662 0.0868 0.1090 0.0175  -0.0063 0.0089  187 ILE A N   
1600 C  CA  . ILE A 190 ? 0.0712 0.0964 0.1121 0.0224  0.0025  0.0135  187 ILE A CA  
1601 C  C   . ILE A 190 ? 0.0934 0.0929 0.1005 0.0204  0.0000  0.0094  187 ILE A C   
1602 O  O   . ILE A 190 ? 0.1045 0.1126 0.1059 0.0195  0.0025  0.0165  187 ILE A O   
1603 C  CB  . ILE A 190 ? 0.0836 0.1056 0.1227 0.0312  0.0051  0.0194  187 ILE A CB  
1604 C  CG1 . ILE A 190 ? 0.0884 0.1078 0.1460 0.0209  0.0075  0.0245  187 ILE A CG1 
1605 C  CG2 . ILE A 190 ? 0.0696 0.1030 0.1453 0.0405  -0.0150 0.0124  187 ILE A CG2 
1606 C  CD1 . ILE A 190 ? 0.1030 0.1423 0.1432 0.0309  0.0049  0.0037  187 ILE A CD1 
1607 N  N   . ALA A 191 ? 0.1097 0.0798 0.1184 0.0129  0.0099  0.0032  188 ALA A N   
1608 C  CA  . ALA A 191 ? 0.0976 0.0929 0.1219 0.0016  0.0060  0.0089  188 ALA A CA  
1609 C  C   . ALA A 191 ? 0.0888 0.0898 0.1213 0.0063  0.0107  0.0080  188 ALA A C   
1610 O  O   . ALA A 191 ? 0.1121 0.0918 0.1239 0.0029  0.0110  0.0146  188 ALA A O   
1611 C  CB  . ALA A 191 ? 0.1335 0.1100 0.1296 -0.0291 0.0127  -0.0097 188 ALA A CB  
1612 N  N   . GLN A 192 ? 0.0730 0.0902 0.1191 0.0099  0.0093  0.0096  189 GLN A N   
1613 C  CA  . GLN A 192 ? 0.0851 0.0979 0.1055 0.0133  0.0090  0.0106  189 GLN A CA  
1614 C  C   . GLN A 192 ? 0.0927 0.0871 0.1013 0.0153  0.0012  0.0238  189 GLN A C   
1615 O  O   . GLN A 192 ? 0.1077 0.1006 0.1026 0.0141  0.0081  0.0175  189 GLN A O   
1616 C  CB  . GLN A 192 ? 0.0617 0.0949 0.1134 0.0311  0.0001  0.0071  189 GLN A CB  
1617 C  CG  . GLN A 192 ? 0.0742 0.0970 0.1093 0.0146  0.0225  0.0305  189 GLN A CG  
1618 C  CD  . GLN A 192 ? 0.0924 0.0851 0.0906 0.0007  -0.0052 0.0088  189 GLN A CD  
1619 O  OE1 . GLN A 192 ? 0.0939 0.1395 0.1675 0.0017  0.0270  0.0030  189 GLN A OE1 
1620 N  NE2 . GLN A 192 ? 0.0534 0.0692 0.0620 0.0093  -0.0013 0.0066  189 GLN A NE2 
1621 N  N   . ALA A 193 ? 0.0888 0.0746 0.1143 0.0113  -0.0015 0.0110  190 ALA A N   
1622 C  CA  . ALA A 193 ? 0.0912 0.0862 0.1010 0.0137  0.0026  0.0208  190 ALA A CA  
1623 C  C   . ALA A 193 ? 0.1041 0.0973 0.1051 0.0166  0.0042  0.0143  190 ALA A C   
1624 O  O   . ALA A 193 ? 0.1164 0.0965 0.1057 0.0076  -0.0050 0.0148  190 ALA A O   
1625 C  CB  . ALA A 193 ? 0.0831 0.1063 0.1210 0.0096  0.0109  0.0144  190 ALA A CB  
1626 N  N   . ARG A 194 ? 0.1064 0.0823 0.1165 0.0092  0.0045  0.0178  191 ARG A N   
1627 C  CA  . ARG A 194 ? 0.1222 0.0950 0.1235 0.0206  -0.0071 0.0187  191 ARG A CA  
1628 C  C   . ARG A 194 ? 0.1363 0.1091 0.1126 0.0153  -0.0056 0.0111  191 ARG A C   
1629 O  O   . ARG A 194 ? 0.1527 0.1507 0.1321 0.0188  -0.0204 0.0201  191 ARG A O   
1630 C  CB  . ARG A 194 ? 0.1392 0.0961 0.1401 0.0140  -0.0140 0.0143  191 ARG A CB  
1631 C  CG  . ARG A 194 ? 0.1360 0.1126 0.1334 0.0145  -0.0184 0.0126  191 ARG A CG  
1632 C  CD  . ARG A 194 ? 0.1615 0.1156 0.1711 0.0545  -0.0042 0.0174  191 ARG A CD  
1633 N  NE  . ARG A 194 ? 0.1874 0.1637 0.1815 0.0172  0.0087  0.0221  191 ARG A NE  
1634 C  CZ  . ARG A 194 ? 0.2035 0.1668 0.1740 0.0097  0.0039  0.0184  191 ARG A CZ  
1635 N  NH1 . ARG A 194 ? 0.2265 0.2038 0.2254 -0.0116 0.0190  0.0200  191 ARG A NH1 
1636 N  NH2 . ARG A 194 ? 0.1741 0.1594 0.1862 0.0345  0.0060  0.0020  191 ARG A NH2 
1637 N  N   . LYS A 195 ? 0.1201 0.1035 0.1272 0.0041  0.0056  0.0146  192 LYS A N   
1638 C  CA  . LYS A 195 ? 0.1585 0.1208 0.1272 -0.0044 0.0038  0.0132  192 LYS A CA  
1639 C  C   . LYS A 195 ? 0.1582 0.1283 0.1234 0.0002  0.0036  0.0144  192 LYS A C   
1640 O  O   . LYS A 195 ? 0.1950 0.1267 0.1142 -0.0251 0.0192  0.0223  192 LYS A O   
1641 C  CB  . LYS A 195 ? 0.1480 0.1212 0.1290 0.0033  -0.0071 0.0082  192 LYS A CB  
1642 C  CG  . LYS A 195 ? 0.1706 0.1139 0.1280 -0.0041 0.0035  -0.0001 192 LYS A CG  
1643 C  CD  . LYS A 195 ? 0.1854 0.1385 0.1659 -0.0115 -0.0048 0.0037  192 LYS A CD  
1644 C  CE  . LYS A 195 ? 0.2093 0.1436 0.1899 -0.0117 0.0006  -0.0028 192 LYS A CE  
1645 N  NZ  . LYS A 195 ? 0.2095 0.1566 0.1973 0.0123  -0.0001 -0.0223 192 LYS A NZ  
1646 N  N   . LEU A 196 ? 0.1408 0.1080 0.1192 -0.0126 0.0071  0.0094  193 LEU A N   
1647 C  CA  . LEU A 196 ? 0.1528 0.1240 0.1153 -0.0075 0.0006  0.0083  193 LEU A CA  
1648 C  C   . LEU A 196 ? 0.1575 0.1333 0.1165 -0.0107 0.0046  0.0083  193 LEU A C   
1649 O  O   . LEU A 196 ? 0.1841 0.1549 0.1201 0.0003  0.0110  0.0044  193 LEU A O   
1650 C  CB  . LEU A 196 ? 0.1255 0.1205 0.1212 -0.0049 0.0094  0.0078  193 LEU A CB  
1651 C  CG  . LEU A 196 ? 0.1266 0.1343 0.1259 -0.0047 0.0031  -0.0033 193 LEU A CG  
1652 C  CD1 . LEU A 196 ? 0.1572 0.1572 0.1687 -0.0115 0.0252  -0.0123 193 LEU A CD1 
1653 C  CD2 . LEU A 196 ? 0.1517 0.1447 0.1416 -0.0095 -0.0040 0.0207  193 LEU A CD2 
1654 N  N   . TYR A 197 ? 0.1537 0.1223 0.1217 0.0036  -0.0186 0.0319  194 TYR A N   
1655 C  CA  . TYR A 197 ? 0.1575 0.1246 0.1513 -0.0043 -0.0280 0.0321  194 TYR A CA  
1656 C  C   . TYR A 197 ? 0.1903 0.1354 0.1590 0.0008  -0.0400 0.0368  194 TYR A C   
1657 O  O   . TYR A 197 ? 0.2382 0.1467 0.1906 -0.0110 -0.0639 0.0384  194 TYR A O   
1658 C  CB  . TYR A 197 ? 0.1506 0.1238 0.1468 -0.0046 -0.0163 0.0166  194 TYR A CB  
1659 C  CG  . TYR A 197 ? 0.1307 0.1128 0.1381 0.0042  -0.0201 0.0136  194 TYR A CG  
1660 C  CD1 . TYR A 197 ? 0.1096 0.1282 0.1353 -0.0075 -0.0082 0.0173  194 TYR A CD1 
1661 C  CD2 . TYR A 197 ? 0.1316 0.1092 0.1358 0.0026  -0.0136 0.0067  194 TYR A CD2 
1662 C  CE1 . TYR A 197 ? 0.1064 0.1156 0.0965 0.0069  0.0015  0.0098  194 TYR A CE1 
1663 C  CE2 . TYR A 197 ? 0.1351 0.1220 0.1194 0.0127  -0.0164 0.0161  194 TYR A CE2 
1664 C  CZ  . TYR A 197 ? 0.1029 0.1130 0.0964 0.0023  0.0051  0.0066  194 TYR A CZ  
1665 O  OH  . TYR A 197 ? 0.1359 0.1027 0.1011 -0.0037 -0.0032 0.0147  194 TYR A OH  
1666 N  N   . LYS A 198 ? 0.2068 0.1240 0.1537 -0.0020 -0.0172 0.0472  195 LYS A N   
1667 C  CA  . LYS A 198 ? 0.2419 0.1657 0.1740 0.0053  -0.0137 0.0527  195 LYS A CA  
1668 C  C   . LYS A 198 ? 0.2321 0.1644 0.1866 0.0029  -0.0202 0.0494  195 LYS A C   
1669 O  O   . LYS A 198 ? 0.2350 0.1832 0.1981 0.0186  -0.0468 0.0759  195 LYS A O   
1670 C  CB  . LYS A 198 ? 0.2496 0.1853 0.1754 0.0046  -0.0156 0.0537  195 LYS A CB  
1671 C  CG  . LYS A 198 ? 0.2798 0.2186 0.1988 0.0089  0.0050  0.0494  195 LYS A CG  
1672 C  CD  . LYS A 198 ? 0.3026 0.2462 0.2266 -0.0055 0.0067  0.0338  195 LYS A CD  
1673 C  CE  . LYS A 198 ? 0.3402 0.3509 0.3457 0.0099  0.0081  0.0095  195 LYS A CE  
1674 N  NZ  . LYS A 198 ? 0.3916 0.3670 0.3997 -0.0031 -0.0007 0.0047  195 LYS A NZ  
1675 N  N   . CYS A 199 ? 0.1727 0.1542 0.1961 0.0085  -0.0101 0.0290  198 CYS A N   
1676 C  CA  . CYS A 199 ? 0.1693 0.1746 0.2325 0.0112  -0.0113 0.0231  198 CYS A CA  
1677 C  C   . CYS A 199 ? 0.2072 0.2008 0.2710 0.0163  -0.0141 0.0173  198 CYS A C   
1678 O  O   . CYS A 199 ? 0.1987 0.1893 0.3224 0.0235  -0.0043 0.0170  198 CYS A O   
1679 C  CB  . CYS A 199 ? 0.1778 0.1452 0.2218 0.0182  -0.0145 0.0022  198 CYS A CB  
1680 S  SG  . CYS A 199 ? 0.1612 0.1660 0.1861 0.0140  -0.0162 0.0429  198 CYS A SG  
1681 N  N   . PRO A 200 ? 0.2320 0.2240 0.2911 0.0145  -0.0007 0.0206  199 PRO A N   
1682 C  CA  . PRO A 200 ? 0.2600 0.2485 0.2993 0.0132  -0.0015 0.0188  199 PRO A CA  
1683 C  C   . PRO A 200 ? 0.2780 0.2761 0.3149 0.0124  0.0008  0.0125  199 PRO A C   
1684 O  O   . PRO A 200 ? 0.2721 0.2848 0.3047 0.0105  0.0009  0.0118  199 PRO A O   
1685 C  CB  . PRO A 200 ? 0.2675 0.2473 0.2994 0.0169  -0.0077 0.0256  199 PRO A CB  
1686 C  CG  . PRO A 200 ? 0.2841 0.2560 0.3009 0.0244  -0.0148 0.0238  199 PRO A CG  
1687 C  CD  . PRO A 200 ? 0.2501 0.2334 0.2896 0.0161  -0.0128 0.0203  199 PRO A CD  
1688 N  N   . ALA A 201 ? 0.3039 0.3087 0.3444 0.0086  -0.0016 0.0070  200 ALA A N   
1689 C  CA  . ALA A 201 ? 0.3375 0.3459 0.3705 0.0074  -0.0019 -0.0006 200 ALA A CA  
1690 C  C   . ALA A 201 ? 0.3552 0.3628 0.3782 0.0091  0.0055  -0.0024 200 ALA A C   
1691 O  O   . ALA A 201 ? 0.3884 0.3838 0.3953 0.0060  -0.0002 -0.0076 200 ALA A O   
1692 C  CB  . ALA A 201 ? 0.3396 0.3486 0.3790 0.0040  0.0023  0.0041  200 ALA A CB  
1693 O  OXT . ALA A 201 ? 0.3539 0.3606 0.3879 0.0138  0.0044  -0.0008 200 ALA A OXT 
1694 C  C   . ACE B .   ? 0.0497 0.0991 0.1098 0.0241  -0.0094 -0.0001 201 ACE A C   
1695 O  O   . ACE B .   ? 0.0979 0.0858 0.0991 0.0280  0.0186  -0.0257 201 ACE A O   
1696 C  CH3 . ACE B .   ? 0.0470 0.0344 0.0483 0.0102  0.0064  -0.0004 201 ACE A CH3 
1697 ZN ZN  . ZN  C .   ? 0.0831 0.0894 0.0913 0.0034  -0.0063 0.0045  210 ZN  A ZN  
1698 ZN ZN  . ZN  D .   ? 0.0544 0.0614 0.0830 0.0058  0.0006  0.0034  211 ZN  A ZN  
1699 S  S   . DMS E .   ? 0.1853 0.1881 0.2160 0.0159  -0.0162 -0.0166 212 DMS A S   
1700 O  O   . DMS E .   ? 0.2346 0.2571 0.2578 0.0301  -0.0259 -0.0083 212 DMS A O   
1701 C  C1  . DMS E .   ? 0.1911 0.2466 0.2204 0.0324  0.0013  -0.0161 212 DMS A C1  
1702 C  C2  . DMS E .   ? 0.2052 0.2174 0.2218 0.0318  -0.0133 0.0145  212 DMS A C2  
1703 S  S   . DMS F .   ? 0.2730 0.3183 0.3419 -0.0007 0.0273  -0.0359 213 DMS A S   
1704 O  O   . DMS F .   ? 0.2974 0.3292 0.3296 -0.0228 0.0253  -0.0353 213 DMS A O   
1705 C  C1  . DMS F .   ? 0.2592 0.2812 0.3075 -0.0022 0.0171  -0.0252 213 DMS A C1  
1706 C  C2  . DMS F .   ? 0.2657 0.2733 0.3129 0.0239  0.0121  -0.0242 213 DMS A C2  
1707 S  S   A DMS G .   ? 0.1120 0.1695 0.1843 -0.0086 -0.0049 0.0351  214 DMS A S   
1708 S  S   B DMS G .   ? 0.2257 0.2011 0.1931 0.0258  -0.0102 0.0087  214 DMS A S   
1709 O  O   A DMS G .   ? 0.0701 0.1281 0.1382 0.0020  -0.0181 0.0187  214 DMS A O   
1710 O  O   B DMS G .   ? 0.1966 0.1405 0.1301 -0.0025 0.0078  -0.0120 214 DMS A O   
1711 C  C1  A DMS G .   ? 0.1331 0.1571 0.1399 -0.0099 -0.0060 0.0236  214 DMS A C1  
1712 C  C1  B DMS G .   ? 0.1579 0.0965 0.0900 0.0316  0.0024  -0.0017 214 DMS A C1  
1713 C  C2  A DMS G .   ? 0.0597 0.0972 0.1286 -0.0460 -0.0029 0.0002  214 DMS A C2  
1714 C  C2  B DMS G .   ? 0.1998 0.1641 0.1817 0.0153  -0.0111 0.0028  214 DMS A C2  
1715 S  S   . DMS H .   ? 0.2468 0.2950 0.1912 0.0110  0.0405  0.0038  215 DMS A S   
1716 O  O   . DMS H .   ? 0.2955 0.3258 0.2145 0.0139  0.0331  0.0069  215 DMS A O   
1717 C  C1  . DMS H .   ? 0.2375 0.2815 0.2338 0.0150  0.0306  0.0083  215 DMS A C1  
1718 C  C2  . DMS H .   ? 0.2172 0.2276 0.1163 0.0241  0.0412  0.0306  215 DMS A C2  
1719 S  S   . DMS I .   ? 0.1648 0.1655 0.2077 0.0438  -0.0418 -0.0218 216 DMS A S   
1720 O  O   . DMS I .   ? 0.2202 0.2027 0.2131 0.0300  -0.0196 0.0007  216 DMS A O   
1721 C  C1  . DMS I .   ? 0.1832 0.2126 0.2041 0.0247  -0.0189 -0.0007 216 DMS A C1  
1722 C  C2  . DMS I .   ? 0.1986 0.1750 0.2020 0.0240  -0.0177 -0.0153 216 DMS A C2  
1723 O  O   . HOH J .   ? 0.1028 0.0977 0.0844 0.0133  -0.0048 0.0128  217 HOH A O   
1724 O  O   . HOH J .   ? 0.1025 0.1218 0.1010 0.0047  0.0121  -0.0115 218 HOH A O   
1725 O  O   . HOH J .   ? 0.1134 0.0890 0.0998 0.0093  -0.0044 0.0072  219 HOH A O   
1726 O  O   . HOH J .   ? 0.1769 0.0876 0.1019 0.0087  0.0168  -0.0053 220 HOH A O   
1727 O  O   . HOH J .   ? 0.1062 0.0782 0.1148 -0.0047 0.0176  0.0107  221 HOH A O   
1728 O  O   . HOH J .   ? 0.0907 0.1145 0.1023 0.0187  0.0218  0.0016  222 HOH A O   
1729 O  O   . HOH J .   ? 0.0845 0.1317 0.1080 -0.0127 -0.0076 -0.0033 223 HOH A O   
1730 O  O   . HOH J .   ? 0.0759 0.0973 0.1047 0.0109  0.0097  0.0025  224 HOH A O   
1731 O  O   . HOH J .   ? 0.0936 0.1040 0.1299 0.0069  0.0042  0.0049  225 HOH A O   
1732 O  O   . HOH J .   ? 0.1221 0.1244 0.0992 0.0154  -0.0112 -0.0081 226 HOH A O   
1733 O  O   . HOH J .   ? 0.1210 0.1182 0.1429 0.0349  -0.0164 -0.0084 227 HOH A O   
1734 O  O   . HOH J .   ? 0.0964 0.0960 0.1434 -0.0103 -0.0294 0.0041  228 HOH A O   
1735 O  O   . HOH J .   ? 0.1412 0.0908 0.1392 -0.0251 -0.0022 -0.0008 229 HOH A O   
1736 O  O   . HOH J .   ? 0.1319 0.1621 0.1443 -0.0103 -0.0046 -0.0112 230 HOH A O   
1737 O  O   . HOH J .   ? 0.1299 0.2076 0.1202 -0.0033 0.0593  0.0344  231 HOH A O   
1738 O  O   . HOH J .   ? 0.1962 0.1478 0.1740 0.0207  -0.0394 0.0221  232 HOH A O   
1739 O  O   . HOH J .   ? 0.1270 0.1877 0.1987 0.0218  0.0244  -0.0109 233 HOH A O   
1740 O  O   . HOH J .   ? 0.1155 0.1108 0.1337 0.0218  -0.0062 -0.0153 234 HOH A O   
1741 O  O   . HOH J .   ? 0.2131 0.1288 0.1744 0.0211  -0.0204 0.0028  235 HOH A O   
1742 O  O   . HOH J .   ? 0.1762 0.2177 0.1562 0.0086  0.0716  0.0194  236 HOH A O   
1743 O  O   . HOH J .   ? 0.1701 0.1500 0.1260 -0.0023 -0.0294 -0.0024 237 HOH A O   
1744 O  O   . HOH J .   ? 0.1415 0.1623 0.1569 -0.0271 -0.0055 -0.0153 238 HOH A O   
1745 O  O   . HOH J .   ? 0.1697 0.1409 0.1683 0.0238  -0.0161 -0.0369 239 HOH A O   
1746 O  O   . HOH J .   ? 0.1172 0.2356 0.2055 0.0343  0.0140  -0.0176 240 HOH A O   
1747 O  O   . HOH J .   ? 0.1173 0.1405 0.1721 0.0175  0.0161  0.0150  241 HOH A O   
1748 O  O   . HOH J .   ? 0.1688 0.1842 0.1906 -0.0034 -0.0106 0.0166  242 HOH A O   
1749 O  O   . HOH J .   ? 0.1249 0.1462 0.1776 -0.0052 0.0176  -0.0215 243 HOH A O   
1750 O  O   . HOH J .   ? 0.1553 0.2004 0.1256 -0.0052 0.0517  0.0345  244 HOH A O   
1751 O  O   . HOH J .   ? 0.2240 0.1711 0.1274 0.0328  -0.0178 -0.0302 245 HOH A O   
1752 O  O   . HOH J .   ? 0.1538 0.2645 0.1350 0.0473  0.0387  0.0040  246 HOH A O   
1753 O  O   . HOH J .   ? 0.1613 0.1374 0.2286 -0.0062 0.0155  0.0125  247 HOH A O   
1754 O  O   . HOH J .   ? 0.1178 0.2094 0.2615 0.0370  0.0219  0.0398  248 HOH A O   
1755 O  O   . HOH J .   ? 0.1847 0.1289 0.2275 0.0004  -0.0204 0.0051  249 HOH A O   
1756 O  O   . HOH J .   ? 0.1626 0.2192 0.1838 -0.0410 0.0176  0.0324  250 HOH A O   
1757 O  O   . HOH J .   ? 0.1977 0.1701 0.1865 -0.0029 -0.0322 0.0411  251 HOH A O   
1758 O  O   . HOH J .   ? 0.2580 0.1876 0.2591 0.0089  -0.0063 0.0249  252 HOH A O   
1759 O  O   . HOH J .   ? 0.1964 0.1881 0.2279 0.0214  0.0281  -0.0070 253 HOH A O   
1760 O  O   . HOH J .   ? 0.1613 0.2608 0.1094 0.0318  -0.0148 0.0345  254 HOH A O   
1761 O  O   . HOH J .   ? 0.2837 0.2110 0.1376 -0.0442 -0.0706 0.0360  255 HOH A O   
1762 O  O   . HOH J .   ? 0.3220 0.1296 0.1996 0.0250  0.0610  0.0262  256 HOH A O   
1763 O  O   . HOH J .   ? 0.2865 0.2176 0.2084 -0.0474 -0.0157 0.0067  257 HOH A O   
1764 O  O   . HOH J .   ? 0.1830 0.1673 0.2061 0.0052  -0.0040 -0.0288 258 HOH A O   
1765 O  O   . HOH J .   ? 0.2622 0.2293 0.1370 0.0286  0.0143  -0.0216 259 HOH A O   
1766 O  O   . HOH J .   ? 0.1394 0.2743 0.1678 0.0181  0.0111  0.0074  260 HOH A O   
1767 O  O   . HOH J .   ? 0.1835 0.1866 0.1788 0.0173  0.0013  -0.0098 261 HOH A O   
1768 O  O   . HOH J .   ? 0.2127 0.4072 0.2073 0.0405  -0.0203 -0.0405 262 HOH A O   
1769 O  O   . HOH J .   ? 0.1308 0.1687 0.3082 0.0169  0.0226  -0.0074 263 HOH A O   
1770 O  O   . HOH J .   ? 0.1358 0.2850 0.2696 -0.0145 -0.0457 0.0369  264 HOH A O   
1771 O  O   . HOH J .   ? 0.2237 0.1726 0.2840 0.0642  0.0058  0.0133  265 HOH A O   
1772 O  O   . HOH J .   ? 0.1425 0.2405 0.3575 0.0212  -0.0056 -0.0095 266 HOH A O   
1773 O  O   . HOH J .   ? 0.2332 0.2110 0.2504 0.0203  0.0295  -0.0377 267 HOH A O   
1774 O  O   . HOH J .   ? 0.2795 0.2648 0.1658 -0.0110 0.0039  0.0127  268 HOH A O   
1775 O  O   . HOH J .   ? 0.1942 0.2199 0.1967 0.0381  0.0169  -0.0197 269 HOH A O   
1776 O  O   . HOH J .   ? 0.1622 0.2524 0.1918 -0.0137 0.0309  0.0412  270 HOH A O   
1777 O  O   . HOH J .   ? 0.2131 0.2016 0.2429 -0.0373 -0.0072 0.0246  271 HOH A O   
1778 O  O   . HOH J .   ? 0.2957 0.2173 0.1751 0.0252  -0.0470 -0.0035 272 HOH A O   
1779 O  O   . HOH J .   ? 0.3276 0.1955 0.1707 -0.0377 0.0048  -0.0221 273 HOH A O   
1780 O  O   . HOH J .   ? 0.1964 0.1418 0.3148 -0.0032 -0.0379 -0.0285 274 HOH A O   
1781 O  O   . HOH J .   ? 0.2846 0.1943 0.2502 0.0017  0.0212  -0.0398 275 HOH A O   
1782 O  O   . HOH J .   ? 0.2515 0.2373 0.1985 -0.0635 0.0212  0.0006  276 HOH A O   
1783 O  O   . HOH J .   ? 0.2997 0.1378 0.1849 -0.0776 -0.0744 -0.0035 277 HOH A O   
1784 O  O   . HOH J .   ? 0.2508 0.1919 0.1777 0.0066  -0.0272 0.0134  278 HOH A O   
1785 O  O   . HOH J .   ? 0.1213 0.2019 0.2350 0.0368  0.0034  -0.0629 279 HOH A O   
1786 O  O   . HOH J .   ? 0.1535 0.1874 0.2773 -0.0195 -0.0125 0.0003  280 HOH A O   
1787 O  O   . HOH J .   ? 0.1473 0.1507 0.2385 0.0238  0.0007  -0.0369 281 HOH A O   
1788 O  O   . HOH J .   ? 0.1561 0.2063 0.2146 0.0151  0.0138  -0.0048 282 HOH A O   
1789 O  O   . HOH J .   ? 0.2034 0.1747 0.2121 0.0352  -0.0301 0.0418  283 HOH A O   
1790 O  O   . HOH J .   ? 0.1688 0.1858 0.2699 0.0158  0.0355  -0.0038 284 HOH A O   
1791 O  O   . HOH J .   ? 0.2174 0.2925 0.3200 -0.0493 0.0740  0.0042  285 HOH A O   
1792 O  O   . HOH J .   ? 0.2201 0.1703 0.2370 0.0175  -0.0182 0.0043  286 HOH A O   
1793 O  O   . HOH J .   ? 0.2073 0.1988 0.2676 0.0062  -0.0435 0.0141  287 HOH A O   
1794 O  O   . HOH J .   ? 0.1771 0.3261 0.1678 -0.0463 -0.0574 0.0000  288 HOH A O   
1795 O  O   . HOH J .   ? 0.1801 0.2410 0.1876 0.0065  0.0491  -0.0121 289 HOH A O   
1796 O  O   . HOH J .   ? 0.1178 0.2746 0.2784 -0.0245 0.0019  0.1153  290 HOH A O   
1797 O  O   . HOH J .   ? 0.1439 0.2794 0.3049 -0.0284 0.0331  0.0704  291 HOH A O   
1798 O  O   . HOH J .   ? 0.2719 0.1776 0.2747 0.0263  0.0311  -0.0482 292 HOH A O   
1799 O  O   . HOH J .   ? 0.3445 0.1789 0.1772 0.0114  -0.0456 -0.0168 293 HOH A O   
1800 O  O   . HOH J .   ? 0.2137 0.2542 0.3125 -0.0048 -0.0193 -0.0351 294 HOH A O   
1801 O  O   . HOH J .   ? 0.2931 0.2811 0.1839 0.0153  -0.0532 0.0474  295 HOH A O   
1802 O  O   . HOH J .   ? 0.2233 0.2682 0.2061 0.0460  0.0128  -0.0456 296 HOH A O   
1803 O  O   . HOH J .   ? 0.3255 0.1788 0.2649 0.0209  -0.0299 -0.0358 297 HOH A O   
1804 O  O   . HOH J .   ? 0.3080 0.2121 0.1877 0.1025  0.0054  -0.0260 298 HOH A O   
1805 O  O   . HOH J .   ? 0.2377 0.3426 0.2150 0.0838  -0.0198 -0.0347 299 HOH A O   
1806 O  O   . HOH J .   ? 0.2640 0.3039 0.1838 -0.0095 0.0729  -0.0385 300 HOH A O   
1807 O  O   . HOH J .   ? 0.2880 0.2418 0.1855 -0.0207 0.0344  -0.0120 301 HOH A O   
1808 O  O   . HOH J .   ? 0.2996 0.2268 0.2360 0.0041  -0.0010 0.0114  302 HOH A O   
1809 O  O   . HOH J .   ? 0.2409 0.1821 0.3341 -0.0112 0.0068  -0.0098 303 HOH A O   
1810 O  O   . HOH J .   ? 0.3393 0.2731 0.2153 0.0067  0.0005  -0.0138 304 HOH A O   
1811 O  O   . HOH J .   ? 0.3203 0.2704 0.1989 -0.0806 -0.0459 0.0726  305 HOH A O   
1812 O  O   . HOH J .   ? 0.2638 0.2186 0.2025 0.0020  0.0069  -0.0189 306 HOH A O   
1813 O  O   . HOH J .   ? 0.3016 0.2350 0.2842 -0.0536 -0.0554 0.0168  307 HOH A O   
1814 O  O   . HOH J .   ? 0.1596 0.2247 0.3241 0.0158  0.0276  -0.0336 308 HOH A O   
1815 O  O   . HOH J .   ? 0.2440 0.2094 0.3043 0.0200  0.0387  -0.0098 309 HOH A O   
1816 O  O   . HOH J .   ? 0.2889 0.1900 0.1989 -0.0303 -0.0314 0.0212  310 HOH A O   
1817 O  O   . HOH J .   ? 0.1434 0.2444 0.3063 -0.0282 0.0256  0.0010  311 HOH A O   
1818 O  O   . HOH J .   ? 0.2835 0.2535 0.2771 -0.0210 0.0921  -0.0144 312 HOH A O   
1819 O  O   . HOH J .   ? 0.3407 0.1858 0.3096 0.0198  0.0483  0.0001  313 HOH A O   
1820 O  O   . HOH J .   ? 0.2540 0.1824 0.2159 -0.0089 -0.0401 0.0237  314 HOH A O   
1821 O  O   . HOH J .   ? 0.1916 0.1802 0.2910 0.0290  -0.0004 -0.0001 315 HOH A O   
1822 O  O   . HOH J .   ? 0.2046 0.2515 0.3633 0.0006  0.0089  -0.0001 316 HOH A O   
1823 O  O   . HOH J .   ? 0.2267 0.2227 0.2854 0.0068  0.0360  0.0167  317 HOH A O   
1824 O  O   . HOH J .   ? 0.2648 0.2602 0.2632 -0.0066 0.0430  0.0513  318 HOH A O   
1825 O  O   . HOH J .   ? 0.3281 0.3198 0.2798 0.0014  -0.0082 -0.0232 319 HOH A O   
1826 O  O   . HOH J .   ? 0.2674 0.2999 0.2708 0.1065  -0.0346 -0.0122 320 HOH A O   
1827 O  O   . HOH J .   ? 0.3666 0.2115 0.2426 -0.0544 0.0516  0.0064  321 HOH A O   
1828 O  O   . HOH J .   ? 0.3096 0.2667 0.3001 -0.0102 0.0619  0.0335  322 HOH A O   
1829 O  O   . HOH J .   ? 0.3166 0.2271 0.2575 -0.0253 0.0248  -0.0520 323 HOH A O   
1830 O  O   . HOH J .   ? 0.3353 0.3928 0.3845 -0.0209 -0.0205 0.0104  324 HOH A O   
1831 O  O   . HOH J .   ? 0.3471 0.3261 0.2715 -0.0355 -0.0502 0.0377  325 HOH A O   
1832 O  O   . HOH J .   ? 0.3130 0.2807 0.2643 -0.0150 -0.0066 -0.0124 326 HOH A O   
1833 O  O   . HOH J .   ? 0.2564 0.2408 0.2067 -0.0230 0.0522  -0.0140 327 HOH A O   
1834 O  O   . HOH J .   ? 0.3473 0.2692 0.1984 0.0297  0.0401  -0.0256 328 HOH A O   
1835 O  O   . HOH J .   ? 0.3459 0.3854 0.3810 -0.0533 -0.0129 -0.0052 329 HOH A O   
1836 O  O   . HOH J .   ? 0.1802 0.2605 0.3555 0.0272  0.0192  -0.0351 330 HOH A O   
1837 O  O   . HOH J .   ? 0.2816 0.1985 0.2166 0.0554  -0.0006 -0.0319 331 HOH A O   
1838 O  O   . HOH J .   ? 0.3479 0.3049 0.2941 -0.0223 0.0289  0.0405  332 HOH A O   
1839 O  O   . HOH J .   ? 0.2489 0.2649 0.2662 -0.0594 0.0147  0.0178  333 HOH A O   
1840 O  O   . HOH J .   ? 0.2528 0.3534 0.3112 0.0115  -0.0565 -0.0056 334 HOH A O   
1841 O  O   . HOH J .   ? 0.2089 0.3108 0.3030 -0.0101 -0.0452 0.0517  335 HOH A O   
1842 O  O   . HOH J .   ? 0.4031 0.3776 0.3023 -0.0151 0.0092  0.0586  336 HOH A O   
1843 O  O   . HOH J .   ? 0.2193 0.1652 0.2206 0.0165  -0.0497 -0.0015 337 HOH A O   
1844 O  O   . HOH J .   ? 0.1878 0.2012 0.2275 0.0183  -0.0206 -0.0008 338 HOH A O   
1845 O  O   . HOH J .   ? 0.2466 0.2588 0.2817 -0.0555 -0.0117 0.0394  339 HOH A O   
1846 O  O   . HOH J .   ? 0.2421 0.1869 0.4458 0.0326  0.0492  0.0132  340 HOH A O   
1847 O  O   . HOH J .   ? 0.2693 0.2998 0.4012 0.0587  0.0384  -0.0126 341 HOH A O   
1848 O  O   . HOH J .   ? 0.3937 0.2594 0.2348 -0.0371 -0.0119 -0.0818 342 HOH A O   
1849 O  O   . HOH J .   ? 0.2889 0.2952 0.2720 0.0257  0.0382  0.0301  343 HOH A O   
1850 O  O   . HOH J .   ? 0.2744 0.1810 0.2646 0.0229  0.0026  -0.0080 344 HOH A O   
1851 O  O   . HOH J .   ? 0.3041 0.3846 0.4090 0.0237  -0.0022 -0.0249 345 HOH A O   
1852 O  O   . HOH J .   ? 0.2348 0.3345 0.3046 -0.0026 -0.0453 0.0083  346 HOH A O   
1853 O  O   . HOH J .   ? 0.3072 0.2403 0.2842 -0.0466 0.0525  0.0577  347 HOH A O   
1854 O  O   . HOH J .   ? 0.1885 0.3387 0.2888 0.0333  0.0395  0.0286  348 HOH A O   
1855 O  O   . HOH J .   ? 0.3480 0.2769 0.3466 -0.0167 0.0180  -0.0422 349 HOH A O   
1856 O  O   . HOH J .   ? 0.2499 0.3157 0.3667 -0.0121 -0.0311 0.0225  350 HOH A O   
1857 O  O   . HOH J .   ? 0.2906 0.2688 0.2586 -0.0517 0.0148  -0.0011 351 HOH A O   
1858 O  O   . HOH J .   ? 0.3704 0.3614 0.3688 0.0251  0.0071  0.0077  352 HOH A O   
1859 O  O   . HOH J .   ? 0.2997 0.3291 0.2878 -0.0183 0.0421  0.0277  353 HOH A O   
1860 O  O   . HOH J .   ? 0.2548 0.3558 0.2688 0.0084  0.0668  0.0341  354 HOH A O   
1861 O  O   . HOH J .   ? 0.2932 0.2743 0.3360 -0.0673 -0.0204 -0.0167 355 HOH A O   
1862 O  O   . HOH J .   ? 0.3619 0.3216 0.3078 0.0238  0.0396  0.0005  356 HOH A O   
1863 O  O   . HOH J .   ? 0.3825 0.2814 0.3628 0.0108  0.0165  0.0244  357 HOH A O   
1864 O  O   . HOH J .   ? 0.2554 0.3072 0.3539 -0.0159 0.0340  -0.0102 358 HOH A O   
1865 O  O   . HOH J .   ? 0.3402 0.2784 0.3190 -0.0072 0.0260  0.0176  359 HOH A O   
1866 O  O   . HOH J .   ? 0.3141 0.3225 0.3149 -0.0375 -0.0250 -0.0180 360 HOH A O   
1867 O  O   . HOH J .   ? 0.3166 0.3478 0.2629 -0.0065 0.0101  0.0326  361 HOH A O   
1868 O  O   . HOH J .   ? 0.3543 0.3326 0.2526 -0.0073 0.0170  0.0469  362 HOH A O   
1869 O  O   . HOH J .   ? 0.2748 0.3575 0.3851 -0.0764 0.0854  0.0376  363 HOH A O   
1870 O  O   . HOH J .   ? 0.2939 0.2530 0.2914 -0.0037 -0.0127 -0.0402 364 HOH A O   
1871 O  O   . HOH J .   ? 0.2736 0.3641 0.4040 0.0189  -0.0316 -0.0103 365 HOH A O   
1872 O  O   . HOH J .   ? 0.1864 0.4505 0.3240 -0.0027 0.0451  -0.0244 366 HOH A O   
1873 O  O   . HOH J .   ? 0.3503 0.3195 0.3567 -0.0124 0.0134  -0.0183 367 HOH A O   
1874 O  O   . HOH J .   ? 0.2160 0.2416 0.3169 0.0034  0.0500  0.0066  368 HOH A O   
1875 O  O   . HOH J .   ? 0.3330 0.3078 0.3317 -0.0170 -0.0076 0.0069  369 HOH A O   
1876 O  O   . HOH J .   ? 0.3577 0.2309 0.2862 0.0795  0.0607  0.0171  370 HOH A O   
1877 O  O   . HOH J .   ? 0.2636 0.2747 0.3167 -0.0159 -0.0383 -0.0223 371 HOH A O   
1878 O  O   . HOH J .   ? 0.4789 0.3730 0.4124 0.0162  -0.0118 0.0308  372 HOH A O   
1879 O  O   . HOH J .   ? 0.2476 0.2879 0.3121 0.0311  0.0376  0.0259  373 HOH A O   
1880 O  O   . HOH J .   ? 0.3919 0.2784 0.2967 0.0198  -0.0582 0.0005  374 HOH A O   
1881 O  O   . HOH J .   ? 0.3705 0.2966 0.2873 -0.0166 0.0188  0.0473  375 HOH A O   
1882 O  O   . HOH J .   ? 0.3697 0.3452 0.2623 0.0347  0.0712  0.0001  376 HOH A O   
1883 O  O   . HOH J .   ? 0.3648 0.2130 0.2230 -0.0595 0.0498  -0.0151 377 HOH A O   
1884 O  O   . HOH J .   ? 0.2753 0.3277 0.2698 0.0273  0.0420  0.0060  378 HOH A O   
1885 O  O   . HOH J .   ? 0.3203 0.2961 0.2896 0.0026  -0.0139 0.0193  379 HOH A O   
1886 O  O   . HOH J .   ? 0.2631 0.2562 0.3342 -0.0266 -0.0039 0.0647  380 HOH A O   
1887 O  O   . HOH J .   ? 0.3770 0.4295 0.4701 -0.0065 -0.0001 0.0053  381 HOH A O   
1888 O  O   . HOH J .   ? 0.3085 0.3878 0.2716 -0.0170 0.0150  -0.0092 382 HOH A O   
1889 O  O   . HOH J .   ? 0.3449 0.4036 0.3227 0.0173  -0.0026 -0.0285 383 HOH A O   
1890 O  O   . HOH J .   ? 0.4423 0.4511 0.4357 0.0092  -0.0196 0.0114  384 HOH A O   
1891 O  O   . HOH J .   ? 0.2235 0.3382 0.3591 -0.0626 -0.0672 -0.0012 385 HOH A O   
1892 O  O   . HOH J .   ? 0.3885 0.3510 0.3425 0.0306  -0.0096 -0.0230 386 HOH A O   
1893 O  O   . HOH J .   ? 0.1959 0.3480 0.4121 -0.0112 -0.0202 0.0161  387 HOH A O   
1894 O  O   . HOH J .   ? 0.4906 0.5179 0.5121 -0.0056 0.0085  0.0093  388 HOH A O   
1895 O  O   . HOH J .   ? 0.2929 0.2967 0.3434 -0.0163 -0.0328 0.0242  389 HOH A O   
1896 O  O   . HOH J .   ? 0.2477 0.4215 0.3235 0.0252  0.0474  0.0193  390 HOH A O   
1897 O  O   . HOH J .   ? 0.3441 0.3320 0.3397 0.0475  0.0235  -0.0257 391 HOH A O   
1898 O  O   . HOH J .   ? 0.2577 0.2258 0.3606 -0.0502 0.0178  0.0612  392 HOH A O   
1899 O  O   . HOH J .   ? 0.2995 0.3805 0.2338 0.0053  -0.0431 -0.0130 393 HOH A O   
1900 O  O   . HOH J .   ? 0.3419 0.2515 0.3312 -0.0157 0.0269  0.0066  394 HOH A O   
1901 O  O   . HOH J .   ? 0.3942 0.3153 0.3021 -0.0296 0.0304  -0.0130 395 HOH A O   
1902 O  O   . HOH J .   ? 0.4103 0.4454 0.3828 -0.0009 -0.0044 0.0262  396 HOH A O   
1903 O  O   . HOH J .   ? 0.3720 0.3145 0.3442 0.0051  0.0011  0.0538  397 HOH A O   
1904 O  O   . HOH J .   ? 0.3035 0.3101 0.2362 -0.0121 -0.0020 0.0039  398 HOH A O   
1905 O  O   . HOH J .   ? 0.3316 0.3514 0.3361 0.0366  0.0449  0.0126  399 HOH A O   
1906 O  O   . HOH J .   ? 0.3353 0.3936 0.2859 -0.0055 0.0119  -0.0076 400 HOH A O   
1907 O  O   . HOH J .   ? 0.3194 0.2736 0.3133 -0.0013 0.0100  -0.0115 401 HOH A O   
1908 O  O   . HOH J .   ? 0.4079 0.3830 0.4022 0.0147  -0.0164 -0.0226 402 HOH A O   
1909 O  O   . HOH J .   ? 0.3012 0.2538 0.4023 -0.0214 0.0570  -0.0075 403 HOH A O   
1910 O  O   . HOH J .   ? 0.3997 0.3669 0.3776 -0.0177 0.0165  0.0156  404 HOH A O   
1911 O  O   . HOH J .   ? 0.3973 0.3601 0.3810 0.0458  0.0155  -0.0424 405 HOH A O   
1912 O  O   . HOH J .   ? 0.2897 0.2655 0.3838 -0.0006 -0.0124 -0.0238 406 HOH A O   
1913 O  O   . HOH J .   ? 0.4904 0.5070 0.4887 -0.0075 0.0383  0.0137  407 HOH A O   
1914 O  O   . HOH J .   ? 0.3043 0.3587 0.3180 -0.0339 -0.0068 0.0163  408 HOH A O   
1915 O  O   . HOH J .   ? 0.2611 0.3578 0.2573 -0.0351 0.0243  -0.0103 409 HOH A O   
1916 O  O   . HOH J .   ? 0.3623 0.3882 0.4332 0.0033  0.0032  0.0171  410 HOH A O   
1917 O  O   . HOH J .   ? 0.3955 0.3148 0.2378 0.0021  -0.0108 0.0201  411 HOH A O   
1918 O  O   . HOH J .   ? 0.4000 0.4194 0.3662 -0.0155 -0.0182 -0.0216 412 HOH A O   
1919 O  O   . HOH J .   ? 0.2837 0.4494 0.3835 -0.0114 0.0509  0.0253  413 HOH A O   
1920 O  O   . HOH J .   ? 0.2822 0.3980 0.3668 -0.0443 -0.0067 -0.0035 414 HOH A O   
1921 O  O   . HOH J .   ? 0.2608 0.2144 0.3001 0.0328  0.0059  0.0328  415 HOH A O   
1922 O  O   . HOH J .   ? 0.4294 0.4728 0.4173 0.0058  0.0154  0.0027  416 HOH A O   
1923 O  O   . HOH J .   ? 0.4179 0.3799 0.3887 -0.0133 -0.0305 0.0158  417 HOH A O   
1924 O  O   . HOH J .   ? 0.6001 0.5965 0.5953 0.0051  -0.0067 -0.0018 418 HOH A O   
1925 O  O   . HOH J .   ? 0.3142 0.3602 0.3104 -0.0427 -0.0339 0.0291  419 HOH A O   
1926 O  O   . HOH J .   ? 0.2643 0.3464 0.4360 0.0174  -0.0067 0.0088  420 HOH A O   
1927 O  O   . HOH J .   ? 0.4032 0.2788 0.3616 -0.0065 -0.0114 0.0131  421 HOH A O   
1928 O  O   . HOH J .   ? 0.3942 0.4002 0.3977 -0.0137 -0.0345 -0.0033 422 HOH A O   
1929 O  O   . HOH J .   ? 0.3522 0.3509 0.4007 -0.0066 -0.0026 -0.0020 423 HOH A O   
1930 O  O   . HOH J .   ? 0.4360 0.3731 0.3701 -0.0062 0.0053  -0.0152 424 HOH A O   
1931 O  O   . HOH J .   ? 0.4922 0.4837 0.4193 -0.0097 0.0076  0.0092  425 HOH A O   
1932 O  O   . HOH J .   ? 0.4515 0.3522 0.3697 -0.0193 -0.0069 -0.0255 426 HOH A O   
1933 O  O   . HOH J .   ? 0.5010 0.4549 0.4325 -0.0189 0.0003  0.0076  427 HOH A O   
1934 O  O   . HOH J .   ? 0.3119 0.2904 0.3440 0.0088  -0.0264 0.0043  428 HOH A O   
1935 O  O   . HOH J .   ? 0.4296 0.4307 0.4576 0.0153  0.0013  -0.0206 429 HOH A O   
1936 O  O   . HOH J .   ? 0.4616 0.4509 0.4799 -0.0013 -0.0128 0.0042  430 HOH A O   
1937 O  O   . HOH J .   ? 0.3920 0.3963 0.3468 0.0223  -0.0106 0.0288  431 HOH A O   
1938 O  O   . HOH J .   ? 0.3538 0.3892 0.3323 0.0055  -0.0079 -0.0328 432 HOH A O   
1939 O  O   . HOH J .   ? 0.3543 0.4397 0.4348 0.0026  -0.0157 -0.0071 433 HOH A O   
1940 O  O   . HOH J .   ? 0.4030 0.3530 0.4222 0.0128  -0.0023 0.0409  434 HOH A O   
1941 O  O   . HOH J .   ? 0.4407 0.4046 0.3638 0.0129  0.0266  0.0070  435 HOH A O   
1942 O  O   . HOH J .   ? 0.4843 0.4566 0.4703 -0.0108 0.0273  -0.0004 436 HOH A O   
1943 O  O   . HOH J .   ? 0.3370 0.3498 0.3407 0.0639  -0.0126 -0.0013 437 HOH A O   
1944 O  O   . HOH J .   ? 0.3812 0.3672 0.3240 -0.0113 -0.0130 0.0113  438 HOH A O   
1945 O  O   . HOH J .   ? 0.3939 0.3628 0.3987 0.0080  -0.0304 0.0281  439 HOH A O   
1946 O  O   . HOH J .   ? 0.3097 0.3497 0.3450 0.0341  -0.0456 -0.0018 440 HOH A O   
1947 O  O   . HOH J .   ? 0.3354 0.3918 0.2995 0.0111  -0.0500 0.0222  441 HOH A O   
1948 O  O   . HOH J .   ? 0.2771 0.2978 0.3857 0.0690  -0.0131 0.0409  442 HOH A O   
1949 O  O   . HOH J .   ? 0.4561 0.4199 0.4057 -0.0122 0.0006  -0.0237 443 HOH A O   
1950 O  O   . HOH J .   ? 0.4482 0.4579 0.4111 0.0003  -0.0118 -0.0056 444 HOH A O   
1951 O  O   . HOH J .   ? 0.3386 0.3455 0.3428 0.0197  0.0258  0.0208  445 HOH A O   
1952 O  O   . HOH J .   ? 0.4482 0.4902 0.4105 -0.0130 0.0051  -0.0073 446 HOH A O   
1953 O  O   . HOH J .   ? 0.4189 0.3945 0.3533 -0.0273 0.0000  0.0197  447 HOH A O   
1954 O  O   . HOH J .   ? 0.4856 0.5033 0.5126 0.0082  -0.0110 0.0027  448 HOH A O   
1955 O  O   . HOH J .   ? 0.2940 0.3493 0.3924 0.0395  -0.0253 -0.0153 449 HOH A O   
1956 O  O   . HOH J .   ? 0.3577 0.3450 0.3780 0.0653  -0.0390 0.0325  450 HOH A O   
1957 O  O   . HOH J .   ? 0.4094 0.4027 0.3715 -0.0181 -0.0123 -0.0033 451 HOH A O   
1958 O  O   . HOH J .   ? 0.4351 0.4605 0.4207 -0.0116 0.0079  0.0057  452 HOH A O   
1959 O  O   . HOH J .   ? 0.4689 0.5155 0.4688 0.0045  0.0044  0.0030  453 HOH A O   
1960 O  O   . HOH J .   ? 0.3860 0.3698 0.4295 -0.0197 -0.0090 -0.0057 454 HOH A O   
1961 O  O   . HOH J .   ? 0.5137 0.4849 0.4989 -0.0136 -0.0125 -0.0068 455 HOH A O   
1962 O  O   . HOH J .   ? 0.3103 0.3707 0.3272 0.0317  -0.0175 0.0029  456 HOH A O   
1963 O  O   . HOH J .   ? 0.4003 0.3952 0.3196 0.0301  -0.0029 -0.0034 457 HOH A O   
1964 O  O   . HOH J .   ? 0.4030 0.4153 0.4094 -0.0385 0.0040  0.0112  458 HOH A O   
1965 O  O   . HOH J .   ? 0.2600 0.3386 0.4216 -0.0517 0.0074  -0.0240 459 HOH A O   
1966 O  O   . HOH J .   ? 0.3030 0.3864 0.4096 -0.0126 0.0063  -0.0057 460 HOH A O   
1967 O  O   . HOH J .   ? 0.4654 0.3917 0.4439 -0.0067 0.0184  0.0106  461 HOH A O   
1968 O  O   . HOH J .   ? 0.4101 0.3315 0.4013 0.0196  0.0155  0.0092  462 HOH A O   
1969 O  O   . HOH J .   ? 0.4205 0.4161 0.3780 -0.0020 0.0102  -0.0197 463 HOH A O   
1970 O  O   . HOH J .   ? 0.5644 0.5556 0.5468 -0.0089 0.0076  0.0056  464 HOH A O   
1971 O  O   . HOH J .   ? 0.4116 0.3203 0.4191 -0.0089 0.0173  -0.0325 465 HOH A O   
1972 O  O   . HOH J .   ? 0.3818 0.3671 0.3516 -0.0188 0.0196  0.0468  466 HOH A O   
1973 O  O   . HOH J .   ? 0.4246 0.4513 0.4076 -0.0253 0.0125  -0.0123 467 HOH A O   
1974 O  O   . HOH J .   ? 0.4471 0.4211 0.4707 0.0269  -0.0124 0.0016  468 HOH A O   
1975 O  O   . HOH J .   ? 0.4006 0.4836 0.4306 -0.0008 0.0141  0.0068  469 HOH A O   
1976 O  O   . HOH J .   ? 0.3698 0.3679 0.4411 0.0144  0.0221  0.0008  470 HOH A O   
1977 O  O   . HOH J .   ? 0.5994 0.5914 0.6170 0.0087  -0.0109 0.0012  471 HOH A O   
1978 O  O   . HOH J .   ? 0.4611 0.4823 0.4767 0.0087  -0.0095 -0.0152 472 HOH A O   
1979 O  O   . HOH J .   ? 0.5759 0.5717 0.5439 0.0048  0.0001  -0.0036 473 HOH A O   
1980 O  O   . HOH J .   ? 0.4494 0.4688 0.4964 -0.0045 -0.0005 0.0040  474 HOH A O   
1981 O  O   . HOH J .   ? 0.3881 0.3984 0.3604 0.0274  -0.0140 0.0345  475 HOH A O   
1982 O  O   . HOH J .   ? 0.5046 0.4946 0.4367 -0.0112 0.0004  -0.0121 476 HOH A O   
1983 O  O   . HOH J .   ? 0.4474 0.4463 0.4663 -0.0087 -0.0106 0.0160  477 HOH A O   
1984 O  O   . HOH J .   ? 0.4222 0.4847 0.4348 0.0065  0.0079  0.0284  478 HOH A O   
1985 O  O   . HOH J .   ? 0.4425 0.4594 0.4204 0.0004  -0.0149 -0.0022 479 HOH A O   
1986 O  O   . HOH J .   ? 0.3298 0.3444 0.4118 -0.0132 0.0130  -0.0458 480 HOH A O   
1987 O  O   . HOH J .   ? 0.5343 0.5242 0.5203 0.0081  0.0000  0.0167  481 HOH A O   
1988 O  O   . HOH J .   ? 0.4684 0.4773 0.4578 -0.0095 0.0130  -0.0107 482 HOH A O   
1989 O  O   . HOH J .   ? 0.4201 0.4117 0.4013 -0.0120 -0.0201 0.0169  483 HOH A O   
1990 O  O   . HOH J .   ? 0.4259 0.4731 0.4694 -0.0234 0.0156  0.0156  484 HOH A O   
1991 O  O   . HOH J .   ? 0.3279 0.3444 0.3913 0.0341  0.0172  -0.0083 485 HOH A O   
1992 O  O   . HOH J .   ? 0.5452 0.4876 0.4948 0.0061  -0.0102 -0.0043 486 HOH A O   
1993 O  O   . HOH J .   ? 0.4998 0.5278 0.4897 0.0177  -0.0015 -0.0051 487 HOH A O   
1994 O  O   . HOH J .   ? 0.5042 0.5416 0.5079 -0.0071 -0.0019 -0.0060 488 HOH A O   
1995 O  O   . HOH J .   ? 0.4089 0.3479 0.3666 -0.0142 -0.0043 -0.0438 489 HOH A O   
1996 O  O   . HOH J .   ? 0.4715 0.5206 0.5094 0.0280  0.0091  0.0020  490 HOH A O   
1997 O  O   . HOH J .   ? 0.3333 0.3929 0.4158 -0.0133 0.0100  -0.0263 491 HOH A O   
1998 O  O   . HOH J .   ? 0.4133 0.4021 0.3709 -0.0267 0.0144  0.0094  492 HOH A O   
1999 O  O   . HOH J .   ? 0.4454 0.4883 0.4903 0.0120  -0.0144 0.0117  493 HOH A O   
2000 O  O   . HOH J .   ? 0.4635 0.4137 0.3365 -0.0026 -0.0006 -0.0250 494 HOH A O   
2001 O  O   . HOH J .   ? 0.4408 0.3692 0.4308 0.0247  -0.0139 0.0210  495 HOH A O   
2002 O  O   . HOH J .   ? 0.3790 0.3864 0.3819 0.0216  -0.0048 0.0226  496 HOH A O   
2003 O  O   . HOH J .   ? 0.3386 0.3233 0.3206 0.0605  -0.0057 0.0241  497 HOH A O   
2004 O  O   . HOH J .   ? 0.4464 0.4538 0.4641 0.0159  0.0170  -0.0130 498 HOH A O   
2005 O  O   . HOH J .   ? 0.5150 0.4887 0.4896 -0.0036 -0.0244 -0.0246 499 HOH A O   
2006 O  O   . HOH J .   ? 0.4912 0.4991 0.4992 0.0189  -0.0249 0.0051  500 HOH A O   
2007 O  O   . HOH J .   ? 0.4097 0.3144 0.3813 0.0302  -0.0031 -0.0757 501 HOH A O   
2008 O  O   . HOH J .   ? 0.4866 0.4739 0.4676 0.0013  0.0110  -0.0132 502 HOH A O   
2009 O  O   . HOH J .   ? 0.4733 0.4614 0.5048 0.0122  -0.0182 -0.0149 503 HOH A O   
2010 O  O   . HOH J .   ? 0.4893 0.4704 0.4948 -0.0011 -0.0236 0.0099  504 HOH A O   
2011 O  O   . HOH J .   ? 0.3350 0.4355 0.4423 0.0216  -0.0206 0.0031  505 HOH A O   
2012 O  O   . HOH J .   ? 0.4920 0.5069 0.4824 0.0037  -0.0086 -0.0101 506 HOH A O   
2013 O  O   . HOH J .   ? 0.3546 0.3156 0.4077 -0.0162 0.0139  0.0084  507 HOH A O   
2014 O  O   . HOH J .   ? 0.5432 0.5637 0.5594 -0.0146 -0.0094 0.0156  508 HOH A O   
2015 O  O   . HOH J .   ? 0.3862 0.4545 0.4218 0.0081  0.0066  -0.0103 509 HOH A O   
2016 O  O   . HOH J .   ? 0.5137 0.5205 0.4988 -0.0008 -0.0055 -0.0085 510 HOH A O   
2017 O  O   . HOH J .   ? 0.4296 0.4889 0.4784 -0.0008 0.0086  -0.0022 511 HOH A O   
2018 O  O   . HOH J .   ? 0.4873 0.4956 0.5251 -0.0163 -0.0060 -0.0022 512 HOH A O   
2019 O  O   . HOH J .   ? 0.5309 0.5597 0.5793 0.0109  -0.0068 0.0040  513 HOH A O   
2020 O  O   . HOH J .   ? 0.4682 0.4523 0.4409 -0.0089 0.0277  -0.0030 514 HOH A O   
2021 O  O   . HOH J .   ? 0.4058 0.4074 0.4033 -0.0124 0.0057  -0.0198 515 HOH A O   
2022 O  O   . HOH J .   ? 0.4300 0.4523 0.4707 -0.0052 -0.0014 -0.0112 516 HOH A O   
2023 O  O   . HOH J .   ? 0.6117 0.5989 0.6092 0.0063  0.0086  -0.0049 517 HOH A O   
2024 O  O   . HOH J .   ? 0.5330 0.5430 0.5311 -0.0017 0.0050  -0.0007 518 HOH A O   
2025 O  O   . HOH J .   ? 0.5405 0.5676 0.5405 -0.0026 -0.0019 -0.0168 519 HOH A O   
2026 O  O   . HOH J .   ? 0.5571 0.5424 0.5697 0.0157  -0.0035 -0.0062 520 HOH A O   
2027 O  O   . HOH J .   ? 0.4529 0.3539 0.4290 -0.0180 0.0042  0.0058  521 HOH A O   
2028 O  O   . HOH J .   ? 0.5447 0.5338 0.5763 -0.0038 0.0010  -0.0053 522 HOH A O   
2029 O  O   . HOH J .   ? 0.5821 0.5674 0.5764 -0.0104 -0.0070 -0.0053 523 HOH A O   
2030 O  O   . HOH J .   ? 0.5157 0.4785 0.4697 -0.0205 -0.0044 -0.0129 524 HOH A O   
2031 O  O   . HOH J .   ? 0.4187 0.3769 0.4408 0.0250  -0.0015 0.0000  525 HOH A O   
2032 O  O   . HOH J .   ? 0.4642 0.4157 0.3932 -0.0215 0.0047  0.0066  526 HOH A O   
2033 O  O   . HOH J .   ? 0.4491 0.4703 0.4408 0.0230  0.0137  -0.0265 527 HOH A O   
2034 O  O   . HOH J .   ? 0.5649 0.5514 0.5455 -0.0063 -0.0051 -0.0071 528 HOH A O   
2035 O  O   . HOH J .   ? 0.4391 0.4605 0.3986 0.0091  -0.0208 0.0133  529 HOH A O   
2036 O  O   . HOH J .   ? 0.5375 0.5338 0.5285 0.0020  0.0040  -0.0095 530 HOH A O   
2037 O  O   . HOH J .   ? 0.3960 0.4620 0.4199 -0.0166 0.0114  -0.0132 531 HOH A O   
2038 O  O   . HOH J .   ? 0.5290 0.5358 0.5061 -0.0139 -0.0083 -0.0147 532 HOH A O   
2039 O  O   . HOH J .   ? 0.5074 0.4634 0.4778 0.0087  0.0042  -0.0048 533 HOH A O   
2040 O  O   . HOH J .   ? 0.5174 0.4697 0.5185 0.0003  -0.0007 -0.0126 534 HOH A O   
2041 O  O   . HOH J .   ? 0.4551 0.4153 0.3787 -0.0165 -0.0071 -0.0264 535 HOH A O   
2042 O  O   . HOH J .   ? 0.3887 0.3911 0.3172 0.0073  0.0246  0.0030  536 HOH A O   
2043 O  O   . HOH J .   ? 0.4998 0.4765 0.4660 -0.0299 -0.0059 -0.0102 537 HOH A O   
2044 O  O   . HOH J .   ? 0.4265 0.3817 0.3408 -0.0103 0.0181  -0.0299 538 HOH A O   
2045 O  O   . HOH J .   ? 0.4878 0.5363 0.5566 -0.0101 -0.0029 0.0075  539 HOH A O   
2046 O  O   . HOH J .   ? 0.4773 0.4704 0.4910 0.0092  -0.0016 0.0154  540 HOH A O   
2047 O  O   . HOH J .   ? 0.5616 0.5603 0.5382 -0.0064 0.0104  0.0069  541 HOH A O   
2048 O  O   . HOH J .   ? 0.5136 0.5267 0.5148 0.0077  -0.0133 0.0153  542 HOH A O   
2049 O  O   . HOH J .   ? 0.5965 0.5658 0.5711 0.0022  0.0036  -0.0111 543 HOH A O   
2050 O  O   . HOH J .   ? 0.6441 0.6479 0.6541 0.0042  -0.0063 -0.0080 544 HOH A O   
2051 O  O   . HOH J .   ? 0.3771 0.4062 0.4305 0.0102  -0.0175 0.0270  545 HOH A O   
2052 O  O   . HOH J .   ? 0.2515 0.2774 0.3261 0.0024  -0.0807 0.0043  546 HOH A O   
2053 O  O   . HOH J .   ? 0.2906 0.3559 0.3950 -0.0230 -0.0647 0.0558  547 HOH A O   
2054 O  O   . HOH J .   ? 0.4006 0.4578 0.4434 0.0116  -0.0102 -0.0125 548 HOH A O   
2055 O  O   . HOH J .   ? 0.5401 0.5358 0.5519 0.0012  -0.0107 -0.0001 549 HOH A O   
2056 O  O   . HOH J .   ? 0.3717 0.3601 0.3614 -0.0407 -0.0010 0.0012  550 HOH A O   
2057 O  O   . HOH J .   ? 0.3664 0.3589 0.4132 0.0041  0.0008  0.0305  551 HOH A O   
2058 O  O   . HOH J .   ? 0.4768 0.4905 0.5148 -0.0016 -0.0107 -0.0040 552 HOH A O   
2059 O  O   . HOH J .   ? 0.6003 0.5872 0.5754 -0.0026 -0.0015 -0.0005 553 HOH A O   
2060 O  O   . HOH J .   ? 0.5231 0.5447 0.5416 0.0004  0.0177  0.0053  554 HOH A O   
2061 O  O   . HOH J .   ? 0.6153 0.6085 0.6148 -0.0052 -0.0080 0.0056  555 HOH A O   
2062 O  O   . HOH J .   ? 0.4075 0.4771 0.4191 0.0009  -0.0003 0.0083  556 HOH A O   
2063 O  O   . HOH J .   ? 0.5179 0.5449 0.5389 -0.0102 -0.0074 -0.0007 557 HOH A O   
2064 O  O   . HOH J .   ? 0.3741 0.3706 0.4016 -0.0024 -0.0054 0.0050  558 HOH A O   
2065 O  O   . HOH J .   ? 0.6747 0.6698 0.6676 -0.0002 -0.0047 0.0021  559 HOH A O   
2066 O  O   . HOH J .   ? 0.4625 0.4395 0.4830 0.0071  -0.0015 -0.0086 560 HOH A O   
2067 O  O   . HOH J .   ? 0.4595 0.4219 0.4792 -0.0108 -0.0103 -0.0065 561 HOH A O   
2068 O  O   . HOH J .   ? 0.6002 0.5996 0.5909 -0.0009 0.0034  -0.0053 562 HOH A O   
2069 O  O   . HOH J .   ? 0.5494 0.5367 0.5519 0.0049  0.0115  -0.0061 563 HOH A O   
2070 O  O   . HOH J .   ? 0.5487 0.5524 0.5030 -0.0021 -0.0078 0.0154  564 HOH A O   
2071 O  O   . HOH J .   ? 0.4790 0.4785 0.4768 0.0047  0.0130  -0.0155 565 HOH A O   
2072 O  O   . HOH J .   ? 0.6351 0.6346 0.6353 -0.0053 -0.0038 0.0038  566 HOH A O   
2073 O  O   . HOH J .   ? 0.3104 0.4180 0.4221 0.0147  -0.0171 -0.0259 567 HOH A O   
2074 O  O   . HOH J .   ? 0.3983 0.4162 0.4503 0.0271  -0.0151 0.0077  568 HOH A O   
2075 O  O   . HOH J .   ? 0.4902 0.4538 0.4931 -0.0118 -0.0039 0.0196  569 HOH A O   
2076 O  O   . HOH J .   ? 0.4705 0.4929 0.4379 -0.0053 0.0062  -0.0099 570 HOH A O   
2077 O  O   . HOH J .   ? 0.4961 0.5577 0.5250 0.0013  -0.0039 -0.0040 571 HOH A O   
2078 O  O   . HOH J .   ? 0.5242 0.5982 0.5697 0.0056  -0.0085 0.0073  572 HOH A O   
2079 O  O   . HOH J .   ? 0.5968 0.6000 0.5953 0.0001  -0.0014 0.0005  573 HOH A O   
2080 O  O   . HOH J .   ? 0.5650 0.5642 0.5745 0.0051  -0.0107 0.0078  574 HOH A O   
2081 O  O   . HOH J .   ? 0.5836 0.5996 0.5963 0.0089  -0.0017 0.0083  575 HOH A O   
2082 O  O   . HOH J .   ? 0.4856 0.5151 0.4987 -0.0050 -0.0097 -0.0157 576 HOH A O   
2083 O  O   . HOH J .   ? 0.5847 0.6274 0.5794 0.0117  -0.0051 -0.0117 577 HOH A O   
2084 O  O   . HOH J .   ? 0.4184 0.3458 0.3896 -0.0060 0.0192  0.0160  578 HOH A O   
2085 O  O   . HOH J .   ? 0.6239 0.6449 0.6168 0.0036  -0.0002 0.0034  579 HOH A O   
2086 O  O   . HOH J .   ? 0.4725 0.4280 0.4410 0.0300  -0.0047 -0.0080 580 HOH A O   
2087 O  O   . HOH J .   ? 0.3933 0.3039 0.4439 -0.0175 -0.0293 -0.0502 581 HOH A O   
2088 O  O   . HOH J .   ? 0.3203 0.4084 0.3521 0.0149  0.0428  -0.0103 582 HOH A O   
2089 O  O   . HOH J .   ? 0.5046 0.5165 0.5239 0.0047  0.0018  -0.0014 583 HOH A O   
2090 O  O   . HOH J .   ? 0.5078 0.5111 0.4949 0.0035  0.0184  -0.0133 584 HOH A O   
2091 O  O   . HOH J .   ? 0.6045 0.5801 0.5854 0.0121  0.0022  0.0016  585 HOH A O   
2092 O  O   . HOH J .   ? 0.5947 0.5973 0.6113 -0.0050 -0.0046 0.0027  586 HOH A O   
2093 O  O   . HOH J .   ? 0.5900 0.5778 0.5887 -0.0056 -0.0035 0.0071  587 HOH A O   
2094 O  O   . HOH J .   ? 0.4633 0.4475 0.4551 0.0042  -0.0077 -0.0144 588 HOH A O   
2095 O  O   . HOH J .   ? 0.5604 0.5642 0.5631 0.0066  0.0035  0.0022  589 HOH A O   
2096 O  O   . HOH J .   ? 0.4415 0.4066 0.3362 -0.0156 -0.0001 0.0034  590 HOH A O   
2097 O  O   . HOH J .   ? 0.4380 0.4519 0.4527 -0.0040 0.0096  -0.0136 591 HOH A O   
2098 O  O   . HOH J .   ? 0.4145 0.4453 0.3882 0.0012  -0.0274 -0.0211 592 HOH A O   
2099 O  O   . HOH J .   ? 0.3014 0.2999 0.2710 -0.0040 0.0186  -0.0069 593 HOH A O   
2100 O  O   . HOH J .   ? 0.1686 0.1406 0.2112 0.0173  -0.0004 -0.0297 594 HOH A O   
2101 O  O   . HOH J .   ? 0.2075 0.2797 0.2271 -0.0043 0.0147  0.0220  595 HOH A O   
2102 O  O   . HOH J .   ? 0.5106 0.4919 0.5234 0.0071  0.0029  -0.0027 596 HOH A O   
2103 O  O   . HOH J .   ? 0.4921 0.4827 0.5042 0.0062  0.0076  -0.0151 597 HOH A O   
2104 O  O   . HOH J .   ? 0.3055 0.2225 0.4113 0.0384  0.0284  -0.0415 598 HOH A O   
2105 O  O   . HOH J .   ? 0.4524 0.3650 0.3400 -0.0033 0.0205  -0.0078 599 HOH A O   
2106 O  O   . HOH J .   ? 0.3871 0.3791 0.3636 0.0304  0.0077  -0.0206 600 HOH A O   
2107 O  O   . HOH J .   ? 0.5197 0.5441 0.5514 0.0017  -0.0040 -0.0035 601 HOH A O   
2108 O  O   . HOH J .   ? 0.4268 0.4055 0.4667 0.0017  0.0002  0.0185  602 HOH A O   
2109 O  O   . HOH J .   ? 0.5398 0.4729 0.5282 0.0168  -0.0108 -0.0011 603 HOH A O   
2110 O  O   . HOH J .   ? 0.3827 0.4027 0.4366 -0.0040 0.0235  -0.0062 604 HOH A O   
2111 O  O   . HOH J .   ? 0.3678 0.3335 0.3786 -0.0260 0.0032  0.0053  605 HOH A O   
2112 O  O   . HOH J .   ? 0.4735 0.4426 0.4566 0.0015  -0.0042 0.0209  606 HOH A O   
2113 O  O   . HOH J .   ? 0.5050 0.4659 0.5130 -0.0031 0.0056  -0.0160 607 HOH A O   
2114 O  O   . HOH J .   ? 0.4716 0.4695 0.4716 -0.0097 -0.0201 0.0008  608 HOH A O   
2115 O  O   . HOH J .   ? 0.4354 0.4057 0.3779 0.0057  -0.0089 0.0016  609 HOH A O   
2116 O  O   . HOH J .   ? 0.4668 0.4836 0.5144 -0.0005 0.0124  0.0075  610 HOH A O   
2117 O  O   . HOH J .   ? 0.5195 0.4998 0.5099 -0.0009 0.0102  0.0080  611 HOH A O   
2118 O  O   . HOH J .   ? 0.4355 0.4679 0.4827 0.0032  0.0090  -0.0057 612 HOH A O   
2119 O  O   . HOH J .   ? 0.4499 0.4387 0.4802 -0.0003 -0.0036 0.0002  613 HOH A O   
2120 O  O   . HOH J .   ? 0.5058 0.4335 0.4692 -0.0044 0.0272  0.0073  614 HOH A O   
2121 O  O   . HOH J .   ? 0.4512 0.4563 0.4251 -0.0149 0.0234  0.0080  615 HOH A O   
2122 O  O   . HOH J .   ? 0.4680 0.4098 0.3916 0.0030  0.0000  0.0125  616 HOH A O   
2123 O  O   . HOH J .   ? 0.5025 0.5195 0.4877 0.0005  0.0048  -0.0086 617 HOH A O   
2124 O  O   . HOH J .   ? 0.5010 0.4650 0.4204 0.0127  0.0056  0.0130  618 HOH A O   
2125 O  O   . HOH J .   ? 0.5495 0.5461 0.5509 0.0024  0.0028  -0.0028 619 HOH A O   
2126 O  O   . HOH J .   ? 0.3450 0.4006 0.4359 0.0183  -0.0085 0.0109  620 HOH A O   
2127 O  O   . HOH J .   ? 0.3999 0.3582 0.4420 0.0196  0.0092  0.0011  621 HOH A O   
2128 O  O   . HOH J .   ? 0.5462 0.5735 0.5576 0.0035  0.0021  -0.0002 622 HOH A O   
2129 O  O   . HOH J .   ? 0.4716 0.4562 0.3887 -0.0012 -0.0061 0.0153  623 HOH A O   
2130 O  O   . HOH J .   ? 0.4153 0.4088 0.4109 -0.0202 -0.0003 -0.0052 624 HOH A O   
2131 O  O   . HOH J .   ? 0.5227 0.5374 0.5312 0.0047  0.0003  -0.0098 625 HOH A O   
2132 O  O   . HOH J .   ? 0.5097 0.5147 0.4921 0.0003  0.0033  0.0122  626 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  TRP 10  10  10  TRP TRP A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  ASN 22  21  21  ASN ASN A A n 
A 1 23  PHE 23  22  22  PHE PHE A . n 
A 1 24  THR 24  23  23  THR THR A . n 
A 1 25  GLY 25  24  24  GLY GLY A . n 
A 1 26  SER 26  25  25  SER SER A . n 
A 1 27  GLN 27  26  26  GLN GLN A . n 
A 1 28  ARG 28  27  27  ARG ARG A . n 
A 1 29  ALA 29  28  28  ALA ALA A . n 
A 1 30  VAL 30  29  29  VAL VAL A . n 
A 1 31  PHE 31  30  30  PHE PHE A . n 
A 1 32  ARG 32  31  31  ARG ARG A . n 
A 1 33  GLN 33  32  32  GLN GLN A . n 
A 1 34  ALA 34  33  33  ALA ALA A . n 
A 1 35  MET 35  34  34  MET MET A . n 
A 1 36  ARG 36  35  35  ARG ARG A . n 
A 1 37  HIS 37  36  36  HIS HIS A . n 
A 1 38  TRP 38  37  37  TRP TRP A . n 
A 1 39  GLU 39  38  38  GLU GLU A . n 
A 1 40  LYS 40  39  39  LYS LYS A . n 
A 1 41  HIS 41  40  40  HIS HIS A . n 
A 1 42  THR 42  41  41  THR THR A . n 
A 1 43  CYS 43  42  42  CYS CYS A . n 
A 1 44  VAL 44  43  43  VAL VAL A . n 
A 1 45  THR 45  44  44  THR THR A . n 
A 1 46  PHE 46  45  45  PHE PHE A . n 
A 1 47  LEU 47  46  46  LEU LEU A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ARG 49  48  48  ARG ARG A . n 
A 1 50  THR 50  49  49  THR THR A . n 
A 1 51  ASP 51  50  50  ASP ASP A . n 
A 1 52  GLU 52  51  51  GLU GLU A . n 
A 1 53  ASP 53  52  52  ASP ASP A . n 
A 1 54  SER 54  53  53  SER SER A . n 
A 1 55  TYR 55  54  54  TYR TYR A . n 
A 1 56  ILE 56  55  55  ILE ILE A . n 
A 1 57  VAL 57  56  56  VAL VAL A . n 
A 1 58  PHE 58  57  57  PHE PHE A . n 
A 1 59  THR 59  58  58  THR THR A . n 
A 1 60  TYR 60  59  59  TYR TYR A . n 
A 1 61  ARG 61  60  60  ARG ARG A . n 
A 1 62  PRO 62  61  61  PRO PRO A . n 
A 1 63  CYS 63  62  62  CYS CYS A . n 
A 1 64  GLY 64  63  63  GLY GLY A . n 
A 1 65  CYS 65  64  64  CYS CYS A . n 
A 1 66  CYS 66  65  65  CYS CYS A . n 
A 1 67  SER 67  66  66  SER SER A . n 
A 1 68  TYR 68  67  67  TYR TYR A . n 
A 1 69  VAL 69  68  68  VAL VAL A . n 
A 1 70  GLY 70  69  69  GLY GLY A . n 
A 1 71  ARG 71  70  70  ARG ARG A . n 
A 1 72  ARG 72  71  71  ARG ARG A . n 
A 1 73  GLY 73  72  72  GLY GLY A . n 
A 1 74  GLY 74  72  72  GLY GLY A A n 
A 1 75  GLY 75  73  73  GLY GLY A . n 
A 1 76  PRO 76  74  74  PRO PRO A . n 
A 1 77  GLN 77  75  75  GLN GLN A . n 
A 1 78  ALA 78  76  76  ALA ALA A . n 
A 1 79  ILE 79  77  77  ILE ILE A . n 
A 1 80  SER 80  78  78  SER SER A . n 
A 1 81  ILE 81  79  79  ILE ILE A . n 
A 1 82  GLY 82  81  81  GLY GLY A . n 
A 1 83  LYS 83  82  82  LYS LYS A . n 
A 1 84  ASN 84  83  83  ASN ASN A . n 
A 1 85  CYS 85  84  84  CYS CYS A . n 
A 1 86  ASP 86  85  85  ASP ASP A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  PHE 88  87  87  PHE PHE A . n 
A 1 89  GLY 89  88  88  GLY GLY A . n 
A 1 90  ILE 90  89  89  ILE ILE A . n 
A 1 91  VAL 91  90  90  VAL VAL A . n 
A 1 92  VAL 92  91  91  VAL VAL A . n 
A 1 93  HIS 93  92  92  HIS HIS A . n 
A 1 94  GLU 94  93  93  GLU GLU A . n 
A 1 95  LEU 95  94  94  LEU LEU A . n 
A 1 96  GLY 96  95  95  GLY GLY A . n 
A 1 97  HIS 97  96  96  HIS HIS A . n 
A 1 98  VAL 98  97  97  VAL VAL A . n 
A 1 99  VAL 99  98  98  VAL VAL A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 TRP 102 101 101 TRP TRP A . n 
A 1 103 HIS 103 102 102 HIS HIS A . n 
A 1 104 GLU 104 103 103 GLU GLU A . n 
A 1 105 HIS 105 104 104 HIS HIS A . n 
A 1 106 THR 106 105 105 THR THR A . n 
A 1 107 ARG 107 106 106 ARG ARG A . n 
A 1 108 PRO 108 107 107 PRO PRO A . n 
A 1 109 ASP 109 108 108 ASP ASP A . n 
A 1 110 ARG 110 109 109 ARG ARG A . n 
A 1 111 ASP 111 110 110 ASP ASP A . n 
A 1 112 ARG 112 111 111 ARG ARG A . n 
A 1 113 HIS 113 112 112 HIS HIS A . n 
A 1 114 VAL 114 113 113 VAL VAL A . n 
A 1 115 SER 115 114 114 SER SER A . n 
A 1 116 ILE 116 115 115 ILE ILE A . n 
A 1 117 VAL 117 116 116 VAL VAL A . n 
A 1 118 ARG 118 117 117 ARG ARG A . n 
A 1 119 GLU 119 118 118 GLU GLU A . n 
A 1 120 ASN 120 119 119 ASN ASN A . n 
A 1 121 ILE 121 120 120 ILE ILE A . n 
A 1 122 GLN 122 121 121 GLN GLN A . n 
A 1 123 PRO 123 122 122 PRO PRO A . n 
A 1 124 GLY 124 123 123 GLY GLY A . n 
A 1 125 GLN 125 124 124 GLN GLN A . n 
A 1 126 GLU 126 125 125 GLU GLU A . n 
A 1 127 TYR 127 126 126 TYR TYR A . n 
A 1 128 ASN 128 127 127 ASN ASN A . n 
A 1 129 PHE 129 128 128 PHE PHE A . n 
A 1 130 LEU 130 129 129 LEU LEU A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 MET 132 131 131 MET MET A . n 
A 1 133 GLU 133 132 132 GLU GLU A . n 
A 1 134 PRO 134 132 132 PRO PRO A A n 
A 1 135 GLN 135 132 132 GLN GLN A B n 
A 1 136 GLU 136 133 133 GLU GLU A . n 
A 1 137 VAL 137 134 134 VAL VAL A . n 
A 1 138 GLU 138 135 135 GLU GLU A . n 
A 1 139 SER 139 136 136 SER SER A . n 
A 1 140 LEU 140 137 137 LEU LEU A . n 
A 1 141 GLY 141 138 138 GLY GLY A . n 
A 1 142 GLU 142 139 139 GLU GLU A . n 
A 1 143 THR 143 140 140 THR THR A . n 
A 1 144 TYR 144 141 141 TYR TYR A . n 
A 1 145 ASP 145 142 142 ASP ASP A . n 
A 1 146 PHE 146 143 143 PHE PHE A . n 
A 1 147 ASP 147 144 144 ASP ASP A . n 
A 1 148 SER 148 145 145 SER SER A . n 
A 1 149 ILE 149 146 146 ILE ILE A . n 
A 1 150 MET 150 147 147 MET MET A . n 
A 1 151 HIS 151 148 148 HIS HIS A . n 
A 1 152 TYR 152 149 149 TYR TYR A . n 
A 1 153 ALA 153 150 150 ALA ALA A . n 
A 1 154 ARG 154 151 151 ARG ARG A . n 
A 1 155 ASN 155 152 152 ASN ASN A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 PHE 157 154 154 PHE PHE A . n 
A 1 158 SER 158 155 155 SER SER A . n 
A 1 159 ARG 159 156 156 ARG ARG A . n 
A 1 160 GLY 160 157 157 GLY GLY A . n 
A 1 161 ILE 161 159 159 ILE ILE A . n 
A 1 162 PHE 162 160 160 PHE PHE A . n 
A 1 163 LEU 163 161 161 LEU LEU A . n 
A 1 164 ASP 164 162 162 ASP ASP A . n 
A 1 165 THR 165 163 163 THR THR A . n 
A 1 166 ILE 166 164 164 ILE ILE A . n 
A 1 167 VAL 167 165 165 VAL VAL A . n 
A 1 168 PRO 168 166 166 PRO PRO A . n 
A 1 169 LYS 169 167 167 LYS LYS A . n 
A 1 170 TYR 170 168 168 TYR TYR A . n 
A 1 171 GLU 171 168 168 GLU GLU A A n 
A 1 172 VAL 172 168 168 VAL VAL A B n 
A 1 173 ASN 173 168 168 ASN ASN A C n 
A 1 174 GLY 174 168 168 GLY GLY A D n 
A 1 175 VAL 175 169 169 VAL VAL A . n 
A 1 176 LYS 176 170 170 LYS ALA A . n 
A 1 177 PRO 177 171 171 PRO PRO A . n 
A 1 178 PRO 178 172 172 PRO PRO A . n 
A 1 179 ILE 179 173 173 ILE ILE A . n 
A 1 180 GLY 180 174 174 GLY GLY A . n 
A 1 181 GLN 181 175 175 GLN GLN A . n 
A 1 182 ARG 182 176 176 ARG ARG A . n 
A 1 183 THR 183 180 180 THR THR A . n 
A 1 184 ARG 184 181 181 ARG ARG A . n 
A 1 185 LEU 185 182 182 LEU LEU A . n 
A 1 186 SER 186 183 183 SER SER A . n 
A 1 187 LYS 187 184 184 LYS LYS A . n 
A 1 188 GLY 188 185 185 GLY GLY A . n 
A 1 189 ASP 189 186 186 ASP ASP A . n 
A 1 190 ILE 190 187 187 ILE ILE A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 ALA 193 190 190 ALA ALA A . n 
A 1 194 ARG 194 191 191 ARG ARG A . n 
A 1 195 LYS 195 192 192 LYS LYS A . n 
A 1 196 LEU 196 193 193 LEU LEU A . n 
A 1 197 TYR 197 194 194 TYR TYR A . n 
A 1 198 LYS 198 195 195 LYS LYS A . n 
A 1 199 CYS 199 198 198 CYS CYS A . n 
A 1 200 PRO 200 199 199 PRO PRO A . n 
A 1 201 ALA 201 200 200 ALA ALA A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 93  ? A HIS 92  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 NE2 ? A HIS 97  ? A HIS 96  ? 1_555 100.0 ? 
2  NE2 ? A HIS 93  ? A HIS 92  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 NE2 ? A HIS 103 ? A HIS 102 ? 1_555 110.4 ? 
3  NE2 ? A HIS 97  ? A HIS 96  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 NE2 ? A HIS 103 ? A HIS 102 ? 1_555 99.7  ? 
4  NE2 ? A HIS 93  ? A HIS 92  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 O   A G DMS .   ? A DMS 214 ? 1_555 133.7 ? 
5  NE2 ? A HIS 97  ? A HIS 96  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 O   A G DMS .   ? A DMS 214 ? 1_555 107.3 ? 
6  NE2 ? A HIS 103 ? A HIS 102 ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 O   A G DMS .   ? A DMS 214 ? 1_555 101.0 ? 
7  NE2 ? A HIS 93  ? A HIS 92  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 O   B G DMS .   ? A DMS 214 ? 1_555 115.7 ? 
8  NE2 ? A HIS 97  ? A HIS 96  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 O   B G DMS .   ? A DMS 214 ? 1_555 104.7 ? 
9  NE2 ? A HIS 103 ? A HIS 102 ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 O   B G DMS .   ? A DMS 214 ? 1_555 121.9 ? 
10 O   A G DMS .   ? A DMS 214 ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 O   B G DMS .   ? A DMS 214 ? 1_555 21.3  ? 
11 NE2 ? A HIS 93  ? A HIS 92  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 S   A G DMS .   ? A DMS 214 ? 1_555 104.6 ? 
12 NE2 ? A HIS 97  ? A HIS 96  ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 S   A G DMS .   ? A DMS 214 ? 1_555 136.5 ? 
13 NE2 ? A HIS 103 ? A HIS 102 ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 S   A G DMS .   ? A DMS 214 ? 1_555 104.4 ? 
14 O   A G DMS .   ? A DMS 214 ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 S   A G DMS .   ? A DMS 214 ? 1_555 32.9  ? 
15 O   B G DMS .   ? A DMS 214 ? 1_555 ZN ? C ZN . ? A ZN 210 ? 1_555 S   A G DMS .   ? A DMS 214 ? 1_555 31.9  ? 
16 NE2 ? A GLN 192 ? A GLN 189 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? B ACE .   ? A ACE 201 ? 1_555 80.6  ? 
17 NE2 ? A GLN 192 ? A GLN 189 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 228 ? 1_555 74.3  ? 
18 O   ? B ACE .   ? A ACE 201 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 228 ? 1_555 103.6 ? 
19 NE2 ? A GLN 192 ? A GLN 189 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 224 ? 1_555 95.8  ? 
20 O   ? B ACE .   ? A ACE 201 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 224 ? 1_555 175.6 ? 
21 O   ? J HOH .   ? A HOH 228 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 224 ? 1_555 77.6  ? 
22 NE2 ? A GLN 192 ? A GLN 189 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 221 ? 1_555 79.9  ? 
23 O   ? B ACE .   ? A ACE 201 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 221 ? 1_555 89.9  ? 
24 O   ? J HOH .   ? A HOH 228 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 221 ? 1_555 148.2 ? 
25 O   ? J HOH .   ? A HOH 224 ? 1_555 ZN ? D ZN . ? A ZN 211 ? 1_555 O   ? J HOH .   ? A HOH 221 ? 1_555 87.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-16 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_pdbx_phasing_MR.entry_id                     3EDH 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           45.010 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        45.010 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
XSCALE      .     ?               package 'Wolfgang Kabsch'    ?                           'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?          ? 1 
PHASER      .     ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/                                 ?          ? 2 
REFMAC      .     ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html                                Fortran_77 ? 3 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O A HOH 442 ? ? O A HOH 545 ? ? 1.91 
2  1 O A HOH 319 ? ? O A HOH 431 ? ? 1.94 
3  1 O A HOH 608 ? ? O A HOH 613 ? ? 1.95 
4  1 O A HOH 268 ? ? O A HOH 616 ? ? 1.98 
5  1 O A HOH 352 ? ? O A HOH 545 ? ? 2.02 
6  1 O A HOH 336 ? ? O A HOH 475 ? ? 2.02 
7  1 O A HOH 466 ? ? O A HOH 611 ? ? 2.04 
8  1 O A HOH 323 ? ? O A HOH 610 ? ? 2.09 
9  1 O A HOH 380 ? ? O A HOH 439 ? ? 2.18 
10 1 O A HOH 309 ? ? O A HOH 525 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 49 ? ? -114.97 -78.79 
2 1 CYS A 84 ? ? -165.92 53.28  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 170 ? CG ? A LYS 176 CG 
2 1 Y 1 A LYS 170 ? CD ? A LYS 176 CD 
3 1 Y 1 A LYS 170 ? CE ? A LYS 176 CE 
4 1 Y 1 A LYS 170 ? NZ ? A LYS 176 NZ 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ACETYL GROUP'       ACE 
3 'ZINC ION'           ZN  
4 'DIMETHYL SULFOXIDE' DMS 
5 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ACE 1   201 200 ACE ACE A . 
C 3 ZN  1   210 210 ZN  ZN  A . 
D 3 ZN  1   211 211 ZN  ZN  A . 
E 4 DMS 1   212 1   DMS DMS A . 
F 4 DMS 1   213 2   DMS DMS A . 
G 4 DMS 1   214 3   DMS DMS A . 
H 4 DMS 1   215 5   DMS DMS A . 
I 4 DMS 1   216 6   DMS DMS A . 
J 5 HOH 1   217 1   HOH HOH A . 
J 5 HOH 2   218 2   HOH HOH A . 
J 5 HOH 3   219 3   HOH HOH A . 
J 5 HOH 4   220 4   HOH HOH A . 
J 5 HOH 5   221 5   HOH HOH A . 
J 5 HOH 6   222 6   HOH HOH A . 
J 5 HOH 7   223 7   HOH HOH A . 
J 5 HOH 8   224 8   HOH HOH A . 
J 5 HOH 9   225 9   HOH HOH A . 
J 5 HOH 10  226 10  HOH HOH A . 
J 5 HOH 11  227 11  HOH HOH A . 
J 5 HOH 12  228 12  HOH HOH A . 
J 5 HOH 13  229 13  HOH HOH A . 
J 5 HOH 14  230 14  HOH HOH A . 
J 5 HOH 15  231 15  HOH HOH A . 
J 5 HOH 16  232 16  HOH HOH A . 
J 5 HOH 17  233 17  HOH HOH A . 
J 5 HOH 18  234 18  HOH HOH A . 
J 5 HOH 19  235 19  HOH HOH A . 
J 5 HOH 20  236 20  HOH HOH A . 
J 5 HOH 21  237 21  HOH HOH A . 
J 5 HOH 22  238 22  HOH HOH A . 
J 5 HOH 23  239 23  HOH HOH A . 
J 5 HOH 24  240 24  HOH HOH A . 
J 5 HOH 25  241 25  HOH HOH A . 
J 5 HOH 26  242 26  HOH HOH A . 
J 5 HOH 27  243 27  HOH HOH A . 
J 5 HOH 28  244 28  HOH HOH A . 
J 5 HOH 29  245 30  HOH HOH A . 
J 5 HOH 30  246 31  HOH HOH A . 
J 5 HOH 31  247 32  HOH HOH A . 
J 5 HOH 32  248 33  HOH HOH A . 
J 5 HOH 33  249 34  HOH HOH A . 
J 5 HOH 34  250 35  HOH HOH A . 
J 5 HOH 35  251 36  HOH HOH A . 
J 5 HOH 36  252 37  HOH HOH A . 
J 5 HOH 37  253 38  HOH HOH A . 
J 5 HOH 38  254 39  HOH HOH A . 
J 5 HOH 39  255 40  HOH HOH A . 
J 5 HOH 40  256 41  HOH HOH A . 
J 5 HOH 41  257 42  HOH HOH A . 
J 5 HOH 42  258 43  HOH HOH A . 
J 5 HOH 43  259 44  HOH HOH A . 
J 5 HOH 44  260 45  HOH HOH A . 
J 5 HOH 45  261 46  HOH HOH A . 
J 5 HOH 46  262 47  HOH HOH A . 
J 5 HOH 47  263 49  HOH HOH A . 
J 5 HOH 48  264 50  HOH HOH A . 
J 5 HOH 49  265 51  HOH HOH A . 
J 5 HOH 50  266 52  HOH HOH A . 
J 5 HOH 51  267 53  HOH HOH A . 
J 5 HOH 52  268 54  HOH HOH A . 
J 5 HOH 53  269 56  HOH HOH A . 
J 5 HOH 54  270 57  HOH HOH A . 
J 5 HOH 55  271 58  HOH HOH A . 
J 5 HOH 56  272 59  HOH HOH A . 
J 5 HOH 57  273 60  HOH HOH A . 
J 5 HOH 58  274 61  HOH HOH A . 
J 5 HOH 59  275 62  HOH HOH A . 
J 5 HOH 60  276 63  HOH HOH A . 
J 5 HOH 61  277 64  HOH HOH A . 
J 5 HOH 62  278 65  HOH HOH A . 
J 5 HOH 63  279 66  HOH HOH A . 
J 5 HOH 64  280 67  HOH HOH A . 
J 5 HOH 65  281 68  HOH HOH A . 
J 5 HOH 66  282 69  HOH HOH A . 
J 5 HOH 67  283 70  HOH HOH A . 
J 5 HOH 68  284 71  HOH HOH A . 
J 5 HOH 69  285 72  HOH HOH A . 
J 5 HOH 70  286 73  HOH HOH A . 
J 5 HOH 71  287 74  HOH HOH A . 
J 5 HOH 72  288 75  HOH HOH A . 
J 5 HOH 73  289 76  HOH HOH A . 
J 5 HOH 74  290 78  HOH HOH A . 
J 5 HOH 75  291 79  HOH HOH A . 
J 5 HOH 76  292 80  HOH HOH A . 
J 5 HOH 77  293 81  HOH HOH A . 
J 5 HOH 78  294 82  HOH HOH A . 
J 5 HOH 79  295 83  HOH HOH A . 
J 5 HOH 80  296 85  HOH HOH A . 
J 5 HOH 81  297 86  HOH HOH A . 
J 5 HOH 82  298 88  HOH HOH A . 
J 5 HOH 83  299 89  HOH HOH A . 
J 5 HOH 84  300 90  HOH HOH A . 
J 5 HOH 85  301 91  HOH HOH A . 
J 5 HOH 86  302 92  HOH HOH A . 
J 5 HOH 87  303 93  HOH HOH A . 
J 5 HOH 88  304 94  HOH HOH A . 
J 5 HOH 89  305 95  HOH HOH A . 
J 5 HOH 90  306 96  HOH HOH A . 
J 5 HOH 91  307 97  HOH HOH A . 
J 5 HOH 92  308 98  HOH HOH A . 
J 5 HOH 93  309 99  HOH HOH A . 
J 5 HOH 94  310 100 HOH HOH A . 
J 5 HOH 95  311 102 HOH HOH A . 
J 5 HOH 96  312 103 HOH HOH A . 
J 5 HOH 97  313 104 HOH HOH A . 
J 5 HOH 98  314 105 HOH HOH A . 
J 5 HOH 99  315 106 HOH HOH A . 
J 5 HOH 100 316 107 HOH HOH A . 
J 5 HOH 101 317 108 HOH HOH A . 
J 5 HOH 102 318 109 HOH HOH A . 
J 5 HOH 103 319 111 HOH HOH A . 
J 5 HOH 104 320 112 HOH HOH A . 
J 5 HOH 105 321 113 HOH HOH A . 
J 5 HOH 106 322 114 HOH HOH A . 
J 5 HOH 107 323 115 HOH HOH A . 
J 5 HOH 108 324 116 HOH HOH A . 
J 5 HOH 109 325 117 HOH HOH A . 
J 5 HOH 110 326 118 HOH HOH A . 
J 5 HOH 111 327 119 HOH HOH A . 
J 5 HOH 112 328 120 HOH HOH A . 
J 5 HOH 113 329 121 HOH HOH A . 
J 5 HOH 114 330 122 HOH HOH A . 
J 5 HOH 115 331 123 HOH HOH A . 
J 5 HOH 116 332 124 HOH HOH A . 
J 5 HOH 117 333 125 HOH HOH A . 
J 5 HOH 118 334 127 HOH HOH A . 
J 5 HOH 119 335 128 HOH HOH A . 
J 5 HOH 120 336 129 HOH HOH A . 
J 5 HOH 121 337 131 HOH HOH A . 
J 5 HOH 122 338 133 HOH HOH A . 
J 5 HOH 123 339 134 HOH HOH A . 
J 5 HOH 124 340 135 HOH HOH A . 
J 5 HOH 125 341 136 HOH HOH A . 
J 5 HOH 126 342 137 HOH HOH A . 
J 5 HOH 127 343 138 HOH HOH A . 
J 5 HOH 128 344 139 HOH HOH A . 
J 5 HOH 129 345 140 HOH HOH A . 
J 5 HOH 130 346 141 HOH HOH A . 
J 5 HOH 131 347 142 HOH HOH A . 
J 5 HOH 132 348 143 HOH HOH A . 
J 5 HOH 133 349 144 HOH HOH A . 
J 5 HOH 134 350 145 HOH HOH A . 
J 5 HOH 135 351 146 HOH HOH A . 
J 5 HOH 136 352 147 HOH HOH A . 
J 5 HOH 137 353 148 HOH HOH A . 
J 5 HOH 138 354 149 HOH HOH A . 
J 5 HOH 139 355 150 HOH HOH A . 
J 5 HOH 140 356 151 HOH HOH A . 
J 5 HOH 141 357 152 HOH HOH A . 
J 5 HOH 142 358 153 HOH HOH A . 
J 5 HOH 143 359 154 HOH HOH A . 
J 5 HOH 144 360 155 HOH HOH A . 
J 5 HOH 145 361 156 HOH HOH A . 
J 5 HOH 146 362 157 HOH HOH A . 
J 5 HOH 147 363 158 HOH HOH A . 
J 5 HOH 148 364 159 HOH HOH A . 
J 5 HOH 149 365 160 HOH HOH A . 
J 5 HOH 150 366 161 HOH HOH A . 
J 5 HOH 151 367 162 HOH HOH A . 
J 5 HOH 152 368 163 HOH HOH A . 
J 5 HOH 153 369 164 HOH HOH A . 
J 5 HOH 154 370 165 HOH HOH A . 
J 5 HOH 155 371 166 HOH HOH A . 
J 5 HOH 156 372 167 HOH HOH A . 
J 5 HOH 157 373 168 HOH HOH A . 
J 5 HOH 158 374 169 HOH HOH A . 
J 5 HOH 159 375 170 HOH HOH A . 
J 5 HOH 160 376 171 HOH HOH A . 
J 5 HOH 161 377 172 HOH HOH A . 
J 5 HOH 162 378 173 HOH HOH A . 
J 5 HOH 163 379 175 HOH HOH A . 
J 5 HOH 164 380 176 HOH HOH A . 
J 5 HOH 165 381 177 HOH HOH A . 
J 5 HOH 166 382 178 HOH HOH A . 
J 5 HOH 167 383 179 HOH HOH A . 
J 5 HOH 168 384 180 HOH HOH A . 
J 5 HOH 169 385 181 HOH HOH A . 
J 5 HOH 170 386 182 HOH HOH A . 
J 5 HOH 171 387 183 HOH HOH A . 
J 5 HOH 172 388 185 HOH HOH A . 
J 5 HOH 173 389 186 HOH HOH A . 
J 5 HOH 174 390 187 HOH HOH A . 
J 5 HOH 175 391 188 HOH HOH A . 
J 5 HOH 176 392 189 HOH HOH A . 
J 5 HOH 177 393 190 HOH HOH A . 
J 5 HOH 178 394 191 HOH HOH A . 
J 5 HOH 179 395 193 HOH HOH A . 
J 5 HOH 180 396 194 HOH HOH A . 
J 5 HOH 181 397 196 HOH HOH A . 
J 5 HOH 182 398 197 HOH HOH A . 
J 5 HOH 183 399 198 HOH HOH A . 
J 5 HOH 184 400 199 HOH HOH A . 
J 5 HOH 185 401 200 HOH HOH A . 
J 5 HOH 186 402 201 HOH HOH A . 
J 5 HOH 187 403 202 HOH HOH A . 
J 5 HOH 188 404 203 HOH HOH A . 
J 5 HOH 189 405 204 HOH HOH A . 
J 5 HOH 190 406 205 HOH HOH A . 
J 5 HOH 191 407 206 HOH HOH A . 
J 5 HOH 192 408 207 HOH HOH A . 
J 5 HOH 193 409 208 HOH HOH A . 
J 5 HOH 194 410 209 HOH HOH A . 
J 5 HOH 195 411 210 HOH HOH A . 
J 5 HOH 196 412 211 HOH HOH A . 
J 5 HOH 197 413 212 HOH HOH A . 
J 5 HOH 198 414 213 HOH HOH A . 
J 5 HOH 199 415 214 HOH HOH A . 
J 5 HOH 200 416 215 HOH HOH A . 
J 5 HOH 201 417 216 HOH HOH A . 
J 5 HOH 202 418 217 HOH HOH A . 
J 5 HOH 203 419 221 HOH HOH A . 
J 5 HOH 204 420 222 HOH HOH A . 
J 5 HOH 205 421 223 HOH HOH A . 
J 5 HOH 206 422 224 HOH HOH A . 
J 5 HOH 207 423 225 HOH HOH A . 
J 5 HOH 208 424 226 HOH HOH A . 
J 5 HOH 209 425 227 HOH HOH A . 
J 5 HOH 210 426 228 HOH HOH A . 
J 5 HOH 211 427 229 HOH HOH A . 
J 5 HOH 212 428 230 HOH HOH A . 
J 5 HOH 213 429 231 HOH HOH A . 
J 5 HOH 214 430 232 HOH HOH A . 
J 5 HOH 215 431 233 HOH HOH A . 
J 5 HOH 216 432 235 HOH HOH A . 
J 5 HOH 217 433 236 HOH HOH A . 
J 5 HOH 218 434 237 HOH HOH A . 
J 5 HOH 219 435 238 HOH HOH A . 
J 5 HOH 220 436 239 HOH HOH A . 
J 5 HOH 221 437 240 HOH HOH A . 
J 5 HOH 222 438 241 HOH HOH A . 
J 5 HOH 223 439 242 HOH HOH A . 
J 5 HOH 224 440 243 HOH HOH A . 
J 5 HOH 225 441 245 HOH HOH A . 
J 5 HOH 226 442 247 HOH HOH A . 
J 5 HOH 227 443 248 HOH HOH A . 
J 5 HOH 228 444 250 HOH HOH A . 
J 5 HOH 229 445 252 HOH HOH A . 
J 5 HOH 230 446 253 HOH HOH A . 
J 5 HOH 231 447 254 HOH HOH A . 
J 5 HOH 232 448 255 HOH HOH A . 
J 5 HOH 233 449 256 HOH HOH A . 
J 5 HOH 234 450 257 HOH HOH A . 
J 5 HOH 235 451 258 HOH HOH A . 
J 5 HOH 236 452 259 HOH HOH A . 
J 5 HOH 237 453 260 HOH HOH A . 
J 5 HOH 238 454 261 HOH HOH A . 
J 5 HOH 239 455 262 HOH HOH A . 
J 5 HOH 240 456 263 HOH HOH A . 
J 5 HOH 241 457 265 HOH HOH A . 
J 5 HOH 242 458 266 HOH HOH A . 
J 5 HOH 243 459 268 HOH HOH A . 
J 5 HOH 244 460 269 HOH HOH A . 
J 5 HOH 245 461 271 HOH HOH A . 
J 5 HOH 246 462 272 HOH HOH A . 
J 5 HOH 247 463 273 HOH HOH A . 
J 5 HOH 248 464 275 HOH HOH A . 
J 5 HOH 249 465 276 HOH HOH A . 
J 5 HOH 250 466 277 HOH HOH A . 
J 5 HOH 251 467 278 HOH HOH A . 
J 5 HOH 252 468 279 HOH HOH A . 
J 5 HOH 253 469 280 HOH HOH A . 
J 5 HOH 254 470 281 HOH HOH A . 
J 5 HOH 255 471 282 HOH HOH A . 
J 5 HOH 256 472 283 HOH HOH A . 
J 5 HOH 257 473 284 HOH HOH A . 
J 5 HOH 258 474 285 HOH HOH A . 
J 5 HOH 259 475 286 HOH HOH A . 
J 5 HOH 260 476 287 HOH HOH A . 
J 5 HOH 261 477 288 HOH HOH A . 
J 5 HOH 262 478 289 HOH HOH A . 
J 5 HOH 263 479 290 HOH HOH A . 
J 5 HOH 264 480 291 HOH HOH A . 
J 5 HOH 265 481 292 HOH HOH A . 
J 5 HOH 266 482 293 HOH HOH A . 
J 5 HOH 267 483 294 HOH HOH A . 
J 5 HOH 268 484 295 HOH HOH A . 
J 5 HOH 269 485 296 HOH HOH A . 
J 5 HOH 270 486 297 HOH HOH A . 
J 5 HOH 271 487 298 HOH HOH A . 
J 5 HOH 272 488 299 HOH HOH A . 
J 5 HOH 273 489 300 HOH HOH A . 
J 5 HOH 274 490 302 HOH HOH A . 
J 5 HOH 275 491 303 HOH HOH A . 
J 5 HOH 276 492 304 HOH HOH A . 
J 5 HOH 277 493 305 HOH HOH A . 
J 5 HOH 278 494 306 HOH HOH A . 
J 5 HOH 279 495 307 HOH HOH A . 
J 5 HOH 280 496 308 HOH HOH A . 
J 5 HOH 281 497 309 HOH HOH A . 
J 5 HOH 282 498 310 HOH HOH A . 
J 5 HOH 283 499 311 HOH HOH A . 
J 5 HOH 284 500 312 HOH HOH A . 
J 5 HOH 285 501 313 HOH HOH A . 
J 5 HOH 286 502 314 HOH HOH A . 
J 5 HOH 287 503 315 HOH HOH A . 
J 5 HOH 288 504 316 HOH HOH A . 
J 5 HOH 289 505 317 HOH HOH A . 
J 5 HOH 290 506 319 HOH HOH A . 
J 5 HOH 291 507 320 HOH HOH A . 
J 5 HOH 292 508 321 HOH HOH A . 
J 5 HOH 293 509 322 HOH HOH A . 
J 5 HOH 294 510 323 HOH HOH A . 
J 5 HOH 295 511 324 HOH HOH A . 
J 5 HOH 296 512 325 HOH HOH A . 
J 5 HOH 297 513 326 HOH HOH A . 
J 5 HOH 298 514 327 HOH HOH A . 
J 5 HOH 299 515 328 HOH HOH A . 
J 5 HOH 300 516 329 HOH HOH A . 
J 5 HOH 301 517 330 HOH HOH A . 
J 5 HOH 302 518 331 HOH HOH A . 
J 5 HOH 303 519 332 HOH HOH A . 
J 5 HOH 304 520 333 HOH HOH A . 
J 5 HOH 305 521 334 HOH HOH A . 
J 5 HOH 306 522 335 HOH HOH A . 
J 5 HOH 307 523 336 HOH HOH A . 
J 5 HOH 308 524 337 HOH HOH A . 
J 5 HOH 309 525 338 HOH HOH A . 
J 5 HOH 310 526 339 HOH HOH A . 
J 5 HOH 311 527 340 HOH HOH A . 
J 5 HOH 312 528 341 HOH HOH A . 
J 5 HOH 313 529 342 HOH HOH A . 
J 5 HOH 314 530 343 HOH HOH A . 
J 5 HOH 315 531 344 HOH HOH A . 
J 5 HOH 316 532 345 HOH HOH A . 
J 5 HOH 317 533 346 HOH HOH A . 
J 5 HOH 318 534 347 HOH HOH A . 
J 5 HOH 319 535 348 HOH HOH A . 
J 5 HOH 320 536 349 HOH HOH A . 
J 5 HOH 321 537 350 HOH HOH A . 
J 5 HOH 322 538 351 HOH HOH A . 
J 5 HOH 323 539 352 HOH HOH A . 
J 5 HOH 324 540 355 HOH HOH A . 
J 5 HOH 325 541 356 HOH HOH A . 
J 5 HOH 326 542 357 HOH HOH A . 
J 5 HOH 327 543 358 HOH HOH A . 
J 5 HOH 328 544 359 HOH HOH A . 
J 5 HOH 329 545 360 HOH HOH A . 
J 5 HOH 330 546 361 HOH HOH A . 
J 5 HOH 331 547 363 HOH HOH A . 
J 5 HOH 332 548 365 HOH HOH A . 
J 5 HOH 333 549 366 HOH HOH A . 
J 5 HOH 334 550 367 HOH HOH A . 
J 5 HOH 335 551 368 HOH HOH A . 
J 5 HOH 336 552 372 HOH HOH A . 
J 5 HOH 337 553 373 HOH HOH A . 
J 5 HOH 338 554 374 HOH HOH A . 
J 5 HOH 339 555 376 HOH HOH A . 
J 5 HOH 340 556 377 HOH HOH A . 
J 5 HOH 341 557 379 HOH HOH A . 
J 5 HOH 342 558 380 HOH HOH A . 
J 5 HOH 343 559 381 HOH HOH A . 
J 5 HOH 344 560 382 HOH HOH A . 
J 5 HOH 345 561 383 HOH HOH A . 
J 5 HOH 346 562 384 HOH HOH A . 
J 5 HOH 347 563 385 HOH HOH A . 
J 5 HOH 348 564 386 HOH HOH A . 
J 5 HOH 349 565 387 HOH HOH A . 
J 5 HOH 350 566 389 HOH HOH A . 
J 5 HOH 351 567 391 HOH HOH A . 
J 5 HOH 352 568 393 HOH HOH A . 
J 5 HOH 353 569 394 HOH HOH A . 
J 5 HOH 354 570 395 HOH HOH A . 
J 5 HOH 355 571 396 HOH HOH A . 
J 5 HOH 356 572 397 HOH HOH A . 
J 5 HOH 357 573 399 HOH HOH A . 
J 5 HOH 358 574 400 HOH HOH A . 
J 5 HOH 359 575 403 HOH HOH A . 
J 5 HOH 360 576 404 HOH HOH A . 
J 5 HOH 361 577 405 HOH HOH A . 
J 5 HOH 362 578 406 HOH HOH A . 
J 5 HOH 363 579 408 HOH HOH A . 
J 5 HOH 364 580 411 HOH HOH A . 
J 5 HOH 365 581 413 HOH HOH A . 
J 5 HOH 366 582 416 HOH HOH A . 
J 5 HOH 367 583 417 HOH HOH A . 
J 5 HOH 368 584 418 HOH HOH A . 
J 5 HOH 369 585 419 HOH HOH A . 
J 5 HOH 370 586 420 HOH HOH A . 
J 5 HOH 371 587 423 HOH HOH A . 
J 5 HOH 372 588 424 HOH HOH A . 
J 5 HOH 373 589 425 HOH HOH A . 
J 5 HOH 374 590 426 HOH HOH A . 
J 5 HOH 375 591 427 HOH HOH A . 
J 5 HOH 376 592 429 HOH HOH A . 
J 5 HOH 377 593 430 HOH HOH A . 
J 5 HOH 378 594 431 HOH HOH A . 
J 5 HOH 379 595 432 HOH HOH A . 
J 5 HOH 380 596 433 HOH HOH A . 
J 5 HOH 381 597 434 HOH HOH A . 
J 5 HOH 382 598 435 HOH HOH A . 
J 5 HOH 383 599 436 HOH HOH A . 
J 5 HOH 384 600 437 HOH HOH A . 
J 5 HOH 385 601 438 HOH HOH A . 
J 5 HOH 386 602 439 HOH HOH A . 
J 5 HOH 387 603 440 HOH HOH A . 
J 5 HOH 388 604 441 HOH HOH A . 
J 5 HOH 389 605 442 HOH HOH A . 
J 5 HOH 390 606 443 HOH HOH A . 
J 5 HOH 391 607 444 HOH HOH A . 
J 5 HOH 392 608 445 HOH HOH A . 
J 5 HOH 393 609 446 HOH HOH A . 
J 5 HOH 394 610 447 HOH HOH A . 
J 5 HOH 395 611 448 HOH HOH A . 
J 5 HOH 396 612 449 HOH HOH A . 
J 5 HOH 397 613 450 HOH HOH A . 
J 5 HOH 398 614 451 HOH HOH A . 
J 5 HOH 399 615 452 HOH HOH A . 
J 5 HOH 400 616 453 HOH HOH A . 
J 5 HOH 401 617 454 HOH HOH A . 
J 5 HOH 402 618 455 HOH HOH A . 
J 5 HOH 403 619 456 HOH HOH A . 
J 5 HOH 404 620 457 HOH HOH A . 
J 5 HOH 405 621 458 HOH HOH A . 
J 5 HOH 406 622 459 HOH HOH A . 
J 5 HOH 407 623 460 HOH HOH A . 
J 5 HOH 408 624 461 HOH HOH A . 
J 5 HOH 409 625 462 HOH HOH A . 
J 5 HOH 410 626 463 HOH HOH A . 
#