data_3ELP
# 
_entry.id   3ELP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ELP         
RCSB  RCSB049479   
WWPDB D_1000049479 
# 
_pdbx_database_status.entry_id                        3ELP 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-09-23 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sun, Q.'       1 
'Sivaraman, J.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the inhibition mechanism of human cystathionine gamma-lyase, an enzyme responsible for the production of H(2)S' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                3076 
_citation.page_last                 3085 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19019829 
_citation.pdbx_database_id_DOI      10.1074/jbc.M805459200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sun, Q.'                1  
primary 'Collins, R.'            2  
primary 'Huang, S.'              3  
primary 'Holmberg-Schiavone, L.' 4  
primary 'Anand, G.S.'            5  
primary 'Tan, C.H.'              6  
primary 'van-den-Berg, S.'       7  
primary 'Deng, L.-W.'            8  
primary 'Moore, P.K.'            9  
primary 'Karlberg, T.'           10 
primary 'Sivaraman, J.'          11 
# 
_cell.length_a           121.304 
_cell.length_b           121.304 
_cell.length_c           125.592 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3ELP 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 42' 
_symmetry.entry_id                         3ELP 
_symmetry.Int_Tables_number                77 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Cystathionine gamma-lyase' 45003.316 4   4.4.1.1 ? ? ? 
2 water   nat water                       18.015    467 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gamma-cystathionase 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSPNSMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAV
AALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVW
IETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNR
LRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVT
FYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALK
AAHPPSGSHS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSPNSMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAV
AALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVW
IETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNR
LRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVT
FYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALK
AAHPPSGSHS
;
_entity_poly.pdbx_strand_id                 B,A,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PRO n 
1 4   ASN n 
1 5   SER n 
1 6   MET n 
1 7   GLN n 
1 8   GLU n 
1 9   LYS n 
1 10  ASP n 
1 11  ALA n 
1 12  SER n 
1 13  SER n 
1 14  GLN n 
1 15  GLY n 
1 16  PHE n 
1 17  LEU n 
1 18  PRO n 
1 19  HIS n 
1 20  PHE n 
1 21  GLN n 
1 22  HIS n 
1 23  PHE n 
1 24  ALA n 
1 25  THR n 
1 26  GLN n 
1 27  ALA n 
1 28  ILE n 
1 29  HIS n 
1 30  VAL n 
1 31  GLY n 
1 32  GLN n 
1 33  ASP n 
1 34  PRO n 
1 35  GLU n 
1 36  GLN n 
1 37  TRP n 
1 38  THR n 
1 39  SER n 
1 40  ARG n 
1 41  ALA n 
1 42  VAL n 
1 43  VAL n 
1 44  PRO n 
1 45  PRO n 
1 46  ILE n 
1 47  SER n 
1 48  LEU n 
1 49  SER n 
1 50  THR n 
1 51  THR n 
1 52  PHE n 
1 53  LYS n 
1 54  GLN n 
1 55  GLY n 
1 56  ALA n 
1 57  PRO n 
1 58  GLY n 
1 59  GLN n 
1 60  HIS n 
1 61  SER n 
1 62  GLY n 
1 63  PHE n 
1 64  GLU n 
1 65  TYR n 
1 66  SER n 
1 67  ARG n 
1 68  SER n 
1 69  GLY n 
1 70  ASN n 
1 71  PRO n 
1 72  THR n 
1 73  ARG n 
1 74  ASN n 
1 75  CYS n 
1 76  LEU n 
1 77  GLU n 
1 78  LYS n 
1 79  ALA n 
1 80  VAL n 
1 81  ALA n 
1 82  ALA n 
1 83  LEU n 
1 84  ASP n 
1 85  GLY n 
1 86  ALA n 
1 87  LYS n 
1 88  TYR n 
1 89  CYS n 
1 90  LEU n 
1 91  ALA n 
1 92  PHE n 
1 93  ALA n 
1 94  SER n 
1 95  GLY n 
1 96  LEU n 
1 97  ALA n 
1 98  ALA n 
1 99  THR n 
1 100 VAL n 
1 101 THR n 
1 102 ILE n 
1 103 THR n 
1 104 HIS n 
1 105 LEU n 
1 106 LEU n 
1 107 LYS n 
1 108 ALA n 
1 109 GLY n 
1 110 ASP n 
1 111 GLN n 
1 112 ILE n 
1 113 ILE n 
1 114 CYS n 
1 115 MET n 
1 116 ASP n 
1 117 ASP n 
1 118 VAL n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 THR n 
1 123 ASN n 
1 124 ARG n 
1 125 TYR n 
1 126 PHE n 
1 127 ARG n 
1 128 GLN n 
1 129 VAL n 
1 130 ALA n 
1 131 SER n 
1 132 GLU n 
1 133 PHE n 
1 134 GLY n 
1 135 LEU n 
1 136 LYS n 
1 137 ILE n 
1 138 SER n 
1 139 PHE n 
1 140 VAL n 
1 141 ASP n 
1 142 CYS n 
1 143 SER n 
1 144 LYS n 
1 145 ILE n 
1 146 LYS n 
1 147 LEU n 
1 148 LEU n 
1 149 GLU n 
1 150 ALA n 
1 151 ALA n 
1 152 ILE n 
1 153 THR n 
1 154 PRO n 
1 155 GLU n 
1 156 THR n 
1 157 LYS n 
1 158 LEU n 
1 159 VAL n 
1 160 TRP n 
1 161 ILE n 
1 162 GLU n 
1 163 THR n 
1 164 PRO n 
1 165 THR n 
1 166 ASN n 
1 167 PRO n 
1 168 THR n 
1 169 GLN n 
1 170 LYS n 
1 171 VAL n 
1 172 ILE n 
1 173 ASP n 
1 174 ILE n 
1 175 GLU n 
1 176 GLY n 
1 177 CYS n 
1 178 ALA n 
1 179 HIS n 
1 180 ILE n 
1 181 VAL n 
1 182 HIS n 
1 183 LYS n 
1 184 HIS n 
1 185 GLY n 
1 186 ASP n 
1 187 ILE n 
1 188 ILE n 
1 189 LEU n 
1 190 VAL n 
1 191 VAL n 
1 192 ASP n 
1 193 ASN n 
1 194 THR n 
1 195 PHE n 
1 196 MET n 
1 197 SER n 
1 198 PRO n 
1 199 TYR n 
1 200 PHE n 
1 201 GLN n 
1 202 ARG n 
1 203 PRO n 
1 204 LEU n 
1 205 ALA n 
1 206 LEU n 
1 207 GLY n 
1 208 ALA n 
1 209 ASP n 
1 210 ILE n 
1 211 SER n 
1 212 MET n 
1 213 TYR n 
1 214 SER n 
1 215 ALA n 
1 216 THR n 
1 217 LYS n 
1 218 TYR n 
1 219 MET n 
1 220 ASN n 
1 221 GLY n 
1 222 HIS n 
1 223 SER n 
1 224 ASP n 
1 225 VAL n 
1 226 VAL n 
1 227 MET n 
1 228 GLY n 
1 229 LEU n 
1 230 VAL n 
1 231 SER n 
1 232 VAL n 
1 233 ASN n 
1 234 CYS n 
1 235 GLU n 
1 236 SER n 
1 237 LEU n 
1 238 HIS n 
1 239 ASN n 
1 240 ARG n 
1 241 LEU n 
1 242 ARG n 
1 243 PHE n 
1 244 LEU n 
1 245 GLN n 
1 246 ASN n 
1 247 SER n 
1 248 LEU n 
1 249 GLY n 
1 250 ALA n 
1 251 VAL n 
1 252 PRO n 
1 253 SER n 
1 254 PRO n 
1 255 ILE n 
1 256 ASP n 
1 257 CYS n 
1 258 TYR n 
1 259 LEU n 
1 260 CYS n 
1 261 ASN n 
1 262 ARG n 
1 263 GLY n 
1 264 LEU n 
1 265 LYS n 
1 266 THR n 
1 267 LEU n 
1 268 HIS n 
1 269 VAL n 
1 270 ARG n 
1 271 MET n 
1 272 GLU n 
1 273 LYS n 
1 274 HIS n 
1 275 PHE n 
1 276 LYS n 
1 277 ASN n 
1 278 GLY n 
1 279 MET n 
1 280 ALA n 
1 281 VAL n 
1 282 ALA n 
1 283 GLN n 
1 284 PHE n 
1 285 LEU n 
1 286 GLU n 
1 287 SER n 
1 288 ASN n 
1 289 PRO n 
1 290 TRP n 
1 291 VAL n 
1 292 GLU n 
1 293 LYS n 
1 294 VAL n 
1 295 ILE n 
1 296 TYR n 
1 297 PRO n 
1 298 GLY n 
1 299 LEU n 
1 300 PRO n 
1 301 SER n 
1 302 HIS n 
1 303 PRO n 
1 304 GLN n 
1 305 HIS n 
1 306 GLU n 
1 307 LEU n 
1 308 VAL n 
1 309 LYS n 
1 310 ARG n 
1 311 GLN n 
1 312 CYS n 
1 313 THR n 
1 314 GLY n 
1 315 CYS n 
1 316 THR n 
1 317 GLY n 
1 318 MET n 
1 319 VAL n 
1 320 THR n 
1 321 PHE n 
1 322 TYR n 
1 323 ILE n 
1 324 LYS n 
1 325 GLY n 
1 326 THR n 
1 327 LEU n 
1 328 GLN n 
1 329 HIS n 
1 330 ALA n 
1 331 GLU n 
1 332 ILE n 
1 333 PHE n 
1 334 LEU n 
1 335 LYS n 
1 336 ASN n 
1 337 LEU n 
1 338 LYS n 
1 339 LEU n 
1 340 PHE n 
1 341 THR n 
1 342 LEU n 
1 343 ALA n 
1 344 GLU n 
1 345 SER n 
1 346 LEU n 
1 347 GLY n 
1 348 GLY n 
1 349 PHE n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ALA n 
1 354 GLU n 
1 355 LEU n 
1 356 PRO n 
1 357 ALA n 
1 358 ILE n 
1 359 MET n 
1 360 THR n 
1 361 HIS n 
1 362 ALA n 
1 363 SER n 
1 364 VAL n 
1 365 LEU n 
1 366 LYS n 
1 367 ASN n 
1 368 ASP n 
1 369 ARG n 
1 370 ASP n 
1 371 VAL n 
1 372 LEU n 
1 373 GLY n 
1 374 ILE n 
1 375 SER n 
1 376 ASP n 
1 377 THR n 
1 378 LEU n 
1 379 ILE n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 VAL n 
1 384 GLY n 
1 385 LEU n 
1 386 GLU n 
1 387 ASP n 
1 388 GLU n 
1 389 GLU n 
1 390 ASP n 
1 391 LEU n 
1 392 LEU n 
1 393 GLU n 
1 394 ASP n 
1 395 LEU n 
1 396 ASP n 
1 397 GLN n 
1 398 ALA n 
1 399 LEU n 
1 400 LYS n 
1 401 ALA n 
1 402 ALA n 
1 403 HIS n 
1 404 PRO n 
1 405 PRO n 
1 406 SER n 
1 407 GLY n 
1 408 SER n 
1 409 HIS n 
1 410 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CTH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL 21' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX4T-3 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CGL_HUMAN 
_struct_ref.pdbx_db_accession          P32929 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDG
AKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPT
NPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQ
NSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKG
TLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPP
SGSHS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ELP B 6 ? 410 ? P32929 1 ? 405 ? 1 405 
2 1 3ELP A 6 ? 410 ? P32929 1 ? 405 ? 1 405 
3 1 3ELP C 6 ? 410 ? P32929 1 ? 405 ? 1 405 
4 1 3ELP D 6 ? 410 ? P32929 1 ? 405 ? 1 405 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ELP GLY B 1 ? UNP P32929 ? ? 'EXPRESSION TAG' -4 1  
1 3ELP SER B 2 ? UNP P32929 ? ? 'EXPRESSION TAG' -3 2  
1 3ELP PRO B 3 ? UNP P32929 ? ? 'EXPRESSION TAG' -2 3  
1 3ELP ASN B 4 ? UNP P32929 ? ? 'EXPRESSION TAG' -1 4  
1 3ELP SER B 5 ? UNP P32929 ? ? 'EXPRESSION TAG' 0  5  
2 3ELP GLY A 1 ? UNP P32929 ? ? 'EXPRESSION TAG' -4 6  
2 3ELP SER A 2 ? UNP P32929 ? ? 'EXPRESSION TAG' -3 7  
2 3ELP PRO A 3 ? UNP P32929 ? ? 'EXPRESSION TAG' -2 8  
2 3ELP ASN A 4 ? UNP P32929 ? ? 'EXPRESSION TAG' -1 9  
2 3ELP SER A 5 ? UNP P32929 ? ? 'EXPRESSION TAG' 0  10 
3 3ELP GLY C 1 ? UNP P32929 ? ? 'EXPRESSION TAG' -4 11 
3 3ELP SER C 2 ? UNP P32929 ? ? 'EXPRESSION TAG' -3 12 
3 3ELP PRO C 3 ? UNP P32929 ? ? 'EXPRESSION TAG' -2 13 
3 3ELP ASN C 4 ? UNP P32929 ? ? 'EXPRESSION TAG' -1 14 
3 3ELP SER C 5 ? UNP P32929 ? ? 'EXPRESSION TAG' 0  15 
4 3ELP GLY D 1 ? UNP P32929 ? ? 'EXPRESSION TAG' -4 16 
4 3ELP SER D 2 ? UNP P32929 ? ? 'EXPRESSION TAG' -3 17 
4 3ELP PRO D 3 ? UNP P32929 ? ? 'EXPRESSION TAG' -2 18 
4 3ELP ASN D 4 ? UNP P32929 ? ? 'EXPRESSION TAG' -1 19 
4 3ELP SER D 5 ? UNP P32929 ? ? 'EXPRESSION TAG' 0  20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3ELP 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        0.564 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   52.08 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'20% (v/v) PEG 1000, 0.2M lithium sulfate, 0.1M phosphate-citrate pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
# 
_reflns.entry_id                     3ELP 
_reflns.d_resolution_high            2.400 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   71004 
_reflns.pdbx_Rmerge_I_obs            0.127 
_reflns.pdbx_netI_over_sigmaI        14.182 
_reflns.pdbx_chi_squared             1.036 
_reflns.pdbx_redundancy              10.200 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -0.5 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        51.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.40 2.49  ? ? ? 0.676 2.1 ? 1.039 4.70  ? 7003 98.80  ? 1  
2.49 2.59  ? ? ? 0.655 ?   ? 1.034 6.50  ? 7044 99.80  ? 2  
2.59 2.70  ? ? ? 0.617 ?   ? 1.032 8.00  ? 7079 100.00 ? 3  
2.70 2.85  ? ? ? 0.537 ?   ? 1.012 9.10  ? 7100 100.00 ? 4  
2.85 3.02  ? ? ? 0.451 ?   ? 1.005 9.70  ? 7082 100.00 ? 5  
3.02 3.26  ? ? ? 0.327 ?   ? 1.035 10.80 ? 7093 100.00 ? 6  
3.26 3.58  ? ? ? 0.196 ?   ? 1.018 12.30 ? 7128 100.00 ? 7  
3.58 4.10  ? ? ? 0.117 ?   ? 1.020 13.20 ? 7113 100.00 ? 8  
4.10 5.17  ? ? ? 0.080 ?   ? 1.056 13.70 ? 7142 100.00 ? 9  
5.17 50.00 ? ? ? 0.044 ?   ? 1.087 13.90 ? 7220 99.80  ? 10 
# 
_refine.entry_id                                 3ELP 
_refine.ls_d_res_high                            2.400 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          1.00 
_refine.ls_percent_reflns_obs                    99.400 
_refine.ls_number_reflns_obs                     70518 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.236 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  3582 
_refine.ls_number_reflns_R_work                  66936 
_refine.B_iso_mean                               49.79 
_refine.solvent_model_param_bsol                 37.540 
_refine.aniso_B[1][1]                            -1.108 
_refine.aniso_B[2][2]                            -1.108 
_refine.aniso_B[3][3]                            2.217 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.overall_FOM_work_R_set                   0.754 
_refine.B_iso_max                                119.40 
_refine.B_iso_min                                16.88 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2NMP' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3ELP 
_refine_analyze.Luzzati_coordinate_error_obs    0.385 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10616 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             467 
_refine_hist.number_atoms_total               11083 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     ? 0.007 ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_deg  ? 1.383 ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  ? 1.938 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 3.030 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 3.356 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 5.105 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   50 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.42 
_refine_ls_shell.number_reflns_R_work             1404 
_refine_ls_shell.R_factor_R_work                  0.410 
_refine_ls_shell.percent_reflns_obs               99.4 
_refine_ls_shell.R_factor_R_free                  0.422 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:dna-rna_rep.param CNS_TOPPAR:dna-rna.top 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:water_rep.param   CNS_TOPPAR:water.top   'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:ion.param         CNS_TOPPAR:ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3ELP 
_struct.title                     'Structure of cystationine gamma lyase' 
_struct.pdbx_descriptor           'Cystathionine gamma-lyase (E.C.4.4.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ELP 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
;alpha beta protein, Alternative splicing, Amino-acid biosynthesis, Cysteine biosynthesis, Cytoplasm, Disease mutation, Lyase, Phosphoprotein, Polymorphism, Pyridoxal phosphate
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 22  ? VAL A 30  ? HIS B 17  VAL B 25  1 ? 9  
HELX_P HELX_P2  2  ASN A 70  ? ASP A 84  ? ASN B 65  ASP B 79  1 ? 15 
HELX_P HELX_P3  3  SER A 94  ? HIS A 104 ? SER B 89  HIS B 99  1 ? 11 
HELX_P HELX_P4  4  ASN A 123 ? GLU A 132 ? ASN B 118 GLU B 127 1 ? 10 
HELX_P HELX_P5  5  PHE A 133 ? LEU A 135 ? PHE B 128 LEU B 130 5 ? 3  
HELX_P HELX_P6  6  LYS A 144 ? ILE A 152 ? LYS B 139 ILE B 147 1 ? 9  
HELX_P HELX_P7  7  ASP A 173 ? HIS A 184 ? ASP B 168 HIS B 179 1 ? 12 
HELX_P HELX_P8  8  ARG A 202 ? GLY A 207 ? ARG B 197 GLY B 202 5 ? 6  
HELX_P HELX_P9  9  CYS A 234 ? GLY A 249 ? CYS B 229 GLY B 244 1 ? 16 
HELX_P HELX_P10 10 SER A 253 ? LYS A 265 ? SER B 248 LYS B 260 1 ? 13 
HELX_P HELX_P11 11 THR A 266 ? SER A 287 ? THR B 261 SER B 282 1 ? 22 
HELX_P HELX_P12 12 GLN A 304 ? ARG A 310 ? GLN B 299 ARG B 305 1 ? 7  
HELX_P HELX_P13 13 THR A 326 ? LEU A 337 ? THR B 321 LEU B 332 1 ? 12 
HELX_P HELX_P14 14 LEU A 355 ? MET A 359 ? LEU B 350 MET B 354 5 ? 5  
HELX_P HELX_P15 15 ASP A 387 ? ALA A 402 ? ASP B 382 ALA B 397 1 ? 16 
HELX_P HELX_P16 16 HIS B 22  ? VAL B 30  ? HIS A 17  VAL A 25  1 ? 9  
HELX_P HELX_P17 17 ASN B 70  ? ASP B 84  ? ASN A 65  ASP A 79  1 ? 15 
HELX_P HELX_P18 18 SER B 94  ? HIS B 104 ? SER A 89  HIS A 99  1 ? 11 
HELX_P HELX_P19 19 ASN B 123 ? GLU B 132 ? ASN A 118 GLU A 127 1 ? 10 
HELX_P HELX_P20 20 LYS B 144 ? ILE B 152 ? LYS A 139 ILE A 147 1 ? 9  
HELX_P HELX_P21 21 ASP B 173 ? HIS B 184 ? ASP A 168 HIS A 179 1 ? 12 
HELX_P HELX_P22 22 THR B 194 ? MET B 196 ? THR A 189 MET A 191 5 ? 3  
HELX_P HELX_P23 23 ARG B 202 ? GLY B 207 ? ARG A 197 GLY A 202 5 ? 6  
HELX_P HELX_P24 24 CYS B 234 ? GLY B 249 ? CYS A 229 GLY A 244 1 ? 16 
HELX_P HELX_P25 25 SER B 253 ? LYS B 265 ? SER A 248 LYS A 260 1 ? 13 
HELX_P HELX_P26 26 THR B 266 ? SER B 287 ? THR A 261 SER A 282 1 ? 22 
HELX_P HELX_P27 27 GLN B 304 ? ARG B 310 ? GLN A 299 ARG A 305 1 ? 7  
HELX_P HELX_P28 28 THR B 326 ? LEU B 337 ? THR A 321 LEU A 332 1 ? 12 
HELX_P HELX_P29 29 LEU B 355 ? MET B 359 ? LEU A 350 MET A 354 5 ? 5  
HELX_P HELX_P30 30 ASP B 387 ? ALA B 402 ? ASP A 382 ALA A 397 1 ? 16 
HELX_P HELX_P31 31 HIS C 22  ? VAL C 30  ? HIS C 17  VAL C 25  1 ? 9  
HELX_P HELX_P32 32 ASN C 70  ? ASP C 84  ? ASN C 65  ASP C 79  1 ? 15 
HELX_P HELX_P33 33 SER C 94  ? HIS C 104 ? SER C 89  HIS C 99  1 ? 11 
HELX_P HELX_P34 34 ASN C 123 ? GLU C 132 ? ASN C 118 GLU C 127 1 ? 10 
HELX_P HELX_P35 35 PHE C 133 ? LEU C 135 ? PHE C 128 LEU C 130 5 ? 3  
HELX_P HELX_P36 36 LYS C 144 ? ILE C 152 ? LYS C 139 ILE C 147 1 ? 9  
HELX_P HELX_P37 37 ASP C 173 ? HIS C 184 ? ASP C 168 HIS C 179 1 ? 12 
HELX_P HELX_P38 38 ARG C 202 ? GLY C 207 ? ARG C 197 GLY C 202 5 ? 6  
HELX_P HELX_P39 39 CYS C 234 ? GLY C 249 ? CYS C 229 GLY C 244 1 ? 16 
HELX_P HELX_P40 40 SER C 253 ? LYS C 265 ? SER C 248 LYS C 260 1 ? 13 
HELX_P HELX_P41 41 THR C 266 ? SER C 287 ? THR C 261 SER C 282 1 ? 22 
HELX_P HELX_P42 42 GLN C 304 ? ARG C 310 ? GLN C 299 ARG C 305 1 ? 7  
HELX_P HELX_P43 43 THR C 326 ? LEU C 337 ? THR C 321 LEU C 332 1 ? 12 
HELX_P HELX_P44 44 LEU C 355 ? MET C 359 ? LEU C 350 MET C 354 5 ? 5  
HELX_P HELX_P45 45 ASP C 387 ? ALA C 402 ? ASP C 382 ALA C 397 1 ? 16 
HELX_P HELX_P46 46 HIS D 22  ? VAL D 30  ? HIS D 17  VAL D 25  1 ? 9  
HELX_P HELX_P47 47 ASN D 70  ? ASP D 84  ? ASN D 65  ASP D 79  1 ? 15 
HELX_P HELX_P48 48 SER D 94  ? HIS D 104 ? SER D 89  HIS D 99  1 ? 11 
HELX_P HELX_P49 49 ASN D 123 ? GLU D 132 ? ASN D 118 GLU D 127 1 ? 10 
HELX_P HELX_P50 50 LYS D 144 ? ILE D 152 ? LYS D 139 ILE D 147 1 ? 9  
HELX_P HELX_P51 51 ASP D 173 ? HIS D 184 ? ASP D 168 HIS D 179 1 ? 12 
HELX_P HELX_P52 52 MET D 196 ? GLN D 201 ? MET D 191 GLN D 196 1 ? 6  
HELX_P HELX_P53 53 ARG D 202 ? GLY D 207 ? ARG D 197 GLY D 202 5 ? 6  
HELX_P HELX_P54 54 CYS D 234 ? GLY D 249 ? CYS D 229 GLY D 244 1 ? 16 
HELX_P HELX_P55 55 SER D 253 ? LYS D 265 ? SER D 248 LYS D 260 1 ? 13 
HELX_P HELX_P56 56 THR D 266 ? SER D 287 ? THR D 261 SER D 282 1 ? 22 
HELX_P HELX_P57 57 GLN D 304 ? ARG D 310 ? GLN D 299 ARG D 305 1 ? 7  
HELX_P HELX_P58 58 THR D 326 ? LEU D 337 ? THR D 321 LEU D 332 1 ? 12 
HELX_P HELX_P59 59 LEU D 355 ? MET D 359 ? LEU D 350 MET D 354 5 ? 5  
HELX_P HELX_P60 60 ASP D 387 ? ALA D 402 ? ASP D 382 ALA D 397 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 163 A . ? THR 158 B PRO 164 A ? PRO 159 B 1 -0.37 
2 ASN 166 A . ? ASN 161 B PRO 167 A ? PRO 162 B 1 -0.13 
3 THR 163 B . ? THR 158 A PRO 164 B ? PRO 159 A 1 -0.22 
4 ASN 166 B . ? ASN 161 A PRO 167 B ? PRO 162 A 1 -0.54 
5 THR 163 C . ? THR 158 C PRO 164 C ? PRO 159 C 1 -0.45 
6 ASN 166 C . ? ASN 161 C PRO 167 C ? PRO 162 C 1 0.23  
7 THR 163 D . ? THR 158 D PRO 164 D ? PRO 159 D 1 -0.60 
8 ASN 166 D . ? ASN 161 D PRO 167 D ? PRO 162 D 1 -0.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 5 ? 
C ? 7 ? 
D ? 5 ? 
E ? 7 ? 
F ? 5 ? 
G ? 7 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 88  ? PHE A 92  ? TYR B 83  PHE B 87  
A 2 MET A 227 ? VAL A 232 ? MET B 222 VAL B 227 
A 3 ILE A 210 ? ALA A 215 ? ILE B 205 ALA B 210 
A 4 ILE A 188 ? ASP A 192 ? ILE B 183 ASP B 187 
A 5 THR A 156 ? GLU A 162 ? THR B 151 GLU B 157 
A 6 GLN A 111 ? MET A 115 ? GLN B 106 MET B 110 
A 7 LYS A 136 ? VAL A 140 ? LYS B 131 VAL B 135 
B 1 VAL A 291 ? ILE A 295 ? VAL B 286 ILE B 290 
B 2 MET A 318 ? ILE A 323 ? MET B 313 ILE B 318 
B 3 LEU A 378 ? SER A 382 ? LEU B 373 SER B 377 
B 4 LEU A 352 ? GLU A 354 ? LEU B 347 GLU B 349 
B 5 THR A 341 ? LEU A 342 ? THR B 336 LEU B 337 
C 1 TYR B 88  ? PHE B 92  ? TYR A 83  PHE A 87  
C 2 MET B 227 ? VAL B 232 ? MET A 222 VAL A 227 
C 3 ILE B 210 ? ALA B 215 ? ILE A 205 ALA A 210 
C 4 ILE B 188 ? ASP B 192 ? ILE A 183 ASP A 187 
C 5 THR B 156 ? GLU B 162 ? THR A 151 GLU A 157 
C 6 GLN B 111 ? MET B 115 ? GLN A 106 MET A 110 
C 7 LYS B 136 ? VAL B 140 ? LYS A 131 VAL A 135 
D 1 VAL B 291 ? ILE B 295 ? VAL A 286 ILE A 290 
D 2 MET B 318 ? ILE B 323 ? MET A 313 ILE A 318 
D 3 LEU B 378 ? SER B 382 ? LEU A 373 SER A 377 
D 4 LEU B 352 ? GLU B 354 ? LEU A 347 GLU A 349 
D 5 THR B 341 ? LEU B 342 ? THR A 336 LEU A 337 
E 1 TYR C 88  ? PHE C 92  ? TYR C 83  PHE C 87  
E 2 MET C 227 ? VAL C 232 ? MET C 222 VAL C 227 
E 3 ILE C 210 ? ALA C 215 ? ILE C 205 ALA C 210 
E 4 ILE C 188 ? ASP C 192 ? ILE C 183 ASP C 187 
E 5 THR C 156 ? GLU C 162 ? THR C 151 GLU C 157 
E 6 GLN C 111 ? MET C 115 ? GLN C 106 MET C 110 
E 7 LYS C 136 ? VAL C 140 ? LYS C 131 VAL C 135 
F 1 VAL C 291 ? ILE C 295 ? VAL C 286 ILE C 290 
F 2 MET C 318 ? ILE C 323 ? MET C 313 ILE C 318 
F 3 LEU C 378 ? SER C 382 ? LEU C 373 SER C 377 
F 4 LEU C 352 ? GLU C 354 ? LEU C 347 GLU C 349 
F 5 THR C 341 ? LEU C 342 ? THR C 336 LEU C 337 
G 1 TYR D 88  ? PHE D 92  ? TYR D 83  PHE D 87  
G 2 MET D 227 ? VAL D 232 ? MET D 222 VAL D 227 
G 3 ILE D 210 ? ALA D 215 ? ILE D 205 ALA D 210 
G 4 ILE D 188 ? ASP D 192 ? ILE D 183 ASP D 187 
G 5 THR D 156 ? GLU D 162 ? THR D 151 GLU D 157 
G 6 GLN D 111 ? MET D 115 ? GLN D 106 MET D 110 
G 7 LYS D 136 ? VAL D 140 ? LYS D 131 VAL D 135 
H 1 VAL D 291 ? ILE D 295 ? VAL D 286 ILE D 290 
H 2 MET D 318 ? ILE D 323 ? MET D 313 ILE D 318 
H 3 LEU D 378 ? SER D 382 ? LEU D 373 SER D 377 
H 4 LEU D 352 ? GLU D 354 ? LEU D 347 GLU D 349 
H 5 THR D 341 ? LEU D 342 ? THR D 336 LEU D 337 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 92  ? N PHE B 87  O GLY A 228 ? O GLY B 223 
A 2 3 O LEU A 229 ? O LEU B 224 N TYR A 213 ? N TYR B 208 
A 3 4 O ILE A 210 ? O ILE B 205 N VAL A 191 ? N VAL B 186 
A 4 5 O ILE A 188 ? O ILE B 183 N VAL A 159 ? N VAL B 154 
A 5 6 O TRP A 160 ? O TRP B 155 N ILE A 113 ? N ILE B 108 
A 6 7 N CYS A 114 ? N CYS B 109 O VAL A 140 ? O VAL B 135 
B 1 2 N ILE A 295 ? N ILE B 290 O THR A 320 ? O THR B 315 
B 2 3 N PHE A 321 ? N PHE B 316 O ILE A 379 ? O ILE B 374 
B 3 4 O SER A 382 ? O SER B 377 N LEU A 352 ? N LEU B 347 
B 4 5 O ALA A 353 ? O ALA B 348 N THR A 341 ? N THR B 336 
C 1 2 N PHE B 92  ? N PHE A 87  O GLY B 228 ? O GLY A 223 
C 2 3 O LEU B 229 ? O LEU A 224 N TYR B 213 ? N TYR A 208 
C 3 4 O MET B 212 ? O MET A 207 N VAL B 191 ? N VAL A 186 
C 4 5 O VAL B 190 ? O VAL A 185 N ILE B 161 ? N ILE A 156 
C 5 6 O TRP B 160 ? O TRP A 155 N ILE B 113 ? N ILE A 108 
C 6 7 N ILE B 112 ? N ILE A 107 O LYS B 136 ? O LYS A 131 
D 1 2 N LYS B 293 ? N LYS A 288 O TYR B 322 ? O TYR A 317 
D 2 3 N VAL B 319 ? N VAL A 314 O LEU B 381 ? O LEU A 376 
D 3 4 O SER B 382 ? O SER A 377 N LEU B 352 ? N LEU A 347 
D 4 5 O ALA B 353 ? O ALA A 348 N THR B 341 ? N THR A 336 
E 1 2 N PHE C 92  ? N PHE C 87  O GLY C 228 ? O GLY C 223 
E 2 3 O LEU C 229 ? O LEU C 224 N TYR C 213 ? N TYR C 208 
E 3 4 O ILE C 210 ? O ILE C 205 N VAL C 191 ? N VAL C 186 
E 4 5 O ILE C 188 ? O ILE C 183 N VAL C 159 ? N VAL C 154 
E 5 6 O TRP C 160 ? O TRP C 155 N ILE C 113 ? N ILE C 108 
E 6 7 N CYS C 114 ? N CYS C 109 O VAL C 140 ? O VAL C 135 
F 1 2 N ILE C 295 ? N ILE C 290 O THR C 320 ? O THR C 315 
F 2 3 N PHE C 321 ? N PHE C 316 O ILE C 379 ? O ILE C 374 
F 3 4 O SER C 382 ? O SER C 377 N LEU C 352 ? N LEU C 347 
F 4 5 O ALA C 353 ? O ALA C 348 N THR C 341 ? N THR C 336 
G 1 2 N PHE D 92  ? N PHE D 87  O GLY D 228 ? O GLY D 223 
G 2 3 O LEU D 229 ? O LEU D 224 N TYR D 213 ? N TYR D 208 
G 3 4 O MET D 212 ? O MET D 207 N VAL D 191 ? N VAL D 186 
G 4 5 O VAL D 190 ? O VAL D 185 N ILE D 161 ? N ILE D 156 
G 5 6 O TRP D 160 ? O TRP D 155 N ILE D 113 ? N ILE D 108 
G 6 7 N ILE D 112 ? N ILE D 107 O LYS D 136 ? O LYS D 131 
H 1 2 N LYS D 293 ? N LYS D 288 O TYR D 322 ? O TYR D 317 
H 2 3 N VAL D 319 ? N VAL D 314 O LEU D 381 ? O LEU D 376 
H 3 4 O SER D 382 ? O SER D 377 N LEU D 352 ? N LEU D 347 
H 4 5 O ALA D 353 ? O ALA D 348 N THR D 341 ? N THR D 336 
# 
_atom_sites.entry_id                    3ELP 
_atom_sites.fract_transf_matrix[1][1]   0.008244 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008244 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007962 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A 1 14  ? 34.950  -29.044 -11.207 1.00 44.91  ? 9   GLN B N   1 
ATOM   2     C CA  . GLN A 1 14  ? 36.013  -28.959 -12.257 1.00 45.74  ? 9   GLN B CA  1 
ATOM   3     C C   . GLN A 1 14  ? 35.944  -27.703 -13.052 1.00 41.94  ? 9   GLN B C   1 
ATOM   4     O O   . GLN A 1 14  ? 34.893  -27.316 -13.530 1.00 54.10  ? 9   GLN B O   1 
ATOM   5     C CB  . GLN A 1 14  ? 35.851  -29.899 -13.445 1.00 41.62  ? 9   GLN B CB  1 
ATOM   6     C CG  . GLN A 1 14  ? 35.866  -31.274 -13.372 1.00 33.99  ? 9   GLN B CG  1 
ATOM   7     C CD  . GLN A 1 14  ? 34.746  -31.960 -14.147 1.00 35.14  ? 9   GLN B CD  1 
ATOM   8     O OE1 . GLN A 1 14  ? 33.660  -32.129 -13.598 1.00 40.48  ? 9   GLN B OE1 1 
ATOM   9     N NE2 . GLN A 1 14  ? 35.014  -32.403 -15.390 1.00 32.63  ? 9   GLN B NE2 1 
ATOM   10    N N   . GLY A 1 15  ? 37.143  -27.250 -13.380 1.00 63.15  ? 10  GLY B N   1 
ATOM   11    C CA  . GLY A 1 15  ? 37.361  -26.109 -14.239 1.00 65.32  ? 10  GLY B CA  1 
ATOM   12    C C   . GLY A 1 15  ? 38.830  -26.132 -14.567 1.00 64.26  ? 10  GLY B C   1 
ATOM   13    O O   . GLY A 1 15  ? 39.415  -25.133 -14.930 1.00 71.50  ? 10  GLY B O   1 
ATOM   14    N N   . PHE A 1 16  ? 39.418  -27.313 -14.429 1.00 65.42  ? 11  PHE B N   1 
ATOM   15    C CA  . PHE A 1 16  ? 40.835  -27.530 -14.722 1.00 60.14  ? 11  PHE B CA  1 
ATOM   16    C C   . PHE A 1 16  ? 41.036  -27.608 -16.236 1.00 58.31  ? 11  PHE B C   1 
ATOM   17    O O   . PHE A 1 16  ? 40.061  -27.690 -16.992 1.00 59.26  ? 11  PHE B O   1 
ATOM   18    C CB  . PHE A 1 16  ? 41.317  -28.850 -14.101 1.00 55.23  ? 11  PHE B CB  1 
ATOM   19    C CG  . PHE A 1 16  ? 41.240  -28.898 -12.597 1.00 50.48  ? 11  PHE B CG  1 
ATOM   20    C CD1 . PHE A 1 16  ? 42.360  -28.610 -11.822 1.00 47.68  ? 11  PHE B CD1 1 
ATOM   21    C CD2 . PHE A 1 16  ? 40.074  -29.330 -11.957 1.00 48.91  ? 11  PHE B CD2 1 
ATOM   22    C CE1 . PHE A 1 16  ? 42.328  -28.764 -10.432 1.00 45.72  ? 11  PHE B CE1 1 
ATOM   23    C CE2 . PHE A 1 16  ? 40.032  -29.486 -10.569 1.00 44.87  ? 11  PHE B CE2 1 
ATOM   24    C CZ  . PHE A 1 16  ? 41.161  -29.206 -9.808  1.00 44.16  ? 11  PHE B CZ  1 
ATOM   25    N N   . LEU A 1 17  ? 42.289  -27.578 -16.682 1.00 55.01  ? 12  LEU B N   1 
ATOM   26    C CA  . LEU A 1 17  ? 42.537  -27.678 -18.109 1.00 50.83  ? 12  LEU B CA  1 
ATOM   27    C C   . LEU A 1 17  ? 41.948  -29.015 -18.522 1.00 48.82  ? 12  LEU B C   1 
ATOM   28    O O   . LEU A 1 17  ? 41.898  -29.960 -17.725 1.00 51.16  ? 12  LEU B O   1 
ATOM   29    C CB  . LEU A 1 17  ? 44.025  -27.722 -18.410 1.00 48.11  ? 12  LEU B CB  1 
ATOM   30    C CG  . LEU A 1 17  ? 44.941  -26.696 -17.760 1.00 49.09  ? 12  LEU B CG  1 
ATOM   31    C CD1 . LEU A 1 17  ? 46.368  -27.221 -17.835 1.00 46.63  ? 12  LEU B CD1 1 
ATOM   32    C CD2 . LEU A 1 17  ? 44.795  -25.327 -18.429 1.00 46.49  ? 12  LEU B CD2 1 
ATOM   33    N N   . PRO A 1 18  ? 41.478  -29.122 -19.766 1.00 48.79  ? 13  PRO B N   1 
ATOM   34    C CA  . PRO A 1 18  ? 40.926  -30.426 -20.146 1.00 46.95  ? 13  PRO B CA  1 
ATOM   35    C C   . PRO A 1 18  ? 42.080  -31.447 -20.175 1.00 45.85  ? 13  PRO B C   1 
ATOM   36    O O   . PRO A 1 18  ? 43.252  -31.073 -20.321 1.00 44.25  ? 13  PRO B O   1 
ATOM   37    C CB  . PRO A 1 18  ? 40.318  -30.151 -21.521 1.00 46.03  ? 13  PRO B CB  1 
ATOM   38    C CG  . PRO A 1 18  ? 41.197  -29.034 -22.058 1.00 46.06  ? 13  PRO B CG  1 
ATOM   39    C CD  . PRO A 1 18  ? 41.360  -28.143 -20.858 1.00 45.93  ? 13  PRO B CD  1 
ATOM   40    N N   . HIS A 1 19  ? 41.756  -32.726 -20.011 1.00 45.75  ? 14  HIS B N   1 
ATOM   41    C CA  . HIS A 1 19  ? 42.784  -33.760 -20.006 1.00 45.09  ? 14  HIS B CA  1 
ATOM   42    C C   . HIS A 1 19  ? 43.515  -33.838 -21.331 1.00 43.12  ? 14  HIS B C   1 
ATOM   43    O O   . HIS A 1 19  ? 42.904  -33.753 -22.395 1.00 42.51  ? 14  HIS B O   1 
ATOM   44    C CB  . HIS A 1 19  ? 42.176  -35.119 -19.637 1.00 46.69  ? 14  HIS B CB  1 
ATOM   45    C CG  . HIS A 1 19  ? 42.016  -35.315 -18.161 1.00 49.83  ? 14  HIS B CG  1 
ATOM   46    N ND1 . HIS A 1 19  ? 40.841  -35.752 -17.587 1.00 50.74  ? 14  HIS B ND1 1 
ATOM   47    C CD2 . HIS A 1 19  ? 42.874  -35.093 -17.136 1.00 50.71  ? 14  HIS B CD2 1 
ATOM   48    C CE1 . HIS A 1 19  ? 40.980  -35.785 -16.273 1.00 51.09  ? 14  HIS B CE1 1 
ATOM   49    N NE2 . HIS A 1 19  ? 42.204  -35.389 -15.973 1.00 52.19  ? 14  HIS B NE2 1 
ATOM   50    N N   . PHE A 1 20  ? 44.832  -33.995 -21.249 1.00 40.71  ? 15  PHE B N   1 
ATOM   51    C CA  . PHE A 1 20  ? 45.682  -34.070 -22.427 1.00 39.52  ? 15  PHE B CA  1 
ATOM   52    C C   . PHE A 1 20  ? 45.218  -35.109 -23.448 1.00 39.74  ? 15  PHE B C   1 
ATOM   53    O O   . PHE A 1 20  ? 44.990  -36.274 -23.116 1.00 39.63  ? 15  PHE B O   1 
ATOM   54    C CB  . PHE A 1 20  ? 47.120  -34.345 -21.995 1.00 37.99  ? 15  PHE B CB  1 
ATOM   55    C CG  . PHE A 1 20  ? 47.635  -33.368 -20.975 1.00 38.37  ? 15  PHE B CG  1 
ATOM   56    C CD1 . PHE A 1 20  ? 47.459  -32.002 -21.154 1.00 36.76  ? 15  PHE B CD1 1 
ATOM   57    C CD2 . PHE A 1 20  ? 48.299  -33.814 -19.835 1.00 38.90  ? 15  PHE B CD2 1 
ATOM   58    C CE1 . PHE A 1 20  ? 47.931  -31.093 -20.221 1.00 37.59  ? 15  PHE B CE1 1 
ATOM   59    C CE2 . PHE A 1 20  ? 48.779  -32.916 -18.892 1.00 37.90  ? 15  PHE B CE2 1 
ATOM   60    C CZ  . PHE A 1 20  ? 48.593  -31.548 -19.087 1.00 39.76  ? 15  PHE B CZ  1 
ATOM   61    N N   . GLN A 1 21  ? 45.079  -34.670 -24.694 1.00 39.10  ? 16  GLN B N   1 
ATOM   62    C CA  . GLN A 1 21  ? 44.631  -35.542 -25.768 1.00 40.37  ? 16  GLN B CA  1 
ATOM   63    C C   . GLN A 1 21  ? 45.602  -36.673 -26.106 1.00 39.76  ? 16  GLN B C   1 
ATOM   64    O O   . GLN A 1 21  ? 46.823  -36.481 -26.140 1.00 38.18  ? 16  GLN B O   1 
ATOM   65    C CB  . GLN A 1 21  ? 44.359  -34.722 -27.036 1.00 43.11  ? 16  GLN B CB  1 
ATOM   66    C CG  . GLN A 1 21  ? 42.934  -34.194 -27.167 1.00 48.11  ? 16  GLN B CG  1 
ATOM   67    C CD  . GLN A 1 21  ? 42.700  -33.476 -28.491 1.00 50.36  ? 16  GLN B CD  1 
ATOM   68    O OE1 . GLN A 1 21  ? 43.210  -32.375 -28.714 1.00 52.35  ? 16  GLN B OE1 1 
ATOM   69    N NE2 . GLN A 1 21  ? 41.933  -34.103 -29.379 1.00 50.58  ? 16  GLN B NE2 1 
ATOM   70    N N   . HIS A 1 22  ? 45.034  -37.853 -26.347 1.00 38.17  ? 17  HIS B N   1 
ATOM   71    C CA  . HIS A 1 22  ? 45.784  -39.041 -26.728 1.00 37.24  ? 17  HIS B CA  1 
ATOM   72    C C   . HIS A 1 22  ? 46.669  -39.676 -25.662 1.00 36.75  ? 17  HIS B C   1 
ATOM   73    O O   . HIS A 1 22  ? 47.196  -40.772 -25.880 1.00 37.27  ? 17  HIS B O   1 
ATOM   74    C CB  . HIS A 1 22  ? 46.623  -38.721 -27.961 1.00 38.12  ? 17  HIS B CB  1 
ATOM   75    C CG  . HIS A 1 22  ? 45.876  -37.950 -29.001 1.00 38.82  ? 17  HIS B CG  1 
ATOM   76    N ND1 . HIS A 1 22  ? 46.413  -36.858 -29.649 1.00 39.39  ? 17  HIS B ND1 1 
ATOM   77    C CD2 . HIS A 1 22  ? 44.622  -38.095 -29.485 1.00 38.75  ? 17  HIS B CD2 1 
ATOM   78    C CE1 . HIS A 1 22  ? 45.521  -36.362 -30.486 1.00 39.75  ? 17  HIS B CE1 1 
ATOM   79    N NE2 . HIS A 1 22  ? 44.426  -37.095 -30.405 1.00 41.02  ? 17  HIS B NE2 1 
ATOM   80    N N   . PHE A 1 23  ? 46.820  -39.013 -24.516 1.00 35.12  ? 18  PHE B N   1 
ATOM   81    C CA  . PHE A 1 23  ? 47.661  -39.528 -23.433 1.00 32.54  ? 18  PHE B CA  1 
ATOM   82    C C   . PHE A 1 23  ? 47.576  -41.050 -23.224 1.00 33.04  ? 18  PHE B C   1 
ATOM   83    O O   . PHE A 1 23  ? 48.560  -41.759 -23.443 1.00 32.65  ? 18  PHE B O   1 
ATOM   84    C CB  . PHE A 1 23  ? 47.322  -38.837 -22.121 1.00 28.54  ? 18  PHE B CB  1 
ATOM   85    C CG  . PHE A 1 23  ? 48.358  -39.035 -21.054 1.00 25.17  ? 18  PHE B CG  1 
ATOM   86    C CD1 . PHE A 1 23  ? 49.379  -38.105 -20.881 1.00 22.09  ? 18  PHE B CD1 1 
ATOM   87    C CD2 . PHE A 1 23  ? 48.327  -40.161 -20.233 1.00 23.14  ? 18  PHE B CD2 1 
ATOM   88    C CE1 . PHE A 1 23  ? 50.351  -38.290 -19.906 1.00 21.64  ? 18  PHE B CE1 1 
ATOM   89    C CE2 . PHE A 1 23  ? 49.295  -40.356 -19.255 1.00 20.86  ? 18  PHE B CE2 1 
ATOM   90    C CZ  . PHE A 1 23  ? 50.309  -39.419 -19.090 1.00 21.31  ? 18  PHE B CZ  1 
ATOM   91    N N   . ALA A 1 24  ? 46.413  -41.547 -22.797 1.00 32.72  ? 19  ALA B N   1 
ATOM   92    C CA  . ALA A 1 24  ? 46.227  -42.986 -22.564 1.00 32.75  ? 19  ALA B CA  1 
ATOM   93    C C   . ALA A 1 24  ? 46.615  -43.838 -23.771 1.00 34.06  ? 19  ALA B C   1 
ATOM   94    O O   . ALA A 1 24  ? 47.293  -44.861 -23.640 1.00 34.15  ? 19  ALA B O   1 
ATOM   95    C CB  . ALA A 1 24  ? 44.798  -43.269 -22.193 1.00 31.62  ? 19  ALA B CB  1 
ATOM   96    N N   . THR A 1 25  ? 46.180  -43.413 -24.952 1.00 35.50  ? 20  THR B N   1 
ATOM   97    C CA  . THR A 1 25  ? 46.483  -44.139 -26.179 1.00 34.16  ? 20  THR B CA  1 
ATOM   98    C C   . THR A 1 25  ? 47.991  -44.190 -26.453 1.00 34.10  ? 20  THR B C   1 
ATOM   99    O O   . THR A 1 25  ? 48.520  -45.227 -26.852 1.00 32.54  ? 20  THR B O   1 
ATOM   100   C CB  . THR A 1 25  ? 45.754  -43.499 -27.376 1.00 33.19  ? 20  THR B CB  1 
ATOM   101   O OG1 . THR A 1 25  ? 44.344  -43.501 -27.122 1.00 31.88  ? 20  THR B OG1 1 
ATOM   102   C CG2 . THR A 1 25  ? 46.027  -44.276 -28.644 1.00 32.12  ? 20  THR B CG2 1 
ATOM   103   N N   . GLN A 1 26  ? 48.677  -43.071 -26.232 1.00 35.07  ? 21  GLN B N   1 
ATOM   104   C CA  . GLN A 1 26  ? 50.118  -43.002 -26.451 1.00 33.95  ? 21  GLN B CA  1 
ATOM   105   C C   . GLN A 1 26  ? 50.827  -43.840 -25.391 1.00 35.06  ? 21  GLN B C   1 
ATOM   106   O O   . GLN A 1 26  ? 51.782  -44.549 -25.691 1.00 35.09  ? 21  GLN B O   1 
ATOM   107   C CB  . GLN A 1 26  ? 50.604  -41.551 -26.372 1.00 32.53  ? 21  GLN B CB  1 
ATOM   108   C CG  . GLN A 1 26  ? 49.763  -40.581 -27.181 1.00 35.08  ? 21  GLN B CG  1 
ATOM   109   C CD  . GLN A 1 26  ? 50.189  -39.125 -27.022 1.00 38.35  ? 21  GLN B CD  1 
ATOM   110   O OE1 . GLN A 1 26  ? 50.528  -38.672 -25.922 1.00 40.75  ? 21  GLN B OE1 1 
ATOM   111   N NE2 . GLN A 1 26  ? 50.148  -38.377 -28.121 1.00 37.28  ? 21  GLN B NE2 1 
ATOM   112   N N   . ALA A 1 27  ? 50.349  -43.767 -24.152 1.00 35.38  ? 22  ALA B N   1 
ATOM   113   C CA  . ALA A 1 27  ? 50.953  -44.519 -23.055 1.00 35.44  ? 22  ALA B CA  1 
ATOM   114   C C   . ALA A 1 27  ? 50.893  -46.026 -23.316 1.00 36.60  ? 22  ALA B C   1 
ATOM   115   O O   . ALA A 1 27  ? 51.831  -46.765 -23.001 1.00 37.42  ? 22  ALA B O   1 
ATOM   116   C CB  . ALA A 1 27  ? 50.249  -44.184 -21.742 1.00 33.82  ? 22  ALA B CB  1 
ATOM   117   N N   . ILE A 1 28  ? 49.789  -46.477 -23.898 1.00 34.24  ? 23  ILE B N   1 
ATOM   118   C CA  . ILE A 1 28  ? 49.612  -47.893 -24.187 1.00 32.80  ? 23  ILE B CA  1 
ATOM   119   C C   . ILE A 1 28  ? 50.189  -48.343 -25.538 1.00 35.35  ? 23  ILE B C   1 
ATOM   120   O O   . ILE A 1 28  ? 50.690  -49.463 -25.655 1.00 36.80  ? 23  ILE B O   1 
ATOM   121   C CB  . ILE A 1 28  ? 48.117  -48.261 -24.150 1.00 31.05  ? 23  ILE B CB  1 
ATOM   122   C CG1 . ILE A 1 28  ? 47.598  -48.159 -22.716 1.00 29.59  ? 23  ILE B CG1 1 
ATOM   123   C CG2 . ILE A 1 28  ? 47.899  -49.653 -24.699 1.00 28.67  ? 23  ILE B CG2 1 
ATOM   124   C CD1 . ILE A 1 28  ? 46.096  -48.351 -22.590 1.00 27.80  ? 23  ILE B CD1 1 
ATOM   125   N N   . HIS A 1 29  ? 50.146  -47.469 -26.543 1.00 35.97  ? 24  HIS B N   1 
ATOM   126   C CA  . HIS A 1 29  ? 50.613  -47.825 -27.878 1.00 34.10  ? 24  HIS B CA  1 
ATOM   127   C C   . HIS A 1 29  ? 51.973  -47.294 -28.372 1.00 35.74  ? 24  HIS B C   1 
ATOM   128   O O   . HIS A 1 29  ? 52.610  -47.937 -29.202 1.00 36.50  ? 24  HIS B O   1 
ATOM   129   C CB  . HIS A 1 29  ? 49.514  -47.464 -28.892 1.00 33.07  ? 24  HIS B CB  1 
ATOM   130   C CG  . HIS A 1 29  ? 48.250  -48.268 -28.740 1.00 32.78  ? 24  HIS B CG  1 
ATOM   131   N ND1 . HIS A 1 29  ? 48.122  -49.558 -29.213 1.00 32.14  ? 24  HIS B ND1 1 
ATOM   132   C CD2 . HIS A 1 29  ? 47.066  -47.972 -28.146 1.00 32.40  ? 24  HIS B CD2 1 
ATOM   133   C CE1 . HIS A 1 29  ? 46.918  -50.021 -28.918 1.00 29.49  ? 24  HIS B CE1 1 
ATOM   134   N NE2 . HIS A 1 29  ? 46.257  -49.079 -28.270 1.00 28.86  ? 24  HIS B NE2 1 
ATOM   135   N N   . VAL A 1 30  ? 52.441  -46.150 -27.884 1.00 38.30  ? 25  VAL B N   1 
ATOM   136   C CA  . VAL A 1 30  ? 53.724  -45.613 -28.371 1.00 40.97  ? 25  VAL B CA  1 
ATOM   137   C C   . VAL A 1 30  ? 54.962  -46.449 -28.042 1.00 45.03  ? 25  VAL B C   1 
ATOM   138   O O   . VAL A 1 30  ? 55.365  -46.540 -26.887 1.00 45.74  ? 25  VAL B O   1 
ATOM   139   C CB  . VAL A 1 30  ? 53.993  -44.175 -27.848 1.00 39.70  ? 25  VAL B CB  1 
ATOM   140   C CG1 . VAL A 1 30  ? 55.358  -43.693 -28.330 1.00 37.43  ? 25  VAL B CG1 1 
ATOM   141   C CG2 . VAL A 1 30  ? 52.908  -43.229 -28.330 1.00 37.84  ? 25  VAL B CG2 1 
ATOM   142   N N   . GLY A 1 31  ? 55.568  -47.047 -29.063 1.00 48.12  ? 26  GLY B N   1 
ATOM   143   C CA  . GLY A 1 31  ? 56.765  -47.837 -28.844 1.00 53.96  ? 26  GLY B CA  1 
ATOM   144   C C   . GLY A 1 31  ? 56.575  -49.338 -28.732 1.00 59.39  ? 26  GLY B C   1 
ATOM   145   O O   . GLY A 1 31  ? 57.554  -50.085 -28.763 1.00 60.31  ? 26  GLY B O   1 
ATOM   146   N N   . GLN A 1 32  ? 55.333  -49.795 -28.606 1.00 63.37  ? 27  GLN B N   1 
ATOM   147   C CA  . GLN A 1 32  ? 55.061  -51.228 -28.482 1.00 66.74  ? 27  GLN B CA  1 
ATOM   148   C C   . GLN A 1 32  ? 55.101  -51.926 -29.844 1.00 69.49  ? 27  GLN B C   1 
ATOM   149   O O   . GLN A 1 32  ? 55.192  -51.279 -30.892 1.00 71.41  ? 27  GLN B O   1 
ATOM   150   C CB  . GLN A 1 32  ? 53.691  -51.460 -27.826 1.00 66.67  ? 27  GLN B CB  1 
ATOM   151   C CG  . GLN A 1 32  ? 53.408  -50.560 -26.626 1.00 64.76  ? 27  GLN B CG  1 
ATOM   152   C CD  . GLN A 1 32  ? 54.543  -50.551 -25.624 1.00 63.71  ? 27  GLN B CD  1 
ATOM   153   O OE1 . GLN A 1 32  ? 54.895  -51.586 -25.060 1.00 62.00  ? 27  GLN B OE1 1 
ATOM   154   N NE2 . GLN A 1 32  ? 55.129  -49.378 -25.401 1.00 62.26  ? 27  GLN B NE2 1 
ATOM   155   N N   . GLY A 1 69  ? 71.662  -46.407 -25.864 1.00 41.78  ? 64  GLY B N   1 
ATOM   156   C CA  . GLY A 1 69  ? 71.845  -47.421 -24.835 1.00 46.13  ? 64  GLY B CA  1 
ATOM   157   C C   . GLY A 1 69  ? 71.055  -48.631 -25.253 1.00 41.94  ? 64  GLY B C   1 
ATOM   158   O O   . GLY A 1 69  ? 71.007  -49.621 -24.516 1.00 48.09  ? 64  GLY B O   1 
ATOM   159   N N   . ASN A 1 70  ? 70.414  -48.513 -26.425 1.00 58.73  ? 65  ASN B N   1 
ATOM   160   C CA  . ASN A 1 70  ? 69.623  -49.584 -27.040 1.00 58.92  ? 65  ASN B CA  1 
ATOM   161   C C   . ASN A 1 70  ? 68.092  -49.542 -26.864 1.00 50.11  ? 65  ASN B C   1 
ATOM   162   O O   . ASN A 1 70  ? 67.574  -48.730 -26.104 1.00 54.21  ? 65  ASN B O   1 
ATOM   163   C CB  . ASN A 1 70  ? 70.206  -50.933 -26.606 1.00 63.91  ? 65  ASN B CB  1 
ATOM   164   C CG  . ASN A 1 70  ? 71.559  -51.201 -27.242 1.00 71.53  ? 65  ASN B CG  1 
ATOM   165   O OD1 . ASN A 1 70  ? 72.373  -50.287 -27.389 1.00 75.31  ? 65  ASN B OD1 1 
ATOM   166   N ND2 . ASN A 1 70  ? 71.807  -52.451 -27.623 1.00 75.66  ? 65  ASN B ND2 1 
ATOM   167   N N   . PRO A 1 71  ? 67.361  -50.428 -27.579 1.00 49.36  ? 66  PRO B N   1 
ATOM   168   C CA  . PRO A 1 71  ? 65.907  -50.610 -27.627 1.00 47.51  ? 66  PRO B CA  1 
ATOM   169   C C   . PRO A 1 71  ? 65.025  -50.158 -26.486 1.00 44.88  ? 66  PRO B C   1 
ATOM   170   O O   . PRO A 1 71  ? 64.448  -49.071 -26.522 1.00 45.78  ? 66  PRO B O   1 
ATOM   171   C CB  . PRO A 1 71  ? 65.764  -52.102 -27.877 1.00 47.18  ? 66  PRO B CB  1 
ATOM   172   C CG  . PRO A 1 71  ? 66.818  -52.338 -28.830 1.00 49.13  ? 66  PRO B CG  1 
ATOM   173   C CD  . PRO A 1 71  ? 68.000  -51.577 -28.247 1.00 50.58  ? 66  PRO B CD  1 
ATOM   174   N N   . THR A 1 72  ? 64.897  -51.030 -25.495 1.00 39.51  ? 67  THR B N   1 
ATOM   175   C CA  . THR A 1 72  ? 64.053  -50.792 -24.347 1.00 34.95  ? 67  THR B CA  1 
ATOM   176   C C   . THR A 1 72  ? 64.014  -49.344 -23.882 1.00 33.63  ? 67  THR B C   1 
ATOM   177   O O   . THR A 1 72  ? 62.944  -48.806 -23.603 1.00 33.31  ? 67  THR B O   1 
ATOM   178   C CB  . THR A 1 72  ? 64.481  -51.715 -23.203 1.00 35.16  ? 67  THR B CB  1 
ATOM   179   O OG1 . THR A 1 72  ? 64.494  -53.062 -23.689 1.00 34.68  ? 67  THR B OG1 1 
ATOM   180   C CG2 . THR A 1 72  ? 63.519  -51.617 -22.023 1.00 33.28  ? 67  THR B CG2 1 
ATOM   181   N N   . ARG A 1 73  ? 65.175  -48.707 -23.823 1.00 32.08  ? 68  ARG B N   1 
ATOM   182   C CA  . ARG A 1 73  ? 65.258  -47.330 -23.371 1.00 32.02  ? 68  ARG B CA  1 
ATOM   183   C C   . ARG A 1 73  ? 64.696  -46.364 -24.406 1.00 35.44  ? 68  ARG B C   1 
ATOM   184   O O   . ARG A 1 73  ? 64.016  -45.396 -24.053 1.00 34.35  ? 68  ARG B O   1 
ATOM   185   C CB  . ARG A 1 73  ? 66.708  -46.982 -23.065 1.00 30.36  ? 68  ARG B CB  1 
ATOM   186   C CG  . ARG A 1 73  ? 66.884  -45.796 -22.156 1.00 27.38  ? 68  ARG B CG  1 
ATOM   187   C CD  . ARG A 1 73  ? 68.355  -45.541 -21.959 1.00 26.86  ? 68  ARG B CD  1 
ATOM   188   N NE  . ARG A 1 73  ? 68.944  -45.013 -23.179 1.00 28.84  ? 68  ARG B NE  1 
ATOM   189   C CZ  . ARG A 1 73  ? 70.241  -44.773 -23.360 1.00 32.05  ? 68  ARG B CZ  1 
ATOM   190   N NH1 . ARG A 1 73  ? 71.130  -45.022 -22.401 1.00 31.94  ? 68  ARG B NH1 1 
ATOM   191   N NH2 . ARG A 1 73  ? 70.649  -44.242 -24.503 1.00 34.38  ? 68  ARG B NH2 1 
ATOM   192   N N   . ASN A 1 74  ? 64.984  -46.628 -25.680 1.00 38.88  ? 69  ASN B N   1 
ATOM   193   C CA  . ASN A 1 74  ? 64.496  -45.788 -26.776 1.00 43.28  ? 69  ASN B CA  1 
ATOM   194   C C   . ASN A 1 74  ? 62.969  -45.774 -26.833 1.00 42.05  ? 69  ASN B C   1 
ATOM   195   O O   . ASN A 1 74  ? 62.371  -44.744 -27.137 1.00 43.23  ? 69  ASN B O   1 
ATOM   196   C CB  . ASN A 1 74  ? 65.047  -46.269 -28.129 1.00 49.57  ? 69  ASN B CB  1 
ATOM   197   C CG  . ASN A 1 74  ? 66.537  -45.964 -28.311 1.00 54.92  ? 69  ASN B CG  1 
ATOM   198   O OD1 . ASN A 1 74  ? 67.390  -46.496 -27.596 1.00 59.34  ? 69  ASN B OD1 1 
ATOM   199   N ND2 . ASN A 1 74  ? 66.850  -45.104 -29.278 1.00 57.00  ? 69  ASN B ND2 1 
ATOM   200   N N   . CYS A 1 75  ? 62.337  -46.912 -26.554 1.00 39.45  ? 70  CYS B N   1 
ATOM   201   C CA  . CYS A 1 75  ? 60.880  -46.971 -26.562 1.00 39.63  ? 70  CYS B CA  1 
ATOM   202   C C   . CYS A 1 75  ? 60.287  -46.285 -25.339 1.00 36.65  ? 70  CYS B C   1 
ATOM   203   O O   . CYS A 1 75  ? 59.218  -45.682 -25.411 1.00 35.28  ? 70  CYS B O   1 
ATOM   204   C CB  . CYS A 1 75  ? 60.402  -48.417 -26.620 1.00 42.64  ? 70  CYS B CB  1 
ATOM   205   S SG  . CYS A 1 75  ? 60.610  -49.149 -28.251 1.00 50.34  ? 70  CYS B SG  1 
ATOM   206   N N   . LEU A 1 76  ? 60.971  -46.392 -24.207 1.00 33.74  ? 71  LEU B N   1 
ATOM   207   C CA  . LEU A 1 76  ? 60.495  -45.731 -23.011 1.00 32.32  ? 71  LEU B CA  1 
ATOM   208   C C   . LEU A 1 76  ? 60.556  -44.243 -23.307 1.00 33.27  ? 71  LEU B C   1 
ATOM   209   O O   . LEU A 1 76  ? 59.618  -43.500 -23.019 1.00 34.62  ? 71  LEU B O   1 
ATOM   210   C CB  . LEU A 1 76  ? 61.396  -46.026 -21.817 1.00 27.77  ? 71  LEU B CB  1 
ATOM   211   C CG  . LEU A 1 76  ? 61.013  -45.302 -20.516 1.00 25.37  ? 71  LEU B CG  1 
ATOM   212   C CD1 . LEU A 1 76  ? 59.635  -45.756 -20.022 1.00 23.09  ? 71  LEU B CD1 1 
ATOM   213   C CD2 . LEU A 1 76  ? 62.059  -45.602 -19.460 1.00 23.57  ? 71  LEU B CD2 1 
ATOM   214   N N   . GLU A 1 77  ? 61.669  -43.820 -23.898 1.00 32.94  ? 72  GLU B N   1 
ATOM   215   C CA  . GLU A 1 77  ? 61.873  -42.419 -24.223 1.00 33.08  ? 72  GLU B CA  1 
ATOM   216   C C   . GLU A 1 77  ? 60.886  -41.885 -25.259 1.00 33.74  ? 72  GLU B C   1 
ATOM   217   O O   . GLU A 1 77  ? 60.452  -40.744 -25.152 1.00 33.87  ? 72  GLU B O   1 
ATOM   218   C CB  . GLU A 1 77  ? 63.328  -42.193 -24.661 1.00 32.03  ? 72  GLU B CB  1 
ATOM   219   C CG  . GLU A 1 77  ? 64.328  -42.576 -23.558 1.00 29.88  ? 72  GLU B CG  1 
ATOM   220   C CD  . GLU A 1 77  ? 65.770  -42.260 -23.900 1.00 29.53  ? 72  GLU B CD  1 
ATOM   221   O OE1 . GLU A 1 77  ? 66.193  -42.509 -25.048 1.00 31.20  ? 72  GLU B OE1 1 
ATOM   222   O OE2 . GLU A 1 77  ? 66.493  -41.782 -23.008 1.00 28.70  ? 72  GLU B OE2 1 
ATOM   223   N N   . LYS A 1 78  ? 60.518  -42.692 -26.252 1.00 35.94  ? 73  LYS B N   1 
ATOM   224   C CA  . LYS A 1 78  ? 59.547  -42.229 -27.251 1.00 38.56  ? 73  LYS B CA  1 
ATOM   225   C C   . LYS A 1 78  ? 58.228  -41.994 -26.546 1.00 34.85  ? 73  LYS B C   1 
ATOM   226   O O   . LYS A 1 78  ? 57.578  -40.973 -26.726 1.00 33.39  ? 73  LYS B O   1 
ATOM   227   C CB  . LYS A 1 78  ? 59.323  -43.268 -28.365 1.00 46.71  ? 73  LYS B CB  1 
ATOM   228   C CG  . LYS A 1 78  ? 60.341  -43.235 -29.509 1.00 57.91  ? 73  LYS B CG  1 
ATOM   229   C CD  . LYS A 1 78  ? 59.745  -43.828 -30.796 1.00 66.75  ? 73  LYS B CD  1 
ATOM   230   C CE  . LYS A 1 78  ? 60.710  -43.763 -31.994 1.00 72.90  ? 73  LYS B CE  1 
ATOM   231   N NZ  . LYS A 1 78  ? 61.763  -44.826 -32.004 1.00 77.11  ? 73  LYS B NZ  1 
ATOM   232   N N   . ALA A 1 79  ? 57.853  -42.970 -25.733 1.00 33.06  ? 74  ALA B N   1 
ATOM   233   C CA  . ALA A 1 79  ? 56.618  -42.932 -24.976 1.00 31.29  ? 74  ALA B CA  1 
ATOM   234   C C   . ALA A 1 79  ? 56.534  -41.712 -24.055 1.00 31.14  ? 74  ALA B C   1 
ATOM   235   O O   . ALA A 1 79  ? 55.632  -40.887 -24.195 1.00 31.60  ? 74  ALA B O   1 
ATOM   236   C CB  . ALA A 1 79  ? 56.476  -44.214 -24.168 1.00 27.14  ? 74  ALA B CB  1 
ATOM   237   N N   . VAL A 1 80  ? 57.473  -41.585 -23.122 1.00 29.30  ? 75  VAL B N   1 
ATOM   238   C CA  . VAL A 1 80  ? 57.430  -40.467 -22.197 1.00 27.97  ? 75  VAL B CA  1 
ATOM   239   C C   . VAL A 1 80  ? 57.498  -39.133 -22.920 1.00 28.76  ? 75  VAL B C   1 
ATOM   240   O O   . VAL A 1 80  ? 56.869  -38.157 -22.489 1.00 30.15  ? 75  VAL B O   1 
ATOM   241   C CB  . VAL A 1 80  ? 58.545  -40.561 -21.142 1.00 26.15  ? 75  VAL B CB  1 
ATOM   242   C CG1 . VAL A 1 80  ? 58.508  -39.348 -20.237 1.00 25.46  ? 75  VAL B CG1 1 
ATOM   243   C CG2 . VAL A 1 80  ? 58.346  -41.804 -20.302 1.00 24.35  ? 75  VAL B CG2 1 
ATOM   244   N N   . ALA A 1 81  ? 58.242  -39.078 -24.020 1.00 28.53  ? 76  ALA B N   1 
ATOM   245   C CA  . ALA A 1 81  ? 58.329  -37.834 -24.775 1.00 28.24  ? 76  ALA B CA  1 
ATOM   246   C C   . ALA A 1 81  ? 56.918  -37.435 -25.176 1.00 29.05  ? 76  ALA B C   1 
ATOM   247   O O   . ALA A 1 81  ? 56.546  -36.271 -25.060 1.00 29.64  ? 76  ALA B O   1 
ATOM   248   C CB  . ALA A 1 81  ? 59.181  -38.010 -26.007 1.00 29.93  ? 76  ALA B CB  1 
ATOM   249   N N   . ALA A 1 82  ? 56.126  -38.401 -25.633 1.00 28.22  ? 77  ALA B N   1 
ATOM   250   C CA  . ALA A 1 82  ? 54.745  -38.120 -26.034 1.00 29.50  ? 77  ALA B CA  1 
ATOM   251   C C   . ALA A 1 82  ? 53.878  -37.690 -24.849 1.00 31.20  ? 77  ALA B C   1 
ATOM   252   O O   . ALA A 1 82  ? 53.109  -36.724 -24.935 1.00 33.57  ? 77  ALA B O   1 
ATOM   253   C CB  . ALA A 1 82  ? 54.132  -39.339 -26.693 1.00 27.37  ? 77  ALA B CB  1 
ATOM   254   N N   . LEU A 1 83  ? 53.993  -38.410 -23.740 1.00 31.10  ? 78  LEU B N   1 
ATOM   255   C CA  . LEU A 1 83  ? 53.210  -38.076 -22.566 1.00 30.87  ? 78  LEU B CA  1 
ATOM   256   C C   . LEU A 1 83  ? 53.512  -36.673 -22.053 1.00 31.69  ? 78  LEU B C   1 
ATOM   257   O O   . LEU A 1 83  ? 52.653  -36.024 -21.461 1.00 33.25  ? 78  LEU B O   1 
ATOM   258   C CB  . LEU A 1 83  ? 53.445  -39.102 -21.455 1.00 27.09  ? 78  LEU B CB  1 
ATOM   259   C CG  . LEU A 1 83  ? 53.011  -40.544 -21.734 1.00 26.13  ? 78  LEU B CG  1 
ATOM   260   C CD1 . LEU A 1 83  ? 52.872  -41.281 -20.411 1.00 25.33  ? 78  LEU B CD1 1 
ATOM   261   C CD2 . LEU A 1 83  ? 51.693  -40.577 -22.479 1.00 21.28  ? 78  LEU B CD2 1 
ATOM   262   N N   . ASP A 1 84  ? 54.733  -36.201 -22.264 1.00 33.64  ? 79  ASP B N   1 
ATOM   263   C CA  . ASP A 1 84  ? 55.088  -34.866 -21.809 1.00 34.27  ? 79  ASP B CA  1 
ATOM   264   C C   . ASP A 1 84  ? 54.805  -33.848 -22.893 1.00 34.74  ? 79  ASP B C   1 
ATOM   265   O O   . ASP A 1 84  ? 55.063  -32.664 -22.712 1.00 36.19  ? 79  ASP B O   1 
ATOM   266   C CB  . ASP A 1 84  ? 56.568  -34.795 -21.435 1.00 35.59  ? 79  ASP B CB  1 
ATOM   267   C CG  . ASP A 1 84  ? 56.860  -35.401 -20.073 1.00 40.51  ? 79  ASP B CG  1 
ATOM   268   O OD1 . ASP A 1 84  ? 55.996  -35.306 -19.177 1.00 43.45  ? 79  ASP B OD1 1 
ATOM   269   O OD2 . ASP A 1 84  ? 57.963  -35.954 -19.882 1.00 43.66  ? 79  ASP B OD2 1 
ATOM   270   N N   . GLY A 1 85  ? 54.266  -34.308 -24.019 1.00 35.70  ? 80  GLY B N   1 
ATOM   271   C CA  . GLY A 1 85  ? 54.004  -33.406 -25.126 1.00 37.39  ? 80  GLY B CA  1 
ATOM   272   C C   . GLY A 1 85  ? 55.308  -32.771 -25.597 1.00 39.52  ? 80  GLY B C   1 
ATOM   273   O O   . GLY A 1 85  ? 55.356  -31.570 -25.878 1.00 41.31  ? 80  GLY B O   1 
ATOM   274   N N   . ALA A 1 86  ? 56.368  -33.578 -25.675 1.00 39.73  ? 81  ALA B N   1 
ATOM   275   C CA  . ALA A 1 86  ? 57.688  -33.112 -26.093 1.00 39.90  ? 81  ALA B CA  1 
ATOM   276   C C   . ALA A 1 86  ? 58.234  -33.905 -27.272 1.00 41.36  ? 81  ALA B C   1 
ATOM   277   O O   . ALA A 1 86  ? 57.836  -35.038 -27.511 1.00 39.34  ? 81  ALA B O   1 
ATOM   278   C CB  . ALA A 1 86  ? 58.653  -33.210 -24.940 1.00 39.98  ? 81  ALA B CB  1 
ATOM   279   N N   . LYS A 1 87  ? 59.169  -33.301 -27.996 1.00 44.83  ? 82  LYS B N   1 
ATOM   280   C CA  . LYS A 1 87  ? 59.776  -33.946 -29.156 1.00 48.87  ? 82  LYS B CA  1 
ATOM   281   C C   . LYS A 1 87  ? 60.737  -35.040 -28.692 1.00 47.59  ? 82  LYS B C   1 
ATOM   282   O O   . LYS A 1 87  ? 60.877  -36.078 -29.342 1.00 45.59  ? 82  LYS B O   1 
ATOM   283   C CB  . LYS A 1 87  ? 60.530  -32.908 -30.000 1.00 53.97  ? 82  LYS B CB  1 
ATOM   284   C CG  . LYS A 1 87  ? 59.709  -31.656 -30.331 1.00 62.65  ? 82  LYS B CG  1 
ATOM   285   C CD  . LYS A 1 87  ? 60.562  -30.516 -30.911 1.00 69.56  ? 82  LYS B CD  1 
ATOM   286   C CE  . LYS A 1 87  ? 60.754  -30.629 -32.425 1.00 73.47  ? 82  LYS B CE  1 
ATOM   287   N NZ  . LYS A 1 87  ? 61.586  -29.519 -32.988 1.00 76.04  ? 82  LYS B NZ  1 
ATOM   288   N N   . TYR A 1 88  ? 61.391  -34.806 -27.557 1.00 46.06  ? 83  TYR B N   1 
ATOM   289   C CA  . TYR A 1 88  ? 62.336  -35.779 -27.035 1.00 45.69  ? 83  TYR B CA  1 
ATOM   290   C C   . TYR A 1 88  ? 62.225  -36.005 -25.533 1.00 43.75  ? 83  TYR B C   1 
ATOM   291   O O   . TYR A 1 88  ? 61.507  -35.304 -24.825 1.00 43.40  ? 83  TYR B O   1 
ATOM   292   C CB  . TYR A 1 88  ? 63.776  -35.359 -27.352 1.00 47.95  ? 83  TYR B CB  1 
ATOM   293   C CG  . TYR A 1 88  ? 63.961  -34.714 -28.705 1.00 52.95  ? 83  TYR B CG  1 
ATOM   294   C CD1 . TYR A 1 88  ? 63.768  -33.338 -28.877 1.00 54.59  ? 83  TYR B CD1 1 
ATOM   295   C CD2 . TYR A 1 88  ? 64.306  -35.474 -29.824 1.00 53.86  ? 83  TYR B CD2 1 
ATOM   296   C CE1 . TYR A 1 88  ? 63.914  -32.736 -30.129 1.00 54.25  ? 83  TYR B CE1 1 
ATOM   297   C CE2 . TYR A 1 88  ? 64.453  -34.881 -31.080 1.00 54.51  ? 83  TYR B CE2 1 
ATOM   298   C CZ  . TYR A 1 88  ? 64.254  -33.512 -31.222 1.00 54.76  ? 83  TYR B CZ  1 
ATOM   299   O OH  . TYR A 1 88  ? 64.384  -32.913 -32.455 1.00 55.97  ? 83  TYR B OH  1 
ATOM   300   N N   . CYS A 1 89  ? 62.968  -37.004 -25.074 1.00 42.62  ? 84  CYS B N   1 
ATOM   301   C CA  . CYS A 1 89  ? 63.042  -37.399 -23.676 1.00 41.83  ? 84  CYS B CA  1 
ATOM   302   C C   . CYS A 1 89  ? 64.260  -38.310 -23.509 1.00 42.26  ? 84  CYS B C   1 
ATOM   303   O O   . CYS A 1 89  ? 64.518  -39.185 -24.341 1.00 43.62  ? 84  CYS B O   1 
ATOM   304   C CB  . CYS A 1 89  ? 61.783  -38.157 -23.250 1.00 41.44  ? 84  CYS B CB  1 
ATOM   305   S SG  . CYS A 1 89  ? 61.896  -38.841 -21.580 1.00 40.25  ? 84  CYS B SG  1 
ATOM   306   N N   . LEU A 1 90  ? 65.014  -38.092 -22.442 1.00 39.84  ? 85  LEU B N   1 
ATOM   307   C CA  . LEU A 1 90  ? 66.181  -38.903 -22.170 1.00 37.60  ? 85  LEU B CA  1 
ATOM   308   C C   . LEU A 1 90  ? 66.020  -39.480 -20.767 1.00 36.19  ? 85  LEU B C   1 
ATOM   309   O O   . LEU A 1 90  ? 65.685  -38.756 -19.835 1.00 38.04  ? 85  LEU B O   1 
ATOM   310   C CB  . LEU A 1 90  ? 67.440  -38.047 -22.253 1.00 39.43  ? 85  LEU B CB  1 
ATOM   311   C CG  . LEU A 1 90  ? 67.557  -37.124 -23.463 1.00 40.47  ? 85  LEU B CG  1 
ATOM   312   C CD1 . LEU A 1 90  ? 66.775  -35.840 -23.199 1.00 40.48  ? 85  LEU B CD1 1 
ATOM   313   C CD2 . LEU A 1 90  ? 69.024  -36.794 -23.705 1.00 40.64  ? 85  LEU B CD2 1 
ATOM   314   N N   . ALA A 1 91  ? 66.259  -40.779 -20.618 1.00 34.57  ? 86  ALA B N   1 
ATOM   315   C CA  . ALA A 1 91  ? 66.116  -41.442 -19.325 1.00 32.37  ? 86  ALA B CA  1 
ATOM   316   C C   . ALA A 1 91  ? 67.440  -41.611 -18.591 1.00 30.71  ? 86  ALA B C   1 
ATOM   317   O O   . ALA A 1 91  ? 68.454  -41.938 -19.200 1.00 31.45  ? 86  ALA B O   1 
ATOM   318   C CB  . ALA A 1 91  ? 65.455  -42.800 -19.522 1.00 31.08  ? 86  ALA B CB  1 
ATOM   319   N N   . PHE A 1 92  ? 67.422  -41.391 -17.279 1.00 30.92  ? 87  PHE B N   1 
ATOM   320   C CA  . PHE A 1 92  ? 68.616  -41.529 -16.448 1.00 31.87  ? 87  PHE B CA  1 
ATOM   321   C C   . PHE A 1 92  ? 68.324  -42.450 -15.281 1.00 32.38  ? 87  PHE B C   1 
ATOM   322   O O   . PHE A 1 92  ? 67.171  -42.760 -15.002 1.00 35.19  ? 87  PHE B O   1 
ATOM   323   C CB  . PHE A 1 92  ? 69.078  -40.172 -15.910 1.00 32.80  ? 87  PHE B CB  1 
ATOM   324   C CG  . PHE A 1 92  ? 69.484  -39.200 -16.984 1.00 34.22  ? 87  PHE B CG  1 
ATOM   325   C CD1 . PHE A 1 92  ? 68.527  -38.477 -17.688 1.00 34.51  ? 87  PHE B CD1 1 
ATOM   326   C CD2 . PHE A 1 92  ? 70.821  -39.029 -17.313 1.00 34.99  ? 87  PHE B CD2 1 
ATOM   327   C CE1 . PHE A 1 92  ? 68.893  -37.601 -18.702 1.00 34.26  ? 87  PHE B CE1 1 
ATOM   328   C CE2 . PHE A 1 92  ? 71.196  -38.153 -18.331 1.00 36.28  ? 87  PHE B CE2 1 
ATOM   329   C CZ  . PHE A 1 92  ? 70.226  -37.438 -19.025 1.00 34.36  ? 87  PHE B CZ  1 
ATOM   330   N N   . ALA A 1 93  ? 69.377  -42.871 -14.594 1.00 33.13  ? 88  ALA B N   1 
ATOM   331   C CA  . ALA A 1 93  ? 69.282  -43.780 -13.457 1.00 34.63  ? 88  ALA B CA  1 
ATOM   332   C C   . ALA A 1 93  ? 68.279  -43.370 -12.382 1.00 35.25  ? 88  ALA B C   1 
ATOM   333   O O   . ALA A 1 93  ? 67.531  -44.198 -11.858 1.00 35.25  ? 88  ALA B O   1 
ATOM   334   C CB  . ALA A 1 93  ? 70.660  -43.942 -12.833 1.00 35.55  ? 88  ALA B CB  1 
ATOM   335   N N   . SER A 1 94  ? 68.277  -42.088 -12.044 1.00 36.13  ? 89  SER B N   1 
ATOM   336   C CA  . SER A 1 94  ? 67.377  -41.569 -11.019 1.00 35.78  ? 89  SER B CA  1 
ATOM   337   C C   . SER A 1 94  ? 67.041  -40.122 -11.332 1.00 35.84  ? 89  SER B C   1 
ATOM   338   O O   . SER A 1 94  ? 67.708  -39.491 -12.154 1.00 34.96  ? 89  SER B O   1 
ATOM   339   C CB  . SER A 1 94  ? 68.057  -41.632 -9.652  1.00 34.46  ? 89  SER B CB  1 
ATOM   340   O OG  . SER A 1 94  ? 69.255  -40.864 -9.654  1.00 32.70  ? 89  SER B OG  1 
ATOM   341   N N   . GLY A 1 95  ? 66.006  -39.600 -10.683 1.00 35.03  ? 90  GLY B N   1 
ATOM   342   C CA  . GLY A 1 95  ? 65.653  -38.215 -10.898 1.00 35.17  ? 90  GLY B CA  1 
ATOM   343   C C   . GLY A 1 95  ? 66.827  -37.356 -10.450 1.00 36.94  ? 90  GLY B C   1 
ATOM   344   O O   . GLY A 1 95  ? 67.124  -36.313 -11.055 1.00 36.10  ? 90  GLY B O   1 
ATOM   345   N N   . LEU A 1 96  ? 67.505  -37.798 -9.389  1.00 37.67  ? 91  LEU B N   1 
ATOM   346   C CA  . LEU A 1 96  ? 68.665  -37.072 -8.869  1.00 38.34  ? 91  LEU B CA  1 
ATOM   347   C C   . LEU A 1 96  ? 69.774  -37.022 -9.923  1.00 38.53  ? 91  LEU B C   1 
ATOM   348   O O   . LEU A 1 96  ? 70.436  -35.994 -10.089 1.00 38.88  ? 91  LEU B O   1 
ATOM   349   C CB  . LEU A 1 96  ? 69.204  -37.733 -7.589  1.00 38.85  ? 91  LEU B CB  1 
ATOM   350   C CG  . LEU A 1 96  ? 70.527  -37.154 -7.059  1.00 39.06  ? 91  LEU B CG  1 
ATOM   351   C CD1 . LEU A 1 96  ? 70.360  -35.680 -6.757  1.00 39.66  ? 91  LEU B CD1 1 
ATOM   352   C CD2 . LEU A 1 96  ? 70.961  -37.891 -5.811  1.00 39.05  ? 91  LEU B CD2 1 
ATOM   353   N N   . ALA A 1 97  ? 69.977  -38.137 -10.626 1.00 37.73  ? 92  ALA B N   1 
ATOM   354   C CA  . ALA A 1 97  ? 70.991  -38.204 -11.673 1.00 34.41  ? 92  ALA B CA  1 
ATOM   355   C C   . ALA A 1 97  ? 70.574  -37.245 -12.786 1.00 32.61  ? 92  ALA B C   1 
ATOM   356   O O   . ALA A 1 97  ? 71.384  -36.463 -13.276 1.00 32.29  ? 92  ALA B O   1 
ATOM   357   C CB  . ALA A 1 97  ? 71.103  -39.629 -12.211 1.00 34.21  ? 92  ALA B CB  1 
ATOM   358   N N   . ALA A 1 98  ? 69.305  -37.301 -13.177 1.00 30.70  ? 93  ALA B N   1 
ATOM   359   C CA  . ALA A 1 98  ? 68.815  -36.418 -14.222 1.00 32.12  ? 93  ALA B CA  1 
ATOM   360   C C   . ALA A 1 98  ? 69.114  -34.969 -13.832 1.00 33.74  ? 93  ALA B C   1 
ATOM   361   O O   . ALA A 1 98  ? 69.560  -34.175 -14.664 1.00 34.08  ? 93  ALA B O   1 
ATOM   362   C CB  . ALA A 1 98  ? 67.311  -36.611 -14.427 1.00 32.37  ? 93  ALA B CB  1 
ATOM   363   N N   . THR A 1 99  ? 68.867  -34.630 -12.567 1.00 34.00  ? 94  THR B N   1 
ATOM   364   C CA  . THR A 1 99  ? 69.116  -33.279 -12.068 1.00 33.00  ? 94  THR B CA  1 
ATOM   365   C C   . THR A 1 99  ? 70.574  -32.870 -12.259 1.00 32.38  ? 94  THR B C   1 
ATOM   366   O O   . THR A 1 99  ? 70.861  -31.811 -12.817 1.00 33.01  ? 94  THR B O   1 
ATOM   367   C CB  . THR A 1 99  ? 68.770  -33.167 -10.581 1.00 31.74  ? 94  THR B CB  1 
ATOM   368   O OG1 . THR A 1 99  ? 67.363  -33.362 -10.402 1.00 32.48  ? 94  THR B OG1 1 
ATOM   369   C CG2 . THR A 1 99  ? 69.148  -31.813 -10.061 1.00 31.92  ? 94  THR B CG2 1 
ATOM   370   N N   . VAL A 1 100 ? 71.489  -33.714 -11.793 1.00 31.24  ? 95  VAL B N   1 
ATOM   371   C CA  . VAL A 1 100 ? 72.914  -33.442 -11.924 1.00 30.19  ? 95  VAL B CA  1 
ATOM   372   C C   . VAL A 1 100 ? 73.258  -33.257 -13.400 1.00 31.82  ? 95  VAL B C   1 
ATOM   373   O O   . VAL A 1 100 ? 74.012  -32.355 -13.772 1.00 31.75  ? 95  VAL B O   1 
ATOM   374   C CB  . VAL A 1 100 ? 73.766  -34.602 -11.322 1.00 26.18  ? 95  VAL B CB  1 
ATOM   375   C CG1 . VAL A 1 100 ? 75.195  -34.501 -11.771 1.00 27.31  ? 95  VAL B CG1 1 
ATOM   376   C CG2 . VAL A 1 100 ? 73.740  -34.544 -9.824  1.00 23.60  ? 95  VAL B CG2 1 
ATOM   377   N N   . THR A 1 101 ? 72.689  -34.102 -14.248 1.00 34.20  ? 96  THR B N   1 
ATOM   378   C CA  . THR A 1 101 ? 72.971  -34.015 -15.675 1.00 35.60  ? 96  THR B CA  1 
ATOM   379   C C   . THR A 1 101 ? 72.588  -32.654 -16.237 1.00 37.22  ? 96  THR B C   1 
ATOM   380   O O   . THR A 1 101 ? 73.355  -32.044 -16.985 1.00 37.39  ? 96  THR B O   1 
ATOM   381   C CB  . THR A 1 101 ? 72.224  -35.111 -16.462 1.00 37.55  ? 96  THR B CB  1 
ATOM   382   O OG1 . THR A 1 101 ? 72.535  -36.398 -15.903 1.00 36.93  ? 96  THR B OG1 1 
ATOM   383   C CG2 . THR A 1 101 ? 72.645  -35.077 -17.938 1.00 37.73  ? 96  THR B CG2 1 
ATOM   384   N N   . ILE A 1 102 ? 71.396  -32.189 -15.868 1.00 37.45  ? 97  ILE B N   1 
ATOM   385   C CA  . ILE A 1 102 ? 70.888  -30.902 -16.321 1.00 36.28  ? 97  ILE B CA  1 
ATOM   386   C C   . ILE A 1 102 ? 71.798  -29.763 -15.877 1.00 39.11  ? 97  ILE B C   1 
ATOM   387   O O   . ILE A 1 102 ? 71.984  -28.800 -16.611 1.00 40.80  ? 97  ILE B O   1 
ATOM   388   C CB  . ILE A 1 102 ? 69.448  -30.646 -15.798 1.00 34.70  ? 97  ILE B CB  1 
ATOM   389   C CG1 . ILE A 1 102 ? 68.475  -31.624 -16.460 1.00 33.41  ? 97  ILE B CG1 1 
ATOM   390   C CG2 . ILE A 1 102 ? 69.015  -29.226 -16.111 1.00 33.95  ? 97  ILE B CG2 1 
ATOM   391   C CD1 . ILE A 1 102 ? 67.035  -31.424 -16.077 1.00 31.30  ? 97  ILE B CD1 1 
ATOM   392   N N   . THR A 1 103 ? 72.371  -29.866 -14.682 1.00 41.04  ? 98  THR B N   1 
ATOM   393   C CA  . THR A 1 103 ? 73.259  -28.813 -14.213 1.00 43.56  ? 98  THR B CA  1 
ATOM   394   C C   . THR A 1 103 ? 74.600  -28.873 -14.956 1.00 45.07  ? 98  THR B C   1 
ATOM   395   O O   . THR A 1 103 ? 75.400  -27.937 -14.878 1.00 46.12  ? 98  THR B O   1 
ATOM   396   C CB  . THR A 1 103 ? 73.541  -28.913 -12.694 1.00 42.91  ? 98  THR B CB  1 
ATOM   397   O OG1 . THR A 1 103 ? 74.563  -29.893 -12.447 1.00 43.08  ? 98  THR B OG1 1 
ATOM   398   C CG2 . THR A 1 103 ? 72.279  -29.293 -11.950 1.00 44.03  ? 98  THR B CG2 1 
ATOM   399   N N   . HIS A 1 104 ? 74.859  -29.969 -15.667 1.00 45.73  ? 99  HIS B N   1 
ATOM   400   C CA  . HIS A 1 104 ? 76.110  -30.076 -16.407 1.00 46.21  ? 99  HIS B CA  1 
ATOM   401   C C   . HIS A 1 104 ? 76.032  -29.252 -17.685 1.00 47.76  ? 99  HIS B C   1 
ATOM   402   O O   . HIS A 1 104 ? 77.033  -29.039 -18.363 1.00 47.98  ? 99  HIS B O   1 
ATOM   403   C CB  . HIS A 1 104 ? 76.436  -31.532 -16.729 1.00 46.75  ? 99  HIS B CB  1 
ATOM   404   C CG  . HIS A 1 104 ? 77.012  -32.290 -15.572 1.00 47.52  ? 99  HIS B CG  1 
ATOM   405   N ND1 . HIS A 1 104 ? 77.490  -31.668 -14.438 1.00 49.07  ? 99  HIS B ND1 1 
ATOM   406   C CD2 . HIS A 1 104 ? 77.206  -33.618 -15.383 1.00 47.56  ? 99  HIS B CD2 1 
ATOM   407   C CE1 . HIS A 1 104 ? 77.950  -32.580 -13.599 1.00 48.55  ? 99  HIS B CE1 1 
ATOM   408   N NE2 . HIS A 1 104 ? 77.790  -33.771 -14.147 1.00 47.55  ? 99  HIS B NE2 1 
ATOM   409   N N   . LEU A 1 105 ? 74.832  -28.786 -18.008 1.00 49.44  ? 100 LEU B N   1 
ATOM   410   C CA  . LEU A 1 105 ? 74.635  -27.948 -19.181 1.00 50.79  ? 100 LEU B CA  1 
ATOM   411   C C   . LEU A 1 105 ? 75.290  -26.604 -18.909 1.00 53.30  ? 100 LEU B C   1 
ATOM   412   O O   . LEU A 1 105 ? 75.533  -25.828 -19.833 1.00 55.03  ? 100 LEU B O   1 
ATOM   413   C CB  . LEU A 1 105 ? 73.144  -27.742 -19.443 1.00 48.50  ? 100 LEU B CB  1 
ATOM   414   C CG  . LEU A 1 105 ? 72.460  -28.669 -20.446 1.00 46.54  ? 100 LEU B CG  1 
ATOM   415   C CD1 . LEU A 1 105 ? 73.076  -30.043 -20.382 1.00 47.67  ? 100 LEU B CD1 1 
ATOM   416   C CD2 . LEU A 1 105 ? 70.968  -28.716 -20.157 1.00 45.19  ? 100 LEU B CD2 1 
ATOM   417   N N   . LEU A 1 106 ? 75.559  -26.328 -17.633 1.00 56.07  ? 101 LEU B N   1 
ATOM   418   C CA  . LEU A 1 106 ? 76.199  -25.077 -17.232 1.00 59.08  ? 101 LEU B CA  1 
ATOM   419   C C   . LEU A 1 106 ? 77.679  -25.299 -16.941 1.00 63.73  ? 101 LEU B C   1 
ATOM   420   O O   . LEU A 1 106 ? 78.123  -26.428 -16.702 1.00 64.07  ? 101 LEU B O   1 
ATOM   421   C CB  . LEU A 1 106 ? 75.528  -24.487 -15.990 1.00 53.54  ? 101 LEU B CB  1 
ATOM   422   C CG  . LEU A 1 106 ? 74.004  -24.410 -16.024 1.00 51.52  ? 101 LEU B CG  1 
ATOM   423   C CD1 . LEU A 1 106 ? 73.554  -23.414 -14.971 1.00 49.93  ? 101 LEU B CD1 1 
ATOM   424   C CD2 . LEU A 1 106 ? 73.507  -23.995 -17.401 1.00 48.41  ? 101 LEU B CD2 1 
ATOM   425   N N   . LYS A 1 107 ? 78.437  -24.206 -16.964 1.00 68.93  ? 102 LYS B N   1 
ATOM   426   C CA  . LYS A 1 107 ? 79.875  -24.246 -16.714 1.00 72.17  ? 102 LYS B CA  1 
ATOM   427   C C   . LYS A 1 107 ? 80.218  -23.399 -15.490 1.00 70.42  ? 102 LYS B C   1 
ATOM   428   O O   . LYS A 1 107 ? 79.443  -22.530 -15.092 1.00 70.84  ? 102 LYS B O   1 
ATOM   429   C CB  . LYS A 1 107 ? 80.617  -23.728 -17.948 1.00 77.58  ? 102 LYS B CB  1 
ATOM   430   C CG  . LYS A 1 107 ? 80.128  -22.370 -18.413 1.00 84.93  ? 102 LYS B CG  1 
ATOM   431   C CD  . LYS A 1 107 ? 80.603  -22.048 -19.816 1.00 91.29  ? 102 LYS B CD  1 
ATOM   432   C CE  . LYS A 1 107 ? 80.248  -20.613 -20.182 1.00 95.35  ? 102 LYS B CE  1 
ATOM   433   N NZ  . LYS A 1 107 ? 78.804  -20.306 -19.957 1.00 97.36  ? 102 LYS B NZ  1 
ATOM   434   N N   . ALA A 1 108 ? 81.374  -23.662 -14.890 1.00 68.57  ? 103 ALA B N   1 
ATOM   435   C CA  . ALA A 1 108 ? 81.804  -22.916 -13.712 1.00 66.05  ? 103 ALA B CA  1 
ATOM   436   C C   . ALA A 1 108 ? 81.508  -21.427 -13.871 1.00 63.83  ? 103 ALA B C   1 
ATOM   437   O O   . ALA A 1 108 ? 81.617  -20.868 -14.964 1.00 62.15  ? 103 ALA B O   1 
ATOM   438   C CB  . ALA A 1 108 ? 83.301  -23.132 -13.469 1.00 66.83  ? 103 ALA B CB  1 
ATOM   439   N N   . GLY A 1 109 ? 81.131  -20.788 -12.773 1.00 62.17  ? 104 GLY B N   1 
ATOM   440   C CA  . GLY A 1 109 ? 80.827  -19.374 -12.831 1.00 62.12  ? 104 GLY B CA  1 
ATOM   441   C C   . GLY A 1 109 ? 79.362  -19.093 -13.117 1.00 62.00  ? 104 GLY B C   1 
ATOM   442   O O   . GLY A 1 109 ? 78.893  -17.967 -12.923 1.00 62.28  ? 104 GLY B O   1 
ATOM   443   N N   . ASP A 1 110 ? 78.630  -20.102 -13.585 1.00 60.43  ? 105 ASP B N   1 
ATOM   444   C CA  . ASP A 1 110 ? 77.215  -19.913 -13.872 1.00 58.87  ? 105 ASP B CA  1 
ATOM   445   C C   . ASP A 1 110 ? 76.382  -19.968 -12.599 1.00 57.46  ? 105 ASP B C   1 
ATOM   446   O O   . ASP A 1 110 ? 76.772  -20.581 -11.609 1.00 55.36  ? 105 ASP B O   1 
ATOM   447   C CB  . ASP A 1 110 ? 76.711  -20.957 -14.879 1.00 60.32  ? 105 ASP B CB  1 
ATOM   448   C CG  . ASP A 1 110 ? 77.176  -20.674 -16.308 1.00 61.45  ? 105 ASP B CG  1 
ATOM   449   O OD1 . ASP A 1 110 ? 77.270  -19.483 -16.676 1.00 62.94  ? 105 ASP B OD1 1 
ATOM   450   O OD2 . ASP A 1 110 ? 77.429  -21.637 -17.068 1.00 61.44  ? 105 ASP B OD2 1 
ATOM   451   N N   . GLN A 1 111 ? 75.231  -19.313 -12.636 1.00 58.72  ? 106 GLN B N   1 
ATOM   452   C CA  . GLN A 1 111 ? 74.330  -19.264 -11.494 1.00 61.27  ? 106 GLN B CA  1 
ATOM   453   C C   . GLN A 1 111 ? 73.023  -19.992 -11.778 1.00 59.68  ? 106 GLN B C   1 
ATOM   454   O O   . GLN A 1 111 ? 72.572  -20.056 -12.922 1.00 59.24  ? 106 GLN B O   1 
ATOM   455   C CB  . GLN A 1 111 ? 74.016  -17.813 -11.140 1.00 66.47  ? 106 GLN B CB  1 
ATOM   456   C CG  . GLN A 1 111 ? 73.022  -17.648 -10.003 1.00 74.29  ? 106 GLN B CG  1 
ATOM   457   C CD  . GLN A 1 111 ? 72.339  -16.304 -10.046 1.00 78.97  ? 106 GLN B CD  1 
ATOM   458   O OE1 . GLN A 1 111 ? 72.999  -15.264 -10.086 1.00 82.70  ? 106 GLN B OE1 1 
ATOM   459   N NE2 . GLN A 1 111 ? 71.010  -16.312 -10.044 1.00 81.58  ? 106 GLN B NE2 1 
ATOM   460   N N   . ILE A 1 112 ? 72.412  -20.520 -10.722 1.00 58.11  ? 107 ILE B N   1 
ATOM   461   C CA  . ILE A 1 112 ? 71.149  -21.238 -10.841 1.00 56.22  ? 107 ILE B CA  1 
ATOM   462   C C   . ILE A 1 112 ? 70.197  -20.886 -9.696  1.00 53.92  ? 107 ILE B C   1 
ATOM   463   O O   . ILE A 1 112 ? 70.580  -20.903 -8.524  1.00 52.70  ? 107 ILE B O   1 
ATOM   464   C CB  . ILE A 1 112 ? 71.392  -22.778 -10.880 1.00 56.63  ? 107 ILE B CB  1 
ATOM   465   C CG1 . ILE A 1 112 ? 70.099  -23.526 -10.542 1.00 57.84  ? 107 ILE B CG1 1 
ATOM   466   C CG2 . ILE A 1 112 ? 72.517  -23.153 -9.936  1.00 54.91  ? 107 ILE B CG2 1 
ATOM   467   C CD1 . ILE A 1 112 ? 70.252  -25.031 -10.484 1.00 59.15  ? 107 ILE B CD1 1 
ATOM   468   N N   . ILE A 1 113 ? 68.960  -20.556 -10.052 1.00 52.26  ? 108 ILE B N   1 
ATOM   469   C CA  . ILE A 1 113 ? 67.934  -20.206 -9.071  1.00 53.52  ? 108 ILE B CA  1 
ATOM   470   C C   . ILE A 1 113 ? 67.031  -21.411 -8.823  1.00 53.20  ? 108 ILE B C   1 
ATOM   471   O O   . ILE A 1 113 ? 66.635  -22.103 -9.763  1.00 52.06  ? 108 ILE B O   1 
ATOM   472   C CB  . ILE A 1 113 ? 67.035  -19.033 -9.560  1.00 53.91  ? 108 ILE B CB  1 
ATOM   473   C CG1 . ILE A 1 113 ? 67.888  -17.802 -9.861  1.00 54.78  ? 108 ILE B CG1 1 
ATOM   474   C CG2 . ILE A 1 113 ? 65.991  -18.692 -8.497  1.00 52.39  ? 108 ILE B CG2 1 
ATOM   475   C CD1 . ILE A 1 113 ? 68.645  -17.282 -8.662  1.00 57.76  ? 108 ILE B CD1 1 
ATOM   476   N N   . CYS A 1 114 ? 66.701  -21.652 -7.558  1.00 53.53  ? 109 CYS B N   1 
ATOM   477   C CA  . CYS A 1 114 ? 65.844  -22.768 -7.194  1.00 53.38  ? 109 CYS B CA  1 
ATOM   478   C C   . CYS A 1 114 ? 64.662  -22.331 -6.360  1.00 54.54  ? 109 CYS B C   1 
ATOM   479   O O   . CYS A 1 114 ? 64.771  -21.424 -5.538  1.00 54.78  ? 109 CYS B O   1 
ATOM   480   C CB  . CYS A 1 114 ? 66.628  -23.808 -6.397  1.00 52.85  ? 109 CYS B CB  1 
ATOM   481   S SG  . CYS A 1 114 ? 67.718  -24.850 -7.363  1.00 54.12  ? 109 CYS B SG  1 
ATOM   482   N N   . MET A 1 115 ? 63.524  -22.976 -6.580  1.00 55.76  ? 110 MET B N   1 
ATOM   483   C CA  . MET A 1 115 ? 62.343  -22.683 -5.794  1.00 56.81  ? 110 MET B CA  1 
ATOM   484   C C   . MET A 1 115 ? 62.847  -23.088 -4.415  1.00 60.32  ? 110 MET B C   1 
ATOM   485   O O   . MET A 1 115 ? 63.298  -24.220 -4.229  1.00 61.16  ? 110 MET B O   1 
ATOM   486   C CB  . MET A 1 115 ? 61.180  -23.586 -6.213  1.00 54.42  ? 110 MET B CB  1 
ATOM   487   C CG  . MET A 1 115 ? 59.820  -22.938 -6.057  1.00 51.80  ? 110 MET B CG  1 
ATOM   488   S SD  . MET A 1 115 ? 59.698  -22.040 -4.506  1.00 51.95  ? 110 MET B SD  1 
ATOM   489   C CE  . MET A 1 115 ? 58.077  -22.516 -3.914  1.00 47.98  ? 110 MET B CE  1 
ATOM   490   N N   . ASP A 1 116 ? 62.810  -22.167 -3.459  1.00 63.30  ? 111 ASP B N   1 
ATOM   491   C CA  . ASP A 1 116 ? 63.297  -22.468 -2.114  1.00 66.20  ? 111 ASP B CA  1 
ATOM   492   C C   . ASP A 1 116 ? 62.419  -23.481 -1.372  1.00 67.77  ? 111 ASP B C   1 
ATOM   493   O O   . ASP A 1 116 ? 61.332  -23.146 -0.886  1.00 68.27  ? 111 ASP B O   1 
ATOM   494   C CB  . ASP A 1 116 ? 63.432  -21.162 -1.304  1.00 67.15  ? 111 ASP B CB  1 
ATOM   495   C CG  . ASP A 1 116 ? 63.897  -21.392 0.133   1.00 67.77  ? 111 ASP B CG  1 
ATOM   496   O OD1 . ASP A 1 116 ? 64.884  -22.130 0.348   1.00 68.17  ? 111 ASP B OD1 1 
ATOM   497   O OD2 . ASP A 1 116 ? 63.278  -20.816 1.054   1.00 68.31  ? 111 ASP B OD2 1 
ATOM   498   N N   . ASP A 1 117 ? 62.892  -24.726 -1.308  1.00 68.00  ? 112 ASP B N   1 
ATOM   499   C CA  . ASP A 1 117 ? 62.175  -25.784 -0.603  1.00 68.61  ? 112 ASP B CA  1 
ATOM   500   C C   . ASP A 1 117 ? 62.538  -25.677 0.872   1.00 68.73  ? 112 ASP B C   1 
ATOM   501   O O   . ASP A 1 117 ? 63.572  -26.182 1.322   1.00 68.82  ? 112 ASP B O   1 
ATOM   502   C CB  . ASP A 1 117 ? 62.576  -27.165 -1.113  1.00 70.18  ? 112 ASP B CB  1 
ATOM   503   C CG  . ASP A 1 117 ? 61.848  -28.281 -0.381  1.00 71.14  ? 112 ASP B CG  1 
ATOM   504   O OD1 . ASP A 1 117 ? 62.339  -29.432 -0.407  1.00 71.63  ? 112 ASP B OD1 1 
ATOM   505   O OD2 . ASP A 1 117 ? 60.779  -28.006 0.214   1.00 71.86  ? 112 ASP B OD2 1 
ATOM   506   N N   . VAL A 1 118 ? 61.663  -25.022 1.620   1.00 69.02  ? 113 VAL B N   1 
ATOM   507   C CA  . VAL A 1 118 ? 61.875  -24.787 3.035   1.00 69.96  ? 113 VAL B CA  1 
ATOM   508   C C   . VAL A 1 118 ? 61.769  -26.007 3.950   1.00 68.19  ? 113 VAL B C   1 
ATOM   509   O O   . VAL A 1 118 ? 62.740  -26.375 4.608   1.00 67.64  ? 113 VAL B O   1 
ATOM   510   C CB  . VAL A 1 118 ? 60.913  -23.667 3.523   1.00 70.15  ? 113 VAL B CB  1 
ATOM   511   C CG1 . VAL A 1 118 ? 59.505  -23.917 2.983   1.00 71.46  ? 113 VAL B CG1 1 
ATOM   512   C CG2 . VAL A 1 118 ? 60.911  -23.597 5.037   1.00 70.39  ? 113 VAL B CG2 1 
ATOM   513   N N   . TYR A 1 119 ? 60.602  -26.637 3.992   1.00 68.79  ? 114 TYR B N   1 
ATOM   514   C CA  . TYR A 1 119 ? 60.411  -27.785 4.872   1.00 69.29  ? 114 TYR B CA  1 
ATOM   515   C C   . TYR A 1 119 ? 60.656  -29.141 4.225   1.00 69.69  ? 114 TYR B C   1 
ATOM   516   O O   . TYR A 1 119 ? 60.683  -30.161 4.912   1.00 69.51  ? 114 TYR B O   1 
ATOM   517   C CB  . TYR A 1 119 ? 59.005  -27.745 5.479   1.00 68.97  ? 114 TYR B CB  1 
ATOM   518   C CG  . TYR A 1 119 ? 58.736  -26.483 6.267   1.00 68.17  ? 114 TYR B CG  1 
ATOM   519   C CD1 . TYR A 1 119 ? 57.690  -25.629 5.916   1.00 68.00  ? 114 TYR B CD1 1 
ATOM   520   C CD2 . TYR A 1 119 ? 59.547  -26.126 7.342   1.00 67.53  ? 114 TYR B CD2 1 
ATOM   521   C CE1 . TYR A 1 119 ? 57.463  -24.448 6.615   1.00 68.05  ? 114 TYR B CE1 1 
ATOM   522   C CE2 . TYR A 1 119 ? 59.329  -24.952 8.047   1.00 67.85  ? 114 TYR B CE2 1 
ATOM   523   C CZ  . TYR A 1 119 ? 58.287  -24.118 7.677   1.00 68.44  ? 114 TYR B CZ  1 
ATOM   524   O OH  . TYR A 1 119 ? 58.080  -22.950 8.367   1.00 70.73  ? 114 TYR B OH  1 
ATOM   525   N N   . GLY A 1 120 ? 60.835  -29.157 2.908   1.00 70.32  ? 115 GLY B N   1 
ATOM   526   C CA  . GLY A 1 120 ? 61.087  -30.411 2.224   1.00 70.32  ? 115 GLY B CA  1 
ATOM   527   C C   . GLY A 1 120 ? 62.460  -30.920 2.606   1.00 70.96  ? 115 GLY B C   1 
ATOM   528   O O   . GLY A 1 120 ? 62.995  -30.557 3.651   1.00 72.07  ? 115 GLY B O   1 
ATOM   529   N N   . GLY A 1 121 ? 63.046  -31.759 1.768   1.00 70.32  ? 116 GLY B N   1 
ATOM   530   C CA  . GLY A 1 121 ? 64.365  -32.266 2.084   1.00 69.81  ? 116 GLY B CA  1 
ATOM   531   C C   . GLY A 1 121 ? 65.437  -31.620 1.228   1.00 69.05  ? 116 GLY B C   1 
ATOM   532   O O   . GLY A 1 121 ? 66.504  -31.246 1.727   1.00 68.93  ? 116 GLY B O   1 
ATOM   533   N N   . THR A 1 122 ? 65.138  -31.492 -0.064  1.00 67.38  ? 117 THR B N   1 
ATOM   534   C CA  . THR A 1 122 ? 66.053  -30.912 -1.037  1.00 63.67  ? 117 THR B CA  1 
ATOM   535   C C   . THR A 1 122 ? 66.652  -29.604 -0.544  1.00 65.53  ? 117 THR B C   1 
ATOM   536   O O   . THR A 1 122 ? 66.275  -29.099 0.523   1.00 66.93  ? 117 THR B O   1 
ATOM   537   C CB  . THR A 1 122 ? 65.342  -30.650 -2.363  1.00 62.48  ? 117 THR B CB  1 
ATOM   538   O OG1 . THR A 1 122 ? 64.356  -29.634 -2.176  1.00 61.61  ? 117 THR B OG1 1 
ATOM   539   C CG2 . THR A 1 122 ? 64.656  -31.908 -2.850  1.00 60.70  ? 117 THR B CG2 1 
ATOM   540   N N   . ASN A 1 123 ? 67.568  -29.065 -1.348  1.00 64.36  ? 118 ASN B N   1 
ATOM   541   C CA  . ASN A 1 123 ? 68.309  -27.825 -1.081  1.00 63.36  ? 118 ASN B CA  1 
ATOM   542   C C   . ASN A 1 123 ? 69.712  -28.218 -0.680  1.00 64.20  ? 118 ASN B C   1 
ATOM   543   O O   . ASN A 1 123 ? 70.671  -27.580 -1.109  1.00 64.55  ? 118 ASN B O   1 
ATOM   544   C CB  . ASN A 1 123 ? 67.691  -26.962 0.031   1.00 61.84  ? 118 ASN B CB  1 
ATOM   545   C CG  . ASN A 1 123 ? 66.647  -25.983 -0.489  1.00 60.40  ? 118 ASN B CG  1 
ATOM   546   O OD1 . ASN A 1 123 ? 66.299  -25.016 0.187   1.00 59.03  ? 118 ASN B OD1 1 
ATOM   547   N ND2 . ASN A 1 123 ? 66.137  -26.236 -1.689  1.00 59.82  ? 118 ASN B ND2 1 
ATOM   548   N N   . ARG A 1 124 ? 69.841  -29.258 0.147   1.00 66.15  ? 119 ARG B N   1 
ATOM   549   C CA  . ARG A 1 124 ? 71.168  -29.720 0.531   1.00 68.01  ? 119 ARG B CA  1 
ATOM   550   C C   . ARG A 1 124 ? 71.745  -30.275 -0.765  1.00 64.84  ? 119 ARG B C   1 
ATOM   551   O O   . ARG A 1 124 ? 72.905  -30.033 -1.091  1.00 63.93  ? 119 ARG B O   1 
ATOM   552   C CB  . ARG A 1 124 ? 71.113  -30.797 1.613   1.00 73.60  ? 119 ARG B CB  1 
ATOM   553   C CG  . ARG A 1 124 ? 70.291  -32.016 1.275   1.00 83.26  ? 119 ARG B CG  1 
ATOM   554   C CD  . ARG A 1 124 ? 70.717  -33.204 2.134   1.00 91.43  ? 119 ARG B CD  1 
ATOM   555   N NE  . ARG A 1 124 ? 71.012  -32.830 3.519   1.00 98.02  ? 119 ARG B NE  1 
ATOM   556   C CZ  . ARG A 1 124 ? 70.169  -32.188 4.325   1.00 101.36 ? 119 ARG B CZ  1 
ATOM   557   N NH1 . ARG A 1 124 ? 68.962  -31.838 3.891   1.00 102.77 ? 119 ARG B NH1 1 
ATOM   558   N NH2 . ARG A 1 124 ? 70.532  -31.896 5.568   1.00 102.37 ? 119 ARG B NH2 1 
ATOM   559   N N   . TYR A 1 125 ? 70.935  -31.016 -1.515  1.00 61.68  ? 120 TYR B N   1 
ATOM   560   C CA  . TYR A 1 125 ? 71.394  -31.496 -2.811  1.00 60.62  ? 120 TYR B CA  1 
ATOM   561   C C   . TYR A 1 125 ? 71.389  -30.159 -3.547  1.00 58.20  ? 120 TYR B C   1 
ATOM   562   O O   . TYR A 1 125 ? 71.056  -29.154 -2.935  1.00 60.19  ? 120 TYR B O   1 
ATOM   563   C CB  . TYR A 1 125 ? 70.388  -32.473 -3.418  1.00 63.59  ? 120 TYR B CB  1 
ATOM   564   C CG  . TYR A 1 125 ? 70.048  -33.631 -2.500  1.00 66.20  ? 120 TYR B CG  1 
ATOM   565   C CD1 . TYR A 1 125 ? 69.013  -33.529 -1.565  1.00 66.86  ? 120 TYR B CD1 1 
ATOM   566   C CD2 . TYR A 1 125 ? 70.798  -34.810 -2.524  1.00 67.23  ? 120 TYR B CD2 1 
ATOM   567   C CE1 . TYR A 1 125 ? 68.736  -34.567 -0.673  1.00 66.55  ? 120 TYR B CE1 1 
ATOM   568   C CE2 . TYR A 1 125 ? 70.530  -35.853 -1.633  1.00 67.84  ? 120 TYR B CE2 1 
ATOM   569   C CZ  . TYR A 1 125 ? 69.500  -35.722 -0.710  1.00 67.48  ? 120 TYR B CZ  1 
ATOM   570   O OH  . TYR A 1 125 ? 69.258  -36.729 0.195   1.00 67.62  ? 120 TYR B OH  1 
ATOM   571   N N   . PHE A 1 126 ? 71.720  -30.101 -4.827  1.00 53.51  ? 121 PHE B N   1 
ATOM   572   C CA  . PHE A 1 126 ? 71.759  -28.788 -5.495  1.00 51.34  ? 121 PHE B CA  1 
ATOM   573   C C   . PHE A 1 126 ? 72.957  -28.019 -4.936  1.00 51.75  ? 121 PHE B C   1 
ATOM   574   O O   . PHE A 1 126 ? 73.890  -27.673 -5.661  1.00 53.13  ? 121 PHE B O   1 
ATOM   575   C CB  . PHE A 1 126 ? 70.487  -27.957 -5.234  1.00 44.93  ? 121 PHE B CB  1 
ATOM   576   C CG  . PHE A 1 126 ? 69.330  -28.331 -6.100  1.00 40.69  ? 121 PHE B CG  1 
ATOM   577   C CD1 . PHE A 1 126 ? 69.404  -28.186 -7.483  1.00 39.45  ? 121 PHE B CD1 1 
ATOM   578   C CD2 . PHE A 1 126 ? 68.177  -28.869 -5.545  1.00 39.57  ? 121 PHE B CD2 1 
ATOM   579   C CE1 . PHE A 1 126 ? 68.345  -28.580 -8.306  1.00 36.69  ? 121 PHE B CE1 1 
ATOM   580   C CE2 . PHE A 1 126 ? 67.110  -29.267 -6.356  1.00 38.14  ? 121 PHE B CE2 1 
ATOM   581   C CZ  . PHE A 1 126 ? 67.197  -29.124 -7.739  1.00 37.37  ? 121 PHE B CZ  1 
ATOM   582   N N   . ARG A 1 127 ? 72.921  -27.751 -3.639  1.00 52.33  ? 122 ARG B N   1 
ATOM   583   C CA  . ARG A 1 127 ? 74.002  -27.047 -2.979  1.00 53.33  ? 122 ARG B CA  1 
ATOM   584   C C   . ARG A 1 127 ? 75.265  -27.922 -3.067  1.00 52.54  ? 122 ARG B C   1 
ATOM   585   O O   . ARG A 1 127 ? 76.335  -27.441 -3.443  1.00 51.82  ? 122 ARG B O   1 
ATOM   586   C CB  . ARG A 1 127 ? 73.615  -26.782 -1.524  1.00 56.79  ? 122 ARG B CB  1 
ATOM   587   C CG  . ARG A 1 127 ? 74.306  -25.591 -0.889  1.00 65.06  ? 122 ARG B CG  1 
ATOM   588   C CD  . ARG A 1 127 ? 73.291  -24.583 -0.348  1.00 70.39  ? 122 ARG B CD  1 
ATOM   589   N NE  . ARG A 1 127 ? 72.435  -25.148 0.694   1.00 74.73  ? 122 ARG B NE  1 
ATOM   590   C CZ  . ARG A 1 127 ? 71.449  -24.485 1.297   1.00 77.37  ? 122 ARG B CZ  1 
ATOM   591   N NH1 . ARG A 1 127 ? 70.721  -25.082 2.235   1.00 78.71  ? 122 ARG B NH1 1 
ATOM   592   N NH2 . ARG A 1 127 ? 71.190  -23.225 0.965   1.00 77.44  ? 122 ARG B NH2 1 
ATOM   593   N N   . GLN A 1 128 ? 75.134  -29.210 -2.743  1.00 52.12  ? 123 GLN B N   1 
ATOM   594   C CA  . GLN A 1 128 ? 76.273  -30.134 -2.799  1.00 51.10  ? 123 GLN B CA  1 
ATOM   595   C C   . GLN A 1 128 ? 76.730  -30.288 -4.239  1.00 50.38  ? 123 GLN B C   1 
ATOM   596   O O   . GLN A 1 128 ? 77.905  -30.545 -4.502  1.00 51.33  ? 123 GLN B O   1 
ATOM   597   C CB  . GLN A 1 128 ? 75.896  -31.522 -2.264  1.00 50.61  ? 123 GLN B CB  1 
ATOM   598   C CG  . GLN A 1 128 ? 75.313  -31.550 -0.853  1.00 51.15  ? 123 GLN B CG  1 
ATOM   599   C CD  . GLN A 1 128 ? 74.900  -32.954 -0.394  1.00 48.31  ? 123 GLN B CD  1 
ATOM   600   O OE1 . GLN A 1 128 ? 74.407  -33.763 -1.185  1.00 48.31  ? 123 GLN B OE1 1 
ATOM   601   N NE2 . GLN A 1 128 ? 75.083  -33.233 0.894   1.00 46.34  ? 123 GLN B NE2 1 
ATOM   602   N N   . VAL A 1 129 ? 75.785  -30.147 -5.165  1.00 49.73  ? 124 VAL B N   1 
ATOM   603   C CA  . VAL A 1 129 ? 76.068  -30.277 -6.587  1.00 50.17  ? 124 VAL B CA  1 
ATOM   604   C C   . VAL A 1 129 ? 76.672  -29.004 -7.134  1.00 49.26  ? 124 VAL B C   1 
ATOM   605   O O   . VAL A 1 129 ? 77.509  -29.044 -8.025  1.00 50.52  ? 124 VAL B O   1 
ATOM   606   C CB  . VAL A 1 129 ? 74.791  -30.607 -7.370  1.00 50.26  ? 124 VAL B CB  1 
ATOM   607   C CG1 . VAL A 1 129 ? 75.042  -30.502 -8.868  1.00 50.28  ? 124 VAL B CG1 1 
ATOM   608   C CG2 . VAL A 1 129 ? 74.332  -32.006 -7.006  1.00 49.49  ? 124 VAL B CG2 1 
ATOM   609   N N   . ALA A 1 130 ? 76.242  -27.869 -6.602  1.00 49.81  ? 125 ALA B N   1 
ATOM   610   C CA  . ALA A 1 130 ? 76.770  -26.588 -7.039  1.00 50.08  ? 125 ALA B CA  1 
ATOM   611   C C   . ALA A 1 130 ? 78.177  -26.429 -6.473  1.00 50.68  ? 125 ALA B C   1 
ATOM   612   O O   . ALA A 1 130 ? 79.092  -26.020 -7.187  1.00 51.03  ? 125 ALA B O   1 
ATOM   613   C CB  . ALA A 1 130 ? 75.873  -25.455 -6.557  1.00 48.70  ? 125 ALA B CB  1 
ATOM   614   N N   . SER A 1 131 ? 78.347  -26.754 -5.191  1.00 51.60  ? 126 SER B N   1 
ATOM   615   C CA  . SER A 1 131 ? 79.653  -26.648 -4.537  1.00 53.08  ? 126 SER B CA  1 
ATOM   616   C C   . SER A 1 131 ? 80.705  -27.318 -5.402  1.00 54.74  ? 126 SER B C   1 
ATOM   617   O O   . SER A 1 131 ? 81.747  -26.742 -5.714  1.00 54.41  ? 126 SER B O   1 
ATOM   618   C CB  . SER A 1 131 ? 79.629  -27.325 -3.176  1.00 52.72  ? 126 SER B CB  1 
ATOM   619   O OG  . SER A 1 131 ? 80.939  -27.366 -2.639  1.00 55.31  ? 126 SER B OG  1 
ATOM   620   N N   . GLU A 1 132 ? 80.426  -28.562 -5.758  1.00 56.71  ? 127 GLU B N   1 
ATOM   621   C CA  . GLU A 1 132 ? 81.291  -29.331 -6.627  1.00 58.03  ? 127 GLU B CA  1 
ATOM   622   C C   . GLU A 1 132 ? 80.887  -28.796 -7.996  1.00 58.08  ? 127 GLU B C   1 
ATOM   623   O O   . GLU A 1 132 ? 79.814  -28.219 -8.127  1.00 59.52  ? 127 GLU B O   1 
ATOM   624   C CB  . GLU A 1 132 ? 80.941  -30.808 -6.490  1.00 60.40  ? 127 GLU B CB  1 
ATOM   625   C CG  . GLU A 1 132 ? 81.614  -31.712 -7.484  1.00 65.09  ? 127 GLU B CG  1 
ATOM   626   C CD  . GLU A 1 132 ? 81.247  -33.162 -7.261  1.00 67.18  ? 127 GLU B CD  1 
ATOM   627   O OE1 . GLU A 1 132 ? 80.039  -33.446 -7.121  1.00 67.73  ? 127 GLU B OE1 1 
ATOM   628   O OE2 . GLU A 1 132 ? 82.162  -34.015 -7.228  1.00 69.25  ? 127 GLU B OE2 1 
ATOM   629   N N   . PHE A 1 133 ? 81.723  -28.958 -9.010  1.00 57.25  ? 128 PHE B N   1 
ATOM   630   C CA  . PHE A 1 133 ? 81.379  -28.446 -10.339 1.00 57.02  ? 128 PHE B CA  1 
ATOM   631   C C   . PHE A 1 133 ? 81.403  -26.914 -10.363 1.00 57.64  ? 128 PHE B C   1 
ATOM   632   O O   . PHE A 1 133 ? 81.159  -26.291 -11.400 1.00 57.74  ? 128 PHE B O   1 
ATOM   633   C CB  . PHE A 1 133 ? 79.997  -28.965 -10.778 1.00 54.32  ? 128 PHE B CB  1 
ATOM   634   C CG  . PHE A 1 133 ? 79.893  -30.465 -10.785 1.00 52.34  ? 128 PHE B CG  1 
ATOM   635   C CD1 . PHE A 1 133 ? 79.122  -31.129 -9.836  1.00 50.99  ? 128 PHE B CD1 1 
ATOM   636   C CD2 . PHE A 1 133 ? 80.619  -31.220 -11.701 1.00 51.43  ? 128 PHE B CD2 1 
ATOM   637   C CE1 . PHE A 1 133 ? 79.082  -32.519 -9.794  1.00 49.73  ? 128 PHE B CE1 1 
ATOM   638   C CE2 . PHE A 1 133 ? 80.587  -32.615 -11.666 1.00 51.00  ? 128 PHE B CE2 1 
ATOM   639   C CZ  . PHE A 1 133 ? 79.817  -33.264 -10.710 1.00 50.25  ? 128 PHE B CZ  1 
ATOM   640   N N   . GLY A 1 134 ? 81.698  -26.329 -9.203  1.00 58.70  ? 129 GLY B N   1 
ATOM   641   C CA  . GLY A 1 134 ? 81.795  -24.884 -9.051  1.00 59.74  ? 129 GLY B CA  1 
ATOM   642   C C   . GLY A 1 134 ? 80.744  -23.972 -9.666  1.00 59.90  ? 129 GLY B C   1 
ATOM   643   O O   . GLY A 1 134 ? 81.057  -23.152 -10.532 1.00 61.31  ? 129 GLY B O   1 
ATOM   644   N N   . LEU A 1 135 ? 79.501  -24.090 -9.219  1.00 58.31  ? 130 LEU B N   1 
ATOM   645   C CA  . LEU A 1 135 ? 78.450  -23.235 -9.743  1.00 57.42  ? 130 LEU B CA  1 
ATOM   646   C C   . LEU A 1 135 ? 77.885  -22.382 -8.617  1.00 59.60  ? 130 LEU B C   1 
ATOM   647   O O   . LEU A 1 135 ? 78.003  -22.729 -7.440  1.00 59.20  ? 130 LEU B O   1 
ATOM   648   C CB  . LEU A 1 135 ? 77.337  -24.074 -10.368 1.00 53.46  ? 130 LEU B CB  1 
ATOM   649   C CG  . LEU A 1 135 ? 77.730  -24.989 -11.524 1.00 48.55  ? 130 LEU B CG  1 
ATOM   650   C CD1 . LEU A 1 135 ? 76.465  -25.588 -12.111 1.00 47.51  ? 130 LEU B CD1 1 
ATOM   651   C CD2 . LEU A 1 135 ? 78.490  -24.212 -12.582 1.00 44.98  ? 130 LEU B CD2 1 
ATOM   652   N N   . LYS A 1 136 ? 77.282  -21.257 -8.984  1.00 62.71  ? 131 LYS B N   1 
ATOM   653   C CA  . LYS A 1 136 ? 76.696  -20.348 -8.006  1.00 66.20  ? 131 LYS B CA  1 
ATOM   654   C C   . LYS A 1 136 ? 75.216  -20.680 -7.872  1.00 63.81  ? 131 LYS B C   1 
ATOM   655   O O   . LYS A 1 136 ? 74.480  -20.663 -8.857  1.00 65.12  ? 131 LYS B O   1 
ATOM   656   C CB  . LYS A 1 136 ? 76.896  -18.891 -8.466  1.00 71.13  ? 131 LYS B CB  1 
ATOM   657   C CG  . LYS A 1 136 ? 76.105  -17.837 -7.688  1.00 78.66  ? 131 LYS B CG  1 
ATOM   658   C CD  . LYS A 1 136 ? 76.444  -17.837 -6.203  1.00 85.23  ? 131 LYS B CD  1 
ATOM   659   C CE  . LYS A 1 136 ? 75.591  -16.830 -5.425  1.00 89.01  ? 131 LYS B CE  1 
ATOM   660   N NZ  . LYS A 1 136 ? 75.862  -15.415 -5.805  1.00 91.22  ? 131 LYS B NZ  1 
ATOM   661   N N   . ILE A 1 137 ? 74.776  -21.001 -6.663  1.00 62.12  ? 132 ILE B N   1 
ATOM   662   C CA  . ILE A 1 137 ? 73.372  -21.327 -6.474  1.00 62.43  ? 132 ILE B CA  1 
ATOM   663   C C   . ILE A 1 137 ? 72.670  -20.298 -5.592  1.00 58.01  ? 132 ILE B C   1 
ATOM   664   O O   . ILE A 1 137 ? 73.286  -19.673 -4.735  1.00 57.12  ? 132 ILE B O   1 
ATOM   665   C CB  . ILE A 1 137 ? 73.205  -22.743 -5.872  1.00 64.17  ? 132 ILE B CB  1 
ATOM   666   C CG1 . ILE A 1 137 ? 72.016  -23.439 -6.534  1.00 66.25  ? 132 ILE B CG1 1 
ATOM   667   C CG2 . ILE A 1 137 ? 72.978  -22.667 -4.370  1.00 65.72  ? 132 ILE B CG2 1 
ATOM   668   C CD1 . ILE A 1 137 ? 71.813  -24.860 -6.066  1.00 70.59  ? 132 ILE B CD1 1 
ATOM   669   N N   . SER A 1 138 ? 71.374  -20.129 -5.808  1.00 54.69  ? 133 SER B N   1 
ATOM   670   C CA  . SER A 1 138 ? 70.594  -19.174 -5.037  1.00 52.50  ? 133 SER B CA  1 
ATOM   671   C C   . SER A 1 138 ? 69.165  -19.702 -4.870  1.00 50.22  ? 133 SER B C   1 
ATOM   672   O O   . SER A 1 138 ? 68.591  -20.262 -5.800  1.00 49.82  ? 133 SER B O   1 
ATOM   673   C CB  . SER A 1 138 ? 70.593  -17.828 -5.765  1.00 52.37  ? 133 SER B CB  1 
ATOM   674   O OG  . SER A 1 138 ? 69.814  -16.866 -5.076  1.00 54.96  ? 133 SER B OG  1 
ATOM   675   N N   . PHE A 1 139 ? 68.587  -19.527 -3.689  1.00 47.37  ? 134 PHE B N   1 
ATOM   676   C CA  . PHE A 1 139 ? 67.233  -20.012 -3.450  1.00 47.10  ? 134 PHE B CA  1 
ATOM   677   C C   . PHE A 1 139 ? 66.222  -18.883 -3.331  1.00 47.43  ? 134 PHE B C   1 
ATOM   678   O O   . PHE A 1 139 ? 66.417  -17.946 -2.561  1.00 48.21  ? 134 PHE B O   1 
ATOM   679   C CB  . PHE A 1 139 ? 67.222  -20.882 -2.197  1.00 47.24  ? 134 PHE B CB  1 
ATOM   680   C CG  . PHE A 1 139 ? 68.032  -22.132 -2.338  1.00 45.50  ? 134 PHE B CG  1 
ATOM   681   C CD1 . PHE A 1 139 ? 67.494  -23.254 -2.952  1.00 45.27  ? 134 PHE B CD1 1 
ATOM   682   C CD2 . PHE A 1 139 ? 69.353  -22.173 -1.907  1.00 46.22  ? 134 PHE B CD2 1 
ATOM   683   C CE1 . PHE A 1 139 ? 68.262  -24.400 -3.136  1.00 45.73  ? 134 PHE B CE1 1 
ATOM   684   C CE2 . PHE A 1 139 ? 70.133  -23.317 -2.087  1.00 46.16  ? 134 PHE B CE2 1 
ATOM   685   C CZ  . PHE A 1 139 ? 69.586  -24.430 -2.702  1.00 46.09  ? 134 PHE B CZ  1 
ATOM   686   N N   . VAL A 1 140 ? 65.135  -18.992 -4.092  1.00 47.15  ? 135 VAL B N   1 
ATOM   687   C CA  . VAL A 1 140 ? 64.097  -17.965 -4.126  1.00 46.73  ? 135 VAL B CA  1 
ATOM   688   C C   . VAL A 1 140 ? 62.690  -18.528 -4.002  1.00 49.71  ? 135 VAL B C   1 
ATOM   689   O O   . VAL A 1 140 ? 62.373  -19.560 -4.596  1.00 50.17  ? 135 VAL B O   1 
ATOM   690   C CB  . VAL A 1 140 ? 64.152  -17.183 -5.449  1.00 45.04  ? 135 VAL B CB  1 
ATOM   691   C CG1 . VAL A 1 140 ? 63.183  -16.012 -5.409  1.00 43.80  ? 135 VAL B CG1 1 
ATOM   692   C CG2 . VAL A 1 140 ? 65.560  -16.720 -5.708  1.00 44.39  ? 135 VAL B CG2 1 
ATOM   693   N N   . ASP A 1 141 ? 61.840  -17.836 -3.247  1.00 51.18  ? 136 ASP B N   1 
ATOM   694   C CA  . ASP A 1 141 ? 60.467  -18.283 -3.079  1.00 54.00  ? 136 ASP B CA  1 
ATOM   695   C C   . ASP A 1 141 ? 59.684  -17.953 -4.346  1.00 54.60  ? 136 ASP B C   1 
ATOM   696   O O   . ASP A 1 141 ? 58.767  -17.129 -4.319  1.00 54.86  ? 136 ASP B O   1 
ATOM   697   C CB  . ASP A 1 141 ? 59.822  -17.591 -1.878  1.00 58.07  ? 136 ASP B CB  1 
ATOM   698   C CG  . ASP A 1 141 ? 58.417  -18.104 -1.598  1.00 62.24  ? 136 ASP B CG  1 
ATOM   699   O OD1 . ASP A 1 141 ? 57.780  -17.621 -0.637  1.00 65.97  ? 136 ASP B OD1 1 
ATOM   700   O OD2 . ASP A 1 141 ? 57.948  -18.993 -2.338  1.00 63.78  ? 136 ASP B OD2 1 
ATOM   701   N N   . CYS A 1 142 ? 60.048  -18.607 -5.449  1.00 53.85  ? 137 CYS B N   1 
ATOM   702   C CA  . CYS A 1 142 ? 59.417  -18.385 -6.753  1.00 53.85  ? 137 CYS B CA  1 
ATOM   703   C C   . CYS A 1 142 ? 57.889  -18.401 -6.792  1.00 55.11  ? 137 CYS B C   1 
ATOM   704   O O   . CYS A 1 142 ? 57.294  -18.262 -7.865  1.00 54.14  ? 137 CYS B O   1 
ATOM   705   C CB  . CYS A 1 142 ? 59.947  -19.393 -7.774  1.00 52.92  ? 137 CYS B CB  1 
ATOM   706   S SG  . CYS A 1 142 ? 61.737  -19.385 -7.965  1.00 50.92  ? 137 CYS B SG  1 
ATOM   707   N N   . SER A 1 143 ? 57.247  -18.591 -5.644  1.00 57.38  ? 138 SER B N   1 
ATOM   708   C CA  . SER A 1 143 ? 55.790  -18.565 -5.613  1.00 60.84  ? 138 SER B CA  1 
ATOM   709   C C   . SER A 1 143 ? 55.422  -17.080 -5.685  1.00 63.84  ? 138 SER B C   1 
ATOM   710   O O   . SER A 1 143 ? 54.284  -16.717 -5.983  1.00 64.30  ? 138 SER B O   1 
ATOM   711   C CB  . SER A 1 143 ? 55.263  -19.202 -4.324  1.00 60.08  ? 138 SER B CB  1 
ATOM   712   O OG  . SER A 1 143 ? 55.839  -18.599 -3.179  1.00 59.29  ? 138 SER B OG  1 
ATOM   713   N N   . LYS A 1 144 ? 56.418  -16.235 -5.414  1.00 66.67  ? 139 LYS B N   1 
ATOM   714   C CA  . LYS A 1 144 ? 56.280  -14.780 -5.461  1.00 69.15  ? 139 LYS B CA  1 
ATOM   715   C C   . LYS A 1 144 ? 57.060  -14.309 -6.682  1.00 66.81  ? 139 LYS B C   1 
ATOM   716   O O   . LYS A 1 144 ? 58.207  -13.882 -6.557  1.00 67.57  ? 139 LYS B O   1 
ATOM   717   C CB  . LYS A 1 144 ? 56.878  -14.138 -4.204  1.00 73.46  ? 139 LYS B CB  1 
ATOM   718   C CG  . LYS A 1 144 ? 56.202  -14.539 -2.902  1.00 80.61  ? 139 LYS B CG  1 
ATOM   719   C CD  . LYS A 1 144 ? 54.705  -14.270 -2.941  1.00 86.84  ? 139 LYS B CD  1 
ATOM   720   C CE  . LYS A 1 144 ? 54.232  -13.585 -1.668  1.00 91.58  ? 139 LYS B CE  1 
ATOM   721   N NZ  . LYS A 1 144 ? 54.854  -12.238 -1.496  1.00 94.68  ? 139 LYS B NZ  1 
ATOM   722   N N   . ILE A 1 145 ? 56.434  -14.393 -7.854  1.00 64.70  ? 140 ILE B N   1 
ATOM   723   C CA  . ILE A 1 145 ? 57.070  -14.010 -9.113  1.00 63.76  ? 140 ILE B CA  1 
ATOM   724   C C   . ILE A 1 145 ? 57.913  -12.733 -9.062  1.00 61.51  ? 140 ILE B C   1 
ATOM   725   O O   . ILE A 1 145 ? 58.992  -12.677 -9.659  1.00 60.84  ? 140 ILE B O   1 
ATOM   726   C CB  . ILE A 1 145 ? 56.025  -13.870 -10.242 1.00 64.29  ? 140 ILE B CB  1 
ATOM   727   C CG1 . ILE A 1 145 ? 55.193  -15.153 -10.336 1.00 66.23  ? 140 ILE B CG1 1 
ATOM   728   C CG2 . ILE A 1 145 ? 56.727  -13.624 -11.578 1.00 63.90  ? 140 ILE B CG2 1 
ATOM   729   C CD1 . ILE A 1 145 ? 54.096  -15.115 -11.396 1.00 67.45  ? 140 ILE B CD1 1 
ATOM   730   N N   . LYS A 1 146 ? 57.433  -11.710 -8.361  1.00 60.74  ? 141 LYS B N   1 
ATOM   731   C CA  . LYS A 1 146 ? 58.185  -10.461 -8.268  1.00 59.88  ? 141 LYS B CA  1 
ATOM   732   C C   . LYS A 1 146 ? 59.567  -10.724 -7.681  1.00 59.03  ? 141 LYS B C   1 
ATOM   733   O O   . LYS A 1 146 ? 60.561  -10.103 -8.083  1.00 57.70  ? 141 LYS B O   1 
ATOM   734   C CB  . LYS A 1 146 ? 57.448  -9.443  -7.393  1.00 60.69  ? 141 LYS B CB  1 
ATOM   735   C CG  . LYS A 1 146 ? 56.104  -9.001  -7.950  1.00 64.63  ? 141 LYS B CG  1 
ATOM   736   C CD  . LYS A 1 146 ? 55.739  -7.584  -7.501  1.00 67.49  ? 141 LYS B CD  1 
ATOM   737   C CE  . LYS A 1 146 ? 55.677  -7.447  -5.981  1.00 69.33  ? 141 LYS B CE  1 
ATOM   738   N NZ  . LYS A 1 146 ? 55.312  -6.056  -5.568  1.00 70.85  ? 141 LYS B NZ  1 
ATOM   739   N N   . LEU A 1 147 ? 59.615  -11.665 -6.741  1.00 57.75  ? 142 LEU B N   1 
ATOM   740   C CA  . LEU A 1 147 ? 60.843  -12.044 -6.049  1.00 57.32  ? 142 LEU B CA  1 
ATOM   741   C C   . LEU A 1 147 ? 61.864  -12.773 -6.935  1.00 58.40  ? 142 LEU B C   1 
ATOM   742   O O   . LEU A 1 147 ? 63.074  -12.734 -6.678  1.00 57.14  ? 142 LEU B O   1 
ATOM   743   C CB  . LEU A 1 147 ? 60.485  -12.905 -4.839  1.00 55.70  ? 142 LEU B CB  1 
ATOM   744   C CG  . LEU A 1 147 ? 61.182  -12.505 -3.543  1.00 53.83  ? 142 LEU B CG  1 
ATOM   745   C CD1 . LEU A 1 147 ? 60.611  -13.326 -2.405  1.00 54.54  ? 142 LEU B CD1 1 
ATOM   746   C CD2 . LEU A 1 147 ? 62.687  -12.710 -3.676  1.00 52.75  ? 142 LEU B CD2 1 
ATOM   747   N N   . LEU A 1 148 ? 61.376  -13.447 -7.969  1.00 59.03  ? 143 LEU B N   1 
ATOM   748   C CA  . LEU A 1 148 ? 62.263  -14.142 -8.887  1.00 61.13  ? 143 LEU B CA  1 
ATOM   749   C C   . LEU A 1 148 ? 62.970  -13.063 -9.717  1.00 65.01  ? 143 LEU B C   1 
ATOM   750   O O   . LEU A 1 148 ? 64.196  -13.077 -9.857  1.00 65.21  ? 143 LEU B O   1 
ATOM   751   C CB  . LEU A 1 148 ? 61.453  -15.092 -9.777  1.00 56.79  ? 143 LEU B CB  1 
ATOM   752   C CG  . LEU A 1 148 ? 62.197  -15.949 -10.806 1.00 55.01  ? 143 LEU B CG  1 
ATOM   753   C CD1 . LEU A 1 148 ? 63.378  -16.684 -10.162 1.00 51.48  ? 143 LEU B CD1 1 
ATOM   754   C CD2 . LEU A 1 148 ? 61.208  -16.932 -11.419 1.00 51.78  ? 143 LEU B CD2 1 
ATOM   755   N N   . GLU A 1 149 ? 62.183  -12.120 -10.244 1.00 69.29  ? 144 GLU B N   1 
ATOM   756   C CA  . GLU A 1 149 ? 62.693  -10.997 -11.043 1.00 72.04  ? 144 GLU B CA  1 
ATOM   757   C C   . GLU A 1 149 ? 63.942  -10.398 -10.408 1.00 71.09  ? 144 GLU B C   1 
ATOM   758   O O   . GLU A 1 149 ? 64.986  -10.258 -11.050 1.00 71.07  ? 144 GLU B O   1 
ATOM   759   C CB  . GLU A 1 149 ? 61.627  -9.902  -11.147 1.00 76.98  ? 144 GLU B CB  1 
ATOM   760   C CG  . GLU A 1 149 ? 60.697  -10.037 -12.331 1.00 84.02  ? 144 GLU B CG  1 
ATOM   761   C CD  . GLU A 1 149 ? 61.331  -9.548  -13.619 1.00 88.24  ? 144 GLU B CD  1 
ATOM   762   O OE1 . GLU A 1 149 ? 62.459  -9.992  -13.939 1.00 90.61  ? 144 GLU B OE1 1 
ATOM   763   O OE2 . GLU A 1 149 ? 60.697  -8.720  -14.310 1.00 90.06  ? 144 GLU B OE2 1 
ATOM   764   N N   . ALA A 1 150 ? 63.808  -10.039 -9.137  1.00 69.12  ? 145 ALA B N   1 
ATOM   765   C CA  . ALA A 1 150 ? 64.895  -9.456  -8.376  1.00 67.67  ? 145 ALA B CA  1 
ATOM   766   C C   . ALA A 1 150 ? 66.127  -10.360 -8.364  1.00 67.15  ? 145 ALA B C   1 
ATOM   767   O O   . ALA A 1 150 ? 67.266  -9.881  -8.378  1.00 68.06  ? 145 ALA B O   1 
ATOM   768   C CB  . ALA A 1 150 ? 64.430  -9.188  -6.952  1.00 66.54  ? 145 ALA B CB  1 
ATOM   769   N N   . ALA A 1 151 ? 65.894  -11.668 -8.349  1.00 65.96  ? 146 ALA B N   1 
ATOM   770   C CA  . ALA A 1 151 ? 66.982  -12.636 -8.306  1.00 64.32  ? 146 ALA B CA  1 
ATOM   771   C C   . ALA A 1 151 ? 67.729  -12.840 -9.621  1.00 62.45  ? 146 ALA B C   1 
ATOM   772   O O   . ALA A 1 151 ? 68.909  -13.194 -9.604  1.00 61.50  ? 146 ALA B O   1 
ATOM   773   C CB  . ALA A 1 151 ? 66.458  -13.968 -7.798  1.00 65.64  ? 146 ALA B CB  1 
ATOM   774   N N   . ILE A 1 152 ? 67.054  -12.631 -10.752 1.00 61.18  ? 147 ILE B N   1 
ATOM   775   C CA  . ILE A 1 152 ? 67.698  -12.807 -12.060 1.00 60.06  ? 147 ILE B CA  1 
ATOM   776   C C   . ILE A 1 152 ? 69.017  -12.032 -12.091 1.00 61.72  ? 147 ILE B C   1 
ATOM   777   O O   . ILE A 1 152 ? 69.083  -10.879 -11.663 1.00 60.73  ? 147 ILE B O   1 
ATOM   778   C CB  . ILE A 1 152 ? 66.809  -12.307 -13.226 1.00 58.36  ? 147 ILE B CB  1 
ATOM   779   C CG1 . ILE A 1 152 ? 65.464  -13.043 -13.230 1.00 55.82  ? 147 ILE B CG1 1 
ATOM   780   C CG2 . ILE A 1 152 ? 67.538  -12.518 -14.554 1.00 55.69  ? 147 ILE B CG2 1 
ATOM   781   C CD1 . ILE A 1 152 ? 65.546  -14.500 -13.628 1.00 54.02  ? 147 ILE B CD1 1 
ATOM   782   N N   . THR A 1 153 ? 70.057  -12.666 -12.618 1.00 61.68  ? 148 THR B N   1 
ATOM   783   C CA  . THR A 1 153 ? 71.384  -12.068 -12.667 1.00 61.43  ? 148 THR B CA  1 
ATOM   784   C C   . THR A 1 153 ? 72.071  -12.357 -13.992 1.00 66.95  ? 148 THR B C   1 
ATOM   785   O O   . THR A 1 153 ? 71.667  -13.259 -14.717 1.00 65.84  ? 148 THR B O   1 
ATOM   786   C CB  . THR A 1 153 ? 72.225  -12.627 -11.492 1.00 60.12  ? 148 THR B CB  1 
ATOM   787   O OG1 . THR A 1 153 ? 71.895  -11.906 -10.303 1.00 58.79  ? 148 THR B OG1 1 
ATOM   788   C CG2 . THR A 1 153 ? 73.712  -12.537 -11.749 1.00 56.89  ? 148 THR B CG2 1 
ATOM   789   N N   . PRO A 1 154 ? 73.099  -11.567 -14.342 1.00 69.37  ? 149 PRO B N   1 
ATOM   790   C CA  . PRO A 1 154 ? 73.824  -11.781 -15.597 1.00 74.01  ? 149 PRO B CA  1 
ATOM   791   C C   . PRO A 1 154 ? 74.332  -13.222 -15.729 1.00 77.22  ? 149 PRO B C   1 
ATOM   792   O O   . PRO A 1 154 ? 74.286  -13.816 -16.809 1.00 77.71  ? 149 PRO B O   1 
ATOM   793   C CB  . PRO A 1 154 ? 74.967  -10.777 -15.497 1.00 73.17  ? 149 PRO B CB  1 
ATOM   794   C CG  . PRO A 1 154 ? 74.314  -9.630  -14.823 1.00 72.41  ? 149 PRO B CG  1 
ATOM   795   C CD  . PRO A 1 154 ? 73.514  -10.295 -13.718 1.00 71.36  ? 149 PRO B CD  1 
ATOM   796   N N   . GLU A 1 155 ? 74.809  -13.781 -14.621 1.00 80.37  ? 150 GLU B N   1 
ATOM   797   C CA  . GLU A 1 155 ? 75.332  -15.141 -14.619 1.00 83.31  ? 150 GLU B CA  1 
ATOM   798   C C   . GLU A 1 155 ? 74.241  -16.192 -14.426 1.00 79.33  ? 150 GLU B C   1 
ATOM   799   O O   . GLU A 1 155 ? 74.526  -17.387 -14.411 1.00 79.94  ? 150 GLU B O   1 
ATOM   800   C CB  . GLU A 1 155 ? 76.408  -15.292 -13.537 1.00 89.84  ? 150 GLU B CB  1 
ATOM   801   C CG  . GLU A 1 155 ? 77.587  -14.329 -13.694 1.00 100.31 ? 150 GLU B CG  1 
ATOM   802   C CD  . GLU A 1 155 ? 77.270  -12.916 -13.223 1.00 105.53 ? 150 GLU B CD  1 
ATOM   803   O OE1 . GLU A 1 155 ? 78.012  -11.977 -13.585 1.00 108.60 ? 150 GLU B OE1 1 
ATOM   804   O OE2 . GLU A 1 155 ? 76.286  -12.745 -12.477 1.00 109.11 ? 150 GLU B OE2 1 
ATOM   805   N N   . THR A 1 156 ? 72.996  -15.749 -14.273 1.00 75.34  ? 151 THR B N   1 
ATOM   806   C CA  . THR A 1 156 ? 71.888  -16.680 -14.109 1.00 72.81  ? 151 THR B CA  1 
ATOM   807   C C   . THR A 1 156 ? 71.637  -17.341 -15.457 1.00 68.87  ? 151 THR B C   1 
ATOM   808   O O   . THR A 1 156 ? 71.397  -16.663 -16.458 1.00 66.57  ? 151 THR B O   1 
ATOM   809   C CB  . THR A 1 156 ? 70.595  -15.968 -13.672 1.00 72.13  ? 151 THR B CB  1 
ATOM   810   O OG1 . THR A 1 156 ? 70.813  -15.297 -12.427 1.00 73.19  ? 151 THR B OG1 1 
ATOM   811   C CG2 . THR A 1 156 ? 69.468  -16.976 -13.495 1.00 72.85  ? 151 THR B CG2 1 
ATOM   812   N N   . LYS A 1 157 ? 71.702  -18.668 -15.480 1.00 67.14  ? 152 LYS B N   1 
ATOM   813   C CA  . LYS A 1 157 ? 71.489  -19.412 -16.715 1.00 66.10  ? 152 LYS B CA  1 
ATOM   814   C C   . LYS A 1 157 ? 70.536  -20.584 -16.545 1.00 60.92  ? 152 LYS B C   1 
ATOM   815   O O   . LYS A 1 157 ? 70.193  -21.259 -17.516 1.00 59.43  ? 152 LYS B O   1 
ATOM   816   C CB  . LYS A 1 157 ? 72.833  -19.891 -17.274 1.00 70.74  ? 152 LYS B CB  1 
ATOM   817   C CG  . LYS A 1 157 ? 73.675  -18.736 -17.814 1.00 78.76  ? 152 LYS B CG  1 
ATOM   818   C CD  . LYS A 1 157 ? 74.971  -19.192 -18.464 1.00 84.88  ? 152 LYS B CD  1 
ATOM   819   C CE  . LYS A 1 157 ? 75.733  -18.011 -19.076 1.00 88.02  ? 152 LYS B CE  1 
ATOM   820   N NZ  . LYS A 1 157 ? 75.024  -17.401 -20.242 1.00 89.49  ? 152 LYS B NZ  1 
ATOM   821   N N   . LEU A 1 158 ? 70.093  -20.807 -15.311 1.00 54.84  ? 153 LEU B N   1 
ATOM   822   C CA  . LEU A 1 158 ? 69.176  -21.895 -15.026 1.00 49.23  ? 153 LEU B CA  1 
ATOM   823   C C   . LEU A 1 158 ? 68.272  -21.626 -13.822 1.00 46.98  ? 153 LEU B C   1 
ATOM   824   O O   . LEU A 1 158 ? 68.741  -21.166 -12.774 1.00 46.31  ? 153 LEU B O   1 
ATOM   825   C CB  . LEU A 1 158 ? 69.960  -23.192 -14.801 1.00 47.96  ? 153 LEU B CB  1 
ATOM   826   C CG  . LEU A 1 158 ? 69.139  -24.442 -14.463 1.00 46.22  ? 153 LEU B CG  1 
ATOM   827   C CD1 . LEU A 1 158 ? 68.151  -24.742 -15.578 1.00 45.16  ? 153 LEU B CD1 1 
ATOM   828   C CD2 . LEU A 1 158 ? 70.076  -25.614 -14.269 1.00 48.24  ? 153 LEU B CD2 1 
ATOM   829   N N   . VAL A 1 159 ? 66.975  -21.908 -13.999 1.00 44.46  ? 154 VAL B N   1 
ATOM   830   C CA  . VAL A 1 159 ? 65.960  -21.759 -12.953 1.00 42.09  ? 154 VAL B CA  1 
ATOM   831   C C   . VAL A 1 159 ? 65.212  -23.082 -12.749 1.00 40.89  ? 154 VAL B C   1 
ATOM   832   O O   . VAL A 1 159 ? 64.466  -23.525 -13.632 1.00 41.42  ? 154 VAL B O   1 
ATOM   833   C CB  . VAL A 1 159 ? 64.927  -20.659 -13.300 1.00 41.50  ? 154 VAL B CB  1 
ATOM   834   C CG1 . VAL A 1 159 ? 63.701  -20.784 -12.398 1.00 38.91  ? 154 VAL B CG1 1 
ATOM   835   C CG2 . VAL A 1 159 ? 65.555  -19.282 -13.104 1.00 42.31  ? 154 VAL B CG2 1 
ATOM   836   N N   . TRP A 1 160 ? 65.419  -23.695 -11.581 1.00 39.11  ? 155 TRP B N   1 
ATOM   837   C CA  . TRP A 1 160 ? 64.794  -24.969 -11.207 1.00 38.36  ? 155 TRP B CA  1 
ATOM   838   C C   . TRP A 1 160 ? 63.526  -24.753 -10.363 1.00 36.83  ? 155 TRP B C   1 
ATOM   839   O O   . TRP A 1 160 ? 63.575  -24.126 -9.311  1.00 36.03  ? 155 TRP B O   1 
ATOM   840   C CB  . TRP A 1 160 ? 65.808  -25.808 -10.431 1.00 38.32  ? 155 TRP B CB  1 
ATOM   841   C CG  . TRP A 1 160 ? 65.382  -27.209 -10.236 1.00 38.51  ? 155 TRP B CG  1 
ATOM   842   C CD1 . TRP A 1 160 ? 64.522  -27.681 -9.295  1.00 37.83  ? 155 TRP B CD1 1 
ATOM   843   C CD2 . TRP A 1 160 ? 65.770  -28.328 -11.033 1.00 39.76  ? 155 TRP B CD2 1 
ATOM   844   N NE1 . TRP A 1 160 ? 64.340  -29.030 -9.459  1.00 39.96  ? 155 TRP B NE1 1 
ATOM   845   C CE2 . TRP A 1 160 ? 65.089  -29.453 -10.524 1.00 40.27  ? 155 TRP B CE2 1 
ATOM   846   C CE3 . TRP A 1 160 ? 66.614  -28.487 -12.141 1.00 41.03  ? 155 TRP B CE3 1 
ATOM   847   C CZ2 . TRP A 1 160 ? 65.245  -30.731 -11.068 1.00 41.09  ? 155 TRP B CZ2 1 
ATOM   848   C CZ3 . TRP A 1 160 ? 66.771  -29.754 -12.684 1.00 41.91  ? 155 TRP B CZ3 1 
ATOM   849   C CH2 . TRP A 1 160 ? 66.080  -30.861 -12.150 1.00 42.62  ? 155 TRP B CH2 1 
ATOM   850   N N   . ILE A 1 161 ? 62.402  -25.301 -10.812 1.00 37.83  ? 156 ILE B N   1 
ATOM   851   C CA  . ILE A 1 161 ? 61.122  -25.106 -10.123 1.00 41.38  ? 156 ILE B CA  1 
ATOM   852   C C   . ILE A 1 161 ? 60.331  -26.385 -9.835  1.00 40.87  ? 156 ILE B C   1 
ATOM   853   O O   . ILE A 1 161 ? 59.984  -27.111 -10.760 1.00 42.93  ? 156 ILE B O   1 
ATOM   854   C CB  . ILE A 1 161 ? 60.186  -24.182 -10.978 1.00 41.98  ? 156 ILE B CB  1 
ATOM   855   C CG1 . ILE A 1 161 ? 60.760  -22.772 -11.068 1.00 42.44  ? 156 ILE B CG1 1 
ATOM   856   C CG2 . ILE A 1 161 ? 58.788  -24.140 -10.395 1.00 41.94  ? 156 ILE B CG2 1 
ATOM   857   C CD1 . ILE A 1 161 ? 60.732  -22.029 -9.769  1.00 44.14  ? 156 ILE B CD1 1 
ATOM   858   N N   . GLU A 1 162 ? 60.027  -26.653 -8.568  1.00 41.27  ? 157 GLU B N   1 
ATOM   859   C CA  . GLU A 1 162 ? 59.214  -27.821 -8.233  1.00 41.22  ? 157 GLU B CA  1 
ATOM   860   C C   . GLU A 1 162 ? 57.854  -27.268 -7.813  1.00 40.66  ? 157 GLU B C   1 
ATOM   861   O O   . GLU A 1 162 ? 57.782  -26.242 -7.131  1.00 41.03  ? 157 GLU B O   1 
ATOM   862   C CB  . GLU A 1 162 ? 59.814  -28.619 -7.071  1.00 42.41  ? 157 GLU B CB  1 
ATOM   863   C CG  . GLU A 1 162 ? 61.322  -28.744 -7.105  1.00 45.83  ? 157 GLU B CG  1 
ATOM   864   C CD  . GLU A 1 162 ? 61.996  -27.650 -6.310  1.00 47.74  ? 157 GLU B CD  1 
ATOM   865   O OE1 . GLU A 1 162 ? 63.225  -27.473 -6.454  1.00 49.11  ? 157 GLU B OE1 1 
ATOM   866   O OE2 . GLU A 1 162 ? 61.289  -26.975 -5.530  1.00 49.98  ? 157 GLU B OE2 1 
ATOM   867   N N   . THR A 1 163 ? 56.778  -27.934 -8.220  1.00 39.83  ? 158 THR B N   1 
ATOM   868   C CA  . THR A 1 163 ? 55.430  -27.484 -7.882  1.00 37.96  ? 158 THR B CA  1 
ATOM   869   C C   . THR A 1 163 ? 54.391  -28.591 -8.068  1.00 37.65  ? 158 THR B C   1 
ATOM   870   O O   . THR A 1 163 ? 54.390  -29.294 -9.081  1.00 38.96  ? 158 THR B O   1 
ATOM   871   C CB  . THR A 1 163 ? 55.018  -26.259 -8.746  1.00 37.25  ? 158 THR B CB  1 
ATOM   872   O OG1 . THR A 1 163 ? 53.633  -25.964 -8.534  1.00 38.60  ? 158 THR B OG1 1 
ATOM   873   C CG2 . THR A 1 163 ? 55.231  -26.535 -10.211 1.00 34.73  ? 158 THR B CG2 1 
ATOM   874   N N   . PRO A 1 164 ? 53.494  -28.769 -7.087  1.00 35.41  ? 159 PRO B N   1 
ATOM   875   C CA  . PRO A 1 164 ? 53.406  -28.010 -5.834  1.00 36.24  ? 159 PRO B CA  1 
ATOM   876   C C   . PRO A 1 164 ? 54.590  -28.327 -4.927  1.00 37.44  ? 159 PRO B C   1 
ATOM   877   O O   . PRO A 1 164 ? 55.235  -29.357 -5.106  1.00 38.91  ? 159 PRO B O   1 
ATOM   878   C CB  . PRO A 1 164 ? 52.085  -28.489 -5.237  1.00 33.02  ? 159 PRO B CB  1 
ATOM   879   C CG  . PRO A 1 164 ? 51.292  -28.883 -6.438  1.00 33.56  ? 159 PRO B CG  1 
ATOM   880   C CD  . PRO A 1 164 ? 52.296  -29.599 -7.279  1.00 34.01  ? 159 PRO B CD  1 
ATOM   881   N N   . THR A 1 165 ? 54.883  -27.451 -3.964  1.00 38.23  ? 160 THR B N   1 
ATOM   882   C CA  . THR A 1 165 ? 55.988  -27.699 -3.041  1.00 39.73  ? 160 THR B CA  1 
ATOM   883   C C   . THR A 1 165 ? 55.602  -28.840 -2.112  1.00 42.01  ? 160 THR B C   1 
ATOM   884   O O   . THR A 1 165 ? 54.460  -29.302 -2.120  1.00 43.51  ? 160 THR B O   1 
ATOM   885   C CB  . THR A 1 165 ? 56.332  -26.476 -2.147  1.00 38.24  ? 160 THR B CB  1 
ATOM   886   O OG1 . THR A 1 165 ? 55.174  -26.067 -1.412  1.00 36.82  ? 160 THR B OG1 1 
ATOM   887   C CG2 . THR A 1 165 ? 56.842  -25.338 -2.976  1.00 38.24  ? 160 THR B CG2 1 
ATOM   888   N N   . ASN A 1 166 ? 56.562  -29.285 -1.311  1.00 42.58  ? 161 ASN B N   1 
ATOM   889   C CA  . ASN A 1 166 ? 56.344  -30.369 -0.371  1.00 42.23  ? 161 ASN B CA  1 
ATOM   890   C C   . ASN A 1 166 ? 56.885  -29.942 0.991   1.00 43.50  ? 161 ASN B C   1 
ATOM   891   O O   . ASN A 1 166 ? 58.027  -29.484 1.099   1.00 44.05  ? 161 ASN B O   1 
ATOM   892   C CB  . ASN A 1 166 ? 57.052  -31.635 -0.877  1.00 41.96  ? 161 ASN B CB  1 
ATOM   893   C CG  . ASN A 1 166 ? 57.100  -32.740 0.161   1.00 41.16  ? 161 ASN B CG  1 
ATOM   894   O OD1 . ASN A 1 166 ? 56.080  -33.126 0.739   1.00 38.93  ? 161 ASN B OD1 1 
ATOM   895   N ND2 . ASN A 1 166 ? 58.296  -33.265 0.397   1.00 43.05  ? 161 ASN B ND2 1 
ATOM   896   N N   . PRO A 1 167 ? 56.067  -30.079 2.048   1.00 44.25  ? 162 PRO B N   1 
ATOM   897   C CA  . PRO A 1 167 ? 54.699  -30.600 2.010   1.00 43.59  ? 162 PRO B CA  1 
ATOM   898   C C   . PRO A 1 167 ? 53.647  -29.500 2.177   1.00 44.50  ? 162 PRO B C   1 
ATOM   899   O O   . PRO A 1 167 ? 52.477  -29.781 2.430   1.00 44.82  ? 162 PRO B O   1 
ATOM   900   C CB  . PRO A 1 167 ? 54.692  -31.551 3.185   1.00 42.76  ? 162 PRO B CB  1 
ATOM   901   C CG  . PRO A 1 167 ? 55.407  -30.715 4.213   1.00 43.70  ? 162 PRO B CG  1 
ATOM   902   C CD  . PRO A 1 167 ? 56.567  -30.070 3.434   1.00 42.54  ? 162 PRO B CD  1 
ATOM   903   N N   . THR A 1 168 ? 54.075  -28.251 2.045   1.00 45.74  ? 163 THR B N   1 
ATOM   904   C CA  . THR A 1 168 ? 53.182  -27.108 2.202   1.00 46.25  ? 163 THR B CA  1 
ATOM   905   C C   . THR A 1 168 ? 52.248  -26.974 1.008   1.00 45.46  ? 163 THR B C   1 
ATOM   906   O O   . THR A 1 168 ? 51.137  -26.458 1.129   1.00 45.98  ? 163 THR B O   1 
ATOM   907   C CB  . THR A 1 168 ? 53.991  -25.814 2.318   1.00 48.49  ? 163 THR B CB  1 
ATOM   908   O OG1 . THR A 1 168 ? 55.104  -26.026 3.197   1.00 50.10  ? 163 THR B OG1 1 
ATOM   909   C CG2 . THR A 1 168 ? 53.119  -24.691 2.861   1.00 49.55  ? 163 THR B CG2 1 
ATOM   910   N N   . GLN A 1 169 ? 52.727  -27.434 -0.146  1.00 44.31  ? 164 GLN B N   1 
ATOM   911   C CA  . GLN A 1 169 ? 51.995  -27.396 -1.408  1.00 42.68  ? 164 GLN B CA  1 
ATOM   912   C C   . GLN A 1 169 ? 51.744  -25.994 -1.985  1.00 44.11  ? 164 GLN B C   1 
ATOM   913   O O   . GLN A 1 169 ? 50.645  -25.684 -2.447  1.00 44.22  ? 164 GLN B O   1 
ATOM   914   C CB  . GLN A 1 169 ? 50.676  -28.187 -1.291  1.00 39.55  ? 164 GLN B CB  1 
ATOM   915   C CG  . GLN A 1 169 ? 50.905  -29.662 -0.976  1.00 36.75  ? 164 GLN B CG  1 
ATOM   916   C CD  . GLN A 1 169 ? 49.722  -30.563 -1.302  1.00 36.76  ? 164 GLN B CD  1 
ATOM   917   O OE1 . GLN A 1 169 ? 49.293  -30.669 -2.459  1.00 37.62  ? 164 GLN B OE1 1 
ATOM   918   N NE2 . GLN A 1 169 ? 49.199  -31.232 -0.282  1.00 34.60  ? 164 GLN B NE2 1 
ATOM   919   N N   . LYS A 1 170 ? 52.772  -25.151 -1.960  1.00 45.16  ? 165 LYS B N   1 
ATOM   920   C CA  . LYS A 1 170 ? 52.665  -23.810 -2.533  1.00 47.26  ? 165 LYS B CA  1 
ATOM   921   C C   . LYS A 1 170 ? 52.754  -24.053 -4.034  1.00 45.79  ? 165 LYS B C   1 
ATOM   922   O O   . LYS A 1 170 ? 53.583  -24.843 -4.474  1.00 47.57  ? 165 LYS B O   1 
ATOM   923   C CB  . LYS A 1 170 ? 53.846  -22.926 -2.096  1.00 52.25  ? 165 LYS B CB  1 
ATOM   924   C CG  . LYS A 1 170 ? 53.996  -22.758 -0.579  1.00 60.00  ? 165 LYS B CG  1 
ATOM   925   C CD  . LYS A 1 170 ? 55.172  -21.851 -0.182  1.00 64.65  ? 165 LYS B CD  1 
ATOM   926   C CE  . LYS A 1 170 ? 56.521  -22.437 -0.589  1.00 69.04  ? 165 LYS B CE  1 
ATOM   927   N NZ  . LYS A 1 170 ? 57.665  -21.594 -0.141  1.00 71.58  ? 165 LYS B NZ  1 
ATOM   928   N N   . VAL A 1 171 ? 51.915  -23.400 -4.828  1.00 44.12  ? 166 VAL B N   1 
ATOM   929   C CA  . VAL A 1 171 ? 51.962  -23.609 -6.276  1.00 41.50  ? 166 VAL B CA  1 
ATOM   930   C C   . VAL A 1 171 ? 52.648  -22.465 -7.037  1.00 42.58  ? 166 VAL B C   1 
ATOM   931   O O   . VAL A 1 171 ? 52.343  -21.289 -6.825  1.00 43.78  ? 166 VAL B O   1 
ATOM   932   C CB  . VAL A 1 171 ? 50.540  -23.840 -6.844  1.00 38.23  ? 166 VAL B CB  1 
ATOM   933   C CG1 . VAL A 1 171 ? 50.595  -24.000 -8.353  1.00 36.24  ? 166 VAL B CG1 1 
ATOM   934   C CG2 . VAL A 1 171 ? 49.933  -25.086 -6.215  1.00 34.52  ? 166 VAL B CG2 1 
ATOM   935   N N   . ILE A 1 172 ? 53.591  -22.820 -7.910  1.00 43.59  ? 167 ILE B N   1 
ATOM   936   C CA  . ILE A 1 172 ? 54.324  -21.834 -8.711  1.00 45.95  ? 167 ILE B CA  1 
ATOM   937   C C   . ILE A 1 172 ? 53.709  -21.725 -10.111 1.00 47.75  ? 167 ILE B C   1 
ATOM   938   O O   . ILE A 1 172 ? 53.348  -22.731 -10.728 1.00 47.43  ? 167 ILE B O   1 
ATOM   939   C CB  . ILE A 1 172 ? 55.839  -22.203 -8.841  1.00 44.29  ? 167 ILE B CB  1 
ATOM   940   C CG1 . ILE A 1 172 ? 56.558  -21.997 -7.511  1.00 44.42  ? 167 ILE B CG1 1 
ATOM   941   C CG2 . ILE A 1 172 ? 56.519  -21.311 -9.857  1.00 43.11  ? 167 ILE B CG2 1 
ATOM   942   C CD1 . ILE A 1 172 ? 56.035  -22.846 -6.389  1.00 47.02  ? 167 ILE B CD1 1 
ATOM   943   N N   . ASP A 1 173 ? 53.576  -20.499 -10.605 1.00 50.92  ? 168 ASP B N   1 
ATOM   944   C CA  . ASP A 1 173 ? 53.005  -20.282 -11.927 1.00 54.91  ? 168 ASP B CA  1 
ATOM   945   C C   . ASP A 1 173 ? 54.080  -20.603 -12.965 1.00 53.22  ? 168 ASP B C   1 
ATOM   946   O O   . ASP A 1 173 ? 54.949  -19.776 -13.224 1.00 53.48  ? 168 ASP B O   1 
ATOM   947   C CB  . ASP A 1 173 ? 52.564  -18.824 -12.067 1.00 59.97  ? 168 ASP B CB  1 
ATOM   948   C CG  . ASP A 1 173 ? 51.669  -18.595 -13.273 1.00 65.26  ? 168 ASP B CG  1 
ATOM   949   O OD1 . ASP A 1 173 ? 52.036  -19.035 -14.387 1.00 66.92  ? 168 ASP B OD1 1 
ATOM   950   O OD2 . ASP A 1 173 ? 50.600  -17.967 -13.106 1.00 68.71  ? 168 ASP B OD2 1 
ATOM   951   N N   . ILE A 1 174 ? 54.030  -21.797 -13.551 1.00 52.50  ? 169 ILE B N   1 
ATOM   952   C CA  . ILE A 1 174 ? 55.033  -22.187 -14.547 1.00 52.21  ? 169 ILE B CA  1 
ATOM   953   C C   . ILE A 1 174 ? 55.136  -21.118 -15.637 1.00 51.20  ? 169 ILE B C   1 
ATOM   954   O O   . ILE A 1 174 ? 56.230  -20.667 -15.976 1.00 49.88  ? 169 ILE B O   1 
ATOM   955   C CB  . ILE A 1 174 ? 54.690  -23.542 -15.240 1.00 51.42  ? 169 ILE B CB  1 
ATOM   956   C CG1 . ILE A 1 174 ? 54.281  -24.605 -14.209 1.00 50.24  ? 169 ILE B CG1 1 
ATOM   957   C CG2 . ILE A 1 174 ? 55.892  -24.022 -16.035 1.00 49.34  ? 169 ILE B CG2 1 
ATOM   958   C CD1 . ILE A 1 174 ? 55.353  -24.969 -13.231 1.00 51.37  ? 169 ILE B CD1 1 
ATOM   959   N N   . GLU A 1 175 ? 53.985  -20.713 -16.171 1.00 52.25  ? 170 GLU B N   1 
ATOM   960   C CA  . GLU A 1 175 ? 53.922  -19.704 -17.225 1.00 54.64  ? 170 GLU B CA  1 
ATOM   961   C C   . GLU A 1 175 ? 54.615  -18.410 -16.809 1.00 55.07  ? 170 GLU B C   1 
ATOM   962   O O   . GLU A 1 175 ? 55.516  -17.922 -17.491 1.00 54.58  ? 170 GLU B O   1 
ATOM   963   C CB  . GLU A 1 175 ? 52.472  -19.390 -17.567 1.00 56.20  ? 170 GLU B CB  1 
ATOM   964   C CG  . GLU A 1 175 ? 52.310  -18.673 -18.885 1.00 60.74  ? 170 GLU B CG  1 
ATOM   965   C CD  . GLU A 1 175 ? 52.228  -19.642 -20.055 1.00 63.66  ? 170 GLU B CD  1 
ATOM   966   O OE1 . GLU A 1 175 ? 51.238  -20.403 -20.121 1.00 64.27  ? 170 GLU B OE1 1 
ATOM   967   O OE2 . GLU A 1 175 ? 53.149  -19.649 -20.903 1.00 66.44  ? 170 GLU B OE2 1 
ATOM   968   N N   . GLY A 1 176 ? 54.174  -17.847 -15.691 1.00 56.07  ? 171 GLY B N   1 
ATOM   969   C CA  . GLY A 1 176 ? 54.772  -16.621 -15.202 1.00 56.70  ? 171 GLY B CA  1 
ATOM   970   C C   . GLY A 1 176 ? 56.281  -16.724 -15.257 1.00 57.33  ? 171 GLY B C   1 
ATOM   971   O O   . GLY A 1 176 ? 56.923  -16.029 -16.040 1.00 58.85  ? 171 GLY B O   1 
ATOM   972   N N   . CYS A 1 177 ? 56.848  -17.601 -14.435 1.00 56.95  ? 172 CYS B N   1 
ATOM   973   C CA  . CYS A 1 177 ? 58.288  -17.794 -14.404 1.00 56.57  ? 172 CYS B CA  1 
ATOM   974   C C   . CYS A 1 177 ? 58.848  -17.934 -15.808 1.00 57.62  ? 172 CYS B C   1 
ATOM   975   O O   . CYS A 1 177 ? 59.988  -17.546 -16.067 1.00 57.26  ? 172 CYS B O   1 
ATOM   976   C CB  . CYS A 1 177 ? 58.639  -19.039 -13.600 1.00 56.07  ? 172 CYS B CB  1 
ATOM   977   S SG  . CYS A 1 177 ? 58.254  -18.909 -11.857 1.00 56.73  ? 172 CYS B SG  1 
ATOM   978   N N   . ALA A 1 178 ? 58.050  -18.496 -16.712 1.00 58.86  ? 173 ALA B N   1 
ATOM   979   C CA  . ALA A 1 178 ? 58.492  -18.669 -18.089 1.00 60.63  ? 173 ALA B CA  1 
ATOM   980   C C   . ALA A 1 178 ? 58.717  -17.297 -18.726 1.00 63.89  ? 173 ALA B C   1 
ATOM   981   O O   . ALA A 1 178 ? 59.802  -17.012 -19.243 1.00 64.01  ? 173 ALA B O   1 
ATOM   982   C CB  . ALA A 1 178 ? 57.458  -19.457 -18.877 1.00 56.46  ? 173 ALA B CB  1 
ATOM   983   N N   . HIS A 1 179 ? 57.692  -16.445 -18.671 1.00 68.29  ? 174 HIS B N   1 
ATOM   984   C CA  . HIS A 1 179 ? 57.772  -15.103 -19.247 1.00 72.59  ? 174 HIS B CA  1 
ATOM   985   C C   . HIS A 1 179 ? 58.888  -14.294 -18.611 1.00 68.80  ? 174 HIS B C   1 
ATOM   986   O O   . HIS A 1 179 ? 59.658  -13.635 -19.304 1.00 68.63  ? 174 HIS B O   1 
ATOM   987   C CB  . HIS A 1 179 ? 56.439  -14.362 -19.073 1.00 83.03  ? 174 HIS B CB  1 
ATOM   988   C CG  . HIS A 1 179 ? 55.301  -14.978 -19.828 1.00 95.10  ? 174 HIS B CG  1 
ATOM   989   N ND1 . HIS A 1 179 ? 54.013  -14.487 -19.766 1.00 99.69  ? 174 HIS B ND1 1 
ATOM   990   C CD2 . HIS A 1 179 ? 55.255  -16.046 -20.660 1.00 100.02 ? 174 HIS B CD2 1 
ATOM   991   C CE1 . HIS A 1 179 ? 53.226  -15.228 -20.525 1.00 103.30 ? 174 HIS B CE1 1 
ATOM   992   N NE2 . HIS A 1 179 ? 53.955  -16.180 -21.080 1.00 103.26 ? 174 HIS B NE2 1 
ATOM   993   N N   . ILE A 1 180 ? 58.964  -14.353 -17.286 1.00 65.46  ? 175 ILE B N   1 
ATOM   994   C CA  . ILE A 1 180 ? 59.974  -13.629 -16.527 1.00 63.35  ? 175 ILE B CA  1 
ATOM   995   C C   . ILE A 1 180 ? 61.382  -14.065 -16.953 1.00 65.09  ? 175 ILE B C   1 
ATOM   996   O O   . ILE A 1 180 ? 62.179  -13.257 -17.448 1.00 65.19  ? 175 ILE B O   1 
ATOM   997   C CB  . ILE A 1 180 ? 59.810  -13.891 -15.005 1.00 61.17  ? 175 ILE B CB  1 
ATOM   998   C CG1 . ILE A 1 180 ? 58.338  -13.749 -14.595 1.00 60.32  ? 175 ILE B CG1 1 
ATOM   999   C CG2 . ILE A 1 180 ? 60.686  -12.945 -14.209 1.00 57.96  ? 175 ILE B CG2 1 
ATOM   1000  C CD1 . ILE A 1 180 ? 57.688  -12.431 -14.965 1.00 58.95  ? 175 ILE B CD1 1 
ATOM   1001  N N   . VAL A 1 181 ? 61.676  -15.349 -16.758 1.00 66.00  ? 176 VAL B N   1 
ATOM   1002  C CA  . VAL A 1 181 ? 62.978  -15.921 -17.098 1.00 65.50  ? 176 VAL B CA  1 
ATOM   1003  C C   . VAL A 1 181 ? 63.360  -15.722 -18.566 1.00 66.56  ? 176 VAL B C   1 
ATOM   1004  O O   . VAL A 1 181 ? 64.419  -15.168 -18.862 1.00 66.78  ? 176 VAL B O   1 
ATOM   1005  C CB  . VAL A 1 181 ? 63.014  -17.430 -16.747 1.00 64.21  ? 176 VAL B CB  1 
ATOM   1006  C CG1 . VAL A 1 181 ? 64.270  -18.070 -17.293 1.00 63.63  ? 176 VAL B CG1 1 
ATOM   1007  C CG2 . VAL A 1 181 ? 62.953  -17.606 -15.243 1.00 61.31  ? 176 VAL B CG2 1 
ATOM   1008  N N   . HIS A 1 182 ? 62.500  -16.164 -19.480 1.00 68.26  ? 177 HIS B N   1 
ATOM   1009  C CA  . HIS A 1 182 ? 62.769  -16.028 -20.910 1.00 71.23  ? 177 HIS B CA  1 
ATOM   1010  C C   . HIS A 1 182 ? 62.973  -14.584 -21.352 1.00 75.13  ? 177 HIS B C   1 
ATOM   1011  O O   . HIS A 1 182 ? 63.785  -14.311 -22.239 1.00 75.83  ? 177 HIS B O   1 
ATOM   1012  C CB  . HIS A 1 182 ? 61.627  -16.622 -21.732 1.00 67.88  ? 177 HIS B CB  1 
ATOM   1013  C CG  . HIS A 1 182 ? 61.471  -18.100 -21.571 1.00 66.48  ? 177 HIS B CG  1 
ATOM   1014  N ND1 . HIS A 1 182 ? 62.547  -18.963 -21.545 1.00 65.31  ? 177 HIS B ND1 1 
ATOM   1015  C CD2 . HIS A 1 182 ? 60.365  -18.875 -21.480 1.00 65.00  ? 177 HIS B CD2 1 
ATOM   1016  C CE1 . HIS A 1 182 ? 62.109  -20.205 -21.449 1.00 64.57  ? 177 HIS B CE1 1 
ATOM   1017  N NE2 . HIS A 1 182 ? 60.788  -20.179 -21.408 1.00 65.02  ? 177 HIS B NE2 1 
ATOM   1018  N N   . LYS A 1 183 ? 62.230  -13.671 -20.728 1.00 79.49  ? 178 LYS B N   1 
ATOM   1019  C CA  . LYS A 1 183 ? 62.277  -12.245 -21.049 1.00 83.99  ? 178 LYS B CA  1 
ATOM   1020  C C   . LYS A 1 183 ? 63.663  -11.681 -21.342 1.00 85.03  ? 178 LYS B C   1 
ATOM   1021  O O   . LYS A 1 183 ? 63.883  -11.086 -22.393 1.00 84.75  ? 178 LYS B O   1 
ATOM   1022  C CB  . LYS A 1 183 ? 61.625  -11.434 -19.926 1.00 87.11  ? 178 LYS B CB  1 
ATOM   1023  C CG  . LYS A 1 183 ? 61.300  -10.000 -20.316 1.00 92.07  ? 178 LYS B CG  1 
ATOM   1024  C CD  . LYS A 1 183 ? 60.295  -9.370  -19.360 1.00 95.69  ? 178 LYS B CD  1 
ATOM   1025  C CE  . LYS A 1 183 ? 59.787  -8.035  -19.891 1.00 97.88  ? 178 LYS B CE  1 
ATOM   1026  N NZ  . LYS A 1 183 ? 58.736  -7.450  -19.014 1.00 99.35  ? 178 LYS B NZ  1 
ATOM   1027  N N   . HIS A 1 184 ? 64.597  -11.854 -20.418 1.00 86.96  ? 179 HIS B N   1 
ATOM   1028  C CA  . HIS A 1 184 ? 65.940  -11.342 -20.640 1.00 88.96  ? 179 HIS B CA  1 
ATOM   1029  C C   . HIS A 1 184 ? 66.998  -12.435 -20.665 1.00 88.38  ? 179 HIS B C   1 
ATOM   1030  O O   . HIS A 1 184 ? 66.935  -13.397 -19.899 1.00 88.20  ? 179 HIS B O   1 
ATOM   1031  C CB  . HIS A 1 184 ? 66.313  -10.312 -19.567 1.00 93.13  ? 179 HIS B CB  1 
ATOM   1032  C CG  . HIS A 1 184 ? 65.607  -8.998  -19.709 1.00 97.44  ? 179 HIS B CG  1 
ATOM   1033  N ND1 . HIS A 1 184 ? 64.461  -8.686  -19.007 1.00 98.76  ? 179 HIS B ND1 1 
ATOM   1034  C CD2 . HIS A 1 184 ? 65.894  -7.909  -20.462 1.00 98.95  ? 179 HIS B CD2 1 
ATOM   1035  C CE1 . HIS A 1 184 ? 64.076  -7.461  -19.319 1.00 99.76  ? 179 HIS B CE1 1 
ATOM   1036  N NE2 . HIS A 1 184 ? 64.929  -6.967  -20.200 1.00 99.96  ? 179 HIS B NE2 1 
ATOM   1037  N N   . GLY A 1 185 ? 67.964  -12.276 -21.562 1.00 87.20  ? 180 GLY B N   1 
ATOM   1038  C CA  . GLY A 1 185 ? 69.059  -13.220 -21.670 1.00 85.64  ? 180 GLY B CA  1 
ATOM   1039  C C   . GLY A 1 185 ? 68.738  -14.662 -22.010 1.00 84.83  ? 180 GLY B C   1 
ATOM   1040  O O   . GLY A 1 185 ? 67.583  -15.035 -22.234 1.00 84.87  ? 180 GLY B O   1 
ATOM   1041  N N   . ASP A 1 186 ? 69.800  -15.466 -22.053 1.00 83.18  ? 181 ASP B N   1 
ATOM   1042  C CA  . ASP A 1 186 ? 69.729  -16.891 -22.353 1.00 80.34  ? 181 ASP B CA  1 
ATOM   1043  C C   . ASP A 1 186 ? 69.664  -17.677 -21.051 1.00 76.39  ? 181 ASP B C   1 
ATOM   1044  O O   . ASP A 1 186 ? 70.658  -17.782 -20.331 1.00 77.27  ? 181 ASP B O   1 
ATOM   1045  C CB  . ASP A 1 186 ? 70.969  -17.320 -23.141 1.00 82.25  ? 181 ASP B CB  1 
ATOM   1046  C CG  . ASP A 1 186 ? 71.329  -18.780 -22.917 1.00 84.81  ? 181 ASP B CG  1 
ATOM   1047  O OD1 . ASP A 1 186 ? 70.551  -19.663 -23.346 1.00 85.88  ? 181 ASP B OD1 1 
ATOM   1048  O OD2 . ASP A 1 186 ? 72.389  -19.041 -22.301 1.00 85.14  ? 181 ASP B OD2 1 
ATOM   1049  N N   . ILE A 1 187 ? 68.498  -18.234 -20.747 1.00 71.26  ? 182 ILE B N   1 
ATOM   1050  C CA  . ILE A 1 187 ? 68.355  -18.993 -19.523 1.00 66.11  ? 182 ILE B CA  1 
ATOM   1051  C C   . ILE A 1 187 ? 67.287  -20.074 -19.613 1.00 60.14  ? 182 ILE B C   1 
ATOM   1052  O O   . ILE A 1 187 ? 66.208  -19.877 -20.176 1.00 59.33  ? 182 ILE B O   1 
ATOM   1053  C CB  . ILE A 1 187 ? 68.083  -18.044 -18.331 1.00 67.09  ? 182 ILE B CB  1 
ATOM   1054  C CG1 . ILE A 1 187 ? 67.625  -18.847 -17.112 1.00 68.74  ? 182 ILE B CG1 1 
ATOM   1055  C CG2 . ILE A 1 187 ? 67.093  -16.976 -18.739 1.00 67.39  ? 182 ILE B CG2 1 
ATOM   1056  C CD1 . ILE A 1 187 ? 67.366  -18.006 -15.881 1.00 70.41  ? 182 ILE B CD1 1 
ATOM   1057  N N   . ILE A 1 188 ? 67.621  -21.225 -19.046 1.00 55.75  ? 183 ILE B N   1 
ATOM   1058  C CA  . ILE A 1 188 ? 66.755  -22.398 -19.037 1.00 52.26  ? 183 ILE B CA  1 
ATOM   1059  C C   . ILE A 1 188 ? 65.804  -22.465 -17.836 1.00 49.02  ? 183 ILE B C   1 
ATOM   1060  O O   . ILE A 1 188 ? 66.176  -22.173 -16.697 1.00 47.58  ? 183 ILE B O   1 
ATOM   1061  C CB  . ILE A 1 188 ? 67.621  -23.678 -19.049 1.00 51.77  ? 183 ILE B CB  1 
ATOM   1062  C CG1 . ILE A 1 188 ? 68.572  -23.633 -20.247 1.00 50.85  ? 183 ILE B CG1 1 
ATOM   1063  C CG2 . ILE A 1 188 ? 66.738  -24.916 -19.094 1.00 50.52  ? 183 ILE B CG2 1 
ATOM   1064  C CD1 . ILE A 1 188 ? 69.902  -24.304 -20.008 1.00 51.42  ? 183 ILE B CD1 1 
ATOM   1065  N N   . LEU A 1 189 ? 64.563  -22.844 -18.097 1.00 46.38  ? 184 LEU B N   1 
ATOM   1066  C CA  . LEU A 1 189 ? 63.593  -22.977 -17.022 1.00 44.02  ? 184 LEU B CA  1 
ATOM   1067  C C   . LEU A 1 189 ? 63.208  -24.440 -16.925 1.00 43.37  ? 184 LEU B C   1 
ATOM   1068  O O   . LEU A 1 189 ? 62.528  -24.966 -17.802 1.00 42.54  ? 184 LEU B O   1 
ATOM   1069  C CB  . LEU A 1 189 ? 62.337  -22.143 -17.287 1.00 41.27  ? 184 LEU B CB  1 
ATOM   1070  C CG  . LEU A 1 189 ? 61.214  -22.463 -16.292 1.00 39.24  ? 184 LEU B CG  1 
ATOM   1071  C CD1 . LEU A 1 189 ? 61.664  -22.167 -14.869 1.00 39.18  ? 184 LEU B CD1 1 
ATOM   1072  C CD2 . LEU A 1 189 ? 60.000  -21.660 -16.628 1.00 39.23  ? 184 LEU B CD2 1 
ATOM   1073  N N   . VAL A 1 190 ? 63.653  -25.092 -15.857 1.00 42.63  ? 185 VAL B N   1 
ATOM   1074  C CA  . VAL A 1 190 ? 63.355  -26.501 -15.642 1.00 41.03  ? 185 VAL B CA  1 
ATOM   1075  C C   . VAL A 1 190 ? 62.239  -26.676 -14.621 1.00 40.71  ? 185 VAL B C   1 
ATOM   1076  O O   . VAL A 1 190 ? 62.180  -25.959 -13.621 1.00 40.08  ? 185 VAL B O   1 
ATOM   1077  C CB  . VAL A 1 190 ? 64.598  -27.258 -15.126 1.00 41.74  ? 185 VAL B CB  1 
ATOM   1078  C CG1 . VAL A 1 190 ? 64.276  -28.737 -14.970 1.00 40.09  ? 185 VAL B CG1 1 
ATOM   1079  C CG2 . VAL A 1 190 ? 65.779  -27.041 -16.083 1.00 40.87  ? 185 VAL B CG2 1 
ATOM   1080  N N   . VAL A 1 191 ? 61.345  -27.620 -14.876 1.00 39.95  ? 186 VAL B N   1 
ATOM   1081  C CA  . VAL A 1 191 ? 60.274  -27.886 -13.928 1.00 40.46  ? 186 VAL B CA  1 
ATOM   1082  C C   . VAL A 1 191 ? 60.283  -29.357 -13.509 1.00 37.63  ? 186 VAL B C   1 
ATOM   1083  O O   . VAL A 1 191 ? 60.181  -30.245 -14.356 1.00 37.26  ? 186 VAL B O   1 
ATOM   1084  C CB  . VAL A 1 191 ? 58.875  -27.530 -14.517 1.00 43.20  ? 186 VAL B CB  1 
ATOM   1085  C CG1 . VAL A 1 191 ? 57.768  -27.967 -13.558 1.00 43.57  ? 186 VAL B CG1 1 
ATOM   1086  C CG2 . VAL A 1 191 ? 58.770  -26.033 -14.738 1.00 44.86  ? 186 VAL B CG2 1 
ATOM   1087  N N   . ASP A 1 192 ? 60.441  -29.605 -12.209 1.00 35.71  ? 187 ASP B N   1 
ATOM   1088  C CA  . ASP A 1 192 ? 60.419  -30.961 -11.675 1.00 35.64  ? 187 ASP B CA  1 
ATOM   1089  C C   . ASP A 1 192 ? 58.932  -31.311 -11.606 1.00 33.98  ? 187 ASP B C   1 
ATOM   1090  O O   . ASP A 1 192 ? 58.208  -30.791 -10.762 1.00 34.70  ? 187 ASP B O   1 
ATOM   1091  C CB  . ASP A 1 192 ? 61.023  -31.006 -10.272 1.00 37.66  ? 187 ASP B CB  1 
ATOM   1092  C CG  . ASP A 1 192 ? 61.131  -32.428 -9.729  1.00 40.48  ? 187 ASP B CG  1 
ATOM   1093  O OD1 . ASP A 1 192 ? 60.170  -33.211 -9.902  1.00 40.40  ? 187 ASP B OD1 1 
ATOM   1094  O OD2 . ASP A 1 192 ? 62.171  -32.762 -9.120  1.00 42.63  ? 187 ASP B OD2 1 
ATOM   1095  N N   . ASN A 1 193 ? 58.496  -32.191 -12.503 1.00 31.86  ? 188 ASN B N   1 
ATOM   1096  C CA  . ASN A 1 193 ? 57.101  -32.599 -12.632 1.00 29.95  ? 188 ASN B CA  1 
ATOM   1097  C C   . ASN A 1 193 ? 56.759  -33.859 -11.847 1.00 30.72  ? 188 ASN B C   1 
ATOM   1098  O O   . ASN A 1 193 ? 55.729  -34.489 -12.075 1.00 30.07  ? 188 ASN B O   1 
ATOM   1099  C CB  . ASN A 1 193 ? 56.805  -32.812 -14.118 1.00 30.13  ? 188 ASN B CB  1 
ATOM   1100  C CG  . ASN A 1 193 ? 55.368  -32.527 -14.477 1.00 31.51  ? 188 ASN B CG  1 
ATOM   1101  O OD1 . ASN A 1 193 ? 54.755  -31.605 -13.933 1.00 33.56  ? 188 ASN B OD1 1 
ATOM   1102  N ND2 . ASN A 1 193 ? 54.825  -33.294 -15.421 1.00 30.26  ? 188 ASN B ND2 1 
ATOM   1103  N N   . THR A 1 194 ? 57.620  -34.206 -10.904 1.00 32.47  ? 189 THR B N   1 
ATOM   1104  C CA  . THR A 1 194 ? 57.442  -35.404 -10.096 1.00 33.97  ? 189 THR B CA  1 
ATOM   1105  C C   . THR A 1 194 ? 56.188  -35.419 -9.221  1.00 35.42  ? 189 THR B C   1 
ATOM   1106  O O   . THR A 1 194 ? 55.491  -36.436 -9.139  1.00 36.37  ? 189 THR B O   1 
ATOM   1107  C CB  . THR A 1 194 ? 58.676  -35.629 -9.190  1.00 35.13  ? 189 THR B CB  1 
ATOM   1108  O OG1 . THR A 1 194 ? 59.859  -35.726 -10.000 1.00 33.97  ? 189 THR B OG1 1 
ATOM   1109  C CG2 . THR A 1 194 ? 58.506  -36.899 -8.372  1.00 33.76  ? 189 THR B CG2 1 
ATOM   1110  N N   . PHE A 1 195 ? 55.902  -34.296 -8.570  1.00 36.28  ? 190 PHE B N   1 
ATOM   1111  C CA  . PHE A 1 195 ? 54.748  -34.204 -7.682  1.00 36.87  ? 190 PHE B CA  1 
ATOM   1112  C C   . PHE A 1 195 ? 53.393  -34.118 -8.353  1.00 33.67  ? 190 PHE B C   1 
ATOM   1113  O O   . PHE A 1 195 ? 52.378  -34.095 -7.675  1.00 34.40  ? 190 PHE B O   1 
ATOM   1114  C CB  . PHE A 1 195 ? 54.920  -33.023 -6.733  1.00 40.78  ? 190 PHE B CB  1 
ATOM   1115  C CG  . PHE A 1 195 ? 56.065  -33.186 -5.783  1.00 47.27  ? 190 PHE B CG  1 
ATOM   1116  C CD1 . PHE A 1 195 ? 56.965  -32.147 -5.569  1.00 50.82  ? 190 PHE B CD1 1 
ATOM   1117  C CD2 . PHE A 1 195 ? 56.252  -34.386 -5.102  1.00 50.18  ? 190 PHE B CD2 1 
ATOM   1118  C CE1 . PHE A 1 195 ? 58.035  -32.301 -4.689  1.00 52.29  ? 190 PHE B CE1 1 
ATOM   1119  C CE2 . PHE A 1 195 ? 57.319  -34.553 -4.219  1.00 51.49  ? 190 PHE B CE2 1 
ATOM   1120  C CZ  . PHE A 1 195 ? 58.211  -33.509 -4.012  1.00 52.33  ? 190 PHE B CZ  1 
ATOM   1121  N N   . MET A 1 196 ? 53.371  -34.082 -9.677  1.00 32.36  ? 191 MET B N   1 
ATOM   1122  C CA  . MET A 1 196 ? 52.116  -33.995 -10.411 1.00 31.40  ? 191 MET B CA  1 
ATOM   1123  C C   . MET A 1 196 ? 51.954  -35.151 -11.379 1.00 31.62  ? 191 MET B C   1 
ATOM   1124  O O   . MET A 1 196 ? 50.862  -35.710 -11.514 1.00 32.01  ? 191 MET B O   1 
ATOM   1125  C CB  . MET A 1 196 ? 52.061  -32.685 -11.197 1.00 30.55  ? 191 MET B CB  1 
ATOM   1126  C CG  . MET A 1 196 ? 51.845  -31.474 -10.336 1.00 32.67  ? 191 MET B CG  1 
ATOM   1127  S SD  . MET A 1 196 ? 50.245  -31.576 -9.522  1.00 35.25  ? 191 MET B SD  1 
ATOM   1128  C CE  . MET A 1 196 ? 49.174  -31.357 -10.956 1.00 33.19  ? 191 MET B CE  1 
ATOM   1129  N N   . SER A 1 197 ? 53.059  -35.488 -12.045 1.00 30.39  ? 192 SER B N   1 
ATOM   1130  C CA  . SER A 1 197 ? 53.131  -36.535 -13.056 1.00 29.87  ? 192 SER B CA  1 
ATOM   1131  C C   . SER A 1 197 ? 52.700  -35.898 -14.373 1.00 30.68  ? 192 SER B C   1 
ATOM   1132  O O   . SER A 1 197 ? 51.891  -34.970 -14.392 1.00 31.43  ? 192 SER B O   1 
ATOM   1133  C CB  . SER A 1 197 ? 52.216  -37.717 -12.723 1.00 30.13  ? 192 SER B CB  1 
ATOM   1134  O OG  . SER A 1 197 ? 50.937  -37.565 -13.316 1.00 32.51  ? 192 SER B OG  1 
ATOM   1135  N N   . PRO A 1 198 ? 53.237  -36.383 -15.495 1.00 30.01  ? 193 PRO B N   1 
ATOM   1136  C CA  . PRO A 1 198 ? 52.852  -35.794 -16.779 1.00 30.96  ? 193 PRO B CA  1 
ATOM   1137  C C   . PRO A 1 198 ? 51.354  -35.845 -17.080 1.00 30.81  ? 193 PRO B C   1 
ATOM   1138  O O   . PRO A 1 198 ? 50.869  -35.179 -18.002 1.00 32.46  ? 193 PRO B O   1 
ATOM   1139  C CB  . PRO A 1 198 ? 53.689  -36.589 -17.790 1.00 30.96  ? 193 PRO B CB  1 
ATOM   1140  C CG  . PRO A 1 198 ? 53.961  -37.898 -17.078 1.00 30.98  ? 193 PRO B CG  1 
ATOM   1141  C CD  . PRO A 1 198 ? 54.213  -37.474 -15.668 1.00 28.94  ? 193 PRO B CD  1 
ATOM   1142  N N   . TYR A 1 199 ? 50.618  -36.618 -16.292 1.00 29.81  ? 194 TYR B N   1 
ATOM   1143  C CA  . TYR A 1 199 ? 49.189  -36.762 -16.516 1.00 31.82  ? 194 TYR B CA  1 
ATOM   1144  C C   . TYR A 1 199 ? 48.372  -35.535 -16.129 1.00 31.97  ? 194 TYR B C   1 
ATOM   1145  O O   . TYR A 1 199 ? 47.372  -35.214 -16.778 1.00 30.51  ? 194 TYR B O   1 
ATOM   1146  C CB  . TYR A 1 199 ? 48.655  -37.970 -15.745 1.00 32.05  ? 194 TYR B CB  1 
ATOM   1147  C CG  . TYR A 1 199 ? 47.181  -38.224 -15.992 1.00 33.51  ? 194 TYR B CG  1 
ATOM   1148  C CD1 . TYR A 1 199 ? 46.737  -38.686 -17.226 1.00 33.91  ? 194 TYR B CD1 1 
ATOM   1149  C CD2 . TYR A 1 199 ? 46.229  -38.008 -14.988 1.00 32.53  ? 194 TYR B CD2 1 
ATOM   1150  C CE1 . TYR A 1 199 ? 45.382  -38.932 -17.457 1.00 35.40  ? 194 TYR B CE1 1 
ATOM   1151  C CE2 . TYR A 1 199 ? 44.870  -38.252 -15.211 1.00 31.90  ? 194 TYR B CE2 1 
ATOM   1152  C CZ  . TYR A 1 199 ? 44.458  -38.715 -16.446 1.00 33.57  ? 194 TYR B CZ  1 
ATOM   1153  O OH  . TYR A 1 199 ? 43.130  -38.974 -16.688 1.00 34.95  ? 194 TYR B OH  1 
ATOM   1154  N N   . PHE A 1 200 ? 48.805  -34.862 -15.067 1.00 32.35  ? 195 PHE B N   1 
ATOM   1155  C CA  . PHE A 1 200 ? 48.114  -33.690 -14.536 1.00 31.97  ? 195 PHE B CA  1 
ATOM   1156  C C   . PHE A 1 200 ? 48.823  -32.372 -14.811 1.00 32.79  ? 195 PHE B C   1 
ATOM   1157  O O   . PHE A 1 200 ? 48.298  -31.309 -14.493 1.00 33.71  ? 195 PHE B O   1 
ATOM   1158  C CB  . PHE A 1 200 ? 47.964  -33.821 -13.020 1.00 31.50  ? 195 PHE B CB  1 
ATOM   1159  C CG  . PHE A 1 200 ? 46.959  -34.845 -12.579 1.00 30.20  ? 195 PHE B CG  1 
ATOM   1160  C CD1 . PHE A 1 200 ? 47.251  -35.700 -11.515 1.00 29.03  ? 195 PHE B CD1 1 
ATOM   1161  C CD2 . PHE A 1 200 ? 45.703  -34.915 -13.169 1.00 28.86  ? 195 PHE B CD2 1 
ATOM   1162  C CE1 . PHE A 1 200 ? 46.302  -36.606 -11.045 1.00 28.51  ? 195 PHE B CE1 1 
ATOM   1163  C CE2 . PHE A 1 200 ? 44.745  -35.821 -12.700 1.00 29.36  ? 195 PHE B CE2 1 
ATOM   1164  C CZ  . PHE A 1 200 ? 45.045  -36.667 -11.636 1.00 26.93  ? 195 PHE B CZ  1 
ATOM   1165  N N   . GLN A 1 201 ? 50.018  -32.424 -15.376 1.00 32.97  ? 196 GLN B N   1 
ATOM   1166  C CA  . GLN A 1 201 ? 50.733  -31.191 -15.634 1.00 33.95  ? 196 GLN B CA  1 
ATOM   1167  C C   . GLN A 1 201 ? 51.699  -31.356 -16.793 1.00 36.17  ? 196 GLN B C   1 
ATOM   1168  O O   . GLN A 1 201 ? 52.396  -32.370 -16.899 1.00 37.46  ? 196 GLN B O   1 
ATOM   1169  C CB  . GLN A 1 201 ? 51.478  -30.770 -14.375 1.00 35.67  ? 196 GLN B CB  1 
ATOM   1170  C CG  . GLN A 1 201 ? 51.861  -29.310 -14.339 1.00 39.87  ? 196 GLN B CG  1 
ATOM   1171  C CD  . GLN A 1 201 ? 52.670  -28.949 -13.108 1.00 40.93  ? 196 GLN B CD  1 
ATOM   1172  O OE1 . GLN A 1 201 ? 52.741  -27.785 -12.717 1.00 44.29  ? 196 GLN B OE1 1 
ATOM   1173  N NE2 . GLN A 1 201 ? 53.296  -29.946 -12.497 1.00 41.78  ? 196 GLN B NE2 1 
ATOM   1174  N N   . ARG A 1 202 ? 51.735  -30.355 -17.667 1.00 36.59  ? 197 ARG B N   1 
ATOM   1175  C CA  . ARG A 1 202 ? 52.607  -30.395 -18.833 1.00 37.17  ? 197 ARG B CA  1 
ATOM   1176  C C   . ARG A 1 202 ? 53.484  -29.139 -18.916 1.00 37.45  ? 197 ARG B C   1 
ATOM   1177  O O   . ARG A 1 202 ? 53.252  -28.247 -19.730 1.00 39.22  ? 197 ARG B O   1 
ATOM   1178  C CB  . ARG A 1 202 ? 51.757  -30.560 -20.098 1.00 34.69  ? 197 ARG B CB  1 
ATOM   1179  C CG  . ARG A 1 202 ? 52.564  -30.739 -21.355 1.00 35.10  ? 197 ARG B CG  1 
ATOM   1180  C CD  . ARG A 1 202 ? 51.695  -31.236 -22.489 1.00 36.56  ? 197 ARG B CD  1 
ATOM   1181  N NE  . ARG A 1 202 ? 51.374  -32.656 -22.380 1.00 34.16  ? 197 ARG B NE  1 
ATOM   1182  C CZ  . ARG A 1 202 ? 50.558  -33.293 -23.214 1.00 33.81  ? 197 ARG B CZ  1 
ATOM   1183  N NH1 . ARG A 1 202 ? 49.978  -32.630 -24.208 1.00 33.96  ? 197 ARG B NH1 1 
ATOM   1184  N NH2 . ARG A 1 202 ? 50.336  -34.594 -23.072 1.00 34.00  ? 197 ARG B NH2 1 
ATOM   1185  N N   . PRO A 1 203 ? 54.517  -29.070 -18.067 1.00 37.44  ? 198 PRO B N   1 
ATOM   1186  C CA  . PRO A 1 203 ? 55.469  -27.959 -17.982 1.00 37.41  ? 198 PRO B CA  1 
ATOM   1187  C C   . PRO A 1 203 ? 55.882  -27.363 -19.319 1.00 37.21  ? 198 PRO B C   1 
ATOM   1188  O O   . PRO A 1 203 ? 55.917  -26.151 -19.472 1.00 38.19  ? 198 PRO B O   1 
ATOM   1189  C CB  . PRO A 1 203 ? 56.646  -28.576 -17.244 1.00 37.38  ? 198 PRO B CB  1 
ATOM   1190  C CG  . PRO A 1 203 ? 55.972  -29.521 -16.320 1.00 38.44  ? 198 PRO B CG  1 
ATOM   1191  C CD  . PRO A 1 203 ? 54.928  -30.176 -17.185 1.00 36.95  ? 198 PRO B CD  1 
ATOM   1192  N N   . LEU A 1 204 ? 56.204  -28.214 -20.283 1.00 38.37  ? 199 LEU B N   1 
ATOM   1193  C CA  . LEU A 1 204 ? 56.615  -27.743 -21.605 1.00 39.60  ? 199 LEU B CA  1 
ATOM   1194  C C   . LEU A 1 204 ? 55.525  -26.953 -22.335 1.00 39.26  ? 199 LEU B C   1 
ATOM   1195  O O   . LEU A 1 204 ? 55.821  -26.020 -23.074 1.00 41.07  ? 199 LEU B O   1 
ATOM   1196  C CB  . LEU A 1 204 ? 57.055  -28.924 -22.480 1.00 37.80  ? 199 LEU B CB  1 
ATOM   1197  C CG  . LEU A 1 204 ? 58.322  -29.673 -22.077 1.00 35.03  ? 199 LEU B CG  1 
ATOM   1198  C CD1 . LEU A 1 204 ? 58.537  -30.806 -23.034 1.00 33.21  ? 199 LEU B CD1 1 
ATOM   1199  C CD2 . LEU A 1 204 ? 59.510  -28.742 -22.091 1.00 34.78  ? 199 LEU B CD2 1 
ATOM   1200  N N   . ALA A 1 205 ? 54.269  -27.331 -22.138 1.00 38.73  ? 200 ALA B N   1 
ATOM   1201  C CA  . ALA A 1 205 ? 53.167  -26.635 -22.788 1.00 38.33  ? 200 ALA B CA  1 
ATOM   1202  C C   . ALA A 1 205 ? 52.871  -25.320 -22.087 1.00 39.97  ? 200 ALA B C   1 
ATOM   1203  O O   . ALA A 1 205 ? 52.104  -24.504 -22.597 1.00 41.68  ? 200 ALA B O   1 
ATOM   1204  C CB  . ALA A 1 205 ? 51.929  -27.504 -22.781 1.00 36.64  ? 200 ALA B CB  1 
ATOM   1205  N N   . LEU A 1 206 ? 53.480  -25.116 -20.920 1.00 40.49  ? 201 LEU B N   1 
ATOM   1206  C CA  . LEU A 1 206 ? 53.262  -23.900 -20.139 1.00 40.08  ? 201 LEU B CA  1 
ATOM   1207  C C   . LEU A 1 206 ? 54.467  -22.965 -20.152 1.00 41.33  ? 201 LEU B C   1 
ATOM   1208  O O   . LEU A 1 206 ? 54.551  -22.050 -19.334 1.00 41.15  ? 201 LEU B O   1 
ATOM   1209  C CB  . LEU A 1 206 ? 52.919  -24.250 -18.686 1.00 39.88  ? 201 LEU B CB  1 
ATOM   1210  C CG  . LEU A 1 206 ? 51.687  -25.115 -18.398 1.00 39.61  ? 201 LEU B CG  1 
ATOM   1211  C CD1 . LEU A 1 206 ? 51.747  -25.569 -16.954 1.00 41.45  ? 201 LEU B CD1 1 
ATOM   1212  C CD2 . LEU A 1 206 ? 50.409  -24.354 -18.656 1.00 37.84  ? 201 LEU B CD2 1 
ATOM   1213  N N   . GLY A 1 207 ? 55.403  -23.201 -21.067 1.00 41.43  ? 202 GLY B N   1 
ATOM   1214  C CA  . GLY A 1 207 ? 56.562  -22.333 -21.155 1.00 42.87  ? 202 GLY B CA  1 
ATOM   1215  C C   . GLY A 1 207 ? 57.906  -22.923 -20.776 1.00 43.21  ? 202 GLY B C   1 
ATOM   1216  O O   . GLY A 1 207 ? 58.931  -22.540 -21.327 1.00 44.18  ? 202 GLY B O   1 
ATOM   1217  N N   . ALA A 1 208 ? 57.914  -23.850 -19.832 1.00 44.68  ? 203 ALA B N   1 
ATOM   1218  C CA  . ALA A 1 208 ? 59.161  -24.469 -19.395 1.00 45.10  ? 203 ALA B CA  1 
ATOM   1219  C C   . ALA A 1 208 ? 59.977  -25.024 -20.551 1.00 43.72  ? 203 ALA B C   1 
ATOM   1220  O O   . ALA A 1 208 ? 59.422  -25.494 -21.546 1.00 42.77  ? 203 ALA B O   1 
ATOM   1221  C CB  . ALA A 1 208 ? 58.862  -25.584 -18.404 1.00 47.23  ? 203 ALA B CB  1 
ATOM   1222  N N   . ASP A 1 209 ? 61.298  -24.964 -20.410 1.00 42.45  ? 204 ASP B N   1 
ATOM   1223  C CA  . ASP A 1 209 ? 62.199  -25.490 -21.424 1.00 42.89  ? 204 ASP B CA  1 
ATOM   1224  C C   . ASP A 1 209 ? 62.369  -26.989 -21.174 1.00 40.96  ? 204 ASP B C   1 
ATOM   1225  O O   . ASP A 1 209 ? 62.331  -27.794 -22.104 1.00 40.10  ? 204 ASP B O   1 
ATOM   1226  C CB  . ASP A 1 209 ? 63.577  -24.808 -21.351 1.00 45.07  ? 204 ASP B CB  1 
ATOM   1227  C CG  . ASP A 1 209 ? 63.522  -23.316 -21.671 1.00 48.61  ? 204 ASP B CG  1 
ATOM   1228  O OD1 . ASP A 1 209 ? 62.928  -22.940 -22.709 1.00 49.31  ? 204 ASP B OD1 1 
ATOM   1229  O OD2 . ASP A 1 209 ? 64.089  -22.517 -20.887 1.00 50.68  ? 204 ASP B OD2 1 
ATOM   1230  N N   . ILE A 1 210 ? 62.542  -27.350 -19.903 1.00 39.93  ? 205 ILE B N   1 
ATOM   1231  C CA  . ILE A 1 210 ? 62.744  -28.741 -19.498 1.00 38.80  ? 205 ILE B CA  1 
ATOM   1232  C C   . ILE A 1 210 ? 61.771  -29.243 -18.426 1.00 37.90  ? 205 ILE B C   1 
ATOM   1233  O O   . ILE A 1 210 ? 61.583  -28.603 -17.384 1.00 37.62  ? 205 ILE B O   1 
ATOM   1234  C CB  . ILE A 1 210 ? 64.178  -28.948 -18.961 1.00 36.88  ? 205 ILE B CB  1 
ATOM   1235  C CG1 . ILE A 1 210 ? 65.194  -28.483 -20.001 1.00 35.17  ? 205 ILE B CG1 1 
ATOM   1236  C CG2 . ILE A 1 210 ? 64.402  -30.411 -18.625 1.00 36.40  ? 205 ILE B CG2 1 
ATOM   1237  C CD1 . ILE A 1 210 ? 66.625  -28.579 -19.525 1.00 38.77  ? 205 ILE B CD1 1 
ATOM   1238  N N   . SER A 1 211 ? 61.158  -30.392 -18.700 1.00 37.97  ? 206 SER B N   1 
ATOM   1239  C CA  . SER A 1 211 ? 60.231  -31.028 -17.769 1.00 39.21  ? 206 SER B CA  1 
ATOM   1240  C C   . SER A 1 211 ? 60.895  -32.315 -17.288 1.00 39.03  ? 206 SER B C   1 
ATOM   1241  O O   . SER A 1 211 ? 61.051  -33.263 -18.058 1.00 38.99  ? 206 SER B O   1 
ATOM   1242  C CB  . SER A 1 211 ? 58.911  -31.359 -18.465 1.00 39.58  ? 206 SER B CB  1 
ATOM   1243  O OG  . SER A 1 211 ? 58.023  -32.004 -17.568 1.00 39.59  ? 206 SER B OG  1 
ATOM   1244  N N   . MET A 1 212 ? 61.284  -32.345 -16.017 1.00 40.10  ? 207 MET B N   1 
ATOM   1245  C CA  . MET A 1 212 ? 61.958  -33.509 -15.442 1.00 42.34  ? 207 MET B CA  1 
ATOM   1246  C C   . MET A 1 212 ? 61.046  -34.310 -14.518 1.00 43.53  ? 207 MET B C   1 
ATOM   1247  O O   . MET A 1 212 ? 60.667  -33.835 -13.459 1.00 44.08  ? 207 MET B O   1 
ATOM   1248  C CB  . MET A 1 212 ? 63.208  -33.051 -14.678 1.00 41.87  ? 207 MET B CB  1 
ATOM   1249  C CG  . MET A 1 212 ? 64.112  -34.166 -14.166 1.00 43.71  ? 207 MET B CG  1 
ATOM   1250  S SD  . MET A 1 212 ? 63.481  -35.022 -12.701 1.00 45.01  ? 207 MET B SD  1 
ATOM   1251  C CE  . MET A 1 212 ? 64.409  -34.172 -11.386 1.00 43.01  ? 207 MET B CE  1 
ATOM   1252  N N   . TYR A 1 213 ? 60.692  -35.521 -14.932 1.00 46.43  ? 208 TYR B N   1 
ATOM   1253  C CA  . TYR A 1 213 ? 59.833  -36.393 -14.134 1.00 49.41  ? 208 TYR B CA  1 
ATOM   1254  C C   . TYR A 1 213 ? 60.701  -37.466 -13.489 1.00 48.80  ? 208 TYR B C   1 
ATOM   1255  O O   . TYR A 1 213 ? 61.309  -38.286 -14.178 1.00 50.71  ? 208 TYR B O   1 
ATOM   1256  C CB  . TYR A 1 213 ? 58.776  -37.052 -15.022 1.00 52.38  ? 208 TYR B CB  1 
ATOM   1257  C CG  . TYR A 1 213 ? 57.812  -37.935 -14.268 1.00 55.67  ? 208 TYR B CG  1 
ATOM   1258  C CD1 . TYR A 1 213 ? 57.169  -37.469 -13.120 1.00 56.84  ? 208 TYR B CD1 1 
ATOM   1259  C CD2 . TYR A 1 213 ? 57.513  -39.224 -14.717 1.00 56.88  ? 208 TYR B CD2 1 
ATOM   1260  C CE1 . TYR A 1 213 ? 56.250  -38.258 -12.436 1.00 57.64  ? 208 TYR B CE1 1 
ATOM   1261  C CE2 . TYR A 1 213 ? 56.589  -40.026 -14.037 1.00 58.41  ? 208 TYR B CE2 1 
ATOM   1262  C CZ  . TYR A 1 213 ? 55.961  -39.531 -12.897 1.00 58.54  ? 208 TYR B CZ  1 
ATOM   1263  O OH  . TYR A 1 213 ? 55.036  -40.296 -12.220 1.00 59.82  ? 208 TYR B OH  1 
ATOM   1264  N N   . SER A 1 214 ? 60.757  -37.467 -12.167 1.00 45.10  ? 209 SER B N   1 
ATOM   1265  C CA  . SER A 1 214 ? 61.586  -38.433 -11.465 1.00 45.68  ? 209 SER B CA  1 
ATOM   1266  C C   . SER A 1 214 ? 60.773  -39.382 -10.625 1.00 47.86  ? 209 SER B C   1 
ATOM   1267  O O   . SER A 1 214 ? 60.224  -38.968 -9.609  1.00 45.31  ? 209 SER B O   1 
ATOM   1268  C CB  . SER A 1 214 ? 62.565  -37.700 -10.557 1.00 48.14  ? 209 SER B CB  1 
ATOM   1269  O OG  . SER A 1 214 ? 62.842  -38.477 -9.404  1.00 50.27  ? 209 SER B OG  1 
ATOM   1270  N N   . ALA A 1 215 ? 60.717  -40.654 -11.006 1.00 40.27  ? 210 ALA B N   1 
ATOM   1271  C CA  . ALA A 1 215 ? 59.937  -41.603 -10.221 1.00 38.88  ? 210 ALA B CA  1 
ATOM   1272  C C   . ALA A 1 215 ? 60.781  -42.534 -9.349  1.00 36.66  ? 210 ALA B C   1 
ATOM   1273  O O   . ALA A 1 215 ? 61.801  -43.068 -9.777  1.00 37.91  ? 210 ALA B O   1 
ATOM   1274  C CB  . ALA A 1 215 ? 59.048  -42.414 -11.123 1.00 35.62  ? 210 ALA B CB  1 
ATOM   1275  N N   . THR A 1 216 ? 60.303  -42.750 -8.129  1.00 44.56  ? 211 THR B N   1 
ATOM   1276  C CA  . THR A 1 216 ? 60.978  -43.597 -7.147  1.00 44.34  ? 211 THR B CA  1 
ATOM   1277  C C   . THR A 1 216 ? 60.454  -45.032 -7.091  1.00 40.95  ? 211 THR B C   1 
ATOM   1278  O O   . THR A 1 216 ? 59.530  -45.404 -7.812  1.00 42.70  ? 211 THR B O   1 
ATOM   1279  C CB  . THR A 1 216 ? 60.843  -42.989 -5.741  1.00 43.14  ? 211 THR B CB  1 
ATOM   1280  O OG1 . THR A 1 216 ? 59.465  -43.008 -5.342  1.00 42.43  ? 211 THR B OG1 1 
ATOM   1281  C CG2 . THR A 1 216 ? 61.332  -41.549 -5.757  1.00 45.27  ? 211 THR B CG2 1 
ATOM   1282  N N   . LYS A 1 217 ? 61.059  -45.825 -6.212  1.00 42.56  ? 212 LYS B N   1 
ATOM   1283  C CA  . LYS A 1 217 ? 60.687  -47.218 -6.020  1.00 43.78  ? 212 LYS B CA  1 
ATOM   1284  C C   . LYS A 1 217 ? 59.308  -47.332 -5.368  1.00 45.06  ? 212 LYS B C   1 
ATOM   1285  O O   . LYS A 1 217 ? 58.942  -48.396 -4.871  1.00 44.17  ? 212 LYS B O   1 
ATOM   1286  C CB  . LYS A 1 217 ? 61.712  -47.893 -5.111  1.00 42.06  ? 212 LYS B CB  1 
ATOM   1287  C CG  . LYS A 1 217 ? 61.761  -47.260 -3.723  1.00 42.38  ? 212 LYS B CG  1 
ATOM   1288  C CD  . LYS A 1 217 ? 62.813  -47.870 -2.808  1.00 43.19  ? 212 LYS B CD  1 
ATOM   1289  C CE  . LYS A 1 217 ? 62.863  -47.128 -1.465  1.00 43.23  ? 212 LYS B CE  1 
ATOM   1290  N NZ  . LYS A 1 217 ? 63.974  -47.587 -0.565  1.00 45.46  ? 212 LYS B NZ  1 
ATOM   1291  N N   . TYR A 1 218 ? 58.533  -46.252 -5.376  1.00 47.69  ? 213 TYR B N   1 
ATOM   1292  C CA  . TYR A 1 218 ? 57.241  -46.290 -4.711  1.00 49.24  ? 213 TYR B CA  1 
ATOM   1293  C C   . TYR A 1 218 ? 55.944  -46.364 -5.504  1.00 50.89  ? 213 TYR B C   1 
ATOM   1294  O O   . TYR A 1 218 ? 54.993  -46.957 -4.997  1.00 52.64  ? 213 TYR B O   1 
ATOM   1295  C CB  . TYR A 1 218 ? 57.139  -45.138 -3.706  1.00 49.71  ? 213 TYR B CB  1 
ATOM   1296  C CG  . TYR A 1 218 ? 58.118  -45.243 -2.557  1.00 50.17  ? 213 TYR B CG  1 
ATOM   1297  C CD1 . TYR A 1 218 ? 59.252  -44.432 -2.502  1.00 51.09  ? 213 TYR B CD1 1 
ATOM   1298  C CD2 . TYR A 1 218 ? 57.922  -46.171 -1.532  1.00 51.55  ? 213 TYR B CD2 1 
ATOM   1299  C CE1 . TYR A 1 218 ? 60.174  -44.538 -1.453  1.00 50.87  ? 213 TYR B CE1 1 
ATOM   1300  C CE2 . TYR A 1 218 ? 58.836  -46.290 -0.478  1.00 51.07  ? 213 TYR B CE2 1 
ATOM   1301  C CZ  . TYR A 1 218 ? 59.960  -45.471 -0.444  1.00 51.92  ? 213 TYR B CZ  1 
ATOM   1302  O OH  . TYR A 1 218 ? 60.863  -45.587 0.595   1.00 50.82  ? 213 TYR B OH  1 
ATOM   1303  N N   . MET A 1 219 ? 55.850  -45.780 -6.703  1.00 51.64  ? 214 MET B N   1 
ATOM   1304  C CA  . MET A 1 219 ? 54.568  -45.889 -7.422  1.00 52.10  ? 214 MET B CA  1 
ATOM   1305  C C   . MET A 1 219 ? 54.469  -47.128 -8.297  1.00 53.83  ? 214 MET B C   1 
ATOM   1306  O O   . MET A 1 219 ? 55.441  -47.869 -8.479  1.00 52.17  ? 214 MET B O   1 
ATOM   1307  C CB  . MET A 1 219 ? 54.230  -44.643 -8.263  1.00 47.99  ? 214 MET B CB  1 
ATOM   1308  C CG  . MET A 1 219 ? 52.773  -44.670 -8.882  1.00 38.58  ? 214 MET B CG  1 
ATOM   1309  S SD  . MET A 1 219 ? 51.347  -44.639 -7.718  1.00 25.17  ? 214 MET B SD  1 
ATOM   1310  C CE  . MET A 1 219 ? 50.505  -46.048 -8.041  1.00 24.19  ? 214 MET B CE  1 
ATOM   1311  N N   . ASN A 1 220 ? 53.274  -47.327 -8.839  1.00 55.88  ? 215 ASN B N   1 
ATOM   1312  C CA  . ASN A 1 220 ? 52.975  -48.491 -9.640  1.00 58.32  ? 215 ASN B CA  1 
ATOM   1313  C C   . ASN A 1 220 ? 53.159  -49.582 -8.600  1.00 59.10  ? 215 ASN B C   1 
ATOM   1314  O O   . ASN A 1 220 ? 53.890  -50.548 -8.812  1.00 60.38  ? 215 ASN B O   1 
ATOM   1315  C CB  . ASN A 1 220 ? 53.976  -48.655 -10.779 1.00 59.83  ? 215 ASN B CB  1 
ATOM   1316  C CG  . ASN A 1 220 ? 53.503  -49.652 -11.811 1.00 63.41  ? 215 ASN B CG  1 
ATOM   1317  O OD1 . ASN A 1 220 ? 52.466  -49.457 -12.439 1.00 65.86  ? 215 ASN B OD1 1 
ATOM   1318  N ND2 . ASN A 1 220 ? 54.254  -50.735 -11.987 1.00 67.29  ? 215 ASN B ND2 1 
ATOM   1319  N N   . GLY A 1 221 ? 52.495  -49.398 -7.459  1.00 58.59  ? 216 GLY B N   1 
ATOM   1320  C CA  . GLY A 1 221 ? 52.613  -50.345 -6.366  1.00 57.62  ? 216 GLY B CA  1 
ATOM   1321  C C   . GLY A 1 221 ? 54.000  -50.102 -5.828  1.00 57.21  ? 216 GLY B C   1 
ATOM   1322  O O   . GLY A 1 221 ? 54.588  -49.061 -6.108  1.00 57.63  ? 216 GLY B O   1 
ATOM   1323  N N   . HIS A 1 222 ? 54.547  -51.030 -5.061  1.00 56.23  ? 217 HIS B N   1 
ATOM   1324  C CA  . HIS A 1 222 ? 55.894  -50.814 -4.565  1.00 54.85  ? 217 HIS B CA  1 
ATOM   1325  C C   . HIS A 1 222 ? 56.836  -51.457 -5.590  1.00 54.85  ? 217 HIS B C   1 
ATOM   1326  O O   . HIS A 1 222 ? 57.628  -52.339 -5.264  1.00 54.75  ? 217 HIS B O   1 
ATOM   1327  C CB  . HIS A 1 222 ? 56.059  -51.446 -3.179  1.00 54.93  ? 217 HIS B CB  1 
ATOM   1328  C CG  . HIS A 1 222 ? 57.189  -50.868 -2.382  1.00 54.58  ? 217 HIS B CG  1 
ATOM   1329  N ND1 . HIS A 1 222 ? 58.507  -50.949 -2.783  1.00 53.80  ? 217 HIS B ND1 1 
ATOM   1330  C CD2 . HIS A 1 222 ? 57.196  -50.191 -1.209  1.00 54.02  ? 217 HIS B CD2 1 
ATOM   1331  C CE1 . HIS A 1 222 ? 59.277  -50.348 -1.895  1.00 52.19  ? 217 HIS B CE1 1 
ATOM   1332  N NE2 . HIS A 1 222 ? 58.506  -49.880 -0.929  1.00 54.58  ? 217 HIS B NE2 1 
ATOM   1333  N N   . SER A 1 223 ? 56.709  -51.026 -6.842  1.00 54.70  ? 218 SER B N   1 
ATOM   1334  C CA  . SER A 1 223 ? 57.533  -51.524 -7.942  1.00 54.21  ? 218 SER B CA  1 
ATOM   1335  C C   . SER A 1 223 ? 58.882  -50.860 -7.725  1.00 54.05  ? 218 SER B C   1 
ATOM   1336  O O   . SER A 1 223 ? 58.979  -49.635 -7.786  1.00 57.04  ? 218 SER B O   1 
ATOM   1337  C CB  . SER A 1 223 ? 56.935  -51.078 -9.277  1.00 55.43  ? 218 SER B CB  1 
ATOM   1338  O OG  . SER A 1 223 ? 57.526  -51.764 -10.360 1.00 59.21  ? 218 SER B OG  1 
ATOM   1339  N N   . ASP A 1 224 ? 59.921  -51.646 -7.472  1.00 50.69  ? 219 ASP B N   1 
ATOM   1340  C CA  . ASP A 1 224 ? 61.219  -51.059 -7.189  1.00 47.98  ? 219 ASP B CA  1 
ATOM   1341  C C   . ASP A 1 224 ? 62.008  -50.549 -8.383  1.00 45.85  ? 219 ASP B C   1 
ATOM   1342  O O   . ASP A 1 224 ? 63.189  -50.865 -8.554  1.00 47.15  ? 219 ASP B O   1 
ATOM   1343  C CB  . ASP A 1 224 ? 62.059  -52.032 -6.381  1.00 50.11  ? 219 ASP B CB  1 
ATOM   1344  C CG  . ASP A 1 224 ? 61.406  -52.403 -5.069  1.00 51.14  ? 219 ASP B CG  1 
ATOM   1345  O OD1 . ASP A 1 224 ? 60.588  -53.345 -5.064  1.00 53.42  ? 219 ASP B OD1 1 
ATOM   1346  O OD2 . ASP A 1 224 ? 61.698  -51.746 -4.045  1.00 53.45  ? 219 ASP B OD2 1 
ATOM   1347  N N   . VAL A 1 225 ? 61.343  -49.728 -9.186  1.00 41.92  ? 220 VAL B N   1 
ATOM   1348  C CA  . VAL A 1 225 ? 61.935  -49.129 -10.363 1.00 37.91  ? 220 VAL B CA  1 
ATOM   1349  C C   . VAL A 1 225 ? 62.264  -47.669 -10.090 1.00 38.84  ? 220 VAL B C   1 
ATOM   1350  O O   . VAL A 1 225 ? 61.401  -46.885 -9.693  1.00 37.87  ? 220 VAL B O   1 
ATOM   1351  C CB  . VAL A 1 225 ? 60.964  -49.200 -11.554 1.00 36.62  ? 220 VAL B CB  1 
ATOM   1352  C CG1 . VAL A 1 225 ? 61.448  -48.311 -12.684 1.00 32.80  ? 220 VAL B CG1 1 
ATOM   1353  C CG2 . VAL A 1 225 ? 60.833  -50.634 -12.016 1.00 34.93  ? 220 VAL B CG2 1 
ATOM   1354  N N   . VAL A 1 226 ? 63.526  -47.312 -10.287 1.00 39.30  ? 221 VAL B N   1 
ATOM   1355  C CA  . VAL A 1 226 ? 63.959  -45.936 -10.098 1.00 37.56  ? 221 VAL B CA  1 
ATOM   1356  C C   . VAL A 1 226 ? 64.246  -45.433 -11.500 1.00 37.61  ? 221 VAL B C   1 
ATOM   1357  O O   . VAL A 1 226 ? 64.701  -46.203 -12.364 1.00 37.94  ? 221 VAL B O   1 
ATOM   1358  C CB  . VAL A 1 226 ? 65.227  -45.848 -9.253  1.00 36.93  ? 221 VAL B CB  1 
ATOM   1359  C CG1 . VAL A 1 226 ? 65.594  -44.395 -9.029  1.00 36.40  ? 221 VAL B CG1 1 
ATOM   1360  C CG2 . VAL A 1 226 ? 65.009  -46.559 -7.933  1.00 36.47  ? 221 VAL B CG2 1 
ATOM   1361  N N   . MET A 1 227 ? 63.991  -44.147 -11.724 1.00 36.25  ? 222 MET B N   1 
ATOM   1362  C CA  . MET A 1 227 ? 64.165  -43.577 -13.046 1.00 33.52  ? 222 MET B CA  1 
ATOM   1363  C C   . MET A 1 227 ? 64.062  -42.076 -13.007 1.00 31.60  ? 222 MET B C   1 
ATOM   1364  O O   . MET A 1 227 ? 63.358  -41.511 -12.183 1.00 30.29  ? 222 MET B O   1 
ATOM   1365  C CB  . MET A 1 227 ? 63.059  -44.107 -13.969 1.00 34.19  ? 222 MET B CB  1 
ATOM   1366  C CG  . MET A 1 227 ? 63.191  -43.763 -15.442 1.00 34.04  ? 222 MET B CG  1 
ATOM   1367  S SD  . MET A 1 227 ? 64.317  -44.881 -16.251 1.00 37.80  ? 222 MET B SD  1 
ATOM   1368  C CE  . MET A 1 227 ? 63.308  -46.447 -16.214 1.00 34.06  ? 222 MET B CE  1 
ATOM   1369  N N   . GLY A 1 228 ? 64.764  -41.443 -13.933 1.00 32.11  ? 223 GLY B N   1 
ATOM   1370  C CA  . GLY A 1 228 ? 64.731  -40.004 -14.054 1.00 33.93  ? 223 GLY B CA  1 
ATOM   1371  C C   . GLY A 1 228 ? 64.491  -39.753 -15.528 1.00 34.47  ? 223 GLY B C   1 
ATOM   1372  O O   . GLY A 1 228 ? 65.313  -40.152 -16.356 1.00 36.43  ? 223 GLY B O   1 
ATOM   1373  N N   . LEU A 1 229 ? 63.369  -39.119 -15.861 1.00 33.37  ? 224 LEU B N   1 
ATOM   1374  C CA  . LEU A 1 229 ? 63.028  -38.838 -17.253 1.00 33.13  ? 224 LEU B CA  1 
ATOM   1375  C C   . LEU A 1 229 ? 63.119  -37.349 -17.544 1.00 32.57  ? 224 LEU B C   1 
ATOM   1376  O O   . LEU A 1 229 ? 62.547  -36.536 -16.825 1.00 33.88  ? 224 LEU B O   1 
ATOM   1377  C CB  . LEU A 1 229 ? 61.624  -39.360 -17.536 1.00 33.80  ? 224 LEU B CB  1 
ATOM   1378  C CG  . LEU A 1 229 ? 61.568  -40.865 -17.258 1.00 35.30  ? 224 LEU B CG  1 
ATOM   1379  C CD1 . LEU A 1 229 ? 60.145  -41.340 -17.112 1.00 36.22  ? 224 LEU B CD1 1 
ATOM   1380  C CD2 . LEU A 1 229 ? 62.274  -41.598 -18.380 1.00 37.09  ? 224 LEU B CD2 1 
ATOM   1381  N N   . VAL A 1 230 ? 63.843  -36.991 -18.597 1.00 31.67  ? 225 VAL B N   1 
ATOM   1382  C CA  . VAL A 1 230 ? 64.016  -35.590 -18.950 1.00 31.90  ? 225 VAL B CA  1 
ATOM   1383  C C   . VAL A 1 230 ? 63.505  -35.290 -20.354 1.00 32.43  ? 225 VAL B C   1 
ATOM   1384  O O   . VAL A 1 230 ? 64.184  -35.573 -21.334 1.00 32.22  ? 225 VAL B O   1 
ATOM   1385  C CB  . VAL A 1 230 ? 65.501  -35.188 -18.865 1.00 31.03  ? 225 VAL B CB  1 
ATOM   1386  C CG1 . VAL A 1 230 ? 65.655  -33.719 -19.154 1.00 30.04  ? 225 VAL B CG1 1 
ATOM   1387  C CG2 . VAL A 1 230 ? 66.046  -35.511 -17.494 1.00 30.53  ? 225 VAL B CG2 1 
ATOM   1388  N N   . SER A 1 231 ? 62.311  -34.707 -20.435 1.00 34.05  ? 226 SER B N   1 
ATOM   1389  C CA  . SER A 1 231 ? 61.691  -34.361 -21.712 1.00 36.22  ? 226 SER B CA  1 
ATOM   1390  C C   . SER A 1 231 ? 62.046  -32.952 -22.136 1.00 37.44  ? 226 SER B C   1 
ATOM   1391  O O   . SER A 1 231 ? 62.150  -32.051 -21.305 1.00 37.58  ? 226 SER B O   1 
ATOM   1392  C CB  . SER A 1 231 ? 60.172  -34.497 -21.627 1.00 36.59  ? 226 SER B CB  1 
ATOM   1393  O OG  . SER A 1 231 ? 59.800  -35.862 -21.619 1.00 37.32  ? 226 SER B OG  1 
ATOM   1394  N N   . VAL A 1 232 ? 62.193  -32.759 -23.443 1.00 39.54  ? 227 VAL B N   1 
ATOM   1395  C CA  . VAL A 1 232 ? 62.585  -31.461 -23.970 1.00 39.37  ? 227 VAL B CA  1 
ATOM   1396  C C   . VAL A 1 232 ? 62.155  -31.263 -25.431 1.00 39.95  ? 227 VAL B C   1 
ATOM   1397  O O   . VAL A 1 232 ? 61.868  -32.234 -26.139 1.00 40.28  ? 227 VAL B O   1 
ATOM   1398  C CB  . VAL A 1 232 ? 64.132  -31.321 -23.820 1.00 38.69  ? 227 VAL B CB  1 
ATOM   1399  C CG1 . VAL A 1 232 ? 64.803  -31.202 -25.174 1.00 37.47  ? 227 VAL B CG1 1 
ATOM   1400  C CG2 . VAL A 1 232 ? 64.460  -30.158 -22.919 1.00 38.48  ? 227 VAL B CG2 1 
ATOM   1401  N N   . ASN A 1 233 ? 62.103  -30.004 -25.867 1.00 41.78  ? 228 ASN B N   1 
ATOM   1402  C CA  . ASN A 1 233 ? 61.737  -29.664 -27.248 1.00 42.45  ? 228 ASN B CA  1 
ATOM   1403  C C   . ASN A 1 233 ? 62.898  -29.070 -28.039 1.00 45.27  ? 228 ASN B C   1 
ATOM   1404  O O   . ASN A 1 233 ? 63.121  -29.436 -29.195 1.00 46.57  ? 228 ASN B O   1 
ATOM   1405  C CB  . ASN A 1 233 ? 60.596  -28.660 -27.286 1.00 38.72  ? 228 ASN B CB  1 
ATOM   1406  C CG  . ASN A 1 233 ? 59.292  -29.254 -26.865 1.00 37.60  ? 228 ASN B CG  1 
ATOM   1407  O OD1 . ASN A 1 233 ? 58.932  -30.355 -27.288 1.00 36.89  ? 228 ASN B OD1 1 
ATOM   1408  N ND2 . ASN A 1 233 ? 58.552  -28.522 -26.039 1.00 36.57  ? 228 ASN B ND2 1 
ATOM   1409  N N   . CYS A 1 234 ? 63.627  -28.146 -27.416 1.00 48.15  ? 229 CYS B N   1 
ATOM   1410  C CA  . CYS A 1 234 ? 64.749  -27.491 -28.071 1.00 51.17  ? 229 CYS B CA  1 
ATOM   1411  C C   . CYS A 1 234 ? 65.739  -28.483 -28.632 1.00 52.14  ? 229 CYS B C   1 
ATOM   1412  O O   . CYS A 1 234 ? 66.153  -29.411 -27.953 1.00 51.99  ? 229 CYS B O   1 
ATOM   1413  C CB  . CYS A 1 234 ? 65.474  -26.560 -27.109 1.00 52.63  ? 229 CYS B CB  1 
ATOM   1414  S SG  . CYS A 1 234 ? 66.813  -25.653 -27.910 1.00 61.28  ? 229 CYS B SG  1 
ATOM   1415  N N   . GLU A 1 235 ? 66.130  -28.251 -29.878 1.00 56.11  ? 230 GLU B N   1 
ATOM   1416  C CA  . GLU A 1 235 ? 67.066  -29.110 -30.587 1.00 60.05  ? 230 GLU B CA  1 
ATOM   1417  C C   . GLU A 1 235 ? 68.440  -29.256 -29.930 1.00 60.15  ? 230 GLU B C   1 
ATOM   1418  O O   . GLU A 1 235 ? 68.855  -30.365 -29.597 1.00 60.81  ? 230 GLU B O   1 
ATOM   1419  C CB  . GLU A 1 235 ? 67.247  -28.597 -32.015 1.00 63.73  ? 230 GLU B CB  1 
ATOM   1420  C CG  . GLU A 1 235 ? 67.755  -29.650 -32.967 1.00 69.09  ? 230 GLU B CG  1 
ATOM   1421  C CD  . GLU A 1 235 ? 66.768  -30.779 -33.115 1.00 72.22  ? 230 GLU B CD  1 
ATOM   1422  O OE1 . GLU A 1 235 ? 67.147  -31.827 -33.674 1.00 75.62  ? 230 GLU B OE1 1 
ATOM   1423  O OE2 . GLU A 1 235 ? 65.609  -30.613 -32.673 1.00 73.17  ? 230 GLU B OE2 1 
ATOM   1424  N N   . SER A 1 236 ? 69.154  -28.149 -29.751 1.00 59.23  ? 231 SER B N   1 
ATOM   1425  C CA  . SER A 1 236 ? 70.478  -28.227 -29.150 1.00 58.76  ? 231 SER B CA  1 
ATOM   1426  C C   . SER A 1 236 ? 70.409  -28.637 -27.683 1.00 56.31  ? 231 SER B C   1 
ATOM   1427  O O   . SER A 1 236 ? 71.334  -29.262 -27.165 1.00 56.86  ? 231 SER B O   1 
ATOM   1428  C CB  . SER A 1 236 ? 71.214  -26.890 -29.290 1.00 61.17  ? 231 SER B CB  1 
ATOM   1429  O OG  . SER A 1 236 ? 70.575  -25.870 -28.542 1.00 66.39  ? 231 SER B OG  1 
ATOM   1430  N N   . LEU A 1 237 ? 69.316  -28.289 -27.010 1.00 53.10  ? 232 LEU B N   1 
ATOM   1431  C CA  . LEU A 1 237 ? 69.155  -28.649 -25.604 1.00 49.02  ? 232 LEU B CA  1 
ATOM   1432  C C   . LEU A 1 237 ? 69.173  -30.177 -25.531 1.00 47.81  ? 232 LEU B C   1 
ATOM   1433  O O   . LEU A 1 237 ? 69.850  -30.767 -24.689 1.00 45.79  ? 232 LEU B O   1 
ATOM   1434  C CB  . LEU A 1 237 ? 67.828  -28.095 -25.070 1.00 46.35  ? 232 LEU B CB  1 
ATOM   1435  C CG  . LEU A 1 237 ? 67.630  -28.028 -23.554 1.00 43.93  ? 232 LEU B CG  1 
ATOM   1436  C CD1 . LEU A 1 237 ? 68.859  -27.413 -22.900 1.00 44.11  ? 232 LEU B CD1 1 
ATOM   1437  C CD2 . LEU A 1 237 ? 66.381  -27.206 -23.235 1.00 41.65  ? 232 LEU B CD2 1 
ATOM   1438  N N   . HIS A 1 238 ? 68.440  -30.804 -26.449 1.00 46.89  ? 233 HIS B N   1 
ATOM   1439  C CA  . HIS A 1 238 ? 68.348  -32.256 -26.540 1.00 45.92  ? 233 HIS B CA  1 
ATOM   1440  C C   . HIS A 1 238 ? 69.672  -32.920 -26.913 1.00 47.97  ? 233 HIS B C   1 
ATOM   1441  O O   . HIS A 1 238 ? 70.029  -33.949 -26.342 1.00 48.86  ? 233 HIS B O   1 
ATOM   1442  C CB  . HIS A 1 238 ? 67.285  -32.640 -27.567 1.00 44.16  ? 233 HIS B CB  1 
ATOM   1443  C CG  . HIS A 1 238 ? 67.356  -34.068 -28.008 1.00 43.73  ? 233 HIS B CG  1 
ATOM   1444  N ND1 . HIS A 1 238 ? 67.320  -35.124 -27.123 1.00 44.41  ? 233 HIS B ND1 1 
ATOM   1445  C CD2 . HIS A 1 238 ? 67.457  -34.616 -29.243 1.00 42.75  ? 233 HIS B CD2 1 
ATOM   1446  C CE1 . HIS A 1 238 ? 67.397  -36.260 -27.792 1.00 43.57  ? 233 HIS B CE1 1 
ATOM   1447  N NE2 . HIS A 1 238 ? 67.481  -35.979 -29.080 1.00 42.97  ? 233 HIS B NE2 1 
ATOM   1448  N N   . ASN A 1 239 ? 70.391  -32.341 -27.876 1.00 50.04  ? 234 ASN B N   1 
ATOM   1449  C CA  . ASN A 1 239 ? 71.669  -32.894 -28.321 1.00 50.18  ? 234 ASN B CA  1 
ATOM   1450  C C   . ASN A 1 239 ? 72.717  -32.874 -27.224 1.00 49.18  ? 234 ASN B C   1 
ATOM   1451  O O   . ASN A 1 239 ? 73.471  -33.829 -27.075 1.00 50.58  ? 234 ASN B O   1 
ATOM   1452  C CB  . ASN A 1 239 ? 72.213  -32.125 -29.531 1.00 54.05  ? 234 ASN B CB  1 
ATOM   1453  C CG  . ASN A 1 239 ? 71.422  -32.383 -30.803 1.00 56.92  ? 234 ASN B CG  1 
ATOM   1454  O OD1 . ASN A 1 239 ? 71.078  -33.525 -31.122 1.00 58.57  ? 234 ASN B OD1 1 
ATOM   1455  N ND2 . ASN A 1 239 ? 71.149  -31.319 -31.549 1.00 58.87  ? 234 ASN B ND2 1 
ATOM   1456  N N   . ARG A 1 240 ? 72.777  -31.785 -26.467 1.00 47.32  ? 235 ARG B N   1 
ATOM   1457  C CA  . ARG A 1 240 ? 73.754  -31.677 -25.391 1.00 47.10  ? 235 ARG B CA  1 
ATOM   1458  C C   . ARG A 1 240 ? 73.426  -32.693 -24.302 1.00 47.07  ? 235 ARG B C   1 
ATOM   1459  O O   . ARG A 1 240 ? 74.319  -33.327 -23.730 1.00 47.45  ? 235 ARG B O   1 
ATOM   1460  C CB  . ARG A 1 240 ? 73.737  -30.263 -24.802 1.00 47.03  ? 235 ARG B CB  1 
ATOM   1461  C CG  . ARG A 1 240 ? 74.141  -29.168 -25.786 1.00 47.97  ? 235 ARG B CG  1 
ATOM   1462  C CD  . ARG A 1 240 ? 73.608  -27.794 -25.370 1.00 48.18  ? 235 ARG B CD  1 
ATOM   1463  N NE  . ARG A 1 240 ? 74.152  -27.334 -24.095 1.00 49.06  ? 235 ARG B NE  1 
ATOM   1464  C CZ  . ARG A 1 240 ? 73.787  -26.206 -23.492 1.00 50.08  ? 235 ARG B CZ  1 
ATOM   1465  N NH1 . ARG A 1 240 ? 72.871  -25.419 -24.049 1.00 51.07  ? 235 ARG B NH1 1 
ATOM   1466  N NH2 . ARG A 1 240 ? 74.343  -25.859 -22.334 1.00 49.66  ? 235 ARG B NH2 1 
ATOM   1467  N N   . LEU A 1 241 ? 72.133  -32.839 -24.029 1.00 46.05  ? 236 LEU B N   1 
ATOM   1468  C CA  . LEU A 1 241 ? 71.638  -33.755 -23.013 1.00 44.31  ? 236 LEU B CA  1 
ATOM   1469  C C   . LEU A 1 241 ? 71.916  -35.205 -23.397 1.00 46.47  ? 236 LEU B C   1 
ATOM   1470  O O   . LEU A 1 241 ? 72.227  -36.034 -22.535 1.00 46.57  ? 236 LEU B O   1 
ATOM   1471  C CB  . LEU A 1 241 ? 70.133  -33.532 -22.822 1.00 40.69  ? 236 LEU B CB  1 
ATOM   1472  C CG  . LEU A 1 241 ? 69.584  -32.939 -21.517 1.00 36.76  ? 236 LEU B CG  1 
ATOM   1473  C CD1 . LEU A 1 241 ? 70.638  -32.162 -20.755 1.00 34.42  ? 236 LEU B CD1 1 
ATOM   1474  C CD2 . LEU A 1 241 ? 68.412  -32.062 -21.853 1.00 34.04  ? 236 LEU B CD2 1 
ATOM   1475  N N   . ARG A 1 242 ? 71.807  -35.502 -24.694 1.00 48.41  ? 237 ARG B N   1 
ATOM   1476  C CA  . ARG A 1 242 ? 72.044  -36.851 -25.218 1.00 50.06  ? 237 ARG B CA  1 
ATOM   1477  C C   . ARG A 1 242 ? 73.534  -37.195 -25.115 1.00 47.81  ? 237 ARG B C   1 
ATOM   1478  O O   . ARG A 1 242 ? 73.899  -38.314 -24.748 1.00 47.60  ? 237 ARG B O   1 
ATOM   1479  C CB  . ARG A 1 242 ? 71.575  -36.946 -26.687 1.00 54.69  ? 237 ARG B CB  1 
ATOM   1480  C CG  . ARG A 1 242 ? 71.489  -38.366 -27.279 1.00 61.76  ? 237 ARG B CG  1 
ATOM   1481  C CD  . ARG A 1 242 ? 70.422  -39.223 -26.567 1.00 71.66  ? 237 ARG B CD  1 
ATOM   1482  N NE  . ARG A 1 242 ? 70.278  -40.575 -27.127 1.00 76.95  ? 237 ARG B NE  1 
ATOM   1483  C CZ  . ARG A 1 242 ? 69.511  -41.536 -26.607 1.00 78.01  ? 237 ARG B CZ  1 
ATOM   1484  N NH1 . ARG A 1 242 ? 68.806  -41.313 -25.504 1.00 77.76  ? 237 ARG B NH1 1 
ATOM   1485  N NH2 . ARG A 1 242 ? 69.446  -42.727 -27.192 1.00 78.92  ? 237 ARG B NH2 1 
ATOM   1486  N N   . PHE A 1 243 ? 74.392  -36.227 -25.432 1.00 45.10  ? 238 PHE B N   1 
ATOM   1487  C CA  . PHE A 1 243 ? 75.833  -36.442 -25.370 1.00 42.60  ? 238 PHE B CA  1 
ATOM   1488  C C   . PHE A 1 243 ? 76.225  -36.751 -23.939 1.00 41.45  ? 238 PHE B C   1 
ATOM   1489  O O   . PHE A 1 243 ? 77.021  -37.658 -23.680 1.00 40.18  ? 238 PHE B O   1 
ATOM   1490  C CB  . PHE A 1 243 ? 76.592  -35.198 -25.837 1.00 43.75  ? 238 PHE B CB  1 
ATOM   1491  C CG  . PHE A 1 243 ? 78.092  -35.324 -25.719 1.00 45.40  ? 238 PHE B CG  1 
ATOM   1492  C CD1 . PHE A 1 243 ? 78.801  -36.186 -26.553 1.00 44.86  ? 238 PHE B CD1 1 
ATOM   1493  C CD2 . PHE A 1 243 ? 78.789  -34.608 -24.748 1.00 45.13  ? 238 PHE B CD2 1 
ATOM   1494  C CE1 . PHE A 1 243 ? 80.174  -36.337 -26.423 1.00 44.70  ? 238 PHE B CE1 1 
ATOM   1495  C CE2 . PHE A 1 243 ? 80.163  -34.752 -24.608 1.00 46.20  ? 238 PHE B CE2 1 
ATOM   1496  C CZ  . PHE A 1 243 ? 80.859  -35.622 -25.449 1.00 46.65  ? 238 PHE B CZ  1 
ATOM   1497  N N   . LEU A 1 244 ? 75.666  -35.978 -23.013 1.00 40.86  ? 239 LEU B N   1 
ATOM   1498  C CA  . LEU A 1 244 ? 75.934  -36.162 -21.595 1.00 40.59  ? 239 LEU B CA  1 
ATOM   1499  C C   . LEU A 1 244 ? 75.443  -37.525 -21.137 1.00 41.55  ? 239 LEU B C   1 
ATOM   1500  O O   . LEU A 1 244 ? 76.147  -38.245 -20.434 1.00 39.77  ? 239 LEU B O   1 
ATOM   1501  C CB  . LEU A 1 244 ? 75.234  -35.080 -20.787 1.00 40.07  ? 239 LEU B CB  1 
ATOM   1502  C CG  . LEU A 1 244 ? 75.916  -33.714 -20.765 1.00 39.91  ? 239 LEU B CG  1 
ATOM   1503  C CD1 . LEU A 1 244 ? 75.071  -32.752 -19.920 1.00 39.76  ? 239 LEU B CD1 1 
ATOM   1504  C CD2 . LEU A 1 244 ? 77.334  -33.850 -20.184 1.00 37.86  ? 239 LEU B CD2 1 
ATOM   1505  N N   . GLN A 1 245 ? 74.227  -37.868 -21.551 1.00 43.30  ? 240 GLN B N   1 
ATOM   1506  C CA  . GLN A 1 245 ? 73.621  -39.142 -21.198 1.00 45.34  ? 240 GLN B CA  1 
ATOM   1507  C C   . GLN A 1 245 ? 74.534  -40.307 -21.548 1.00 48.11  ? 240 GLN B C   1 
ATOM   1508  O O   . GLN A 1 245 ? 74.806  -41.166 -20.710 1.00 50.19  ? 240 GLN B O   1 
ATOM   1509  C CB  . GLN A 1 245 ? 72.286  -39.322 -21.928 1.00 43.39  ? 240 GLN B CB  1 
ATOM   1510  C CG  . GLN A 1 245 ? 71.478  -40.543 -21.479 1.00 38.74  ? 240 GLN B CG  1 
ATOM   1511  C CD  . GLN A 1 245 ? 70.278  -40.817 -22.374 1.00 38.31  ? 240 GLN B CD  1 
ATOM   1512  O OE1 . GLN A 1 245 ? 69.378  -41.584 -22.018 1.00 36.56  ? 240 GLN B OE1 1 
ATOM   1513  N NE2 . GLN A 1 245 ? 70.264  -40.195 -23.550 1.00 38.80  ? 240 GLN B NE2 1 
ATOM   1514  N N   . ASN A 1 246 ? 75.011  -40.335 -22.785 1.00 50.39  ? 241 ASN B N   1 
ATOM   1515  C CA  . ASN A 1 246 ? 75.869  -41.426 -23.226 1.00 52.85  ? 241 ASN B CA  1 
ATOM   1516  C C   . ASN A 1 246 ? 77.321  -41.352 -22.761 1.00 52.35  ? 241 ASN B C   1 
ATOM   1517  O O   . ASN A 1 246 ? 77.927  -42.379 -22.457 1.00 53.37  ? 241 ASN B O   1 
ATOM   1518  C CB  . ASN A 1 246 ? 75.831  -41.537 -24.751 1.00 56.49  ? 241 ASN B CB  1 
ATOM   1519  C CG  . ASN A 1 246 ? 74.420  -41.704 -25.288 1.00 60.50  ? 241 ASN B CG  1 
ATOM   1520  O OD1 . ASN A 1 246 ? 73.653  -42.545 -24.813 1.00 62.12  ? 241 ASN B OD1 1 
ATOM   1521  N ND2 . ASN A 1 246 ? 74.073  -40.905 -26.291 1.00 63.27  ? 241 ASN B ND2 1 
ATOM   1522  N N   . SER A 1 247 ? 77.885  -40.151 -22.695 1.00 50.12  ? 242 SER B N   1 
ATOM   1523  C CA  . SER A 1 247 ? 79.278  -40.019 -22.287 1.00 47.60  ? 242 SER B CA  1 
ATOM   1524  C C   . SER A 1 247 ? 79.565  -40.190 -20.797 1.00 45.67  ? 242 SER B C   1 
ATOM   1525  O O   . SER A 1 247 ? 80.706  -40.463 -20.436 1.00 47.90  ? 242 SER B O   1 
ATOM   1526  C CB  . SER A 1 247 ? 79.853  -38.674 -22.770 1.00 48.76  ? 242 SER B CB  1 
ATOM   1527  O OG  . SER A 1 247 ? 79.095  -37.569 -22.303 1.00 49.31  ? 242 SER B OG  1 
ATOM   1528  N N   . LEU A 1 248 ? 78.553  -40.048 -19.939 1.00 42.60  ? 243 LEU B N   1 
ATOM   1529  C CA  . LEU A 1 248 ? 78.752  -40.174 -18.490 1.00 39.67  ? 243 LEU B CA  1 
ATOM   1530  C C   . LEU A 1 248 ? 78.204  -41.447 -17.824 1.00 40.52  ? 243 LEU B C   1 
ATOM   1531  O O   . LEU A 1 248 ? 78.534  -41.743 -16.664 1.00 39.86  ? 243 LEU B O   1 
ATOM   1532  C CB  . LEU A 1 248 ? 78.196  -38.941 -17.793 1.00 36.74  ? 243 LEU B CB  1 
ATOM   1533  C CG  . LEU A 1 248 ? 78.921  -37.672 -18.232 1.00 34.21  ? 243 LEU B CG  1 
ATOM   1534  C CD1 . LEU A 1 248 ? 78.312  -36.453 -17.554 1.00 32.97  ? 243 LEU B CD1 1 
ATOM   1535  C CD2 . LEU A 1 248 ? 80.400  -37.810 -17.894 1.00 31.32  ? 243 LEU B CD2 1 
ATOM   1536  N N   . GLY A 1 249 ? 77.363  -42.184 -18.554 1.00 40.41  ? 244 GLY B N   1 
ATOM   1537  C CA  . GLY A 1 249 ? 76.822  -43.444 -18.066 1.00 37.59  ? 244 GLY B CA  1 
ATOM   1538  C C   . GLY A 1 249 ? 75.806  -43.505 -16.942 1.00 36.80  ? 244 GLY B C   1 
ATOM   1539  O O   . GLY A 1 249 ? 75.573  -44.584 -16.412 1.00 37.37  ? 244 GLY B O   1 
ATOM   1540  N N   . ALA A 1 250 ? 75.196  -42.389 -16.563 1.00 36.08  ? 245 ALA B N   1 
ATOM   1541  C CA  . ALA A 1 250 ? 74.193  -42.426 -15.494 1.00 36.39  ? 245 ALA B CA  1 
ATOM   1542  C C   . ALA A 1 250 ? 72.841  -42.809 -16.113 1.00 36.68  ? 245 ALA B C   1 
ATOM   1543  O O   . ALA A 1 250 ? 71.870  -42.050 -16.050 1.00 38.34  ? 245 ALA B O   1 
ATOM   1544  C CB  . ALA A 1 250 ? 74.106  -41.064 -14.820 1.00 35.64  ? 245 ALA B CB  1 
ATOM   1545  N N   . VAL A 1 251 ? 72.785  -44.010 -16.682 1.00 36.58  ? 246 VAL B N   1 
ATOM   1546  C CA  . VAL A 1 251 ? 71.610  -44.512 -17.393 1.00 35.89  ? 246 VAL B CA  1 
ATOM   1547  C C   . VAL A 1 251 ? 70.877  -45.689 -16.695 1.00 35.13  ? 246 VAL B C   1 
ATOM   1548  O O   . VAL A 1 251 ? 71.457  -46.364 -15.846 1.00 35.53  ? 246 VAL B O   1 
ATOM   1549  C CB  . VAL A 1 251 ? 72.100  -44.895 -18.823 1.00 38.53  ? 246 VAL B CB  1 
ATOM   1550  C CG1 . VAL A 1 251 ? 71.003  -45.536 -19.643 1.00 43.45  ? 246 VAL B CG1 1 
ATOM   1551  C CG2 . VAL A 1 251 ? 72.611  -43.647 -19.529 1.00 37.65  ? 246 VAL B CG2 1 
ATOM   1552  N N   . PRO A 1 252 ? 69.583  -45.933 -17.026 1.00 33.99  ? 247 PRO B N   1 
ATOM   1553  C CA  . PRO A 1 252 ? 68.839  -47.039 -16.402 1.00 31.14  ? 247 PRO B CA  1 
ATOM   1554  C C   . PRO A 1 252 ? 69.223  -48.356 -17.050 1.00 31.86  ? 247 PRO B C   1 
ATOM   1555  O O   . PRO A 1 252 ? 69.793  -48.373 -18.131 1.00 33.02  ? 247 PRO B O   1 
ATOM   1556  C CB  . PRO A 1 252 ? 67.375  -46.729 -16.726 1.00 31.98  ? 247 PRO B CB  1 
ATOM   1557  C CG  . PRO A 1 252 ? 67.365  -45.362 -17.314 1.00 32.83  ? 247 PRO B CG  1 
ATOM   1558  C CD  . PRO A 1 252 ? 68.703  -45.190 -17.947 1.00 34.14  ? 247 PRO B CD  1 
ATOM   1559  N N   . SER A 1 253 ? 68.897  -49.464 -16.408 1.00 31.87  ? 248 SER B N   1 
ATOM   1560  C CA  . SER A 1 253 ? 69.195  -50.753 -17.011 1.00 33.83  ? 248 SER B CA  1 
ATOM   1561  C C   . SER A 1 253 ? 68.030  -51.053 -17.943 1.00 33.25  ? 248 SER B C   1 
ATOM   1562  O O   . SER A 1 253 ? 66.982  -50.438 -17.851 1.00 33.40  ? 248 SER B O   1 
ATOM   1563  C CB  . SER A 1 253 ? 69.256  -51.857 -15.959 1.00 35.06  ? 248 SER B CB  1 
ATOM   1564  O OG  . SER A 1 253 ? 67.942  -52.269 -15.619 1.00 36.47  ? 248 SER B OG  1 
ATOM   1565  N N   . PRO A 1 254 ? 68.201  -52.003 -18.859 1.00 35.09  ? 249 PRO B N   1 
ATOM   1566  C CA  . PRO A 1 254 ? 67.104  -52.331 -19.768 1.00 35.51  ? 249 PRO B CA  1 
ATOM   1567  C C   . PRO A 1 254 ? 65.844  -52.763 -19.004 1.00 36.33  ? 249 PRO B C   1 
ATOM   1568  O O   . PRO A 1 254 ? 64.722  -52.460 -19.415 1.00 37.81  ? 249 PRO B O   1 
ATOM   1569  C CB  . PRO A 1 254 ? 67.688  -53.460 -20.608 1.00 36.15  ? 249 PRO B CB  1 
ATOM   1570  C CG  . PRO A 1 254 ? 69.132  -53.087 -20.691 1.00 36.47  ? 249 PRO B CG  1 
ATOM   1571  C CD  . PRO A 1 254 ? 69.447  -52.671 -19.270 1.00 35.85  ? 249 PRO B CD  1 
ATOM   1572  N N   . ILE A 1 255 ? 66.023  -53.466 -17.890 1.00 37.18  ? 250 ILE B N   1 
ATOM   1573  C CA  . ILE A 1 255 ? 64.877  -53.917 -17.115 1.00 37.18  ? 250 ILE B CA  1 
ATOM   1574  C C   . ILE A 1 255 ? 64.095  -52.767 -16.488 1.00 38.86  ? 250 ILE B C   1 
ATOM   1575  O O   . ILE A 1 255 ? 62.864  -52.808 -16.459 1.00 39.72  ? 250 ILE B O   1 
ATOM   1576  C CB  . ILE A 1 255 ? 65.300  -54.923 -16.045 1.00 34.86  ? 250 ILE B CB  1 
ATOM   1577  C CG1 . ILE A 1 255 ? 65.914  -56.127 -16.748 1.00 33.87  ? 250 ILE B CG1 1 
ATOM   1578  C CG2 . ILE A 1 255 ? 64.095  -55.359 -15.211 1.00 33.57  ? 250 ILE B CG2 1 
ATOM   1579  C CD1 . ILE A 1 255 ? 66.113  -57.319 -15.872 1.00 36.35  ? 250 ILE B CD1 1 
ATOM   1580  N N   . ASP A 1 256 ? 64.795  -51.748 -15.995 1.00 39.29  ? 251 ASP B N   1 
ATOM   1581  C CA  . ASP A 1 256 ? 64.123  -50.588 -15.417 1.00 41.45  ? 251 ASP B CA  1 
ATOM   1582  C C   . ASP A 1 256 ? 63.268  -49.900 -16.485 1.00 40.67  ? 251 ASP B C   1 
ATOM   1583  O O   . ASP A 1 256 ? 62.134  -49.484 -16.222 1.00 41.04  ? 251 ASP B O   1 
ATOM   1584  C CB  . ASP A 1 256 ? 65.136  -49.563 -14.900 1.00 46.11  ? 251 ASP B CB  1 
ATOM   1585  C CG  . ASP A 1 256 ? 65.945  -50.076 -13.748 1.00 50.34  ? 251 ASP B CG  1 
ATOM   1586  O OD1 . ASP A 1 256 ? 65.331  -50.460 -12.731 1.00 55.02  ? 251 ASP B OD1 1 
ATOM   1587  O OD2 . ASP A 1 256 ? 67.191  -50.092 -13.855 1.00 52.87  ? 251 ASP B OD2 1 
ATOM   1588  N N   . CYS A 1 257 ? 63.827  -49.764 -17.686 1.00 37.31  ? 252 CYS B N   1 
ATOM   1589  C CA  . CYS A 1 257 ? 63.117  -49.109 -18.774 1.00 35.23  ? 252 CYS B CA  1 
ATOM   1590  C C   . CYS A 1 257 ? 61.890  -49.896 -19.134 1.00 33.88  ? 252 CYS B C   1 
ATOM   1591  O O   . CYS A 1 257 ? 60.848  -49.323 -19.421 1.00 33.67  ? 252 CYS B O   1 
ATOM   1592  C CB  . CYS A 1 257 ? 64.006  -48.974 -20.005 1.00 34.49  ? 252 CYS B CB  1 
ATOM   1593  S SG  . CYS A 1 257 ? 65.447  -47.939 -19.752 1.00 36.04  ? 252 CYS B SG  1 
ATOM   1594  N N   . TYR A 1 258 ? 62.018  -51.216 -19.127 1.00 33.35  ? 253 TYR B N   1 
ATOM   1595  C CA  . TYR A 1 258 ? 60.895  -52.071 -19.458 1.00 32.70  ? 253 TYR B CA  1 
ATOM   1596  C C   . TYR A 1 258 ? 59.810  -51.974 -18.391 1.00 32.83  ? 253 TYR B C   1 
ATOM   1597  O O   . TYR A 1 258 ? 58.624  -51.843 -18.695 1.00 33.45  ? 253 TYR B O   1 
ATOM   1598  C CB  . TYR A 1 258 ? 61.335  -53.522 -19.574 1.00 34.31  ? 253 TYR B CB  1 
ATOM   1599  C CG  . TYR A 1 258 ? 60.160  -54.427 -19.814 1.00 36.35  ? 253 TYR B CG  1 
ATOM   1600  C CD1 . TYR A 1 258 ? 59.467  -54.383 -21.020 1.00 39.00  ? 253 TYR B CD1 1 
ATOM   1601  C CD2 . TYR A 1 258 ? 59.695  -55.278 -18.818 1.00 36.77  ? 253 TYR B CD2 1 
ATOM   1602  C CE1 . TYR A 1 258 ? 58.336  -55.160 -21.227 1.00 40.08  ? 253 TYR B CE1 1 
ATOM   1603  C CE2 . TYR A 1 258 ? 58.562  -56.061 -19.013 1.00 39.05  ? 253 TYR B CE2 1 
ATOM   1604  C CZ  . TYR A 1 258 ? 57.888  -55.995 -20.221 1.00 40.56  ? 253 TYR B CZ  1 
ATOM   1605  O OH  . TYR A 1 258 ? 56.752  -56.750 -20.427 1.00 45.07  ? 253 TYR B OH  1 
ATOM   1606  N N   . LEU A 1 259 ? 60.224  -52.057 -17.135 1.00 31.98  ? 254 LEU B N   1 
ATOM   1607  C CA  . LEU A 1 259 ? 59.297  -51.975 -16.022 1.00 28.36  ? 254 LEU B CA  1 
ATOM   1608  C C   . LEU A 1 259 ? 58.619  -50.609 -15.981 1.00 28.79  ? 254 LEU B C   1 
ATOM   1609  O O   . LEU A 1 259 ? 57.403  -50.520 -15.825 1.00 29.10  ? 254 LEU B O   1 
ATOM   1610  C CB  . LEU A 1 259 ? 60.053  -52.251 -14.723 1.00 26.74  ? 254 LEU B CB  1 
ATOM   1611  C CG  . LEU A 1 259 ? 59.953  -53.675 -14.156 1.00 27.60  ? 254 LEU B CG  1 
ATOM   1612  C CD1 . LEU A 1 259 ? 59.913  -54.704 -15.260 1.00 27.15  ? 254 LEU B CD1 1 
ATOM   1613  C CD2 . LEU A 1 259 ? 61.117  -53.922 -13.214 1.00 26.85  ? 254 LEU B CD2 1 
ATOM   1614  N N   . CYS A 1 260 ? 59.411  -49.553 -16.138 1.00 29.12  ? 255 CYS B N   1 
ATOM   1615  C CA  . CYS A 1 260 ? 58.907  -48.184 -16.116 1.00 31.51  ? 255 CYS B CA  1 
ATOM   1616  C C   . CYS A 1 260 ? 57.868  -47.918 -17.208 1.00 32.76  ? 255 CYS B C   1 
ATOM   1617  O O   . CYS A 1 260 ? 56.843  -47.273 -16.975 1.00 31.80  ? 255 CYS B O   1 
ATOM   1618  C CB  . CYS A 1 260 ? 60.073  -47.212 -16.266 1.00 32.44  ? 255 CYS B CB  1 
ATOM   1619  S SG  . CYS A 1 260 ? 59.623  -45.486 -16.078 1.00 32.83  ? 255 CYS B SG  1 
ATOM   1620  N N   . ASN A 1 261 ? 58.147  -48.408 -18.408 1.00 35.49  ? 256 ASN B N   1 
ATOM   1621  C CA  . ASN A 1 261 ? 57.228  -48.245 -19.523 1.00 37.76  ? 256 ASN B CA  1 
ATOM   1622  C C   . ASN A 1 261 ? 55.939  -49.010 -19.204 1.00 36.34  ? 256 ASN B C   1 
ATOM   1623  O O   . ASN A 1 261 ? 54.833  -48.532 -19.476 1.00 36.84  ? 256 ASN B O   1 
ATOM   1624  C CB  . ASN A 1 261 ? 57.870  -48.781 -20.811 1.00 39.56  ? 256 ASN B CB  1 
ATOM   1625  C CG  . ASN A 1 261 ? 57.075  -48.427 -22.056 1.00 42.45  ? 256 ASN B CG  1 
ATOM   1626  O OD1 . ASN A 1 261 ? 55.941  -48.867 -22.232 1.00 45.87  ? 256 ASN B OD1 1 
ATOM   1627  N ND2 . ASN A 1 261 ? 57.672  -47.629 -22.928 1.00 46.20  ? 256 ASN B ND2 1 
ATOM   1628  N N   . ARG A 1 262 ? 56.083  -50.190 -18.611 1.00 35.46  ? 257 ARG B N   1 
ATOM   1629  C CA  . ARG A 1 262 ? 54.932  -51.021 -18.262 1.00 37.96  ? 257 ARG B CA  1 
ATOM   1630  C C   . ARG A 1 262 ? 53.960  -50.319 -17.312 1.00 35.98  ? 257 ARG B C   1 
ATOM   1631  O O   . ARG A 1 262 ? 52.741  -50.431 -17.454 1.00 34.22  ? 257 ARG B O   1 
ATOM   1632  C CB  . ARG A 1 262 ? 55.422  -52.338 -17.656 1.00 42.69  ? 257 ARG B CB  1 
ATOM   1633  C CG  . ARG A 1 262 ? 54.334  -53.234 -17.087 1.00 49.44  ? 257 ARG B CG  1 
ATOM   1634  C CD  . ARG A 1 262 ? 54.644  -54.699 -17.368 1.00 56.42  ? 257 ARG B CD  1 
ATOM   1635  N NE  . ARG A 1 262 ? 53.607  -55.281 -18.219 1.00 64.68  ? 257 ARG B NE  1 
ATOM   1636  C CZ  . ARG A 1 262 ? 52.403  -55.659 -17.789 1.00 66.33  ? 257 ARG B CZ  1 
ATOM   1637  N NH1 . ARG A 1 262 ? 52.079  -55.532 -16.506 1.00 67.59  ? 257 ARG B NH1 1 
ATOM   1638  N NH2 . ARG A 1 262 ? 51.510  -56.143 -18.649 1.00 66.00  ? 257 ARG B NH2 1 
ATOM   1639  N N   . GLY A 1 263 ? 54.506  -49.591 -16.345 1.00 35.42  ? 258 GLY B N   1 
ATOM   1640  C CA  . GLY A 1 263 ? 53.674  -48.879 -15.396 1.00 33.40  ? 258 GLY B CA  1 
ATOM   1641  C C   . GLY A 1 263 ? 52.996  -47.688 -16.040 1.00 33.86  ? 258 GLY B C   1 
ATOM   1642  O O   . GLY A 1 263 ? 51.889  -47.316 -15.662 1.00 36.34  ? 258 GLY B O   1 
ATOM   1643  N N   . LEU A 1 264 ? 53.660  -47.086 -17.017 1.00 32.97  ? 259 LEU B N   1 
ATOM   1644  C CA  . LEU A 1 264 ? 53.111  -45.939 -17.718 1.00 30.58  ? 259 LEU B CA  1 
ATOM   1645  C C   . LEU A 1 264 ? 51.729  -46.244 -18.283 1.00 31.44  ? 259 LEU B C   1 
ATOM   1646  O O   . LEU A 1 264 ? 50.872  -45.369 -18.346 1.00 33.11  ? 259 LEU B O   1 
ATOM   1647  C CB  . LEU A 1 264 ? 54.050  -45.540 -18.854 1.00 30.29  ? 259 LEU B CB  1 
ATOM   1648  C CG  . LEU A 1 264 ? 54.970  -44.319 -18.701 1.00 31.37  ? 259 LEU B CG  1 
ATOM   1649  C CD1 . LEU A 1 264 ? 55.512  -44.193 -17.290 1.00 30.87  ? 259 LEU B CD1 1 
ATOM   1650  C CD2 . LEU A 1 264 ? 56.103  -44.446 -19.708 1.00 31.13  ? 259 LEU B CD2 1 
ATOM   1651  N N   . LYS A 1 265 ? 51.505  -47.493 -18.674 1.00 32.38  ? 260 LYS B N   1 
ATOM   1652  C CA  . LYS A 1 265 ? 50.231  -47.901 -19.267 1.00 32.14  ? 260 LYS B CA  1 
ATOM   1653  C C   . LYS A 1 265 ? 48.982  -47.784 -18.386 1.00 31.80  ? 260 LYS B C   1 
ATOM   1654  O O   . LYS A 1 265 ? 47.862  -47.768 -18.895 1.00 31.48  ? 260 LYS B O   1 
ATOM   1655  C CB  . LYS A 1 265 ? 50.363  -49.329 -19.809 1.00 31.56  ? 260 LYS B CB  1 
ATOM   1656  C CG  . LYS A 1 265 ? 51.575  -49.478 -20.698 1.00 32.22  ? 260 LYS B CG  1 
ATOM   1657  C CD  . LYS A 1 265 ? 51.534  -50.704 -21.565 1.00 31.99  ? 260 LYS B CD  1 
ATOM   1658  C CE  . LYS A 1 265 ? 52.705  -50.662 -22.537 1.00 32.93  ? 260 LYS B CE  1 
ATOM   1659  N NZ  . LYS A 1 265 ? 52.562  -51.684 -23.608 1.00 32.47  ? 260 LYS B NZ  1 
ATOM   1660  N N   . THR A 1 266 ? 49.160  -47.703 -17.074 1.00 31.12  ? 261 THR B N   1 
ATOM   1661  C CA  . THR A 1 266 ? 48.013  -47.577 -16.182 1.00 31.07  ? 261 THR B CA  1 
ATOM   1662  C C   . THR A 1 266 ? 48.081  -46.299 -15.360 1.00 30.15  ? 261 THR B C   1 
ATOM   1663  O O   . THR A 1 266 ? 47.282  -46.091 -14.451 1.00 29.34  ? 261 THR B O   1 
ATOM   1664  C CB  . THR A 1 266 ? 47.930  -48.755 -15.217 1.00 33.64  ? 261 THR B CB  1 
ATOM   1665  O OG1 . THR A 1 266 ? 49.127  -48.810 -14.423 1.00 35.10  ? 261 THR B OG1 1 
ATOM   1666  C CG2 . THR A 1 266 ? 47.750  -50.050 -15.993 1.00 33.72  ? 261 THR B CG2 1 
ATOM   1667  N N   . LEU A 1 267 ? 49.041  -45.447 -15.693 1.00 29.59  ? 262 LEU B N   1 
ATOM   1668  C CA  . LEU A 1 267 ? 49.235  -44.189 -14.996 1.00 28.09  ? 262 LEU B CA  1 
ATOM   1669  C C   . LEU A 1 267 ? 47.982  -43.319 -14.990 1.00 30.57  ? 262 LEU B C   1 
ATOM   1670  O O   . LEU A 1 267 ? 47.649  -42.711 -13.973 1.00 30.16  ? 262 LEU B O   1 
ATOM   1671  C CB  . LEU A 1 267 ? 50.399  -43.414 -15.626 1.00 25.64  ? 262 LEU B CB  1 
ATOM   1672  C CG  . LEU A 1 267 ? 50.619  -42.003 -15.080 1.00 23.37  ? 262 LEU B CG  1 
ATOM   1673  C CD1 . LEU A 1 267 ? 51.080  -42.075 -13.637 1.00 20.36  ? 262 LEU B CD1 1 
ATOM   1674  C CD2 . LEU A 1 267 ? 51.637  -41.281 -15.932 1.00 23.05  ? 262 LEU B CD2 1 
ATOM   1675  N N   . HIS A 1 268 ? 47.283  -43.243 -16.117 1.00 32.31  ? 263 HIS B N   1 
ATOM   1676  C CA  . HIS A 1 268 ? 46.086  -42.415 -16.156 1.00 32.26  ? 263 HIS B CA  1 
ATOM   1677  C C   . HIS A 1 268 ? 45.001  -42.910 -15.186 1.00 33.01  ? 263 HIS B C   1 
ATOM   1678  O O   . HIS A 1 268 ? 44.465  -42.117 -14.408 1.00 33.11  ? 263 HIS B O   1 
ATOM   1679  C CB  . HIS A 1 268 ? 45.533  -42.307 -17.586 1.00 32.93  ? 263 HIS B CB  1 
ATOM   1680  C CG  . HIS A 1 268 ? 45.098  -43.612 -18.176 1.00 36.48  ? 263 HIS B CG  1 
ATOM   1681  N ND1 . HIS A 1 268 ? 44.197  -43.690 -19.215 1.00 36.81  ? 263 HIS B ND1 1 
ATOM   1682  C CD2 . HIS A 1 268 ? 45.453  -44.889 -17.888 1.00 37.95  ? 263 HIS B CD2 1 
ATOM   1683  C CE1 . HIS A 1 268 ? 44.013  -44.959 -19.542 1.00 38.17  ? 263 HIS B CE1 1 
ATOM   1684  N NE2 . HIS A 1 268 ? 44.763  -45.706 -18.752 1.00 38.85  ? 263 HIS B NE2 1 
ATOM   1685  N N   . VAL A 1 269 ? 44.689  -44.206 -15.206 1.00 31.82  ? 264 VAL B N   1 
ATOM   1686  C CA  . VAL A 1 269 ? 43.658  -44.739 -14.313 1.00 30.78  ? 264 VAL B CA  1 
ATOM   1687  C C   . VAL A 1 269 ? 44.033  -44.670 -12.834 1.00 31.90  ? 264 VAL B C   1 
ATOM   1688  O O   . VAL A 1 269 ? 43.165  -44.468 -11.981 1.00 32.01  ? 264 VAL B O   1 
ATOM   1689  C CB  . VAL A 1 269 ? 43.286  -46.198 -14.649 1.00 30.54  ? 264 VAL B CB  1 
ATOM   1690  C CG1 . VAL A 1 269 ? 42.690  -46.268 -16.031 1.00 31.98  ? 264 VAL B CG1 1 
ATOM   1691  C CG2 . VAL A 1 269 ? 44.498  -47.088 -14.544 1.00 30.81  ? 264 VAL B CG2 1 
ATOM   1692  N N   . ARG A 1 270 ? 45.315  -44.841 -12.525 1.00 32.23  ? 265 ARG B N   1 
ATOM   1693  C CA  . ARG A 1 270 ? 45.764  -44.767 -11.137 1.00 30.77  ? 265 ARG B CA  1 
ATOM   1694  C C   . ARG A 1 270 ? 45.731  -43.329 -10.655 1.00 30.30  ? 265 ARG B C   1 
ATOM   1695  O O   . ARG A 1 270 ? 45.320  -43.061 -9.530  1.00 32.15  ? 265 ARG B O   1 
ATOM   1696  C CB  . ARG A 1 270 ? 47.183  -45.321 -10.982 1.00 28.87  ? 265 ARG B CB  1 
ATOM   1697  C CG  . ARG A 1 270 ? 47.262  -46.819 -11.125 1.00 30.41  ? 265 ARG B CG  1 
ATOM   1698  C CD  . ARG A 1 270 ? 48.648  -47.363 -10.800 1.00 30.17  ? 265 ARG B CD  1 
ATOM   1699  N NE  . ARG A 1 270 ? 49.605  -47.181 -11.889 1.00 30.75  ? 265 ARG B NE  1 
ATOM   1700  C CZ  . ARG A 1 270 ? 50.500  -46.204 -11.946 1.00 28.60  ? 265 ARG B CZ  1 
ATOM   1701  N NH1 . ARG A 1 270 ? 50.564  -45.312 -10.970 1.00 29.39  ? 265 ARG B NH1 1 
ATOM   1702  N NH2 . ARG A 1 270 ? 51.338  -46.128 -12.971 1.00 27.46  ? 265 ARG B NH2 1 
ATOM   1703  N N   . MET A 1 271 ? 46.163  -42.403 -11.505 1.00 31.08  ? 266 MET B N   1 
ATOM   1704  C CA  . MET A 1 271 ? 46.168  -41.001 -11.127 1.00 33.50  ? 266 MET B CA  1 
ATOM   1705  C C   . MET A 1 271 ? 44.741  -40.500 -10.931 1.00 34.61  ? 266 MET B C   1 
ATOM   1706  O O   . MET A 1 271 ? 44.469  -39.672 -10.058 1.00 32.84  ? 266 MET B O   1 
ATOM   1707  C CB  . MET A 1 271 ? 46.882  -40.155 -12.182 1.00 31.40  ? 266 MET B CB  1 
ATOM   1708  C CG  . MET A 1 271 ? 48.376  -40.375 -12.241 1.00 32.15  ? 266 MET B CG  1 
ATOM   1709  S SD  . MET A 1 271 ? 49.127  -40.515 -10.610 1.00 32.92  ? 266 MET B SD  1 
ATOM   1710  C CE  . MET A 1 271 ? 49.262  -38.833 -10.139 1.00 33.22  ? 266 MET B CE  1 
ATOM   1711  N N   . GLU A 1 272 ? 43.824  -41.013 -11.740 1.00 36.57  ? 267 GLU B N   1 
ATOM   1712  C CA  . GLU A 1 272 ? 42.446  -40.592 -11.614 1.00 39.31  ? 267 GLU B CA  1 
ATOM   1713  C C   . GLU A 1 272 ? 41.878  -40.989 -10.263 1.00 36.46  ? 267 GLU B C   1 
ATOM   1714  O O   . GLU A 1 272 ? 41.206  -40.193 -9.609  1.00 35.36  ? 267 GLU B O   1 
ATOM   1715  C CB  . GLU A 1 272 ? 41.604  -41.175 -12.755 1.00 45.47  ? 267 GLU B CB  1 
ATOM   1716  C CG  . GLU A 1 272 ? 41.578  -40.267 -13.988 1.00 52.53  ? 267 GLU B CG  1 
ATOM   1717  C CD  . GLU A 1 272 ? 41.054  -38.862 -13.668 1.00 57.54  ? 267 GLU B CD  1 
ATOM   1718  O OE1 . GLU A 1 272 ? 41.267  -37.941 -14.485 1.00 59.95  ? 267 GLU B OE1 1 
ATOM   1719  O OE2 . GLU A 1 272 ? 40.423  -38.675 -12.601 1.00 60.56  ? 267 GLU B OE2 1 
ATOM   1720  N N   . LYS A 1 273 ? 42.161  -42.216 -9.844  1.00 35.82  ? 268 LYS B N   1 
ATOM   1721  C CA  . LYS A 1 273 ? 41.671  -42.706 -8.569  1.00 34.79  ? 268 LYS B CA  1 
ATOM   1722  C C   . LYS A 1 273 ? 42.361  -41.967 -7.425  1.00 34.70  ? 268 LYS B C   1 
ATOM   1723  O O   . LYS A 1 273 ? 41.750  -41.709 -6.394  1.00 35.39  ? 268 LYS B O   1 
ATOM   1724  C CB  . LYS A 1 273 ? 41.885  -44.221 -8.462  1.00 33.61  ? 268 LYS B CB  1 
ATOM   1725  C CG  . LYS A 1 273 ? 41.412  -44.826 -7.149  1.00 36.27  ? 268 LYS B CG  1 
ATOM   1726  C CD  . LYS A 1 273 ? 40.008  -44.346 -6.747  1.00 37.99  ? 268 LYS B CD  1 
ATOM   1727  C CE  . LYS A 1 273 ? 38.902  -44.949 -7.608  1.00 40.26  ? 268 LYS B CE  1 
ATOM   1728  N NZ  . LYS A 1 273 ? 37.530  -44.569 -7.133  1.00 39.92  ? 268 LYS B NZ  1 
ATOM   1729  N N   . HIS A 1 274 ? 43.629  -41.617 -7.602  1.00 34.84  ? 269 HIS B N   1 
ATOM   1730  C CA  . HIS A 1 274 ? 44.338  -40.891 -6.558  1.00 37.18  ? 269 HIS B CA  1 
ATOM   1731  C C   . HIS A 1 274 ? 43.621  -39.568 -6.380  1.00 38.58  ? 269 HIS B C   1 
ATOM   1732  O O   . HIS A 1 274 ? 43.325  -39.150 -5.264  1.00 38.74  ? 269 HIS B O   1 
ATOM   1733  C CB  . HIS A 1 274 ? 45.794  -40.618 -6.955  1.00 39.55  ? 269 HIS B CB  1 
ATOM   1734  C CG  . HIS A 1 274 ? 46.732  -41.750 -6.663  1.00 41.88  ? 269 HIS B CG  1 
ATOM   1735  N ND1 . HIS A 1 274 ? 46.894  -42.276 -5.399  1.00 42.95  ? 269 HIS B ND1 1 
ATOM   1736  C CD2 . HIS A 1 274 ? 47.574  -42.439 -7.467  1.00 42.39  ? 269 HIS B CD2 1 
ATOM   1737  C CE1 . HIS A 1 274 ? 47.795  -43.240 -5.437  1.00 42.63  ? 269 HIS B CE1 1 
ATOM   1738  N NE2 . HIS A 1 274 ? 48.224  -43.360 -6.680  1.00 44.01  ? 269 HIS B NE2 1 
ATOM   1739  N N   . PHE A 1 275 ? 43.348  -38.921 -7.509  1.00 40.49  ? 270 PHE B N   1 
ATOM   1740  C CA  . PHE A 1 275 ? 42.675  -37.632 -7.553  1.00 40.71  ? 270 PHE B CA  1 
ATOM   1741  C C   . PHE A 1 275 ? 41.298  -37.708 -6.901  1.00 40.87  ? 270 PHE B C   1 
ATOM   1742  O O   . PHE A 1 275 ? 40.948  -36.858 -6.079  1.00 40.27  ? 270 PHE B O   1 
ATOM   1743  C CB  . PHE A 1 275 ? 42.564  -37.176 -9.009  1.00 43.24  ? 270 PHE B CB  1 
ATOM   1744  C CG  . PHE A 1 275 ? 41.945  -35.822 -9.183  1.00 47.77  ? 270 PHE B CG  1 
ATOM   1745  C CD1 . PHE A 1 275 ? 42.208  -34.796 -8.282  1.00 50.13  ? 270 PHE B CD1 1 
ATOM   1746  C CD2 . PHE A 1 275 ? 41.119  -35.561 -10.274 1.00 49.17  ? 270 PHE B CD2 1 
ATOM   1747  C CE1 . PHE A 1 275 ? 41.655  -33.527 -8.464  1.00 51.17  ? 270 PHE B CE1 1 
ATOM   1748  C CE2 . PHE A 1 275 ? 40.564  -34.300 -10.464 1.00 50.55  ? 270 PHE B CE2 1 
ATOM   1749  C CZ  . PHE A 1 275 ? 40.832  -33.281 -9.558  1.00 51.64  ? 270 PHE B CZ  1 
ATOM   1750  N N   . LYS A 1 276 ? 40.518  -38.724 -7.262  1.00 39.86  ? 271 LYS B N   1 
ATOM   1751  C CA  . LYS A 1 276 ? 39.201  -38.890 -6.673  1.00 39.68  ? 271 LYS B CA  1 
ATOM   1752  C C   . LYS A 1 276 ? 39.307  -39.027 -5.159  1.00 38.94  ? 271 LYS B C   1 
ATOM   1753  O O   . LYS A 1 276 ? 38.775  -38.192 -4.428  1.00 40.06  ? 271 LYS B O   1 
ATOM   1754  C CB  . LYS A 1 276 ? 38.499  -40.117 -7.244  1.00 41.63  ? 271 LYS B CB  1 
ATOM   1755  C CG  . LYS A 1 276 ? 37.645  -39.826 -8.458  1.00 47.24  ? 271 LYS B CG  1 
ATOM   1756  C CD  . LYS A 1 276 ? 36.740  -41.011 -8.793  1.00 52.08  ? 271 LYS B CD  1 
ATOM   1757  C CE  . LYS A 1 276 ? 35.772  -41.331 -7.647  1.00 54.08  ? 271 LYS B CE  1 
ATOM   1758  N NZ  . LYS A 1 276 ? 34.871  -42.493 -7.944  1.00 53.62  ? 271 LYS B NZ  1 
ATOM   1759  N N   . ASN A 1 277 ? 39.991  -40.072 -4.687  1.00 36.84  ? 272 ASN B N   1 
ATOM   1760  C CA  . ASN A 1 277 ? 40.148  -40.293 -3.251  1.00 35.05  ? 272 ASN B CA  1 
ATOM   1761  C C   . ASN A 1 277 ? 40.723  -39.057 -2.588  1.00 34.31  ? 272 ASN B C   1 
ATOM   1762  O O   . ASN A 1 277 ? 40.315  -38.686 -1.491  1.00 33.82  ? 272 ASN B O   1 
ATOM   1763  C CB  . ASN A 1 277 ? 41.068  -41.491 -2.955  1.00 36.31  ? 272 ASN B CB  1 
ATOM   1764  C CG  . ASN A 1 277 ? 40.389  -42.831 -3.195  1.00 36.24  ? 272 ASN B CG  1 
ATOM   1765  O OD1 . ASN A 1 277 ? 39.165  -42.934 -3.146  1.00 36.05  ? 272 ASN B OD1 1 
ATOM   1766  N ND2 . ASN A 1 277 ? 41.188  -43.869 -3.437  1.00 34.56  ? 272 ASN B ND2 1 
ATOM   1767  N N   . GLY A 1 278 ? 41.677  -38.423 -3.260  1.00 33.04  ? 273 GLY B N   1 
ATOM   1768  C CA  . GLY A 1 278 ? 42.292  -37.227 -2.718  1.00 32.24  ? 273 GLY B CA  1 
ATOM   1769  C C   . GLY A 1 278 ? 41.297  -36.097 -2.520  1.00 32.73  ? 273 GLY B C   1 
ATOM   1770  O O   . GLY A 1 278 ? 41.368  -35.376 -1.530  1.00 32.47  ? 273 GLY B O   1 
ATOM   1771  N N   . MET A 1 279 ? 40.377  -35.936 -3.468  1.00 33.02  ? 274 MET B N   1 
ATOM   1772  C CA  . MET A 1 279 ? 39.359  -34.895 -3.396  1.00 31.97  ? 274 MET B CA  1 
ATOM   1773  C C   . MET A 1 279 ? 38.406  -35.211 -2.247  1.00 31.28  ? 274 MET B C   1 
ATOM   1774  O O   . MET A 1 279 ? 38.084  -34.341 -1.441  1.00 29.62  ? 274 MET B O   1 
ATOM   1775  C CB  . MET A 1 279 ? 38.579  -34.839 -4.705  1.00 35.61  ? 274 MET B CB  1 
ATOM   1776  C CG  . MET A 1 279 ? 37.897  -33.517 -4.957  1.00 37.83  ? 274 MET B CG  1 
ATOM   1777  S SD  . MET A 1 279 ? 39.080  -32.172 -5.090  1.00 42.98  ? 274 MET B SD  1 
ATOM   1778  C CE  . MET A 1 279 ? 38.079  -30.823 -4.470  1.00 42.43  ? 274 MET B CE  1 
ATOM   1779  N N   . ALA A 1 280 ? 37.955  -36.460 -2.180  1.00 30.52  ? 275 ALA B N   1 
ATOM   1780  C CA  . ALA A 1 280 ? 37.067  -36.894 -1.108  1.00 30.13  ? 275 ALA B CA  1 
ATOM   1781  C C   . ALA A 1 280 ? 37.699  -36.637 0.262   1.00 30.32  ? 275 ALA B C   1 
ATOM   1782  O O   . ALA A 1 280 ? 37.114  -35.963 1.103   1.00 31.58  ? 275 ALA B O   1 
ATOM   1783  C CB  . ALA A 1 280 ? 36.767  -38.359 -1.257  1.00 29.32  ? 275 ALA B CB  1 
ATOM   1784  N N   . VAL A 1 281 ? 38.895  -37.178 0.476   1.00 31.09  ? 276 VAL B N   1 
ATOM   1785  C CA  . VAL A 1 281 ? 39.609  -37.012 1.740   1.00 31.17  ? 276 VAL B CA  1 
ATOM   1786  C C   . VAL A 1 281 ? 39.710  -35.547 2.121   1.00 33.14  ? 276 VAL B C   1 
ATOM   1787  O O   . VAL A 1 281 ? 39.359  -35.178 3.232   1.00 33.69  ? 276 VAL B O   1 
ATOM   1788  C CB  . VAL A 1 281 ? 41.051  -37.622 1.677   1.00 30.24  ? 276 VAL B CB  1 
ATOM   1789  C CG1 . VAL A 1 281 ? 41.878  -37.158 2.862   1.00 27.96  ? 276 VAL B CG1 1 
ATOM   1790  C CG2 . VAL A 1 281 ? 40.978  -39.143 1.673   1.00 26.67  ? 276 VAL B CG2 1 
ATOM   1791  N N   . ALA A 1 282 ? 40.182  -34.717 1.196   1.00 35.54  ? 277 ALA B N   1 
ATOM   1792  C CA  . ALA A 1 282 ? 40.337  -33.287 1.454   1.00 38.24  ? 277 ALA B CA  1 
ATOM   1793  C C   . ALA A 1 282 ? 39.024  -32.599 1.816   1.00 40.81  ? 277 ALA B C   1 
ATOM   1794  O O   . ALA A 1 282 ? 38.999  -31.739 2.698   1.00 43.11  ? 277 ALA B O   1 
ATOM   1795  C CB  . ALA A 1 282 ? 40.973  -32.595 0.247   1.00 36.61  ? 277 ALA B CB  1 
ATOM   1796  N N   . GLN A 1 283 ? 37.934  -32.955 1.144   1.00 42.07  ? 278 GLN B N   1 
ATOM   1797  C CA  . GLN A 1 283 ? 36.658  -32.329 1.464   1.00 44.22  ? 278 GLN B CA  1 
ATOM   1798  C C   . GLN A 1 283 ? 36.182  -32.769 2.841   1.00 43.30  ? 278 GLN B C   1 
ATOM   1799  O O   . GLN A 1 283 ? 35.783  -31.939 3.662   1.00 43.52  ? 278 GLN B O   1 
ATOM   1800  C CB  . GLN A 1 283 ? 35.611  -32.660 0.400   1.00 46.89  ? 278 GLN B CB  1 
ATOM   1801  C CG  . GLN A 1 283 ? 35.938  -32.014 -0.936  1.00 52.66  ? 278 GLN B CG  1 
ATOM   1802  C CD  . GLN A 1 283 ? 35.012  -32.443 -2.054  1.00 55.39  ? 278 GLN B CD  1 
ATOM   1803  O OE1 . GLN A 1 283 ? 34.601  -33.609 -2.133  1.00 57.45  ? 278 GLN B OE1 1 
ATOM   1804  N NE2 . GLN A 1 283 ? 34.695  -31.507 -2.945  1.00 56.66  ? 278 GLN B NE2 1 
ATOM   1805  N N   . PHE A 1 284 ? 36.248  -34.073 3.092   1.00 41.07  ? 279 PHE B N   1 
ATOM   1806  C CA  . PHE A 1 284 ? 35.834  -34.636 4.371   1.00 38.77  ? 279 PHE B CA  1 
ATOM   1807  C C   . PHE A 1 284 ? 36.559  -33.996 5.548   1.00 38.57  ? 279 PHE B C   1 
ATOM   1808  O O   . PHE A 1 284 ? 35.934  -33.617 6.539   1.00 39.05  ? 279 PHE B O   1 
ATOM   1809  C CB  . PHE A 1 284 ? 36.101  -36.137 4.401   1.00 37.17  ? 279 PHE B CB  1 
ATOM   1810  C CG  . PHE A 1 284 ? 35.898  -36.751 5.745   1.00 34.80  ? 279 PHE B CG  1 
ATOM   1811  C CD1 . PHE A 1 284 ? 34.628  -37.106 6.172   1.00 34.12  ? 279 PHE B CD1 1 
ATOM   1812  C CD2 . PHE A 1 284 ? 36.974  -36.929 6.609   1.00 34.72  ? 279 PHE B CD2 1 
ATOM   1813  C CE1 . PHE A 1 284 ? 34.423  -37.631 7.443   1.00 33.75  ? 279 PHE B CE1 1 
ATOM   1814  C CE2 . PHE A 1 284 ? 36.782  -37.452 7.885   1.00 34.53  ? 279 PHE B CE2 1 
ATOM   1815  C CZ  . PHE A 1 284 ? 35.501  -37.803 8.305   1.00 33.80  ? 279 PHE B CZ  1 
ATOM   1816  N N   . LEU A 1 285 ? 37.881  -33.901 5.447   1.00 38.51  ? 280 LEU B N   1 
ATOM   1817  C CA  . LEU A 1 285 ? 38.682  -33.319 6.517   1.00 39.38  ? 280 LEU B CA  1 
ATOM   1818  C C   . LEU A 1 285 ? 38.339  -31.860 6.706   1.00 40.46  ? 280 LEU B C   1 
ATOM   1819  O O   . LEU A 1 285 ? 38.302  -31.363 7.828   1.00 41.79  ? 280 LEU B O   1 
ATOM   1820  C CB  . LEU A 1 285 ? 40.180  -33.442 6.213   1.00 35.98  ? 280 LEU B CB  1 
ATOM   1821  C CG  . LEU A 1 285 ? 40.790  -34.840 6.316   1.00 34.95  ? 280 LEU B CG  1 
ATOM   1822  C CD1 . LEU A 1 285 ? 42.207  -34.823 5.785   1.00 31.75  ? 280 LEU B CD1 1 
ATOM   1823  C CD2 . LEU A 1 285 ? 40.756  -35.305 7.761   1.00 33.66  ? 280 LEU B CD2 1 
ATOM   1824  N N   . GLU A 1 286 ? 38.083  -31.175 5.600   1.00 42.62  ? 281 GLU B N   1 
ATOM   1825  C CA  . GLU A 1 286 ? 37.769  -29.756 5.653   1.00 45.41  ? 281 GLU B CA  1 
ATOM   1826  C C   . GLU A 1 286 ? 36.474  -29.422 6.391   1.00 44.35  ? 281 GLU B C   1 
ATOM   1827  O O   . GLU A 1 286 ? 36.363  -28.354 6.997   1.00 44.54  ? 281 GLU B O   1 
ATOM   1828  C CB  . GLU A 1 286 ? 37.737  -29.180 4.238   1.00 46.06  ? 281 GLU B CB  1 
ATOM   1829  C CG  . GLU A 1 286 ? 37.313  -27.733 4.182   1.00 48.69  ? 281 GLU B CG  1 
ATOM   1830  C CD  . GLU A 1 286 ? 37.976  -26.983 3.054   1.00 50.20  ? 281 GLU B CD  1 
ATOM   1831  O OE1 . GLU A 1 286 ? 39.173  -26.655 3.192   1.00 50.69  ? 281 GLU B OE1 1 
ATOM   1832  O OE2 . GLU A 1 286 ? 37.306  -26.727 2.031   1.00 50.53  ? 281 GLU B OE2 1 
ATOM   1833  N N   . SER A 1 287 ? 35.500  -30.326 6.350   1.00 43.45  ? 282 SER B N   1 
ATOM   1834  C CA  . SER A 1 287 ? 34.236  -30.083 7.031   1.00 43.36  ? 282 SER B CA  1 
ATOM   1835  C C   . SER A 1 287 ? 34.158  -30.845 8.362   1.00 42.98  ? 282 SER B C   1 
ATOM   1836  O O   . SER A 1 287 ? 33.107  -30.923 8.999   1.00 43.42  ? 282 SER B O   1 
ATOM   1837  C CB  . SER A 1 287 ? 33.065  -30.461 6.113   1.00 43.28  ? 282 SER B CB  1 
ATOM   1838  O OG  . SER A 1 287 ? 33.020  -31.853 5.871   1.00 43.57  ? 282 SER B OG  1 
ATOM   1839  N N   . ASN A 1 288 ? 35.288  -31.386 8.787   1.00 42.17  ? 283 ASN B N   1 
ATOM   1840  C CA  . ASN A 1 288 ? 35.357  -32.130 10.031  1.00 42.80  ? 283 ASN B CA  1 
ATOM   1841  C C   . ASN A 1 288 ? 35.690  -31.160 11.167  1.00 45.45  ? 283 ASN B C   1 
ATOM   1842  O O   . ASN A 1 288 ? 36.537  -30.282 11.012  1.00 44.65  ? 283 ASN B O   1 
ATOM   1843  C CB  . ASN A 1 288 ? 36.424  -33.229 9.908   1.00 41.69  ? 283 ASN B CB  1 
ATOM   1844  C CG  . ASN A 1 288 ? 36.568  -34.064 11.168  1.00 39.68  ? 283 ASN B CG  1 
ATOM   1845  O OD1 . ASN A 1 288 ? 37.167  -33.631 12.153  1.00 38.99  ? 283 ASN B OD1 1 
ATOM   1846  N ND2 . ASN A 1 288 ? 36.013  -35.267 11.142  1.00 39.56  ? 283 ASN B ND2 1 
ATOM   1847  N N   . PRO A 1 289 ? 35.024  -31.320 12.328  1.00 47.49  ? 284 PRO B N   1 
ATOM   1848  C CA  . PRO A 1 289 ? 35.175  -30.508 13.545  1.00 48.43  ? 284 PRO B CA  1 
ATOM   1849  C C   . PRO A 1 289 ? 36.573  -30.485 14.164  1.00 49.17  ? 284 PRO B C   1 
ATOM   1850  O O   . PRO A 1 289 ? 36.900  -29.576 14.932  1.00 49.93  ? 284 PRO B O   1 
ATOM   1851  C CB  . PRO A 1 289 ? 34.167  -31.137 14.511  1.00 47.98  ? 284 PRO B CB  1 
ATOM   1852  C CG  . PRO A 1 289 ? 33.157  -31.768 13.610  1.00 49.06  ? 284 PRO B CG  1 
ATOM   1853  C CD  . PRO A 1 289 ? 34.020  -32.377 12.548  1.00 48.30  ? 284 PRO B CD  1 
ATOM   1854  N N   . TRP A 1 290 ? 37.394  -31.477 13.825  1.00 49.63  ? 285 TRP B N   1 
ATOM   1855  C CA  . TRP A 1 290 ? 38.730  -31.590 14.395  1.00 47.83  ? 285 TRP B CA  1 
ATOM   1856  C C   . TRP A 1 290 ? 39.856  -31.152 13.485  1.00 46.51  ? 285 TRP B C   1 
ATOM   1857  O O   . TRP A 1 290 ? 41.027  -31.402 13.779  1.00 45.96  ? 285 TRP B O   1 
ATOM   1858  C CB  . TRP A 1 290 ? 38.953  -33.029 14.840  1.00 48.23  ? 285 TRP B CB  1 
ATOM   1859  C CG  . TRP A 1 290 ? 37.841  -33.511 15.709  1.00 49.50  ? 285 TRP B CG  1 
ATOM   1860  C CD1 . TRP A 1 290 ? 36.963  -34.521 15.436  1.00 51.01  ? 285 TRP B CD1 1 
ATOM   1861  C CD2 . TRP A 1 290 ? 37.473  -32.993 16.991  1.00 49.81  ? 285 TRP B CD2 1 
ATOM   1862  N NE1 . TRP A 1 290 ? 36.068  -34.665 16.474  1.00 51.92  ? 285 TRP B NE1 1 
ATOM   1863  C CE2 . TRP A 1 290 ? 36.359  -33.740 17.441  1.00 50.75  ? 285 TRP B CE2 1 
ATOM   1864  C CE3 . TRP A 1 290 ? 37.973  -31.965 17.803  1.00 51.14  ? 285 TRP B CE3 1 
ATOM   1865  C CZ2 . TRP A 1 290 ? 35.743  -33.499 18.673  1.00 51.49  ? 285 TRP B CZ2 1 
ATOM   1866  C CZ3 . TRP A 1 290 ? 37.360  -31.723 19.031  1.00 52.07  ? 285 TRP B CZ3 1 
ATOM   1867  C CH2 . TRP A 1 290 ? 36.254  -32.488 19.451  1.00 52.51  ? 285 TRP B CH2 1 
ATOM   1868  N N   . VAL A 1 291 ? 39.500  -30.485 12.391  1.00 46.46  ? 286 VAL B N   1 
ATOM   1869  C CA  . VAL A 1 291 ? 40.483  -29.998 11.432  1.00 47.51  ? 286 VAL B CA  1 
ATOM   1870  C C   . VAL A 1 291 ? 40.525  -28.469 11.425  1.00 47.69  ? 286 VAL B C   1 
ATOM   1871  O O   . VAL A 1 291 ? 39.501  -27.828 11.205  1.00 46.16  ? 286 VAL B O   1 
ATOM   1872  C CB  . VAL A 1 291 ? 40.147  -30.503 9.992   1.00 47.27  ? 286 VAL B CB  1 
ATOM   1873  C CG1 . VAL A 1 291 ? 41.178  -29.976 8.983   1.00 44.78  ? 286 VAL B CG1 1 
ATOM   1874  C CG2 . VAL A 1 291 ? 40.105  -32.027 9.971   1.00 44.59  ? 286 VAL B CG2 1 
ATOM   1875  N N   . GLU A 1 292 ? 41.703  -27.892 11.675  1.00 50.86  ? 287 GLU B N   1 
ATOM   1876  C CA  . GLU A 1 292 ? 41.853  -26.436 11.662  1.00 55.16  ? 287 GLU B CA  1 
ATOM   1877  C C   . GLU A 1 292 ? 41.631  -25.969 10.226  1.00 54.35  ? 287 GLU B C   1 
ATOM   1878  O O   . GLU A 1 292 ? 40.768  -25.128 9.960   1.00 55.61  ? 287 GLU B O   1 
ATOM   1879  C CB  . GLU A 1 292 ? 43.251  -26.012 12.120  1.00 60.16  ? 287 GLU B CB  1 
ATOM   1880  C CG  . GLU A 1 292 ? 43.282  -25.062 13.332  1.00 70.93  ? 287 GLU B CG  1 
ATOM   1881  C CD  . GLU A 1 292 ? 42.432  -23.793 13.170  1.00 76.66  ? 287 GLU B CD  1 
ATOM   1882  O OE1 . GLU A 1 292 ? 42.844  -22.734 13.695  1.00 79.85  ? 287 GLU B OE1 1 
ATOM   1883  O OE2 . GLU A 1 292 ? 41.350  -23.846 12.544  1.00 80.30  ? 287 GLU B OE2 1 
ATOM   1884  N N   . LYS A 1 293 ? 42.429  -26.509 9.308   1.00 52.63  ? 288 LYS B N   1 
ATOM   1885  C CA  . LYS A 1 293 ? 42.295  -26.187 7.890   1.00 50.18  ? 288 LYS B CA  1 
ATOM   1886  C C   . LYS A 1 293 ? 42.983  -27.220 7.004   1.00 48.01  ? 288 LYS B C   1 
ATOM   1887  O O   . LYS A 1 293 ? 43.822  -28.000 7.463   1.00 48.35  ? 288 LYS B O   1 
ATOM   1888  C CB  . LYS A 1 293 ? 42.828  -24.786 7.577   1.00 50.70  ? 288 LYS B CB  1 
ATOM   1889  C CG  . LYS A 1 293 ? 44.324  -24.647 7.482   1.00 50.82  ? 288 LYS B CG  1 
ATOM   1890  C CD  . LYS A 1 293 ? 44.645  -23.235 7.026   1.00 52.16  ? 288 LYS B CD  1 
ATOM   1891  C CE  . LYS A 1 293 ? 46.133  -22.983 6.945   1.00 53.39  ? 288 LYS B CE  1 
ATOM   1892  N NZ  . LYS A 1 293 ? 46.417  -21.582 6.530   1.00 52.51  ? 288 LYS B NZ  1 
ATOM   1893  N N   . VAL A 1 294 ? 42.614  -27.217 5.730   1.00 44.84  ? 289 VAL B N   1 
ATOM   1894  C CA  . VAL A 1 294 ? 43.152  -28.164 4.766   1.00 40.02  ? 289 VAL B CA  1 
ATOM   1895  C C   . VAL A 1 294 ? 43.906  -27.471 3.643   1.00 38.88  ? 289 VAL B C   1 
ATOM   1896  O O   . VAL A 1 294 ? 43.566  -26.362 3.243   1.00 39.72  ? 289 VAL B O   1 
ATOM   1897  C CB  . VAL A 1 294 ? 42.014  -28.999 4.139   1.00 38.60  ? 289 VAL B CB  1 
ATOM   1898  C CG1 . VAL A 1 294 ? 42.578  -30.001 3.164   1.00 37.36  ? 289 VAL B CG1 1 
ATOM   1899  C CG2 . VAL A 1 294 ? 41.208  -29.701 5.234   1.00 38.25  ? 289 VAL B CG2 1 
ATOM   1900  N N   . ILE A 1 295 ? 44.945  -28.125 3.146   1.00 37.67  ? 290 ILE B N   1 
ATOM   1901  C CA  . ILE A 1 295 ? 45.716  -27.591 2.038   1.00 36.60  ? 290 ILE B CA  1 
ATOM   1902  C C   . ILE A 1 295 ? 45.711  -28.623 0.930   1.00 36.92  ? 290 ILE B C   1 
ATOM   1903  O O   . ILE A 1 295 ? 46.502  -29.557 0.949   1.00 37.61  ? 290 ILE B O   1 
ATOM   1904  C CB  . ILE A 1 295 ? 47.161  -27.320 2.416   1.00 36.64  ? 290 ILE B CB  1 
ATOM   1905  C CG1 . ILE A 1 295 ? 47.209  -26.386 3.623   1.00 37.63  ? 290 ILE B CG1 1 
ATOM   1906  C CG2 . ILE A 1 295 ? 47.893  -26.733 1.214   1.00 34.72  ? 290 ILE B CG2 1 
ATOM   1907  C CD1 . ILE A 1 295 ? 46.425  -25.090 3.427   1.00 41.23  ? 290 ILE B CD1 1 
ATOM   1908  N N   . TYR A 1 296 ? 44.800  -28.464 -0.020  1.00 37.91  ? 291 TYR B N   1 
ATOM   1909  C CA  . TYR A 1 296 ? 44.687  -29.381 -1.145  1.00 38.01  ? 291 TYR B CA  1 
ATOM   1910  C C   . TYR A 1 296 ? 44.344  -28.580 -2.404  1.00 39.56  ? 291 TYR B C   1 
ATOM   1911  O O   . TYR A 1 296 ? 43.287  -27.944 -2.485  1.00 39.75  ? 291 TYR B O   1 
ATOM   1912  C CB  . TYR A 1 296 ? 43.604  -30.424 -0.864  1.00 36.72  ? 291 TYR B CB  1 
ATOM   1913  C CG  . TYR A 1 296 ? 43.511  -31.469 -1.943  1.00 37.09  ? 291 TYR B CG  1 
ATOM   1914  C CD1 . TYR A 1 296 ? 44.589  -32.306 -2.218  1.00 37.97  ? 291 TYR B CD1 1 
ATOM   1915  C CD2 . TYR A 1 296 ? 42.365  -31.587 -2.727  1.00 36.40  ? 291 TYR B CD2 1 
ATOM   1916  C CE1 . TYR A 1 296 ? 44.531  -33.231 -3.253  1.00 38.82  ? 291 TYR B CE1 1 
ATOM   1917  C CE2 . TYR A 1 296 ? 42.293  -32.502 -3.762  1.00 36.49  ? 291 TYR B CE2 1 
ATOM   1918  C CZ  . TYR A 1 296 ? 43.380  -33.321 -4.023  1.00 38.47  ? 291 TYR B CZ  1 
ATOM   1919  O OH  . TYR A 1 296 ? 43.323  -34.218 -5.065  1.00 38.42  ? 291 TYR B OH  1 
ATOM   1920  N N   . PRO A 1 297 ? 45.237  -28.601 -3.408  1.00 40.51  ? 292 PRO B N   1 
ATOM   1921  C CA  . PRO A 1 297 ? 45.033  -27.870 -4.666  1.00 40.51  ? 292 PRO B CA  1 
ATOM   1922  C C   . PRO A 1 297 ? 43.654  -28.032 -5.309  1.00 39.58  ? 292 PRO B C   1 
ATOM   1923  O O   . PRO A 1 297 ? 43.127  -27.092 -5.900  1.00 40.73  ? 292 PRO B O   1 
ATOM   1924  C CB  . PRO A 1 297 ? 46.161  -28.397 -5.545  1.00 40.45  ? 292 PRO B CB  1 
ATOM   1925  C CG  . PRO A 1 297 ? 47.263  -28.606 -4.545  1.00 39.59  ? 292 PRO B CG  1 
ATOM   1926  C CD  . PRO A 1 297 ? 46.524  -29.319 -3.428  1.00 39.32  ? 292 PRO B CD  1 
ATOM   1927  N N   . GLY A 1 298 ? 43.068  -29.216 -5.185  1.00 38.84  ? 293 GLY B N   1 
ATOM   1928  C CA  . GLY A 1 298 ? 41.762  -29.455 -5.768  1.00 38.69  ? 293 GLY B CA  1 
ATOM   1929  C C   . GLY A 1 298 ? 40.625  -28.664 -5.140  1.00 39.82  ? 293 GLY B C   1 
ATOM   1930  O O   . GLY A 1 298 ? 39.617  -28.421 -5.807  1.00 40.80  ? 293 GLY B O   1 
ATOM   1931  N N   . LEU A 1 299 ? 40.773  -28.266 -3.873  1.00 38.81  ? 294 LEU B N   1 
ATOM   1932  C CA  . LEU A 1 299 ? 39.737  -27.497 -3.166  1.00 38.16  ? 294 LEU B CA  1 
ATOM   1933  C C   . LEU A 1 299 ? 39.815  -26.004 -3.481  1.00 39.48  ? 294 LEU B C   1 
ATOM   1934  O O   . LEU A 1 299 ? 40.908  -25.439 -3.531  1.00 38.36  ? 294 LEU B O   1 
ATOM   1935  C CB  . LEU A 1 299 ? 39.870  -27.672 -1.650  1.00 36.28  ? 294 LEU B CB  1 
ATOM   1936  C CG  . LEU A 1 299 ? 39.642  -29.054 -1.046  1.00 33.83  ? 294 LEU B CG  1 
ATOM   1937  C CD1 . LEU A 1 299 ? 39.907  -28.994 0.448   1.00 32.93  ? 294 LEU B CD1 1 
ATOM   1938  C CD2 . LEU A 1 299 ? 38.231  -29.515 -1.323  1.00 31.15  ? 294 LEU B CD2 1 
ATOM   1939  N N   . PRO A 1 300 ? 38.651  -25.343 -3.677  1.00 39.76  ? 295 PRO B N   1 
ATOM   1940  C CA  . PRO A 1 300 ? 38.598  -23.907 -3.985  1.00 39.08  ? 295 PRO B CA  1 
ATOM   1941  C C   . PRO A 1 300 ? 39.167  -23.048 -2.854  1.00 42.02  ? 295 PRO B C   1 
ATOM   1942  O O   . PRO A 1 300 ? 39.427  -21.848 -3.028  1.00 39.82  ? 295 PRO B O   1 
ATOM   1943  C CB  . PRO A 1 300 ? 37.112  -23.662 -4.229  1.00 38.64  ? 295 PRO B CB  1 
ATOM   1944  C CG  . PRO A 1 300 ? 36.459  -24.676 -3.351  1.00 38.53  ? 295 PRO B CG  1 
ATOM   1945  C CD  . PRO A 1 300 ? 37.290  -25.904 -3.587  1.00 38.75  ? 295 PRO B CD  1 
ATOM   1946  N N   . SER A 1 301 ? 39.371  -23.689 -1.702  1.00 42.59  ? 296 SER B N   1 
ATOM   1947  C CA  . SER A 1 301 ? 39.919  -23.032 -0.521  1.00 41.79  ? 296 SER B CA  1 
ATOM   1948  C C   . SER A 1 301 ? 41.438  -22.933 -0.588  1.00 42.39  ? 296 SER B C   1 
ATOM   1949  O O   . SER A 1 301 ? 42.060  -22.278 0.251   1.00 42.95  ? 296 SER B O   1 
ATOM   1950  C CB  . SER A 1 301 ? 39.517  -23.791 0.746   1.00 41.59  ? 296 SER B CB  1 
ATOM   1951  O OG  . SER A 1 301 ? 39.875  -25.153 0.657   1.00 40.71  ? 296 SER B OG  1 
ATOM   1952  N N   . HIS A 1 302 ? 42.044  -23.591 -1.571  1.00 41.80  ? 297 HIS B N   1 
ATOM   1953  C CA  . HIS A 1 302 ? 43.492  -23.526 -1.703  1.00 41.36  ? 297 HIS B CA  1 
ATOM   1954  C C   . HIS A 1 302 ? 43.810  -22.127 -2.190  1.00 41.96  ? 297 HIS B C   1 
ATOM   1955  O O   . HIS A 1 302 ? 43.225  -21.659 -3.172  1.00 42.57  ? 297 HIS B O   1 
ATOM   1956  C CB  . HIS A 1 302 ? 44.010  -24.546 -2.719  1.00 40.85  ? 297 HIS B CB  1 
ATOM   1957  C CG  . HIS A 1 302 ? 45.500  -24.547 -2.851  1.00 40.06  ? 297 HIS B CG  1 
ATOM   1958  N ND1 . HIS A 1 302 ? 46.313  -25.377 -2.108  1.00 40.77  ? 297 HIS B ND1 1 
ATOM   1959  C CD2 . HIS A 1 302 ? 46.330  -23.776 -3.593  1.00 39.60  ? 297 HIS B CD2 1 
ATOM   1960  C CE1 . HIS A 1 302 ? 47.577  -25.115 -2.384  1.00 38.88  ? 297 HIS B CE1 1 
ATOM   1961  N NE2 . HIS A 1 302 ? 47.615  -24.147 -3.282  1.00 39.28  ? 297 HIS B NE2 1 
ATOM   1962  N N   . PRO A 1 303 ? 44.730  -21.433 -1.510  1.00 43.07  ? 298 PRO B N   1 
ATOM   1963  C CA  . PRO A 1 303 ? 45.093  -20.073 -1.916  1.00 43.47  ? 298 PRO B CA  1 
ATOM   1964  C C   . PRO A 1 303 ? 45.269  -19.861 -3.422  1.00 44.68  ? 298 PRO B C   1 
ATOM   1965  O O   . PRO A 1 303 ? 44.801  -18.856 -3.963  1.00 46.69  ? 298 PRO B O   1 
ATOM   1966  C CB  . PRO A 1 303 ? 46.372  -19.789 -1.113  1.00 42.82  ? 298 PRO B CB  1 
ATOM   1967  C CG  . PRO A 1 303 ? 46.848  -21.145 -0.670  1.00 43.89  ? 298 PRO B CG  1 
ATOM   1968  C CD  . PRO A 1 303 ? 45.571  -21.884 -0.395  1.00 43.16  ? 298 PRO B CD  1 
ATOM   1969  N N   . GLN A 1 304 ? 45.923  -20.796 -4.105  1.00 44.61  ? 299 GLN B N   1 
ATOM   1970  C CA  . GLN A 1 304 ? 46.130  -20.652 -5.545  1.00 44.55  ? 299 GLN B CA  1 
ATOM   1971  C C   . GLN A 1 304 ? 45.283  -21.621 -6.363  1.00 43.70  ? 299 GLN B C   1 
ATOM   1972  O O   . GLN A 1 304 ? 45.728  -22.129 -7.388  1.00 42.39  ? 299 GLN B O   1 
ATOM   1973  C CB  . GLN A 1 304 ? 47.611  -20.847 -5.894  1.00 45.58  ? 299 GLN B CB  1 
ATOM   1974  C CG  . GLN A 1 304 ? 48.546  -19.966 -5.089  1.00 48.27  ? 299 GLN B CG  1 
ATOM   1975  C CD  . GLN A 1 304 ? 49.369  -20.752 -4.089  1.00 50.95  ? 299 GLN B CD  1 
ATOM   1976  O OE1 . GLN A 1 304 ? 50.390  -21.337 -4.438  1.00 53.65  ? 299 GLN B OE1 1 
ATOM   1977  N NE2 . GLN A 1 304 ? 48.921  -20.782 -2.838  1.00 52.85  ? 299 GLN B NE2 1 
ATOM   1978  N N   . HIS A 1 305 ? 44.058  -21.867 -5.916  1.00 44.34  ? 300 HIS B N   1 
ATOM   1979  C CA  . HIS A 1 305 ? 43.170  -22.782 -6.623  1.00 46.06  ? 300 HIS B CA  1 
ATOM   1980  C C   . HIS A 1 305 ? 42.921  -22.328 -8.055  1.00 47.42  ? 300 HIS B C   1 
ATOM   1981  O O   . HIS A 1 305 ? 42.692  -23.151 -8.939  1.00 46.54  ? 300 HIS B O   1 
ATOM   1982  C CB  . HIS A 1 305 ? 41.827  -22.911 -5.895  1.00 45.21  ? 300 HIS B CB  1 
ATOM   1983  C CG  . HIS A 1 305 ? 40.864  -23.841 -6.569  1.00 44.85  ? 300 HIS B CG  1 
ATOM   1984  N ND1 . HIS A 1 305 ? 41.152  -25.167 -6.806  1.00 45.05  ? 300 HIS B ND1 1 
ATOM   1985  C CD2 . HIS A 1 305 ? 39.631  -23.629 -7.087  1.00 46.61  ? 300 HIS B CD2 1 
ATOM   1986  C CE1 . HIS A 1 305 ? 40.141  -25.732 -7.442  1.00 44.84  ? 300 HIS B CE1 1 
ATOM   1987  N NE2 . HIS A 1 305 ? 39.204  -24.820 -7.626  1.00 45.06  ? 300 HIS B NE2 1 
ATOM   1988  N N   . GLU A 1 306 ? 42.956  -21.020 -8.285  1.00 50.46  ? 301 GLU B N   1 
ATOM   1989  C CA  . GLU A 1 306 ? 42.726  -20.498 -9.626  1.00 52.84  ? 301 GLU B CA  1 
ATOM   1990  C C   . GLU A 1 306 ? 43.886  -20.858 -10.537 1.00 50.58  ? 301 GLU B C   1 
ATOM   1991  O O   . GLU A 1 306 ? 43.678  -21.329 -11.655 1.00 49.67  ? 301 GLU B O   1 
ATOM   1992  C CB  . GLU A 1 306 ? 42.534  -18.980 -9.596  1.00 57.68  ? 301 GLU B CB  1 
ATOM   1993  C CG  . GLU A 1 306 ? 41.206  -18.526 -8.998  1.00 66.17  ? 301 GLU B CG  1 
ATOM   1994  C CD  . GLU A 1 306 ? 39.996  -19.214 -9.628  1.00 70.90  ? 301 GLU B CD  1 
ATOM   1995  O OE1 . GLU A 1 306 ? 39.731  -20.386 -9.290  1.00 74.04  ? 301 GLU B OE1 1 
ATOM   1996  O OE2 . GLU A 1 306 ? 39.311  -18.588 -10.466 1.00 74.27  ? 301 GLU B OE2 1 
ATOM   1997  N N   . LEU A 1 307 ? 45.106  -20.642 -10.049 1.00 48.65  ? 302 LEU B N   1 
ATOM   1998  C CA  . LEU A 1 307 ? 46.309  -20.958 -10.811 1.00 47.05  ? 302 LEU B CA  1 
ATOM   1999  C C   . LEU A 1 307 ? 46.239  -22.430 -11.209 1.00 47.68  ? 302 LEU B C   1 
ATOM   2000  O O   . LEU A 1 307 ? 46.405  -22.785 -12.382 1.00 48.46  ? 302 LEU B O   1 
ATOM   2001  C CB  . LEU A 1 307 ? 47.551  -20.734 -9.958  1.00 44.26  ? 302 LEU B CB  1 
ATOM   2002  C CG  . LEU A 1 307 ? 48.790  -20.279 -10.722 1.00 44.17  ? 302 LEU B CG  1 
ATOM   2003  C CD1 . LEU A 1 307 ? 50.017  -20.546 -9.870  1.00 43.04  ? 302 LEU B CD1 1 
ATOM   2004  C CD2 . LEU A 1 307 ? 48.887  -21.005 -12.048 1.00 43.03  ? 302 LEU B CD2 1 
ATOM   2005  N N   . VAL A 1 308 ? 45.997  -23.273 -10.207 1.00 46.03  ? 303 VAL B N   1 
ATOM   2006  C CA  . VAL A 1 308 ? 45.871  -24.711 -10.393 1.00 43.63  ? 303 VAL B CA  1 
ATOM   2007  C C   . VAL A 1 308 ? 45.033  -24.993 -11.629 1.00 45.34  ? 303 VAL B C   1 
ATOM   2008  O O   . VAL A 1 308 ? 45.552  -25.439 -12.648 1.00 46.81  ? 303 VAL B O   1 
ATOM   2009  C CB  . VAL A 1 308 ? 45.180  -25.378 -9.169  1.00 41.48  ? 303 VAL B CB  1 
ATOM   2010  C CG1 . VAL A 1 308 ? 44.873  -26.836 -9.465  1.00 38.64  ? 303 VAL B CG1 1 
ATOM   2011  C CG2 . VAL A 1 308 ? 46.071  -25.268 -7.940  1.00 39.79  ? 303 VAL B CG2 1 
ATOM   2012  N N   . LYS A 1 309 ? 43.739  -24.706 -11.536 1.00 46.20  ? 304 LYS B N   1 
ATOM   2013  C CA  . LYS A 1 309 ? 42.811  -24.946 -12.633 1.00 45.98  ? 304 LYS B CA  1 
ATOM   2014  C C   . LYS A 1 309 ? 43.324  -24.546 -14.011 1.00 46.17  ? 304 LYS B C   1 
ATOM   2015  O O   . LYS A 1 309 ? 43.009  -25.210 -14.997 1.00 46.62  ? 304 LYS B O   1 
ATOM   2016  C CB  . LYS A 1 309 ? 41.464  -24.260 -12.361 1.00 47.75  ? 304 LYS B CB  1 
ATOM   2017  C CG  . LYS A 1 309 ? 40.640  -24.897 -11.237 1.00 47.90  ? 304 LYS B CG  1 
ATOM   2018  C CD  . LYS A 1 309 ? 39.216  -24.341 -11.184 1.00 49.55  ? 304 LYS B CD  1 
ATOM   2019  C CE  . LYS A 1 309 ? 39.197  -22.816 -11.033 1.00 49.09  ? 304 LYS B CE  1 
ATOM   2020  N NZ  . LYS A 1 309 ? 37.809  -22.258 -10.934 1.00 49.57  ? 304 LYS B NZ  1 
ATOM   2021  N N   . ARG A 1 310 ? 44.108  -23.479 -14.102 1.00 45.38  ? 305 ARG B N   1 
ATOM   2022  C CA  . ARG A 1 310 ? 44.606  -23.078 -15.411 1.00 47.03  ? 305 ARG B CA  1 
ATOM   2023  C C   . ARG A 1 310 ? 46.040  -23.553 -15.664 1.00 46.09  ? 305 ARG B C   1 
ATOM   2024  O O   . ARG A 1 310 ? 46.735  -23.042 -16.549 1.00 47.14  ? 305 ARG B O   1 
ATOM   2025  C CB  . ARG A 1 310 ? 44.523  -21.558 -15.576 1.00 49.60  ? 305 ARG B CB  1 
ATOM   2026  C CG  . ARG A 1 310 ? 45.519  -20.782 -14.741 1.00 54.30  ? 305 ARG B CG  1 
ATOM   2027  C CD  . ARG A 1 310 ? 45.819  -19.423 -15.364 1.00 57.24  ? 305 ARG B CD  1 
ATOM   2028  N NE  . ARG A 1 310 ? 46.878  -18.734 -14.637 1.00 59.94  ? 305 ARG B NE  1 
ATOM   2029  C CZ  . ARG A 1 310 ? 46.698  -18.094 -13.488 1.00 62.31  ? 305 ARG B CZ  1 
ATOM   2030  N NH1 . ARG A 1 310 ? 45.488  -18.040 -12.934 1.00 62.00  ? 305 ARG B NH1 1 
ATOM   2031  N NH2 . ARG A 1 310 ? 47.736  -17.528 -12.881 1.00 64.13  ? 305 ARG B NH2 1 
ATOM   2032  N N   . GLN A 1 311 ? 46.479  -24.544 -14.895 1.00 43.67  ? 306 GLN B N   1 
ATOM   2033  C CA  . GLN A 1 311 ? 47.832  -25.062 -15.044 1.00 41.15  ? 306 GLN B CA  1 
ATOM   2034  C C   . GLN A 1 311 ? 47.922  -26.589 -14.934 1.00 40.89  ? 306 GLN B C   1 
ATOM   2035  O O   . GLN A 1 311 ? 48.892  -27.199 -15.397 1.00 40.16  ? 306 GLN B O   1 
ATOM   2036  C CB  . GLN A 1 311 ? 48.747  -24.401 -14.007 1.00 36.82  ? 306 GLN B CB  1 
ATOM   2037  C CG  . GLN A 1 311 ? 50.087  -25.055 -13.872 1.00 32.76  ? 306 GLN B CG  1 
ATOM   2038  C CD  . GLN A 1 311 ? 51.012  -24.302 -12.955 1.00 32.16  ? 306 GLN B CD  1 
ATOM   2039  O OE1 . GLN A 1 311 ? 51.476  -23.203 -13.275 1.00 29.70  ? 306 GLN B OE1 1 
ATOM   2040  N NE2 . GLN A 1 311 ? 51.293  -24.891 -11.800 1.00 32.97  ? 306 GLN B NE2 1 
ATOM   2041  N N   . CYS A 1 312 ? 46.902  -27.198 -14.334 1.00 39.17  ? 307 CYS B N   1 
ATOM   2042  C CA  . CYS A 1 312 ? 46.870  -28.638 -14.143 1.00 38.39  ? 307 CYS B CA  1 
ATOM   2043  C C   . CYS A 1 312 ? 45.552  -29.179 -14.639 1.00 38.01  ? 307 CYS B C   1 
ATOM   2044  O O   . CYS A 1 312 ? 44.584  -28.433 -14.772 1.00 38.52  ? 307 CYS B O   1 
ATOM   2045  C CB  . CYS A 1 312 ? 47.009  -28.972 -12.664 1.00 39.20  ? 307 CYS B CB  1 
ATOM   2046  S SG  . CYS A 1 312 ? 48.265  -27.990 -11.800 1.00 47.46  ? 307 CYS B SG  1 
ATOM   2047  N N   . THR A 1 313 ? 45.514  -30.481 -14.905 1.00 37.02  ? 308 THR B N   1 
ATOM   2048  C CA  . THR A 1 313 ? 44.298  -31.131 -15.382 1.00 35.15  ? 308 THR B CA  1 
ATOM   2049  C C   . THR A 1 313 ? 43.622  -31.824 -14.213 1.00 33.07  ? 308 THR B C   1 
ATOM   2050  O O   . THR A 1 313 ? 42.522  -32.348 -14.355 1.00 35.03  ? 308 THR B O   1 
ATOM   2051  C CB  . THR A 1 313 ? 44.600  -32.203 -16.461 1.00 35.53  ? 308 THR B CB  1 
ATOM   2052  O OG1 . THR A 1 313 ? 45.341  -33.279 -15.869 1.00 36.97  ? 308 THR B OG1 1 
ATOM   2053  C CG2 . THR A 1 313 ? 45.408  -31.609 -17.612 1.00 34.67  ? 308 THR B CG2 1 
ATOM   2054  N N   . GLY A 1 314 ? 44.291  -31.820 -13.063 1.00 31.80  ? 309 GLY B N   1 
ATOM   2055  C CA  . GLY A 1 314 ? 43.762  -32.467 -11.872 1.00 31.73  ? 309 GLY B CA  1 
ATOM   2056  C C   . GLY A 1 314 ? 44.781  -32.439 -10.743 1.00 32.09  ? 309 GLY B C   1 
ATOM   2057  O O   . GLY A 1 314 ? 45.764  -31.702 -10.817 1.00 30.84  ? 309 GLY B O   1 
ATOM   2058  N N   . CYS A 1 315 ? 44.565  -33.242 -9.702  1.00 34.77  ? 310 CYS B N   1 
ATOM   2059  C CA  . CYS A 1 315 ? 45.484  -33.264 -8.559  1.00 37.48  ? 310 CYS B CA  1 
ATOM   2060  C C   . CYS A 1 315 ? 45.845  -34.650 -8.054  1.00 34.59  ? 310 CYS B C   1 
ATOM   2061  O O   . CYS A 1 315 ? 45.109  -35.614 -8.240  1.00 32.42  ? 310 CYS B O   1 
ATOM   2062  C CB  . CYS A 1 315 ? 44.904  -32.470 -7.381  1.00 40.98  ? 310 CYS B CB  1 
ATOM   2063  S SG  . CYS A 1 315 ? 44.349  -30.788 -7.774  1.00 48.52  ? 310 CYS B SG  1 
ATOM   2064  N N   . THR A 1 316 ? 46.988  -34.704 -7.380  1.00 36.22  ? 311 THR B N   1 
ATOM   2065  C CA  . THR A 1 316 ? 47.567  -35.914 -6.794  1.00 36.76  ? 311 THR B CA  1 
ATOM   2066  C C   . THR A 1 316 ? 46.796  -36.324 -5.540  1.00 35.57  ? 311 THR B C   1 
ATOM   2067  O O   . THR A 1 316 ? 45.818  -35.685 -5.169  1.00 36.85  ? 311 THR B O   1 
ATOM   2068  C CB  . THR A 1 316 ? 49.045  -35.641 -6.419  1.00 37.41  ? 311 THR B CB  1 
ATOM   2069  O OG1 . THR A 1 316 ? 49.782  -35.326 -7.605  1.00 39.61  ? 311 THR B OG1 1 
ATOM   2070  C CG2 . THR A 1 316 ? 49.675  -36.838 -5.753  1.00 42.62  ? 311 THR B CG2 1 
ATOM   2071  N N   . GLY A 1 317 ? 47.235  -37.387 -4.883  1.00 33.88  ? 312 GLY B N   1 
ATOM   2072  C CA  . GLY A 1 317 ? 46.560  -37.816 -3.676  1.00 33.85  ? 312 GLY B CA  1 
ATOM   2073  C C   . GLY A 1 317 ? 47.170  -37.210 -2.423  1.00 33.61  ? 312 GLY B C   1 
ATOM   2074  O O   . GLY A 1 317 ? 46.780  -37.561 -1.310  1.00 31.53  ? 312 GLY B O   1 
ATOM   2075  N N   . MET A 1 318 ? 48.136  -36.310 -2.598  1.00 34.41  ? 313 MET B N   1 
ATOM   2076  C CA  . MET A 1 318 ? 48.783  -35.664 -1.459  1.00 36.02  ? 313 MET B CA  1 
ATOM   2077  C C   . MET A 1 318 ? 47.928  -34.571 -0.802  1.00 34.78  ? 313 MET B C   1 
ATOM   2078  O O   . MET A 1 318 ? 47.877  -33.430 -1.266  1.00 35.17  ? 313 MET B O   1 
ATOM   2079  C CB  . MET A 1 318 ? 50.131  -35.072 -1.875  1.00 38.99  ? 313 MET B CB  1 
ATOM   2080  C CG  . MET A 1 318 ? 50.756  -34.197 -0.796  1.00 45.00  ? 313 MET B CG  1 
ATOM   2081  S SD  . MET A 1 318 ? 52.483  -33.748 -1.089  1.00 51.38  ? 313 MET B SD  1 
ATOM   2082  C CE  . MET A 1 318 ? 52.301  -32.407 -2.359  1.00 54.86  ? 313 MET B CE  1 
ATOM   2083  N N   . VAL A 1 319 ? 47.262  -34.933 0.288   1.00 32.88  ? 314 VAL B N   1 
ATOM   2084  C CA  . VAL A 1 319 ? 46.423  -34.001 1.023   1.00 30.18  ? 314 VAL B CA  1 
ATOM   2085  C C   . VAL A 1 319 ? 47.114  -33.558 2.309   1.00 31.52  ? 314 VAL B C   1 
ATOM   2086  O O   . VAL A 1 319 ? 47.501  -34.389 3.125   1.00 31.41  ? 314 VAL B O   1 
ATOM   2087  C CB  . VAL A 1 319 ? 45.092  -34.646 1.410   1.00 29.68  ? 314 VAL B CB  1 
ATOM   2088  C CG1 . VAL A 1 319 ? 44.211  -33.627 2.103   1.00 28.90  ? 314 VAL B CG1 1 
ATOM   2089  C CG2 . VAL A 1 319 ? 44.405  -35.206 0.180   1.00 28.54  ? 314 VAL B CG2 1 
ATOM   2090  N N   . THR A 1 320 ? 47.267  -32.248 2.481   1.00 31.60  ? 315 THR B N   1 
ATOM   2091  C CA  . THR A 1 320 ? 47.893  -31.684 3.677   1.00 29.79  ? 315 THR B CA  1 
ATOM   2092  C C   . THR A 1 320 ? 46.827  -31.036 4.569   1.00 30.96  ? 315 THR B C   1 
ATOM   2093  O O   . THR A 1 320 ? 45.921  -30.369 4.084   1.00 30.51  ? 315 THR B O   1 
ATOM   2094  C CB  . THR A 1 320 ? 48.944  -30.621 3.297   1.00 27.93  ? 315 THR B CB  1 
ATOM   2095  O OG1 . THR A 1 320 ? 50.021  -31.253 2.597   1.00 27.16  ? 315 THR B OG1 1 
ATOM   2096  C CG2 . THR A 1 320 ? 49.485  -29.931 4.534   1.00 25.48  ? 315 THR B CG2 1 
ATOM   2097  N N   . PHE A 1 321 ? 46.920  -31.234 5.873   1.00 32.02  ? 316 PHE B N   1 
ATOM   2098  C CA  . PHE A 1 321 ? 45.928  -30.629 6.741   1.00 34.95  ? 316 PHE B CA  1 
ATOM   2099  C C   . PHE A 1 321 ? 46.482  -30.433 8.139   1.00 36.19  ? 316 PHE B C   1 
ATOM   2100  O O   . PHE A 1 321 ? 47.436  -31.100 8.542   1.00 36.33  ? 316 PHE B O   1 
ATOM   2101  C CB  . PHE A 1 321 ? 44.652  -31.486 6.774   1.00 33.99  ? 316 PHE B CB  1 
ATOM   2102  C CG  . PHE A 1 321 ? 44.719  -32.668 7.710   1.00 36.16  ? 316 PHE B CG  1 
ATOM   2103  C CD1 . PHE A 1 321 ? 44.475  -32.511 9.074   1.00 34.29  ? 316 PHE B CD1 1 
ATOM   2104  C CD2 . PHE A 1 321 ? 44.993  -33.950 7.221   1.00 36.03  ? 316 PHE B CD2 1 
ATOM   2105  C CE1 . PHE A 1 321 ? 44.496  -33.614 9.940   1.00 36.32  ? 316 PHE B CE1 1 
ATOM   2106  C CE2 . PHE A 1 321 ? 45.017  -35.063 8.080   1.00 36.27  ? 316 PHE B CE2 1 
ATOM   2107  C CZ  . PHE A 1 321 ? 44.767  -34.895 9.442   1.00 35.86  ? 316 PHE B CZ  1 
ATOM   2108  N N   . TYR A 1 322 ? 45.878  -29.499 8.866   1.00 38.61  ? 317 TYR B N   1 
ATOM   2109  C CA  . TYR A 1 322 ? 46.290  -29.181 10.230  1.00 38.21  ? 317 TYR B CA  1 
ATOM   2110  C C   . TYR A 1 322 ? 45.263  -29.706 11.200  1.00 37.89  ? 317 TYR B C   1 
ATOM   2111  O O   . TYR A 1 322 ? 44.089  -29.343 11.108  1.00 39.59  ? 317 TYR B O   1 
ATOM   2112  C CB  . TYR A 1 322 ? 46.407  -27.673 10.404  1.00 35.63  ? 317 TYR B CB  1 
ATOM   2113  C CG  . TYR A 1 322 ? 47.454  -27.057 9.513   1.00 35.90  ? 317 TYR B CG  1 
ATOM   2114  C CD1 . TYR A 1 322 ? 47.232  -26.877 8.142   1.00 33.90  ? 317 TYR B CD1 1 
ATOM   2115  C CD2 . TYR A 1 322 ? 48.679  -26.656 10.042  1.00 36.49  ? 317 TYR B CD2 1 
ATOM   2116  C CE1 . TYR A 1 322 ? 48.210  -26.306 7.330   1.00 33.09  ? 317 TYR B CE1 1 
ATOM   2117  C CE2 . TYR A 1 322 ? 49.656  -26.088 9.242   1.00 35.46  ? 317 TYR B CE2 1 
ATOM   2118  C CZ  . TYR A 1 322 ? 49.419  -25.911 7.898   1.00 34.32  ? 317 TYR B CZ  1 
ATOM   2119  O OH  . TYR A 1 322 ? 50.395  -25.294 7.164   1.00 35.37  ? 317 TYR B OH  1 
ATOM   2120  N N   . ILE A 1 323 ? 45.687  -30.563 12.123  1.00 37.75  ? 318 ILE B N   1 
ATOM   2121  C CA  . ILE A 1 323 ? 44.739  -31.090 13.085  1.00 39.83  ? 318 ILE B CA  1 
ATOM   2122  C C   . ILE A 1 323 ? 44.474  -30.042 14.160  1.00 42.51  ? 318 ILE B C   1 
ATOM   2123  O O   . ILE A 1 323 ? 45.384  -29.357 14.625  1.00 40.83  ? 318 ILE B O   1 
ATOM   2124  C CB  . ILE A 1 323 ? 45.241  -32.391 13.749  1.00 39.60  ? 318 ILE B CB  1 
ATOM   2125  C CG1 . ILE A 1 323 ? 44.066  -33.062 14.480  1.00 40.99  ? 318 ILE B CG1 1 
ATOM   2126  C CG2 . ILE A 1 323 ? 46.409  -32.091 14.698  1.00 37.96  ? 318 ILE B CG2 1 
ATOM   2127  C CD1 . ILE A 1 323 ? 44.307  -34.504 14.921  1.00 40.00  ? 318 ILE B CD1 1 
ATOM   2128  N N   . LYS A 1 324 ? 43.211  -29.891 14.529  1.00 45.84  ? 319 LYS B N   1 
ATOM   2129  C CA  . LYS A 1 324 ? 42.848  -28.928 15.555  1.00 48.47  ? 319 LYS B CA  1 
ATOM   2130  C C   . LYS A 1 324 ? 43.495  -29.422 16.851  1.00 48.98  ? 319 LYS B C   1 
ATOM   2131  O O   . LYS A 1 324 ? 43.395  -30.607 17.183  1.00 50.49  ? 319 LYS B O   1 
ATOM   2132  C CB  . LYS A 1 324 ? 41.323  -28.889 15.705  1.00 52.21  ? 319 LYS B CB  1 
ATOM   2133  C CG  . LYS A 1 324 ? 40.701  -27.507 15.590  1.00 55.93  ? 319 LYS B CG  1 
ATOM   2134  C CD  . LYS A 1 324 ? 39.184  -27.603 15.556  1.00 59.69  ? 319 LYS B CD  1 
ATOM   2135  C CE  . LYS A 1 324 ? 38.537  -26.229 15.473  1.00 63.49  ? 319 LYS B CE  1 
ATOM   2136  N NZ  . LYS A 1 324 ? 39.011  -25.474 14.282  1.00 66.67  ? 319 LYS B NZ  1 
ATOM   2137  N N   . GLY A 1 325 ? 44.184  -28.539 17.569  1.00 48.04  ? 320 GLY B N   1 
ATOM   2138  C CA  . GLY A 1 325 ? 44.792  -28.965 18.818  1.00 46.24  ? 320 GLY B CA  1 
ATOM   2139  C C   . GLY A 1 325 ? 46.285  -28.779 19.003  1.00 45.24  ? 320 GLY B C   1 
ATOM   2140  O O   . GLY A 1 325 ? 46.862  -27.779 18.584  1.00 45.37  ? 320 GLY B O   1 
ATOM   2141  N N   . THR A 1 326 ? 46.906  -29.767 19.635  1.00 45.02  ? 321 THR B N   1 
ATOM   2142  C CA  . THR A 1 326 ? 48.331  -29.734 19.930  1.00 45.42  ? 321 THR B CA  1 
ATOM   2143  C C   . THR A 1 326 ? 49.096  -30.881 19.298  1.00 45.51  ? 321 THR B C   1 
ATOM   2144  O O   . THR A 1 326 ? 48.503  -31.825 18.778  1.00 46.40  ? 321 THR B O   1 
ATOM   2145  C CB  . THR A 1 326 ? 48.539  -29.809 21.436  1.00 45.37  ? 321 THR B CB  1 
ATOM   2146  O OG1 . THR A 1 326 ? 47.821  -28.733 22.044  1.00 46.84  ? 321 THR B OG1 1 
ATOM   2147  C CG2 . THR A 1 326 ? 50.021  -29.716 21.800  1.00 47.30  ? 321 THR B CG2 1 
ATOM   2148  N N   . LEU A 1 327 ? 50.421  -30.790 19.347  1.00 44.96  ? 322 LEU B N   1 
ATOM   2149  C CA  . LEU A 1 327 ? 51.276  -31.835 18.812  1.00 46.11  ? 322 LEU B CA  1 
ATOM   2150  C C   . LEU A 1 327 ? 50.821  -33.181 19.381  1.00 49.95  ? 322 LEU B C   1 
ATOM   2151  O O   . LEU A 1 327 ? 50.937  -34.226 18.733  1.00 50.74  ? 322 LEU B O   1 
ATOM   2152  C CB  . LEU A 1 327 ? 52.724  -31.567 19.210  1.00 39.41  ? 322 LEU B CB  1 
ATOM   2153  C CG  . LEU A 1 327 ? 53.713  -32.708 18.991  1.00 35.64  ? 322 LEU B CG  1 
ATOM   2154  C CD1 . LEU A 1 327 ? 53.825  -33.066 17.522  1.00 33.03  ? 322 LEU B CD1 1 
ATOM   2155  C CD2 . LEU A 1 327 ? 55.047  -32.273 19.531  1.00 34.36  ? 322 LEU B CD2 1 
ATOM   2156  N N   . GLN A 1 328 ? 50.284  -33.147 20.594  1.00 55.39  ? 323 GLN B N   1 
ATOM   2157  C CA  . GLN A 1 328 ? 49.839  -34.368 21.227  1.00 60.86  ? 323 GLN B CA  1 
ATOM   2158  C C   . GLN A 1 328 ? 48.602  -34.926 20.549  1.00 57.57  ? 323 GLN B C   1 
ATOM   2159  O O   . GLN A 1 328 ? 48.408  -36.136 20.526  1.00 58.42  ? 323 GLN B O   1 
ATOM   2160  C CB  . GLN A 1 328 ? 49.573  -34.142 22.718  1.00 70.07  ? 323 GLN B CB  1 
ATOM   2161  C CG  . GLN A 1 328 ? 49.656  -35.436 23.535  1.00 85.81  ? 323 GLN B CG  1 
ATOM   2162  C CD  . GLN A 1 328 ? 49.387  -35.245 25.021  1.00 94.34  ? 323 GLN B CD  1 
ATOM   2163  O OE1 . GLN A 1 328 ? 49.475  -36.196 25.802  1.00 99.79  ? 323 GLN B OE1 1 
ATOM   2164  N NE2 . GLN A 1 328 ? 49.057  -34.018 25.419  1.00 100.01 ? 323 GLN B NE2 1 
ATOM   2165  N N   . HIS A 1 329 ? 47.762  -34.057 19.996  1.00 55.09  ? 324 HIS B N   1 
ATOM   2166  C CA  . HIS A 1 329 ? 46.559  -34.530 19.318  1.00 52.83  ? 324 HIS B CA  1 
ATOM   2167  C C   . HIS A 1 329 ? 46.944  -35.169 17.999  1.00 50.43  ? 324 HIS B C   1 
ATOM   2168  O O   . HIS A 1 329 ? 46.365  -36.177 17.603  1.00 49.04  ? 324 HIS B O   1 
ATOM   2169  C CB  . HIS A 1 329 ? 45.581  -33.393 19.041  1.00 54.71  ? 324 HIS B CB  1 
ATOM   2170  C CG  . HIS A 1 329 ? 45.011  -32.769 20.273  1.00 57.57  ? 324 HIS B CG  1 
ATOM   2171  N ND1 . HIS A 1 329 ? 45.754  -31.973 21.118  1.00 58.20  ? 324 HIS B ND1 1 
ATOM   2172  C CD2 . HIS A 1 329 ? 43.762  -32.813 20.795  1.00 58.48  ? 324 HIS B CD2 1 
ATOM   2173  C CE1 . HIS A 1 329 ? 44.987  -31.552 22.107  1.00 59.62  ? 324 HIS B CE1 1 
ATOM   2174  N NE2 . HIS A 1 329 ? 43.773  -32.046 21.934  1.00 59.94  ? 324 HIS B NE2 1 
ATOM   2175  N N   . ALA A 1 330 ? 47.919  -34.577 17.318  1.00 48.25  ? 325 ALA B N   1 
ATOM   2176  C CA  . ALA A 1 330 ? 48.373  -35.116 16.044  1.00 49.46  ? 325 ALA B CA  1 
ATOM   2177  C C   . ALA A 1 330 ? 48.904  -36.528 16.280  1.00 50.91  ? 325 ALA B C   1 
ATOM   2178  O O   . ALA A 1 330 ? 48.705  -37.430 15.460  1.00 50.25  ? 325 ALA B O   1 
ATOM   2179  C CB  . ALA A 1 330 ? 49.455  -34.235 15.461  1.00 46.44  ? 325 ALA B CB  1 
ATOM   2180  N N   . GLU A 1 331 ? 49.573  -36.705 17.416  1.00 54.45  ? 326 GLU B N   1 
ATOM   2181  C CA  . GLU A 1 331 ? 50.124  -37.995 17.800  1.00 56.64  ? 326 GLU B CA  1 
ATOM   2182  C C   . GLU A 1 331 ? 49.009  -39.003 18.030  1.00 52.50  ? 326 GLU B C   1 
ATOM   2183  O O   . GLU A 1 331 ? 49.068  -40.126 17.534  1.00 51.10  ? 326 GLU B O   1 
ATOM   2184  C CB  . GLU A 1 331 ? 50.961  -37.853 19.070  1.00 66.32  ? 326 GLU B CB  1 
ATOM   2185  C CG  . GLU A 1 331 ? 52.422  -37.556 18.806  1.00 80.93  ? 326 GLU B CG  1 
ATOM   2186  C CD  . GLU A 1 331 ? 53.091  -38.667 18.015  1.00 89.48  ? 326 GLU B CD  1 
ATOM   2187  O OE1 . GLU A 1 331 ? 53.106  -39.818 18.499  1.00 95.71  ? 326 GLU B OE1 1 
ATOM   2188  O OE2 . GLU A 1 331 ? 53.599  -38.393 16.907  1.00 94.96  ? 326 GLU B OE2 1 
ATOM   2189  N N   . ILE A 1 332 ? 47.992  -38.604 18.786  1.00 49.14  ? 327 ILE B N   1 
ATOM   2190  C CA  . ILE A 1 332 ? 46.869  -39.498 19.058  1.00 47.88  ? 327 ILE B CA  1 
ATOM   2191  C C   . ILE A 1 332 ? 46.288  -39.939 17.718  1.00 48.81  ? 327 ILE B C   1 
ATOM   2192  O O   . ILE A 1 332 ? 46.067  -41.123 17.485  1.00 49.28  ? 327 ILE B O   1 
ATOM   2193  C CB  . ILE A 1 332 ? 45.744  -38.797 19.874  1.00 45.95  ? 327 ILE B CB  1 
ATOM   2194  C CG1 . ILE A 1 332 ? 46.302  -38.201 21.178  1.00 45.06  ? 327 ILE B CG1 1 
ATOM   2195  C CG2 . ILE A 1 332 ? 44.638  -39.786 20.176  1.00 41.61  ? 327 ILE B CG2 1 
ATOM   2196  C CD1 . ILE A 1 332 ? 46.850  -39.214 22.161  1.00 43.78  ? 327 ILE B CD1 1 
ATOM   2197  N N   . PHE A 1 333 ? 46.049  -38.970 16.838  1.00 49.12  ? 328 PHE B N   1 
ATOM   2198  C CA  . PHE A 1 333 ? 45.505  -39.244 15.517  1.00 47.63  ? 328 PHE B CA  1 
ATOM   2199  C C   . PHE A 1 333 ? 46.309  -40.326 14.810  1.00 47.32  ? 328 PHE B C   1 
ATOM   2200  O O   . PHE A 1 333 ? 45.762  -41.362 14.434  1.00 47.65  ? 328 PHE B O   1 
ATOM   2201  C CB  . PHE A 1 333 ? 45.504  -37.966 14.669  1.00 49.19  ? 328 PHE B CB  1 
ATOM   2202  C CG  . PHE A 1 333 ? 45.086  -38.184 13.239  1.00 49.41  ? 328 PHE B CG  1 
ATOM   2203  C CD1 . PHE A 1 333 ? 43.809  -38.637 12.930  1.00 50.27  ? 328 PHE B CD1 1 
ATOM   2204  C CD2 . PHE A 1 333 ? 45.975  -37.944 12.199  1.00 50.22  ? 328 PHE B CD2 1 
ATOM   2205  C CE1 . PHE A 1 333 ? 43.421  -38.849 11.606  1.00 49.83  ? 328 PHE B CE1 1 
ATOM   2206  C CE2 . PHE A 1 333 ? 45.598  -38.152 10.872  1.00 50.39  ? 328 PHE B CE2 1 
ATOM   2207  C CZ  . PHE A 1 333 ? 44.318  -38.605 10.576  1.00 49.07  ? 328 PHE B CZ  1 
ATOM   2208  N N   . LEU A 1 334 ? 47.606  -40.095 14.638  1.00 46.37  ? 329 LEU B N   1 
ATOM   2209  C CA  . LEU A 1 334 ? 48.461  -41.065 13.953  1.00 47.18  ? 329 LEU B CA  1 
ATOM   2210  C C   . LEU A 1 334 ? 48.451  -42.467 14.548  1.00 48.54  ? 329 LEU B C   1 
ATOM   2211  O O   . LEU A 1 334 ? 48.482  -43.456 13.813  1.00 48.88  ? 329 LEU B O   1 
ATOM   2212  C CB  . LEU A 1 334 ? 49.903  -40.567 13.898  1.00 44.01  ? 329 LEU B CB  1 
ATOM   2213  C CG  . LEU A 1 334 ? 50.151  -39.345 13.022  1.00 42.82  ? 329 LEU B CG  1 
ATOM   2214  C CD1 . LEU A 1 334 ? 51.625  -39.052 13.023  1.00 43.37  ? 329 LEU B CD1 1 
ATOM   2215  C CD2 . LEU A 1 334 ? 49.673  -39.586 11.602  1.00 41.28  ? 329 LEU B CD2 1 
ATOM   2216  N N   . LYS A 1 335 ? 48.419  -42.553 15.875  1.00 50.95  ? 330 LYS B N   1 
ATOM   2217  C CA  . LYS A 1 335 ? 48.422  -43.848 16.542  1.00 52.27  ? 330 LYS B CA  1 
ATOM   2218  C C   . LYS A 1 335 ? 47.094  -44.570 16.372  1.00 49.57  ? 330 LYS B C   1 
ATOM   2219  O O   . LYS A 1 335 ? 47.041  -45.802 16.390  1.00 48.40  ? 330 LYS B O   1 
ATOM   2220  C CB  . LYS A 1 335 ? 48.732  -43.677 18.032  1.00 57.41  ? 330 LYS B CB  1 
ATOM   2221  C CG  . LYS A 1 335 ? 50.121  -43.131 18.320  1.00 64.96  ? 330 LYS B CG  1 
ATOM   2222  C CD  . LYS A 1 335 ? 50.328  -42.938 19.817  1.00 72.68  ? 330 LYS B CD  1 
ATOM   2223  C CE  . LYS A 1 335 ? 51.638  -42.217 20.118  1.00 76.51  ? 330 LYS B CE  1 
ATOM   2224  N NZ  . LYS A 1 335 ? 52.803  -42.953 19.556  1.00 79.26  ? 330 LYS B NZ  1 
ATOM   2225  N N   . ASN A 1 336 ? 46.022  -43.805 16.195  1.00 47.24  ? 331 ASN B N   1 
ATOM   2226  C CA  . ASN A 1 336 ? 44.704  -44.396 16.036  1.00 45.64  ? 331 ASN B CA  1 
ATOM   2227  C C   . ASN A 1 336 ? 44.384  -44.885 14.635  1.00 45.75  ? 331 ASN B C   1 
ATOM   2228  O O   . ASN A 1 336 ? 43.533  -45.763 14.470  1.00 46.58  ? 331 ASN B O   1 
ATOM   2229  C CB  . ASN A 1 336 ? 43.638  -43.416 16.497  1.00 45.07  ? 331 ASN B CB  1 
ATOM   2230  C CG  . ASN A 1 336 ? 43.440  -43.454 17.988  1.00 45.49  ? 331 ASN B CG  1 
ATOM   2231  O OD1 . ASN A 1 336 ? 43.048  -44.481 18.542  1.00 46.16  ? 331 ASN B OD1 1 
ATOM   2232  N ND2 . ASN A 1 336 ? 43.708  -42.339 18.652  1.00 44.03  ? 331 ASN B ND2 1 
ATOM   2233  N N   . LEU A 1 337 ? 45.052  -44.317 13.628  1.00 43.07  ? 332 LEU B N   1 
ATOM   2234  C CA  . LEU A 1 337 ? 44.830  -44.726 12.244  1.00 38.80  ? 332 LEU B CA  1 
ATOM   2235  C C   . LEU A 1 337 ? 44.983  -46.240 12.146  1.00 39.50  ? 332 LEU B C   1 
ATOM   2236  O O   . LEU A 1 337 ? 45.937  -46.815 12.674  1.00 38.09  ? 332 LEU B O   1 
ATOM   2237  C CB  . LEU A 1 337 ? 45.831  -44.036 11.309  1.00 35.25  ? 332 LEU B CB  1 
ATOM   2238  C CG  . LEU A 1 337 ? 45.576  -42.554 11.036  1.00 31.99  ? 332 LEU B CG  1 
ATOM   2239  C CD1 . LEU A 1 337 ? 46.767  -41.936 10.322  1.00 27.18  ? 332 LEU B CD1 1 
ATOM   2240  C CD2 . LEU A 1 337 ? 44.293  -42.409 10.220  1.00 29.13  ? 332 LEU B CD2 1 
ATOM   2241  N N   . LYS A 1 338 ? 44.029  -46.879 11.478  1.00 39.52  ? 333 LYS B N   1 
ATOM   2242  C CA  . LYS A 1 338 ? 44.047  -48.324 11.311  1.00 39.02  ? 333 LYS B CA  1 
ATOM   2243  C C   . LYS A 1 338 ? 44.133  -48.739 9.842   1.00 38.36  ? 333 LYS B C   1 
ATOM   2244  O O   . LYS A 1 338 ? 44.618  -49.824 9.540   1.00 38.71  ? 333 LYS B O   1 
ATOM   2245  C CB  . LYS A 1 338 ? 42.806  -48.926 11.965  1.00 41.38  ? 333 LYS B CB  1 
ATOM   2246  C CG  . LYS A 1 338 ? 42.796  -48.769 13.478  1.00 46.73  ? 333 LYS B CG  1 
ATOM   2247  C CD  . LYS A 1 338 ? 41.421  -48.396 14.027  1.00 51.25  ? 333 LYS B CD  1 
ATOM   2248  C CE  . LYS A 1 338 ? 40.353  -49.422 13.661  1.00 55.43  ? 333 LYS B CE  1 
ATOM   2249  N NZ  . LYS A 1 338 ? 38.988  -48.992 14.109  1.00 59.26  ? 333 LYS B NZ  1 
ATOM   2250  N N   . LEU A 1 339 ? 43.671  -47.877 8.934   1.00 37.55  ? 334 LEU B N   1 
ATOM   2251  C CA  . LEU A 1 339 ? 43.712  -48.169 7.499   1.00 36.12  ? 334 LEU B CA  1 
ATOM   2252  C C   . LEU A 1 339 ? 44.928  -47.481 6.898   1.00 35.45  ? 334 LEU B C   1 
ATOM   2253  O O   . LEU A 1 339 ? 45.650  -48.085 6.112   1.00 36.29  ? 334 LEU B O   1 
ATOM   2254  C CB  . LEU A 1 339 ? 42.436  -47.677 6.802   1.00 37.39  ? 334 LEU B CB  1 
ATOM   2255  C CG  . LEU A 1 339 ? 42.099  -48.144 5.374   1.00 38.01  ? 334 LEU B CG  1 
ATOM   2256  C CD1 . LEU A 1 339 ? 43.069  -47.576 4.370   1.00 40.20  ? 334 LEU B CD1 1 
ATOM   2257  C CD2 . LEU A 1 339 ? 42.134  -49.657 5.320   1.00 41.11  ? 334 LEU B CD2 1 
ATOM   2258  N N   . PHE A 1 340 ? 45.149  -46.217 7.257   1.00 34.94  ? 335 PHE B N   1 
ATOM   2259  C CA  . PHE A 1 340 ? 46.316  -45.486 6.761   1.00 34.11  ? 335 PHE B CA  1 
ATOM   2260  C C   . PHE A 1 340 ? 47.553  -46.093 7.399   1.00 35.51  ? 335 PHE B C   1 
ATOM   2261  O O   . PHE A 1 340 ? 47.514  -46.589 8.530   1.00 35.32  ? 335 PHE B O   1 
ATOM   2262  C CB  . PHE A 1 340 ? 46.270  -44.000 7.124   1.00 30.49  ? 335 PHE B CB  1 
ATOM   2263  C CG  . PHE A 1 340 ? 45.422  -43.175 6.208   1.00 28.71  ? 335 PHE B CG  1 
ATOM   2264  C CD1 . PHE A 1 340 ? 44.036  -43.261 6.252   1.00 27.93  ? 335 PHE B CD1 1 
ATOM   2265  C CD2 . PHE A 1 340 ? 46.010  -42.318 5.291   1.00 29.23  ? 335 PHE B CD2 1 
ATOM   2266  C CE1 . PHE A 1 340 ? 43.248  -42.507 5.397   1.00 29.31  ? 335 PHE B CE1 1 
ATOM   2267  C CE2 . PHE A 1 340 ? 45.234  -41.558 4.429   1.00 30.47  ? 335 PHE B CE2 1 
ATOM   2268  C CZ  . PHE A 1 340 ? 43.848  -41.650 4.479   1.00 30.07  ? 335 PHE B CZ  1 
ATOM   2269  N N   . THR A 1 341 ? 48.653  -46.035 6.666   1.00 36.65  ? 336 THR B N   1 
ATOM   2270  C CA  . THR A 1 341 ? 49.913  -46.584 7.124   1.00 37.97  ? 336 THR B CA  1 
ATOM   2271  C C   . THR A 1 341 ? 50.899  -45.447 7.389   1.00 39.02  ? 336 THR B C   1 
ATOM   2272  O O   . THR A 1 341 ? 51.029  -44.533 6.569   1.00 40.77  ? 336 THR B O   1 
ATOM   2273  C CB  . THR A 1 341 ? 50.463  -47.531 6.047   1.00 36.65  ? 336 THR B CB  1 
ATOM   2274  O OG1 . THR A 1 341 ? 49.589  -48.656 5.932   1.00 37.95  ? 336 THR B OG1 1 
ATOM   2275  C CG2 . THR A 1 341 ? 51.847  -48.004 6.385   1.00 37.85  ? 336 THR B CG2 1 
ATOM   2276  N N   . LEU A 1 342 ? 51.581  -45.481 8.531   1.00 38.81  ? 337 LEU B N   1 
ATOM   2277  C CA  . LEU A 1 342 ? 52.548  -44.431 8.838   1.00 39.77  ? 337 LEU B CA  1 
ATOM   2278  C C   . LEU A 1 342 ? 53.787  -44.638 7.985   1.00 38.57  ? 337 LEU B C   1 
ATOM   2279  O O   . LEU A 1 342 ? 54.369  -45.718 7.987   1.00 39.77  ? 337 LEU B O   1 
ATOM   2280  C CB  . LEU A 1 342 ? 52.919  -44.455 10.321  1.00 41.02  ? 337 LEU B CB  1 
ATOM   2281  C CG  . LEU A 1 342 ? 51.733  -44.288 11.276  1.00 43.81  ? 337 LEU B CG  1 
ATOM   2282  C CD1 . LEU A 1 342 ? 52.234  -44.254 12.701  1.00 45.63  ? 337 LEU B CD1 1 
ATOM   2283  C CD2 . LEU A 1 342 ? 50.979  -43.003 10.962  1.00 45.87  ? 337 LEU B CD2 1 
ATOM   2284  N N   . ALA A 1 343 ? 54.182  -43.606 7.247   1.00 37.76  ? 338 ALA B N   1 
ATOM   2285  C CA  . ALA A 1 343 ? 55.348  -43.694 6.378   1.00 38.86  ? 338 ALA B CA  1 
ATOM   2286  C C   . ALA A 1 343 ? 55.768  -42.309 5.877   1.00 40.44  ? 338 ALA B C   1 
ATOM   2287  O O   . ALA A 1 343 ? 54.949  -41.393 5.836   1.00 39.21  ? 338 ALA B O   1 
ATOM   2288  C CB  . ALA A 1 343 ? 55.033  -44.615 5.196   1.00 37.31  ? 338 ALA B CB  1 
ATOM   2289  N N   . GLU A 1 344 ? 57.040  -42.158 5.496   1.00 42.94  ? 339 GLU B N   1 
ATOM   2290  C CA  . GLU A 1 344 ? 57.546  -40.872 5.004   1.00 46.28  ? 339 GLU B CA  1 
ATOM   2291  C C   . GLU A 1 344 ? 57.608  -40.785 3.489   1.00 45.23  ? 339 GLU B C   1 
ATOM   2292  O O   . GLU A 1 344 ? 57.933  -39.741 2.925   1.00 44.57  ? 339 GLU B O   1 
ATOM   2293  C CB  . GLU A 1 344 ? 58.942  -40.581 5.551   1.00 50.40  ? 339 GLU B CB  1 
ATOM   2294  C CG  . GLU A 1 344 ? 58.996  -40.263 7.032   1.00 57.68  ? 339 GLU B CG  1 
ATOM   2295  C CD  . GLU A 1 344 ? 60.383  -39.825 7.465   1.00 61.83  ? 339 GLU B CD  1 
ATOM   2296  O OE1 . GLU A 1 344 ? 60.723  -40.011 8.655   1.00 65.03  ? 339 GLU B OE1 1 
ATOM   2297  O OE2 . GLU A 1 344 ? 61.128  -39.287 6.613   1.00 63.57  ? 339 GLU B OE2 1 
ATOM   2298  N N   . SER A 1 345 ? 57.311  -41.887 2.824   1.00 44.30  ? 340 SER B N   1 
ATOM   2299  C CA  . SER A 1 345 ? 57.341  -41.890 1.377   1.00 43.91  ? 340 SER B CA  1 
ATOM   2300  C C   . SER A 1 345 ? 55.959  -41.529 0.858   1.00 45.24  ? 340 SER B C   1 
ATOM   2301  O O   . SER A 1 345 ? 55.015  -41.378 1.640   1.00 44.30  ? 340 SER B O   1 
ATOM   2302  C CB  . SER A 1 345 ? 57.745  -43.274 0.873   1.00 43.77  ? 340 SER B CB  1 
ATOM   2303  O OG  . SER A 1 345 ? 56.870  -44.276 1.366   1.00 44.16  ? 340 SER B OG  1 
ATOM   2304  N N   . LEU A 1 346 ? 55.838  -41.373 -0.457  1.00 44.61  ? 341 LEU B N   1 
ATOM   2305  C CA  . LEU A 1 346 ? 54.543  -41.068 -1.046  1.00 45.16  ? 341 LEU B CA  1 
ATOM   2306  C C   . LEU A 1 346 ? 54.375  -41.706 -2.410  1.00 45.07  ? 341 LEU B C   1 
ATOM   2307  O O   . LEU A 1 346 ? 55.334  -41.801 -3.180  1.00 45.11  ? 341 LEU B O   1 
ATOM   2308  C CB  . LEU A 1 346 ? 54.321  -39.551 -1.160  1.00 44.80  ? 341 LEU B CB  1 
ATOM   2309  C CG  . LEU A 1 346 ? 55.219  -38.709 -2.057  1.00 44.21  ? 341 LEU B CG  1 
ATOM   2310  C CD1 . LEU A 1 346 ? 54.765  -37.256 -2.017  1.00 44.16  ? 341 LEU B CD1 1 
ATOM   2311  C CD2 . LEU A 1 346 ? 56.650  -38.832 -1.583  1.00 46.33  ? 341 LEU B CD2 1 
ATOM   2312  N N   . GLY A 1 347 ? 53.162  -42.181 -2.686  1.00 43.73  ? 342 GLY B N   1 
ATOM   2313  C CA  . GLY A 1 347 ? 52.898  -42.749 -3.983  1.00 42.83  ? 342 GLY B CA  1 
ATOM   2314  C C   . GLY A 1 347 ? 52.361  -44.152 -4.152  1.00 43.07  ? 342 GLY B C   1 
ATOM   2315  O O   . GLY A 1 347 ? 51.832  -44.464 -5.214  1.00 46.27  ? 342 GLY B O   1 
ATOM   2316  N N   . GLY A 1 348 ? 52.465  -45.018 -3.162  1.00 41.10  ? 343 GLY B N   1 
ATOM   2317  C CA  . GLY A 1 348 ? 51.958  -46.361 -3.411  1.00 40.25  ? 343 GLY B CA  1 
ATOM   2318  C C   . GLY A 1 348 ? 50.457  -46.495 -3.644  1.00 37.04  ? 343 GLY B C   1 
ATOM   2319  O O   . GLY A 1 348 ? 49.727  -45.509 -3.727  1.00 36.63  ? 343 GLY B O   1 
ATOM   2320  N N   . PHE A 1 349 ? 49.994  -47.731 -3.760  1.00 34.91  ? 344 PHE B N   1 
ATOM   2321  C CA  . PHE A 1 349 ? 48.571  -47.989 -3.928  1.00 35.41  ? 344 PHE B CA  1 
ATOM   2322  C C   . PHE A 1 349 ? 47.938  -47.837 -2.545  1.00 35.95  ? 344 PHE B C   1 
ATOM   2323  O O   . PHE A 1 349 ? 46.720  -47.736 -2.387  1.00 34.05  ? 344 PHE B O   1 
ATOM   2324  C CB  . PHE A 1 349 ? 48.334  -49.431 -4.386  1.00 31.64  ? 344 PHE B CB  1 
ATOM   2325  C CG  . PHE A 1 349 ? 48.852  -49.742 -5.758  1.00 29.90  ? 344 PHE B CG  1 
ATOM   2326  C CD1 . PHE A 1 349 ? 49.062  -48.735 -6.694  1.00 29.00  ? 344 PHE B CD1 1 
ATOM   2327  C CD2 . PHE A 1 349 ? 49.056  -51.065 -6.140  1.00 29.22  ? 344 PHE B CD2 1 
ATOM   2328  C CE1 . PHE A 1 349 ? 49.464  -49.048 -7.991  1.00 28.25  ? 344 PHE B CE1 1 
ATOM   2329  C CE2 . PHE A 1 349 ? 49.455  -51.385 -7.429  1.00 26.33  ? 344 PHE B CE2 1 
ATOM   2330  C CZ  . PHE A 1 349 ? 49.657  -50.378 -8.356  1.00 26.84  ? 344 PHE B CZ  1 
ATOM   2331  N N   . GLU A 1 350 ? 48.813  -47.828 -1.554  1.00 37.85  ? 345 GLU B N   1 
ATOM   2332  C CA  . GLU A 1 350 ? 48.468  -47.771 -0.149  1.00 41.29  ? 345 GLU B CA  1 
ATOM   2333  C C   . GLU A 1 350 ? 48.419  -46.348 0.391   1.00 38.08  ? 345 GLU B C   1 
ATOM   2334  O O   . GLU A 1 350 ? 49.280  -45.536 0.077   1.00 38.20  ? 345 GLU B O   1 
ATOM   2335  C CB  . GLU A 1 350 ? 49.526  -48.605 0.557   1.00 50.21  ? 345 GLU B CB  1 
ATOM   2336  C CG  . GLU A 1 350 ? 49.336  -48.946 1.994   1.00 63.14  ? 345 GLU B CG  1 
ATOM   2337  C CD  . GLU A 1 350 ? 50.195  -50.148 2.351   1.00 70.32  ? 345 GLU B CD  1 
ATOM   2338  O OE1 . GLU A 1 350 ? 50.469  -50.379 3.553   1.00 76.00  ? 345 GLU B OE1 1 
ATOM   2339  O OE2 . GLU A 1 350 ? 50.586  -50.870 1.405   1.00 72.66  ? 345 GLU B OE2 1 
ATOM   2340  N N   . SER A 1 351 ? 47.411  -46.036 1.198   1.00 34.81  ? 346 SER B N   1 
ATOM   2341  C CA  . SER A 1 351 ? 47.305  -44.693 1.758   1.00 33.69  ? 346 SER B CA  1 
ATOM   2342  C C   . SER A 1 351 ? 48.201  -44.511 2.972   1.00 33.04  ? 346 SER B C   1 
ATOM   2343  O O   . SER A 1 351 ? 48.136  -45.288 3.930   1.00 30.97  ? 346 SER B O   1 
ATOM   2344  C CB  . SER A 1 351 ? 45.860  -44.370 2.134   1.00 34.35  ? 346 SER B CB  1 
ATOM   2345  O OG  . SER A 1 351 ? 45.080  -44.210 0.966   1.00 34.01  ? 346 SER B OG  1 
ATOM   2346  N N   . LEU A 1 352 ? 49.021  -43.463 2.927   1.00 31.39  ? 347 LEU B N   1 
ATOM   2347  C CA  . LEU A 1 352 ? 49.969  -43.164 3.993   1.00 31.73  ? 347 LEU B CA  1 
ATOM   2348  C C   . LEU A 1 352 ? 49.676  -41.864 4.755   1.00 31.86  ? 347 LEU B C   1 
ATOM   2349  O O   . LEU A 1 352 ? 48.989  -40.970 4.252   1.00 32.82  ? 347 LEU B O   1 
ATOM   2350  C CB  . LEU A 1 352 ? 51.378  -43.096 3.398   1.00 31.98  ? 347 LEU B CB  1 
ATOM   2351  C CG  . LEU A 1 352 ? 51.727  -44.165 2.347   1.00 32.78  ? 347 LEU B CG  1 
ATOM   2352  C CD1 . LEU A 1 352 ? 53.069  -43.830 1.727   1.00 31.08  ? 347 LEU B CD1 1 
ATOM   2353  C CD2 . LEU A 1 352 ? 51.748  -45.560 2.977   1.00 32.61  ? 347 LEU B CD2 1 
ATOM   2354  N N   . ALA A 1 353 ? 50.203  -41.774 5.974   1.00 29.66  ? 348 ALA B N   1 
ATOM   2355  C CA  . ALA A 1 353 ? 50.038  -40.594 6.812   1.00 28.83  ? 348 ALA B CA  1 
ATOM   2356  C C   . ALA A 1 353 ? 51.390  -40.297 7.431   1.00 29.78  ? 348 ALA B C   1 
ATOM   2357  O O   . ALA A 1 353 ? 52.103  -41.211 7.828   1.00 29.02  ? 348 ALA B O   1 
ATOM   2358  C CB  . ALA A 1 353 ? 49.013  -40.849 7.896   1.00 26.29  ? 348 ALA B CB  1 
ATOM   2359  N N   . GLU A 1 354 ? 51.731  -39.016 7.523   1.00 33.11  ? 349 GLU B N   1 
ATOM   2360  C CA  . GLU A 1 354 ? 53.014  -38.591 8.067   1.00 35.21  ? 349 GLU B CA  1 
ATOM   2361  C C   . GLU A 1 354 ? 52.898  -37.293 8.865   1.00 36.54  ? 349 GLU B C   1 
ATOM   2362  O O   . GLU A 1 354 ? 52.077  -36.429 8.545   1.00 37.03  ? 349 GLU B O   1 
ATOM   2363  C CB  . GLU A 1 354 ? 53.984  -38.381 6.910   1.00 37.72  ? 349 GLU B CB  1 
ATOM   2364  C CG  . GLU A 1 354 ? 55.291  -37.715 7.273   1.00 43.66  ? 349 GLU B CG  1 
ATOM   2365  C CD  . GLU A 1 354 ? 55.909  -36.982 6.092   1.00 46.37  ? 349 GLU B CD  1 
ATOM   2366  O OE1 . GLU A 1 354 ? 57.056  -36.510 6.212   1.00 49.70  ? 349 GLU B OE1 1 
ATOM   2367  O OE2 . GLU A 1 354 ? 55.245  -36.866 5.044   1.00 48.62  ? 349 GLU B OE2 1 
ATOM   2368  N N   . LEU A 1 355 ? 53.717  -37.168 9.907   1.00 37.91  ? 350 LEU B N   1 
ATOM   2369  C CA  . LEU A 1 355 ? 53.757  -35.962 10.731  1.00 37.54  ? 350 LEU B CA  1 
ATOM   2370  C C   . LEU A 1 355 ? 55.176  -35.425 10.611  1.00 37.71  ? 350 LEU B C   1 
ATOM   2371  O O   . LEU A 1 355 ? 56.055  -35.804 11.386  1.00 39.64  ? 350 LEU B O   1 
ATOM   2372  C CB  . LEU A 1 355 ? 53.450  -36.279 12.193  1.00 38.65  ? 350 LEU B CB  1 
ATOM   2373  C CG  . LEU A 1 355 ? 53.326  -35.039 13.089  1.00 40.83  ? 350 LEU B CG  1 
ATOM   2374  C CD1 . LEU A 1 355 ? 52.128  -35.178 13.988  1.00 41.16  ? 350 LEU B CD1 1 
ATOM   2375  C CD2 . LEU A 1 355 ? 54.579  -34.848 13.908  1.00 41.60  ? 350 LEU B CD2 1 
ATOM   2376  N N   . PRO A 1 356 ? 55.414  -34.534 9.629   1.00 39.13  ? 351 PRO B N   1 
ATOM   2377  C CA  . PRO A 1 356 ? 56.693  -33.889 9.312   1.00 39.92  ? 351 PRO B CA  1 
ATOM   2378  C C   . PRO A 1 356 ? 57.465  -33.289 10.490  1.00 42.86  ? 351 PRO B C   1 
ATOM   2379  O O   . PRO A 1 356 ? 58.697  -33.278 10.485  1.00 42.68  ? 351 PRO B O   1 
ATOM   2380  C CB  . PRO A 1 356 ? 56.294  -32.818 8.303   1.00 37.53  ? 351 PRO B CB  1 
ATOM   2381  C CG  . PRO A 1 356 ? 55.106  -33.409 7.641   1.00 36.62  ? 351 PRO B CG  1 
ATOM   2382  C CD  . PRO A 1 356 ? 54.340  -33.969 8.794   1.00 36.96  ? 351 PRO B CD  1 
ATOM   2383  N N   . ALA A 1 357 ? 56.747  -32.779 11.487  1.00 46.50  ? 352 ALA B N   1 
ATOM   2384  C CA  . ALA A 1 357 ? 57.389  -32.162 12.646  1.00 50.48  ? 352 ALA B CA  1 
ATOM   2385  C C   . ALA A 1 357 ? 58.380  -33.092 13.327  1.00 53.42  ? 352 ALA B C   1 
ATOM   2386  O O   . ALA A 1 357 ? 59.360  -32.637 13.917  1.00 51.71  ? 352 ALA B O   1 
ATOM   2387  C CB  . ALA A 1 357 ? 56.336  -31.700 13.655  1.00 52.39  ? 352 ALA B CB  1 
ATOM   2388  N N   . ILE A 1 358 ? 58.124  -34.396 13.242  1.00 58.00  ? 353 ILE B N   1 
ATOM   2389  C CA  . ILE A 1 358 ? 59.002  -35.393 13.860  1.00 61.13  ? 353 ILE B CA  1 
ATOM   2390  C C   . ILE A 1 358 ? 59.399  -36.555 12.947  1.00 63.02  ? 353 ILE B C   1 
ATOM   2391  O O   . ILE A 1 358 ? 59.474  -37.692 13.401  1.00 64.88  ? 353 ILE B O   1 
ATOM   2392  C CB  . ILE A 1 358 ? 58.359  -36.002 15.132  1.00 61.89  ? 353 ILE B CB  1 
ATOM   2393  C CG1 . ILE A 1 358 ? 57.043  -36.692 14.774  1.00 61.93  ? 353 ILE B CG1 1 
ATOM   2394  C CG2 . ILE A 1 358 ? 58.130  -34.924 16.168  1.00 63.91  ? 353 ILE B CG2 1 
ATOM   2395  C CD1 . ILE A 1 358 ? 56.300  -37.235 15.974  1.00 62.51  ? 353 ILE B CD1 1 
ATOM   2396  N N   . MET A 1 359 ? 59.660  -36.283 11.674  1.00 62.72  ? 354 MET B N   1 
ATOM   2397  C CA  . MET A 1 359 ? 60.041  -37.345 10.753  1.00 62.06  ? 354 MET B CA  1 
ATOM   2398  C C   . MET A 1 359 ? 61.012  -36.833 9.695   1.00 62.84  ? 354 MET B C   1 
ATOM   2399  O O   . MET A 1 359 ? 62.232  -36.945 9.845   1.00 63.12  ? 354 MET B O   1 
ATOM   2400  C CB  . MET A 1 359 ? 58.790  -37.952 10.089  1.00 61.89  ? 354 MET B CB  1 
ATOM   2401  C CG  . MET A 1 359 ? 57.892  -38.772 11.046  1.00 62.93  ? 354 MET B CG  1 
ATOM   2402  S SD  . MET A 1 359 ? 56.507  -39.731 10.284  1.00 64.92  ? 354 MET B SD  1 
ATOM   2403  C CE  . MET A 1 359 ? 55.411  -39.951 11.647  1.00 63.53  ? 354 MET B CE  1 
ATOM   2404  N N   . LEU A 1 372 ? 63.155  -21.770 12.035  1.00 76.74  ? 367 LEU B N   1 
ATOM   2405  C CA  . LEU A 1 372 ? 61.932  -22.341 12.595  1.00 77.71  ? 367 LEU B CA  1 
ATOM   2406  C C   . LEU A 1 372 ? 61.571  -23.712 12.033  1.00 75.61  ? 367 LEU B C   1 
ATOM   2407  O O   . LEU A 1 372 ? 62.258  -24.243 11.154  1.00 75.94  ? 367 LEU B O   1 
ATOM   2408  C CB  . LEU A 1 372 ? 60.749  -21.394 12.384  1.00 81.39  ? 367 LEU B CB  1 
ATOM   2409  C CG  . LEU A 1 372 ? 60.531  -20.321 13.453  1.00 84.81  ? 367 LEU B CG  1 
ATOM   2410  C CD1 . LEU A 1 372 ? 59.332  -19.455 13.089  1.00 86.71  ? 367 LEU B CD1 1 
ATOM   2411  C CD2 . LEU A 1 372 ? 60.305  -20.992 14.800  1.00 86.65  ? 367 LEU B CD2 1 
ATOM   2412  N N   . GLY A 1 373 ? 60.480  -24.275 12.547  1.00 72.39  ? 368 GLY B N   1 
ATOM   2413  C CA  . GLY A 1 373 ? 60.037  -25.584 12.103  1.00 68.29  ? 368 GLY B CA  1 
ATOM   2414  C C   . GLY A 1 373 ? 58.578  -25.640 11.693  1.00 65.40  ? 368 GLY B C   1 
ATOM   2415  O O   . GLY A 1 373 ? 57.794  -24.733 11.994  1.00 65.32  ? 368 GLY B O   1 
ATOM   2416  N N   . ILE A 1 374 ? 58.219  -26.716 10.998  1.00 62.16  ? 369 ILE B N   1 
ATOM   2417  C CA  . ILE A 1 374 ? 56.850  -26.926 10.534  1.00 59.40  ? 369 ILE B CA  1 
ATOM   2418  C C   . ILE A 1 374 ? 55.951  -27.145 11.741  1.00 57.49  ? 369 ILE B C   1 
ATOM   2419  O O   . ILE A 1 374 ? 56.354  -27.790 12.712  1.00 57.90  ? 369 ILE B O   1 
ATOM   2420  C CB  . ILE A 1 374 ? 56.726  -28.181 9.626   1.00 59.14  ? 369 ILE B CB  1 
ATOM   2421  C CG1 . ILE A 1 374 ? 58.100  -28.610 9.110   1.00 60.02  ? 369 ILE B CG1 1 
ATOM   2422  C CG2 . ILE A 1 374 ? 55.805  -27.886 8.453   1.00 57.46  ? 369 ILE B CG2 1 
ATOM   2423  C CD1 . ILE A 1 374 ? 58.991  -29.232 10.166  1.00 61.71  ? 369 ILE B CD1 1 
ATOM   2424  N N   . SER A 1 375 ? 54.732  -26.617 11.683  1.00 55.12  ? 370 SER B N   1 
ATOM   2425  C CA  . SER A 1 375 ? 53.802  -26.781 12.791  1.00 53.17  ? 370 SER B CA  1 
ATOM   2426  C C   . SER A 1 375 ? 53.734  -28.247 13.197  1.00 52.95  ? 370 SER B C   1 
ATOM   2427  O O   . SER A 1 375 ? 53.797  -29.148 12.358  1.00 50.33  ? 370 SER B O   1 
ATOM   2428  C CB  . SER A 1 375 ? 52.408  -26.287 12.413  1.00 50.52  ? 370 SER B CB  1 
ATOM   2429  O OG  . SER A 1 375 ? 51.879  -27.061 11.361  1.00 52.50  ? 370 SER B OG  1 
ATOM   2430  N N   . ASP A 1 376 ? 53.619  -28.465 14.501  1.00 55.58  ? 371 ASP B N   1 
ATOM   2431  C CA  . ASP A 1 376 ? 53.546  -29.797 15.081  1.00 57.65  ? 371 ASP B CA  1 
ATOM   2432  C C   . ASP A 1 376 ? 52.130  -30.324 14.883  1.00 55.85  ? 371 ASP B C   1 
ATOM   2433  O O   . ASP A 1 376 ? 51.785  -31.426 15.312  1.00 54.54  ? 371 ASP B O   1 
ATOM   2434  C CB  . ASP A 1 376 ? 53.861  -29.712 16.571  1.00 63.07  ? 371 ASP B CB  1 
ATOM   2435  C CG  . ASP A 1 376 ? 54.821  -28.588 16.893  1.00 68.28  ? 371 ASP B CG  1 
ATOM   2436  O OD1 . ASP A 1 376 ? 54.468  -27.418 16.632  1.00 72.09  ? 371 ASP B OD1 1 
ATOM   2437  O OD2 . ASP A 1 376 ? 55.927  -28.872 17.402  1.00 72.63  ? 371 ASP B OD2 1 
ATOM   2438  N N   . THR A 1 377 ? 51.314  -29.520 14.218  1.00 54.19  ? 372 THR B N   1 
ATOM   2439  C CA  . THR A 1 377 ? 49.932  -29.876 13.966  1.00 53.16  ? 372 THR B CA  1 
ATOM   2440  C C   . THR A 1 377 ? 49.694  -30.235 12.486  1.00 49.12  ? 372 THR B C   1 
ATOM   2441  O O   . THR A 1 377 ? 48.598  -30.668 12.112  1.00 48.14  ? 372 THR B O   1 
ATOM   2442  C CB  . THR A 1 377 ? 49.009  -28.702 14.425  1.00 55.20  ? 372 THR B CB  1 
ATOM   2443  O OG1 . THR A 1 377 ? 47.665  -28.941 13.998  1.00 60.43  ? 372 THR B OG1 1 
ATOM   2444  C CG2 . THR A 1 377 ? 49.500  -27.368 13.860  1.00 56.22  ? 372 THR B CG2 1 
ATOM   2445  N N   . LEU A 1 378 ? 50.732  -30.084 11.660  1.00 45.58  ? 373 LEU B N   1 
ATOM   2446  C CA  . LEU A 1 378 ? 50.640  -30.373 10.225  1.00 41.99  ? 373 LEU B CA  1 
ATOM   2447  C C   . LEU A 1 378 ? 50.844  -31.849 9.881   1.00 40.85  ? 373 LEU B C   1 
ATOM   2448  O O   . LEU A 1 378 ? 51.861  -32.455 10.241  1.00 39.39  ? 373 LEU B O   1 
ATOM   2449  C CB  . LEU A 1 378 ? 51.646  -29.518 9.442   1.00 40.07  ? 373 LEU B CB  1 
ATOM   2450  C CG  . LEU A 1 378 ? 51.639  -29.675 7.916   1.00 40.13  ? 373 LEU B CG  1 
ATOM   2451  C CD1 . LEU A 1 378 ? 52.211  -28.424 7.274   1.00 40.23  ? 373 LEU B CD1 1 
ATOM   2452  C CD2 . LEU A 1 378 ? 52.434  -30.906 7.497   1.00 38.07  ? 373 LEU B CD2 1 
ATOM   2453  N N   . ILE A 1 379 ? 49.870  -32.411 9.167   1.00 38.20  ? 374 ILE B N   1 
ATOM   2454  C CA  . ILE A 1 379 ? 49.895  -33.814 8.761   1.00 34.00  ? 374 ILE B CA  1 
ATOM   2455  C C   . ILE A 1 379 ? 49.745  -33.943 7.256   1.00 34.65  ? 374 ILE B C   1 
ATOM   2456  O O   . ILE A 1 379 ? 48.829  -33.363 6.683   1.00 36.32  ? 374 ILE B O   1 
ATOM   2457  C CB  . ILE A 1 379 ? 48.740  -34.598 9.412   1.00 31.78  ? 374 ILE B CB  1 
ATOM   2458  C CG1 . ILE A 1 379 ? 48.930  -34.646 10.921  1.00 31.72  ? 374 ILE B CG1 1 
ATOM   2459  C CG2 . ILE A 1 379 ? 48.693  -35.994 8.865   1.00 30.94  ? 374 ILE B CG2 1 
ATOM   2460  C CD1 . ILE A 1 379 ? 47.836  -35.378 11.635  1.00 34.25  ? 374 ILE B CD1 1 
ATOM   2461  N N   . ARG A 1 380 ? 50.642  -34.690 6.616   1.00 33.64  ? 375 ARG B N   1 
ATOM   2462  C CA  . ARG A 1 380 ? 50.557  -34.900 5.174   1.00 32.31  ? 375 ARG B CA  1 
ATOM   2463  C C   . ARG A 1 380 ? 50.136  -36.328 4.890   1.00 32.51  ? 375 ARG B C   1 
ATOM   2464  O O   . ARG A 1 380 ? 50.711  -37.272 5.425   1.00 32.56  ? 375 ARG B O   1 
ATOM   2465  C CB  . ARG A 1 380 ? 51.895  -34.636 4.471   1.00 33.10  ? 375 ARG B CB  1 
ATOM   2466  C CG  . ARG A 1 380 ? 51.908  -35.147 3.021   1.00 33.51  ? 375 ARG B CG  1 
ATOM   2467  C CD  . ARG A 1 380 ? 53.116  -34.684 2.212   1.00 35.62  ? 375 ARG B CD  1 
ATOM   2468  N NE  . ARG A 1 380 ? 54.381  -35.359 2.536   1.00 40.85  ? 375 ARG B NE  1 
ATOM   2469  C CZ  . ARG A 1 380 ? 54.730  -36.585 2.138   1.00 42.07  ? 375 ARG B CZ  1 
ATOM   2470  N NH1 . ARG A 1 380 ? 53.910  -37.314 1.386   1.00 45.82  ? 375 ARG B NH1 1 
ATOM   2471  N NH2 . ARG A 1 380 ? 55.919  -37.077 2.470   1.00 40.70  ? 375 ARG B NH2 1 
ATOM   2472  N N   . LEU A 1 381 ? 49.126  -36.487 4.047   1.00 33.03  ? 376 LEU B N   1 
ATOM   2473  C CA  . LEU A 1 381 ? 48.655  -37.816 3.688   1.00 33.73  ? 376 LEU B CA  1 
ATOM   2474  C C   . LEU A 1 381 ? 48.916  -38.075 2.213   1.00 35.71  ? 376 LEU B C   1 
ATOM   2475  O O   . LEU A 1 381 ? 48.711  -37.191 1.380   1.00 36.64  ? 376 LEU B O   1 
ATOM   2476  C CB  . LEU A 1 381 ? 47.153  -37.945 3.913   1.00 32.86  ? 376 LEU B CB  1 
ATOM   2477  C CG  . LEU A 1 381 ? 46.552  -37.491 5.236   1.00 35.38  ? 376 LEU B CG  1 
ATOM   2478  C CD1 . LEU A 1 381 ? 45.053  -37.799 5.217   1.00 35.93  ? 376 LEU B CD1 1 
ATOM   2479  C CD2 . LEU A 1 381 ? 47.237  -38.190 6.398   1.00 34.72  ? 376 LEU B CD2 1 
ATOM   2480  N N   . SER A 1 382 ? 49.387  -39.275 1.888   1.00 35.73  ? 377 SER B N   1 
ATOM   2481  C CA  . SER A 1 382 ? 49.582  -39.635 0.495   1.00 33.46  ? 377 SER B CA  1 
ATOM   2482  C C   . SER A 1 382 ? 48.464  -40.642 0.260   1.00 33.52  ? 377 SER B C   1 
ATOM   2483  O O   . SER A 1 382 ? 48.642  -41.835 0.519   1.00 33.41  ? 377 SER B O   1 
ATOM   2484  C CB  . SER A 1 382 ? 50.932  -40.289 0.276   1.00 33.79  ? 377 SER B CB  1 
ATOM   2485  O OG  . SER A 1 382 ? 51.078  -40.622 -1.096  1.00 35.81  ? 377 SER B OG  1 
ATOM   2486  N N   . VAL A 1 383 ? 47.313  -40.149 -0.206  1.00 32.36  ? 378 VAL B N   1 
ATOM   2487  C CA  . VAL A 1 383 ? 46.123  -40.977 -0.438  1.00 31.13  ? 378 VAL B CA  1 
ATOM   2488  C C   . VAL A 1 383 ? 46.251  -41.995 -1.564  1.00 29.80  ? 378 VAL B C   1 
ATOM   2489  O O   . VAL A 1 383 ? 46.576  -41.644 -2.706  1.00 28.64  ? 378 VAL B O   1 
ATOM   2490  C CB  . VAL A 1 383 ? 44.887  -40.091 -0.702  1.00 32.47  ? 378 VAL B CB  1 
ATOM   2491  C CG1 . VAL A 1 383 ? 43.615  -40.922 -0.669  1.00 31.44  ? 378 VAL B CG1 1 
ATOM   2492  C CG2 . VAL A 1 383 ? 44.820  -38.997 0.342   1.00 34.56  ? 378 VAL B CG2 1 
ATOM   2493  N N   . GLY A 1 384 ? 45.958  -43.251 -1.219  1.00 28.07  ? 379 GLY B N   1 
ATOM   2494  C CA  . GLY A 1 384 ? 46.061  -44.361 -2.148  1.00 27.86  ? 379 GLY B CA  1 
ATOM   2495  C C   . GLY A 1 384 ? 44.863  -44.697 -3.005  1.00 27.72  ? 379 GLY B C   1 
ATOM   2496  O O   . GLY A 1 384 ? 44.037  -43.836 -3.274  1.00 28.48  ? 379 GLY B O   1 
ATOM   2497  N N   . LEU A 1 385 ? 44.766  -45.957 -3.431  1.00 28.39  ? 380 LEU B N   1 
ATOM   2498  C CA  . LEU A 1 385 ? 43.673  -46.382 -4.295  1.00 28.80  ? 380 LEU B CA  1 
ATOM   2499  C C   . LEU A 1 385 ? 42.616  -47.255 -3.633  1.00 30.22  ? 380 LEU B C   1 
ATOM   2500  O O   . LEU A 1 385 ? 41.946  -48.036 -4.319  1.00 30.02  ? 380 LEU B O   1 
ATOM   2501  C CB  . LEU A 1 385 ? 44.230  -47.111 -5.518  1.00 27.01  ? 380 LEU B CB  1 
ATOM   2502  C CG  . LEU A 1 385 ? 45.368  -46.399 -6.258  1.00 28.02  ? 380 LEU B CG  1 
ATOM   2503  C CD1 . LEU A 1 385 ? 45.767  -47.228 -7.459  1.00 28.41  ? 380 LEU B CD1 1 
ATOM   2504  C CD2 . LEU A 1 385 ? 44.945  -45.002 -6.700  1.00 27.43  ? 380 LEU B CD2 1 
ATOM   2505  N N   . GLU A 1 386 ? 42.453  -47.120 -2.315  1.00 31.94  ? 381 GLU B N   1 
ATOM   2506  C CA  . GLU A 1 386 ? 41.455  -47.907 -1.586  1.00 33.09  ? 381 GLU B CA  1 
ATOM   2507  C C   . GLU A 1 386 ? 40.062  -47.312 -1.736  1.00 33.42  ? 381 GLU B C   1 
ATOM   2508  O O   . GLU A 1 386 ? 39.869  -46.322 -2.443  1.00 31.94  ? 381 GLU B O   1 
ATOM   2509  C CB  . GLU A 1 386 ? 41.780  -47.973 -0.093  1.00 31.60  ? 381 GLU B CB  1 
ATOM   2510  C CG  . GLU A 1 386 ? 43.135  -48.537 0.267   1.00 29.84  ? 381 GLU B CG  1 
ATOM   2511  C CD  . GLU A 1 386 ? 44.191  -47.465 0.372   1.00 29.25  ? 381 GLU B CD  1 
ATOM   2512  O OE1 . GLU A 1 386 ? 45.171  -47.672 1.118   1.00 28.53  ? 381 GLU B OE1 1 
ATOM   2513  O OE2 . GLU A 1 386 ? 44.046  -46.418 -0.292  1.00 29.23  ? 381 GLU B OE2 1 
ATOM   2514  N N   . ASP A 1 387 ? 39.093  -47.929 -1.064  1.00 37.13  ? 382 ASP B N   1 
ATOM   2515  C CA  . ASP A 1 387 ? 37.719  -47.447 -1.096  1.00 43.14  ? 382 ASP B CA  1 
ATOM   2516  C C   . ASP A 1 387 ? 37.574  -46.147 -0.320  1.00 44.18  ? 382 ASP B C   1 
ATOM   2517  O O   . ASP A 1 387 ? 37.879  -46.084 0.870   1.00 44.37  ? 382 ASP B O   1 
ATOM   2518  C CB  . ASP A 1 387 ? 36.767  -48.494 -0.520  1.00 45.65  ? 382 ASP B CB  1 
ATOM   2519  C CG  . ASP A 1 387 ? 36.342  -49.512 -1.553  1.00 51.10  ? 382 ASP B CG  1 
ATOM   2520  O OD1 . ASP A 1 387 ? 35.504  -49.172 -2.421  1.00 54.16  ? 382 ASP B OD1 1 
ATOM   2521  O OD2 . ASP A 1 387 ? 36.857  -50.648 -1.512  1.00 54.66  ? 382 ASP B OD2 1 
ATOM   2522  N N   . GLU A 1 388 ? 37.121  -45.109 -1.014  1.00 46.89  ? 383 GLU B N   1 
ATOM   2523  C CA  . GLU A 1 388 ? 36.916  -43.789 -0.427  1.00 51.15  ? 383 GLU B CA  1 
ATOM   2524  C C   . GLU A 1 388 ? 36.231  -43.888 0.937   1.00 50.94  ? 383 GLU B C   1 
ATOM   2525  O O   . GLU A 1 388 ? 36.661  -43.283 1.918   1.00 50.02  ? 383 GLU B O   1 
ATOM   2526  C CB  . GLU A 1 388 ? 36.066  -42.957 -1.386  1.00 53.56  ? 383 GLU B CB  1 
ATOM   2527  C CG  . GLU A 1 388 ? 35.480  -41.702 -0.796  1.00 59.11  ? 383 GLU B CG  1 
ATOM   2528  C CD  . GLU A 1 388 ? 34.612  -40.964 -1.791  1.00 63.59  ? 383 GLU B CD  1 
ATOM   2529  O OE1 . GLU A 1 388 ? 34.020  -39.930 -1.413  1.00 66.54  ? 383 GLU B OE1 1 
ATOM   2530  O OE2 . GLU A 1 388 ? 34.525  -41.417 -2.957  1.00 67.00  ? 383 GLU B OE2 1 
ATOM   2531  N N   . GLU A 1 389 ? 35.155  -44.662 0.977   1.00 52.92  ? 384 GLU B N   1 
ATOM   2532  C CA  . GLU A 1 389 ? 34.386  -44.885 2.192   1.00 56.57  ? 384 GLU B CA  1 
ATOM   2533  C C   . GLU A 1 389 ? 35.278  -45.300 3.370   1.00 51.48  ? 384 GLU B C   1 
ATOM   2534  O O   . GLU A 1 389 ? 35.279  -44.656 4.413   1.00 50.10  ? 384 GLU B O   1 
ATOM   2535  C CB  . GLU A 1 389 ? 33.332  -45.962 1.905   1.00 66.37  ? 384 GLU B CB  1 
ATOM   2536  C CG  . GLU A 1 389 ? 32.603  -46.529 3.107   1.00 82.61  ? 384 GLU B CG  1 
ATOM   2537  C CD  . GLU A 1 389 ? 31.689  -47.689 2.722   1.00 91.61  ? 384 GLU B CD  1 
ATOM   2538  O OE1 . GLU A 1 389 ? 30.653  -47.444 2.065   1.00 96.89  ? 384 GLU B OE1 1 
ATOM   2539  O OE2 . GLU A 1 389 ? 32.016  -48.849 3.065   1.00 97.72  ? 384 GLU B OE2 1 
ATOM   2540  N N   . ASP A 1 390 ? 36.047  -46.369 3.194   1.00 46.79  ? 385 ASP B N   1 
ATOM   2541  C CA  . ASP A 1 390 ? 36.920  -46.862 4.252   1.00 42.27  ? 385 ASP B CA  1 
ATOM   2542  C C   . ASP A 1 390 ? 37.967  -45.862 4.697   1.00 40.24  ? 385 ASP B C   1 
ATOM   2543  O O   . ASP A 1 390 ? 38.332  -45.819 5.873   1.00 38.42  ? 385 ASP B O   1 
ATOM   2544  C CB  . ASP A 1 390 ? 37.601  -48.154 3.812   1.00 41.85  ? 385 ASP B CB  1 
ATOM   2545  C CG  . ASP A 1 390 ? 36.602  -49.232 3.439   1.00 43.91  ? 385 ASP B CG  1 
ATOM   2546  O OD1 . ASP A 1 390 ? 35.477  -49.223 4.003   1.00 44.97  ? 385 ASP B OD1 1 
ATOM   2547  O OD2 . ASP A 1 390 ? 36.940  -50.091 2.592   1.00 43.78  ? 385 ASP B OD2 1 
ATOM   2548  N N   . LEU A 1 391 ? 38.456  -45.060 3.760   1.00 38.28  ? 386 LEU B N   1 
ATOM   2549  C CA  . LEU A 1 391 ? 39.457  -44.061 4.089   1.00 36.54  ? 386 LEU B CA  1 
ATOM   2550  C C   . LEU A 1 391 ? 38.814  -42.989 4.946   1.00 38.09  ? 386 LEU B C   1 
ATOM   2551  O O   . LEU A 1 391 ? 39.353  -42.594 5.977   1.00 39.89  ? 386 LEU B O   1 
ATOM   2552  C CB  . LEU A 1 391 ? 40.024  -43.434 2.823   1.00 34.20  ? 386 LEU B CB  1 
ATOM   2553  C CG  . LEU A 1 391 ? 40.809  -44.373 1.915   1.00 33.40  ? 386 LEU B CG  1 
ATOM   2554  C CD1 . LEU A 1 391 ? 41.383  -43.576 0.749   1.00 31.90  ? 386 LEU B CD1 1 
ATOM   2555  C CD2 . LEU A 1 391 ? 41.925  -45.039 2.715   1.00 33.14  ? 386 LEU B CD2 1 
ATOM   2556  N N   . LEU A 1 392 ? 37.653  -42.520 4.512   1.00 38.99  ? 387 LEU B N   1 
ATOM   2557  C CA  . LEU A 1 392 ? 36.927  -41.490 5.237   1.00 39.70  ? 387 LEU B CA  1 
ATOM   2558  C C   . LEU A 1 392 ? 36.644  -41.919 6.672   1.00 41.05  ? 387 LEU B C   1 
ATOM   2559  O O   . LEU A 1 392 ? 36.822  -41.135 7.601   1.00 43.31  ? 387 LEU B O   1 
ATOM   2560  C CB  . LEU A 1 392 ? 35.615  -41.201 4.520   1.00 38.26  ? 387 LEU B CB  1 
ATOM   2561  C CG  . LEU A 1 392 ? 35.490  -39.934 3.676   1.00 38.13  ? 387 LEU B CG  1 
ATOM   2562  C CD1 . LEU A 1 392 ? 36.815  -39.570 3.002   1.00 35.26  ? 387 LEU B CD1 1 
ATOM   2563  C CD2 . LEU A 1 392 ? 34.362  -40.167 2.667   1.00 38.19  ? 387 LEU B CD2 1 
ATOM   2564  N N   . GLU A 1 393 ? 36.217  -43.170 6.842   1.00 43.57  ? 388 GLU B N   1 
ATOM   2565  C CA  . GLU A 1 393 ? 35.887  -43.722 8.153   1.00 45.47  ? 388 GLU B CA  1 
ATOM   2566  C C   . GLU A 1 393 ? 37.103  -43.953 9.027   1.00 43.16  ? 388 GLU B C   1 
ATOM   2567  O O   . GLU A 1 393 ? 37.022  -43.852 10.248  1.00 43.36  ? 388 GLU B O   1 
ATOM   2568  C CB  . GLU A 1 393 ? 35.125  -45.034 7.994   1.00 51.27  ? 388 GLU B CB  1 
ATOM   2569  C CG  . GLU A 1 393 ? 33.873  -44.901 7.139   1.00 63.61  ? 388 GLU B CG  1 
ATOM   2570  C CD  . GLU A 1 393 ? 33.125  -46.216 6.958   1.00 70.57  ? 388 GLU B CD  1 
ATOM   2571  O OE1 . GLU A 1 393 ? 33.664  -47.283 7.348   1.00 74.36  ? 388 GLU B OE1 1 
ATOM   2572  O OE2 . GLU A 1 393 ? 31.995  -46.176 6.416   1.00 73.83  ? 388 GLU B OE2 1 
ATOM   2573  N N   . ASP A 1 394 ? 38.234  -44.273 8.414   1.00 41.70  ? 389 ASP B N   1 
ATOM   2574  C CA  . ASP A 1 394 ? 39.433  -44.491 9.201   1.00 41.39  ? 389 ASP B CA  1 
ATOM   2575  C C   . ASP A 1 394 ? 39.880  -43.161 9.796   1.00 41.10  ? 389 ASP B C   1 
ATOM   2576  O O   . ASP A 1 394 ? 40.189  -43.069 10.987  1.00 40.35  ? 389 ASP B O   1 
ATOM   2577  C CB  . ASP A 1 394 ? 40.548  -45.081 8.342   1.00 41.65  ? 389 ASP B CB  1 
ATOM   2578  C CG  . ASP A 1 394 ? 41.807  -45.355 9.140   1.00 41.56  ? 389 ASP B CG  1 
ATOM   2579  O OD1 . ASP A 1 394 ? 41.704  -45.998 10.204  1.00 42.80  ? 389 ASP B OD1 1 
ATOM   2580  O OD2 . ASP A 1 394 ? 42.898  -44.931 8.709   1.00 41.26  ? 389 ASP B OD2 1 
ATOM   2581  N N   . LEU A 1 395 ? 39.901  -42.126 8.961   1.00 41.19  ? 390 LEU B N   1 
ATOM   2582  C CA  . LEU A 1 395 ? 40.299  -40.792 9.398   1.00 40.26  ? 390 LEU B CA  1 
ATOM   2583  C C   . LEU A 1 395 ? 39.380  -40.283 10.496  1.00 42.02  ? 390 LEU B C   1 
ATOM   2584  O O   . LEU A 1 395 ? 39.843  -39.790 11.527  1.00 39.54  ? 390 LEU B O   1 
ATOM   2585  C CB  . LEU A 1 395 ? 40.266  -39.824 8.220   1.00 37.63  ? 390 LEU B CB  1 
ATOM   2586  C CG  . LEU A 1 395 ? 41.337  -40.031 7.159   1.00 34.95  ? 390 LEU B CG  1 
ATOM   2587  C CD1 . LEU A 1 395 ? 41.111  -39.068 6.000   1.00 33.74  ? 390 LEU B CD1 1 
ATOM   2588  C CD2 . LEU A 1 395 ? 42.700  -39.815 7.795   1.00 34.01  ? 390 LEU B CD2 1 
ATOM   2589  N N   . ASP A 1 396 ? 38.076  -40.410 10.257  1.00 45.06  ? 391 ASP B N   1 
ATOM   2590  C CA  . ASP A 1 396 ? 37.053  -39.975 11.201  1.00 49.66  ? 391 ASP B CA  1 
ATOM   2591  C C   . ASP A 1 396 ? 37.212  -40.678 12.545  1.00 49.45  ? 391 ASP B C   1 
ATOM   2592  O O   . ASP A 1 396 ? 37.081  -40.060 13.599  1.00 49.48  ? 391 ASP B O   1 
ATOM   2593  C CB  . ASP A 1 396 ? 35.668  -40.262 10.627  1.00 54.90  ? 391 ASP B CB  1 
ATOM   2594  C CG  . ASP A 1 396 ? 34.550  -39.746 11.515  1.00 60.08  ? 391 ASP B CG  1 
ATOM   2595  O OD1 . ASP A 1 396 ? 34.576  -38.543 11.861  1.00 62.67  ? 391 ASP B OD1 1 
ATOM   2596  O OD2 . ASP A 1 396 ? 33.647  -40.543 11.860  1.00 62.26  ? 391 ASP B OD2 1 
ATOM   2597  N N   . GLN A 1 397 ? 37.482  -41.977 12.491  1.00 48.85  ? 392 GLN B N   1 
ATOM   2598  C CA  . GLN A 1 397 ? 37.694  -42.783 13.685  1.00 46.90  ? 392 GLN B CA  1 
ATOM   2599  C C   . GLN A 1 397 ? 38.913  -42.259 14.453  1.00 46.35  ? 392 GLN B C   1 
ATOM   2600  O O   . GLN A 1 397 ? 38.861  -42.083 15.673  1.00 46.41  ? 392 GLN B O   1 
ATOM   2601  C CB  . GLN A 1 397 ? 37.904  -44.244 13.272  1.00 48.32  ? 392 GLN B CB  1 
ATOM   2602  C CG  . GLN A 1 397 ? 38.575  -45.143 14.309  1.00 51.16  ? 392 GLN B CG  1 
ATOM   2603  C CD  . GLN A 1 397 ? 40.099  -45.121 14.232  1.00 51.47  ? 392 GLN B CD  1 
ATOM   2604  O OE1 . GLN A 1 397 ? 40.680  -45.177 13.143  1.00 50.58  ? 392 GLN B OE1 1 
ATOM   2605  N NE2 . GLN A 1 397 ? 40.753  -45.061 15.395  1.00 51.58  ? 392 GLN B NE2 1 
ATOM   2606  N N   . ALA A 1 398 ? 39.999  -41.995 13.730  1.00 43.82  ? 393 ALA B N   1 
ATOM   2607  C CA  . ALA A 1 398 ? 41.234  -41.497 14.336  1.00 42.10  ? 393 ALA B CA  1 
ATOM   2608  C C   . ALA A 1 398 ? 41.087  -40.084 14.897  1.00 42.17  ? 393 ALA B C   1 
ATOM   2609  O O   . ALA A 1 398 ? 41.630  -39.770 15.955  1.00 39.88  ? 393 ALA B O   1 
ATOM   2610  C CB  . ALA A 1 398 ? 42.368  -41.539 13.315  1.00 39.36  ? 393 ALA B CB  1 
ATOM   2611  N N   . LEU A 1 399 ? 40.366  -39.228 14.178  1.00 43.31  ? 394 LEU B N   1 
ATOM   2612  C CA  . LEU A 1 399 ? 40.148  -37.857 14.629  1.00 43.90  ? 394 LEU B CA  1 
ATOM   2613  C C   . LEU A 1 399 ? 39.300  -37.869 15.906  1.00 46.36  ? 394 LEU B C   1 
ATOM   2614  O O   . LEU A 1 399 ? 39.614  -37.175 16.872  1.00 46.50  ? 394 LEU B O   1 
ATOM   2615  C CB  . LEU A 1 399 ? 39.453  -37.039 13.530  1.00 42.48  ? 394 LEU B CB  1 
ATOM   2616  C CG  . LEU A 1 399 ? 40.326  -36.593 12.344  1.00 40.74  ? 394 LEU B CG  1 
ATOM   2617  C CD1 . LEU A 1 399 ? 39.455  -36.157 11.177  1.00 38.99  ? 394 LEU B CD1 1 
ATOM   2618  C CD2 . LEU A 1 399 ? 41.235  -35.460 12.776  1.00 37.52  ? 394 LEU B CD2 1 
ATOM   2619  N N   . LYS A 1 400 ? 38.231  -38.665 15.908  1.00 48.72  ? 395 LYS B N   1 
ATOM   2620  C CA  . LYS A 1 400 ? 37.352  -38.782 17.073  1.00 49.65  ? 395 LYS B CA  1 
ATOM   2621  C C   . LYS A 1 400 ? 38.142  -39.273 18.279  1.00 51.80  ? 395 LYS B C   1 
ATOM   2622  O O   . LYS A 1 400 ? 37.928  -38.821 19.406  1.00 51.59  ? 395 LYS B O   1 
ATOM   2623  C CB  . LYS A 1 400 ? 36.216  -39.772 16.801  1.00 48.13  ? 395 LYS B CB  1 
ATOM   2624  C CG  . LYS A 1 400 ? 35.051  -39.225 16.006  1.00 47.00  ? 395 LYS B CG  1 
ATOM   2625  C CD  . LYS A 1 400 ? 33.938  -40.263 15.959  1.00 48.08  ? 395 LYS B CD  1 
ATOM   2626  C CE  . LYS A 1 400 ? 32.576  -39.646 15.663  1.00 47.54  ? 395 LYS B CE  1 
ATOM   2627  N NZ  . LYS A 1 400 ? 32.567  -38.917 14.369  1.00 47.31  ? 395 LYS B NZ  1 
ATOM   2628  N N   . ALA A 1 401 ? 39.049  -40.213 18.025  1.00 53.70  ? 396 ALA B N   1 
ATOM   2629  C CA  . ALA A 1 401 ? 39.881  -40.799 19.065  1.00 55.41  ? 396 ALA B CA  1 
ATOM   2630  C C   . ALA A 1 401 ? 40.834  -39.773 19.656  1.00 57.13  ? 396 ALA B C   1 
ATOM   2631  O O   . ALA A 1 401 ? 41.155  -39.825 20.841  1.00 57.96  ? 396 ALA B O   1 
ATOM   2632  C CB  . ALA A 1 401 ? 40.666  -41.972 18.499  1.00 54.85  ? 396 ALA B CB  1 
ATOM   2633  N N   . ALA A 1 402 ? 41.282  -38.839 18.826  1.00 59.21  ? 397 ALA B N   1 
ATOM   2634  C CA  . ALA A 1 402 ? 42.202  -37.803 19.277  1.00 62.67  ? 397 ALA B CA  1 
ATOM   2635  C C   . ALA A 1 402 ? 41.456  -36.664 19.966  1.00 66.42  ? 397 ALA B C   1 
ATOM   2636  O O   . ALA A 1 402 ? 42.039  -35.619 20.259  1.00 65.49  ? 397 ALA B O   1 
ATOM   2637  C CB  . ALA A 1 402 ? 43.010  -37.267 18.094  1.00 60.99  ? 397 ALA B CB  1 
ATOM   2638  N N   . HIS A 1 403 ? 40.166  -36.877 20.220  1.00 71.25  ? 398 HIS B N   1 
ATOM   2639  C CA  . HIS A 1 403 ? 39.307  -35.893 20.882  1.00 78.04  ? 398 HIS B CA  1 
ATOM   2640  C C   . HIS A 1 403 ? 38.155  -36.615 21.588  1.00 85.40  ? 398 HIS B C   1 
ATOM   2641  O O   . HIS A 1 403 ? 37.099  -36.837 20.996  1.00 83.81  ? 398 HIS B O   1 
ATOM   2642  C CB  . HIS A 1 403 ? 38.744  -34.912 19.855  1.00 76.48  ? 398 HIS B CB  1 
ATOM   2643  C CG  . HIS A 1 403 ? 39.790  -34.110 19.148  1.00 76.82  ? 398 HIS B CG  1 
ATOM   2644  N ND1 . HIS A 1 403 ? 40.335  -32.961 19.679  1.00 77.17  ? 398 HIS B ND1 1 
ATOM   2645  C CD2 . HIS A 1 403 ? 40.394  -34.291 17.949  1.00 77.17  ? 398 HIS B CD2 1 
ATOM   2646  C CE1 . HIS A 1 403 ? 41.226  -32.468 18.837  1.00 77.40  ? 398 HIS B CE1 1 
ATOM   2647  N NE2 . HIS A 1 403 ? 41.281  -33.257 17.778  1.00 76.61  ? 398 HIS B NE2 1 
ATOM   2648  N N   . PRO A 1 404 ? 38.354  -37.001 22.862  1.00 88.39  ? 399 PRO B N   1 
ATOM   2649  C CA  . PRO A 1 404 ? 37.380  -37.707 23.711  1.00 94.40  ? 399 PRO B CA  1 
ATOM   2650  C C   . PRO A 1 404 ? 36.061  -36.973 24.020  1.00 97.63  ? 399 PRO B C   1 
ATOM   2651  O O   . PRO A 1 404 ? 35.871  -36.549 25.184  1.00 98.66  ? 399 PRO B O   1 
ATOM   2652  C CB  . PRO A 1 404 ? 38.185  -38.006 24.976  1.00 95.09  ? 399 PRO B CB  1 
ATOM   2653  C CG  . PRO A 1 404 ? 39.589  -38.146 24.451  1.00 93.93  ? 399 PRO B CG  1 
ATOM   2654  C CD  . PRO A 1 404 ? 39.674  -36.969 23.518  1.00 91.48  ? 399 PRO B CD  1 
ATOM   2655  N N   . GLN B 1 14  ? 24.166  -44.291 -12.207 1.00 51.12  ? 9   GLN A N   1 
ATOM   2656  C CA  . GLN B 1 14  ? 22.685  -44.611 -12.309 1.00 50.93  ? 9   GLN A CA  1 
ATOM   2657  C C   . GLN B 1 14  ? 22.509  -46.131 -11.924 1.00 44.85  ? 9   GLN A C   1 
ATOM   2658  O O   . GLN B 1 14  ? 23.374  -46.727 -11.240 1.00 59.53  ? 9   GLN A O   1 
ATOM   2659  C CB  . GLN B 1 14  ? 22.272  -44.326 -13.825 1.00 45.13  ? 9   GLN A CB  1 
ATOM   2660  C CG  . GLN B 1 14  ? 20.691  -44.140 -14.212 1.00 35.25  ? 9   GLN A CG  1 
ATOM   2661  C CD  . GLN B 1 14  ? 20.406  -42.716 -14.698 1.00 34.26  ? 9   GLN A CD  1 
ATOM   2662  O OE1 . GLN B 1 14  ? 20.179  -42.458 -15.913 1.00 32.50  ? 9   GLN A OE1 1 
ATOM   2663  N NE2 . GLN B 1 14  ? 20.492  -41.762 -13.752 1.00 32.04  ? 9   GLN A NE2 1 
ATOM   2664  N N   . GLY B 1 15  ? 21.376  -46.676 -12.338 1.00 66.63  ? 10  GLY A N   1 
ATOM   2665  C CA  . GLY B 1 15  ? 20.971  -48.089 -12.172 1.00 67.47  ? 10  GLY A CA  1 
ATOM   2666  C C   . GLY B 1 15  ? 21.508  -49.459 -11.637 1.00 64.93  ? 10  GLY A C   1 
ATOM   2667  O O   . GLY B 1 15  ? 20.657  -50.154 -10.993 1.00 73.40  ? 10  GLY A O   1 
ATOM   2668  N N   . PHE B 1 16  ? 22.792  -49.848 -11.764 1.00 66.89  ? 11  PHE A N   1 
ATOM   2669  C CA  . PHE B 1 16  ? 23.289  -51.148 -11.268 1.00 62.08  ? 11  PHE A CA  1 
ATOM   2670  C C   . PHE B 1 16  ? 23.378  -51.344 -9.755  1.00 59.15  ? 11  PHE A C   1 
ATOM   2671  O O   . PHE B 1 16  ? 23.299  -50.406 -8.980  1.00 58.18  ? 11  PHE A O   1 
ATOM   2672  C CB  . PHE B 1 16  ? 24.671  -51.439 -11.881 1.00 58.32  ? 11  PHE A CB  1 
ATOM   2673  C CG  . PHE B 1 16  ? 24.721  -51.248 -13.396 1.00 54.08  ? 11  PHE A CG  1 
ATOM   2674  C CD1 . PHE B 1 16  ? 24.663  -52.334 -14.273 1.00 52.43  ? 11  PHE A CD1 1 
ATOM   2675  C CD2 . PHE B 1 16  ? 24.816  -49.974 -13.934 1.00 52.48  ? 11  PHE A CD2 1 
ATOM   2676  C CE1 . PHE B 1 16  ? 24.701  -52.150 -15.663 1.00 50.62  ? 11  PHE A CE1 1 
ATOM   2677  C CE2 . PHE B 1 16  ? 24.854  -49.773 -15.309 1.00 52.69  ? 11  PHE A CE2 1 
ATOM   2678  C CZ  . PHE B 1 16  ? 24.798  -50.862 -16.183 1.00 51.30  ? 11  PHE A CZ  1 
ATOM   2679  N N   . LEU B 1 17  ? 23.560  -52.592 -9.342  1.00 56.09  ? 12  LEU A N   1 
ATOM   2680  C CA  . LEU B 1 17  ? 23.735  -52.885 -7.927  1.00 54.04  ? 12  LEU A CA  1 
ATOM   2681  C C   . LEU B 1 17  ? 24.901  -52.039 -7.478  1.00 53.91  ? 12  LEU A C   1 
ATOM   2682  O O   . LEU B 1 17  ? 25.864  -51.881 -8.218  1.00 53.19  ? 12  LEU A O   1 
ATOM   2683  C CB  . LEU B 1 17  ? 24.086  -54.362 -7.694  1.00 52.27  ? 12  LEU A CB  1 
ATOM   2684  C CG  . LEU B 1 17  ? 23.071  -55.352 -8.240  1.00 52.92  ? 12  LEU A CG  1 
ATOM   2685  C CD1 . LEU B 1 17  ? 23.695  -56.720 -8.297  1.00 53.42  ? 12  LEU A CD1 1 
ATOM   2686  C CD2 . LEU B 1 17  ? 21.831  -55.356 -7.360  1.00 53.85  ? 12  LEU A CD2 1 
ATOM   2687  N N   . PRO B 1 18  ? 24.819  -51.462 -6.269  1.00 52.43  ? 13  PRO A N   1 
ATOM   2688  C CA  . PRO B 1 18  ? 25.917  -50.631 -5.764  1.00 53.42  ? 13  PRO A CA  1 
ATOM   2689  C C   . PRO B 1 18  ? 27.192  -51.479 -5.648  1.00 53.42  ? 13  PRO A C   1 
ATOM   2690  O O   . PRO B 1 18  ? 27.147  -52.621 -5.187  1.00 53.44  ? 13  PRO A O   1 
ATOM   2691  C CB  . PRO B 1 18  ? 25.386  -50.150 -4.411  1.00 52.81  ? 13  PRO A CB  1 
ATOM   2692  C CG  . PRO B 1 18  ? 24.461  -51.263 -3.993  1.00 52.40  ? 13  PRO A CG  1 
ATOM   2693  C CD  . PRO B 1 18  ? 23.737  -51.567 -5.273  1.00 52.49  ? 13  PRO A CD  1 
ATOM   2694  N N   . HIS B 1 19  ? 28.322  -50.927 -6.075  1.00 52.67  ? 14  HIS A N   1 
ATOM   2695  C CA  . HIS B 1 19  ? 29.580  -51.660 -6.024  1.00 52.88  ? 14  HIS A CA  1 
ATOM   2696  C C   . HIS B 1 19  ? 29.844  -52.291 -4.682  1.00 50.47  ? 14  HIS A C   1 
ATOM   2697  O O   . HIS B 1 19  ? 29.541  -51.715 -3.642  1.00 50.80  ? 14  HIS A O   1 
ATOM   2698  C CB  . HIS B 1 19  ? 30.757  -50.755 -6.387  1.00 55.84  ? 14  HIS A CB  1 
ATOM   2699  C CG  . HIS B 1 19  ? 30.878  -50.500 -7.855  1.00 58.95  ? 14  HIS A CG  1 
ATOM   2700  N ND1 . HIS B 1 19  ? 30.631  -49.267 -8.421  1.00 59.45  ? 14  HIS A ND1 1 
ATOM   2701  C CD2 . HIS B 1 19  ? 31.179  -51.332 -8.880  1.00 59.36  ? 14  HIS A CD2 1 
ATOM   2702  C CE1 . HIS B 1 19  ? 30.774  -49.351 -9.731  1.00 60.75  ? 14  HIS A CE1 1 
ATOM   2703  N NE2 . HIS B 1 19  ? 31.105  -50.593 -10.036 1.00 61.00  ? 14  HIS A NE2 1 
ATOM   2704  N N   . PHE B 1 20  ? 30.429  -53.478 -4.718  1.00 47.70  ? 15  PHE A N   1 
ATOM   2705  C CA  . PHE B 1 20  ? 30.746  -54.211 -3.509  1.00 45.46  ? 15  PHE A CA  1 
ATOM   2706  C C   . PHE B 1 20  ? 31.668  -53.397 -2.607  1.00 46.19  ? 15  PHE A C   1 
ATOM   2707  O O   . PHE B 1 20  ? 32.708  -52.912 -3.038  1.00 46.50  ? 15  PHE A O   1 
ATOM   2708  C CB  . PHE B 1 20  ? 31.385  -55.533 -3.903  1.00 41.87  ? 15  PHE A CB  1 
ATOM   2709  C CG  . PHE B 1 20  ? 30.646  -56.241 -4.996  1.00 38.72  ? 15  PHE A CG  1 
ATOM   2710  C CD1 . PHE B 1 20  ? 29.396  -56.787 -4.761  1.00 36.20  ? 15  PHE A CD1 1 
ATOM   2711  C CD2 . PHE B 1 20  ? 31.180  -56.322 -6.277  1.00 39.04  ? 15  PHE A CD2 1 
ATOM   2712  C CE1 . PHE B 1 20  ? 28.686  -57.405 -5.779  1.00 36.25  ? 15  PHE A CE1 1 
ATOM   2713  C CE2 . PHE B 1 20  ? 30.472  -56.942 -7.310  1.00 37.89  ? 15  PHE A CE2 1 
ATOM   2714  C CZ  . PHE B 1 20  ? 29.224  -57.483 -7.058  1.00 36.72  ? 15  PHE A CZ  1 
ATOM   2715  N N   . GLN B 1 21  ? 31.259  -53.233 -1.355  1.00 48.37  ? 16  GLN A N   1 
ATOM   2716  C CA  . GLN B 1 21  ? 32.030  -52.482 -0.373  1.00 51.18  ? 16  GLN A CA  1 
ATOM   2717  C C   . GLN B 1 21  ? 33.404  -53.078 -0.123  1.00 47.14  ? 16  GLN A C   1 
ATOM   2718  O O   . GLN B 1 21  ? 33.580  -54.294 -0.194  1.00 46.10  ? 16  GLN A O   1 
ATOM   2719  C CB  . GLN B 1 21  ? 31.301  -52.456 0.964   1.00 59.23  ? 16  GLN A CB  1 
ATOM   2720  C CG  . GLN B 1 21  ? 30.157  -51.489 1.086   1.00 71.77  ? 16  GLN A CG  1 
ATOM   2721  C CD  . GLN B 1 21  ? 29.529  -51.566 2.463   1.00 78.47  ? 16  GLN A CD  1 
ATOM   2722  O OE1 . GLN B 1 21  ? 28.922  -52.576 2.823   1.00 83.19  ? 16  GLN A OE1 1 
ATOM   2723  N NE2 . GLN B 1 21  ? 29.689  -50.507 3.249   1.00 82.90  ? 16  GLN A NE2 1 
ATOM   2724  N N   . HIS B 1 22  ? 34.358  -52.204 0.192   1.00 43.34  ? 17  HIS A N   1 
ATOM   2725  C CA  . HIS B 1 22  ? 35.741  -52.574 0.510   1.00 41.04  ? 17  HIS A CA  1 
ATOM   2726  C C   . HIS B 1 22  ? 36.564  -53.317 -0.555  1.00 37.97  ? 17  HIS A C   1 
ATOM   2727  O O   . HIS B 1 22  ? 37.737  -53.604 -0.327  1.00 36.27  ? 17  HIS A O   1 
ATOM   2728  C CB  . HIS B 1 22  ? 35.784  -53.411 1.798   1.00 42.23  ? 17  HIS A CB  1 
ATOM   2729  C CG  . HIS B 1 22  ? 34.876  -52.919 2.884   1.00 43.27  ? 17  HIS A CG  1 
ATOM   2730  N ND1 . HIS B 1 22  ? 33.524  -53.182 2.901   1.00 44.19  ? 17  HIS A ND1 1 
ATOM   2731  C CD2 . HIS B 1 22  ? 35.129  -52.179 3.989   1.00 44.57  ? 17  HIS A CD2 1 
ATOM   2732  C CE1 . HIS B 1 22  ? 32.980  -52.624 3.970   1.00 43.56  ? 17  HIS A CE1 1 
ATOM   2733  N NE2 . HIS B 1 22  ? 33.933  -52.009 4.645   1.00 44.15  ? 17  HIS A NE2 1 
ATOM   2734  N N   . PHE B 1 23  ? 35.967  -53.625 -1.704  1.00 35.80  ? 18  PHE A N   1 
ATOM   2735  C CA  . PHE B 1 23  ? 36.663  -54.362 -2.757  1.00 33.64  ? 18  PHE A CA  1 
ATOM   2736  C C   . PHE B 1 23  ? 38.092  -53.879 -2.952  1.00 32.34  ? 18  PHE A C   1 
ATOM   2737  O O   . PHE B 1 23  ? 39.039  -54.641 -2.777  1.00 32.32  ? 18  PHE A O   1 
ATOM   2738  C CB  . PHE B 1 23  ? 35.909  -54.246 -4.075  1.00 33.31  ? 18  PHE A CB  1 
ATOM   2739  C CG  . PHE B 1 23  ? 36.394  -55.196 -5.134  1.00 34.45  ? 18  PHE A CG  1 
ATOM   2740  C CD1 . PHE B 1 23  ? 35.854  -56.472 -5.247  1.00 34.23  ? 18  PHE A CD1 1 
ATOM   2741  C CD2 . PHE B 1 23  ? 37.395  -54.814 -6.021  1.00 35.03  ? 18  PHE A CD2 1 
ATOM   2742  C CE1 . PHE B 1 23  ? 36.300  -57.356 -6.230  1.00 35.30  ? 18  PHE A CE1 1 
ATOM   2743  C CE2 . PHE B 1 23  ? 37.851  -55.690 -7.009  1.00 35.79  ? 18  PHE A CE2 1 
ATOM   2744  C CZ  . PHE B 1 23  ? 37.302  -56.962 -7.115  1.00 35.51  ? 18  PHE A CZ  1 
ATOM   2745  N N   . ALA B 1 24  ? 38.240  -52.608 -3.309  1.00 31.73  ? 19  ALA A N   1 
ATOM   2746  C CA  . ALA B 1 24  ? 39.555  -52.000 -3.528  1.00 30.98  ? 19  ALA A CA  1 
ATOM   2747  C C   . ALA B 1 24  ? 40.460  -52.076 -2.297  1.00 31.42  ? 19  ALA A C   1 
ATOM   2748  O O   . ALA B 1 24  ? 41.653  -52.374 -2.409  1.00 32.68  ? 19  ALA A O   1 
ATOM   2749  C CB  . ALA B 1 24  ? 39.386  -50.556 -3.951  1.00 29.84  ? 19  ALA A CB  1 
ATOM   2750  N N   . THR B 1 25  ? 39.896  -51.797 -1.126  1.00 30.11  ? 20  THR A N   1 
ATOM   2751  C CA  . THR B 1 25  ? 40.658  -51.848 0.110   1.00 29.08  ? 20  THR A CA  1 
ATOM   2752  C C   . THR B 1 25  ? 41.209  -53.244 0.343   1.00 29.28  ? 20  THR A C   1 
ATOM   2753  O O   . THR B 1 25  ? 42.396  -53.405 0.604   1.00 29.22  ? 20  THR A O   1 
ATOM   2754  C CB  . THR B 1 25  ? 39.790  -51.446 1.312   1.00 29.13  ? 20  THR A CB  1 
ATOM   2755  O OG1 . THR B 1 25  ? 39.337  -50.101 1.134   1.00 30.69  ? 20  THR A OG1 1 
ATOM   2756  C CG2 . THR B 1 25  ? 40.592  -51.519 2.600   1.00 28.44  ? 20  THR A CG2 1 
ATOM   2757  N N   . GLN B 1 26  ? 40.340  -54.246 0.238   1.00 31.41  ? 21  GLN A N   1 
ATOM   2758  C CA  . GLN B 1 26  ? 40.714  -55.646 0.433   1.00 33.76  ? 21  GLN A CA  1 
ATOM   2759  C C   . GLN B 1 26  ? 41.729  -56.104 -0.618  1.00 36.01  ? 21  GLN A C   1 
ATOM   2760  O O   . GLN B 1 26  ? 42.722  -56.775 -0.302  1.00 35.41  ? 21  GLN A O   1 
ATOM   2761  C CB  . GLN B 1 26  ? 39.479  -56.546 0.334   1.00 34.70  ? 21  GLN A CB  1 
ATOM   2762  C CG  . GLN B 1 26  ? 38.304  -56.121 1.190   1.00 37.51  ? 21  GLN A CG  1 
ATOM   2763  C CD  . GLN B 1 26  ? 37.096  -57.034 1.020   1.00 39.95  ? 21  GLN A CD  1 
ATOM   2764  O OE1 . GLN B 1 26  ? 36.598  -57.237 -0.091  1.00 40.36  ? 21  GLN A OE1 1 
ATOM   2765  N NE2 . GLN B 1 26  ? 36.619  -57.590 2.127   1.00 40.62  ? 21  GLN A NE2 1 
ATOM   2766  N N   . ALA B 1 27  ? 41.464  -55.747 -1.873  1.00 35.70  ? 22  ALA A N   1 
ATOM   2767  C CA  . ALA B 1 27  ? 42.331  -56.119 -2.988  1.00 34.98  ? 22  ALA A CA  1 
ATOM   2768  C C   . ALA B 1 27  ? 43.757  -55.629 -2.772  1.00 35.45  ? 22  ALA A C   1 
ATOM   2769  O O   . ALA B 1 27  ? 44.724  -56.228 -3.247  1.00 36.73  ? 22  ALA A O   1 
ATOM   2770  C CB  . ALA B 1 27  ? 41.774  -55.550 -4.286  1.00 32.59  ? 22  ALA A CB  1 
ATOM   2771  N N   . ILE B 1 28  ? 43.886  -54.539 -2.037  1.00 34.04  ? 23  ILE A N   1 
ATOM   2772  C CA  . ILE B 1 28  ? 45.192  -53.970 -1.786  1.00 32.50  ? 23  ILE A CA  1 
ATOM   2773  C C   . ILE B 1 28  ? 45.815  -54.418 -0.466  1.00 34.09  ? 23  ILE A C   1 
ATOM   2774  O O   . ILE B 1 28  ? 46.998  -54.762 -0.411  1.00 33.62  ? 23  ILE A O   1 
ATOM   2775  C CB  . ILE B 1 28  ? 45.100  -52.436 -1.816  1.00 30.93  ? 23  ILE A CB  1 
ATOM   2776  C CG1 . ILE B 1 28  ? 44.596  -51.993 -3.195  1.00 29.44  ? 23  ILE A CG1 1 
ATOM   2777  C CG2 . ILE B 1 28  ? 46.448  -51.820 -1.468  1.00 29.33  ? 23  ILE A CG2 1 
ATOM   2778  C CD1 . ILE B 1 28  ? 44.419  -50.487 -3.370  1.00 26.36  ? 23  ILE A CD1 1 
ATOM   2779  N N   . HIS B 1 29  ? 45.015  -54.436 0.593   1.00 35.65  ? 24  HIS A N   1 
ATOM   2780  C CA  . HIS B 1 29  ? 45.522  -54.802 1.906   1.00 36.05  ? 24  HIS A CA  1 
ATOM   2781  C C   . HIS B 1 29  ? 45.432  -56.256 2.337   1.00 36.96  ? 24  HIS A C   1 
ATOM   2782  O O   . HIS B 1 29  ? 46.359  -56.757 2.961   1.00 37.35  ? 24  HIS A O   1 
ATOM   2783  C CB  . HIS B 1 29  ? 44.861  -53.910 2.952   1.00 35.73  ? 24  HIS A CB  1 
ATOM   2784  C CG  . HIS B 1 29  ? 45.163  -52.460 2.759   1.00 36.96  ? 24  HIS A CG  1 
ATOM   2785  N ND1 . HIS B 1 29  ? 46.434  -51.943 2.903   1.00 36.56  ? 24  HIS A ND1 1 
ATOM   2786  C CD2 . HIS B 1 29  ? 44.381  -51.429 2.363   1.00 37.79  ? 24  HIS A CD2 1 
ATOM   2787  C CE1 . HIS B 1 29  ? 46.422  -50.658 2.601   1.00 35.84  ? 24  HIS A CE1 1 
ATOM   2788  N NE2 . HIS B 1 29  ? 45.188  -50.321 2.269   1.00 38.74  ? 24  HIS A NE2 1 
ATOM   2789  N N   . VAL B 1 30  ? 44.339  -56.937 2.011   1.00 39.00  ? 25  VAL A N   1 
ATOM   2790  C CA  . VAL B 1 30  ? 44.182  -58.329 2.422   1.00 41.86  ? 25  VAL A CA  1 
ATOM   2791  C C   . VAL B 1 30  ? 45.376  -59.219 2.063   1.00 46.90  ? 25  VAL A C   1 
ATOM   2792  O O   . VAL B 1 30  ? 45.767  -59.327 0.896   1.00 47.00  ? 25  VAL A O   1 
ATOM   2793  C CB  . VAL B 1 30  ? 42.883  -58.956 1.836   1.00 39.06  ? 25  VAL A CB  1 
ATOM   2794  C CG1 . VAL B 1 30  ? 42.789  -60.427 2.220   1.00 34.77  ? 25  VAL A CG1 1 
ATOM   2795  C CG2 . VAL B 1 30  ? 41.670  -58.223 2.375   1.00 35.76  ? 25  VAL A CG2 1 
ATOM   2796  N N   . GLY B 1 31  ? 45.948  -59.849 3.089   1.00 52.28  ? 26  GLY A N   1 
ATOM   2797  C CA  . GLY B 1 31  ? 47.083  -60.738 2.903   1.00 58.01  ? 26  GLY A CA  1 
ATOM   2798  C C   . GLY B 1 31  ? 48.410  -60.061 2.602   1.00 62.07  ? 26  GLY A C   1 
ATOM   2799  O O   . GLY B 1 31  ? 49.368  -60.729 2.212   1.00 63.25  ? 26  GLY A O   1 
ATOM   2800  N N   . GLN B 1 32  ? 48.477  -58.743 2.790   1.00 65.74  ? 27  GLN A N   1 
ATOM   2801  C CA  . GLN B 1 32  ? 49.695  -57.976 2.517   1.00 68.04  ? 27  GLN A CA  1 
ATOM   2802  C C   . GLN B 1 32  ? 50.389  -57.472 3.785   1.00 68.86  ? 27  GLN A C   1 
ATOM   2803  O O   . GLN B 1 32  ? 50.540  -58.202 4.766   1.00 70.14  ? 27  GLN A O   1 
ATOM   2804  C CB  . GLN B 1 32  ? 49.364  -56.780 1.621   1.00 69.20  ? 27  GLN A CB  1 
ATOM   2805  C CG  . GLN B 1 32  ? 48.618  -57.140 0.346   1.00 72.75  ? 27  GLN A CG  1 
ATOM   2806  C CD  . GLN B 1 32  ? 49.466  -57.936 -0.631  1.00 74.92  ? 27  GLN A CD  1 
ATOM   2807  O OE1 . GLN B 1 32  ? 50.509  -57.460 -1.095  1.00 76.51  ? 27  GLN A OE1 1 
ATOM   2808  N NE2 . GLN B 1 32  ? 49.022  -59.152 -0.952  1.00 74.23  ? 27  GLN A NE2 1 
ATOM   2809  N N   . GLY B 1 69  ? 51.029  -75.207 -1.291  1.00 78.03  ? 64  GLY A N   1 
ATOM   2810  C CA  . GLY B 1 69  ? 50.906  -73.861 -1.818  1.00 76.06  ? 64  GLY A CA  1 
ATOM   2811  C C   . GLY B 1 69  ? 51.810  -72.918 -1.063  1.00 74.12  ? 64  GLY A C   1 
ATOM   2812  O O   . GLY B 1 69  ? 52.720  -72.330 -1.645  1.00 76.60  ? 64  GLY A O   1 
ATOM   2813  N N   . ASN B 1 70  ? 51.550  -72.781 0.234   1.00 70.05  ? 65  ASN A N   1 
ATOM   2814  C CA  . ASN B 1 70  ? 52.339  -71.929 1.114   1.00 65.55  ? 65  ASN A CA  1 
ATOM   2815  C C   . ASN B 1 70  ? 52.048  -70.428 1.007   1.00 60.29  ? 65  ASN A C   1 
ATOM   2816  O O   . ASN B 1 70  ? 51.288  -69.996 0.142   1.00 60.37  ? 65  ASN A O   1 
ATOM   2817  C CB  . ASN B 1 70  ? 53.825  -72.238 0.920   1.00 67.61  ? 65  ASN A CB  1 
ATOM   2818  C CG  . ASN B 1 70  ? 54.189  -73.618 1.429   1.00 68.45  ? 65  ASN A CG  1 
ATOM   2819  O OD1 . ASN B 1 70  ? 53.787  -74.626 0.852   1.00 70.01  ? 65  ASN A OD1 1 
ATOM   2820  N ND2 . ASN B 1 70  ? 54.933  -73.671 2.528   1.00 69.11  ? 65  ASN A ND2 1 
ATOM   2821  N N   . PRO B 1 71  ? 52.664  -69.614 1.885   1.00 56.48  ? 66  PRO A N   1 
ATOM   2822  C CA  . PRO B 1 71  ? 52.461  -68.167 1.911   1.00 52.98  ? 66  PRO A CA  1 
ATOM   2823  C C   . PRO B 1 71  ? 51.885  -67.488 0.681   1.00 49.34  ? 66  PRO A C   1 
ATOM   2824  O O   . PRO B 1 71  ? 50.765  -66.985 0.710   1.00 49.85  ? 66  PRO A O   1 
ATOM   2825  C CB  . PRO B 1 71  ? 53.841  -67.643 2.285   1.00 52.89  ? 66  PRO A CB  1 
ATOM   2826  C CG  . PRO B 1 71  ? 54.263  -68.620 3.289   1.00 53.50  ? 66  PRO A CG  1 
ATOM   2827  C CD  . PRO B 1 71  ? 53.890  -69.947 2.640   1.00 55.01  ? 66  PRO A CD  1 
ATOM   2828  N N   . THR B 1 72  ? 52.645  -67.476 -0.400  1.00 45.60  ? 67  THR A N   1 
ATOM   2829  C CA  . THR B 1 72  ? 52.201  -66.804 -1.599  1.00 42.96  ? 67  THR A CA  1 
ATOM   2830  C C   . THR B 1 72  ? 50.783  -67.187 -2.010  1.00 42.81  ? 67  THR A C   1 
ATOM   2831  O O   . THR B 1 72  ? 49.927  -66.319 -2.193  1.00 41.45  ? 67  THR A O   1 
ATOM   2832  C CB  . THR B 1 72  ? 53.162  -67.090 -2.732  1.00 43.45  ? 67  THR A CB  1 
ATOM   2833  O OG1 . THR B 1 72  ? 54.469  -67.308 -2.184  1.00 43.82  ? 67  THR A OG1 1 
ATOM   2834  C CG2 . THR B 1 72  ? 53.208  -65.915 -3.688  1.00 42.55  ? 67  THR A CG2 1 
ATOM   2835  N N   . ARG B 1 73  ? 50.526  -68.486 -2.132  1.00 41.52  ? 68  ARG A N   1 
ATOM   2836  C CA  . ARG B 1 73  ? 49.210  -68.950 -2.545  1.00 40.38  ? 68  ARG A CA  1 
ATOM   2837  C C   . ARG B 1 73  ? 48.119  -68.623 -1.542  1.00 40.67  ? 68  ARG A C   1 
ATOM   2838  O O   . ARG B 1 73  ? 47.039  -68.177 -1.922  1.00 41.08  ? 68  ARG A O   1 
ATOM   2839  C CB  . ARG B 1 73  ? 49.224  -70.453 -2.803  1.00 38.10  ? 68  ARG A CB  1 
ATOM   2840  C CG  . ARG B 1 73  ? 48.042  -70.909 -3.625  1.00 38.15  ? 68  ARG A CG  1 
ATOM   2841  C CD  . ARG B 1 73  ? 48.162  -72.376 -3.963  1.00 40.47  ? 68  ARG A CD  1 
ATOM   2842  N NE  . ARG B 1 73  ? 47.875  -73.221 -2.808  1.00 41.53  ? 68  ARG A NE  1 
ATOM   2843  C CZ  . ARG B 1 73  ? 48.121  -74.524 -2.758  1.00 40.83  ? 68  ARG A CZ  1 
ATOM   2844  N NH1 . ARG B 1 73  ? 48.666  -75.144 -3.798  1.00 40.26  ? 68  ARG A NH1 1 
ATOM   2845  N NH2 . ARG B 1 73  ? 47.824  -75.208 -1.663  1.00 42.69  ? 68  ARG A NH2 1 
ATOM   2846  N N   . ASN B 1 74  ? 48.404  -68.844 -0.264  1.00 40.80  ? 69  ASN A N   1 
ATOM   2847  C CA  . ASN B 1 74  ? 47.436  -68.570 0.792   1.00 42.06  ? 69  ASN A CA  1 
ATOM   2848  C C   . ASN B 1 74  ? 46.997  -67.112 0.772   1.00 40.32  ? 69  ASN A C   1 
ATOM   2849  O O   . ASN B 1 74  ? 45.803  -66.816 0.868   1.00 39.22  ? 69  ASN A O   1 
ATOM   2850  C CB  . ASN B 1 74  ? 48.042  -68.918 2.149   1.00 46.61  ? 69  ASN A CB  1 
ATOM   2851  C CG  . ASN B 1 74  ? 48.379  -70.394 2.269   1.00 50.43  ? 69  ASN A CG  1 
ATOM   2852  O OD1 . ASN B 1 74  ? 48.695  -71.054 1.278   1.00 52.77  ? 69  ASN A OD1 1 
ATOM   2853  N ND2 . ASN B 1 74  ? 48.327  -70.914 3.486   1.00 53.62  ? 69  ASN A ND2 1 
ATOM   2854  N N   . CYS B 1 75  ? 47.962  -66.206 0.646   1.00 38.54  ? 70  CYS A N   1 
ATOM   2855  C CA  . CYS B 1 75  ? 47.665  -64.780 0.599   1.00 38.88  ? 70  CYS A CA  1 
ATOM   2856  C C   . CYS B 1 75  ? 46.799  -64.464 -0.603  1.00 36.49  ? 70  CYS A C   1 
ATOM   2857  O O   . CYS B 1 75  ? 45.837  -63.705 -0.496  1.00 35.46  ? 70  CYS A O   1 
ATOM   2858  C CB  . CYS B 1 75  ? 48.951  -63.962 0.529   1.00 40.74  ? 70  CYS A CB  1 
ATOM   2859  S SG  . CYS B 1 75  ? 49.884  -63.991 2.066   1.00 47.70  ? 70  CYS A SG  1 
ATOM   2860  N N   . LEU B 1 76  ? 47.149  -65.045 -1.748  1.00 35.02  ? 71  LEU A N   1 
ATOM   2861  C CA  . LEU B 1 76  ? 46.382  -64.839 -2.967  1.00 33.50  ? 71  LEU A CA  1 
ATOM   2862  C C   . LEU B 1 76  ? 44.956  -65.302 -2.736  1.00 33.59  ? 71  LEU A C   1 
ATOM   2863  O O   . LEU B 1 76  ? 44.004  -64.596 -3.070  1.00 33.28  ? 71  LEU A O   1 
ATOM   2864  C CB  . LEU B 1 76  ? 46.967  -65.638 -4.132  1.00 30.27  ? 71  LEU A CB  1 
ATOM   2865  C CG  . LEU B 1 76  ? 46.153  -65.534 -5.427  1.00 26.34  ? 71  LEU A CG  1 
ATOM   2866  C CD1 . LEU B 1 76  ? 46.215  -64.122 -5.949  1.00 24.75  ? 71  LEU A CD1 1 
ATOM   2867  C CD2 . LEU B 1 76  ? 46.702  -66.489 -6.461  1.00 27.11  ? 71  LEU A CD2 1 
ATOM   2868  N N   . GLU B 1 77  ? 44.817  -66.494 -2.165  1.00 33.29  ? 72  GLU A N   1 
ATOM   2869  C CA  . GLU B 1 77  ? 43.503  -67.058 -1.901  1.00 35.59  ? 72  GLU A CA  1 
ATOM   2870  C C   . GLU B 1 77  ? 42.753  -66.222 -0.866  1.00 35.76  ? 72  GLU A C   1 
ATOM   2871  O O   . GLU B 1 77  ? 41.587  -65.901 -1.071  1.00 36.99  ? 72  GLU A O   1 
ATOM   2872  C CB  . GLU B 1 77  ? 43.634  -68.522 -1.455  1.00 36.19  ? 72  GLU A CB  1 
ATOM   2873  C CG  . GLU B 1 77  ? 44.329  -69.409 -2.493  1.00 37.05  ? 72  GLU A CG  1 
ATOM   2874  C CD  . GLU B 1 77  ? 44.477  -70.866 -2.064  1.00 39.21  ? 72  GLU A CD  1 
ATOM   2875  O OE1 . GLU B 1 77  ? 44.888  -71.118 -0.912  1.00 41.94  ? 72  GLU A OE1 1 
ATOM   2876  O OE2 . GLU B 1 77  ? 44.200  -71.767 -2.888  1.00 39.61  ? 72  GLU A OE2 1 
ATOM   2877  N N   . LYS B 1 78  ? 43.409  -65.851 0.230   1.00 37.15  ? 73  LYS A N   1 
ATOM   2878  C CA  . LYS B 1 78  ? 42.738  -65.033 1.241   1.00 39.82  ? 73  LYS A CA  1 
ATOM   2879  C C   . LYS B 1 78  ? 42.093  -63.843 0.554   1.00 38.07  ? 73  LYS A C   1 
ATOM   2880  O O   . LYS B 1 78  ? 40.898  -63.611 0.683   1.00 39.15  ? 73  LYS A O   1 
ATOM   2881  C CB  . LYS B 1 78  ? 43.716  -64.494 2.297   1.00 44.35  ? 73  LYS A CB  1 
ATOM   2882  C CG  . LYS B 1 78  ? 44.142  -65.476 3.382   1.00 54.28  ? 73  LYS A CG  1 
ATOM   2883  C CD  . LYS B 1 78  ? 44.841  -64.758 4.558   1.00 59.68  ? 73  LYS A CD  1 
ATOM   2884  C CE  . LYS B 1 78  ? 45.471  -65.743 5.568   1.00 63.12  ? 73  LYS A CE  1 
ATOM   2885  N NZ  . LYS B 1 78  ? 46.644  -66.510 5.022   1.00 63.92  ? 73  LYS A NZ  1 
ATOM   2886  N N   . ALA B 1 79  ? 42.908  -63.099 -0.183  1.00 36.38  ? 74  ALA A N   1 
ATOM   2887  C CA  . ALA B 1 79  ? 42.470  -61.905 -0.884  1.00 34.54  ? 74  ALA A CA  1 
ATOM   2888  C C   . ALA B 1 79  ? 41.377  -62.144 -1.916  1.00 33.72  ? 74  ALA A C   1 
ATOM   2889  O O   . ALA B 1 79  ? 40.428  -61.364 -2.011  1.00 33.98  ? 74  ALA A O   1 
ATOM   2890  C CB  . ALA B 1 79  ? 43.676  -61.215 -1.540  1.00 33.41  ? 74  ALA A CB  1 
ATOM   2891  N N   . VAL B 1 80  ? 41.502  -63.208 -2.698  1.00 34.35  ? 75  VAL A N   1 
ATOM   2892  C CA  . VAL B 1 80  ? 40.492  -63.485 -3.712  1.00 34.24  ? 75  VAL A CA  1 
ATOM   2893  C C   . VAL B 1 80  ? 39.191  -63.861 -3.027  1.00 34.87  ? 75  VAL A C   1 
ATOM   2894  O O   . VAL B 1 80  ? 38.112  -63.486 -3.479  1.00 35.39  ? 75  VAL A O   1 
ATOM   2895  C CB  . VAL B 1 80  ? 40.924  -64.625 -4.660  1.00 34.60  ? 75  VAL A CB  1 
ATOM   2896  C CG1 . VAL B 1 80  ? 39.834  -64.883 -5.702  1.00 32.06  ? 75  VAL A CG1 1 
ATOM   2897  C CG2 . VAL B 1 80  ? 42.228  -64.257 -5.345  1.00 34.15  ? 75  VAL A CG2 1 
ATOM   2898  N N   . ALA B 1 81  ? 39.294  -64.598 -1.928  1.00 34.35  ? 76  ALA A N   1 
ATOM   2899  C CA  . ALA B 1 81  ? 38.110  -64.994 -1.188  1.00 34.75  ? 76  ALA A CA  1 
ATOM   2900  C C   . ALA B 1 81  ? 37.312  -63.738 -0.855  1.00 36.03  ? 76  ALA A C   1 
ATOM   2901  O O   . ALA B 1 81  ? 36.112  -63.663 -1.104  1.00 38.00  ? 76  ALA A O   1 
ATOM   2902  C CB  . ALA B 1 81  ? 38.513  -65.714 0.089   1.00 33.96  ? 76  ALA A CB  1 
ATOM   2903  N N   . ALA B 1 82  ? 37.999  -62.740 -0.315  1.00 36.21  ? 77  ALA A N   1 
ATOM   2904  C CA  . ALA B 1 82  ? 37.369  -61.492 0.073   1.00 36.19  ? 77  ALA A CA  1 
ATOM   2905  C C   . ALA B 1 82  ? 36.670  -60.793 -1.086  1.00 37.18  ? 77  ALA A C   1 
ATOM   2906  O O   . ALA B 1 82  ? 35.516  -60.381 -0.964  1.00 37.22  ? 77  ALA A O   1 
ATOM   2907  C CB  . ALA B 1 82  ? 38.409  -60.572 0.691   1.00 36.82  ? 77  ALA A CB  1 
ATOM   2908  N N   . LEU B 1 83  ? 37.372  -60.658 -2.208  1.00 37.56  ? 78  LEU A N   1 
ATOM   2909  C CA  . LEU B 1 83  ? 36.817  -59.990 -3.387  1.00 37.12  ? 78  LEU A CA  1 
ATOM   2910  C C   . LEU B 1 83  ? 35.581  -60.710 -3.932  1.00 38.27  ? 78  LEU A C   1 
ATOM   2911  O O   . LEU B 1 83  ? 34.685  -60.077 -4.500  1.00 38.45  ? 78  LEU A O   1 
ATOM   2912  C CB  . LEU B 1 83  ? 37.894  -59.861 -4.474  1.00 32.30  ? 78  LEU A CB  1 
ATOM   2913  C CG  . LEU B 1 83  ? 39.131  -59.084 -4.021  1.00 27.45  ? 78  LEU A CG  1 
ATOM   2914  C CD1 . LEU B 1 83  ? 40.116  -59.013 -5.142  1.00 25.10  ? 78  LEU A CD1 1 
ATOM   2915  C CD2 . LEU B 1 83  ? 38.740  -57.688 -3.595  1.00 26.96  ? 78  LEU A CD2 1 
ATOM   2916  N N   . ASP B 1 84  ? 35.539  -62.029 -3.755  1.00 39.22  ? 79  ASP A N   1 
ATOM   2917  C CA  . ASP B 1 84  ? 34.402  -62.832 -4.196  1.00 40.10  ? 79  ASP A CA  1 
ATOM   2918  C C   . ASP B 1 84  ? 33.330  -62.835 -3.116  1.00 40.82  ? 79  ASP A C   1 
ATOM   2919  O O   . ASP B 1 84  ? 32.272  -63.440 -3.285  1.00 41.35  ? 79  ASP A O   1 
ATOM   2920  C CB  . ASP B 1 84  ? 34.809  -64.283 -4.454  1.00 40.65  ? 79  ASP A CB  1 
ATOM   2921  C CG  . ASP B 1 84  ? 35.480  -64.478 -5.795  1.00 42.56  ? 79  ASP A CG  1 
ATOM   2922  O OD1 . ASP B 1 84  ? 35.113  -63.773 -6.758  1.00 42.70  ? 79  ASP A OD1 1 
ATOM   2923  O OD2 . ASP B 1 84  ? 36.362  -65.360 -5.891  1.00 44.69  ? 79  ASP A OD2 1 
ATOM   2924  N N   . GLY B 1 85  ? 33.608  -62.165 -2.003  1.00 40.63  ? 80  GLY A N   1 
ATOM   2925  C CA  . GLY B 1 85  ? 32.652  -62.141 -0.916  1.00 41.22  ? 80  GLY A CA  1 
ATOM   2926  C C   . GLY B 1 85  ? 32.543  -63.536 -0.329  1.00 42.14  ? 80  GLY A C   1 
ATOM   2927  O O   . GLY B 1 85  ? 31.649  -63.820 0.463   1.00 42.64  ? 80  GLY A O   1 
ATOM   2928  N N   . ALA B 1 86  ? 33.468  -64.406 -0.727  1.00 43.09  ? 81  ALA A N   1 
ATOM   2929  C CA  . ALA B 1 86  ? 33.506  -65.790 -0.264  1.00 43.61  ? 81  ALA A CA  1 
ATOM   2930  C C   . ALA B 1 86  ? 34.295  -65.951 1.025   1.00 44.09  ? 81  ALA A C   1 
ATOM   2931  O O   . ALA B 1 86  ? 35.162  -65.140 1.347   1.00 42.95  ? 81  ALA A O   1 
ATOM   2932  C CB  . ALA B 1 86  ? 34.116  -66.684 -1.336  1.00 43.80  ? 81  ALA A CB  1 
ATOM   2933  N N   . LYS B 1 87  ? 33.995  -67.023 1.749   1.00 45.83  ? 82  LYS A N   1 
ATOM   2934  C CA  . LYS B 1 87  ? 34.681  -67.305 2.991   1.00 47.51  ? 82  LYS A CA  1 
ATOM   2935  C C   . LYS B 1 87  ? 35.982  -68.037 2.675   1.00 47.60  ? 82  LYS A C   1 
ATOM   2936  O O   . LYS B 1 87  ? 36.975  -67.894 3.398   1.00 46.99  ? 82  LYS A O   1 
ATOM   2937  C CB  . LYS B 1 87  ? 33.794  -68.152 3.919   1.00 49.40  ? 82  LYS A CB  1 
ATOM   2938  C CG  . LYS B 1 87  ? 34.380  -68.300 5.321   1.00 54.87  ? 82  LYS A CG  1 
ATOM   2939  C CD  . LYS B 1 87  ? 33.436  -68.981 6.315   1.00 59.64  ? 82  LYS A CD  1 
ATOM   2940  C CE  . LYS B 1 87  ? 34.064  -69.034 7.728   1.00 61.94  ? 82  LYS A CE  1 
ATOM   2941  N NZ  . LYS B 1 87  ? 33.200  -69.684 8.772   1.00 62.14  ? 82  LYS A NZ  1 
ATOM   2942  N N   . TYR B 1 88  ? 35.984  -68.794 1.577   1.00 48.01  ? 83  TYR A N   1 
ATOM   2943  C CA  . TYR B 1 88  ? 37.168  -69.555 1.167   1.00 48.25  ? 83  TYR A CA  1 
ATOM   2944  C C   . TYR B 1 88  ? 37.502  -69.426 -0.329  1.00 45.27  ? 83  TYR A C   1 
ATOM   2945  O O   . TYR B 1 88  ? 36.657  -69.040 -1.140  1.00 43.72  ? 83  TYR A O   1 
ATOM   2946  C CB  . TYR B 1 88  ? 36.966  -71.043 1.487   1.00 54.08  ? 83  TYR A CB  1 
ATOM   2947  C CG  . TYR B 1 88  ? 36.533  -71.362 2.905   1.00 60.33  ? 83  TYR A CG  1 
ATOM   2948  C CD1 . TYR B 1 88  ? 35.452  -72.209 3.147   1.00 63.72  ? 83  TYR A CD1 1 
ATOM   2949  C CD2 . TYR B 1 88  ? 37.220  -70.855 4.000   1.00 63.50  ? 83  TYR A CD2 1 
ATOM   2950  C CE1 . TYR B 1 88  ? 35.066  -72.548 4.447   1.00 65.44  ? 83  TYR A CE1 1 
ATOM   2951  C CE2 . TYR B 1 88  ? 36.843  -71.186 5.305   1.00 66.15  ? 83  TYR A CE2 1 
ATOM   2952  C CZ  . TYR B 1 88  ? 35.766  -72.033 5.517   1.00 65.68  ? 83  TYR A CZ  1 
ATOM   2953  O OH  . TYR B 1 88  ? 35.393  -72.361 6.797   1.00 64.85  ? 83  TYR A OH  1 
ATOM   2954  N N   . CYS B 1 89  ? 38.746  -69.745 -0.683  1.00 42.41  ? 84  CYS A N   1 
ATOM   2955  C CA  . CYS B 1 89  ? 39.173  -69.732 -2.082  1.00 40.31  ? 84  CYS A CA  1 
ATOM   2956  C C   . CYS B 1 89  ? 40.277  -70.758 -2.335  1.00 39.05  ? 84  CYS A C   1 
ATOM   2957  O O   . CYS B 1 89  ? 41.067  -71.057 -1.441  1.00 38.89  ? 84  CYS A O   1 
ATOM   2958  C CB  . CYS B 1 89  ? 39.654  -68.350 -2.526  1.00 39.88  ? 84  CYS A CB  1 
ATOM   2959  S SG  . CYS B 1 89  ? 39.911  -68.259 -4.340  1.00 35.94  ? 84  CYS A SG  1 
ATOM   2960  N N   . LEU B 1 90  ? 40.312  -71.295 -3.556  1.00 37.68  ? 85  LEU A N   1 
ATOM   2961  C CA  . LEU B 1 90  ? 41.295  -72.300 -3.964  1.00 35.66  ? 85  LEU A CA  1 
ATOM   2962  C C   . LEU B 1 90  ? 41.873  -71.929 -5.321  1.00 35.68  ? 85  LEU A C   1 
ATOM   2963  O O   . LEU B 1 90  ? 41.121  -71.702 -6.266  1.00 36.99  ? 85  LEU A O   1 
ATOM   2964  C CB  . LEU B 1 90  ? 40.621  -73.663 -4.058  1.00 34.28  ? 85  LEU A CB  1 
ATOM   2965  C CG  . LEU B 1 90  ? 39.938  -74.058 -2.753  1.00 33.32  ? 85  LEU A CG  1 
ATOM   2966  C CD1 . LEU B 1 90  ? 38.784  -74.954 -3.034  1.00 33.23  ? 85  LEU A CD1 1 
ATOM   2967  C CD2 . LEU B 1 90  ? 40.921  -74.725 -1.847  1.00 34.12  ? 85  LEU A CD2 1 
ATOM   2968  N N   . ALA B 1 91  ? 43.201  -71.883 -5.418  1.00 34.25  ? 86  ALA A N   1 
ATOM   2969  C CA  . ALA B 1 91  ? 43.877  -71.524 -6.662  1.00 32.60  ? 86  ALA A CA  1 
ATOM   2970  C C   . ALA B 1 91  ? 44.394  -72.732 -7.430  1.00 33.52  ? 86  ALA A C   1 
ATOM   2971  O O   . ALA B 1 91  ? 44.991  -73.636 -6.846  1.00 33.38  ? 86  ALA A O   1 
ATOM   2972  C CB  . ALA B 1 91  ? 45.030  -70.584 -6.365  1.00 33.13  ? 86  ALA A CB  1 
ATOM   2973  N N   . PHE B 1 92  ? 44.166  -72.732 -8.743  1.00 33.54  ? 87  PHE A N   1 
ATOM   2974  C CA  . PHE B 1 92  ? 44.605  -73.816 -9.613  1.00 33.73  ? 87  PHE A CA  1 
ATOM   2975  C C   . PHE B 1 92  ? 45.418  -73.277 -10.785 1.00 33.90  ? 87  PHE A C   1 
ATOM   2976  O O   . PHE B 1 92  ? 45.356  -72.094 -11.098 1.00 33.96  ? 87  PHE A O   1 
ATOM   2977  C CB  . PHE B 1 92  ? 43.406  -74.622 -10.129 1.00 35.15  ? 87  PHE A CB  1 
ATOM   2978  C CG  . PHE B 1 92  ? 42.615  -75.289 -9.039  1.00 36.51  ? 87  PHE A CG  1 
ATOM   2979  C CD1 . PHE B 1 92  ? 41.585  -74.613 -8.394  1.00 37.22  ? 87  PHE A CD1 1 
ATOM   2980  C CD2 . PHE B 1 92  ? 42.944  -76.566 -8.610  1.00 37.49  ? 87  PHE A CD2 1 
ATOM   2981  C CE1 . PHE B 1 92  ? 40.899  -75.201 -7.334  1.00 39.02  ? 87  PHE A CE1 1 
ATOM   2982  C CE2 . PHE B 1 92  ? 42.260  -77.166 -7.545  1.00 38.59  ? 87  PHE A CE2 1 
ATOM   2983  C CZ  . PHE B 1 92  ? 41.240  -76.483 -6.908  1.00 38.13  ? 87  PHE A CZ  1 
ATOM   2984  N N   . ALA B 1 93  ? 46.182  -74.160 -11.422 1.00 34.10  ? 88  ALA A N   1 
ATOM   2985  C CA  . ALA B 1 93  ? 47.046  -73.805 -12.534 1.00 33.56  ? 88  ALA A CA  1 
ATOM   2986  C C   . ALA B 1 93  ? 46.354  -73.060 -13.672 1.00 34.79  ? 88  ALA A C   1 
ATOM   2987  O O   . ALA B 1 93  ? 46.960  -72.216 -14.343 1.00 34.24  ? 88  ALA A O   1 
ATOM   2988  C CB  . ALA B 1 93  ? 47.716  -75.062 -13.067 1.00 32.56  ? 88  ALA A CB  1 
ATOM   2989  N N   . SER B 1 94  ? 45.083  -73.370 -13.890 1.00 35.69  ? 89  SER A N   1 
ATOM   2990  C CA  . SER B 1 94  ? 44.337  -72.733 -14.965 1.00 36.11  ? 89  SER A CA  1 
ATOM   2991  C C   . SER B 1 94  ? 42.851  -72.811 -14.681 1.00 36.38  ? 89  SER A C   1 
ATOM   2992  O O   . SER B 1 94  ? 42.418  -73.613 -13.853 1.00 36.86  ? 89  SER A O   1 
ATOM   2993  C CB  . SER B 1 94  ? 44.617  -73.454 -16.280 1.00 37.58  ? 89  SER A CB  1 
ATOM   2994  O OG  . SER B 1 94  ? 44.071  -74.766 -16.253 1.00 37.06  ? 89  SER A OG  1 
ATOM   2995  N N   . GLY B 1 95  ? 42.070  -71.987 -15.373 1.00 35.58  ? 90  GLY A N   1 
ATOM   2996  C CA  . GLY B 1 95  ? 40.633  -72.026 -15.181 1.00 35.99  ? 90  GLY A CA  1 
ATOM   2997  C C   . GLY B 1 95  ? 40.098  -73.406 -15.540 1.00 35.98  ? 90  GLY A C   1 
ATOM   2998  O O   . GLY B 1 95  ? 39.172  -73.915 -14.897 1.00 34.95  ? 90  GLY A O   1 
ATOM   2999  N N   . LEU B 1 96  ? 40.687  -74.012 -16.570 1.00 36.49  ? 91  LEU A N   1 
ATOM   3000  C CA  . LEU B 1 96  ? 40.284  -75.345 -17.010 1.00 37.92  ? 91  LEU A CA  1 
ATOM   3001  C C   . LEU B 1 96  ? 40.560  -76.365 -15.909 1.00 38.36  ? 91  LEU A C   1 
ATOM   3002  O O   . LEU B 1 96  ? 39.701  -77.195 -15.591 1.00 39.07  ? 91  LEU A O   1 
ATOM   3003  C CB  . LEU B 1 96  ? 41.045  -75.760 -18.267 1.00 37.65  ? 91  LEU A CB  1 
ATOM   3004  C CG  . LEU B 1 96  ? 40.483  -77.000 -18.968 1.00 39.30  ? 91  LEU A CG  1 
ATOM   3005  C CD1 . LEU B 1 96  ? 39.254  -76.603 -19.781 1.00 39.20  ? 91  LEU A CD1 1 
ATOM   3006  C CD2 . LEU B 1 96  ? 41.527  -77.597 -19.887 1.00 38.23  ? 91  LEU A CD2 1 
ATOM   3007  N N   . ALA B 1 97  ? 41.762  -76.303 -15.336 1.00 37.37  ? 92  ALA A N   1 
ATOM   3008  C CA  . ALA B 1 97  ? 42.148  -77.215 -14.261 1.00 36.11  ? 92  ALA A CA  1 
ATOM   3009  C C   . ALA B 1 97  ? 41.203  -77.002 -13.087 1.00 35.36  ? 92  ALA A C   1 
ATOM   3010  O O   . ALA B 1 97  ? 40.908  -77.925 -12.316 1.00 33.70  ? 92  ALA A O   1 
ATOM   3011  C CB  . ALA B 1 97  ? 43.588  -76.945 -13.833 1.00 36.04  ? 92  ALA A CB  1 
ATOM   3012  N N   . ALA B 1 98  ? 40.737  -75.767 -12.949 1.00 34.76  ? 93  ALA A N   1 
ATOM   3013  C CA  . ALA B 1 98  ? 39.810  -75.445 -11.884 1.00 36.49  ? 93  ALA A CA  1 
ATOM   3014  C C   . ALA B 1 98  ? 38.553  -76.244 -12.189 1.00 37.33  ? 93  ALA A C   1 
ATOM   3015  O O   . ALA B 1 98  ? 38.083  -77.012 -11.355 1.00 37.66  ? 93  ALA A O   1 
ATOM   3016  C CB  . ALA B 1 98  ? 39.500  -73.944 -11.879 1.00 36.88  ? 93  ALA A CB  1 
ATOM   3017  N N   . THR B 1 99  ? 38.037  -76.071 -13.405 1.00 37.48  ? 94  THR A N   1 
ATOM   3018  C CA  . THR B 1 99  ? 36.836  -76.757 -13.860 1.00 37.50  ? 94  THR A CA  1 
ATOM   3019  C C   . THR B 1 99  ? 36.898  -78.267 -13.646 1.00 38.86  ? 94  THR A C   1 
ATOM   3020  O O   . THR B 1 99  ? 35.962  -78.860 -13.096 1.00 40.01  ? 94  THR A O   1 
ATOM   3021  C CB  . THR B 1 99  ? 36.599  -76.507 -15.342 1.00 37.57  ? 94  THR A CB  1 
ATOM   3022  O OG1 . THR B 1 99  ? 36.724  -75.108 -15.618 1.00 36.46  ? 94  THR A OG1 1 
ATOM   3023  C CG2 . THR B 1 99  ? 35.213  -76.981 -15.735 1.00 38.29  ? 94  THR A CG2 1 
ATOM   3024  N N   . VAL B 1 100 ? 37.986  -78.889 -14.099 1.00 38.07  ? 95  VAL A N   1 
ATOM   3025  C CA  . VAL B 1 100 ? 38.163  -80.332 -13.938 1.00 36.84  ? 95  VAL A CA  1 
ATOM   3026  C C   . VAL B 1 100 ? 38.002  -80.664 -12.466 1.00 36.64  ? 95  VAL A C   1 
ATOM   3027  O O   . VAL B 1 100 ? 37.149  -81.459 -12.085 1.00 38.69  ? 95  VAL A O   1 
ATOM   3028  C CB  . VAL B 1 100 ? 39.583  -80.803 -14.387 1.00 37.62  ? 95  VAL A CB  1 
ATOM   3029  C CG1 . VAL B 1 100 ? 39.768  -82.296 -14.100 1.00 34.23  ? 95  VAL A CG1 1 
ATOM   3030  C CG2 . VAL B 1 100 ? 39.785  -80.525 -15.867 1.00 37.39  ? 95  VAL A CG2 1 
ATOM   3031  N N   . THR B 1 101 ? 38.823  -80.041 -11.638 1.00 35.46  ? 96  THR A N   1 
ATOM   3032  C CA  . THR B 1 101 ? 38.768  -80.283 -10.213 1.00 35.78  ? 96  THR A CA  1 
ATOM   3033  C C   . THR B 1 101 ? 37.358  -80.150 -9.649  1.00 36.11  ? 96  THR A C   1 
ATOM   3034  O O   . THR B 1 101 ? 36.970  -80.914 -8.770  1.00 37.08  ? 96  THR A O   1 
ATOM   3035  C CB  . THR B 1 101 ? 39.705  -79.329 -9.475  1.00 36.03  ? 96  THR A CB  1 
ATOM   3036  O OG1 . THR B 1 101 ? 41.031  -79.491 -9.992  1.00 36.74  ? 96  THR A OG1 1 
ATOM   3037  C CG2 . THR B 1 101 ? 39.706  -79.631 -7.979  1.00 35.62  ? 96  THR A CG2 1 
ATOM   3038  N N   . ILE B 1 102 ? 36.594  -79.179 -10.140 1.00 37.52  ? 97  ILE A N   1 
ATOM   3039  C CA  . ILE B 1 102 ? 35.227  -78.991 -9.659  1.00 38.54  ? 97  ILE A CA  1 
ATOM   3040  C C   . ILE B 1 102 ? 34.470  -80.280 -9.965  1.00 40.05  ? 97  ILE A C   1 
ATOM   3041  O O   . ILE B 1 102 ? 33.854  -80.868 -9.083  1.00 41.14  ? 97  ILE A O   1 
ATOM   3042  C CB  . ILE B 1 102 ? 34.489  -77.807 -10.377 1.00 38.18  ? 97  ILE A CB  1 
ATOM   3043  C CG1 . ILE B 1 102 ? 35.121  -76.454 -10.013 1.00 35.80  ? 97  ILE A CG1 1 
ATOM   3044  C CG2 . ILE B 1 102 ? 33.016  -77.813 -9.996  1.00 37.28  ? 97  ILE A CG2 1 
ATOM   3045  C CD1 . ILE B 1 102 ? 35.021  -76.094 -8.561  1.00 34.97  ? 97  ILE A CD1 1 
ATOM   3046  N N   . THR B 1 103 ? 34.533  -80.729 -11.216 1.00 40.54  ? 98  THR A N   1 
ATOM   3047  C CA  . THR B 1 103 ? 33.833  -81.946 -11.597 1.00 42.38  ? 98  THR A CA  1 
ATOM   3048  C C   . THR B 1 103 ? 34.310  -83.188 -10.840 1.00 43.84  ? 98  THR A C   1 
ATOM   3049  O O   . THR B 1 103 ? 33.534  -84.116 -10.635 1.00 45.28  ? 98  THR A O   1 
ATOM   3050  C CB  . THR B 1 103 ? 33.915  -82.207 -13.133 1.00 41.55  ? 98  THR A CB  1 
ATOM   3051  O OG1 . THR B 1 103 ? 35.251  -82.563 -13.508 1.00 40.83  ? 98  THR A OG1 1 
ATOM   3052  C CG2 . THR B 1 103 ? 33.487  -80.961 -13.903 1.00 39.82  ? 98  THR A CG2 1 
ATOM   3053  N N   . HIS B 1 104 ? 35.573  -83.220 -10.422 1.00 46.13  ? 99  HIS A N   1 
ATOM   3054  C CA  . HIS B 1 104 ? 36.081  -84.376 -9.677  1.00 47.08  ? 99  HIS A CA  1 
ATOM   3055  C C   . HIS B 1 104 ? 35.269  -84.537 -8.404  1.00 47.85  ? 99  HIS A C   1 
ATOM   3056  O O   . HIS B 1 104 ? 35.385  -85.539 -7.697  1.00 47.89  ? 99  HIS A O   1 
ATOM   3057  C CB  . HIS B 1 104 ? 37.551  -84.199 -9.294  1.00 48.13  ? 99  HIS A CB  1 
ATOM   3058  C CG  . HIS B 1 104 ? 38.504  -84.449 -10.417 1.00 49.43  ? 99  HIS A CG  1 
ATOM   3059  N ND1 . HIS B 1 104 ? 38.266  -85.387 -11.396 1.00 49.57  ? 99  HIS A ND1 1 
ATOM   3060  C CD2 . HIS B 1 104 ? 39.727  -83.929 -10.680 1.00 50.54  ? 99  HIS A CD2 1 
ATOM   3061  C CE1 . HIS B 1 104 ? 39.303  -85.437 -12.214 1.00 51.03  ? 99  HIS A CE1 1 
ATOM   3062  N NE2 . HIS B 1 104 ? 40.203  -84.563 -11.802 1.00 52.21  ? 99  HIS A NE2 1 
ATOM   3063  N N   . LEU B 1 105 ? 34.461  -83.524 -8.115  1.00 48.02  ? 100 LEU A N   1 
ATOM   3064  C CA  . LEU B 1 105 ? 33.607  -83.519 -6.941  1.00 48.81  ? 100 LEU A CA  1 
ATOM   3065  C C   . LEU B 1 105 ? 32.514  -84.573 -7.097  1.00 51.19  ? 100 LEU A C   1 
ATOM   3066  O O   . LEU B 1 105 ? 32.114  -85.209 -6.124  1.00 52.57  ? 100 LEU A O   1 
ATOM   3067  C CB  . LEU B 1 105 ? 32.978  -82.136 -6.780  1.00 46.84  ? 100 LEU A CB  1 
ATOM   3068  C CG  . LEU B 1 105 ? 33.266  -81.285 -5.544  1.00 45.14  ? 100 LEU A CG  1 
ATOM   3069  C CD1 . LEU B 1 105 ? 34.676  -81.520 -5.031  1.00 45.61  ? 100 LEU A CD1 1 
ATOM   3070  C CD2 . LEU B 1 105 ? 33.047  -79.831 -5.909  1.00 43.18  ? 100 LEU A CD2 1 
ATOM   3071  N N   . LEU B 1 106 ? 32.043  -84.750 -8.330  1.00 52.93  ? 101 LEU A N   1 
ATOM   3072  C CA  . LEU B 1 106 ? 30.993  -85.719 -8.646  1.00 54.96  ? 101 LEU A CA  1 
ATOM   3073  C C   . LEU B 1 106 ? 31.531  -87.138 -8.783  1.00 59.24  ? 101 LEU A C   1 
ATOM   3074  O O   . LEU B 1 106 ? 32.729  -87.346 -8.978  1.00 59.33  ? 101 LEU A O   1 
ATOM   3075  C CB  . LEU B 1 106 ? 30.290  -85.333 -9.953  1.00 51.27  ? 101 LEU A CB  1 
ATOM   3076  C CG  . LEU B 1 106 ? 29.684  -83.929 -10.017 1.00 48.29  ? 101 LEU A CG  1 
ATOM   3077  C CD1 . LEU B 1 106 ? 28.971  -83.721 -11.347 1.00 45.27  ? 101 LEU A CD1 1 
ATOM   3078  C CD2 . LEU B 1 106 ? 28.717  -83.754 -8.860  1.00 47.67  ? 101 LEU A CD2 1 
ATOM   3079  N N   . LYS B 1 107 ? 30.633  -88.113 -8.684  1.00 64.64  ? 102 LYS A N   1 
ATOM   3080  C CA  . LYS B 1 107 ? 31.000  -89.522 -8.819  1.00 69.38  ? 102 LYS A CA  1 
ATOM   3081  C C   . LYS B 1 107 ? 30.481  -90.057 -10.151 1.00 68.92  ? 102 LYS A C   1 
ATOM   3082  O O   . LYS B 1 107 ? 29.558  -89.482 -10.735 1.00 69.85  ? 102 LYS A O   1 
ATOM   3083  C CB  . LYS B 1 107 ? 30.419  -90.335 -7.656  1.00 75.27  ? 102 LYS A CB  1 
ATOM   3084  C CG  . LYS B 1 107 ? 29.033  -89.879 -7.197  1.00 83.51  ? 102 LYS A CG  1 
ATOM   3085  C CD  . LYS B 1 107 ? 28.517  -90.717 -6.024  1.00 88.97  ? 102 LYS A CD  1 
ATOM   3086  C CE  . LYS B 1 107 ? 27.249  -90.123 -5.402  1.00 91.35  ? 102 LYS A CE  1 
ATOM   3087  N NZ  . LYS B 1 107 ? 26.119  -90.012 -6.365  1.00 92.25  ? 102 LYS A NZ  1 
ATOM   3088  N N   . ALA B 1 108 ? 31.077  -91.142 -10.639 1.00 68.17  ? 103 ALA A N   1 
ATOM   3089  C CA  . ALA B 1 108 ? 30.656  -91.734 -11.908 1.00 66.83  ? 103 ALA A CA  1 
ATOM   3090  C C   . ALA B 1 108 ? 29.138  -91.891 -11.935 1.00 66.31  ? 103 ALA A C   1 
ATOM   3091  O O   . ALA B 1 108 ? 28.530  -92.353 -10.965 1.00 66.02  ? 103 ALA A O   1 
ATOM   3092  C CB  . ALA B 1 108 ? 31.327  -93.084 -12.103 1.00 66.33  ? 103 ALA A CB  1 
ATOM   3093  N N   . GLY B 1 109 ? 28.522  -91.495 -13.041 1.00 65.43  ? 104 GLY A N   1 
ATOM   3094  C CA  . GLY B 1 109 ? 27.081  -91.607 -13.134 1.00 65.61  ? 104 GLY A CA  1 
ATOM   3095  C C   . GLY B 1 109 ? 26.342  -90.285 -13.016 1.00 66.60  ? 104 GLY A C   1 
ATOM   3096  O O   . GLY B 1 109 ? 25.389  -90.052 -13.766 1.00 67.96  ? 104 GLY A O   1 
ATOM   3097  N N   . ASP B 1 110 ? 26.760  -89.423 -12.088 1.00 66.73  ? 105 ASP A N   1 
ATOM   3098  C CA  . ASP B 1 110 ? 26.109  -88.123 -11.905 1.00 67.12  ? 105 ASP A CA  1 
ATOM   3099  C C   . ASP B 1 110 ? 25.997  -87.358 -13.213 1.00 65.68  ? 105 ASP A C   1 
ATOM   3100  O O   . ASP B 1 110 ? 26.829  -87.507 -14.109 1.00 63.41  ? 105 ASP A O   1 
ATOM   3101  C CB  . ASP B 1 110 ? 26.884  -87.256 -10.913 1.00 70.78  ? 105 ASP A CB  1 
ATOM   3102  C CG  . ASP B 1 110 ? 26.861  -87.809 -9.509  1.00 75.19  ? 105 ASP A CG  1 
ATOM   3103  O OD1 . ASP B 1 110 ? 27.344  -88.942 -9.311  1.00 78.64  ? 105 ASP A OD1 1 
ATOM   3104  O OD2 . ASP B 1 110 ? 26.359  -87.111 -8.603  1.00 77.68  ? 105 ASP A OD2 1 
ATOM   3105  N N   . GLN B 1 111 ? 24.956  -86.543 -13.324 1.00 67.12  ? 106 GLN A N   1 
ATOM   3106  C CA  . GLN B 1 111 ? 24.772  -85.741 -14.522 1.00 68.76  ? 106 GLN A CA  1 
ATOM   3107  C C   . GLN B 1 111 ? 25.113  -84.285 -14.257 1.00 67.68  ? 106 GLN A C   1 
ATOM   3108  O O   . GLN B 1 111 ? 24.777  -83.731 -13.207 1.00 67.65  ? 106 GLN A O   1 
ATOM   3109  C CB  . GLN B 1 111 ? 23.338  -85.792 -15.043 1.00 69.20  ? 106 GLN A CB  1 
ATOM   3110  C CG  . GLN B 1 111 ? 23.187  -84.887 -16.268 1.00 71.67  ? 106 GLN A CG  1 
ATOM   3111  C CD  . GLN B 1 111 ? 21.765  -84.721 -16.726 1.00 72.65  ? 106 GLN A CD  1 
ATOM   3112  O OE1 . GLN B 1 111 ? 20.908  -84.272 -15.966 1.00 74.72  ? 106 GLN A OE1 1 
ATOM   3113  N NE2 . GLN B 1 111 ? 21.501  -85.073 -17.982 1.00 72.30  ? 106 GLN A NE2 1 
ATOM   3114  N N   . ILE B 1 112 ? 25.772  -83.670 -15.231 1.00 66.59  ? 107 ILE A N   1 
ATOM   3115  C CA  . ILE B 1 112 ? 26.155  -82.275 -15.136 1.00 66.21  ? 107 ILE A CA  1 
ATOM   3116  C C   . ILE B 1 112 ? 25.476  -81.502 -16.266 1.00 63.29  ? 107 ILE A C   1 
ATOM   3117  O O   . ILE B 1 112 ? 25.576  -81.865 -17.438 1.00 63.53  ? 107 ILE A O   1 
ATOM   3118  C CB  . ILE B 1 112 ? 27.716  -82.126 -15.179 1.00 66.78  ? 107 ILE A CB  1 
ATOM   3119  C CG1 . ILE B 1 112 ? 28.112  -80.725 -15.639 1.00 67.84  ? 107 ILE A CG1 1 
ATOM   3120  C CG2 . ILE B 1 112 ? 28.327  -83.196 -16.064 1.00 66.91  ? 107 ILE A CG2 1 
ATOM   3121  C CD1 . ILE B 1 112 ? 27.657  -79.625 -14.717 1.00 69.87  ? 107 ILE A CD1 1 
ATOM   3122  N N   . ILE B 1 113 ? 24.754  -80.451 -15.897 1.00 60.71  ? 108 ILE A N   1 
ATOM   3123  C CA  . ILE B 1 113 ? 24.054  -79.629 -16.871 1.00 59.69  ? 108 ILE A CA  1 
ATOM   3124  C C   . ILE B 1 113 ? 24.829  -78.335 -17.065 1.00 58.74  ? 108 ILE A C   1 
ATOM   3125  O O   . ILE B 1 113 ? 25.058  -77.589 -16.110 1.00 57.94  ? 108 ILE A O   1 
ATOM   3126  C CB  . ILE B 1 113 ? 22.623  -79.302 -16.388 1.00 59.76  ? 108 ILE A CB  1 
ATOM   3127  C CG1 . ILE B 1 113 ? 21.903  -80.602 -16.012 1.00 60.26  ? 108 ILE A CG1 1 
ATOM   3128  C CG2 . ILE B 1 113 ? 21.849  -78.562 -17.484 1.00 58.08  ? 108 ILE A CG2 1 
ATOM   3129  C CD1 . ILE B 1 113 ? 20.518  -80.408 -15.422 1.00 60.59  ? 108 ILE A CD1 1 
ATOM   3130  N N   . CYS B 1 114 ? 25.238  -78.076 -18.302 1.00 57.99  ? 109 CYS A N   1 
ATOM   3131  C CA  . CYS B 1 114 ? 25.995  -76.871 -18.621 1.00 58.56  ? 109 CYS A CA  1 
ATOM   3132  C C   . CYS B 1 114 ? 25.209  -75.886 -19.454 1.00 58.24  ? 109 CYS A C   1 
ATOM   3133  O O   . CYS B 1 114 ? 24.342  -76.276 -20.227 1.00 57.56  ? 109 CYS A O   1 
ATOM   3134  C CB  . CYS B 1 114 ? 27.256  -77.218 -19.409 1.00 57.86  ? 109 CYS A CB  1 
ATOM   3135  S SG  . CYS B 1 114 ? 28.521  -78.022 -18.473 1.00 58.19  ? 109 CYS A SG  1 
ATOM   3136  N N   . MET B 1 115 ? 25.523  -74.605 -19.299 1.00 59.63  ? 110 MET A N   1 
ATOM   3137  C CA  . MET B 1 115 ? 24.874  -73.587 -20.106 1.00 61.59  ? 110 MET A CA  1 
ATOM   3138  C C   . MET B 1 115 ? 25.341  -74.012 -21.497 1.00 63.40  ? 110 MET A C   1 
ATOM   3139  O O   . MET B 1 115 ? 26.443  -74.549 -21.639 1.00 63.11  ? 110 MET A O   1 
ATOM   3140  C CB  . MET B 1 115 ? 25.425  -72.199 -19.770 1.00 60.90  ? 110 MET A CB  1 
ATOM   3141  C CG  . MET B 1 115 ? 24.399  -71.078 -19.816 1.00 61.90  ? 110 MET A CG  1 
ATOM   3142  S SD  . MET B 1 115 ? 23.490  -70.977 -21.359 1.00 63.24  ? 110 MET A SD  1 
ATOM   3143  C CE  . MET B 1 115 ? 24.710  -70.239 -22.412 1.00 66.17  ? 110 MET A CE  1 
ATOM   3144  N N   . ASP B 1 116 ? 24.521  -73.805 -22.519 1.00 65.28  ? 111 ASP A N   1 
ATOM   3145  C CA  . ASP B 1 116 ? 24.931  -74.218 -23.847 1.00 67.52  ? 111 ASP A CA  1 
ATOM   3146  C C   . ASP B 1 116 ? 25.696  -73.103 -24.536 1.00 70.31  ? 111 ASP A C   1 
ATOM   3147  O O   . ASP B 1 116 ? 25.137  -72.052 -24.848 1.00 69.26  ? 111 ASP A O   1 
ATOM   3148  C CB  . ASP B 1 116 ? 23.715  -74.637 -24.674 1.00 67.34  ? 111 ASP A CB  1 
ATOM   3149  C CG  . ASP B 1 116 ? 24.098  -75.191 -26.032 1.00 67.04  ? 111 ASP A CG  1 
ATOM   3150  O OD1 . ASP B 1 116 ? 25.147  -75.863 -26.127 1.00 66.99  ? 111 ASP A OD1 1 
ATOM   3151  O OD2 . ASP B 1 116 ? 23.343  -74.967 -27.002 1.00 67.74  ? 111 ASP A OD2 1 
ATOM   3152  N N   . ASP B 1 117 ? 26.990  -73.339 -24.745 1.00 73.77  ? 112 ASP A N   1 
ATOM   3153  C CA  . ASP B 1 117 ? 27.860  -72.369 -25.402 1.00 76.34  ? 112 ASP A CA  1 
ATOM   3154  C C   . ASP B 1 117 ? 27.807  -72.646 -26.898 1.00 75.01  ? 112 ASP A C   1 
ATOM   3155  O O   . ASP B 1 117 ? 28.700  -73.278 -27.466 1.00 75.62  ? 112 ASP A O   1 
ATOM   3156  C CB  . ASP B 1 117 ? 29.300  -72.508 -24.898 1.00 81.50  ? 112 ASP A CB  1 
ATOM   3157  C CG  . ASP B 1 117 ? 30.183  -71.352 -25.334 1.00 85.71  ? 112 ASP A CG  1 
ATOM   3158  O OD1 . ASP B 1 117 ? 31.420  -71.448 -25.169 1.00 88.00  ? 112 ASP A OD1 1 
ATOM   3159  O OD2 . ASP B 1 117 ? 29.636  -70.342 -25.835 1.00 88.22  ? 112 ASP A OD2 1 
ATOM   3160  N N   . VAL B 1 118 ? 26.743  -72.167 -27.525 1.00 72.89  ? 113 VAL A N   1 
ATOM   3161  C CA  . VAL B 1 118 ? 26.527  -72.373 -28.944 1.00 69.87  ? 113 VAL A CA  1 
ATOM   3162  C C   . VAL B 1 118 ? 27.638  -71.843 -29.848 1.00 70.03  ? 113 VAL A C   1 
ATOM   3163  O O   . VAL B 1 118 ? 28.401  -72.623 -30.412 1.00 70.15  ? 113 VAL A O   1 
ATOM   3164  C CB  . VAL B 1 118 ? 25.162  -71.776 -29.364 1.00 67.91  ? 113 VAL A CB  1 
ATOM   3165  C CG1 . VAL B 1 118 ? 24.942  -70.443 -28.666 1.00 66.23  ? 113 VAL A CG1 1 
ATOM   3166  C CG2 . VAL B 1 118 ? 25.100  -71.617 -30.881 1.00 65.59  ? 113 VAL A CG2 1 
ATOM   3167  N N   . TYR B 1 119 ? 27.737  -70.526 -29.988 1.00 70.99  ? 114 TYR A N   1 
ATOM   3168  C CA  . TYR B 1 119 ? 28.754  -69.941 -30.855 1.00 71.59  ? 114 TYR A CA  1 
ATOM   3169  C C   . TYR B 1 119 ? 30.136  -69.874 -30.215 1.00 70.67  ? 114 TYR A C   1 
ATOM   3170  O O   . TYR B 1 119 ? 31.146  -69.777 -30.910 1.00 69.01  ? 114 TYR A O   1 
ATOM   3171  C CB  . TYR B 1 119 ? 28.325  -68.543 -31.301 1.00 74.14  ? 114 TYR A CB  1 
ATOM   3172  C CG  . TYR B 1 119 ? 27.043  -68.518 -32.104 1.00 77.37  ? 114 TYR A CG  1 
ATOM   3173  C CD1 . TYR B 1 119 ? 25.889  -67.926 -31.594 1.00 79.33  ? 114 TYR A CD1 1 
ATOM   3174  C CD2 . TYR B 1 119 ? 26.987  -69.072 -33.380 1.00 78.88  ? 114 TYR A CD2 1 
ATOM   3175  C CE1 . TYR B 1 119 ? 24.708  -67.883 -32.338 1.00 81.08  ? 114 TYR A CE1 1 
ATOM   3176  C CE2 . TYR B 1 119 ? 25.814  -69.036 -34.132 1.00 80.82  ? 114 TYR A CE2 1 
ATOM   3177  C CZ  . TYR B 1 119 ? 24.680  -68.440 -33.605 1.00 81.52  ? 114 TYR A CZ  1 
ATOM   3178  O OH  . TYR B 1 119 ? 23.518  -68.399 -34.342 1.00 82.80  ? 114 TYR A OH  1 
ATOM   3179  N N   . GLY B 1 120 ? 30.180  -69.925 -28.889 1.00 70.96  ? 115 GLY A N   1 
ATOM   3180  C CA  . GLY B 1 120 ? 31.457  -69.870 -28.198 1.00 70.51  ? 115 GLY A CA  1 
ATOM   3181  C C   . GLY B 1 120 ? 32.316  -71.094 -28.450 1.00 70.41  ? 115 GLY A C   1 
ATOM   3182  O O   . GLY B 1 120 ? 31.966  -71.971 -29.244 1.00 70.22  ? 115 GLY A O   1 
ATOM   3183  N N   . GLY B 1 121 ? 33.446  -71.164 -27.760 1.00 70.35  ? 116 GLY A N   1 
ATOM   3184  C CA  . GLY B 1 121 ? 34.337  -72.294 -27.946 1.00 70.86  ? 116 GLY A CA  1 
ATOM   3185  C C   . GLY B 1 121 ? 34.045  -73.529 -27.111 1.00 70.32  ? 116 GLY A C   1 
ATOM   3186  O O   . GLY B 1 121 ? 33.898  -74.627 -27.652 1.00 69.84  ? 116 GLY A O   1 
ATOM   3187  N N   . THR B 1 122 ? 33.961  -73.349 -25.795 1.00 69.71  ? 117 THR A N   1 
ATOM   3188  C CA  . THR B 1 122 ? 33.719  -74.455 -24.878 1.00 69.16  ? 117 THR A CA  1 
ATOM   3189  C C   . THR B 1 122 ? 32.613  -75.392 -25.341 1.00 68.08  ? 117 THR A C   1 
ATOM   3190  O O   . THR B 1 122 ? 31.994  -75.179 -26.389 1.00 68.60  ? 117 THR A O   1 
ATOM   3191  C CB  . THR B 1 122 ? 33.385  -73.952 -23.455 1.00 71.84  ? 117 THR A CB  1 
ATOM   3192  O OG1 . THR B 1 122 ? 32.028  -74.279 -23.130 1.00 74.82  ? 117 THR A OG1 1 
ATOM   3193  C CG2 . THR B 1 122 ? 33.578  -72.448 -23.361 1.00 72.62  ? 117 THR A CG2 1 
ATOM   3194  N N   . ASN B 1 123 ? 32.377  -76.420 -24.531 1.00 65.56  ? 118 ASN A N   1 
ATOM   3195  C CA  . ASN B 1 123 ? 31.392  -77.470 -24.782 1.00 63.78  ? 118 ASN A CA  1 
ATOM   3196  C C   . ASN B 1 123 ? 32.161  -78.718 -25.213 1.00 62.86  ? 118 ASN A C   1 
ATOM   3197  O O   . ASN B 1 123 ? 31.828  -79.822 -24.786 1.00 62.53  ? 118 ASN A O   1 
ATOM   3198  C CB  . ASN B 1 123 ? 30.363  -77.075 -25.853 1.00 62.21  ? 118 ASN A CB  1 
ATOM   3199  C CG  . ASN B 1 123 ? 28.996  -76.778 -25.263 1.00 59.91  ? 118 ASN A CG  1 
ATOM   3200  O OD1 . ASN B 1 123 ? 28.503  -77.523 -24.422 1.00 57.96  ? 118 ASN A OD1 1 
ATOM   3201  N ND2 . ASN B 1 123 ? 28.373  -75.695 -25.711 1.00 59.69  ? 118 ASN A ND2 1 
ATOM   3202  N N   . ARG B 1 124 ? 33.177  -78.552 -26.061 1.00 62.16  ? 119 ARG A N   1 
ATOM   3203  C CA  . ARG B 1 124 ? 33.998  -79.695 -26.447 1.00 62.51  ? 119 ARG A CA  1 
ATOM   3204  C C   . ARG B 1 124 ? 34.658  -80.113 -25.130 1.00 59.57  ? 119 ARG A C   1 
ATOM   3205  O O   . ARG B 1 124 ? 34.784  -81.301 -24.833 1.00 58.72  ? 119 ARG A O   1 
ATOM   3206  C CB  . ARG B 1 124 ? 35.046  -79.306 -27.498 1.00 67.32  ? 119 ARG A CB  1 
ATOM   3207  C CG  . ARG B 1 124 ? 35.610  -77.905 -27.354 1.00 75.31  ? 119 ARG A CG  1 
ATOM   3208  C CD  . ARG B 1 124 ? 36.622  -77.598 -28.452 1.00 81.99  ? 119 ARG A CD  1 
ATOM   3209  N NE  . ARG B 1 124 ? 36.086  -77.813 -29.797 1.00 89.33  ? 119 ARG A NE  1 
ATOM   3210  C CZ  . ARG B 1 124 ? 35.088  -77.117 -30.341 1.00 92.51  ? 119 ARG A CZ  1 
ATOM   3211  N NH1 . ARG B 1 124 ? 34.495  -76.143 -29.662 1.00 94.35  ? 119 ARG A NH1 1 
ATOM   3212  N NH2 . ARG B 1 124 ? 34.682  -77.397 -31.573 1.00 93.91  ? 119 ARG A NH2 1 
ATOM   3213  N N   . TYR B 1 125 ? 35.074  -79.125 -24.338 1.00 57.26  ? 120 TYR A N   1 
ATOM   3214  C CA  . TYR B 1 125 ? 35.634  -79.403 -23.019 1.00 55.01  ? 120 TYR A CA  1 
ATOM   3215  C C   . TYR B 1 125 ? 34.346  -79.731 -22.290 1.00 54.48  ? 120 TYR A C   1 
ATOM   3216  O O   . TYR B 1 125 ? 33.271  -79.484 -22.826 1.00 56.57  ? 120 TYR A O   1 
ATOM   3217  C CB  . TYR B 1 125 ? 36.256  -78.156 -22.399 1.00 55.77  ? 120 TYR A CB  1 
ATOM   3218  C CG  . TYR B 1 125 ? 37.212  -77.421 -23.305 1.00 56.88  ? 120 TYR A CG  1 
ATOM   3219  C CD1 . TYR B 1 125 ? 36.748  -76.448 -24.198 1.00 56.99  ? 120 TYR A CD1 1 
ATOM   3220  C CD2 . TYR B 1 125 ? 38.579  -77.716 -23.298 1.00 56.35  ? 120 TYR A CD2 1 
ATOM   3221  C CE1 . TYR B 1 125 ? 37.618  -75.788 -25.066 1.00 56.60  ? 120 TYR A CE1 1 
ATOM   3222  C CE2 . TYR B 1 125 ? 39.459  -77.064 -24.165 1.00 57.34  ? 120 TYR A CE2 1 
ATOM   3223  C CZ  . TYR B 1 125 ? 38.969  -76.101 -25.048 1.00 56.91  ? 120 TYR A CZ  1 
ATOM   3224  O OH  . TYR B 1 125 ? 39.817  -75.459 -25.918 1.00 55.68  ? 120 TYR A OH  1 
ATOM   3225  N N   . PHE B 1 126 ? 34.415  -80.242 -21.075 1.00 52.60  ? 121 PHE A N   1 
ATOM   3226  C CA  . PHE B 1 126 ? 33.177  -80.613 -20.382 1.00 51.12  ? 121 PHE A CA  1 
ATOM   3227  C C   . PHE B 1 126 ? 32.793  -81.945 -21.002 1.00 51.09  ? 121 PHE A C   1 
ATOM   3228  O O   . PHE B 1 126 ? 32.759  -82.967 -20.325 1.00 51.43  ? 121 PHE A O   1 
ATOM   3229  C CB  . PHE B 1 126 ? 32.029  -79.613 -20.632 1.00 49.06  ? 121 PHE A CB  1 
ATOM   3230  C CG  . PHE B 1 126 ? 32.141  -78.327 -19.855 1.00 48.44  ? 121 PHE A CG  1 
ATOM   3231  C CD1 . PHE B 1 126 ? 32.149  -78.333 -18.457 1.00 46.88  ? 121 PHE A CD1 1 
ATOM   3232  C CD2 . PHE B 1 126 ? 32.213  -77.103 -20.520 1.00 47.55  ? 121 PHE A CD2 1 
ATOM   3233  C CE1 . PHE B 1 126 ? 32.228  -77.133 -17.728 1.00 46.70  ? 121 PHE A CE1 1 
ATOM   3234  C CE2 . PHE B 1 126 ? 32.293  -75.895 -19.803 1.00 47.18  ? 121 PHE A CE2 1 
ATOM   3235  C CZ  . PHE B 1 126 ? 32.300  -75.912 -18.405 1.00 46.45  ? 121 PHE A CZ  1 
ATOM   3236  N N   . ARG B 1 127 ? 32.518  -81.930 -22.302 1.00 51.83  ? 122 ARG A N   1 
ATOM   3237  C CA  . ARG B 1 127 ? 32.156  -83.147 -23.009 1.00 53.60  ? 122 ARG A CA  1 
ATOM   3238  C C   . ARG B 1 127 ? 33.313  -84.149 -22.898 1.00 54.98  ? 122 ARG A C   1 
ATOM   3239  O O   . ARG B 1 127 ? 33.086  -85.333 -22.631 1.00 55.92  ? 122 ARG A O   1 
ATOM   3240  C CB  . ARG B 1 127 ? 31.844  -82.828 -24.475 1.00 54.13  ? 122 ARG A CB  1 
ATOM   3241  C CG  . ARG B 1 127 ? 30.714  -83.662 -25.090 1.00 56.51  ? 122 ARG A CG  1 
ATOM   3242  C CD  . ARG B 1 127 ? 29.827  -82.814 -26.015 1.00 57.84  ? 122 ARG A CD  1 
ATOM   3243  N NE  . ARG B 1 127 ? 30.590  -82.140 -27.069 1.00 61.68  ? 122 ARG A NE  1 
ATOM   3244  C CZ  . ARG B 1 127 ? 30.163  -81.076 -27.751 1.00 63.24  ? 122 ARG A CZ  1 
ATOM   3245  N NH1 . ARG B 1 127 ? 30.934  -80.535 -28.690 1.00 63.40  ? 122 ARG A NH1 1 
ATOM   3246  N NH2 . ARG B 1 127 ? 28.971  -80.545 -27.493 1.00 63.29  ? 122 ARG A NH2 1 
ATOM   3247  N N   . GLN B 1 128 ? 34.549  -83.676 -23.076 1.00 56.05  ? 123 GLN A N   1 
ATOM   3248  C CA  . GLN B 1 128 ? 35.721  -84.557 -22.971 1.00 56.46  ? 123 GLN A CA  1 
ATOM   3249  C C   . GLN B 1 128 ? 35.971  -84.940 -21.510 1.00 55.42  ? 123 GLN A C   1 
ATOM   3250  O O   . GLN B 1 128 ? 36.376  -86.069 -21.210 1.00 54.34  ? 123 GLN A O   1 
ATOM   3251  C CB  . GLN B 1 128 ? 36.977  -83.875 -23.524 1.00 58.42  ? 123 GLN A CB  1 
ATOM   3252  C CG  . GLN B 1 128 ? 36.846  -83.364 -24.947 1.00 63.85  ? 123 GLN A CG  1 
ATOM   3253  C CD  . GLN B 1 128 ? 38.120  -82.702 -25.454 1.00 65.45  ? 123 GLN A CD  1 
ATOM   3254  O OE1 . GLN B 1 128 ? 38.794  -81.986 -24.713 1.00 67.49  ? 123 GLN A OE1 1 
ATOM   3255  N NE2 . GLN B 1 128 ? 38.445  -82.926 -26.726 1.00 66.05  ? 123 GLN A NE2 1 
ATOM   3256  N N   . VAL B 1 129 ? 35.740  -83.988 -20.607 1.00 54.21  ? 124 VAL A N   1 
ATOM   3257  C CA  . VAL B 1 129 ? 35.933  -84.226 -19.180 1.00 52.22  ? 124 VAL A CA  1 
ATOM   3258  C C   . VAL B 1 129 ? 34.833  -85.158 -18.692 1.00 53.61  ? 124 VAL A C   1 
ATOM   3259  O O   . VAL B 1 129 ? 35.030  -85.930 -17.761 1.00 53.30  ? 124 VAL A O   1 
ATOM   3260  C CB  . VAL B 1 129 ? 35.904  -82.893 -18.367 1.00 50.21  ? 124 VAL A CB  1 
ATOM   3261  C CG1 . VAL B 1 129 ? 35.901  -83.173 -16.859 1.00 46.93  ? 124 VAL A CG1 1 
ATOM   3262  C CG2 . VAL B 1 129 ? 37.117  -82.054 -18.724 1.00 46.76  ? 124 VAL A CG2 1 
ATOM   3263  N N   . ALA B 1 130 ? 33.674  -85.089 -19.335 1.00 55.38  ? 125 ALA A N   1 
ATOM   3264  C CA  . ALA B 1 130 ? 32.558  -85.941 -18.963 1.00 58.04  ? 125 ALA A CA  1 
ATOM   3265  C C   . ALA B 1 130 ? 32.870  -87.355 -19.433 1.00 60.05  ? 125 ALA A C   1 
ATOM   3266  O O   . ALA B 1 130 ? 32.745  -88.312 -18.666 1.00 60.43  ? 125 ALA A O   1 
ATOM   3267  C CB  . ALA B 1 130 ? 31.275  -85.436 -19.607 1.00 58.45  ? 125 ALA A CB  1 
ATOM   3268  N N   . SER B 1 131 ? 33.276  -87.477 -20.696 1.00 61.65  ? 126 SER A N   1 
ATOM   3269  C CA  . SER B 1 131 ? 33.630  -88.776 -21.277 1.00 63.38  ? 126 SER A CA  1 
ATOM   3270  C C   . SER B 1 131 ? 34.541  -89.521 -20.307 1.00 63.26  ? 126 SER A C   1 
ATOM   3271  O O   . SER B 1 131 ? 34.129  -90.492 -19.677 1.00 63.22  ? 126 SER A O   1 
ATOM   3272  C CB  . SER B 1 131 ? 34.353  -88.581 -22.609 1.00 64.59  ? 126 SER A CB  1 
ATOM   3273  O OG  . SER B 1 131 ? 34.920  -89.803 -23.046 1.00 67.54  ? 126 SER A OG  1 
ATOM   3274  N N   . GLU B 1 132 ? 35.786  -89.064 -20.209 1.00 62.66  ? 127 GLU A N   1 
ATOM   3275  C CA  . GLU B 1 132 ? 36.745  -89.635 -19.276 1.00 62.00  ? 127 GLU A CA  1 
ATOM   3276  C C   . GLU B 1 132 ? 36.085  -89.376 -17.925 1.00 62.68  ? 127 GLU A C   1 
ATOM   3277  O O   . GLU B 1 132 ? 35.154  -88.577 -17.848 1.00 64.70  ? 127 GLU A O   1 
ATOM   3278  C CB  . GLU B 1 132 ? 38.068  -88.873 -19.389 1.00 62.39  ? 127 GLU A CB  1 
ATOM   3279  C CG  . GLU B 1 132 ? 39.066  -89.110 -18.272 1.00 61.87  ? 127 GLU A CG  1 
ATOM   3280  C CD  . GLU B 1 132 ? 40.362  -88.344 -18.494 1.00 61.63  ? 127 GLU A CD  1 
ATOM   3281  O OE1 . GLU B 1 132 ? 40.279  -87.161 -18.894 1.00 60.81  ? 127 GLU A OE1 1 
ATOM   3282  O OE2 . GLU B 1 132 ? 41.455  -88.916 -18.264 1.00 60.57  ? 127 GLU A OE2 1 
ATOM   3283  N N   . PHE B 1 133 ? 36.528  -90.041 -16.866 1.00 61.76  ? 128 PHE A N   1 
ATOM   3284  C CA  . PHE B 1 133 ? 35.918  -89.823 -15.548 1.00 62.09  ? 128 PHE A CA  1 
ATOM   3285  C C   . PHE B 1 133 ? 34.490  -90.388 -15.449 1.00 62.71  ? 128 PHE A C   1 
ATOM   3286  O O   . PHE B 1 133 ? 33.917  -90.461 -14.356 1.00 63.41  ? 128 PHE A O   1 
ATOM   3287  C CB  . PHE B 1 133 ? 35.893  -88.324 -15.215 1.00 60.66  ? 128 PHE A CB  1 
ATOM   3288  C CG  . PHE B 1 133 ? 37.239  -87.663 -15.299 1.00 57.38  ? 128 PHE A CG  1 
ATOM   3289  C CD1 . PHE B 1 133 ? 37.353  -86.357 -15.751 1.00 56.35  ? 128 PHE A CD1 1 
ATOM   3290  C CD2 . PHE B 1 133 ? 38.389  -88.349 -14.934 1.00 56.27  ? 128 PHE A CD2 1 
ATOM   3291  C CE1 . PHE B 1 133 ? 38.588  -85.749 -15.843 1.00 56.43  ? 128 PHE A CE1 1 
ATOM   3292  C CE2 . PHE B 1 133 ? 39.630  -87.751 -15.021 1.00 55.47  ? 128 PHE A CE2 1 
ATOM   3293  C CZ  . PHE B 1 133 ? 39.733  -86.448 -15.477 1.00 56.58  ? 128 PHE A CZ  1 
ATOM   3294  N N   . GLY B 1 134 ? 33.921  -90.763 -16.594 1.00 62.07  ? 129 GLY A N   1 
ATOM   3295  C CA  . GLY B 1 134 ? 32.591  -91.350 -16.631 1.00 61.72  ? 129 GLY A CA  1 
ATOM   3296  C C   . GLY B 1 134 ? 31.433  -90.575 -16.032 1.00 61.65  ? 129 GLY A C   1 
ATOM   3297  O O   . GLY B 1 134 ? 30.866  -90.973 -15.005 1.00 60.78  ? 129 GLY A O   1 
ATOM   3298  N N   . LEU B 1 135 ? 31.068  -89.478 -16.686 1.00 61.22  ? 130 LEU A N   1 
ATOM   3299  C CA  . LEU B 1 135 ? 29.963  -88.639 -16.236 1.00 61.72  ? 130 LEU A CA  1 
ATOM   3300  C C   . LEU B 1 135 ? 29.010  -88.363 -17.394 1.00 62.52  ? 130 LEU A C   1 
ATOM   3301  O O   . LEU B 1 135 ? 29.381  -88.495 -18.560 1.00 62.30  ? 130 LEU A O   1 
ATOM   3302  C CB  . LEU B 1 135 ? 30.486  -87.309 -15.679 1.00 61.12  ? 130 LEU A CB  1 
ATOM   3303  C CG  . LEU B 1 135 ? 31.291  -87.324 -14.378 1.00 59.25  ? 130 LEU A CG  1 
ATOM   3304  C CD1 . LEU B 1 135 ? 31.715  -85.912 -14.042 1.00 59.90  ? 130 LEU A CD1 1 
ATOM   3305  C CD2 . LEU B 1 135 ? 30.454  -87.897 -13.253 1.00 58.50  ? 130 LEU A CD2 1 
ATOM   3306  N N   . LYS B 1 136 ? 27.782  -87.980 -17.062 1.00 64.52  ? 131 LYS A N   1 
ATOM   3307  C CA  . LYS B 1 136 ? 26.769  -87.680 -18.065 1.00 67.78  ? 131 LYS A CA  1 
ATOM   3308  C C   . LYS B 1 136 ? 26.650  -86.164 -18.196 1.00 66.53  ? 131 LYS A C   1 
ATOM   3309  O O   . LYS B 1 136 ? 26.372  -85.470 -17.216 1.00 67.38  ? 131 LYS A O   1 
ATOM   3310  C CB  . LYS B 1 136 ? 25.425  -88.272 -17.636 1.00 71.61  ? 131 LYS A CB  1 
ATOM   3311  C CG  . LYS B 1 136 ? 24.266  -88.015 -18.594 1.00 78.04  ? 131 LYS A CG  1 
ATOM   3312  C CD  . LYS B 1 136 ? 24.079  -89.156 -19.578 1.00 82.82  ? 131 LYS A CD  1 
ATOM   3313  C CE  . LYS B 1 136 ? 22.803  -88.974 -20.382 1.00 85.49  ? 131 LYS A CE  1 
ATOM   3314  N NZ  . LYS B 1 136 ? 22.560  -90.118 -21.297 1.00 87.04  ? 131 LYS A NZ  1 
ATOM   3315  N N   . ILE B 1 137 ? 26.864  -85.649 -19.402 1.00 65.51  ? 132 ILE A N   1 
ATOM   3316  C CA  . ILE B 1 137 ? 26.779  -84.212 -19.633 1.00 64.94  ? 132 ILE A CA  1 
ATOM   3317  C C   . ILE B 1 137 ? 25.524  -83.882 -20.435 1.00 65.03  ? 132 ILE A C   1 
ATOM   3318  O O   . ILE B 1 137 ? 25.156  -84.605 -21.363 1.00 64.09  ? 132 ILE A O   1 
ATOM   3319  C CB  . ILE B 1 137 ? 28.044  -83.678 -20.392 1.00 63.53  ? 132 ILE A CB  1 
ATOM   3320  C CG1 . ILE B 1 137 ? 28.081  -82.147 -20.369 1.00 61.85  ? 132 ILE A CG1 1 
ATOM   3321  C CG2 . ILE B 1 137 ? 28.028  -84.136 -21.844 1.00 63.43  ? 132 ILE A CG2 1 
ATOM   3322  C CD1 . ILE B 1 137 ? 28.216  -81.553 -19.001 1.00 58.99  ? 132 ILE A CD1 1 
ATOM   3323  N N   . SER B 1 138 ? 24.863  -82.798 -20.049 1.00 65.65  ? 133 SER A N   1 
ATOM   3324  C CA  . SER B 1 138 ? 23.659  -82.346 -20.731 1.00 67.82  ? 133 SER A CA  1 
ATOM   3325  C C   . SER B 1 138 ? 23.732  -80.830 -20.874 1.00 67.66  ? 133 SER A C   1 
ATOM   3326  O O   . SER B 1 138 ? 23.733  -80.105 -19.878 1.00 68.15  ? 133 SER A O   1 
ATOM   3327  C CB  . SER B 1 138 ? 22.416  -82.738 -19.933 1.00 70.01  ? 133 SER A CB  1 
ATOM   3328  O OG  . SER B 1 138 ? 21.241  -82.296 -20.593 1.00 73.33  ? 133 SER A OG  1 
ATOM   3329  N N   . PHE B 1 139 ? 23.806  -80.358 -22.113 1.00 66.46  ? 134 PHE A N   1 
ATOM   3330  C CA  . PHE B 1 139 ? 23.896  -78.931 -22.379 1.00 66.67  ? 134 PHE A CA  1 
ATOM   3331  C C   . PHE B 1 139 ? 22.514  -78.330 -22.570 1.00 64.65  ? 134 PHE A C   1 
ATOM   3332  O O   . PHE B 1 139 ? 21.754  -78.748 -23.436 1.00 65.62  ? 134 PHE A O   1 
ATOM   3333  C CB  . PHE B 1 139 ? 24.780  -78.692 -23.605 1.00 70.03  ? 134 PHE A CB  1 
ATOM   3334  C CG  . PHE B 1 139 ? 26.180  -79.223 -23.443 1.00 74.31  ? 134 PHE A CG  1 
ATOM   3335  C CD1 . PHE B 1 139 ? 26.990  -78.775 -22.402 1.00 76.88  ? 134 PHE A CD1 1 
ATOM   3336  C CD2 . PHE B 1 139 ? 26.678  -80.193 -24.305 1.00 75.76  ? 134 PHE A CD2 1 
ATOM   3337  C CE1 . PHE B 1 139 ? 28.277  -79.289 -22.219 1.00 78.64  ? 134 PHE A CE1 1 
ATOM   3338  C CE2 . PHE B 1 139 ? 27.962  -80.713 -24.132 1.00 77.52  ? 134 PHE A CE2 1 
ATOM   3339  C CZ  . PHE B 1 139 ? 28.762  -80.261 -23.087 1.00 78.45  ? 134 PHE A CZ  1 
ATOM   3340  N N   . VAL B 1 140 ? 22.197  -77.338 -21.750 1.00 62.56  ? 135 VAL A N   1 
ATOM   3341  C CA  . VAL B 1 140 ? 20.894  -76.697 -21.796 1.00 61.60  ? 135 VAL A CA  1 
ATOM   3342  C C   . VAL B 1 140 ? 20.973  -75.175 -21.804 1.00 61.30  ? 135 VAL A C   1 
ATOM   3343  O O   . VAL B 1 140 ? 21.672  -74.581 -20.981 1.00 61.00  ? 135 VAL A O   1 
ATOM   3344  C CB  . VAL B 1 140 ? 20.054  -77.136 -20.580 1.00 60.67  ? 135 VAL A CB  1 
ATOM   3345  C CG1 . VAL B 1 140 ? 18.789  -76.285 -20.472 1.00 59.97  ? 135 VAL A CG1 1 
ATOM   3346  C CG2 . VAL B 1 140 ? 19.719  -78.617 -20.700 1.00 59.53  ? 135 VAL A CG2 1 
ATOM   3347  N N   . ASP B 1 141 ? 20.247  -74.545 -22.724 1.00 60.63  ? 136 ASP A N   1 
ATOM   3348  C CA  . ASP B 1 141 ? 20.237  -73.088 -22.799 1.00 60.73  ? 136 ASP A CA  1 
ATOM   3349  C C   . ASP B 1 141 ? 19.501  -72.546 -21.579 1.00 60.25  ? 136 ASP A C   1 
ATOM   3350  O O   . ASP B 1 141 ? 18.276  -72.563 -21.524 1.00 60.69  ? 136 ASP A O   1 
ATOM   3351  C CB  . ASP B 1 141 ? 19.549  -72.613 -24.086 1.00 60.73  ? 136 ASP A CB  1 
ATOM   3352  C CG  . ASP B 1 141 ? 19.434  -71.096 -24.165 1.00 62.07  ? 136 ASP A CG  1 
ATOM   3353  O OD1 . ASP B 1 141 ? 19.244  -70.567 -25.280 1.00 63.36  ? 136 ASP A OD1 1 
ATOM   3354  O OD2 . ASP B 1 141 ? 19.523  -70.425 -23.115 1.00 60.75  ? 136 ASP A OD2 1 
ATOM   3355  N N   . CYS B 1 142 ? 20.259  -72.064 -20.603 1.00 59.98  ? 137 CYS A N   1 
ATOM   3356  C CA  . CYS B 1 142 ? 19.677  -71.535 -19.382 1.00 60.13  ? 137 CYS A CA  1 
ATOM   3357  C C   . CYS B 1 142 ? 19.244  -70.080 -19.492 1.00 60.80  ? 137 CYS A C   1 
ATOM   3358  O O   . CYS B 1 142 ? 19.009  -69.420 -18.482 1.00 60.09  ? 137 CYS A O   1 
ATOM   3359  C CB  . CYS B 1 142 ? 20.660  -71.721 -18.233 1.00 60.26  ? 137 CYS A CB  1 
ATOM   3360  S SG  . CYS B 1 142 ? 21.185  -73.453 -18.074 1.00 63.21  ? 137 CYS A SG  1 
ATOM   3361  N N   . SER B 1 143 ? 19.143  -69.587 -20.726 1.00 63.06  ? 138 SER A N   1 
ATOM   3362  C CA  . SER B 1 143 ? 18.689  -68.222 -20.983 1.00 64.82  ? 138 SER A CA  1 
ATOM   3363  C C   . SER B 1 143 ? 17.208  -68.242 -20.619 1.00 65.95  ? 138 SER A C   1 
ATOM   3364  O O   . SER B 1 143 ? 16.603  -67.217 -20.297 1.00 65.58  ? 138 SER A O   1 
ATOM   3365  C CB  . SER B 1 143 ? 18.860  -67.877 -22.468 1.00 65.03  ? 138 SER A CB  1 
ATOM   3366  O OG  . SER B 1 143 ? 18.205  -66.667 -22.808 1.00 67.34  ? 138 SER A OG  1 
ATOM   3367  N N   . LYS B 1 144 ? 16.647  -69.447 -20.671 1.00 67.84  ? 139 LYS A N   1 
ATOM   3368  C CA  . LYS B 1 144 ? 15.249  -69.693 -20.357 1.00 69.96  ? 139 LYS A CA  1 
ATOM   3369  C C   . LYS B 1 144 ? 15.193  -70.517 -19.070 1.00 73.12  ? 139 LYS A C   1 
ATOM   3370  O O   . LYS B 1 144 ? 15.323  -71.743 -19.107 1.00 71.59  ? 139 LYS A O   1 
ATOM   3371  C CB  . LYS B 1 144 ? 14.599  -70.471 -21.501 1.00 67.34  ? 139 LYS A CB  1 
ATOM   3372  C CG  . LYS B 1 144 ? 14.982  -69.967 -22.881 1.00 65.19  ? 139 LYS A CG  1 
ATOM   3373  C CD  . LYS B 1 144 ? 14.589  -68.506 -23.080 1.00 64.46  ? 139 LYS A CD  1 
ATOM   3374  C CE  . LYS B 1 144 ? 15.233  -67.926 -24.337 1.00 63.77  ? 139 LYS A CE  1 
ATOM   3375  N NZ  . LYS B 1 144 ? 14.944  -68.747 -25.549 1.00 63.43  ? 139 LYS A NZ  1 
ATOM   3376  N N   . ILE B 1 145 ? 15.005  -69.837 -17.939 1.00 77.69  ? 140 ILE A N   1 
ATOM   3377  C CA  . ILE B 1 145 ? 14.942  -70.496 -16.634 1.00 82.89  ? 140 ILE A CA  1 
ATOM   3378  C C   . ILE B 1 145 ? 14.076  -71.744 -16.675 1.00 81.33  ? 140 ILE A C   1 
ATOM   3379  O O   . ILE B 1 145 ? 14.404  -72.759 -16.062 1.00 82.22  ? 140 ILE A O   1 
ATOM   3380  C CB  . ILE B 1 145 ? 14.388  -69.543 -15.534 1.00 87.75  ? 140 ILE A CB  1 
ATOM   3381  C CG1 . ILE B 1 145 ? 15.424  -68.465 -15.191 1.00 92.07  ? 140 ILE A CG1 1 
ATOM   3382  C CG2 . ILE B 1 145 ? 14.040  -70.336 -14.274 1.00 89.87  ? 140 ILE A CG2 1 
ATOM   3383  C CD1 . ILE B 1 145 ? 15.786  -67.537 -16.345 1.00 96.90  ? 140 ILE A CD1 1 
ATOM   3384  N N   . LYS B 1 146 ? 12.969  -71.665 -17.401 1.00 80.41  ? 141 LYS A N   1 
ATOM   3385  C CA  . LYS B 1 146 ? 12.067  -72.797 -17.513 1.00 79.33  ? 141 LYS A CA  1 
ATOM   3386  C C   . LYS B 1 146 ? 12.780  -74.035 -18.074 1.00 76.76  ? 141 LYS A C   1 
ATOM   3387  O O   . LYS B 1 146 ? 12.578  -75.148 -17.579 1.00 76.95  ? 141 LYS A O   1 
ATOM   3388  C CB  . LYS B 1 146 ? 10.853  -72.404 -18.370 1.00 80.77  ? 141 LYS A CB  1 
ATOM   3389  C CG  . LYS B 1 146 ? 9.801   -71.595 -17.591 1.00 82.09  ? 141 LYS A CG  1 
ATOM   3390  C CD  . LYS B 1 146 ? 8.786   -70.893 -18.494 1.00 83.16  ? 141 LYS A CD  1 
ATOM   3391  C CE  . LYS B 1 146 ? 9.374   -69.630 -19.121 1.00 84.21  ? 141 LYS A CE  1 
ATOM   3392  N NZ  . LYS B 1 146 ? 8.421   -68.874 -19.985 1.00 83.74  ? 141 LYS A NZ  1 
ATOM   3393  N N   . LEU B 1 147 ? 13.628  -73.840 -19.085 1.00 73.90  ? 142 LEU A N   1 
ATOM   3394  C CA  . LEU B 1 147 ? 14.378  -74.947 -19.696 1.00 71.06  ? 142 LEU A CA  1 
ATOM   3395  C C   . LEU B 1 147 ? 15.258  -75.707 -18.700 1.00 69.47  ? 142 LEU A C   1 
ATOM   3396  O O   . LEU B 1 147 ? 15.400  -76.927 -18.788 1.00 67.51  ? 142 LEU A O   1 
ATOM   3397  C CB  . LEU B 1 147 ? 15.244  -74.423 -20.844 1.00 68.96  ? 142 LEU A CB  1 
ATOM   3398  C CG  . LEU B 1 147 ? 14.568  -74.415 -22.215 1.00 67.48  ? 142 LEU A CG  1 
ATOM   3399  C CD1 . LEU B 1 147 ? 15.250  -73.422 -23.145 1.00 65.37  ? 142 LEU A CD1 1 
ATOM   3400  C CD2 . LEU B 1 147 ? 14.607  -75.832 -22.782 1.00 66.01  ? 142 LEU A CD2 1 
ATOM   3401  N N   . LEU B 1 148 ? 15.851  -74.977 -17.760 1.00 68.75  ? 143 LEU A N   1 
ATOM   3402  C CA  . LEU B 1 148 ? 16.696  -75.582 -16.742 1.00 68.87  ? 143 LEU A CA  1 
ATOM   3403  C C   . LEU B 1 148 ? 15.819  -76.395 -15.786 1.00 71.65  ? 143 LEU A C   1 
ATOM   3404  O O   . LEU B 1 148 ? 16.191  -77.495 -15.378 1.00 72.14  ? 143 LEU A O   1 
ATOM   3405  C CB  . LEU B 1 148 ? 17.453  -74.497 -15.969 1.00 64.59  ? 143 LEU A CB  1 
ATOM   3406  C CG  . LEU B 1 148 ? 18.458  -74.979 -14.919 1.00 60.61  ? 143 LEU A CG  1 
ATOM   3407  C CD1 . LEU B 1 148 ? 19.534  -75.816 -15.588 1.00 57.17  ? 143 LEU A CD1 1 
ATOM   3408  C CD2 . LEU B 1 148 ? 19.070  -73.782 -14.213 1.00 58.43  ? 143 LEU A CD2 1 
ATOM   3409  N N   . GLU B 1 149 ? 14.658  -75.846 -15.427 1.00 75.15  ? 144 GLU A N   1 
ATOM   3410  C CA  . GLU B 1 149 ? 13.717  -76.537 -14.539 1.00 78.03  ? 144 GLU A CA  1 
ATOM   3411  C C   . GLU B 1 149 ? 13.478  -77.936 -15.081 1.00 75.19  ? 144 GLU A C   1 
ATOM   3412  O O   . GLU B 1 149 ? 13.459  -78.918 -14.340 1.00 74.48  ? 144 GLU A O   1 
ATOM   3413  C CB  . GLU B 1 149 ? 12.367  -75.810 -14.498 1.00 83.80  ? 144 GLU A CB  1 
ATOM   3414  C CG  . GLU B 1 149 ? 12.240  -74.719 -13.455 1.00 93.07  ? 144 GLU A CG  1 
ATOM   3415  C CD  . GLU B 1 149 ? 11.006  -74.903 -12.585 1.00 98.13  ? 144 GLU A CD  1 
ATOM   3416  O OE1 . GLU B 1 149 ? 10.934  -75.922 -11.862 1.00 101.52 ? 144 GLU A OE1 1 
ATOM   3417  O OE2 . GLU B 1 149 ? 10.108  -74.033 -12.628 1.00 100.83 ? 144 GLU A OE2 1 
ATOM   3418  N N   . ALA B 1 150 ? 13.292  -77.997 -16.395 1.00 72.91  ? 145 ALA A N   1 
ATOM   3419  C CA  . ALA B 1 150 ? 13.033  -79.237 -17.099 1.00 71.17  ? 145 ALA A CA  1 
ATOM   3420  C C   . ALA B 1 150 ? 14.194  -80.226 -17.038 1.00 70.52  ? 145 ALA A C   1 
ATOM   3421  O O   . ALA B 1 150 ? 14.101  -81.252 -16.363 1.00 71.37  ? 145 ALA A O   1 
ATOM   3422  C CB  . ALA B 1 150 ? 12.680  -78.929 -18.549 1.00 69.59  ? 145 ALA A CB  1 
ATOM   3423  N N   . ALA B 1 151 ? 15.280  -79.906 -17.741 1.00 69.82  ? 146 ALA A N   1 
ATOM   3424  C CA  . ALA B 1 151 ? 16.470  -80.758 -17.816 1.00 68.48  ? 146 ALA A CA  1 
ATOM   3425  C C   . ALA B 1 151 ? 16.937  -81.421 -16.516 1.00 67.77  ? 146 ALA A C   1 
ATOM   3426  O O   . ALA B 1 151 ? 17.600  -82.462 -16.558 1.00 67.07  ? 146 ALA A O   1 
ATOM   3427  C CB  . ALA B 1 151 ? 17.622  -79.971 -18.433 1.00 67.92  ? 146 ALA A CB  1 
ATOM   3428  N N   . ILE B 1 152 ? 16.599  -80.830 -15.371 1.00 68.72  ? 147 ILE A N   1 
ATOM   3429  C CA  . ILE B 1 152 ? 17.004  -81.378 -14.076 1.00 71.04  ? 147 ILE A CA  1 
ATOM   3430  C C   . ILE B 1 152 ? 16.592  -82.842 -13.919 1.00 72.43  ? 147 ILE A C   1 
ATOM   3431  O O   . ILE B 1 152 ? 15.408  -83.168 -13.832 1.00 72.31  ? 147 ILE A O   1 
ATOM   3432  C CB  . ILE B 1 152 ? 16.412  -80.563 -12.898 1.00 69.25  ? 147 ILE A CB  1 
ATOM   3433  C CG1 . ILE B 1 152 ? 16.823  -79.092 -13.015 1.00 69.22  ? 147 ILE A CG1 1 
ATOM   3434  C CG2 . ILE B 1 152 ? 16.916  -81.118 -11.571 1.00 67.96  ? 147 ILE A CG2 1 
ATOM   3435  C CD1 . ILE B 1 152 ? 18.312  -78.860 -12.942 1.00 69.46  ? 147 ILE A CD1 1 
ATOM   3436  N N   . THR B 1 153 ? 17.598  -83.710 -13.883 1.00 75.14  ? 148 THR A N   1 
ATOM   3437  C CA  . THR B 1 153 ? 17.425  -85.152 -13.752 1.00 78.84  ? 148 THR A CA  1 
ATOM   3438  C C   . THR B 1 153 ? 17.815  -85.573 -12.339 1.00 82.67  ? 148 THR A C   1 
ATOM   3439  O O   . THR B 1 153 ? 18.609  -84.902 -11.686 1.00 81.35  ? 148 THR A O   1 
ATOM   3440  C CB  . THR B 1 153 ? 18.335  -85.879 -14.762 1.00 77.52  ? 148 THR A CB  1 
ATOM   3441  O OG1 . THR B 1 153 ? 17.962  -85.491 -16.088 1.00 78.06  ? 148 THR A OG1 1 
ATOM   3442  C CG2 . THR B 1 153 ? 18.229  -87.383 -14.625 1.00 76.56  ? 148 THR A CG2 1 
ATOM   3443  N N   . PRO B 1 154 ? 17.243  -86.680 -11.839 1.00 84.97  ? 149 PRO A N   1 
ATOM   3444  C CA  . PRO B 1 154 ? 17.591  -87.129 -10.486 1.00 89.60  ? 149 PRO A CA  1 
ATOM   3445  C C   . PRO B 1 154 ? 19.093  -87.387 -10.322 1.00 92.38  ? 149 PRO A C   1 
ATOM   3446  O O   . PRO B 1 154 ? 19.583  -87.583 -9.208  1.00 92.52  ? 149 PRO A O   1 
ATOM   3447  C CB  . PRO B 1 154 ? 16.761  -88.398 -10.326 1.00 88.51  ? 149 PRO A CB  1 
ATOM   3448  C CG  . PRO B 1 154 ? 15.527  -88.076 -11.116 1.00 87.98  ? 149 PRO A CG  1 
ATOM   3449  C CD  . PRO B 1 154 ? 16.097  -87.446 -12.366 1.00 86.64  ? 149 PRO A CD  1 
ATOM   3450  N N   . GLU B 1 155 ? 19.816  -87.384 -11.438 1.00 94.86  ? 150 GLU A N   1 
ATOM   3451  C CA  . GLU B 1 155 ? 21.260  -87.614 -11.430 1.00 96.94  ? 150 GLU A CA  1 
ATOM   3452  C C   . GLU B 1 155 ? 22.030  -86.294 -11.448 1.00 93.94  ? 150 GLU A C   1 
ATOM   3453  O O   . GLU B 1 155 ? 23.227  -86.253 -11.149 1.00 94.55  ? 150 GLU A O   1 
ATOM   3454  C CB  . GLU B 1 155 ? 21.669  -88.471 -12.635 1.00 103.06 ? 150 GLU A CB  1 
ATOM   3455  C CG  . GLU B 1 155 ? 21.315  -89.950 -12.506 1.00 110.46 ? 150 GLU A CG  1 
ATOM   3456  C CD  . GLU B 1 155 ? 19.817  -90.215 -12.493 1.00 114.80 ? 150 GLU A CD  1 
ATOM   3457  O OE1 . GLU B 1 155 ? 19.424  -91.377 -12.258 1.00 117.09 ? 150 GLU A OE1 1 
ATOM   3458  O OE2 . GLU B 1 155 ? 19.032  -89.272 -12.722 1.00 117.01 ? 150 GLU A OE2 1 
ATOM   3459  N N   . THR B 1 156 ? 21.327  -85.220 -11.801 1.00 88.43  ? 151 THR A N   1 
ATOM   3460  C CA  . THR B 1 156 ? 21.909  -83.886 -11.857 1.00 81.18  ? 151 THR A CA  1 
ATOM   3461  C C   . THR B 1 156 ? 22.473  -83.466 -10.500 1.00 80.10  ? 151 THR A C   1 
ATOM   3462  O O   . THR B 1 156 ? 21.727  -83.256 -9.540  1.00 79.16  ? 151 THR A O   1 
ATOM   3463  C CB  . THR B 1 156 ? 20.853  -82.850 -12.299 1.00 78.44  ? 151 THR A CB  1 
ATOM   3464  O OG1 . THR B 1 156 ? 20.453  -83.123 -13.645 1.00 74.33  ? 151 THR A OG1 1 
ATOM   3465  C CG2 . THR B 1 156 ? 21.411  -81.447 -12.226 1.00 75.63  ? 151 THR A CG2 1 
ATOM   3466  N N   . LYS B 1 157 ? 23.796  -83.349 -10.429 1.00 77.51  ? 152 LYS A N   1 
ATOM   3467  C CA  . LYS B 1 157 ? 24.463  -82.943 -9.198  1.00 74.24  ? 152 LYS A CA  1 
ATOM   3468  C C   . LYS B 1 157 ? 25.264  -81.650 -9.377  1.00 70.53  ? 152 LYS A C   1 
ATOM   3469  O O   . LYS B 1 157 ? 25.869  -81.152 -8.426  1.00 71.25  ? 152 LYS A O   1 
ATOM   3470  C CB  . LYS B 1 157 ? 25.379  -84.063 -8.691  1.00 76.25  ? 152 LYS A CB  1 
ATOM   3471  C CG  . LYS B 1 157 ? 24.890  -84.728 -7.406  1.00 79.22  ? 152 LYS A CG  1 
ATOM   3472  C CD  . LYS B 1 157 ? 23.637  -85.572 -7.632  1.00 80.18  ? 152 LYS A CD  1 
ATOM   3473  C CE  . LYS B 1 157 ? 22.958  -85.946 -6.310  1.00 80.38  ? 152 LYS A CE  1 
ATOM   3474  N NZ  . LYS B 1 157 ? 23.865  -86.587 -5.312  1.00 79.34  ? 152 LYS A NZ  1 
ATOM   3475  N N   . LEU B 1 158 ? 25.260  -81.110 -10.594 1.00 64.96  ? 153 LEU A N   1 
ATOM   3476  C CA  . LEU B 1 158 ? 25.972  -79.867 -10.885 1.00 58.37  ? 153 LEU A CA  1 
ATOM   3477  C C   . LEU B 1 158 ? 25.382  -79.114 -12.078 1.00 56.35  ? 153 LEU A C   1 
ATOM   3478  O O   . LEU B 1 158 ? 24.988  -79.715 -13.077 1.00 56.02  ? 153 LEU A O   1 
ATOM   3479  C CB  . LEU B 1 158 ? 27.459  -80.142 -11.162 1.00 54.60  ? 153 LEU A CB  1 
ATOM   3480  C CG  . LEU B 1 158 ? 28.332  -78.926 -11.539 1.00 49.67  ? 153 LEU A CG  1 
ATOM   3481  C CD1 . LEU B 1 158 ? 28.570  -78.049 -10.327 1.00 47.12  ? 153 LEU A CD1 1 
ATOM   3482  C CD2 . LEU B 1 158 ? 29.654  -79.396 -12.086 1.00 46.43  ? 153 LEU A CD2 1 
ATOM   3483  N N   . VAL B 1 159 ? 25.316  -77.792 -11.959 1.00 54.66  ? 154 VAL A N   1 
ATOM   3484  C CA  . VAL B 1 159 ? 24.824  -76.946 -13.037 1.00 53.37  ? 154 VAL A CA  1 
ATOM   3485  C C   . VAL B 1 159 ? 25.907  -75.905 -13.279 1.00 52.18  ? 154 VAL A C   1 
ATOM   3486  O O   . VAL B 1 159 ? 26.197  -75.095 -12.401 1.00 52.99  ? 154 VAL A O   1 
ATOM   3487  C CB  . VAL B 1 159 ? 23.526  -76.211 -12.658 1.00 54.82  ? 154 VAL A CB  1 
ATOM   3488  C CG1 . VAL B 1 159 ? 23.079  -75.335 -13.814 1.00 54.47  ? 154 VAL A CG1 1 
ATOM   3489  C CG2 . VAL B 1 159 ? 22.441  -77.204 -12.307 1.00 55.54  ? 154 VAL A CG2 1 
ATOM   3490  N N   . TRP B 1 160 ? 26.513  -75.933 -14.460 1.00 50.84  ? 155 TRP A N   1 
ATOM   3491  C CA  . TRP B 1 160 ? 27.570  -74.988 -14.781 1.00 48.91  ? 155 TRP A CA  1 
ATOM   3492  C C   . TRP B 1 160 ? 27.045  -73.912 -15.713 1.00 49.75  ? 155 TRP A C   1 
ATOM   3493  O O   . TRP B 1 160 ? 26.534  -74.215 -16.797 1.00 49.36  ? 155 TRP A O   1 
ATOM   3494  C CB  . TRP B 1 160 ? 28.749  -75.714 -15.430 1.00 46.58  ? 155 TRP A CB  1 
ATOM   3495  C CG  . TRP B 1 160 ? 29.976  -74.862 -15.545 1.00 45.69  ? 155 TRP A CG  1 
ATOM   3496  C CD1 . TRP B 1 160 ? 30.172  -73.805 -16.391 1.00 43.33  ? 155 TRP A CD1 1 
ATOM   3497  C CD2 . TRP B 1 160 ? 31.169  -74.973 -14.762 1.00 44.89  ? 155 TRP A CD2 1 
ATOM   3498  N NE1 . TRP B 1 160 ? 31.408  -73.251 -16.180 1.00 43.29  ? 155 TRP A NE1 1 
ATOM   3499  C CE2 . TRP B 1 160 ? 32.042  -73.944 -15.183 1.00 44.21  ? 155 TRP A CE2 1 
ATOM   3500  C CE3 . TRP B 1 160 ? 31.580  -75.833 -13.737 1.00 44.91  ? 155 TRP A CE3 1 
ATOM   3501  C CZ2 . TRP B 1 160 ? 33.312  -73.761 -14.626 1.00 43.63  ? 155 TRP A CZ2 1 
ATOM   3502  C CZ3 . TRP B 1 160 ? 32.842  -75.652 -13.181 1.00 46.40  ? 155 TRP A CZ3 1 
ATOM   3503  C CH2 . TRP B 1 160 ? 33.692  -74.617 -13.625 1.00 45.19  ? 155 TRP A CH2 1 
ATOM   3504  N N   . ILE B 1 161 ? 27.180  -72.657 -15.284 1.00 51.43  ? 156 ILE A N   1 
ATOM   3505  C CA  . ILE B 1 161 ? 26.712  -71.510 -16.062 1.00 52.59  ? 156 ILE A CA  1 
ATOM   3506  C C   . ILE B 1 161 ? 27.777  -70.438 -16.312 1.00 50.76  ? 156 ILE A C   1 
ATOM   3507  O O   . ILE B 1 161 ? 28.648  -70.205 -15.472 1.00 49.70  ? 156 ILE A O   1 
ATOM   3508  C CB  . ILE B 1 161 ? 25.503  -70.836 -15.361 1.00 54.50  ? 156 ILE A CB  1 
ATOM   3509  C CG1 . ILE B 1 161 ? 24.301  -71.778 -15.420 1.00 55.71  ? 156 ILE A CG1 1 
ATOM   3510  C CG2 . ILE B 1 161 ? 25.211  -69.463 -15.978 1.00 54.93  ? 156 ILE A CG2 1 
ATOM   3511  C CD1 . ILE B 1 161 ? 22.975  -71.087 -15.646 1.00 59.32  ? 156 ILE A CD1 1 
ATOM   3512  N N   . GLU B 1 162 ? 27.697  -69.803 -17.480 1.00 49.11  ? 157 GLU A N   1 
ATOM   3513  C CA  . GLU B 1 162 ? 28.606  -68.719 -17.852 1.00 48.66  ? 157 GLU A CA  1 
ATOM   3514  C C   . GLU B 1 162 ? 27.738  -67.534 -18.303 1.00 48.11  ? 157 GLU A C   1 
ATOM   3515  O O   . GLU B 1 162 ? 26.877  -67.690 -19.168 1.00 48.92  ? 157 GLU A O   1 
ATOM   3516  C CB  . GLU B 1 162 ? 29.533  -69.124 -19.010 1.00 48.88  ? 157 GLU A CB  1 
ATOM   3517  C CG  . GLU B 1 162 ? 30.292  -70.425 -18.829 1.00 48.58  ? 157 GLU A CG  1 
ATOM   3518  C CD  . GLU B 1 162 ? 29.634  -71.572 -19.574 1.00 50.27  ? 157 GLU A CD  1 
ATOM   3519  O OE1 . GLU B 1 162 ? 30.091  -72.732 -19.447 1.00 49.83  ? 157 GLU A OE1 1 
ATOM   3520  O OE2 . GLU B 1 162 ? 28.651  -71.304 -20.298 1.00 52.25  ? 157 GLU A OE2 1 
ATOM   3521  N N   . THR B 1 163 ? 27.955  -66.355 -17.725 1.00 45.60  ? 158 THR A N   1 
ATOM   3522  C CA  . THR B 1 163 ? 27.165  -65.185 -18.102 1.00 43.67  ? 158 THR A CA  1 
ATOM   3523  C C   . THR B 1 163 ? 27.907  -63.868 -17.856 1.00 44.87  ? 158 THR A C   1 
ATOM   3524  O O   . THR B 1 163 ? 28.473  -63.652 -16.786 1.00 45.24  ? 158 THR A O   1 
ATOM   3525  C CB  . THR B 1 163 ? 25.838  -65.160 -17.333 1.00 41.99  ? 158 THR A CB  1 
ATOM   3526  O OG1 . THR B 1 163 ? 25.138  -63.944 -17.614 1.00 39.55  ? 158 THR A OG1 1 
ATOM   3527  C CG2 . THR B 1 163 ? 26.096  -65.260 -15.842 1.00 41.38  ? 158 THR A CG2 1 
ATOM   3528  N N   . PRO B 1 164 ? 27.906  -62.963 -18.845 1.00 44.99  ? 159 PRO A N   1 
ATOM   3529  C CA  . PRO B 1 164 ? 27.262  -63.110 -20.157 1.00 45.28  ? 159 PRO A CA  1 
ATOM   3530  C C   . PRO B 1 164 ? 27.857  -64.268 -20.953 1.00 46.25  ? 159 PRO A C   1 
ATOM   3531  O O   . PRO B 1 164 ? 28.842  -64.872 -20.537 1.00 46.93  ? 159 PRO A O   1 
ATOM   3532  C CB  . PRO B 1 164 ? 27.543  -61.766 -20.832 1.00 44.73  ? 159 PRO A CB  1 
ATOM   3533  C CG  . PRO B 1 164 ? 27.698  -60.820 -19.688 1.00 44.30  ? 159 PRO A CG  1 
ATOM   3534  C CD  . PRO B 1 164 ? 28.501  -61.623 -18.702 1.00 43.79  ? 159 PRO A CD  1 
ATOM   3535  N N   . THR B 1 165 ? 27.252  -64.583 -22.093 1.00 47.29  ? 160 THR A N   1 
ATOM   3536  C CA  . THR B 1 165 ? 27.774  -65.636 -22.951 1.00 48.39  ? 160 THR A CA  1 
ATOM   3537  C C   . THR B 1 165 ? 28.720  -64.975 -23.948 1.00 49.04  ? 160 THR A C   1 
ATOM   3538  O O   . THR B 1 165 ? 28.735  -63.749 -24.092 1.00 48.47  ? 160 THR A O   1 
ATOM   3539  C CB  . THR B 1 165 ? 26.665  -66.355 -23.754 1.00 48.86  ? 160 THR A CB  1 
ATOM   3540  O OG1 . THR B 1 165 ? 25.988  -65.411 -24.599 1.00 48.31  ? 160 THR A OG1 1 
ATOM   3541  C CG2 . THR B 1 165 ? 25.680  -67.033 -22.814 1.00 48.83  ? 160 THR A CG2 1 
ATOM   3542  N N   . ASN B 1 166 ? 29.493  -65.796 -24.647 1.00 50.18  ? 161 ASN A N   1 
ATOM   3543  C CA  . ASN B 1 166 ? 30.456  -65.309 -25.624 1.00 50.79  ? 161 ASN A CA  1 
ATOM   3544  C C   . ASN B 1 166 ? 30.137  -65.909 -26.995 1.00 51.33  ? 161 ASN A C   1 
ATOM   3545  O O   . ASN B 1 166 ? 30.039  -67.128 -27.137 1.00 49.68  ? 161 ASN A O   1 
ATOM   3546  C CB  . ASN B 1 166 ? 31.865  -65.696 -25.156 1.00 51.75  ? 161 ASN A CB  1 
ATOM   3547  C CG  . ASN B 1 166 ? 32.956  -65.179 -26.070 1.00 53.63  ? 161 ASN A CG  1 
ATOM   3548  O OD1 . ASN B 1 166 ? 32.852  -64.086 -26.634 1.00 54.37  ? 161 ASN A OD1 1 
ATOM   3549  N ND2 . ASN B 1 166 ? 34.026  -65.957 -26.204 1.00 54.26  ? 161 ASN A ND2 1 
ATOM   3550  N N   . PRO B 1 167 ? 29.984  -65.059 -28.027 1.00 50.03  ? 162 PRO A N   1 
ATOM   3551  C CA  . PRO B 1 167 ? 30.075  -63.595 -28.006 1.00 51.25  ? 162 PRO A CA  1 
ATOM   3552  C C   . PRO B 1 167 ? 28.727  -62.863 -28.079 1.00 53.65  ? 162 PRO A C   1 
ATOM   3553  O O   . PRO B 1 167 ? 28.693  -61.636 -28.216 1.00 50.62  ? 162 PRO A O   1 
ATOM   3554  C CB  . PRO B 1 167 ? 30.918  -63.314 -29.234 1.00 50.59  ? 162 PRO A CB  1 
ATOM   3555  C CG  . PRO B 1 167 ? 30.302  -64.259 -30.223 1.00 49.73  ? 162 PRO A CG  1 
ATOM   3556  C CD  . PRO B 1 167 ? 30.076  -65.548 -29.414 1.00 50.30  ? 162 PRO A CD  1 
ATOM   3557  N N   . THR B 1 168 ? 27.627  -63.614 -27.999 1.00 55.60  ? 163 THR A N   1 
ATOM   3558  C CA  . THR B 1 168 ? 26.283  -63.032 -28.075 1.00 55.60  ? 163 THR A CA  1 
ATOM   3559  C C   . THR B 1 168 ? 25.920  -62.255 -26.819 1.00 56.53  ? 163 THR A C   1 
ATOM   3560  O O   . THR B 1 168 ? 25.107  -61.327 -26.862 1.00 57.13  ? 163 THR A O   1 
ATOM   3561  C CB  . THR B 1 168 ? 25.217  -64.116 -28.316 1.00 56.42  ? 163 THR A CB  1 
ATOM   3562  O OG1 . THR B 1 168 ? 25.471  -64.745 -29.577 1.00 56.78  ? 163 THR A OG1 1 
ATOM   3563  C CG2 . THR B 1 168 ? 23.816  -63.506 -28.328 1.00 56.57  ? 163 THR A CG2 1 
ATOM   3564  N N   . GLN B 1 169 ? 26.527  -62.642 -25.702 1.00 55.63  ? 164 GLN A N   1 
ATOM   3565  C CA  . GLN B 1 169 ? 26.298  -61.978 -24.425 1.00 53.49  ? 164 GLN A CA  1 
ATOM   3566  C C   . GLN B 1 169 ? 24.872  -62.075 -23.880 1.00 52.04  ? 164 GLN A C   1 
ATOM   3567  O O   . GLN B 1 169 ? 24.279  -61.065 -23.497 1.00 50.92  ? 164 GLN A O   1 
ATOM   3568  C CB  . GLN B 1 169 ? 26.707  -60.499 -24.513 1.00 52.83  ? 164 GLN A CB  1 
ATOM   3569  C CG  . GLN B 1 169 ? 28.160  -60.263 -24.890 1.00 50.80  ? 164 GLN A CG  1 
ATOM   3570  C CD  . GLN B 1 169 ? 28.646  -58.870 -24.522 1.00 50.64  ? 164 GLN A CD  1 
ATOM   3571  O OE1 . GLN B 1 169 ? 28.739  -58.516 -23.339 1.00 50.25  ? 164 GLN A OE1 1 
ATOM   3572  N NE2 . GLN B 1 169 ? 28.961  -58.071 -25.534 1.00 51.06  ? 164 GLN A NE2 1 
ATOM   3573  N N   . LYS B 1 170 ? 24.319  -63.282 -23.854 1.00 51.27  ? 165 LYS A N   1 
ATOM   3574  C CA  . LYS B 1 170 ? 22.984  -63.472 -23.303 1.00 51.24  ? 165 LYS A CA  1 
ATOM   3575  C C   . LYS B 1 170 ? 23.178  -63.609 -21.796 1.00 48.67  ? 165 LYS A C   1 
ATOM   3576  O O   . LYS B 1 170 ? 23.902  -64.494 -21.342 1.00 49.03  ? 165 LYS A O   1 
ATOM   3577  C CB  . LYS B 1 170 ? 22.318  -64.737 -23.876 1.00 54.45  ? 165 LYS A CB  1 
ATOM   3578  C CG  . LYS B 1 170 ? 21.689  -64.545 -25.263 1.00 59.50  ? 165 LYS A CG  1 
ATOM   3579  C CD  . LYS B 1 170 ? 20.872  -65.756 -25.718 1.00 62.75  ? 165 LYS A CD  1 
ATOM   3580  C CE  . LYS B 1 170 ? 21.755  -66.974 -25.984 1.00 66.68  ? 165 LYS A CE  1 
ATOM   3581  N NZ  . LYS B 1 170 ? 21.019  -68.137 -26.579 1.00 67.76  ? 165 LYS A NZ  1 
ATOM   3582  N N   . VAL B 1 171 ? 22.550  -62.726 -21.023 1.00 45.33  ? 166 VAL A N   1 
ATOM   3583  C CA  . VAL B 1 171 ? 22.683  -62.759 -19.569 1.00 40.99  ? 166 VAL A CA  1 
ATOM   3584  C C   . VAL B 1 171 ? 21.797  -63.819 -18.935 1.00 42.26  ? 166 VAL A C   1 
ATOM   3585  O O   . VAL B 1 171 ? 20.606  -63.869 -19.206 1.00 42.05  ? 166 VAL A O   1 
ATOM   3586  C CB  . VAL B 1 171 ? 22.321  -61.408 -18.935 1.00 37.51  ? 166 VAL A CB  1 
ATOM   3587  C CG1 . VAL B 1 171 ? 22.691  -61.424 -17.467 1.00 36.05  ? 166 VAL A CG1 1 
ATOM   3588  C CG2 . VAL B 1 171 ? 23.033  -60.289 -19.649 1.00 34.10  ? 166 VAL A CG2 1 
ATOM   3589  N N   . ILE B 1 172 ? 22.383  -64.668 -18.098 1.00 43.72  ? 167 ILE A N   1 
ATOM   3590  C CA  . ILE B 1 172 ? 21.626  -65.718 -17.419 1.00 43.68  ? 167 ILE A CA  1 
ATOM   3591  C C   . ILE B 1 172 ? 21.249  -65.223 -16.023 1.00 48.45  ? 167 ILE A C   1 
ATOM   3592  O O   . ILE B 1 172 ? 22.082  -64.634 -15.327 1.00 49.03  ? 167 ILE A O   1 
ATOM   3593  C CB  . ILE B 1 172 ? 22.456  -67.025 -17.278 1.00 40.71  ? 167 ILE A CB  1 
ATOM   3594  C CG1 . ILE B 1 172 ? 22.490  -67.781 -18.605 1.00 36.25  ? 167 ILE A CG1 1 
ATOM   3595  C CG2 . ILE B 1 172 ? 21.886  -67.895 -16.171 1.00 40.16  ? 167 ILE A CG2 1 
ATOM   3596  C CD1 . ILE B 1 172 ? 23.358  -67.142 -19.647 1.00 35.30  ? 167 ILE A CD1 1 
ATOM   3597  N N   . ASP B 1 173 ? 20.000  -65.448 -15.618 1.00 52.83  ? 168 ASP A N   1 
ATOM   3598  C CA  . ASP B 1 173 ? 19.557  -65.020 -14.296 1.00 56.88  ? 168 ASP A CA  1 
ATOM   3599  C C   . ASP B 1 173 ? 20.091  -66.005 -13.258 1.00 58.32  ? 168 ASP A C   1 
ATOM   3600  O O   . ASP B 1 173 ? 19.480  -67.039 -12.963 1.00 57.65  ? 168 ASP A O   1 
ATOM   3601  C CB  . ASP B 1 173 ? 18.031  -64.954 -14.227 1.00 60.71  ? 168 ASP A CB  1 
ATOM   3602  C CG  . ASP B 1 173 ? 17.536  -64.259 -12.967 1.00 64.62  ? 168 ASP A CG  1 
ATOM   3603  O OD1 . ASP B 1 173 ? 17.873  -64.726 -11.858 1.00 66.15  ? 168 ASP A OD1 1 
ATOM   3604  O OD2 . ASP B 1 173 ? 16.814  -63.243 -13.086 1.00 66.95  ? 168 ASP A OD2 1 
ATOM   3605  N N   . ILE B 1 174 ? 21.253  -65.666 -12.719 1.00 59.29  ? 169 ILE A N   1 
ATOM   3606  C CA  . ILE B 1 174 ? 21.927  -66.487 -11.730 1.00 60.05  ? 169 ILE A CA  1 
ATOM   3607  C C   . ILE B 1 174 ? 21.017  -66.764 -10.537 1.00 63.36  ? 169 ILE A C   1 
ATOM   3608  O O   . ILE B 1 174 ? 20.914  -67.901 -10.084 1.00 63.08  ? 169 ILE A O   1 
ATOM   3609  C CB  . ILE B 1 174 ? 23.237  -65.796 -11.253 1.00 58.61  ? 169 ILE A CB  1 
ATOM   3610  C CG1 . ILE B 1 174 ? 24.071  -65.374 -12.471 1.00 56.28  ? 169 ILE A CG1 1 
ATOM   3611  C CG2 . ILE B 1 174 ? 24.050  -66.748 -10.382 1.00 56.39  ? 169 ILE A CG2 1 
ATOM   3612  C CD1 . ILE B 1 174 ? 25.308  -64.566 -12.132 1.00 54.45  ? 169 ILE A CD1 1 
ATOM   3613  N N   . GLU B 1 175 ? 20.351  -65.731 -10.034 1.00 66.39  ? 170 GLU A N   1 
ATOM   3614  C CA  . GLU B 1 175 ? 19.458  -65.906 -8.895  1.00 69.23  ? 170 GLU A CA  1 
ATOM   3615  C C   . GLU B 1 175 ? 18.318  -66.859 -9.264  1.00 70.73  ? 170 GLU A C   1 
ATOM   3616  O O   . GLU B 1 175 ? 17.928  -67.722 -8.470  1.00 71.22  ? 170 GLU A O   1 
ATOM   3617  C CB  . GLU B 1 175 ? 18.887  -64.558 -8.454  1.00 72.37  ? 170 GLU A CB  1 
ATOM   3618  C CG  . GLU B 1 175 ? 18.101  -64.624 -7.158  1.00 76.30  ? 170 GLU A CG  1 
ATOM   3619  C CD  . GLU B 1 175 ? 18.972  -64.993 -5.969  1.00 79.18  ? 170 GLU A CD  1 
ATOM   3620  O OE1 . GLU B 1 175 ? 19.776  -64.136 -5.536  1.00 81.11  ? 170 GLU A OE1 1 
ATOM   3621  O OE2 . GLU B 1 175 ? 18.857  -66.138 -5.474  1.00 79.63  ? 170 GLU A OE2 1 
ATOM   3622  N N   . GLY B 1 176 ? 17.791  -66.701 -10.476 1.00 70.93  ? 171 GLY A N   1 
ATOM   3623  C CA  . GLY B 1 176 ? 16.714  -67.559 -10.932 1.00 70.29  ? 171 GLY A CA  1 
ATOM   3624  C C   . GLY B 1 176 ? 17.141  -69.015 -10.935 1.00 70.07  ? 171 GLY A C   1 
ATOM   3625  O O   . GLY B 1 176 ? 16.431  -69.886 -10.424 1.00 71.66  ? 171 GLY A O   1 
ATOM   3626  N N   . CYS B 1 177 ? 18.314  -69.277 -11.504 1.00 68.76  ? 172 CYS A N   1 
ATOM   3627  C CA  . CYS B 1 177 ? 18.847  -70.631 -11.578 1.00 67.05  ? 172 CYS A CA  1 
ATOM   3628  C C   . CYS B 1 177 ? 19.190  -71.196 -10.201 1.00 67.20  ? 172 CYS A C   1 
ATOM   3629  O O   . CYS B 1 177 ? 19.113  -72.402 -9.981  1.00 66.19  ? 172 CYS A O   1 
ATOM   3630  C CB  . CYS B 1 177 ? 20.093  -70.648 -12.467 1.00 66.10  ? 172 CYS A CB  1 
ATOM   3631  S SG  . CYS B 1 177 ? 19.824  -70.035 -14.151 1.00 65.66  ? 172 CYS A SG  1 
ATOM   3632  N N   . ALA B 1 178 ? 19.574  -70.323 -9.278  1.00 69.44  ? 173 ALA A N   1 
ATOM   3633  C CA  . ALA B 1 178 ? 19.927  -70.748 -7.930  1.00 72.45  ? 173 ALA A CA  1 
ATOM   3634  C C   . ALA B 1 178 ? 18.717  -71.349 -7.219  1.00 76.00  ? 173 ALA A C   1 
ATOM   3635  O O   . ALA B 1 178 ? 18.803  -72.440 -6.648  1.00 75.30  ? 173 ALA A O   1 
ATOM   3636  C CB  . ALA B 1 178 ? 20.466  -69.568 -7.137  1.00 70.14  ? 173 ALA A CB  1 
ATOM   3637  N N   . HIS B 1 179 ? 17.594  -70.634 -7.259  1.00 81.23  ? 174 HIS A N   1 
ATOM   3638  C CA  . HIS B 1 179 ? 16.367  -71.093 -6.618  1.00 86.26  ? 174 HIS A CA  1 
ATOM   3639  C C   . HIS B 1 179 ? 15.834  -72.355 -7.269  1.00 84.39  ? 174 HIS A C   1 
ATOM   3640  O O   . HIS B 1 179 ? 15.359  -73.263 -6.583  1.00 85.17  ? 174 HIS A O   1 
ATOM   3641  C CB  . HIS B 1 179 ? 15.306  -69.993 -6.656  1.00 94.77  ? 174 HIS A CB  1 
ATOM   3642  C CG  . HIS B 1 179 ? 15.462  -68.975 -5.571  1.00 104.70 ? 174 HIS A CG  1 
ATOM   3643  N ND1 . HIS B 1 179 ? 14.836  -67.748 -5.603  1.00 109.37 ? 174 HIS A ND1 1 
ATOM   3644  C CD2 . HIS B 1 179 ? 16.165  -69.009 -4.413  1.00 108.63 ? 174 HIS A CD2 1 
ATOM   3645  C CE1 . HIS B 1 179 ? 15.147  -67.068 -4.513  1.00 111.75 ? 174 HIS A CE1 1 
ATOM   3646  N NE2 . HIS B 1 179 ? 15.951  -67.811 -3.774  1.00 111.64 ? 174 HIS A NE2 1 
ATOM   3647  N N   . ILE B 1 180 ? 15.916  -72.413 -8.593  1.00 80.46  ? 175 ILE A N   1 
ATOM   3648  C CA  . ILE B 1 180 ? 15.454  -73.583 -9.329  1.00 76.27  ? 175 ILE A CA  1 
ATOM   3649  C C   . ILE B 1 180 ? 16.317  -74.799 -8.963  1.00 77.52  ? 175 ILE A C   1 
ATOM   3650  O O   . ILE B 1 180 ? 15.794  -75.879 -8.683  1.00 77.34  ? 175 ILE A O   1 
ATOM   3651  C CB  . ILE B 1 180 ? 15.540  -73.348 -10.859 1.00 73.21  ? 175 ILE A CB  1 
ATOM   3652  C CG1 . ILE B 1 180 ? 14.651  -72.167 -11.266 1.00 69.87  ? 175 ILE A CG1 1 
ATOM   3653  C CG2 . ILE B 1 180 ? 15.161  -74.613 -11.603 1.00 70.76  ? 175 ILE A CG2 1 
ATOM   3654  C CD1 . ILE B 1 180 ? 13.186  -72.356 -10.968 1.00 67.33  ? 175 ILE A CD1 1 
ATOM   3655  N N   . VAL B 1 181 ? 17.637  -74.603 -8.955  1.00 77.88  ? 176 VAL A N   1 
ATOM   3656  C CA  . VAL B 1 181 ? 18.608  -75.658 -8.645  1.00 76.41  ? 176 VAL A CA  1 
ATOM   3657  C C   . VAL B 1 181 ? 18.589  -76.116 -7.186  1.00 78.64  ? 176 VAL A C   1 
ATOM   3658  O O   . VAL B 1 181 ? 18.666  -77.309 -6.898  1.00 77.75  ? 176 VAL A O   1 
ATOM   3659  C CB  . VAL B 1 181 ? 20.057  -75.202 -8.995  1.00 74.69  ? 176 VAL A CB  1 
ATOM   3660  C CG1 . VAL B 1 181 ? 21.066  -76.214 -8.482  1.00 72.36  ? 176 VAL A CG1 1 
ATOM   3661  C CG2 . VAL B 1 181 ? 20.209  -75.043 -10.501 1.00 72.61  ? 176 VAL A CG2 1 
ATOM   3662  N N   . HIS B 1 182 ? 18.492  -75.168 -6.265  1.00 81.35  ? 177 HIS A N   1 
ATOM   3663  C CA  . HIS B 1 182 ? 18.485  -75.507 -4.851  1.00 84.51  ? 177 HIS A CA  1 
ATOM   3664  C C   . HIS B 1 182 ? 17.151  -76.040 -4.355  1.00 85.19  ? 177 HIS A C   1 
ATOM   3665  O O   . HIS B 1 182 ? 17.100  -76.713 -3.326  1.00 85.35  ? 177 HIS A O   1 
ATOM   3666  C CB  . HIS B 1 182 ? 18.907  -74.289 -4.028  1.00 85.74  ? 177 HIS A CB  1 
ATOM   3667  C CG  . HIS B 1 182 ? 20.359  -73.952 -4.164  1.00 86.93  ? 177 HIS A CG  1 
ATOM   3668  N ND1 . HIS B 1 182 ? 20.961  -73.740 -5.385  1.00 87.58  ? 177 HIS A ND1 1 
ATOM   3669  C CD2 . HIS B 1 182 ? 21.336  -73.824 -3.235  1.00 87.04  ? 177 HIS A CD2 1 
ATOM   3670  C CE1 . HIS B 1 182 ? 22.246  -73.498 -5.203  1.00 87.76  ? 177 HIS A CE1 1 
ATOM   3671  N NE2 . HIS B 1 182 ? 22.499  -73.544 -3.907  1.00 87.38  ? 177 HIS A NE2 1 
ATOM   3672  N N   . LYS B 1 183 ? 16.081  -75.751 -5.091  1.00 88.45  ? 178 LYS A N   1 
ATOM   3673  C CA  . LYS B 1 183 ? 14.737  -76.200 -4.724  1.00 92.54  ? 178 LYS A CA  1 
ATOM   3674  C C   . LYS B 1 183 ? 14.660  -77.680 -4.353  1.00 91.91  ? 178 LYS A C   1 
ATOM   3675  O O   . LYS B 1 183 ? 14.045  -78.040 -3.347  1.00 90.45  ? 178 LYS A O   1 
ATOM   3676  C CB  . LYS B 1 183 ? 13.752  -75.926 -5.865  1.00 95.86  ? 178 LYS A CB  1 
ATOM   3677  C CG  . LYS B 1 183 ? 12.355  -76.482 -5.614  1.00 102.43 ? 178 LYS A CG  1 
ATOM   3678  C CD  . LYS B 1 183 ? 11.449  -76.322 -6.824  1.00 108.59 ? 178 LYS A CD  1 
ATOM   3679  C CE  . LYS B 1 183 ? 11.155  -74.861 -7.116  1.00 113.28 ? 178 LYS A CE  1 
ATOM   3680  N NZ  . LYS B 1 183 ? 10.256  -74.703 -8.296  1.00 116.87 ? 178 LYS A NZ  1 
ATOM   3681  N N   . HIS B 1 184 ? 15.275  -78.534 -5.167  1.00 93.16  ? 179 HIS A N   1 
ATOM   3682  C CA  . HIS B 1 184 ? 15.252  -79.971 -4.913  1.00 95.65  ? 179 HIS A CA  1 
ATOM   3683  C C   . HIS B 1 184 ? 16.611  -80.653 -4.861  1.00 94.70  ? 179 HIS A C   1 
ATOM   3684  O O   . HIS B 1 184 ? 17.522  -80.315 -5.611  1.00 92.88  ? 179 HIS A O   1 
ATOM   3685  C CB  . HIS B 1 184 ? 14.393  -80.686 -5.959  1.00 99.96  ? 179 HIS A CB  1 
ATOM   3686  C CG  . HIS B 1 184 ? 12.974  -80.904 -5.533  1.00 105.02 ? 179 HIS A CG  1 
ATOM   3687  N ND1 . HIS B 1 184 ? 12.048  -79.884 -5.469  1.00 107.51 ? 179 HIS A ND1 1 
ATOM   3688  C CD2 . HIS B 1 184 ? 12.326  -82.026 -5.140  1.00 106.94 ? 179 HIS A CD2 1 
ATOM   3689  C CE1 . HIS B 1 184 ? 10.891  -80.370 -5.058  1.00 108.83 ? 179 HIS A CE1 1 
ATOM   3690  N NE2 . HIS B 1 184 ? 11.032  -81.667 -4.851  1.00 108.67 ? 179 HIS A NE2 1 
ATOM   3691  N N   . GLY B 1 185 ? 16.718  -81.627 -3.961  1.00 94.81  ? 180 GLY A N   1 
ATOM   3692  C CA  . GLY B 1 185 ? 17.935  -82.400 -3.799  1.00 96.54  ? 180 GLY A CA  1 
ATOM   3693  C C   . GLY B 1 185 ? 19.220  -81.641 -3.540  1.00 97.59  ? 180 GLY A C   1 
ATOM   3694  O O   . GLY B 1 185 ? 19.236  -80.415 -3.431  1.00 98.51  ? 180 GLY A O   1 
ATOM   3695  N N   . ASP B 1 186 ? 20.306  -82.399 -3.430  1.00 97.89  ? 181 ASP A N   1 
ATOM   3696  C CA  . ASP B 1 186 ? 21.635  -81.851 -3.196  1.00 97.58  ? 181 ASP A CA  1 
ATOM   3697  C C   . ASP B 1 186 ? 22.343  -81.675 -4.536  1.00 93.34  ? 181 ASP A C   1 
ATOM   3698  O O   . ASP B 1 186 ? 22.840  -82.636 -5.124  1.00 94.00  ? 181 ASP A O   1 
ATOM   3699  C CB  . ASP B 1 186 ? 22.435  -82.796 -2.292  1.00 103.08 ? 181 ASP A CB  1 
ATOM   3700  C CG  . ASP B 1 186 ? 23.935  -82.599 -2.414  1.00 107.21 ? 181 ASP A CG  1 
ATOM   3701  O OD1 . ASP B 1 186 ? 24.413  -81.466 -2.185  1.00 109.11 ? 181 ASP A OD1 1 
ATOM   3702  O OD2 . ASP B 1 186 ? 24.633  -83.588 -2.738  1.00 109.89 ? 181 ASP A OD2 1 
ATOM   3703  N N   . ILE B 1 187 ? 22.379  -80.437 -5.016  1.00 87.73  ? 182 ILE A N   1 
ATOM   3704  C CA  . ILE B 1 187 ? 23.012  -80.126 -6.292  1.00 80.86  ? 182 ILE A CA  1 
ATOM   3705  C C   . ILE B 1 187 ? 23.825  -78.823 -6.216  1.00 74.46  ? 182 ILE A C   1 
ATOM   3706  O O   . ILE B 1 187 ? 23.490  -77.898 -5.465  1.00 72.79  ? 182 ILE A O   1 
ATOM   3707  C CB  . ILE B 1 187 ? 21.941  -80.030 -7.407  1.00 81.72  ? 182 ILE A CB  1 
ATOM   3708  C CG1 . ILE B 1 187 ? 22.587  -79.621 -8.729  1.00 82.39  ? 182 ILE A CG1 1 
ATOM   3709  C CG2 . ILE B 1 187 ? 20.856  -79.053 -6.996  1.00 81.42  ? 182 ILE A CG2 1 
ATOM   3710  C CD1 . ILE B 1 187 ? 21.593  -79.392 -9.837  1.00 82.82  ? 182 ILE A CD1 1 
ATOM   3711  N N   . ILE B 1 188 ? 24.890  -78.759 -7.006  1.00 67.17  ? 183 ILE A N   1 
ATOM   3712  C CA  . ILE B 1 188 ? 25.771  -77.601 -7.009  1.00 60.89  ? 183 ILE A CA  1 
ATOM   3713  C C   . ILE B 1 188 ? 25.614  -76.646 -8.183  1.00 57.87  ? 183 ILE A C   1 
ATOM   3714  O O   . ILE B 1 188 ? 25.551  -77.060 -9.340  1.00 57.21  ? 183 ILE A O   1 
ATOM   3715  C CB  . ILE B 1 188 ? 27.242  -78.051 -6.955  1.00 58.17  ? 183 ILE A CB  1 
ATOM   3716  C CG1 . ILE B 1 188 ? 27.463  -78.908 -5.712  1.00 56.00  ? 183 ILE A CG1 1 
ATOM   3717  C CG2 . ILE B 1 188 ? 28.159  -76.845 -6.929  1.00 56.57  ? 183 ILE A CG2 1 
ATOM   3718  C CD1 . ILE B 1 188 ? 28.830  -79.524 -5.626  1.00 55.87  ? 183 ILE A CD1 1 
ATOM   3719  N N   . LEU B 1 189 ? 25.548  -75.357 -7.872  1.00 55.12  ? 184 LEU A N   1 
ATOM   3720  C CA  . LEU B 1 189 ? 25.442  -74.338 -8.905  1.00 52.82  ? 184 LEU A CA  1 
ATOM   3721  C C   . LEU B 1 189 ? 26.796  -73.648 -9.005  1.00 50.87  ? 184 LEU A C   1 
ATOM   3722  O O   . LEU B 1 189 ? 27.325  -73.136 -8.015  1.00 50.10  ? 184 LEU A O   1 
ATOM   3723  C CB  . LEU B 1 189 ? 24.371  -73.298 -8.568  1.00 50.76  ? 184 LEU A CB  1 
ATOM   3724  C CG  . LEU B 1 189 ? 24.291  -72.213 -9.650  1.00 49.79  ? 184 LEU A CG  1 
ATOM   3725  C CD1 . LEU B 1 189 ? 23.715  -72.809 -10.924 1.00 48.52  ? 184 LEU A CD1 1 
ATOM   3726  C CD2 . LEU B 1 189 ? 23.439  -71.054 -9.178  1.00 50.49  ? 184 LEU A CD2 1 
ATOM   3727  N N   . VAL B 1 190 ? 27.359  -73.652 -10.206 1.00 49.27  ? 185 VAL A N   1 
ATOM   3728  C CA  . VAL B 1 190 ? 28.651  -73.028 -10.444 1.00 47.44  ? 185 VAL A CA  1 
ATOM   3729  C C   . VAL B 1 190 ? 28.525  -71.964 -11.525 1.00 45.76  ? 185 VAL A C   1 
ATOM   3730  O O   . VAL B 1 190 ? 27.990  -72.214 -12.616 1.00 44.89  ? 185 VAL A O   1 
ATOM   3731  C CB  . VAL B 1 190 ? 29.714  -74.070 -10.891 1.00 47.05  ? 185 VAL A CB  1 
ATOM   3732  C CG1 . VAL B 1 190 ? 31.042  -73.382 -11.189 1.00 48.41  ? 185 VAL A CG1 1 
ATOM   3733  C CG2 . VAL B 1 190 ? 29.915  -75.101 -9.806  1.00 46.92  ? 185 VAL A CG2 1 
ATOM   3734  N N   . VAL B 1 191 ? 29.009  -70.769 -11.209 1.00 43.70  ? 186 VAL A N   1 
ATOM   3735  C CA  . VAL B 1 191 ? 28.978  -69.681 -12.164 1.00 44.15  ? 186 VAL A CA  1 
ATOM   3736  C C   . VAL B 1 191 ? 30.415  -69.357 -12.522 1.00 43.05  ? 186 VAL A C   1 
ATOM   3737  O O   . VAL B 1 191 ? 31.274  -69.279 -11.640 1.00 43.25  ? 186 VAL A O   1 
ATOM   3738  C CB  . VAL B 1 191 ? 28.316  -68.421 -11.579 1.00 44.39  ? 186 VAL A CB  1 
ATOM   3739  C CG1 . VAL B 1 191 ? 28.356  -67.290 -12.599 1.00 43.45  ? 186 VAL A CG1 1 
ATOM   3740  C CG2 . VAL B 1 191 ? 26.884  -68.728 -11.187 1.00 45.52  ? 186 VAL A CG2 1 
ATOM   3741  N N   . ASP B 1 192 ? 30.668  -69.201 -13.819 1.00 41.40  ? 187 ASP A N   1 
ATOM   3742  C CA  . ASP B 1 192 ? 31.993  -68.866 -14.321 1.00 40.48  ? 187 ASP A CA  1 
ATOM   3743  C C   . ASP B 1 192 ? 32.024  -67.350 -14.478 1.00 40.47  ? 187 ASP A C   1 
ATOM   3744  O O   . ASP B 1 192 ? 31.689  -66.811 -15.532 1.00 40.95  ? 187 ASP A O   1 
ATOM   3745  C CB  . ASP B 1 192 ? 32.239  -69.533 -15.671 1.00 40.21  ? 187 ASP A CB  1 
ATOM   3746  C CG  . ASP B 1 192 ? 33.589  -69.187 -16.243 1.00 40.62  ? 187 ASP A CG  1 
ATOM   3747  O OD1 . ASP B 1 192 ? 34.270  -68.307 -15.672 1.00 40.91  ? 187 ASP A OD1 1 
ATOM   3748  O OD2 . ASP B 1 192 ? 33.972  -69.786 -17.264 1.00 41.72  ? 187 ASP A OD2 1 
ATOM   3749  N N   . ASN B 1 193 ? 32.444  -66.677 -13.417 1.00 39.44  ? 188 ASN A N   1 
ATOM   3750  C CA  . ASN B 1 193 ? 32.487  -65.225 -13.373 1.00 38.80  ? 188 ASN A CA  1 
ATOM   3751  C C   . ASN B 1 193 ? 33.554  -64.604 -14.257 1.00 38.74  ? 188 ASN A C   1 
ATOM   3752  O O   . ASN B 1 193 ? 33.654  -63.383 -14.346 1.00 39.53  ? 188 ASN A O   1 
ATOM   3753  C CB  . ASN B 1 193 ? 32.690  -64.782 -11.921 1.00 39.01  ? 188 ASN A CB  1 
ATOM   3754  C CG  . ASN B 1 193 ? 31.903  -63.538 -11.573 1.00 37.06  ? 188 ASN A CG  1 
ATOM   3755  O OD1 . ASN B 1 193 ? 30.798  -63.334 -12.063 1.00 37.43  ? 188 ASN A OD1 1 
ATOM   3756  N ND2 . ASN B 1 193 ? 32.461  -62.712 -10.704 1.00 38.04  ? 188 ASN A ND2 1 
ATOM   3757  N N   . THR B 1 194 ? 34.338  -65.436 -14.925 1.00 37.84  ? 189 THR A N   1 
ATOM   3758  C CA  . THR B 1 194 ? 35.405  -64.934 -15.780 1.00 38.55  ? 189 THR A CA  1 
ATOM   3759  C C   . THR B 1 194 ? 35.053  -63.735 -16.676 1.00 41.07  ? 189 THR A C   1 
ATOM   3760  O O   . THR B 1 194 ? 35.783  -62.740 -16.696 1.00 42.68  ? 189 THR A O   1 
ATOM   3761  C CB  . THR B 1 194 ? 35.964  -66.057 -16.650 1.00 37.16  ? 189 THR A CB  1 
ATOM   3762  O OG1 . THR B 1 194 ? 36.458  -67.097 -15.805 1.00 37.97  ? 189 THR A OG1 1 
ATOM   3763  C CG2 . THR B 1 194 ? 37.097  -65.557 -17.501 1.00 36.63  ? 189 THR A CG2 1 
ATOM   3764  N N   . PHE B 1 195 ? 33.943  -63.815 -17.401 1.00 42.82  ? 190 PHE A N   1 
ATOM   3765  C CA  . PHE B 1 195 ? 33.543  -62.736 -18.306 1.00 44.73  ? 190 PHE A CA  1 
ATOM   3766  C C   . PHE B 1 195 ? 33.115  -61.429 -17.649 1.00 41.30  ? 190 PHE A C   1 
ATOM   3767  O O   . PHE B 1 195 ? 32.897  -60.439 -18.341 1.00 40.97  ? 190 PHE A O   1 
ATOM   3768  C CB  . PHE B 1 195 ? 32.419  -63.219 -19.226 1.00 51.76  ? 190 PHE A CB  1 
ATOM   3769  C CG  . PHE B 1 195 ? 32.805  -64.389 -20.087 1.00 59.18  ? 190 PHE A CG  1 
ATOM   3770  C CD1 . PHE B 1 195 ? 31.997  -65.519 -20.151 1.00 62.76  ? 190 PHE A CD1 1 
ATOM   3771  C CD2 . PHE B 1 195 ? 33.987  -64.366 -20.822 1.00 61.76  ? 190 PHE A CD2 1 
ATOM   3772  C CE1 . PHE B 1 195 ? 32.362  -66.611 -20.933 1.00 66.30  ? 190 PHE A CE1 1 
ATOM   3773  C CE2 . PHE B 1 195 ? 34.360  -65.450 -21.605 1.00 64.35  ? 190 PHE A CE2 1 
ATOM   3774  C CZ  . PHE B 1 195 ? 33.549  -66.575 -21.661 1.00 66.90  ? 190 PHE A CZ  1 
ATOM   3775  N N   . MET B 1 196 ? 33.001  -61.424 -16.326 1.00 37.96  ? 191 MET A N   1 
ATOM   3776  C CA  . MET B 1 196 ? 32.581  -60.229 -15.594 1.00 36.80  ? 191 MET A CA  1 
ATOM   3777  C C   . MET B 1 196 ? 33.615  -59.762 -14.579 1.00 35.24  ? 191 MET A C   1 
ATOM   3778  O O   . MET B 1 196 ? 33.806  -58.561 -14.391 1.00 32.97  ? 191 MET A O   1 
ATOM   3779  C CB  . MET B 1 196 ? 31.261  -60.498 -14.853 1.00 36.47  ? 191 MET A CB  1 
ATOM   3780  C CG  . MET B 1 196 ? 30.020  -60.600 -15.734 1.00 36.94  ? 191 MET A CG  1 
ATOM   3781  S SD  . MET B 1 196 ? 29.564  -59.016 -16.484 1.00 36.32  ? 191 MET A SD  1 
ATOM   3782  C CE  . MET B 1 196 ? 29.482  -57.984 -15.058 1.00 35.58  ? 191 MET A CE  1 
ATOM   3783  N N   . SER B 1 197 ? 34.253  -60.736 -13.926 1.00 34.40  ? 192 SER A N   1 
ATOM   3784  C CA  . SER B 1 197 ? 35.267  -60.531 -12.886 1.00 33.34  ? 192 SER A CA  1 
ATOM   3785  C C   . SER B 1 197 ? 34.572  -60.197 -11.573 1.00 33.02  ? 192 SER A C   1 
ATOM   3786  O O   . SER B 1 197 ? 33.525  -59.567 -11.566 1.00 34.09  ? 192 SER A O   1 
ATOM   3787  C CB  . SER B 1 197 ? 36.238  -59.404 -13.255 1.00 31.69  ? 192 SER A CB  1 
ATOM   3788  O OG  . SER B 1 197 ? 35.737  -58.151 -12.850 1.00 29.22  ? 192 SER A OG  1 
ATOM   3789  N N   . PRO B 1 198 ? 35.147  -60.617 -10.440 1.00 33.33  ? 193 PRO A N   1 
ATOM   3790  C CA  . PRO B 1 198 ? 34.527  -60.332 -9.140  1.00 33.27  ? 193 PRO A CA  1 
ATOM   3791  C C   . PRO B 1 198 ? 34.188  -58.875 -8.843  1.00 33.86  ? 193 PRO A C   1 
ATOM   3792  O O   . PRO B 1 198 ? 33.486  -58.591 -7.877  1.00 34.00  ? 193 PRO A O   1 
ATOM   3793  C CB  . PRO B 1 198 ? 35.534  -60.909 -8.136  1.00 33.64  ? 193 PRO A CB  1 
ATOM   3794  C CG  . PRO B 1 198 ? 36.831  -60.910 -8.901  1.00 35.06  ? 193 PRO A CG  1 
ATOM   3795  C CD  . PRO B 1 198 ? 36.409  -61.355 -10.270 1.00 32.83  ? 193 PRO A CD  1 
ATOM   3796  N N   . TYR B 1 199 ? 34.672  -57.954 -9.667  1.00 34.38  ? 194 TYR A N   1 
ATOM   3797  C CA  . TYR B 1 199 ? 34.409  -56.540 -9.434  1.00 35.09  ? 194 TYR A CA  1 
ATOM   3798  C C   . TYR B 1 199 ? 33.020  -56.111 -9.902  1.00 36.48  ? 194 TYR A C   1 
ATOM   3799  O O   . TYR B 1 199 ? 32.392  -55.229 -9.301  1.00 38.06  ? 194 TYR A O   1 
ATOM   3800  C CB  . TYR B 1 199 ? 35.476  -55.677 -10.123 1.00 35.35  ? 194 TYR A CB  1 
ATOM   3801  C CG  . TYR B 1 199 ? 35.292  -54.183 -9.911  1.00 34.51  ? 194 TYR A CG  1 
ATOM   3802  C CD1 . TYR B 1 199 ? 35.586  -53.587 -8.684  1.00 32.54  ? 194 TYR A CD1 1 
ATOM   3803  C CD2 . TYR B 1 199 ? 34.794  -53.369 -10.934 1.00 33.07  ? 194 TYR A CD2 1 
ATOM   3804  C CE1 . TYR B 1 199 ? 35.388  -52.220 -8.480  1.00 32.69  ? 194 TYR A CE1 1 
ATOM   3805  C CE2 . TYR B 1 199 ? 34.593  -52.000 -10.737 1.00 31.89  ? 194 TYR A CE2 1 
ATOM   3806  C CZ  . TYR B 1 199 ? 34.890  -51.432 -9.512  1.00 32.07  ? 194 TYR A CZ  1 
ATOM   3807  O OH  . TYR B 1 199 ? 34.687  -50.079 -9.325  1.00 31.55  ? 194 TYR A OH  1 
ATOM   3808  N N   . PHE B 1 200 ? 32.543  -56.731 -10.973 1.00 36.22  ? 195 PHE A N   1 
ATOM   3809  C CA  . PHE B 1 200 ? 31.235  -56.398 -11.516 1.00 36.41  ? 195 PHE A CA  1 
ATOM   3810  C C   . PHE B 1 200 ? 30.168  -57.434 -11.181 1.00 36.30  ? 195 PHE A C   1 
ATOM   3811  O O   . PHE B 1 200 ? 28.980  -57.141 -11.252 1.00 37.83  ? 195 PHE A O   1 
ATOM   3812  C CB  . PHE B 1 200 ? 31.320  -56.242 -13.037 1.00 35.26  ? 195 PHE A CB  1 
ATOM   3813  C CG  . PHE B 1 200 ? 31.999  -54.984 -13.483 1.00 33.89  ? 195 PHE A CG  1 
ATOM   3814  C CD1 . PHE B 1 200 ? 32.858  -54.998 -14.578 1.00 33.12  ? 195 PHE A CD1 1 
ATOM   3815  C CD2 . PHE B 1 200 ? 31.773  -53.782 -12.826 1.00 33.02  ? 195 PHE A CD2 1 
ATOM   3816  C CE1 . PHE B 1 200 ? 33.485  -53.833 -15.013 1.00 31.71  ? 195 PHE A CE1 1 
ATOM   3817  C CE2 . PHE B 1 200 ? 32.397  -52.604 -13.257 1.00 32.01  ? 195 PHE A CE2 1 
ATOM   3818  C CZ  . PHE B 1 200 ? 33.255  -52.633 -14.353 1.00 31.30  ? 195 PHE A CZ  1 
ATOM   3819  N N   . GLN B 1 201 ? 30.575  -58.637 -10.807 1.00 35.07  ? 196 GLN A N   1 
ATOM   3820  C CA  . GLN B 1 201 ? 29.598  -59.671 -10.513 1.00 35.32  ? 196 GLN A CA  1 
ATOM   3821  C C   . GLN B 1 201 ? 30.060  -60.588 -9.386  1.00 36.20  ? 196 GLN A C   1 
ATOM   3822  O O   . GLN B 1 201 ? 31.202  -61.037 -9.370  1.00 34.59  ? 196 GLN A O   1 
ATOM   3823  C CB  . GLN B 1 201 ? 29.321  -60.457 -11.794 1.00 34.61  ? 196 GLN A CB  1 
ATOM   3824  C CG  . GLN B 1 201 ? 28.218  -61.469 -11.710 1.00 35.93  ? 196 GLN A CG  1 
ATOM   3825  C CD  . GLN B 1 201 ? 27.899  -62.051 -13.070 1.00 39.60  ? 196 GLN A CD  1 
ATOM   3826  O OE1 . GLN B 1 201 ? 27.443  -61.343 -13.970 1.00 39.80  ? 196 GLN A OE1 1 
ATOM   3827  N NE2 . GLN B 1 201 ? 28.146  -63.343 -13.233 1.00 40.18  ? 196 GLN A NE2 1 
ATOM   3828  N N   . ARG B 1 202 ? 29.158  -60.859 -8.445  1.00 37.47  ? 197 ARG A N   1 
ATOM   3829  C CA  . ARG B 1 202 ? 29.469  -61.690 -7.287  1.00 37.91  ? 197 ARG A CA  1 
ATOM   3830  C C   . ARG B 1 202 ? 28.482  -62.836 -7.136  1.00 40.58  ? 197 ARG A C   1 
ATOM   3831  O O   . ARG B 1 202 ? 27.566  -62.776 -6.318  1.00 42.12  ? 197 ARG A O   1 
ATOM   3832  C CB  . ARG B 1 202 ? 29.466  -60.816 -6.027  1.00 37.22  ? 197 ARG A CB  1 
ATOM   3833  C CG  . ARG B 1 202 ? 29.753  -61.531 -4.725  1.00 35.33  ? 197 ARG A CG  1 
ATOM   3834  C CD  . ARG B 1 202 ? 29.991  -60.518 -3.609  1.00 33.09  ? 197 ARG A CD  1 
ATOM   3835  N NE  . ARG B 1 202 ? 31.299  -59.890 -3.730  1.00 34.73  ? 197 ARG A NE  1 
ATOM   3836  C CZ  . ARG B 1 202 ? 31.733  -58.886 -2.969  1.00 35.67  ? 197 ARG A CZ  1 
ATOM   3837  N NH1 . ARG B 1 202 ? 30.954  -58.381 -2.023  1.00 33.42  ? 197 ARG A NH1 1 
ATOM   3838  N NH2 . ARG B 1 202 ? 32.957  -58.396 -3.146  1.00 33.23  ? 197 ARG A NH2 1 
ATOM   3839  N N   . PRO B 1 203 ? 28.664  -63.906 -7.926  1.00 41.67  ? 198 PRO A N   1 
ATOM   3840  C CA  . PRO B 1 203 ? 27.811  -65.096 -7.916  1.00 42.10  ? 198 PRO A CA  1 
ATOM   3841  C C   . PRO B 1 203 ? 27.417  -65.624 -6.535  1.00 42.86  ? 198 PRO A C   1 
ATOM   3842  O O   . PRO B 1 203 ? 26.236  -65.792 -6.250  1.00 44.19  ? 198 PRO A O   1 
ATOM   3843  C CB  . PRO B 1 203 ? 28.631  -66.098 -8.718  1.00 41.78  ? 198 PRO A CB  1 
ATOM   3844  C CG  . PRO B 1 203 ? 29.247  -65.220 -9.754  1.00 41.76  ? 198 PRO A CG  1 
ATOM   3845  C CD  . PRO B 1 203 ? 29.738  -64.054 -8.924  1.00 41.75  ? 198 PRO A CD  1 
ATOM   3846  N N   . LEU B 1 204 ? 28.400  -65.890 -5.684  1.00 42.53  ? 199 LEU A N   1 
ATOM   3847  C CA  . LEU B 1 204 ? 28.119  -66.405 -4.351  1.00 42.56  ? 199 LEU A CA  1 
ATOM   3848  C C   . LEU B 1 204 ? 27.006  -65.641 -3.635  1.00 43.82  ? 199 LEU A C   1 
ATOM   3849  O O   . LEU B 1 204 ? 26.204  -66.234 -2.912  1.00 43.88  ? 199 LEU A O   1 
ATOM   3850  C CB  . LEU B 1 204 ? 29.388  -66.376 -3.498  1.00 42.64  ? 199 LEU A CB  1 
ATOM   3851  C CG  . LEU B 1 204 ? 30.479  -67.385 -3.841  1.00 41.69  ? 199 LEU A CG  1 
ATOM   3852  C CD1 . LEU B 1 204 ? 31.685  -67.089 -3.001  1.00 42.18  ? 199 LEU A CD1 1 
ATOM   3853  C CD2 . LEU B 1 204 ? 29.997  -68.804 -3.584  1.00 42.04  ? 199 LEU A CD2 1 
ATOM   3854  N N   . ALA B 1 205 ? 26.960  -64.328 -3.833  1.00 44.93  ? 200 ALA A N   1 
ATOM   3855  C CA  . ALA B 1 205 ? 25.941  -63.503 -3.194  1.00 46.20  ? 200 ALA A CA  1 
ATOM   3856  C C   . ALA B 1 205 ? 24.574  -63.711 -3.845  1.00 47.65  ? 200 ALA A C   1 
ATOM   3857  O O   . ALA B 1 205 ? 23.538  -63.507 -3.208  1.00 49.49  ? 200 ALA A O   1 
ATOM   3858  C CB  . ALA B 1 205 ? 26.338  -62.035 -3.265  1.00 44.43  ? 200 ALA A CB  1 
ATOM   3859  N N   . LEU B 1 206 ? 24.577  -64.122 -5.112  1.00 48.25  ? 201 LEU A N   1 
ATOM   3860  C CA  . LEU B 1 206 ? 23.341  -64.355 -5.854  1.00 47.43  ? 201 LEU A CA  1 
ATOM   3861  C C   . LEU B 1 206 ? 22.863  -65.792 -5.750  1.00 47.44  ? 201 LEU A C   1 
ATOM   3862  O O   . LEU B 1 206 ? 22.109  -66.260 -6.599  1.00 48.85  ? 201 LEU A O   1 
ATOM   3863  C CB  . LEU B 1 206 ? 23.522  -63.998 -7.329  1.00 46.81  ? 201 LEU A CB  1 
ATOM   3864  C CG  . LEU B 1 206 ? 23.869  -62.544 -7.647  1.00 47.39  ? 201 LEU A CG  1 
ATOM   3865  C CD1 . LEU B 1 206 ? 24.123  -62.417 -9.134  1.00 47.77  ? 201 LEU A CD1 1 
ATOM   3866  C CD2 . LEU B 1 206 ? 22.743  -61.621 -7.205  1.00 46.55  ? 201 LEU A CD2 1 
ATOM   3867  N N   . GLY B 1 207 ? 23.315  -66.502 -4.723  1.00 47.81  ? 202 GLY A N   1 
ATOM   3868  C CA  . GLY B 1 207 ? 22.873  -67.870 -4.544  1.00 47.60  ? 202 GLY A CA  1 
ATOM   3869  C C   . GLY B 1 207 ? 23.773  -68.960 -5.082  1.00 47.80  ? 202 GLY A C   1 
ATOM   3870  O O   . GLY B 1 207 ? 23.555  -70.123 -4.763  1.00 48.81  ? 202 GLY A O   1 
ATOM   3871  N N   . ALA B 1 208 ? 24.771  -68.607 -5.890  1.00 48.00  ? 203 ALA A N   1 
ATOM   3872  C CA  . ALA B 1 208 ? 25.686  -69.604 -6.450  1.00 46.86  ? 203 ALA A CA  1 
ATOM   3873  C C   . ALA B 1 208 ? 26.416  -70.322 -5.326  1.00 46.66  ? 203 ALA A C   1 
ATOM   3874  O O   . ALA B 1 208 ? 26.570  -69.770 -4.239  1.00 48.64  ? 203 ALA A O   1 
ATOM   3875  C CB  . ALA B 1 208 ? 26.693  -68.933 -7.361  1.00 47.79  ? 203 ALA A CB  1 
ATOM   3876  N N   . ASP B 1 209 ? 26.863  -71.548 -5.585  1.00 45.57  ? 204 ASP A N   1 
ATOM   3877  C CA  . ASP B 1 209 ? 27.585  -72.328 -4.581  1.00 44.54  ? 204 ASP A CA  1 
ATOM   3878  C C   . ASP B 1 209 ? 29.085  -72.229 -4.806  1.00 43.29  ? 204 ASP A C   1 
ATOM   3879  O O   . ASP B 1 209 ? 29.884  -72.448 -3.895  1.00 42.04  ? 204 ASP A O   1 
ATOM   3880  C CB  . ASP B 1 209 ? 27.172  -73.793 -4.658  1.00 47.23  ? 204 ASP A CB  1 
ATOM   3881  C CG  . ASP B 1 209 ? 25.709  -73.990 -4.379  1.00 49.75  ? 204 ASP A CG  1 
ATOM   3882  O OD1 . ASP B 1 209 ? 25.265  -73.576 -3.288  1.00 51.42  ? 204 ASP A OD1 1 
ATOM   3883  O OD2 . ASP B 1 209 ? 25.007  -74.554 -5.249  1.00 52.31  ? 204 ASP A OD2 1 
ATOM   3884  N N   . ILE B 1 210 ? 29.451  -71.897 -6.039  1.00 43.02  ? 205 ILE A N   1 
ATOM   3885  C CA  . ILE B 1 210 ? 30.842  -71.775 -6.434  1.00 42.39  ? 205 ILE A CA  1 
ATOM   3886  C C   . ILE B 1 210 ? 31.004  -70.687 -7.490  1.00 41.98  ? 205 ILE A C   1 
ATOM   3887  O O   . ILE B 1 210 ? 30.363  -70.730 -8.546  1.00 41.85  ? 205 ILE A O   1 
ATOM   3888  C CB  . ILE B 1 210 ? 31.359  -73.114 -7.022  1.00 40.71  ? 205 ILE A CB  1 
ATOM   3889  C CG1 . ILE B 1 210 ? 31.484  -74.163 -5.918  1.00 40.40  ? 205 ILE A CG1 1 
ATOM   3890  C CG2 . ILE B 1 210 ? 32.690  -72.910 -7.713  1.00 41.21  ? 205 ILE A CG2 1 
ATOM   3891  C CD1 . ILE B 1 210 ? 31.909  -75.534 -6.421  1.00 39.96  ? 205 ILE A CD1 1 
ATOM   3892  N N   . SER B 1 211 ? 31.847  -69.703 -7.192  1.00 42.67  ? 206 SER A N   1 
ATOM   3893  C CA  . SER B 1 211 ? 32.132  -68.632 -8.146  1.00 43.56  ? 206 SER A CA  1 
ATOM   3894  C C   . SER B 1 211 ? 33.541  -68.900 -8.640  1.00 43.49  ? 206 SER A C   1 
ATOM   3895  O O   . SER B 1 211 ? 34.508  -68.798 -7.884  1.00 41.72  ? 206 SER A O   1 
ATOM   3896  C CB  . SER B 1 211 ? 32.084  -67.257 -7.489  1.00 42.81  ? 206 SER A CB  1 
ATOM   3897  O OG  . SER B 1 211 ? 32.173  -66.250 -8.480  1.00 41.87  ? 206 SER A OG  1 
ATOM   3898  N N   . MET B 1 212 ? 33.649  -69.256 -9.911  1.00 44.17  ? 207 MET A N   1 
ATOM   3899  C CA  . MET B 1 212 ? 34.938  -69.573 -10.492 1.00 45.30  ? 207 MET A CA  1 
ATOM   3900  C C   . MET B 1 212 ? 35.441  -68.425 -11.347 1.00 45.95  ? 207 MET A C   1 
ATOM   3901  O O   . MET B 1 212 ? 34.711  -67.890 -12.182 1.00 46.46  ? 207 MET A O   1 
ATOM   3902  C CB  . MET B 1 212 ? 34.807  -70.852 -11.323 1.00 45.71  ? 207 MET A CB  1 
ATOM   3903  C CG  . MET B 1 212 ? 36.115  -71.487 -11.734 1.00 46.83  ? 207 MET A CG  1 
ATOM   3904  S SD  . MET B 1 212 ? 36.835  -70.739 -13.200 1.00 49.94  ? 207 MET A SD  1 
ATOM   3905  C CE  . MET B 1 212 ? 36.424  -71.928 -14.461 1.00 48.94  ? 207 MET A CE  1 
ATOM   3906  N N   . TYR B 1 213 ? 36.682  -68.021 -11.109 1.00 47.68  ? 208 TYR A N   1 
ATOM   3907  C CA  . TYR B 1 213 ? 37.289  -66.953 -11.890 1.00 50.05  ? 208 TYR A CA  1 
ATOM   3908  C C   . TYR B 1 213 ? 38.513  -67.510 -12.594 1.00 48.09  ? 208 TYR A C   1 
ATOM   3909  O O   . TYR B 1 213 ? 39.467  -67.948 -11.952 1.00 49.15  ? 208 TYR A O   1 
ATOM   3910  C CB  . TYR B 1 213 ? 37.702  -65.774 -11.012 1.00 54.67  ? 208 TYR A CB  1 
ATOM   3911  C CG  . TYR B 1 213 ? 38.279  -64.636 -11.824 1.00 60.59  ? 208 TYR A CG  1 
ATOM   3912  C CD1 . TYR B 1 213 ? 37.702  -64.271 -13.039 1.00 63.60  ? 208 TYR A CD1 1 
ATOM   3913  C CD2 . TYR B 1 213 ? 39.394  -63.919 -11.383 1.00 62.95  ? 208 TYR A CD2 1 
ATOM   3914  C CE1 . TYR B 1 213 ? 38.214  -63.226 -13.798 1.00 65.92  ? 208 TYR A CE1 1 
ATOM   3915  C CE2 . TYR B 1 213 ? 39.916  -62.865 -12.137 1.00 64.81  ? 208 TYR A CE2 1 
ATOM   3916  C CZ  . TYR B 1 213 ? 39.318  -62.528 -13.344 1.00 65.81  ? 208 TYR A CZ  1 
ATOM   3917  O OH  . TYR B 1 213 ? 39.813  -61.499 -14.108 1.00 67.09  ? 208 TYR A OH  1 
ATOM   3918  N N   . SER B 1 214 ? 38.481  -67.495 -13.919 1.00 43.11  ? 209 SER A N   1 
ATOM   3919  C CA  . SER B 1 214 ? 39.580  -68.025 -14.707 1.00 42.68  ? 209 SER A CA  1 
ATOM   3920  C C   . SER B 1 214 ? 40.320  -66.945 -15.477 1.00 45.12  ? 209 SER A C   1 
ATOM   3921  O O   . SER B 1 214 ? 39.841  -66.482 -16.514 1.00 41.67  ? 209 SER A O   1 
ATOM   3922  C CB  . SER B 1 214 ? 39.044  -69.078 -15.675 1.00 43.05  ? 209 SER A CB  1 
ATOM   3923  O OG  . SER B 1 214 ? 39.919  -69.230 -16.777 1.00 47.20  ? 209 SER A OG  1 
ATOM   3924  N N   . ALA B 1 215 ? 41.496  -66.560 -14.990 1.00 38.48  ? 210 ALA A N   1 
ATOM   3925  C CA  . ALA B 1 215 ? 42.271  -65.518 -15.658 1.00 37.42  ? 210 ALA A CA  1 
ATOM   3926  C C   . ALA B 1 215 ? 43.386  -66.065 -16.544 1.00 35.00  ? 210 ALA A C   1 
ATOM   3927  O O   . ALA B 1 215 ? 44.221  -66.850 -16.115 1.00 36.10  ? 210 ALA A O   1 
ATOM   3928  C CB  . ALA B 1 215 ? 42.850  -64.567 -14.639 1.00 34.33  ? 210 ALA A CB  1 
ATOM   3929  N N   . THR B 1 216 ? 43.401  -65.580 -17.776 1.00 41.82  ? 211 THR A N   1 
ATOM   3930  C CA  . THR B 1 216 ? 44.367  -65.967 -18.794 1.00 42.95  ? 211 THR A CA  1 
ATOM   3931  C C   . THR B 1 216 ? 45.586  -65.047 -18.832 1.00 41.16  ? 211 THR A C   1 
ATOM   3932  O O   . THR B 1 216 ? 45.662  -64.066 -18.098 1.00 44.10  ? 211 THR A O   1 
ATOM   3933  C CB  . THR B 1 216 ? 43.702  -65.940 -20.185 1.00 44.13  ? 211 THR A CB  1 
ATOM   3934  O OG1 . THR B 1 216 ? 43.181  -64.623 -20.431 1.00 43.35  ? 211 THR A OG1 1 
ATOM   3935  C CG2 . THR B 1 216 ? 42.557  -66.960 -20.256 1.00 44.44  ? 211 THR A CG2 1 
ATOM   3936  N N   . LYS B 1 217 ? 46.535  -65.378 -19.703 1.00 43.94  ? 212 LYS A N   1 
ATOM   3937  C CA  . LYS B 1 217 ? 47.759  -64.599 -19.873 1.00 45.54  ? 212 LYS A CA  1 
ATOM   3938  C C   . LYS B 1 217 ? 47.443  -63.278 -20.571 1.00 48.23  ? 212 LYS A C   1 
ATOM   3939  O O   . LYS B 1 217 ? 48.252  -62.786 -21.353 1.00 48.27  ? 212 LYS A O   1 
ATOM   3940  C CB  . LYS B 1 217 ? 48.749  -65.369 -20.745 1.00 42.09  ? 212 LYS A CB  1 
ATOM   3941  C CG  . LYS B 1 217 ? 48.212  -65.592 -22.155 1.00 39.64  ? 212 LYS A CG  1 
ATOM   3942  C CD  . LYS B 1 217 ? 49.151  -66.368 -23.041 1.00 37.79  ? 212 LYS A CD  1 
ATOM   3943  C CE  . LYS B 1 217 ? 48.497  -66.611 -24.396 1.00 38.13  ? 212 LYS A CE  1 
ATOM   3944  N NZ  . LYS B 1 217 ? 49.382  -67.330 -25.360 1.00 37.21  ? 212 LYS A NZ  1 
ATOM   3945  N N   . TYR B 1 218 ? 46.285  -62.685 -20.293 1.00 51.79  ? 213 TYR A N   1 
ATOM   3946  C CA  . TYR B 1 218 ? 45.950  -61.449 -20.982 1.00 53.20  ? 213 TYR A CA  1 
ATOM   3947  C C   . TYR B 1 218 ? 45.547  -60.169 -20.263 1.00 54.13  ? 213 TYR A C   1 
ATOM   3948  O O   . TYR B 1 218 ? 45.756  -59.113 -20.856 1.00 54.04  ? 213 TYR A O   1 
ATOM   3949  C CB  . TYR B 1 218 ? 44.872  -61.711 -22.043 1.00 56.85  ? 213 TYR A CB  1 
ATOM   3950  C CG  . TYR B 1 218 ? 45.323  -62.496 -23.254 1.00 58.87  ? 213 TYR A CG  1 
ATOM   3951  C CD1 . TYR B 1 218 ? 45.027  -63.850 -23.380 1.00 60.20  ? 213 TYR A CD1 1 
ATOM   3952  C CD2 . TYR B 1 218 ? 46.036  -61.880 -24.282 1.00 60.59  ? 213 TYR A CD2 1 
ATOM   3953  C CE1 . TYR B 1 218 ? 45.428  -64.578 -24.505 1.00 62.30  ? 213 TYR A CE1 1 
ATOM   3954  C CE2 . TYR B 1 218 ? 46.447  -62.597 -25.412 1.00 62.11  ? 213 TYR A CE2 1 
ATOM   3955  C CZ  . TYR B 1 218 ? 46.140  -63.947 -25.518 1.00 62.92  ? 213 TYR A CZ  1 
ATOM   3956  O OH  . TYR B 1 218 ? 46.556  -64.672 -26.623 1.00 62.48  ? 213 TYR A OH  1 
ATOM   3957  N N   . MET B 1 219 ? 45.008  -60.193 -19.032 1.00 52.89  ? 214 MET A N   1 
ATOM   3958  C CA  . MET B 1 219 ? 44.562  -58.894 -18.472 1.00 52.37  ? 214 MET A CA  1 
ATOM   3959  C C   . MET B 1 219 ? 45.480  -57.855 -17.845 1.00 53.63  ? 214 MET A C   1 
ATOM   3960  O O   . MET B 1 219 ? 45.569  -56.745 -18.378 1.00 54.93  ? 214 MET A O   1 
ATOM   3961  C CB  . MET B 1 219 ? 43.351  -59.035 -17.532 1.00 47.70  ? 214 MET A CB  1 
ATOM   3962  C CG  . MET B 1 219 ? 42.761  -57.636 -17.085 1.00 37.04  ? 214 MET A CG  1 
ATOM   3963  S SD  . MET B 1 219 ? 42.464  -56.362 -18.400 1.00 24.24  ? 214 MET A SD  1 
ATOM   3964  C CE  . MET B 1 219 ? 43.258  -54.959 -17.782 1.00 23.25  ? 214 MET A CE  1 
ATOM   3965  N N   . ASN B 1 220 ? 46.115  -58.143 -16.716 1.00 53.19  ? 215 ASN A N   1 
ATOM   3966  C CA  . ASN B 1 220 ? 46.969  -57.117 -16.137 1.00 53.61  ? 215 ASN A CA  1 
ATOM   3967  C C   . ASN B 1 220 ? 48.054  -56.884 -17.178 1.00 55.54  ? 215 ASN A C   1 
ATOM   3968  O O   . ASN B 1 220 ? 49.206  -57.275 -16.998 1.00 57.04  ? 215 ASN A O   1 
ATOM   3969  C CB  . ASN B 1 220 ? 47.553  -57.587 -14.809 1.00 51.76  ? 215 ASN A CB  1 
ATOM   3970  C CG  . ASN B 1 220 ? 48.291  -56.490 -14.092 1.00 52.13  ? 215 ASN A CG  1 
ATOM   3971  O OD1 . ASN B 1 220 ? 47.913  -55.323 -14.175 1.00 52.89  ? 215 ASN A OD1 1 
ATOM   3972  N ND2 . ASN B 1 220 ? 49.348  -56.852 -13.373 1.00 53.50  ? 215 ASN A ND2 1 
ATOM   3973  N N   . GLY B 1 221 ? 47.663  -56.224 -18.269 1.00 56.08  ? 216 GLY A N   1 
ATOM   3974  C CA  . GLY B 1 221 ? 48.565  -56.005 -19.381 1.00 56.88  ? 216 GLY A CA  1 
ATOM   3975  C C   . GLY B 1 221 ? 48.654  -57.408 -19.939 1.00 56.61  ? 216 GLY A C   1 
ATOM   3976  O O   . GLY B 1 221 ? 47.937  -58.296 -19.476 1.00 58.49  ? 216 GLY A O   1 
ATOM   3977  N N   . HIS B 1 222 ? 49.502  -57.647 -20.922 1.00 55.47  ? 217 HIS A N   1 
ATOM   3978  C CA  . HIS B 1 222 ? 49.602  -59.004 -21.431 1.00 53.31  ? 217 HIS A CA  1 
ATOM   3979  C C   . HIS B 1 222 ? 50.496  -59.715 -20.430 1.00 52.01  ? 217 HIS A C   1 
ATOM   3980  O O   . HIS B 1 222 ? 51.536  -60.247 -20.788 1.00 51.84  ? 217 HIS A O   1 
ATOM   3981  C CB  . HIS B 1 222 ? 50.245  -59.012 -22.820 1.00 54.51  ? 217 HIS A CB  1 
ATOM   3982  C CG  . HIS B 1 222 ? 50.063  -60.298 -23.566 1.00 55.20  ? 217 HIS A CG  1 
ATOM   3983  N ND1 . HIS B 1 222 ? 50.381  -61.526 -23.026 1.00 54.87  ? 217 HIS A ND1 1 
ATOM   3984  C CD2 . HIS B 1 222 ? 49.614  -60.543 -24.821 1.00 55.11  ? 217 HIS A CD2 1 
ATOM   3985  C CE1 . HIS B 1 222 ? 50.138  -62.473 -23.916 1.00 55.21  ? 217 HIS A CE1 1 
ATOM   3986  N NE2 . HIS B 1 222 ? 49.671  -61.903 -25.013 1.00 55.67  ? 217 HIS A NE2 1 
ATOM   3987  N N   . SER B 1 223 ? 50.101  -59.684 -19.162 1.00 52.01  ? 218 SER A N   1 
ATOM   3988  C CA  . SER B 1 223 ? 50.868  -60.326 -18.096 1.00 51.84  ? 218 SER A CA  1 
ATOM   3989  C C   . SER B 1 223 ? 50.592  -61.827 -18.129 1.00 51.02  ? 218 SER A C   1 
ATOM   3990  O O   . SER B 1 223 ? 49.537  -62.286 -17.681 1.00 53.63  ? 218 SER A O   1 
ATOM   3991  C CB  . SER B 1 223 ? 50.468  -59.750 -16.740 1.00 52.91  ? 218 SER A CB  1 
ATOM   3992  O OG  . SER B 1 223 ? 51.288  -60.259 -15.708 1.00 56.46  ? 218 SER A OG  1 
ATOM   3993  N N   . ASP B 1 224 ? 51.556  -62.578 -18.655 1.00 47.77  ? 219 ASP A N   1 
ATOM   3994  C CA  . ASP B 1 224 ? 51.449  -64.020 -18.810 1.00 45.91  ? 219 ASP A CA  1 
ATOM   3995  C C   . ASP B 1 224 ? 51.244  -64.831 -17.542 1.00 43.10  ? 219 ASP A C   1 
ATOM   3996  O O   . ASP B 1 224 ? 52.008  -65.751 -17.241 1.00 42.43  ? 219 ASP A O   1 
ATOM   3997  C CB  . ASP B 1 224 ? 52.671  -64.541 -19.559 1.00 48.74  ? 219 ASP A CB  1 
ATOM   3998  C CG  . ASP B 1 224 ? 52.863  -63.849 -20.890 1.00 51.60  ? 219 ASP A CG  1 
ATOM   3999  O OD1 . ASP B 1 224 ? 53.705  -62.927 -20.958 1.00 54.01  ? 219 ASP A OD1 1 
ATOM   4000  O OD2 . ASP B 1 224 ? 52.161  -64.215 -21.863 1.00 54.00  ? 219 ASP A OD2 1 
ATOM   4001  N N   . VAL B 1 225 ? 50.190  -64.499 -16.813 1.00 39.94  ? 220 VAL A N   1 
ATOM   4002  C CA  . VAL B 1 225 ? 49.863  -65.200 -15.593 1.00 38.56  ? 220 VAL A CA  1 
ATOM   4003  C C   . VAL B 1 225 ? 48.569  -65.959 -15.837 1.00 38.37  ? 220 VAL A C   1 
ATOM   4004  O O   . VAL B 1 225 ? 47.547  -65.364 -16.177 1.00 37.03  ? 220 VAL A O   1 
ATOM   4005  C CB  . VAL B 1 225 ? 49.658  -64.216 -14.424 1.00 38.80  ? 220 VAL A CB  1 
ATOM   4006  C CG1 . VAL B 1 225 ? 49.285  -64.973 -13.151 1.00 38.98  ? 220 VAL A CG1 1 
ATOM   4007  C CG2 . VAL B 1 225 ? 50.919  -63.404 -14.208 1.00 40.05  ? 220 VAL A CG2 1 
ATOM   4008  N N   . VAL B 1 226 ? 48.627  -67.278 -15.696 1.00 36.89  ? 221 VAL A N   1 
ATOM   4009  C CA  . VAL B 1 226 ? 47.453  -68.110 -15.874 1.00 36.15  ? 221 VAL A CA  1 
ATOM   4010  C C   . VAL B 1 226 ? 47.019  -68.488 -14.458 1.00 37.94  ? 221 VAL A C   1 
ATOM   4011  O O   . VAL B 1 226 ? 47.865  -68.614 -13.565 1.00 38.28  ? 221 VAL A O   1 
ATOM   4012  C CB  . VAL B 1 226 ? 47.792  -69.359 -16.680 1.00 35.90  ? 221 VAL A CB  1 
ATOM   4013  C CG1 . VAL B 1 226 ? 46.513  -70.078 -17.099 1.00 35.43  ? 221 VAL A CG1 1 
ATOM   4014  C CG2 . VAL B 1 226 ? 48.612  -68.964 -17.885 1.00 36.35  ? 221 VAL A CG2 1 
ATOM   4015  N N   . MET B 1 227 ? 45.717  -68.667 -14.244 1.00 36.52  ? 222 MET A N   1 
ATOM   4016  C CA  . MET B 1 227 ? 45.235  -68.981 -12.909 1.00 34.54  ? 222 MET A CA  1 
ATOM   4017  C C   . MET B 1 227 ? 43.775  -69.425 -12.895 1.00 34.85  ? 222 MET A C   1 
ATOM   4018  O O   . MET B 1 227 ? 42.953  -68.936 -13.668 1.00 34.07  ? 222 MET A O   1 
ATOM   4019  C CB  . MET B 1 227 ? 45.394  -67.739 -12.029 1.00 34.96  ? 222 MET A CB  1 
ATOM   4020  C CG  . MET B 1 227 ? 45.057  -67.917 -10.554 1.00 35.72  ? 222 MET A CG  1 
ATOM   4021  S SD  . MET B 1 227 ? 46.443  -68.568 -9.597  1.00 39.91  ? 222 MET A SD  1 
ATOM   4022  C CE  . MET B 1 227 ? 47.716  -67.343 -9.978  1.00 32.94  ? 222 MET A CE  1 
ATOM   4023  N N   . GLY B 1 228 ? 43.468  -70.350 -11.993 1.00 35.03  ? 223 GLY A N   1 
ATOM   4024  C CA  . GLY B 1 228 ? 42.116  -70.854 -11.846 1.00 36.39  ? 223 GLY A CA  1 
ATOM   4025  C C   . GLY B 1 228 ? 41.700  -70.616 -10.407 1.00 37.18  ? 223 GLY A C   1 
ATOM   4026  O O   . GLY B 1 228 ? 42.203  -71.272 -9.499  1.00 36.78  ? 223 GLY A O   1 
ATOM   4027  N N   . LEU B 1 229 ? 40.788  -69.671 -10.197 1.00 37.33  ? 224 LEU A N   1 
ATOM   4028  C CA  . LEU B 1 229 ? 40.323  -69.327 -8.856  1.00 36.33  ? 224 LEU A CA  1 
ATOM   4029  C C   . LEU B 1 229 ? 38.895  -69.820 -8.561  1.00 38.37  ? 224 LEU A C   1 
ATOM   4030  O O   . LEU B 1 229 ? 37.926  -69.457 -9.235  1.00 38.39  ? 224 LEU A O   1 
ATOM   4031  C CB  . LEU B 1 229 ? 40.428  -67.810 -8.665  1.00 33.07  ? 224 LEU A CB  1 
ATOM   4032  C CG  . LEU B 1 229 ? 41.859  -67.257 -8.714  1.00 32.06  ? 224 LEU A CG  1 
ATOM   4033  C CD1 . LEU B 1 229 ? 41.867  -65.741 -8.868  1.00 27.03  ? 224 LEU A CD1 1 
ATOM   4034  C CD2 . LEU B 1 229 ? 42.583  -67.674 -7.438  1.00 30.90  ? 224 LEU A CD2 1 
ATOM   4035  N N   . VAL B 1 230 ? 38.786  -70.661 -7.541  1.00 39.62  ? 225 VAL A N   1 
ATOM   4036  C CA  . VAL B 1 230 ? 37.515  -71.233 -7.132  1.00 39.16  ? 225 VAL A CA  1 
ATOM   4037  C C   . VAL B 1 230 ? 37.189  -70.759 -5.731  1.00 41.26  ? 225 VAL A C   1 
ATOM   4038  O O   . VAL B 1 230 ? 37.934  -71.039 -4.794  1.00 41.56  ? 225 VAL A O   1 
ATOM   4039  C CB  . VAL B 1 230 ? 37.593  -72.765 -7.106  1.00 38.86  ? 225 VAL A CB  1 
ATOM   4040  C CG1 . VAL B 1 230 ? 36.281  -73.336 -6.632  1.00 37.05  ? 225 VAL A CG1 1 
ATOM   4041  C CG2 . VAL B 1 230 ? 37.954  -73.292 -8.491  1.00 38.59  ? 225 VAL A CG2 1 
ATOM   4042  N N   . SER B 1 231 ? 36.083  -70.041 -5.583  1.00 41.74  ? 226 SER A N   1 
ATOM   4043  C CA  . SER B 1 231 ? 35.682  -69.560 -4.268  1.00 43.83  ? 226 SER A CA  1 
ATOM   4044  C C   . SER B 1 231 ? 34.373  -70.213 -3.826  1.00 44.75  ? 226 SER A C   1 
ATOM   4045  O O   . SER B 1 231 ? 33.591  -70.700 -4.648  1.00 43.88  ? 226 SER A O   1 
ATOM   4046  C CB  . SER B 1 231 ? 35.547  -68.035 -4.272  1.00 44.68  ? 226 SER A CB  1 
ATOM   4047  O OG  . SER B 1 231 ? 36.823  -67.408 -4.309  1.00 45.64  ? 226 SER A OG  1 
ATOM   4048  N N   . VAL B 1 232 ? 34.139  -70.223 -2.521  1.00 46.24  ? 227 VAL A N   1 
ATOM   4049  C CA  . VAL B 1 232 ? 32.939  -70.844 -1.984  1.00 47.78  ? 227 VAL A CA  1 
ATOM   4050  C C   . VAL B 1 232 ? 32.798  -70.502 -0.496  1.00 47.30  ? 227 VAL A C   1 
ATOM   4051  O O   . VAL B 1 232 ? 33.752  -70.047 0.133   1.00 47.20  ? 227 VAL A O   1 
ATOM   4052  C CB  . VAL B 1 232 ? 33.012  -72.387 -2.185  1.00 47.94  ? 227 VAL A CB  1 
ATOM   4053  C CG1 . VAL B 1 232 ? 34.176  -72.963 -1.400  1.00 48.02  ? 227 VAL A CG1 1 
ATOM   4054  C CG2 . VAL B 1 232 ? 31.715  -73.037 -1.758  1.00 52.11  ? 227 VAL A CG2 1 
ATOM   4055  N N   . ASN B 1 233 ? 31.603  -70.708 0.055   1.00 47.97  ? 228 ASN A N   1 
ATOM   4056  C CA  . ASN B 1 233 ? 31.341  -70.425 1.468   1.00 48.48  ? 228 ASN A CA  1 
ATOM   4057  C C   . ASN B 1 233 ? 31.106  -71.724 2.259   1.00 50.41  ? 228 ASN A C   1 
ATOM   4058  O O   . ASN B 1 233 ? 31.389  -71.796 3.465   1.00 47.79  ? 228 ASN A O   1 
ATOM   4059  C CB  . ASN B 1 233 ? 30.108  -69.521 1.606   1.00 46.60  ? 228 ASN A CB  1 
ATOM   4060  C CG  . ASN B 1 233 ? 30.299  -68.149 0.962   1.00 46.58  ? 228 ASN A CG  1 
ATOM   4061  O OD1 . ASN B 1 233 ? 31.193  -67.386 1.342   1.00 45.59  ? 228 ASN A OD1 1 
ATOM   4062  N ND2 . ASN B 1 233 ? 29.445  -67.826 -0.012  1.00 44.42  ? 228 ASN A ND2 1 
ATOM   4063  N N   . CYS B 1 234 ? 30.591  -72.745 1.570   1.00 53.50  ? 229 CYS A N   1 
ATOM   4064  C CA  . CYS B 1 234 ? 30.301  -74.037 2.196   1.00 57.36  ? 229 CYS A CA  1 
ATOM   4065  C C   . CYS B 1 234 ? 31.510  -74.562 2.944   1.00 58.87  ? 229 CYS A C   1 
ATOM   4066  O O   . CYS B 1 234 ? 32.649  -74.251 2.610   1.00 60.70  ? 229 CYS A O   1 
ATOM   4067  C CB  . CYS B 1 234 ? 29.865  -75.075 1.150   1.00 58.40  ? 229 CYS A CB  1 
ATOM   4068  S SG  . CYS B 1 234 ? 29.107  -76.605 1.831   1.00 61.20  ? 229 CYS A SG  1 
ATOM   4069  N N   . GLU B 1 235 ? 31.257  -75.375 3.958   1.00 60.76  ? 230 GLU A N   1 
ATOM   4070  C CA  . GLU B 1 235 ? 32.334  -75.930 4.748   1.00 60.95  ? 230 GLU A CA  1 
ATOM   4071  C C   . GLU B 1 235 ? 32.948  -77.136 4.063   1.00 59.44  ? 230 GLU A C   1 
ATOM   4072  O O   . GLU B 1 235 ? 34.150  -77.175 3.822   1.00 58.84  ? 230 GLU A O   1 
ATOM   4073  C CB  . GLU B 1 235 ? 31.804  -76.323 6.126   1.00 64.43  ? 230 GLU A CB  1 
ATOM   4074  C CG  . GLU B 1 235 ? 32.879  -76.757 7.097   1.00 67.71  ? 230 GLU A CG  1 
ATOM   4075  C CD  . GLU B 1 235 ? 33.943  -75.698 7.295   1.00 69.41  ? 230 GLU A CD  1 
ATOM   4076  O OE1 . GLU B 1 235 ? 34.856  -75.939 8.112   1.00 70.45  ? 230 GLU A OE1 1 
ATOM   4077  O OE2 . GLU B 1 235 ? 33.870  -74.634 6.634   1.00 70.89  ? 230 GLU A OE2 1 
ATOM   4078  N N   . SER B 1 236 ? 32.109  -78.112 3.740   1.00 59.87  ? 231 SER A N   1 
ATOM   4079  C CA  . SER B 1 236 ? 32.563  -79.348 3.103   1.00 61.43  ? 231 SER A CA  1 
ATOM   4080  C C   . SER B 1 236 ? 33.077  -79.156 1.683   1.00 59.72  ? 231 SER A C   1 
ATOM   4081  O O   . SER B 1 236 ? 34.060  -79.784 1.273   1.00 59.43  ? 231 SER A O   1 
ATOM   4082  C CB  . SER B 1 236 ? 31.427  -80.369 3.078   1.00 63.11  ? 231 SER A CB  1 
ATOM   4083  O OG  . SER B 1 236 ? 30.349  -79.896 2.285   1.00 66.98  ? 231 SER A OG  1 
ATOM   4084  N N   . LEU B 1 237 ? 32.392  -78.300 0.932   1.00 57.92  ? 232 LEU A N   1 
ATOM   4085  C CA  . LEU B 1 237 ? 32.760  -78.022 -0.450  1.00 55.05  ? 232 LEU A CA  1 
ATOM   4086  C C   . LEU B 1 237 ? 34.224  -77.586 -0.481  1.00 55.02  ? 232 LEU A C   1 
ATOM   4087  O O   . LEU B 1 237 ? 35.013  -78.059 -1.306  1.00 55.03  ? 232 LEU A O   1 
ATOM   4088  C CB  . LEU B 1 237 ? 31.853  -76.920 -1.003  1.00 51.55  ? 232 LEU A CB  1 
ATOM   4089  C CG  . LEU B 1 237 ? 31.498  -77.001 -2.484  1.00 49.24  ? 232 LEU A CG  1 
ATOM   4090  C CD1 . LEU B 1 237 ? 31.137  -78.433 -2.850  1.00 46.30  ? 232 LEU A CD1 1 
ATOM   4091  C CD2 . LEU B 1 237 ? 30.336  -76.059 -2.771  1.00 47.38  ? 232 LEU A CD2 1 
ATOM   4092  N N   . HIS B 1 238 ? 34.575  -76.691 0.442   1.00 53.73  ? 233 HIS A N   1 
ATOM   4093  C CA  . HIS B 1 238 ? 35.929  -76.175 0.558   1.00 51.79  ? 233 HIS A CA  1 
ATOM   4094  C C   . HIS B 1 238 ? 36.891  -77.289 0.945   1.00 51.75  ? 233 HIS A C   1 
ATOM   4095  O O   . HIS B 1 238 ? 37.986  -77.390 0.390   1.00 52.04  ? 233 HIS A O   1 
ATOM   4096  C CB  . HIS B 1 238 ? 35.975  -75.069 1.617   1.00 51.76  ? 233 HIS A CB  1 
ATOM   4097  C CG  . HIS B 1 238 ? 37.360  -74.732 2.083   1.00 51.87  ? 233 HIS A CG  1 
ATOM   4098  N ND1 . HIS B 1 238 ? 38.345  -74.277 1.231   1.00 52.46  ? 233 HIS A ND1 1 
ATOM   4099  C CD2 . HIS B 1 238 ? 37.928  -74.801 3.310   1.00 51.36  ? 233 HIS A CD2 1 
ATOM   4100  C CE1 . HIS B 1 238 ? 39.460  -74.082 1.912   1.00 51.73  ? 233 HIS A CE1 1 
ATOM   4101  N NE2 . HIS B 1 238 ? 39.234  -74.392 3.176   1.00 52.04  ? 233 HIS A NE2 1 
ATOM   4102  N N   . ASN B 1 239 ? 36.479  -78.111 1.907   1.00 51.41  ? 234 ASN A N   1 
ATOM   4103  C CA  . ASN B 1 239 ? 37.298  -79.223 2.386   1.00 51.10  ? 234 ASN A CA  1 
ATOM   4104  C C   . ASN B 1 239 ? 37.615  -80.196 1.264   1.00 49.02  ? 234 ASN A C   1 
ATOM   4105  O O   . ASN B 1 239 ? 38.772  -80.525 1.030   1.00 47.04  ? 234 ASN A O   1 
ATOM   4106  C CB  . ASN B 1 239 ? 36.573  -79.966 3.508   1.00 54.10  ? 234 ASN A CB  1 
ATOM   4107  C CG  . ASN B 1 239 ? 36.496  -79.162 4.791   1.00 56.55  ? 234 ASN A CG  1 
ATOM   4108  O OD1 . ASN B 1 239 ? 36.694  -77.943 4.795   1.00 60.07  ? 234 ASN A OD1 1 
ATOM   4109  N ND2 . ASN B 1 239 ? 36.193  -79.843 5.890   1.00 57.50  ? 234 ASN A ND2 1 
ATOM   4110  N N   . ARG B 1 240 ? 36.575  -80.657 0.579   1.00 49.30  ? 235 ARG A N   1 
ATOM   4111  C CA  . ARG B 1 240 ? 36.738  -81.596 -0.527  1.00 49.83  ? 235 ARG A CA  1 
ATOM   4112  C C   . ARG B 1 240 ? 37.603  -81.002 -1.636  1.00 47.88  ? 235 ARG A C   1 
ATOM   4113  O O   . ARG B 1 240 ? 38.462  -81.677 -2.208  1.00 47.91  ? 235 ARG A O   1 
ATOM   4114  C CB  . ARG B 1 240 ? 35.365  -81.982 -1.088  1.00 52.11  ? 235 ARG A CB  1 
ATOM   4115  C CG  . ARG B 1 240 ? 34.544  -82.866 -0.159  1.00 56.59  ? 235 ARG A CG  1 
ATOM   4116  C CD  . ARG B 1 240 ? 33.070  -82.868 -0.556  1.00 61.07  ? 235 ARG A CD  1 
ATOM   4117  N NE  . ARG B 1 240 ? 32.822  -83.454 -1.874  1.00 64.11  ? 235 ARG A NE  1 
ATOM   4118  C CZ  . ARG B 1 240 ? 31.691  -83.295 -2.562  1.00 65.37  ? 235 ARG A CZ  1 
ATOM   4119  N NH1 . ARG B 1 240 ? 30.702  -82.562 -2.057  1.00 64.93  ? 235 ARG A NH1 1 
ATOM   4120  N NH2 . ARG B 1 240 ? 31.547  -83.868 -3.753  1.00 65.12  ? 235 ARG A NH2 1 
ATOM   4121  N N   . LEU B 1 241 ? 37.373  -79.731 -1.932  1.00 45.48  ? 236 LEU A N   1 
ATOM   4122  C CA  . LEU B 1 241 ? 38.114  -79.047 -2.973  1.00 44.77  ? 236 LEU A CA  1 
ATOM   4123  C C   . LEU B 1 241 ? 39.580  -78.898 -2.595  1.00 45.68  ? 236 LEU A C   1 
ATOM   4124  O O   . LEU B 1 241 ? 40.462  -79.061 -3.438  1.00 46.43  ? 236 LEU A O   1 
ATOM   4125  C CB  . LEU B 1 241 ? 37.481  -77.686 -3.219  1.00 42.58  ? 236 LEU A CB  1 
ATOM   4126  C CG  . LEU B 1 241 ? 36.897  -77.359 -4.593  1.00 41.66  ? 236 LEU A CG  1 
ATOM   4127  C CD1 . LEU B 1 241 ? 36.468  -78.599 -5.352  1.00 40.97  ? 236 LEU A CD1 1 
ATOM   4128  C CD2 . LEU B 1 241 ? 35.719  -76.428 -4.370  1.00 43.00  ? 236 LEU A CD2 1 
ATOM   4129  N N   . ARG B 1 242 ? 39.838  -78.597 -1.325  1.00 47.17  ? 237 ARG A N   1 
ATOM   4130  C CA  . ARG B 1 242 ? 41.205  -78.435 -0.835  1.00 48.61  ? 237 ARG A CA  1 
ATOM   4131  C C   . ARG B 1 242 ? 41.941  -79.753 -1.014  1.00 47.75  ? 237 ARG A C   1 
ATOM   4132  O O   . ARG B 1 242 ? 43.038  -79.792 -1.563  1.00 47.74  ? 237 ARG A O   1 
ATOM   4133  C CB  . ARG B 1 242 ? 41.211  -78.042 0.651   1.00 51.67  ? 237 ARG A CB  1 
ATOM   4134  C CG  . ARG B 1 242 ? 42.563  -77.547 1.164   1.00 56.43  ? 237 ARG A CG  1 
ATOM   4135  C CD  . ARG B 1 242 ? 42.934  -76.194 0.541   1.00 63.61  ? 237 ARG A CD  1 
ATOM   4136  N NE  . ARG B 1 242 ? 44.338  -75.814 0.739   1.00 67.69  ? 237 ARG A NE  1 
ATOM   4137  C CZ  . ARG B 1 242 ? 44.902  -74.716 0.231   1.00 67.72  ? 237 ARG A CZ  1 
ATOM   4138  N NH1 . ARG B 1 242 ? 44.189  -73.874 -0.511  1.00 66.71  ? 237 ARG A NH1 1 
ATOM   4139  N NH2 . ARG B 1 242 ? 46.184  -74.461 0.461   1.00 67.94  ? 237 ARG A NH2 1 
ATOM   4140  N N   . PHE B 1 243 ? 41.321  -80.835 -0.556  1.00 48.09  ? 238 PHE A N   1 
ATOM   4141  C CA  . PHE B 1 243 ? 41.922  -82.155 -0.667  1.00 47.92  ? 238 PHE A CA  1 
ATOM   4142  C C   . PHE B 1 243 ? 42.339  -82.397 -2.109  1.00 47.68  ? 238 PHE A C   1 
ATOM   4143  O O   . PHE B 1 243 ? 43.486  -82.753 -2.371  1.00 48.58  ? 238 PHE A O   1 
ATOM   4144  C CB  . PHE B 1 243 ? 40.939  -83.245 -0.235  1.00 48.40  ? 238 PHE A CB  1 
ATOM   4145  C CG  . PHE B 1 243 ? 41.524  -84.628 -0.277  1.00 49.39  ? 238 PHE A CG  1 
ATOM   4146  C CD1 . PHE B 1 243 ? 42.481  -85.023 0.660   1.00 49.69  ? 238 PHE A CD1 1 
ATOM   4147  C CD2 . PHE B 1 243 ? 41.175  -85.516 -1.298  1.00 49.65  ? 238 PHE A CD2 1 
ATOM   4148  C CE1 . PHE B 1 243 ? 43.087  -86.277 0.578   1.00 48.33  ? 238 PHE A CE1 1 
ATOM   4149  C CE2 . PHE B 1 243 ? 41.774  -86.772 -1.392  1.00 47.68  ? 238 PHE A CE2 1 
ATOM   4150  C CZ  . PHE B 1 243 ? 42.733  -87.154 -0.453  1.00 48.17  ? 238 PHE A CZ  1 
ATOM   4151  N N   . LEU B 1 244 ? 41.405  -82.202 -3.037  1.00 46.00  ? 239 LEU A N   1 
ATOM   4152  C CA  . LEU B 1 244 ? 41.684  -82.389 -4.457  1.00 45.22  ? 239 LEU A CA  1 
ATOM   4153  C C   . LEU B 1 244 ? 42.855  -81.530 -4.896  1.00 46.08  ? 239 LEU A C   1 
ATOM   4154  O O   . LEU B 1 244 ? 43.770  -82.008 -5.575  1.00 45.11  ? 239 LEU A O   1 
ATOM   4155  C CB  . LEU B 1 244 ? 40.463  -82.026 -5.288  1.00 43.07  ? 239 LEU A CB  1 
ATOM   4156  C CG  . LEU B 1 244 ? 39.313  -83.004 -5.089  1.00 43.40  ? 239 LEU A CG  1 
ATOM   4157  C CD1 . LEU B 1 244 ? 38.069  -82.493 -5.803  1.00 43.91  ? 239 LEU A CD1 1 
ATOM   4158  C CD2 . LEU B 1 244 ? 39.732  -84.373 -5.611  1.00 41.33  ? 239 LEU A CD2 1 
ATOM   4159  N N   . GLN B 1 245 ? 42.819  -80.261 -4.498  1.00 46.47  ? 240 GLN A N   1 
ATOM   4160  C CA  . GLN B 1 245 ? 43.876  -79.324 -4.842  1.00 46.79  ? 240 GLN A CA  1 
ATOM   4161  C C   . GLN B 1 245 ? 45.229  -79.913 -4.481  1.00 47.42  ? 240 GLN A C   1 
ATOM   4162  O O   . GLN B 1 245 ? 46.101  -80.051 -5.336  1.00 50.23  ? 240 GLN A O   1 
ATOM   4163  C CB  . GLN B 1 245 ? 43.686  -78.002 -4.096  1.00 46.83  ? 240 GLN A CB  1 
ATOM   4164  C CG  . GLN B 1 245 ? 44.623  -76.883 -4.551  1.00 44.69  ? 240 GLN A CG  1 
ATOM   4165  C CD  . GLN B 1 245 ? 44.606  -75.695 -3.608  1.00 44.58  ? 240 GLN A CD  1 
ATOM   4166  O OE1 . GLN B 1 245 ? 45.014  -74.586 -3.972  1.00 46.01  ? 240 GLN A OE1 1 
ATOM   4167  N NE2 . GLN B 1 245 ? 44.144  -75.922 -2.381  1.00 41.85  ? 240 GLN A NE2 1 
ATOM   4168  N N   . ASN B 1 246 ? 45.400  -80.282 -3.217  1.00 47.21  ? 241 ASN A N   1 
ATOM   4169  C CA  . ASN B 1 246 ? 46.671  -80.834 -2.766  1.00 48.51  ? 241 ASN A CA  1 
ATOM   4170  C C   . ASN B 1 246 ? 46.959  -82.282 -3.180  1.00 47.53  ? 241 ASN A C   1 
ATOM   4171  O O   . ASN B 1 246 ? 48.110  -82.704 -3.169  1.00 47.01  ? 241 ASN A O   1 
ATOM   4172  C CB  . ASN B 1 246 ? 46.782  -80.704 -1.241  1.00 50.87  ? 241 ASN A CB  1 
ATOM   4173  C CG  . ASN B 1 246 ? 46.699  -79.250 -0.766  1.00 53.72  ? 241 ASN A CG  1 
ATOM   4174  O OD1 . ASN B 1 246 ? 47.355  -78.361 -1.325  1.00 53.73  ? 241 ASN A OD1 1 
ATOM   4175  N ND2 . ASN B 1 246 ? 45.899  -79.007 0.276   1.00 53.57  ? 241 ASN A ND2 1 
ATOM   4176  N N   . SER B 1 247 ? 45.927  -83.033 -3.555  1.00 46.90  ? 242 SER A N   1 
ATOM   4177  C CA  . SER B 1 247 ? 46.085  -84.438 -3.947  1.00 47.18  ? 242 SER A CA  1 
ATOM   4178  C C   . SER B 1 247 ? 46.501  -84.633 -5.389  1.00 45.15  ? 242 SER A C   1 
ATOM   4179  O O   . SER B 1 247 ? 47.283  -85.531 -5.702  1.00 43.12  ? 242 SER A O   1 
ATOM   4180  C CB  . SER B 1 247 ? 44.777  -85.198 -3.745  1.00 48.39  ? 242 SER A CB  1 
ATOM   4181  O OG  . SER B 1 247 ? 44.332  -85.093 -2.412  1.00 52.77  ? 242 SER A OG  1 
ATOM   4182  N N   . LEU B 1 248 ? 45.955  -83.792 -6.262  1.00 44.93  ? 243 LEU A N   1 
ATOM   4183  C CA  . LEU B 1 248 ? 46.227  -83.873 -7.696  1.00 45.12  ? 243 LEU A CA  1 
ATOM   4184  C C   . LEU B 1 248 ? 47.365  -82.967 -8.221  1.00 43.60  ? 243 LEU A C   1 
ATOM   4185  O O   . LEU B 1 248 ? 48.003  -83.282 -9.230  1.00 44.62  ? 243 LEU A O   1 
ATOM   4186  C CB  . LEU B 1 248 ? 44.916  -83.628 -8.456  1.00 44.85  ? 243 LEU A CB  1 
ATOM   4187  C CG  . LEU B 1 248 ? 43.765  -84.540 -7.993  1.00 42.07  ? 243 LEU A CG  1 
ATOM   4188  C CD1 . LEU B 1 248 ? 42.515  -84.216 -8.784  1.00 41.25  ? 243 LEU A CD1 1 
ATOM   4189  C CD2 . LEU B 1 248 ? 44.147  -86.007 -8.171  1.00 39.98  ? 243 LEU A CD2 1 
ATOM   4190  N N   . GLY B 1 249 ? 47.621  -81.852 -7.546  1.00 40.81  ? 244 GLY A N   1 
ATOM   4191  C CA  . GLY B 1 249 ? 48.713  -80.988 -7.957  1.00 38.93  ? 244 GLY A CA  1 
ATOM   4192  C C   . GLY B 1 249 ? 48.527  -80.061 -9.145  1.00 39.05  ? 244 GLY A C   1 
ATOM   4193  O O   . GLY B 1 249 ? 49.517  -79.661 -9.756  1.00 39.39  ? 244 GLY A O   1 
ATOM   4194  N N   . ALA B 1 250 ? 47.281  -79.726 -9.482  1.00 38.18  ? 245 ALA A N   1 
ATOM   4195  C CA  . ALA B 1 250 ? 46.982  -78.811 -10.593 1.00 36.46  ? 245 ALA A CA  1 
ATOM   4196  C C   . ALA B 1 250 ? 47.066  -77.417 -9.985  1.00 35.74  ? 245 ALA A C   1 
ATOM   4197  O O   . ALA B 1 250 ? 46.142  -76.614 -10.061 1.00 36.66  ? 245 ALA A O   1 
ATOM   4198  C CB  . ALA B 1 250 ? 45.570  -79.072 -11.135 1.00 36.54  ? 245 ALA A CB  1 
ATOM   4199  N N   . VAL B 1 251 ? 48.210  -77.145 -9.390  1.00 35.32  ? 246 VAL A N   1 
ATOM   4200  C CA  . VAL B 1 251 ? 48.452  -75.908 -8.688  1.00 34.37  ? 246 VAL A CA  1 
ATOM   4201  C C   . VAL B 1 251 ? 49.373  -74.890 -9.378  1.00 34.75  ? 246 VAL A C   1 
ATOM   4202  O O   . VAL B 1 251 ? 50.198  -75.251 -10.222 1.00 34.71  ? 246 VAL A O   1 
ATOM   4203  C CB  . VAL B 1 251 ? 48.990  -76.296 -7.296  1.00 33.27  ? 246 VAL A CB  1 
ATOM   4204  C CG1 . VAL B 1 251 ? 49.820  -75.190 -6.695  1.00 34.32  ? 246 VAL A CG1 1 
ATOM   4205  C CG2 . VAL B 1 251 ? 47.809  -76.654 -6.393  1.00 33.21  ? 246 VAL A CG2 1 
ATOM   4206  N N   . PRO B 1 252 ? 49.226  -73.595 -9.027  1.00 35.27  ? 247 PRO A N   1 
ATOM   4207  C CA  . PRO B 1 252 ? 50.009  -72.468 -9.555  1.00 36.05  ? 247 PRO A CA  1 
ATOM   4208  C C   . PRO B 1 252 ? 51.382  -72.376 -8.873  1.00 36.69  ? 247 PRO A C   1 
ATOM   4209  O O   . PRO B 1 252 ? 51.547  -72.852 -7.746  1.00 36.50  ? 247 PRO A O   1 
ATOM   4210  C CB  . PRO B 1 252 ? 49.157  -71.251 -9.198  1.00 35.93  ? 247 PRO A CB  1 
ATOM   4211  C CG  . PRO B 1 252 ? 47.800  -71.806 -8.944  1.00 35.95  ? 247 PRO A CG  1 
ATOM   4212  C CD  . PRO B 1 252 ? 48.074  -73.092 -8.261  1.00 34.77  ? 247 PRO A CD  1 
ATOM   4213  N N   . SER B 1 253 ? 52.357  -71.752 -9.534  1.00 37.43  ? 248 SER A N   1 
ATOM   4214  C CA  . SER B 1 253 ? 53.685  -71.598 -8.929  1.00 38.02  ? 248 SER A CA  1 
ATOM   4215  C C   . SER B 1 253 ? 53.716  -70.333 -8.066  1.00 37.75  ? 248 SER A C   1 
ATOM   4216  O O   . SER B 1 253 ? 52.918  -69.423 -8.258  1.00 36.45  ? 248 SER A O   1 
ATOM   4217  C CB  . SER B 1 253 ? 54.764  -71.474 -10.000 1.00 38.92  ? 248 SER A CB  1 
ATOM   4218  O OG  . SER B 1 253 ? 55.005  -70.112 -10.314 1.00 39.59  ? 248 SER A OG  1 
ATOM   4219  N N   . PRO B 1 254 ? 54.642  -70.261 -7.102  1.00 38.52  ? 249 PRO A N   1 
ATOM   4220  C CA  . PRO B 1 254 ? 54.699  -69.064 -6.261  1.00 39.90  ? 249 PRO A CA  1 
ATOM   4221  C C   . PRO B 1 254 ? 54.781  -67.773 -7.077  1.00 39.67  ? 249 PRO A C   1 
ATOM   4222  O O   . PRO B 1 254 ? 54.255  -66.741 -6.666  1.00 39.57  ? 249 PRO A O   1 
ATOM   4223  C CB  . PRO B 1 254 ? 55.933  -69.317 -5.401  1.00 39.40  ? 249 PRO A CB  1 
ATOM   4224  C CG  . PRO B 1 254 ? 55.875  -70.790 -5.196  1.00 38.08  ? 249 PRO A CG  1 
ATOM   4225  C CD  . PRO B 1 254 ? 55.567  -71.292 -6.596  1.00 39.29  ? 249 PRO A CD  1 
ATOM   4226  N N   . ILE B 1 255 ? 55.435  -67.832 -8.232  1.00 40.06  ? 250 ILE A N   1 
ATOM   4227  C CA  . ILE B 1 255 ? 55.541  -66.658 -9.092  1.00 41.20  ? 250 ILE A CA  1 
ATOM   4228  C C   . ILE B 1 255 ? 54.151  -66.234 -9.590  1.00 41.14  ? 250 ILE A C   1 
ATOM   4229  O O   . ILE B 1 255 ? 53.757  -65.077 -9.438  1.00 40.74  ? 250 ILE A O   1 
ATOM   4230  C CB  . ILE B 1 255 ? 56.448  -66.932 -10.312 1.00 41.43  ? 250 ILE A CB  1 
ATOM   4231  C CG1 . ILE B 1 255 ? 57.884  -67.192 -9.853  1.00 42.70  ? 250 ILE A CG1 1 
ATOM   4232  C CG2 . ILE B 1 255 ? 56.420  -65.740 -11.261 1.00 42.94  ? 250 ILE A CG2 1 
ATOM   4233  C CD1 . ILE B 1 255 ? 58.607  -65.964 -9.329  1.00 42.75  ? 250 ILE A CD1 1 
ATOM   4234  N N   . ASP B 1 256 ? 53.417  -67.168 -10.193 1.00 41.14  ? 251 ASP A N   1 
ATOM   4235  C CA  . ASP B 1 256 ? 52.075  -66.880 -10.691 1.00 41.52  ? 251 ASP A CA  1 
ATOM   4236  C C   . ASP B 1 256 ? 51.236  -66.226 -9.609  1.00 38.67  ? 251 ASP A C   1 
ATOM   4237  O O   . ASP B 1 256 ? 50.631  -65.180 -9.831  1.00 39.11  ? 251 ASP A O   1 
ATOM   4238  C CB  . ASP B 1 256 ? 51.363  -68.161 -11.112 1.00 48.05  ? 251 ASP A CB  1 
ATOM   4239  C CG  . ASP B 1 256 ? 51.973  -68.791 -12.327 1.00 54.97  ? 251 ASP A CG  1 
ATOM   4240  O OD1 . ASP B 1 256 ? 52.054  -68.087 -13.360 1.00 58.62  ? 251 ASP A OD1 1 
ATOM   4241  O OD2 . ASP B 1 256 ? 52.360  -69.986 -12.247 1.00 58.29  ? 251 ASP A OD2 1 
ATOM   4242  N N   . CYS B 1 257 ? 51.185  -66.867 -8.444  1.00 34.87  ? 252 CYS A N   1 
ATOM   4243  C CA  . CYS B 1 257 ? 50.408  -66.357 -7.326  1.00 33.04  ? 252 CYS A CA  1 
ATOM   4244  C C   . CYS B 1 257 ? 50.798  -64.941 -6.987  1.00 31.29  ? 252 CYS A C   1 
ATOM   4245  O O   . CYS B 1 257 ? 49.942  -64.086 -6.763  1.00 31.53  ? 252 CYS A O   1 
ATOM   4246  C CB  . CYS B 1 257 ? 50.595  -67.236 -6.098  1.00 32.66  ? 252 CYS A CB  1 
ATOM   4247  S SG  . CYS B 1 257 ? 49.808  -68.830 -6.273  1.00 35.74  ? 252 CYS A SG  1 
ATOM   4248  N N   . TYR B 1 258 ? 52.098  -64.693 -6.951  1.00 29.88  ? 253 TYR A N   1 
ATOM   4249  C CA  . TYR B 1 258 ? 52.576  -63.366 -6.634  1.00 29.48  ? 253 TYR A CA  1 
ATOM   4250  C C   . TYR B 1 258 ? 52.145  -62.372 -7.698  1.00 27.66  ? 253 TYR A C   1 
ATOM   4251  O O   . TYR B 1 258 ? 51.611  -61.315 -7.387  1.00 27.45  ? 253 TYR A O   1 
ATOM   4252  C CB  . TYR B 1 258 ? 54.094  -63.345 -6.520  1.00 31.63  ? 253 TYR A CB  1 
ATOM   4253  C CG  . TYR B 1 258 ? 54.597  -61.957 -6.255  1.00 35.51  ? 253 TYR A CG  1 
ATOM   4254  C CD1 . TYR B 1 258 ? 54.419  -61.361 -5.006  1.00 37.01  ? 253 TYR A CD1 1 
ATOM   4255  C CD2 . TYR B 1 258 ? 55.149  -61.193 -7.280  1.00 37.45  ? 253 TYR A CD2 1 
ATOM   4256  C CE1 . TYR B 1 258 ? 54.770  -60.036 -4.786  1.00 39.96  ? 253 TYR A CE1 1 
ATOM   4257  C CE2 . TYR B 1 258 ? 55.502  -59.864 -7.074  1.00 40.23  ? 253 TYR A CE2 1 
ATOM   4258  C CZ  . TYR B 1 258 ? 55.306  -59.289 -5.826  1.00 42.02  ? 253 TYR A CZ  1 
ATOM   4259  O OH  . TYR B 1 258 ? 55.609  -57.955 -5.634  1.00 46.33  ? 253 TYR A OH  1 
ATOM   4260  N N   . LEU B 1 259 ? 52.387  -62.711 -8.955  1.00 27.80  ? 254 LEU A N   1 
ATOM   4261  C CA  . LEU B 1 259 ? 52.022  -61.836 -10.055 1.00 28.29  ? 254 LEU A CA  1 
ATOM   4262  C C   . LEU B 1 259 ? 50.526  -61.586 -10.096 1.00 29.76  ? 254 LEU A C   1 
ATOM   4263  O O   . LEU B 1 259 ? 50.085  -60.443 -10.244 1.00 30.29  ? 254 LEU A O   1 
ATOM   4264  C CB  . LEU B 1 259 ? 52.497  -62.437 -11.376 1.00 28.57  ? 254 LEU A CB  1 
ATOM   4265  C CG  . LEU B 1 259 ? 53.831  -61.906 -11.916 1.00 31.29  ? 254 LEU A CG  1 
ATOM   4266  C CD1 . LEU B 1 259 ? 54.760  -61.518 -10.778 1.00 30.37  ? 254 LEU A CD1 1 
ATOM   4267  C CD2 . LEU B 1 259 ? 54.463  -62.960 -12.809 1.00 31.16  ? 254 LEU A CD2 1 
ATOM   4268  N N   . CYS B 1 260 ? 49.747  -62.653 -9.954  1.00 30.33  ? 255 CYS A N   1 
ATOM   4269  C CA  . CYS B 1 260 ? 48.297  -62.552 -9.974  1.00 30.38  ? 255 CYS A CA  1 
ATOM   4270  C C   . CYS B 1 260 ? 47.814  -61.595 -8.875  1.00 32.73  ? 255 CYS A C   1 
ATOM   4271  O O   . CYS B 1 260 ? 47.021  -60.675 -9.122  1.00 33.01  ? 255 CYS A O   1 
ATOM   4272  C CB  . CYS B 1 260 ? 47.698  -63.941 -9.774  1.00 31.39  ? 255 CYS A CB  1 
ATOM   4273  S SG  . CYS B 1 260 ? 45.899  -64.003 -9.824  1.00 32.53  ? 255 CYS A SG  1 
ATOM   4274  N N   . ASN B 1 261 ? 48.307  -61.819 -7.664  1.00 33.19  ? 256 ASN A N   1 
ATOM   4275  C CA  . ASN B 1 261 ? 47.957  -60.990 -6.520  1.00 34.51  ? 256 ASN A CA  1 
ATOM   4276  C C   . ASN B 1 261 ? 48.357  -59.537 -6.799  1.00 35.64  ? 256 ASN A C   1 
ATOM   4277  O O   . ASN B 1 261 ? 47.611  -58.603 -6.503  1.00 35.28  ? 256 ASN A O   1 
ATOM   4278  C CB  . ASN B 1 261 ? 48.678  -61.525 -5.278  1.00 33.26  ? 256 ASN A CB  1 
ATOM   4279  C CG  . ASN B 1 261 ? 48.060  -61.045 -3.978  1.00 32.18  ? 256 ASN A CG  1 
ATOM   4280  O OD1 . ASN B 1 261 ? 48.241  -61.671 -2.928  1.00 33.61  ? 256 ASN A OD1 1 
ATOM   4281  N ND2 . ASN B 1 261 ? 47.344  -59.929 -4.033  1.00 30.23  ? 256 ASN A ND2 1 
ATOM   4282  N N   . ARG B 1 262 ? 49.535  -59.361 -7.384  1.00 37.95  ? 257 ARG A N   1 
ATOM   4283  C CA  . ARG B 1 262 ? 50.050  -58.040 -7.711  1.00 39.89  ? 257 ARG A CA  1 
ATOM   4284  C C   . ARG B 1 262 ? 49.085  -57.289 -8.622  1.00 39.07  ? 257 ARG A C   1 
ATOM   4285  O O   . ARG B 1 262 ? 48.851  -56.090 -8.442  1.00 38.82  ? 257 ARG A O   1 
ATOM   4286  C CB  . ARG B 1 262 ? 51.408  -58.177 -8.405  1.00 44.75  ? 257 ARG A CB  1 
ATOM   4287  C CG  . ARG B 1 262 ? 52.025  -56.861 -8.864  1.00 51.59  ? 257 ARG A CG  1 
ATOM   4288  C CD  . ARG B 1 262 ? 52.785  -56.152 -7.748  1.00 59.58  ? 257 ARG A CD  1 
ATOM   4289  N NE  . ARG B 1 262 ? 52.993  -54.730 -8.040  1.00 64.38  ? 257 ARG A NE  1 
ATOM   4290  C CZ  . ARG B 1 262 ? 53.576  -54.253 -9.138  1.00 65.88  ? 257 ARG A CZ  1 
ATOM   4291  N NH1 . ARG B 1 262 ? 54.027  -55.071 -10.080 1.00 67.72  ? 257 ARG A NH1 1 
ATOM   4292  N NH2 . ARG B 1 262 ? 53.708  -52.948 -9.296  1.00 66.82  ? 257 ARG A NH2 1 
ATOM   4293  N N   . GLY B 1 263 ? 48.531  -58.004 -9.599  1.00 38.23  ? 258 GLY A N   1 
ATOM   4294  C CA  . GLY B 1 263 ? 47.613  -57.401 -10.555 1.00 37.25  ? 258 GLY A CA  1 
ATOM   4295  C C   . GLY B 1 263 ? 46.241  -57.039 -10.022 1.00 37.16  ? 258 GLY A C   1 
ATOM   4296  O O   . GLY B 1 263 ? 45.613  -56.091 -10.500 1.00 36.58  ? 258 GLY A O   1 
ATOM   4297  N N   . LEU B 1 264 ? 45.772  -57.800 -9.038  1.00 36.88  ? 259 LEU A N   1 
ATOM   4298  C CA  . LEU B 1 264 ? 44.467  -57.569 -8.422  1.00 35.39  ? 259 LEU A CA  1 
ATOM   4299  C C   . LEU B 1 264 ? 44.354  -56.165 -7.814  1.00 35.59  ? 259 LEU A C   1 
ATOM   4300  O O   . LEU B 1 264 ? 43.294  -55.543 -7.868  1.00 36.35  ? 259 LEU A O   1 
ATOM   4301  C CB  . LEU B 1 264 ? 44.231  -58.617 -7.333  1.00 36.62  ? 259 LEU A CB  1 
ATOM   4302  C CG  . LEU B 1 264 ? 43.289  -59.810 -7.544  1.00 36.98  ? 259 LEU A CG  1 
ATOM   4303  C CD1 . LEU B 1 264 ? 43.396  -60.384 -8.950  1.00 35.82  ? 259 LEU A CD1 1 
ATOM   4304  C CD2 . LEU B 1 264 ? 43.627  -60.863 -6.482  1.00 35.83  ? 259 LEU A CD2 1 
ATOM   4305  N N   . LYS B 1 265 ? 45.448  -55.671 -7.238  1.00 33.67  ? 260 LYS A N   1 
ATOM   4306  C CA  . LYS B 1 265 ? 45.464  -54.354 -6.613  1.00 32.78  ? 260 LYS A CA  1 
ATOM   4307  C C   . LYS B 1 265 ? 44.805  -53.269 -7.459  1.00 30.41  ? 260 LYS A C   1 
ATOM   4308  O O   . LYS B 1 265 ? 44.186  -52.366 -6.927  1.00 29.32  ? 260 LYS A O   1 
ATOM   4309  C CB  . LYS B 1 265 ? 46.900  -53.916 -6.313  1.00 34.42  ? 260 LYS A CB  1 
ATOM   4310  C CG  . LYS B 1 265 ? 47.760  -54.933 -5.569  1.00 36.24  ? 260 LYS A CG  1 
ATOM   4311  C CD  . LYS B 1 265 ? 47.474  -54.978 -4.088  1.00 37.80  ? 260 LYS A CD  1 
ATOM   4312  C CE  . LYS B 1 265 ? 48.478  -55.878 -3.375  1.00 37.05  ? 260 LYS A CE  1 
ATOM   4313  N NZ  . LYS B 1 265 ? 49.874  -55.422 -3.575  1.00 37.78  ? 260 LYS A NZ  1 
ATOM   4314  N N   . THR B 1 266 ? 44.941  -53.355 -8.775  1.00 31.38  ? 261 THR A N   1 
ATOM   4315  C CA  . THR B 1 266 ? 44.375  -52.340 -9.669  1.00 30.93  ? 261 THR A CA  1 
ATOM   4316  C C   . THR B 1 266 ? 43.151  -52.797 -10.458 1.00 30.97  ? 261 THR A C   1 
ATOM   4317  O O   . THR B 1 266 ? 42.662  -52.067 -11.326 1.00 31.86  ? 261 THR A O   1 
ATOM   4318  C CB  . THR B 1 266 ? 45.434  -51.851 -10.688 1.00 30.46  ? 261 THR A CB  1 
ATOM   4319  O OG1 . THR B 1 266 ? 45.902  -52.961 -11.476 1.00 32.69  ? 261 THR A OG1 1 
ATOM   4320  C CG2 . THR B 1 266 ? 46.611  -51.226 -9.965  1.00 30.36  ? 261 THR A CG2 1 
ATOM   4321  N N   . LEU B 1 267 ? 42.652  -53.991 -10.161 1.00 28.58  ? 262 LEU A N   1 
ATOM   4322  C CA  . LEU B 1 267 ? 41.497  -54.514 -10.874 1.00 29.25  ? 262 LEU A CA  1 
ATOM   4323  C C   . LEU B 1 267 ? 40.323  -53.535 -10.930 1.00 31.78  ? 262 LEU A C   1 
ATOM   4324  O O   . LEU B 1 267 ? 39.669  -53.401 -11.961 1.00 31.24  ? 262 LEU A O   1 
ATOM   4325  C CB  . LEU B 1 267 ? 41.045  -55.824 -10.237 1.00 28.36  ? 262 LEU A CB  1 
ATOM   4326  C CG  . LEU B 1 267 ? 39.878  -56.527 -10.926 1.00 29.08  ? 262 LEU A CG  1 
ATOM   4327  C CD1 . LEU B 1 267 ? 40.248  -56.809 -12.373 1.00 28.67  ? 262 LEU A CD1 1 
ATOM   4328  C CD2 . LEU B 1 267 ? 39.529  -57.819 -10.183 1.00 27.83  ? 262 LEU A CD2 1 
ATOM   4329  N N   . HIS B 1 268 ? 40.060  -52.854 -9.820  1.00 33.99  ? 263 HIS A N   1 
ATOM   4330  C CA  . HIS B 1 268 ? 38.961  -51.906 -9.764  1.00 36.19  ? 263 HIS A CA  1 
ATOM   4331  C C   . HIS B 1 268 ? 39.148  -50.723 -10.709 1.00 35.79  ? 263 HIS A C   1 
ATOM   4332  O O   . HIS B 1 268 ? 38.220  -50.380 -11.436 1.00 34.93  ? 263 HIS A O   1 
ATOM   4333  C CB  . HIS B 1 268 ? 38.744  -51.418 -8.322  1.00 41.02  ? 263 HIS A CB  1 
ATOM   4334  C CG  . HIS B 1 268 ? 39.936  -50.739 -7.714  1.00 46.35  ? 263 HIS A CG  1 
ATOM   4335  N ND1 . HIS B 1 268 ? 40.050  -49.368 -7.629  1.00 48.46  ? 263 HIS A ND1 1 
ATOM   4336  C CD2 . HIS B 1 268 ? 41.061  -51.244 -7.153  1.00 47.62  ? 263 HIS A CD2 1 
ATOM   4337  C CE1 . HIS B 1 268 ? 41.192  -49.059 -7.042  1.00 49.21  ? 263 HIS A CE1 1 
ATOM   4338  N NE2 . HIS B 1 268 ? 41.825  -50.179 -6.743  1.00 48.47  ? 263 HIS A NE2 1 
ATOM   4339  N N   . VAL B 1 269 ? 40.333  -50.105 -10.717 1.00 35.53  ? 264 VAL A N   1 
ATOM   4340  C CA  . VAL B 1 269 ? 40.574  -48.965 -11.606 1.00 35.66  ? 264 VAL A CA  1 
ATOM   4341  C C   . VAL B 1 269 ? 40.666  -49.375 -13.067 1.00 36.13  ? 264 VAL A C   1 
ATOM   4342  O O   . VAL B 1 269 ? 40.262  -48.617 -13.953 1.00 37.03  ? 264 VAL A O   1 
ATOM   4343  C CB  . VAL B 1 269 ? 41.860  -48.172 -11.255 1.00 34.88  ? 264 VAL A CB  1 
ATOM   4344  C CG1 . VAL B 1 269 ? 41.645  -47.370 -9.981  1.00 34.53  ? 264 VAL A CG1 1 
ATOM   4345  C CG2 . VAL B 1 269 ? 43.044  -49.109 -11.139 1.00 33.95  ? 264 VAL A CG2 1 
ATOM   4346  N N   . ARG B 1 270 ? 41.206  -50.560 -13.328 1.00 35.19  ? 265 ARG A N   1 
ATOM   4347  C CA  . ARG B 1 270 ? 41.284  -51.021 -14.699 1.00 35.35  ? 265 ARG A CA  1 
ATOM   4348  C C   . ARG B 1 270 ? 39.881  -51.326 -15.220 1.00 36.91  ? 265 ARG A C   1 
ATOM   4349  O O   . ARG B 1 270 ? 39.492  -50.819 -16.271 1.00 38.66  ? 265 ARG A O   1 
ATOM   4350  C CB  . ARG B 1 270 ? 42.169  -52.257 -14.811 1.00 34.02  ? 265 ARG A CB  1 
ATOM   4351  C CG  . ARG B 1 270 ? 43.632  -51.909 -14.922 1.00 31.98  ? 265 ARG A CG  1 
ATOM   4352  C CD  . ARG B 1 270 ? 44.488  -53.124 -15.189 1.00 31.36  ? 265 ARG A CD  1 
ATOM   4353  N NE  . ARG B 1 270 ? 44.520  -54.018 -14.039 1.00 32.58  ? 265 ARG A NE  1 
ATOM   4354  C CZ  . ARG B 1 270 ? 43.925  -55.205 -13.998 1.00 31.86  ? 265 ARG A CZ  1 
ATOM   4355  N NH1 . ARG B 1 270 ? 43.250  -55.648 -15.048 1.00 32.16  ? 265 ARG A NH1 1 
ATOM   4356  N NH2 . ARG B 1 270 ? 44.004  -55.948 -12.905 1.00 32.04  ? 265 ARG A NH2 1 
ATOM   4357  N N   . MET B 1 271 ? 39.113  -52.125 -14.482 1.00 36.67  ? 266 MET A N   1 
ATOM   4358  C CA  . MET B 1 271 ? 37.764  -52.473 -14.909 1.00 38.11  ? 266 MET A CA  1 
ATOM   4359  C C   . MET B 1 271 ? 36.821  -51.273 -15.065 1.00 39.24  ? 266 MET A C   1 
ATOM   4360  O O   . MET B 1 271 ? 35.961  -51.276 -15.944 1.00 40.07  ? 266 MET A O   1 
ATOM   4361  C CB  . MET B 1 271 ? 37.151  -53.511 -13.962 1.00 37.57  ? 266 MET A CB  1 
ATOM   4362  C CG  . MET B 1 271 ? 37.822  -54.882 -14.033 1.00 38.07  ? 266 MET A CG  1 
ATOM   4363  S SD  . MET B 1 271 ? 37.984  -55.497 -15.732 1.00 38.39  ? 266 MET A SD  1 
ATOM   4364  C CE  . MET B 1 271 ? 36.733  -56.806 -15.787 1.00 41.21  ? 266 MET A CE  1 
ATOM   4365  N N   . GLU B 1 272 ? 36.967  -50.245 -14.232 1.00 40.09  ? 267 GLU A N   1 
ATOM   4366  C CA  . GLU B 1 272 ? 36.098  -49.075 -14.369 1.00 41.90  ? 267 GLU A CA  1 
ATOM   4367  C C   . GLU B 1 272 ? 36.318  -48.380 -15.704 1.00 39.88  ? 267 GLU A C   1 
ATOM   4368  O O   . GLU B 1 272 ? 35.370  -47.915 -16.324 1.00 40.44  ? 267 GLU A O   1 
ATOM   4369  C CB  . GLU B 1 272 ? 36.319  -48.058 -13.238 1.00 44.40  ? 267 GLU A CB  1 
ATOM   4370  C CG  . GLU B 1 272 ? 35.475  -48.313 -11.990 1.00 50.22  ? 267 GLU A CG  1 
ATOM   4371  C CD  . GLU B 1 272 ? 33.966  -48.307 -12.262 1.00 53.77  ? 267 GLU A CD  1 
ATOM   4372  O OE1 . GLU B 1 272 ? 33.196  -48.660 -11.341 1.00 54.87  ? 267 GLU A OE1 1 
ATOM   4373  O OE2 . GLU B 1 272 ? 33.548  -47.949 -13.387 1.00 55.36  ? 267 GLU A OE2 1 
ATOM   4374  N N   . LYS B 1 273 ? 37.568  -48.305 -16.145 1.00 39.27  ? 268 LYS A N   1 
ATOM   4375  C CA  . LYS B 1 273 ? 37.876  -47.661 -17.415 1.00 38.07  ? 268 LYS A CA  1 
ATOM   4376  C C   . LYS B 1 273 ? 37.427  -48.520 -18.592 1.00 37.50  ? 268 LYS A C   1 
ATOM   4377  O O   . LYS B 1 273 ? 37.050  -47.999 -19.641 1.00 37.32  ? 268 LYS A O   1 
ATOM   4378  C CB  . LYS B 1 273 ? 39.371  -47.385 -17.524 1.00 38.65  ? 268 LYS A CB  1 
ATOM   4379  C CG  . LYS B 1 273 ? 39.770  -46.736 -18.835 1.00 40.25  ? 268 LYS A CG  1 
ATOM   4380  C CD  . LYS B 1 273 ? 39.136  -45.358 -19.021 1.00 39.34  ? 268 LYS A CD  1 
ATOM   4381  C CE  . LYS B 1 273 ? 39.712  -44.694 -20.268 1.00 39.35  ? 268 LYS A CE  1 
ATOM   4382  N NZ  . LYS B 1 273 ? 39.294  -43.288 -20.440 1.00 40.03  ? 268 LYS A NZ  1 
ATOM   4383  N N   . HIS B 1 274 ? 37.480  -49.837 -18.426 1.00 36.27  ? 269 HIS A N   1 
ATOM   4384  C CA  . HIS B 1 274 ? 37.053  -50.730 -19.492 1.00 36.17  ? 269 HIS A CA  1 
ATOM   4385  C C   . HIS B 1 274 ? 35.572  -50.458 -19.697 1.00 38.73  ? 269 HIS A C   1 
ATOM   4386  O O   . HIS B 1 274 ? 35.062  -50.506 -20.818 1.00 40.63  ? 269 HIS A O   1 
ATOM   4387  C CB  . HIS B 1 274 ? 37.230  -52.195 -19.091 1.00 33.61  ? 269 HIS A CB  1 
ATOM   4388  C CG  . HIS B 1 274 ? 38.604  -52.745 -19.325 1.00 31.76  ? 269 HIS A CG  1 
ATOM   4389  N ND1 . HIS B 1 274 ? 39.183  -52.797 -20.575 1.00 29.82  ? 269 HIS A ND1 1 
ATOM   4390  C CD2 . HIS B 1 274 ? 39.476  -53.352 -18.482 1.00 31.26  ? 269 HIS A CD2 1 
ATOM   4391  C CE1 . HIS B 1 274 ? 40.348  -53.417 -20.492 1.00 30.12  ? 269 HIS A CE1 1 
ATOM   4392  N NE2 . HIS B 1 274 ? 40.550  -53.765 -19.233 1.00 30.37  ? 269 HIS A NE2 1 
ATOM   4393  N N   . PHE B 1 275 ? 34.894  -50.166 -18.590 1.00 41.06  ? 270 PHE A N   1 
ATOM   4394  C CA  . PHE B 1 275 ? 33.461  -49.900 -18.581 1.00 42.54  ? 270 PHE A CA  1 
ATOM   4395  C C   . PHE B 1 275 ? 33.091  -48.533 -19.163 1.00 42.49  ? 270 PHE A C   1 
ATOM   4396  O O   . PHE B 1 275 ? 32.131  -48.425 -19.928 1.00 42.39  ? 270 PHE A O   1 
ATOM   4397  C CB  . PHE B 1 275 ? 32.939  -50.055 -17.147 1.00 43.97  ? 270 PHE A CB  1 
ATOM   4398  C CG  . PHE B 1 275 ? 31.456  -49.865 -17.005 1.00 46.06  ? 270 PHE A CG  1 
ATOM   4399  C CD1 . PHE B 1 275 ? 30.589  -50.214 -18.036 1.00 47.24  ? 270 PHE A CD1 1 
ATOM   4400  C CD2 . PHE B 1 275 ? 30.923  -49.364 -15.819 1.00 45.56  ? 270 PHE A CD2 1 
ATOM   4401  C CE1 . PHE B 1 275 ? 29.210  -50.067 -17.888 1.00 48.58  ? 270 PHE A CE1 1 
ATOM   4402  C CE2 . PHE B 1 275 ? 29.555  -49.216 -15.660 1.00 45.75  ? 270 PHE A CE2 1 
ATOM   4403  C CZ  . PHE B 1 275 ? 28.693  -49.567 -16.695 1.00 47.95  ? 270 PHE A CZ  1 
ATOM   4404  N N   . LYS B 1 276 ? 33.838  -47.491 -18.807 1.00 43.91  ? 271 LYS A N   1 
ATOM   4405  C CA  . LYS B 1 276 ? 33.557  -46.157 -19.346 1.00 45.97  ? 271 LYS A CA  1 
ATOM   4406  C C   . LYS B 1 276 ? 33.776  -46.176 -20.851 1.00 44.20  ? 271 LYS A C   1 
ATOM   4407  O O   . LYS B 1 276 ? 32.983  -45.624 -21.612 1.00 43.82  ? 271 LYS A O   1 
ATOM   4408  C CB  . LYS B 1 276 ? 34.478  -45.094 -18.737 1.00 49.67  ? 271 LYS A CB  1 
ATOM   4409  C CG  . LYS B 1 276 ? 34.057  -44.569 -17.382 1.00 55.56  ? 271 LYS A CG  1 
ATOM   4410  C CD  . LYS B 1 276 ? 34.948  -43.399 -16.934 1.00 62.00  ? 271 LYS A CD  1 
ATOM   4411  C CE  . LYS B 1 276 ? 34.852  -42.175 -17.868 1.00 64.03  ? 271 LYS A CE  1 
ATOM   4412  N NZ  . LYS B 1 276 ? 35.534  -42.357 -19.192 1.00 65.26  ? 271 LYS A NZ  1 
ATOM   4413  N N   . ASN B 1 277 ? 34.871  -46.808 -21.265 1.00 42.46  ? 272 ASN A N   1 
ATOM   4414  C CA  . ASN B 1 277 ? 35.208  -46.916 -22.672 1.00 39.26  ? 272 ASN A CA  1 
ATOM   4415  C C   . ASN B 1 277 ? 34.216  -47.846 -23.362 1.00 39.49  ? 272 ASN A C   1 
ATOM   4416  O O   . ASN B 1 277 ? 33.797  -47.584 -24.486 1.00 38.29  ? 272 ASN A O   1 
ATOM   4417  C CB  . ASN B 1 277 ? 36.643  -47.433 -22.830 1.00 38.95  ? 272 ASN A CB  1 
ATOM   4418  C CG  . ASN B 1 277 ? 37.695  -46.334 -22.656 1.00 37.16  ? 272 ASN A CG  1 
ATOM   4419  O OD1 . ASN B 1 277 ? 37.370  -45.180 -22.355 1.00 37.02  ? 272 ASN A OD1 1 
ATOM   4420  N ND2 . ASN B 1 277 ? 38.961  -46.693 -22.850 1.00 34.01  ? 272 ASN A ND2 1 
ATOM   4421  N N   . GLY B 1 278 ? 33.830  -48.925 -22.685 1.00 40.85  ? 273 GLY A N   1 
ATOM   4422  C CA  . GLY B 1 278 ? 32.870  -49.857 -23.265 1.00 42.65  ? 273 GLY A CA  1 
ATOM   4423  C C   . GLY B 1 278 ? 31.534  -49.176 -23.540 1.00 43.27  ? 273 GLY A C   1 
ATOM   4424  O O   . GLY B 1 278 ? 30.996  -49.230 -24.653 1.00 42.31  ? 273 GLY A O   1 
ATOM   4425  N N   . MET B 1 279 ? 31.002  -48.533 -22.505 1.00 43.40  ? 274 MET A N   1 
ATOM   4426  C CA  . MET B 1 279 ? 29.747  -47.805 -22.592 1.00 43.71  ? 274 MET A CA  1 
ATOM   4427  C C   . MET B 1 279 ? 29.805  -46.816 -23.776 1.00 43.03  ? 274 MET A C   1 
ATOM   4428  O O   . MET B 1 279 ? 28.941  -46.838 -24.656 1.00 42.86  ? 274 MET A O   1 
ATOM   4429  C CB  . MET B 1 279 ? 29.522  -47.043 -21.286 1.00 45.92  ? 274 MET A CB  1 
ATOM   4430  C CG  . MET B 1 279 ? 28.088  -46.615 -21.032 1.00 48.23  ? 274 MET A CG  1 
ATOM   4431  S SD  . MET B 1 279 ? 27.014  -48.014 -20.664 1.00 53.78  ? 274 MET A SD  1 
ATOM   4432  C CE  . MET B 1 279 ? 25.760  -47.835 -21.926 1.00 50.15  ? 274 MET A CE  1 
ATOM   4433  N N   . ALA B 1 280 ? 30.829  -45.961 -23.791 1.00 40.41  ? 275 ALA A N   1 
ATOM   4434  C CA  . ALA B 1 280 ? 31.009  -44.972 -24.851 1.00 38.28  ? 275 ALA A CA  1 
ATOM   4435  C C   . ALA B 1 280 ? 30.988  -45.605 -26.239 1.00 40.09  ? 275 ALA A C   1 
ATOM   4436  O O   . ALA B 1 280 ? 30.260  -45.157 -27.126 1.00 39.86  ? 275 ALA A O   1 
ATOM   4437  C CB  . ALA B 1 280 ? 32.313  -44.235 -24.650 1.00 34.33  ? 275 ALA A CB  1 
ATOM   4438  N N   . VAL B 1 281 ? 31.804  -46.639 -26.425 1.00 41.18  ? 276 VAL A N   1 
ATOM   4439  C CA  . VAL B 1 281 ? 31.871  -47.339 -27.698 1.00 42.17  ? 276 VAL A CA  1 
ATOM   4440  C C   . VAL B 1 281 ? 30.505  -47.908 -28.041 1.00 43.48  ? 276 VAL A C   1 
ATOM   4441  O O   . VAL B 1 281 ? 30.036  -47.755 -29.160 1.00 45.37  ? 276 VAL A O   1 
ATOM   4442  C CB  . VAL B 1 281 ? 32.888  -48.516 -27.659 1.00 42.76  ? 276 VAL A CB  1 
ATOM   4443  C CG1 . VAL B 1 281 ? 32.684  -49.423 -28.866 1.00 42.26  ? 276 VAL A CG1 1 
ATOM   4444  C CG2 . VAL B 1 281 ? 34.314  -47.988 -27.653 1.00 40.02  ? 276 VAL A CG2 1 
ATOM   4445  N N   . ALA B 1 282 ? 29.865  -48.568 -27.081 1.00 44.55  ? 277 ALA A N   1 
ATOM   4446  C CA  . ALA B 1 282 ? 28.557  -49.166 -27.322 1.00 46.26  ? 277 ALA A CA  1 
ATOM   4447  C C   . ALA B 1 282 ? 27.508  -48.152 -27.779 1.00 48.91  ? 277 ALA A C   1 
ATOM   4448  O O   . ALA B 1 282 ? 26.676  -48.459 -28.637 1.00 49.94  ? 277 ALA A O   1 
ATOM   4449  C CB  . ALA B 1 282 ? 28.078  -49.887 -26.074 1.00 44.90  ? 277 ALA A CB  1 
ATOM   4450  N N   . GLN B 1 283 ? 27.545  -46.950 -27.206 1.00 51.01  ? 278 GLN A N   1 
ATOM   4451  C CA  . GLN B 1 283 ? 26.598  -45.896 -27.564 1.00 52.99  ? 278 GLN A CA  1 
ATOM   4452  C C   . GLN B 1 283 ? 26.863  -45.379 -28.967 1.00 51.18  ? 278 GLN A C   1 
ATOM   4453  O O   . GLN B 1 283 ? 25.975  -45.375 -29.820 1.00 52.07  ? 278 GLN A O   1 
ATOM   4454  C CB  . GLN B 1 283 ? 26.698  -44.743 -26.577 1.00 57.86  ? 278 GLN A CB  1 
ATOM   4455  C CG  . GLN B 1 283 ? 25.820  -44.895 -25.359 1.00 64.94  ? 278 GLN A CG  1 
ATOM   4456  C CD  . GLN B 1 283 ? 26.247  -43.969 -24.248 1.00 69.87  ? 278 GLN A CD  1 
ATOM   4457  O OE1 . GLN B 1 283 ? 26.690  -42.844 -24.497 1.00 73.16  ? 278 GLN A OE1 1 
ATOM   4458  N NE2 . GLN B 1 283 ? 26.114  -44.430 -23.012 1.00 72.40  ? 278 GLN A NE2 1 
ATOM   4459  N N   . PHE B 1 284 ? 28.088  -44.925 -29.190 1.00 49.33  ? 279 PHE A N   1 
ATOM   4460  C CA  . PHE B 1 284 ? 28.499  -44.425 -30.490 1.00 48.38  ? 279 PHE A CA  1 
ATOM   4461  C C   . PHE B 1 284 ? 28.015  -45.364 -31.608 1.00 48.30  ? 279 PHE A C   1 
ATOM   4462  O O   . PHE B 1 284 ? 27.422  -44.927 -32.602 1.00 45.86  ? 279 PHE A O   1 
ATOM   4463  C CB  . PHE B 1 284 ? 30.024  -44.330 -30.529 1.00 47.94  ? 279 PHE A CB  1 
ATOM   4464  C CG  . PHE B 1 284 ? 30.575  -43.982 -31.878 1.00 48.38  ? 279 PHE A CG  1 
ATOM   4465  C CD1 . PHE B 1 284 ? 30.707  -42.651 -32.268 1.00 47.65  ? 279 PHE A CD1 1 
ATOM   4466  C CD2 . PHE B 1 284 ? 30.947  -44.986 -32.772 1.00 48.00  ? 279 PHE A CD2 1 
ATOM   4467  C CE1 . PHE B 1 284 ? 31.201  -42.321 -33.525 1.00 47.41  ? 279 PHE A CE1 1 
ATOM   4468  C CE2 . PHE B 1 284 ? 31.441  -44.668 -34.034 1.00 48.67  ? 279 PHE A CE2 1 
ATOM   4469  C CZ  . PHE B 1 284 ? 31.569  -43.332 -34.412 1.00 48.30  ? 279 PHE A CZ  1 
ATOM   4470  N N   . LEU B 1 285 ? 28.276  -46.655 -31.429 1.00 49.26  ? 280 LEU A N   1 
ATOM   4471  C CA  . LEU B 1 285 ? 27.904  -47.669 -32.407 1.00 51.06  ? 280 LEU A CA  1 
ATOM   4472  C C   . LEU B 1 285 ? 26.415  -47.732 -32.665 1.00 52.27  ? 280 LEU A C   1 
ATOM   4473  O O   . LEU B 1 285 ? 25.974  -47.608 -33.806 1.00 52.49  ? 280 LEU A O   1 
ATOM   4474  C CB  . LEU B 1 285 ? 28.403  -49.049 -31.960 1.00 49.74  ? 280 LEU A CB  1 
ATOM   4475  C CG  . LEU B 1 285 ? 29.918  -49.248 -32.033 1.00 48.61  ? 280 LEU A CG  1 
ATOM   4476  C CD1 . LEU B 1 285 ? 30.262  -50.607 -31.467 1.00 49.39  ? 280 LEU A CD1 1 
ATOM   4477  C CD2 . LEU B 1 285 ? 30.402  -49.118 -33.477 1.00 46.66  ? 280 LEU A CD2 1 
ATOM   4478  N N   . GLU B 1 286 ? 25.644  -47.932 -31.604 1.00 54.54  ? 281 GLU A N   1 
ATOM   4479  C CA  . GLU B 1 286 ? 24.192  -48.022 -31.715 1.00 57.40  ? 281 GLU A CA  1 
ATOM   4480  C C   . GLU B 1 286 ? 23.564  -46.768 -32.322 1.00 57.83  ? 281 GLU A C   1 
ATOM   4481  O O   . GLU B 1 286 ? 22.446  -46.811 -32.829 1.00 58.04  ? 281 GLU A O   1 
ATOM   4482  C CB  . GLU B 1 286 ? 23.593  -48.299 -30.338 1.00 58.23  ? 281 GLU A CB  1 
ATOM   4483  C CG  . GLU B 1 286 ? 22.090  -48.345 -30.306 1.00 59.11  ? 281 GLU A CG  1 
ATOM   4484  C CD  . GLU B 1 286 ? 21.580  -49.061 -29.077 1.00 61.37  ? 281 GLU A CD  1 
ATOM   4485  O OE1 . GLU B 1 286 ? 21.686  -50.310 -29.039 1.00 60.34  ? 281 GLU A OE1 1 
ATOM   4486  O OE2 . GLU B 1 286 ? 21.088  -48.375 -28.150 1.00 61.78  ? 281 GLU A OE2 1 
ATOM   4487  N N   . SER B 1 287 ? 24.292  -45.658 -32.275 1.00 58.85  ? 282 SER A N   1 
ATOM   4488  C CA  . SER B 1 287 ? 23.803  -44.406 -32.828 1.00 60.96  ? 282 SER A CA  1 
ATOM   4489  C C   . SER B 1 287 ? 24.401  -44.157 -34.208 1.00 61.96  ? 282 SER A C   1 
ATOM   4490  O O   . SER B 1 287 ? 24.144  -43.122 -34.821 1.00 62.68  ? 282 SER A O   1 
ATOM   4491  C CB  . SER B 1 287 ? 24.163  -43.242 -31.903 1.00 61.34  ? 282 SER A CB  1 
ATOM   4492  O OG  . SER B 1 287 ? 23.615  -43.417 -30.605 1.00 63.65  ? 282 SER A OG  1 
ATOM   4493  N N   . ASN B 1 288 ? 25.196  -45.104 -34.696 1.00 62.85  ? 283 ASN A N   1 
ATOM   4494  C CA  . ASN B 1 288 ? 25.833  -44.966 -36.003 1.00 65.08  ? 283 ASN A CA  1 
ATOM   4495  C C   . ASN B 1 288 ? 24.984  -45.560 -37.141 1.00 68.42  ? 283 ASN A C   1 
ATOM   4496  O O   . ASN B 1 288 ? 24.517  -46.705 -37.064 1.00 67.76  ? 283 ASN A O   1 
ATOM   4497  C CB  . ASN B 1 288 ? 27.223  -45.618 -35.966 1.00 64.78  ? 283 ASN A CB  1 
ATOM   4498  C CG  . ASN B 1 288 ? 28.047  -45.329 -37.216 1.00 64.53  ? 283 ASN A CG  1 
ATOM   4499  O OD1 . ASN B 1 288 ? 27.845  -45.940 -38.265 1.00 65.14  ? 283 ASN A OD1 1 
ATOM   4500  N ND2 . ASN B 1 288 ? 28.977  -44.387 -37.106 1.00 62.88  ? 283 ASN A ND2 1 
ATOM   4501  N N   . PRO B 1 289 ? 24.777  -44.780 -38.218 1.00 67.34  ? 284 PRO A N   1 
ATOM   4502  C CA  . PRO B 1 289 ? 23.994  -45.167 -39.398 1.00 68.03  ? 284 PRO A CA  1 
ATOM   4503  C C   . PRO B 1 289 ? 24.416  -46.474 -40.073 1.00 68.57  ? 284 PRO A C   1 
ATOM   4504  O O   . PRO B 1 289 ? 23.615  -47.114 -40.758 1.00 69.12  ? 284 PRO A O   1 
ATOM   4505  C CB  . PRO B 1 289 ? 24.171  -43.970 -40.330 1.00 68.48  ? 284 PRO A CB  1 
ATOM   4506  C CG  . PRO B 1 289 ? 24.323  -42.828 -39.381 1.00 68.16  ? 284 PRO A CG  1 
ATOM   4507  C CD  . PRO B 1 289 ? 25.275  -43.400 -38.365 1.00 67.96  ? 284 PRO A CD  1 
ATOM   4508  N N   . TRP B 1 290 ? 25.670  -46.866 -39.875 1.00 66.82  ? 285 TRP A N   1 
ATOM   4509  C CA  . TRP B 1 290 ? 26.204  -48.075 -40.495 1.00 65.22  ? 285 TRP A CA  1 
ATOM   4510  C C   . TRP B 1 290 ? 26.185  -49.322 -39.601 1.00 62.69  ? 285 TRP A C   1 
ATOM   4511  O O   . TRP B 1 290 ? 26.764  -50.357 -39.949 1.00 61.66  ? 285 TRP A O   1 
ATOM   4512  C CB  . TRP B 1 290 ? 27.631  -47.795 -40.969 1.00 67.80  ? 285 TRP A CB  1 
ATOM   4513  C CG  . TRP B 1 290 ? 27.724  -46.637 -41.919 1.00 70.98  ? 285 TRP A CG  1 
ATOM   4514  C CD1 . TRP B 1 290 ? 28.599  -45.591 -41.856 1.00 71.52  ? 285 TRP A CD1 1 
ATOM   4515  C CD2 . TRP B 1 290 ? 26.926  -46.424 -43.090 1.00 73.41  ? 285 TRP A CD2 1 
ATOM   4516  N NE1 . TRP B 1 290 ? 28.398  -44.739 -42.916 1.00 72.43  ? 285 TRP A NE1 1 
ATOM   4517  C CE2 . TRP B 1 290 ? 27.377  -45.226 -43.690 1.00 73.99  ? 285 TRP A CE2 1 
ATOM   4518  C CE3 . TRP B 1 290 ? 25.873  -47.129 -43.694 1.00 74.48  ? 285 TRP A CE3 1 
ATOM   4519  C CZ2 . TRP B 1 290 ? 26.809  -44.716 -44.866 1.00 75.61  ? 285 TRP A CZ2 1 
ATOM   4520  C CZ3 . TRP B 1 290 ? 25.308  -46.621 -44.864 1.00 75.25  ? 285 TRP A CZ3 1 
ATOM   4521  C CH2 . TRP B 1 290 ? 25.779  -45.426 -45.436 1.00 75.78  ? 285 TRP A CH2 1 
ATOM   4522  N N   . VAL B 1 291 ? 25.513  -49.224 -38.456 1.00 59.97  ? 286 VAL A N   1 
ATOM   4523  C CA  . VAL B 1 291 ? 25.433  -50.344 -37.526 1.00 57.63  ? 286 VAL A CA  1 
ATOM   4524  C C   . VAL B 1 291 ? 23.999  -50.841 -37.360 1.00 59.49  ? 286 VAL A C   1 
ATOM   4525  O O   . VAL B 1 291 ? 23.139  -50.124 -36.847 1.00 59.12  ? 286 VAL A O   1 
ATOM   4526  C CB  . VAL B 1 291 ? 25.994  -49.951 -36.131 1.00 52.54  ? 286 VAL A CB  1 
ATOM   4527  C CG1 . VAL B 1 291 ? 25.997  -51.156 -35.203 1.00 48.25  ? 286 VAL A CG1 1 
ATOM   4528  C CG2 . VAL B 1 291 ? 27.395  -49.394 -36.274 1.00 48.51  ? 286 VAL A CG2 1 
ATOM   4529  N N   . GLU B 1 292 ? 23.748  -52.075 -37.791 1.00 63.12  ? 287 GLU A N   1 
ATOM   4530  C CA  . GLU B 1 292 ? 22.416  -52.667 -37.679 1.00 68.21  ? 287 GLU A CA  1 
ATOM   4531  C C   . GLU B 1 292 ? 21.943  -52.797 -36.241 1.00 66.11  ? 287 GLU A C   1 
ATOM   4532  O O   . GLU B 1 292 ? 20.838  -52.370 -35.905 1.00 66.43  ? 287 GLU A O   1 
ATOM   4533  C CB  . GLU B 1 292 ? 22.372  -54.045 -38.347 1.00 74.35  ? 287 GLU A CB  1 
ATOM   4534  C CG  . GLU B 1 292 ? 21.772  -54.010 -39.739 1.00 85.32  ? 287 GLU A CG  1 
ATOM   4535  C CD  . GLU B 1 292 ? 20.355  -53.460 -39.741 1.00 91.10  ? 287 GLU A CD  1 
ATOM   4536  O OE1 . GLU B 1 292 ? 19.853  -53.124 -40.835 1.00 95.15  ? 287 GLU A OE1 1 
ATOM   4537  O OE2 . GLU B 1 292 ? 19.745  -53.371 -38.650 1.00 94.10  ? 287 GLU A OE2 1 
ATOM   4538  N N   . LYS B 1 293 ? 22.774  -53.398 -35.395 1.00 63.27  ? 288 LYS A N   1 
ATOM   4539  C CA  . LYS B 1 293 ? 22.415  -53.570 -33.995 1.00 59.50  ? 288 LYS A CA  1 
ATOM   4540  C C   . LYS B 1 293 ? 23.625  -53.644 -33.072 1.00 56.28  ? 288 LYS A C   1 
ATOM   4541  O O   . LYS B 1 293 ? 24.734  -53.963 -33.499 1.00 56.34  ? 288 LYS A O   1 
ATOM   4542  C CB  . LYS B 1 293 ? 21.563  -54.832 -33.821 1.00 59.51  ? 288 LYS A CB  1 
ATOM   4543  C CG  . LYS B 1 293 ? 21.050  -55.016 -32.405 1.00 59.47  ? 288 LYS A CG  1 
ATOM   4544  C CD  . LYS B 1 293 ? 19.924  -56.031 -32.327 1.00 59.53  ? 288 LYS A CD  1 
ATOM   4545  C CE  . LYS B 1 293 ? 20.375  -57.420 -32.727 1.00 60.05  ? 288 LYS A CE  1 
ATOM   4546  N NZ  . LYS B 1 293 ? 19.341  -58.435 -32.375 1.00 60.98  ? 288 LYS A NZ  1 
ATOM   4547  N N   . VAL B 1 294 ? 23.402  -53.321 -31.804 1.00 51.29  ? 289 VAL A N   1 
ATOM   4548  C CA  . VAL B 1 294 ? 24.455  -53.387 -30.809 1.00 46.16  ? 289 VAL A CA  1 
ATOM   4549  C C   . VAL B 1 294 ? 23.942  -54.243 -29.666 1.00 47.74  ? 289 VAL A C   1 
ATOM   4550  O O   . VAL B 1 294 ? 22.742  -54.277 -29.379 1.00 47.87  ? 289 VAL A O   1 
ATOM   4551  C CB  . VAL B 1 294 ? 24.845  -51.996 -30.256 1.00 43.59  ? 289 VAL A CB  1 
ATOM   4552  C CG1 . VAL B 1 294 ? 25.773  -52.155 -29.054 1.00 40.62  ? 289 VAL A CG1 1 
ATOM   4553  C CG2 . VAL B 1 294 ? 25.550  -51.186 -31.326 1.00 40.14  ? 289 VAL A CG2 1 
ATOM   4554  N N   . ILE B 1 295 ? 24.860  -54.959 -29.034 1.00 47.51  ? 290 ILE A N   1 
ATOM   4555  C CA  . ILE B 1 295 ? 24.521  -55.812 -27.912 1.00 47.02  ? 290 ILE A CA  1 
ATOM   4556  C C   . ILE B 1 295 ? 25.579  -55.534 -26.859 1.00 47.29  ? 290 ILE A C   1 
ATOM   4557  O O   . ILE B 1 295 ? 26.735  -55.936 -26.994 1.00 49.01  ? 290 ILE A O   1 
ATOM   4558  C CB  . ILE B 1 295 ? 24.557  -57.287 -28.309 1.00 45.86  ? 290 ILE A CB  1 
ATOM   4559  C CG1 . ILE B 1 295 ? 23.717  -57.498 -29.563 1.00 45.66  ? 290 ILE A CG1 1 
ATOM   4560  C CG2 . ILE B 1 295 ? 24.015  -58.138 -27.183 1.00 46.29  ? 290 ILE A CG2 1 
ATOM   4561  C CD1 . ILE B 1 295 ? 24.058  -58.767 -30.295 1.00 48.49  ? 290 ILE A CD1 1 
ATOM   4562  N N   . TYR B 1 296 ? 25.181  -54.802 -25.830 1.00 46.43  ? 291 TYR A N   1 
ATOM   4563  C CA  . TYR B 1 296 ? 26.077  -54.459 -24.753 1.00 45.55  ? 291 TYR A CA  1 
ATOM   4564  C C   . TYR B 1 296 ? 25.224  -54.339 -23.514 1.00 46.46  ? 291 TYR A C   1 
ATOM   4565  O O   . TYR B 1 296 ? 24.410  -53.432 -23.411 1.00 47.82  ? 291 TYR A O   1 
ATOM   4566  C CB  . TYR B 1 296 ? 26.774  -53.133 -25.039 1.00 44.28  ? 291 TYR A CB  1 
ATOM   4567  C CG  . TYR B 1 296 ? 27.730  -52.721 -23.944 1.00 45.07  ? 291 TYR A CG  1 
ATOM   4568  C CD1 . TYR B 1 296 ? 28.822  -53.527 -23.605 1.00 46.18  ? 291 TYR A CD1 1 
ATOM   4569  C CD2 . TYR B 1 296 ? 27.546  -51.532 -23.236 1.00 45.84  ? 291 TYR A CD2 1 
ATOM   4570  C CE1 . TYR B 1 296 ? 29.704  -53.161 -22.592 1.00 44.39  ? 291 TYR A CE1 1 
ATOM   4571  C CE2 . TYR B 1 296 ? 28.429  -51.154 -22.218 1.00 45.33  ? 291 TYR A CE2 1 
ATOM   4572  C CZ  . TYR B 1 296 ? 29.503  -51.976 -21.908 1.00 44.95  ? 291 TYR A CZ  1 
ATOM   4573  O OH  . TYR B 1 296 ? 30.392  -51.606 -20.931 1.00 47.54  ? 291 TYR A OH  1 
ATOM   4574  N N   . PRO B 1 297 ? 25.393  -55.260 -22.557 1.00 46.44  ? 292 PRO A N   1 
ATOM   4575  C CA  . PRO B 1 297 ? 24.629  -55.265 -21.305 1.00 47.80  ? 292 PRO A CA  1 
ATOM   4576  C C   . PRO B 1 297 ? 24.515  -53.901 -20.624 1.00 48.24  ? 292 PRO A C   1 
ATOM   4577  O O   . PRO B 1 297 ? 23.658  -53.706 -19.764 1.00 49.19  ? 292 PRO A O   1 
ATOM   4578  C CB  . PRO B 1 297 ? 25.391  -56.271 -20.447 1.00 47.60  ? 292 PRO A CB  1 
ATOM   4579  C CG  . PRO B 1 297 ? 25.872  -57.256 -21.461 1.00 47.07  ? 292 PRO A CG  1 
ATOM   4580  C CD  . PRO B 1 297 ? 26.374  -56.360 -22.574 1.00 46.78  ? 292 PRO A CD  1 
ATOM   4581  N N   . GLY B 1 298 ? 25.376  -52.965 -21.009 1.00 48.00  ? 293 GLY A N   1 
ATOM   4582  C CA  . GLY B 1 298 ? 25.346  -51.649 -20.403 1.00 47.89  ? 293 GLY A CA  1 
ATOM   4583  C C   . GLY B 1 298 ? 24.304  -50.710 -20.972 1.00 48.47  ? 293 GLY A C   1 
ATOM   4584  O O   . GLY B 1 298 ? 23.974  -49.703 -20.352 1.00 49.86  ? 293 GLY A O   1 
ATOM   4585  N N   . LEU B 1 299 ? 23.788  -51.025 -22.153 1.00 48.87  ? 294 LEU A N   1 
ATOM   4586  C CA  . LEU B 1 299 ? 22.782  -50.183 -22.795 1.00 48.65  ? 294 LEU A CA  1 
ATOM   4587  C C   . LEU B 1 299 ? 21.397  -50.666 -22.403 1.00 49.68  ? 294 LEU A C   1 
ATOM   4588  O O   . LEU B 1 299 ? 21.217  -51.839 -22.071 1.00 50.67  ? 294 LEU A O   1 
ATOM   4589  C CB  . LEU B 1 299 ? 22.913  -50.256 -24.324 1.00 46.54  ? 294 LEU A CB  1 
ATOM   4590  C CG  . LEU B 1 299 ? 24.177  -49.739 -25.012 1.00 43.56  ? 294 LEU A CG  1 
ATOM   4591  C CD1 . LEU B 1 299 ? 24.125  -50.081 -26.489 1.00 42.81  ? 294 LEU A CD1 1 
ATOM   4592  C CD2 . LEU B 1 299 ? 24.300  -48.246 -24.808 1.00 41.51  ? 294 LEU A CD2 1 
ATOM   4593  N N   . PRO B 1 300 ? 20.399  -49.765 -22.421 1.00 50.67  ? 295 PRO A N   1 
ATOM   4594  C CA  . PRO B 1 300 ? 19.019  -50.130 -22.069 1.00 50.30  ? 295 PRO A CA  1 
ATOM   4595  C C   . PRO B 1 300 ? 18.351  -50.939 -23.181 1.00 50.97  ? 295 PRO A C   1 
ATOM   4596  O O   . PRO B 1 300 ? 17.359  -51.636 -22.949 1.00 50.32  ? 295 PRO A O   1 
ATOM   4597  C CB  . PRO B 1 300 ? 18.352  -48.779 -21.854 1.00 49.35  ? 295 PRO A CB  1 
ATOM   4598  C CG  . PRO B 1 300 ? 19.098  -47.893 -22.804 1.00 49.73  ? 295 PRO A CG  1 
ATOM   4599  C CD  . PRO B 1 300 ? 20.529  -48.305 -22.586 1.00 49.33  ? 295 PRO A CD  1 
ATOM   4600  N N   . SER B 1 301 ? 18.917  -50.838 -24.385 1.00 52.06  ? 296 SER A N   1 
ATOM   4601  C CA  . SER B 1 301 ? 18.420  -51.543 -25.566 1.00 52.26  ? 296 SER A CA  1 
ATOM   4602  C C   . SER B 1 301 ? 18.627  -53.060 -25.464 1.00 52.97  ? 296 SER A C   1 
ATOM   4603  O O   . SER B 1 301 ? 17.975  -53.843 -26.169 1.00 53.22  ? 296 SER A O   1 
ATOM   4604  C CB  . SER B 1 301 ? 19.129  -51.024 -26.817 1.00 51.26  ? 296 SER A CB  1 
ATOM   4605  O OG  . SER B 1 301 ? 20.507  -51.355 -26.791 1.00 51.95  ? 296 SER A OG  1 
ATOM   4606  N N   . HIS B 1 302 ? 19.545  -53.468 -24.594 1.00 53.10  ? 297 HIS A N   1 
ATOM   4607  C CA  . HIS B 1 302 ? 19.827  -54.881 -24.395 1.00 53.42  ? 297 HIS A CA  1 
ATOM   4608  C C   . HIS B 1 302 ? 18.558  -55.577 -23.901 1.00 53.92  ? 297 HIS A C   1 
ATOM   4609  O O   . HIS B 1 302 ? 17.832  -55.039 -23.067 1.00 53.95  ? 297 HIS A O   1 
ATOM   4610  C CB  . HIS B 1 302 ? 20.943  -55.054 -23.359 1.00 53.48  ? 297 HIS A CB  1 
ATOM   4611  C CG  . HIS B 1 302 ? 21.450  -56.459 -23.247 1.00 53.87  ? 297 HIS A CG  1 
ATOM   4612  N ND1 . HIS B 1 302 ? 22.375  -56.989 -24.121 1.00 54.36  ? 297 HIS A ND1 1 
ATOM   4613  C CD2 . HIS B 1 302 ? 21.126  -57.458 -22.392 1.00 53.33  ? 297 HIS A CD2 1 
ATOM   4614  C CE1 . HIS B 1 302 ? 22.598  -58.253 -23.810 1.00 54.00  ? 297 HIS A CE1 1 
ATOM   4615  N NE2 . HIS B 1 302 ? 21.852  -58.562 -22.765 1.00 53.34  ? 297 HIS A NE2 1 
ATOM   4616  N N   . PRO B 1 303 ? 18.278  -56.788 -24.404 1.00 54.59  ? 298 PRO A N   1 
ATOM   4617  C CA  . PRO B 1 303 ? 17.085  -57.529 -23.992 1.00 55.57  ? 298 PRO A CA  1 
ATOM   4618  C C   . PRO B 1 303 ? 17.087  -57.977 -22.542 1.00 56.18  ? 298 PRO A C   1 
ATOM   4619  O O   . PRO B 1 303 ? 16.116  -58.579 -22.094 1.00 58.44  ? 298 PRO A O   1 
ATOM   4620  C CB  . PRO B 1 303 ? 17.063  -58.713 -24.953 1.00 55.28  ? 298 PRO A CB  1 
ATOM   4621  C CG  . PRO B 1 303 ? 18.513  -58.968 -25.181 1.00 55.43  ? 298 PRO A CG  1 
ATOM   4622  C CD  . PRO B 1 303 ? 19.048  -57.561 -25.391 1.00 55.35  ? 298 PRO A CD  1 
ATOM   4623  N N   . GLN B 1 304 ? 18.167  -57.704 -21.813 1.00 56.19  ? 299 GLN A N   1 
ATOM   4624  C CA  . GLN B 1 304 ? 18.246  -58.088 -20.403 1.00 58.15  ? 299 GLN A CA  1 
ATOM   4625  C C   . GLN B 1 304 ? 18.792  -56.972 -19.523 1.00 59.39  ? 299 GLN A C   1 
ATOM   4626  O O   . GLN B 1 304 ? 19.157  -57.213 -18.373 1.00 59.02  ? 299 GLN A O   1 
ATOM   4627  C CB  . GLN B 1 304 ? 19.118  -59.334 -20.215 1.00 57.40  ? 299 GLN A CB  1 
ATOM   4628  C CG  . GLN B 1 304 ? 18.450  -60.643 -20.581 1.00 58.06  ? 299 GLN A CG  1 
ATOM   4629  C CD  . GLN B 1 304 ? 19.176  -61.359 -21.700 1.00 59.29  ? 299 GLN A CD  1 
ATOM   4630  O OE1 . GLN B 1 304 ? 20.382  -61.580 -21.626 1.00 60.58  ? 299 GLN A OE1 1 
ATOM   4631  N NE2 . GLN B 1 304 ? 18.446  -61.725 -22.743 1.00 60.53  ? 299 GLN A NE2 1 
ATOM   4632  N N   . HIS B 1 305 ? 18.838  -55.757 -20.061 1.00 61.33  ? 300 HIS A N   1 
ATOM   4633  C CA  . HIS B 1 305 ? 19.354  -54.604 -19.329 1.00 64.43  ? 300 HIS A CA  1 
ATOM   4634  C C   . HIS B 1 305 ? 18.830  -54.505 -17.898 1.00 63.63  ? 300 HIS A C   1 
ATOM   4635  O O   . HIS B 1 305 ? 19.532  -54.036 -16.998 1.00 63.14  ? 300 HIS A O   1 
ATOM   4636  C CB  . HIS B 1 305 ? 19.020  -53.313 -20.075 1.00 69.41  ? 300 HIS A CB  1 
ATOM   4637  C CG  . HIS B 1 305 ? 19.626  -52.089 -19.460 1.00 76.20  ? 300 HIS A CG  1 
ATOM   4638  N ND1 . HIS B 1 305 ? 20.987  -51.874 -19.417 1.00 78.27  ? 300 HIS A ND1 1 
ATOM   4639  C CD2 . HIS B 1 305 ? 19.058  -51.017 -18.858 1.00 79.62  ? 300 HIS A CD2 1 
ATOM   4640  C CE1 . HIS B 1 305 ? 21.231  -50.722 -18.817 1.00 80.02  ? 300 HIS A CE1 1 
ATOM   4641  N NE2 . HIS B 1 305 ? 20.077  -50.182 -18.468 1.00 80.94  ? 300 HIS A NE2 1 
ATOM   4642  N N   . GLU B 1 306 ? 17.597  -54.943 -17.681 1.00 62.72  ? 301 GLU A N   1 
ATOM   4643  C CA  . GLU B 1 306 ? 17.030  -54.874 -16.349 1.00 62.29  ? 301 GLU A CA  1 
ATOM   4644  C C   . GLU B 1 306 ? 17.500  -56.025 -15.461 1.00 59.42  ? 301 GLU A C   1 
ATOM   4645  O O   . GLU B 1 306 ? 17.559  -55.882 -14.240 1.00 59.47  ? 301 GLU A O   1 
ATOM   4646  C CB  . GLU B 1 306 ? 15.503  -54.801 -16.440 1.00 65.30  ? 301 GLU A CB  1 
ATOM   4647  C CG  . GLU B 1 306 ? 15.020  -53.540 -17.179 1.00 70.79  ? 301 GLU A CG  1 
ATOM   4648  C CD  . GLU B 1 306 ? 15.465  -52.229 -16.508 1.00 73.17  ? 301 GLU A CD  1 
ATOM   4649  O OE1 . GLU B 1 306 ? 15.531  -51.183 -17.203 1.00 73.33  ? 301 GLU A OE1 1 
ATOM   4650  O OE2 . GLU B 1 306 ? 15.737  -52.242 -15.285 1.00 74.46  ? 301 GLU A OE2 1 
ATOM   4651  N N   . LEU B 1 307 ? 17.845  -57.160 -16.062 1.00 56.75  ? 302 LEU A N   1 
ATOM   4652  C CA  . LEU B 1 307 ? 18.353  -58.286 -15.280 1.00 55.02  ? 302 LEU A CA  1 
ATOM   4653  C C   . LEU B 1 307 ? 19.779  -57.898 -14.896 1.00 55.63  ? 302 LEU A C   1 
ATOM   4654  O O   . LEU B 1 307 ? 20.241  -58.169 -13.788 1.00 55.94  ? 302 LEU A O   1 
ATOM   4655  C CB  . LEU B 1 307 ? 18.402  -59.567 -16.114 1.00 52.37  ? 302 LEU A CB  1 
ATOM   4656  C CG  . LEU B 1 307 ? 18.475  -60.902 -15.351 1.00 49.49  ? 302 LEU A CG  1 
ATOM   4657  C CD1 . LEU B 1 307 ? 18.798  -62.019 -16.323 1.00 47.49  ? 302 LEU A CD1 1 
ATOM   4658  C CD2 . LEU B 1 307 ? 19.522  -60.856 -14.265 1.00 48.76  ? 302 LEU A CD2 1 
ATOM   4659  N N   . VAL B 1 308 ? 20.466  -57.256 -15.838 1.00 56.30  ? 303 VAL A N   1 
ATOM   4660  C CA  . VAL B 1 308 ? 21.838  -56.799 -15.650 1.00 56.36  ? 303 VAL A CA  1 
ATOM   4661  C C   . VAL B 1 308 ? 21.976  -55.794 -14.500 1.00 56.99  ? 303 VAL A C   1 
ATOM   4662  O O   . VAL B 1 308 ? 22.902  -55.894 -13.705 1.00 58.30  ? 303 VAL A O   1 
ATOM   4663  C CB  . VAL B 1 308 ? 22.392  -56.152 -16.955 1.00 55.32  ? 303 VAL A CB  1 
ATOM   4664  C CG1 . VAL B 1 308 ? 23.777  -55.571 -16.712 1.00 54.53  ? 303 VAL A CG1 1 
ATOM   4665  C CG2 . VAL B 1 308 ? 22.446  -57.188 -18.063 1.00 53.01  ? 303 VAL A CG2 1 
ATOM   4666  N N   . LYS B 1 309 ? 21.066  -54.830 -14.400 1.00 56.84  ? 304 LYS A N   1 
ATOM   4667  C CA  . LYS B 1 309 ? 21.161  -53.849 -13.327 1.00 58.17  ? 304 LYS A CA  1 
ATOM   4668  C C   . LYS B 1 309 ? 20.916  -54.417 -11.934 1.00 58.17  ? 304 LYS A C   1 
ATOM   4669  O O   . LYS B 1 309 ? 21.310  -53.807 -10.948 1.00 59.30  ? 304 LYS A O   1 
ATOM   4670  C CB  . LYS B 1 309 ? 20.209  -52.677 -13.578 1.00 59.98  ? 304 LYS A CB  1 
ATOM   4671  C CG  . LYS B 1 309 ? 20.705  -51.705 -14.644 1.00 63.62  ? 304 LYS A CG  1 
ATOM   4672  C CD  . LYS B 1 309 ? 19.827  -50.458 -14.735 1.00 67.49  ? 304 LYS A CD  1 
ATOM   4673  C CE  . LYS B 1 309 ? 18.386  -50.800 -15.117 1.00 69.72  ? 304 LYS A CE  1 
ATOM   4674  N NZ  . LYS B 1 309 ? 17.520  -49.589 -15.268 1.00 71.09  ? 304 LYS A NZ  1 
ATOM   4675  N N   . ARG B 1 310 ? 20.277  -55.579 -11.842 1.00 58.24  ? 305 ARG A N   1 
ATOM   4676  C CA  . ARG B 1 310 ? 19.997  -56.194 -10.541 1.00 58.59  ? 305 ARG A CA  1 
ATOM   4677  C C   . ARG B 1 310 ? 20.884  -57.404 -10.248 1.00 57.49  ? 305 ARG A C   1 
ATOM   4678  O O   . ARG B 1 310 ? 20.591  -58.200 -9.355  1.00 57.28  ? 305 ARG A O   1 
ATOM   4679  C CB  . ARG B 1 310 ? 18.521  -56.610 -10.460 1.00 60.76  ? 305 ARG A CB  1 
ATOM   4680  C CG  . ARG B 1 310 ? 17.992  -57.337 -11.696 1.00 65.91  ? 305 ARG A CG  1 
ATOM   4681  C CD  . ARG B 1 310 ? 16.538  -57.781 -11.525 1.00 68.95  ? 305 ARG A CD  1 
ATOM   4682  N NE  . ARG B 1 310 ? 16.430  -59.001 -10.728 1.00 73.82  ? 305 ARG A NE  1 
ATOM   4683  C CZ  . ARG B 1 310 ? 16.573  -60.236 -11.209 1.00 75.81  ? 305 ARG A CZ  1 
ATOM   4684  N NH1 . ARG B 1 310 ? 16.826  -60.428 -12.498 1.00 76.68  ? 305 ARG A NH1 1 
ATOM   4685  N NH2 . ARG B 1 310 ? 16.471  -61.285 -10.400 1.00 75.56  ? 305 ARG A NH2 1 
ATOM   4686  N N   . GLN B 1 311 ? 21.978  -57.528 -10.990 1.00 55.99  ? 306 GLN A N   1 
ATOM   4687  C CA  . GLN B 1 311 ? 22.895  -58.654 -10.828 1.00 54.29  ? 306 GLN A CA  1 
ATOM   4688  C C   . GLN B 1 311 ? 24.372  -58.233 -10.916 1.00 52.51  ? 306 GLN A C   1 
ATOM   4689  O O   . GLN B 1 311 ? 25.241  -58.855 -10.302 1.00 51.30  ? 306 GLN A O   1 
ATOM   4690  C CB  . GLN B 1 311 ? 22.563  -59.708 -11.890 1.00 53.90  ? 306 GLN A CB  1 
ATOM   4691  C CG  . GLN B 1 311 ? 23.607  -60.773 -12.103 1.00 54.01  ? 306 GLN A CG  1 
ATOM   4692  C CD  . GLN B 1 311 ? 23.125  -61.849 -13.053 1.00 55.80  ? 306 GLN A CD  1 
ATOM   4693  O OE1 . GLN B 1 311 ? 22.262  -62.654 -12.705 1.00 56.95  ? 306 GLN A OE1 1 
ATOM   4694  N NE2 . GLN B 1 311 ? 23.668  -61.863 -14.266 1.00 55.96  ? 306 GLN A NE2 1 
ATOM   4695  N N   . CYS B 1 312 ? 24.638  -57.166 -11.667 1.00 50.54  ? 307 CYS A N   1 
ATOM   4696  C CA  . CYS B 1 312 ? 25.990  -56.651 -11.848 1.00 48.71  ? 307 CYS A CA  1 
ATOM   4697  C C   . CYS B 1 312 ? 26.079  -55.234 -11.320 1.00 46.70  ? 307 CYS A C   1 
ATOM   4698  O O   . CYS B 1 312 ? 25.062  -54.595 -11.062 1.00 47.28  ? 307 CYS A O   1 
ATOM   4699  C CB  . CYS B 1 312 ? 26.360  -56.629 -13.328 1.00 48.40  ? 307 CYS A CB  1 
ATOM   4700  S SG  . CYS B 1 312 ? 25.823  -58.071 -14.227 1.00 52.61  ? 307 CYS A SG  1 
ATOM   4701  N N   . THR B 1 313 ? 27.308  -54.750 -11.166 1.00 46.41  ? 308 THR A N   1 
ATOM   4702  C CA  . THR B 1 313 ? 27.549  -53.392 -10.697 1.00 44.88  ? 308 THR A CA  1 
ATOM   4703  C C   . THR B 1 313 ? 28.159  -52.617 -11.856 1.00 42.39  ? 308 THR A C   1 
ATOM   4704  O O   . THR B 1 313 ? 28.599  -51.480 -11.692 1.00 41.79  ? 308 THR A O   1 
ATOM   4705  C CB  . THR B 1 313 ? 28.523  -53.365 -9.511  1.00 44.90  ? 308 THR A CB  1 
ATOM   4706  O OG1 . THR B 1 313 ? 29.837  -53.713 -9.965  1.00 47.00  ? 308 THR A OG1 1 
ATOM   4707  C CG2 . THR B 1 313 ? 28.077  -54.353 -8.437  1.00 44.90  ? 308 THR A CG2 1 
ATOM   4708  N N   . GLY B 1 314 ? 28.176  -53.250 -13.029 1.00 41.97  ? 309 GLY A N   1 
ATOM   4709  C CA  . GLY B 1 314 ? 28.726  -52.622 -14.219 1.00 42.83  ? 309 GLY A CA  1 
ATOM   4710  C C   . GLY B 1 314 ? 29.001  -53.622 -15.324 1.00 43.20  ? 309 GLY A C   1 
ATOM   4711  O O   . GLY B 1 314 ? 28.575  -54.772 -15.231 1.00 42.75  ? 309 GLY A O   1 
ATOM   4712  N N   . CYS B 1 315 ? 29.717  -53.184 -16.361 1.00 45.68  ? 310 CYS A N   1 
ATOM   4713  C CA  . CYS B 1 315 ? 30.050  -54.041 -17.501 1.00 48.61  ? 310 CYS A CA  1 
ATOM   4714  C C   . CYS B 1 315 ? 31.498  -53.975 -17.982 1.00 48.44  ? 310 CYS A C   1 
ATOM   4715  O O   . CYS B 1 315 ? 32.211  -52.996 -17.761 1.00 48.65  ? 310 CYS A O   1 
ATOM   4716  C CB  . CYS B 1 315 ? 29.143  -53.719 -18.685 1.00 48.86  ? 310 CYS A CB  1 
ATOM   4717  S SG  . CYS B 1 315 ? 27.419  -54.049 -18.371 1.00 54.88  ? 310 CYS A SG  1 
ATOM   4718  N N   . THR B 1 316 ? 31.900  -55.041 -18.667 1.00 50.18  ? 311 THR A N   1 
ATOM   4719  C CA  . THR B 1 316 ? 33.233  -55.197 -19.232 1.00 51.31  ? 311 THR A CA  1 
ATOM   4720  C C   . THR B 1 316 ? 33.360  -54.307 -20.469 1.00 47.62  ? 311 THR A C   1 
ATOM   4721  O O   . THR B 1 316 ? 32.454  -53.548 -20.800 1.00 47.65  ? 311 THR A O   1 
ATOM   4722  C CB  . THR B 1 316 ? 33.460  -56.662 -19.664 1.00 54.19  ? 311 THR A CB  1 
ATOM   4723  O OG1 . THR B 1 316 ? 32.874  -57.539 -18.696 1.00 58.62  ? 311 THR A OG1 1 
ATOM   4724  C CG2 . THR B 1 316 ? 34.939  -56.972 -19.760 1.00 59.54  ? 311 THR A CG2 1 
ATOM   4725  N N   . GLY B 1 317 ? 34.493  -54.401 -21.147 1.00 44.75  ? 312 GLY A N   1 
ATOM   4726  C CA  . GLY B 1 317 ? 34.687  -53.613 -22.342 1.00 43.75  ? 312 GLY A CA  1 
ATOM   4727  C C   . GLY B 1 317 ? 34.304  -54.440 -23.556 1.00 42.75  ? 312 GLY A C   1 
ATOM   4728  O O   . GLY B 1 317 ? 34.639  -54.081 -24.685 1.00 40.07  ? 312 GLY A O   1 
ATOM   4729  N N   . MET B 1 318 ? 33.616  -55.560 -23.322 1.00 43.79  ? 313 MET A N   1 
ATOM   4730  C CA  . MET B 1 318 ? 33.182  -56.431 -24.412 1.00 43.97  ? 313 MET A CA  1 
ATOM   4731  C C   . MET B 1 318 ? 31.896  -55.916 -25.035 1.00 43.41  ? 313 MET A C   1 
ATOM   4732  O O   . MET B 1 318 ? 30.810  -56.014 -24.450 1.00 43.46  ? 313 MET A O   1 
ATOM   4733  C CB  . MET B 1 318 ? 32.976  -57.880 -23.942 1.00 45.55  ? 313 MET A CB  1 
ATOM   4734  C CG  . MET B 1 318 ? 32.214  -58.739 -24.975 1.00 47.59  ? 313 MET A CG  1 
ATOM   4735  S SD  . MET B 1 318 ? 32.373  -60.555 -24.860 1.00 52.18  ? 313 MET A SD  1 
ATOM   4736  C CE  . MET B 1 318 ? 31.307  -60.961 -23.373 1.00 50.16  ? 313 MET A CE  1 
ATOM   4737  N N   . VAL B 1 319 ? 32.041  -55.359 -26.231 1.00 41.97  ? 314 VAL A N   1 
ATOM   4738  C CA  . VAL B 1 319 ? 30.925  -54.816 -26.978 1.00 40.09  ? 314 VAL A CA  1 
ATOM   4739  C C   . VAL B 1 319 ? 30.773  -55.574 -28.290 1.00 40.42  ? 314 VAL A C   1 
ATOM   4740  O O   . VAL B 1 319 ? 31.730  -55.734 -29.045 1.00 39.67  ? 314 VAL A O   1 
ATOM   4741  C CB  . VAL B 1 319 ? 31.146  -53.325 -27.284 1.00 37.67  ? 314 VAL A CB  1 
ATOM   4742  C CG1 . VAL B 1 319 ? 30.027  -52.801 -28.160 1.00 36.76  ? 314 VAL A CG1 1 
ATOM   4743  C CG2 . VAL B 1 319 ? 31.216  -52.544 -25.994 1.00 35.07  ? 314 VAL A CG2 1 
ATOM   4744  N N   . THR B 1 320 ? 29.565  -56.056 -28.548 1.00 41.02  ? 315 THR A N   1 
ATOM   4745  C CA  . THR B 1 320 ? 29.292  -56.772 -29.782 1.00 41.28  ? 315 THR A CA  1 
ATOM   4746  C C   . THR B 1 320 ? 28.369  -55.896 -30.629 1.00 43.03  ? 315 THR A C   1 
ATOM   4747  O O   . THR B 1 320 ? 27.602  -55.094 -30.096 1.00 43.01  ? 315 THR A O   1 
ATOM   4748  C CB  . THR B 1 320 ? 28.609  -58.106 -29.500 1.00 39.84  ? 315 THR A CB  1 
ATOM   4749  O OG1 . THR B 1 320 ? 29.440  -58.882 -28.632 1.00 38.54  ? 315 THR A OG1 1 
ATOM   4750  C CG2 . THR B 1 320 ? 28.371  -58.868 -30.798 1.00 39.97  ? 315 THR A CG2 1 
ATOM   4751  N N   . PHE B 1 321 ? 28.448  -56.033 -31.947 1.00 43.62  ? 316 PHE A N   1 
ATOM   4752  C CA  . PHE B 1 321 ? 27.598  -55.231 -32.816 1.00 43.95  ? 316 PHE A CA  1 
ATOM   4753  C C   . PHE B 1 321 ? 27.565  -55.766 -34.243 1.00 44.63  ? 316 PHE A C   1 
ATOM   4754  O O   . PHE B 1 321 ? 28.521  -56.379 -34.708 1.00 45.37  ? 316 PHE A O   1 
ATOM   4755  C CB  . PHE B 1 321 ? 28.082  -53.780 -32.808 1.00 41.60  ? 316 PHE A CB  1 
ATOM   4756  C CG  . PHE B 1 321 ? 29.205  -53.499 -33.770 1.00 40.51  ? 316 PHE A CG  1 
ATOM   4757  C CD1 . PHE B 1 321 ? 28.936  -53.225 -35.106 1.00 38.57  ? 316 PHE A CD1 1 
ATOM   4758  C CD2 . PHE B 1 321 ? 30.528  -53.470 -33.333 1.00 39.99  ? 316 PHE A CD2 1 
ATOM   4759  C CE1 . PHE B 1 321 ? 29.961  -52.922 -35.992 1.00 39.58  ? 316 PHE A CE1 1 
ATOM   4760  C CE2 . PHE B 1 321 ? 31.564  -53.167 -34.212 1.00 38.83  ? 316 PHE A CE2 1 
ATOM   4761  C CZ  . PHE B 1 321 ? 31.281  -52.891 -35.545 1.00 40.06  ? 316 PHE A CZ  1 
ATOM   4762  N N   . TYR B 1 322 ? 26.455  -55.535 -34.934 1.00 45.40  ? 317 TYR A N   1 
ATOM   4763  C CA  . TYR B 1 322 ? 26.310  -55.981 -36.312 1.00 44.59  ? 317 TYR A CA  1 
ATOM   4764  C C   . TYR B 1 322 ? 26.523  -54.792 -37.215 1.00 45.76  ? 317 TYR A C   1 
ATOM   4765  O O   . TYR B 1 322 ? 25.973  -53.723 -36.971 1.00 46.59  ? 317 TYR A O   1 
ATOM   4766  C CB  . TYR B 1 322 ? 24.919  -56.557 -36.544 1.00 43.53  ? 317 TYR A CB  1 
ATOM   4767  C CG  . TYR B 1 322 ? 24.629  -57.765 -35.686 1.00 44.49  ? 317 TYR A CG  1 
ATOM   4768  C CD1 . TYR B 1 322 ? 24.323  -57.633 -34.330 1.00 42.99  ? 317 TYR A CD1 1 
ATOM   4769  C CD2 . TYR B 1 322 ? 24.676  -59.051 -36.229 1.00 44.07  ? 317 TYR A CD2 1 
ATOM   4770  C CE1 . TYR B 1 322 ? 24.070  -58.758 -33.541 1.00 44.05  ? 317 TYR A CE1 1 
ATOM   4771  C CE2 . TYR B 1 322 ? 24.426  -60.175 -35.452 1.00 43.54  ? 317 TYR A CE2 1 
ATOM   4772  C CZ  . TYR B 1 322 ? 24.123  -60.026 -34.114 1.00 44.15  ? 317 TYR A CZ  1 
ATOM   4773  O OH  . TYR B 1 322 ? 23.857  -61.150 -33.363 1.00 45.45  ? 317 TYR A OH  1 
ATOM   4774  N N   . ILE B 1 323 ? 27.333  -54.966 -38.250 1.00 48.11  ? 318 ILE A N   1 
ATOM   4775  C CA  . ILE B 1 323 ? 27.597  -53.877 -39.178 1.00 50.58  ? 318 ILE A CA  1 
ATOM   4776  C C   . ILE B 1 323 ? 26.621  -53.959 -40.345 1.00 54.11  ? 318 ILE A C   1 
ATOM   4777  O O   . ILE B 1 323 ? 26.434  -55.028 -40.922 1.00 55.67  ? 318 ILE A O   1 
ATOM   4778  C CB  . ILE B 1 323 ? 29.035  -53.951 -39.708 1.00 50.12  ? 318 ILE A CB  1 
ATOM   4779  C CG1 . ILE B 1 323 ? 29.273  -52.806 -40.696 1.00 50.06  ? 318 ILE A CG1 1 
ATOM   4780  C CG2 . ILE B 1 323 ? 29.292  -55.323 -40.332 1.00 46.95  ? 318 ILE A CG2 1 
ATOM   4781  C CD1 . ILE B 1 323 ? 30.739  -52.405 -40.840 1.00 50.55  ? 318 ILE A CD1 1 
ATOM   4782  N N   . LYS B 1 324 ? 25.983  -52.842 -40.685 1.00 56.68  ? 319 LYS A N   1 
ATOM   4783  C CA  . LYS B 1 324 ? 25.024  -52.829 -41.795 1.00 57.96  ? 319 LYS A CA  1 
ATOM   4784  C C   . LYS B 1 324 ? 25.677  -53.277 -43.102 1.00 58.42  ? 319 LYS A C   1 
ATOM   4785  O O   . LYS B 1 324 ? 26.651  -52.664 -43.549 1.00 59.14  ? 319 LYS A O   1 
ATOM   4786  C CB  . LYS B 1 324 ? 24.440  -51.424 -42.000 1.00 58.90  ? 319 LYS A CB  1 
ATOM   4787  C CG  . LYS B 1 324 ? 23.193  -51.100 -41.188 1.00 61.85  ? 319 LYS A CG  1 
ATOM   4788  C CD  . LYS B 1 324 ? 22.544  -49.808 -41.706 1.00 64.23  ? 319 LYS A CD  1 
ATOM   4789  C CE  . LYS B 1 324 ? 21.290  -49.408 -40.928 1.00 64.73  ? 319 LYS A CE  1 
ATOM   4790  N NZ  . LYS B 1 324 ? 21.589  -48.808 -39.594 1.00 64.84  ? 319 LYS A NZ  1 
ATOM   4791  N N   . GLY B 1 325 ? 25.140  -54.334 -43.714 1.00 57.47  ? 320 GLY A N   1 
ATOM   4792  C CA  . GLY B 1 325 ? 25.685  -54.815 -44.975 1.00 56.19  ? 320 GLY A CA  1 
ATOM   4793  C C   . GLY B 1 325 ? 25.942  -56.308 -45.019 1.00 57.16  ? 320 GLY A C   1 
ATOM   4794  O O   . GLY B 1 325 ? 25.155  -57.094 -44.487 1.00 54.65  ? 320 GLY A O   1 
ATOM   4795  N N   . THR B 1 326 ? 27.046  -56.692 -45.660 1.00 59.15  ? 321 THR A N   1 
ATOM   4796  C CA  . THR B 1 326 ? 27.438  -58.100 -45.784 1.00 62.72  ? 321 THR A CA  1 
ATOM   4797  C C   . THR B 1 326 ? 28.827  -58.386 -45.228 1.00 65.40  ? 321 THR A C   1 
ATOM   4798  O O   . THR B 1 326 ? 29.558  -57.473 -44.841 1.00 65.55  ? 321 THR A O   1 
ATOM   4799  C CB  . THR B 1 326 ? 27.461  -58.559 -47.248 1.00 62.72  ? 321 THR A CB  1 
ATOM   4800  O OG1 . THR B 1 326 ? 27.647  -57.419 -48.098 1.00 63.36  ? 321 THR A OG1 1 
ATOM   4801  C CG2 . THR B 1 326 ? 26.185  -59.314 -47.601 1.00 63.58  ? 321 THR A CG2 1 
ATOM   4802  N N   . LEU B 1 327 ? 29.187  -59.666 -45.214 1.00 66.82  ? 322 LEU A N   1 
ATOM   4803  C CA  . LEU B 1 327 ? 30.494  -60.096 -44.735 1.00 69.79  ? 322 LEU A CA  1 
ATOM   4804  C C   . LEU B 1 327 ? 31.602  -59.341 -45.456 1.00 73.81  ? 322 LEU A C   1 
ATOM   4805  O O   . LEU B 1 327 ? 32.739  -59.299 -44.993 1.00 74.33  ? 322 LEU A O   1 
ATOM   4806  C CB  . LEU B 1 327 ? 30.670  -61.594 -44.973 1.00 66.57  ? 322 LEU A CB  1 
ATOM   4807  C CG  . LEU B 1 327 ? 32.095  -62.138 -44.858 1.00 64.00  ? 322 LEU A CG  1 
ATOM   4808  C CD1 . LEU B 1 327 ? 32.650  -61.907 -43.465 1.00 63.11  ? 322 LEU A CD1 1 
ATOM   4809  C CD2 . LEU B 1 327 ? 32.075  -63.607 -45.183 1.00 63.04  ? 322 LEU A CD2 1 
ATOM   4810  N N   . GLN B 1 328 ? 31.266  -58.754 -46.599 1.00 78.50  ? 323 GLN A N   1 
ATOM   4811  C CA  . GLN B 1 328 ? 32.234  -58.002 -47.377 1.00 83.34  ? 323 GLN A CA  1 
ATOM   4812  C C   . GLN B 1 328 ? 32.456  -56.652 -46.711 1.00 80.58  ? 323 GLN A C   1 
ATOM   4813  O O   . GLN B 1 328 ? 33.510  -56.036 -46.868 1.00 80.80  ? 323 GLN A O   1 
ATOM   4814  C CB  . GLN B 1 328 ? 31.718  -57.796 -48.800 1.00 92.11  ? 323 GLN A CB  1 
ATOM   4815  C CG  . GLN B 1 328 ? 32.720  -57.126 -49.725 1.00 105.10 ? 323 GLN A CG  1 
ATOM   4816  C CD  . GLN B 1 328 ? 32.099  -56.665 -51.033 1.00 112.05 ? 323 GLN A CD  1 
ATOM   4817  O OE1 . GLN B 1 328 ? 32.792  -56.157 -51.917 1.00 116.69 ? 323 GLN A OE1 1 
ATOM   4818  N NE2 . GLN B 1 328 ? 30.786  -56.835 -51.158 1.00 116.50 ? 323 GLN A NE2 1 
ATOM   4819  N N   . HIS B 1 329 ? 31.453  -56.200 -45.965 1.00 77.48  ? 324 HIS A N   1 
ATOM   4820  C CA  . HIS B 1 329 ? 31.525  -54.919 -45.271 1.00 74.60  ? 324 HIS A CA  1 
ATOM   4821  C C   . HIS B 1 329 ? 32.200  -55.051 -43.915 1.00 71.77  ? 324 HIS A C   1 
ATOM   4822  O O   . HIS B 1 329 ? 32.920  -54.151 -43.474 1.00 71.19  ? 324 HIS A O   1 
ATOM   4823  C CB  . HIS B 1 329 ? 30.124  -54.337 -45.116 1.00 75.45  ? 324 HIS A CB  1 
ATOM   4824  C CG  . HIS B 1 329 ? 29.532  -53.865 -46.404 1.00 77.06  ? 324 HIS A CG  1 
ATOM   4825  N ND1 . HIS B 1 329 ? 28.198  -53.547 -46.540 1.00 78.16  ? 324 HIS A ND1 1 
ATOM   4826  C CD2 . HIS B 1 329 ? 30.098  -53.634 -47.612 1.00 77.90  ? 324 HIS A CD2 1 
ATOM   4827  C CE1 . HIS B 1 329 ? 27.970  -53.138 -47.774 1.00 78.95  ? 324 HIS A CE1 1 
ATOM   4828  N NE2 . HIS B 1 329 ? 29.107  -53.182 -48.446 1.00 78.41  ? 324 HIS A NE2 1 
ATOM   4829  N N   . ALA B 1 330 ? 31.960  -56.169 -43.244 1.00 68.58  ? 325 ALA A N   1 
ATOM   4830  C CA  . ALA B 1 330 ? 32.598  -56.397 -41.963 1.00 67.32  ? 325 ALA A CA  1 
ATOM   4831  C C   . ALA B 1 330 ? 34.096  -56.439 -42.287 1.00 67.23  ? 325 ALA A C   1 
ATOM   4832  O O   . ALA B 1 330 ? 34.935  -56.008 -41.493 1.00 66.74  ? 325 ALA A O   1 
ATOM   4833  C CB  . ALA B 1 330 ? 32.133  -57.723 -41.372 1.00 65.99  ? 325 ALA A CB  1 
ATOM   4834  N N   . GLU B 1 331 ? 34.409  -56.949 -43.476 1.00 67.29  ? 326 GLU A N   1 
ATOM   4835  C CA  . GLU B 1 331 ? 35.779  -57.051 -43.961 1.00 68.50  ? 326 GLU A CA  1 
ATOM   4836  C C   . GLU B 1 331 ? 36.419  -55.676 -44.080 1.00 67.92  ? 326 GLU A C   1 
ATOM   4837  O O   . GLU B 1 331 ? 37.438  -55.394 -43.446 1.00 67.42  ? 326 GLU A O   1 
ATOM   4838  C CB  . GLU B 1 331 ? 35.797  -57.720 -45.332 1.00 72.53  ? 326 GLU A CB  1 
ATOM   4839  C CG  . GLU B 1 331 ? 35.654  -59.215 -45.293 1.00 80.14  ? 326 GLU A CG  1 
ATOM   4840  C CD  . GLU B 1 331 ? 36.882  -59.876 -44.727 1.00 84.67  ? 326 GLU A CD  1 
ATOM   4841  O OE1 . GLU B 1 331 ? 37.963  -59.715 -45.328 1.00 87.83  ? 326 GLU A OE1 1 
ATOM   4842  O OE2 . GLU B 1 331 ? 36.773  -60.550 -43.683 1.00 88.11  ? 326 GLU A OE2 1 
ATOM   4843  N N   . ILE B 1 332 ? 35.820  -54.825 -44.907 1.00 66.79  ? 327 ILE A N   1 
ATOM   4844  C CA  . ILE B 1 332 ? 36.336  -53.480 -45.116 1.00 66.45  ? 327 ILE A CA  1 
ATOM   4845  C C   . ILE B 1 332 ? 36.542  -52.809 -43.768 1.00 65.47  ? 327 ILE A C   1 
ATOM   4846  O O   . ILE B 1 332 ? 37.607  -52.256 -43.488 1.00 64.73  ? 327 ILE A O   1 
ATOM   4847  C CB  . ILE B 1 332 ? 35.361  -52.619 -45.947 1.00 67.60  ? 327 ILE A CB  1 
ATOM   4848  C CG1 . ILE B 1 332 ? 34.998  -53.343 -47.242 1.00 69.04  ? 327 ILE A CG1 1 
ATOM   4849  C CG2 . ILE B 1 332 ? 35.997  -51.273 -46.270 1.00 67.37  ? 327 ILE A CG2 1 
ATOM   4850  C CD1 . ILE B 1 332 ? 36.188  -53.672 -48.114 1.00 71.07  ? 327 ILE A CD1 1 
ATOM   4851  N N   . PHE B 1 333 ? 35.511  -52.870 -42.935 1.00 64.32  ? 328 PHE A N   1 
ATOM   4852  C CA  . PHE B 1 333 ? 35.566  -52.274 -41.613 1.00 63.35  ? 328 PHE A CA  1 
ATOM   4853  C C   . PHE B 1 333 ? 36.819  -52.708 -40.850 1.00 62.00  ? 328 PHE A C   1 
ATOM   4854  O O   . PHE B 1 333 ? 37.722  -51.902 -40.626 1.00 61.10  ? 328 PHE A O   1 
ATOM   4855  C CB  . PHE B 1 333 ? 34.313  -52.653 -40.819 1.00 64.20  ? 328 PHE A CB  1 
ATOM   4856  C CG  . PHE B 1 333 ? 34.385  -52.280 -39.370 1.00 64.54  ? 328 PHE A CG  1 
ATOM   4857  C CD1 . PHE B 1 333 ? 34.533  -50.951 -38.988 1.00 64.75  ? 328 PHE A CD1 1 
ATOM   4858  C CD2 . PHE B 1 333 ? 34.334  -53.259 -38.385 1.00 64.71  ? 328 PHE A CD2 1 
ATOM   4859  C CE1 . PHE B 1 333 ? 34.632  -50.603 -37.642 1.00 65.27  ? 328 PHE A CE1 1 
ATOM   4860  C CE2 . PHE B 1 333 ? 34.431  -52.923 -37.038 1.00 65.04  ? 328 PHE A CE2 1 
ATOM   4861  C CZ  . PHE B 1 333 ? 34.581  -51.593 -36.665 1.00 65.28  ? 328 PHE A CZ  1 
ATOM   4862  N N   . LEU B 1 334 ? 36.867  -53.982 -40.460 1.00 60.12  ? 329 LEU A N   1 
ATOM   4863  C CA  . LEU B 1 334 ? 37.993  -54.527 -39.708 1.00 58.61  ? 329 LEU A CA  1 
ATOM   4864  C C   . LEU B 1 334 ? 39.352  -54.188 -40.271 1.00 57.44  ? 329 LEU A C   1 
ATOM   4865  O O   . LEU B 1 334 ? 40.290  -53.911 -39.523 1.00 57.22  ? 329 LEU A O   1 
ATOM   4866  C CB  . LEU B 1 334 ? 37.894  -56.045 -39.611 1.00 58.45  ? 329 LEU A CB  1 
ATOM   4867  C CG  . LEU B 1 334 ? 36.872  -56.582 -38.619 1.00 60.30  ? 329 LEU A CG  1 
ATOM   4868  C CD1 . LEU B 1 334 ? 37.047  -58.082 -38.497 1.00 61.34  ? 329 LEU A CD1 1 
ATOM   4869  C CD2 . LEU B 1 334 ? 37.068  -55.920 -37.266 1.00 60.90  ? 329 LEU A CD2 1 
ATOM   4870  N N   . LYS B 1 335 ? 39.461  -54.216 -41.592 1.00 56.86  ? 330 LYS A N   1 
ATOM   4871  C CA  . LYS B 1 335 ? 40.730  -53.942 -42.236 1.00 56.48  ? 330 LYS A CA  1 
ATOM   4872  C C   . LYS B 1 335 ? 41.134  -52.472 -42.182 1.00 54.57  ? 330 LYS A C   1 
ATOM   4873  O O   . LYS B 1 335 ? 42.302  -52.143 -42.376 1.00 54.67  ? 330 LYS A O   1 
ATOM   4874  C CB  . LYS B 1 335 ? 40.694  -54.434 -43.684 1.00 58.07  ? 330 LYS A CB  1 
ATOM   4875  C CG  . LYS B 1 335 ? 42.042  -54.918 -44.161 1.00 61.20  ? 330 LYS A CG  1 
ATOM   4876  C CD  . LYS B 1 335 ? 42.003  -55.433 -45.583 1.00 64.92  ? 330 LYS A CD  1 
ATOM   4877  C CE  . LYS B 1 335 ? 43.400  -55.862 -46.031 1.00 66.34  ? 330 LYS A CE  1 
ATOM   4878  N NZ  . LYS B 1 335 ? 44.420  -54.782 -45.857 1.00 65.45  ? 330 LYS A NZ  1 
ATOM   4879  N N   . ASN B 1 336 ? 40.174  -51.595 -41.900 1.00 53.33  ? 331 ASN A N   1 
ATOM   4880  C CA  . ASN B 1 336 ? 40.438  -50.155 -41.825 1.00 51.53  ? 331 ASN A CA  1 
ATOM   4881  C C   . ASN B 1 336 ? 40.745  -49.626 -40.421 1.00 49.88  ? 331 ASN A C   1 
ATOM   4882  O O   . ASN B 1 336 ? 41.240  -48.507 -40.279 1.00 49.69  ? 331 ASN A O   1 
ATOM   4883  C CB  . ASN B 1 336 ? 39.258  -49.364 -42.405 1.00 52.81  ? 331 ASN A CB  1 
ATOM   4884  C CG  . ASN B 1 336 ? 39.345  -49.204 -43.909 1.00 53.14  ? 331 ASN A CG  1 
ATOM   4885  O OD1 . ASN B 1 336 ? 40.190  -48.474 -44.424 1.00 53.44  ? 331 ASN A OD1 1 
ATOM   4886  N ND2 . ASN B 1 336 ? 38.471  -49.895 -44.621 1.00 55.13  ? 331 ASN A ND2 1 
ATOM   4887  N N   . LEU B 1 337 ? 40.425  -50.409 -39.391 1.00 48.43  ? 332 LEU A N   1 
ATOM   4888  C CA  . LEU B 1 337 ? 40.700  -50.006 -38.011 1.00 44.33  ? 332 LEU A CA  1 
ATOM   4889  C C   . LEU B 1 337 ? 42.197  -49.740 -37.964 1.00 44.12  ? 332 LEU A C   1 
ATOM   4890  O O   . LEU B 1 337 ? 42.979  -50.477 -38.566 1.00 44.59  ? 332 LEU A O   1 
ATOM   4891  C CB  . LEU B 1 337 ? 40.342  -51.135 -37.049 1.00 39.79  ? 332 LEU A CB  1 
ATOM   4892  C CG  . LEU B 1 337 ? 38.872  -51.543 -37.024 1.00 37.23  ? 332 LEU A CG  1 
ATOM   4893  C CD1 . LEU B 1 337 ? 38.726  -52.915 -36.407 1.00 36.01  ? 332 LEU A CD1 1 
ATOM   4894  C CD2 . LEU B 1 337 ? 38.079  -50.519 -36.252 1.00 35.04  ? 332 LEU A CD2 1 
ATOM   4895  N N   . LYS B 1 338 ? 42.595  -48.682 -37.272 1.00 43.29  ? 333 LYS A N   1 
ATOM   4896  C CA  . LYS B 1 338 ? 44.003  -48.327 -37.181 1.00 43.96  ? 333 LYS A CA  1 
ATOM   4897  C C   . LYS B 1 338 ? 44.499  -48.317 -35.740 1.00 43.31  ? 333 LYS A C   1 
ATOM   4898  O O   . LYS B 1 338 ? 45.696  -48.459 -35.492 1.00 42.88  ? 333 LYS A O   1 
ATOM   4899  C CB  . LYS B 1 338 ? 44.231  -46.952 -37.814 1.00 45.88  ? 333 LYS A CB  1 
ATOM   4900  C CG  . LYS B 1 338 ? 43.864  -46.869 -39.291 1.00 48.90  ? 333 LYS A CG  1 
ATOM   4901  C CD  . LYS B 1 338 ? 43.985  -45.446 -39.793 1.00 52.31  ? 333 LYS A CD  1 
ATOM   4902  C CE  . LYS B 1 338 ? 43.917  -45.367 -41.312 1.00 55.13  ? 333 LYS A CE  1 
ATOM   4903  N NZ  . LYS B 1 338 ? 44.196  -43.973 -41.791 1.00 56.70  ? 333 LYS A NZ  1 
ATOM   4904  N N   . LEU B 1 339 ? 43.573  -48.135 -34.797 1.00 42.45  ? 334 LEU A N   1 
ATOM   4905  C CA  . LEU B 1 339 ? 43.905  -48.104 -33.378 1.00 39.73  ? 334 LEU A CA  1 
ATOM   4906  C C   . LEU B 1 339 ? 43.477  -49.408 -32.725 1.00 37.77  ? 334 LEU A C   1 
ATOM   4907  O O   . LEU B 1 339 ? 44.141  -49.880 -31.816 1.00 37.84  ? 334 LEU A O   1 
ATOM   4908  C CB  . LEU B 1 339 ? 43.231  -46.901 -32.697 1.00 42.10  ? 334 LEU A CB  1 
ATOM   4909  C CG  . LEU B 1 339 ? 43.576  -46.536 -31.240 1.00 42.47  ? 334 LEU A CG  1 
ATOM   4910  C CD1 . LEU B 1 339 ? 42.738  -47.361 -30.299 1.00 45.84  ? 334 LEU A CD1 1 
ATOM   4911  C CD2 . LEU B 1 339 ? 45.061  -46.746 -30.964 1.00 42.17  ? 334 LEU A CD2 1 
ATOM   4912  N N   . PHE B 1 340 ? 42.369  -49.991 -33.179 1.00 36.52  ? 335 PHE A N   1 
ATOM   4913  C CA  . PHE B 1 340 ? 41.926  -51.273 -32.631 1.00 36.77  ? 335 PHE A CA  1 
ATOM   4914  C C   . PHE B 1 340 ? 42.847  -52.326 -33.237 1.00 38.78  ? 335 PHE A C   1 
ATOM   4915  O O   . PHE B 1 340 ? 43.386  -52.141 -34.335 1.00 38.60  ? 335 PHE A O   1 
ATOM   4916  C CB  . PHE B 1 340 ? 40.477  -51.610 -33.038 1.00 35.02  ? 335 PHE A CB  1 
ATOM   4917  C CG  . PHE B 1 340 ? 39.425  -51.098 -32.091 1.00 30.57  ? 335 PHE A CG  1 
ATOM   4918  C CD1 . PHE B 1 340 ? 39.073  -49.750 -32.076 1.00 29.84  ? 335 PHE A CD1 1 
ATOM   4919  C CD2 . PHE B 1 340 ? 38.783  -51.966 -31.218 1.00 29.25  ? 335 PHE A CD2 1 
ATOM   4920  C CE1 . PHE B 1 340 ? 38.092  -49.272 -31.200 1.00 28.96  ? 335 PHE A CE1 1 
ATOM   4921  C CE2 . PHE B 1 340 ? 37.797  -51.496 -30.334 1.00 31.07  ? 335 PHE A CE2 1 
ATOM   4922  C CZ  . PHE B 1 340 ? 37.453  -50.146 -30.329 1.00 28.55  ? 335 PHE A CZ  1 
ATOM   4923  N N   . THR B 1 341 ? 43.012  -53.439 -32.536 1.00 39.88  ? 336 THR A N   1 
ATOM   4924  C CA  . THR B 1 341 ? 43.862  -54.512 -33.026 1.00 40.84  ? 336 THR A CA  1 
ATOM   4925  C C   . THR B 1 341 ? 43.062  -55.774 -33.342 1.00 41.25  ? 336 THR A C   1 
ATOM   4926  O O   . THR B 1 341 ? 42.217  -56.203 -32.550 1.00 41.24  ? 336 THR A O   1 
ATOM   4927  C CB  . THR B 1 341 ? 44.949  -54.834 -31.996 1.00 42.39  ? 336 THR A CB  1 
ATOM   4928  O OG1 . THR B 1 341 ? 45.898  -53.758 -31.975 1.00 45.46  ? 336 THR A OG1 1 
ATOM   4929  C CG2 . THR B 1 341 ? 45.648  -56.144 -32.336 1.00 42.36  ? 336 THR A CG2 1 
ATOM   4930  N N   . LEU B 1 342 ? 43.333  -56.368 -34.502 1.00 40.43  ? 337 LEU A N   1 
ATOM   4931  C CA  . LEU B 1 342 ? 42.634  -57.581 -34.910 1.00 38.53  ? 337 LEU A CA  1 
ATOM   4932  C C   . LEU B 1 342 ? 43.178  -58.771 -34.139 1.00 39.04  ? 337 LEU A C   1 
ATOM   4933  O O   . LEU B 1 342 ? 44.233  -59.300 -34.465 1.00 38.10  ? 337 LEU A O   1 
ATOM   4934  C CB  . LEU B 1 342 ? 42.796  -57.815 -36.418 1.00 36.18  ? 337 LEU A CB  1 
ATOM   4935  C CG  . LEU B 1 342 ? 42.325  -56.702 -37.358 1.00 35.30  ? 337 LEU A CG  1 
ATOM   4936  C CD1 . LEU B 1 342 ? 42.403  -57.196 -38.785 1.00 35.78  ? 337 LEU A CD1 1 
ATOM   4937  C CD2 . LEU B 1 342 ? 40.902  -56.293 -37.037 1.00 36.07  ? 337 LEU A CD2 1 
ATOM   4938  N N   . ALA B 1 343 ? 42.461  -59.183 -33.101 1.00 41.06  ? 338 ALA A N   1 
ATOM   4939  C CA  . ALA B 1 343 ? 42.890  -60.315 -32.291 1.00 42.65  ? 338 ALA A CA  1 
ATOM   4940  C C   . ALA B 1 343 ? 41.678  -61.115 -31.845 1.00 44.84  ? 338 ALA A C   1 
ATOM   4941  O O   . ALA B 1 343 ? 40.577  -60.581 -31.721 1.00 44.54  ? 338 ALA A O   1 
ATOM   4942  C CB  . ALA B 1 343 ? 43.680  -59.831 -31.084 1.00 42.60  ? 338 ALA A CB  1 
ATOM   4943  N N   . GLU B 1 344 ? 41.901  -62.396 -31.589 1.00 48.50  ? 339 GLU A N   1 
ATOM   4944  C CA  . GLU B 1 344 ? 40.847  -63.323 -31.194 1.00 51.66  ? 339 GLU A CA  1 
ATOM   4945  C C   . GLU B 1 344 ? 40.686  -63.458 -29.680 1.00 50.33  ? 339 GLU A C   1 
ATOM   4946  O O   . GLU B 1 344 ? 39.749  -64.099 -29.203 1.00 50.58  ? 339 GLU A O   1 
ATOM   4947  C CB  . GLU B 1 344 ? 41.161  -64.683 -31.816 1.00 57.13  ? 339 GLU A CB  1 
ATOM   4948  C CG  . GLU B 1 344 ? 40.016  -65.649 -31.906 1.00 65.74  ? 339 GLU A CG  1 
ATOM   4949  C CD  . GLU B 1 344 ? 40.293  -66.722 -32.937 1.00 70.95  ? 339 GLU A CD  1 
ATOM   4950  O OE1 . GLU B 1 344 ? 40.297  -66.394 -34.143 1.00 73.04  ? 339 GLU A OE1 1 
ATOM   4951  O OE2 . GLU B 1 344 ? 40.523  -67.887 -32.544 1.00 75.54  ? 339 GLU A OE2 1 
ATOM   4952  N N   . SER B 1 345 ? 41.601  -62.857 -28.929 1.00 49.00  ? 340 SER A N   1 
ATOM   4953  C CA  . SER B 1 345 ? 41.552  -62.918 -27.473 1.00 48.42  ? 340 SER A CA  1 
ATOM   4954  C C   . SER B 1 345 ? 40.788  -61.716 -26.931 1.00 49.39  ? 340 SER A C   1 
ATOM   4955  O O   . SER B 1 345 ? 40.246  -60.916 -27.699 1.00 49.42  ? 340 SER A O   1 
ATOM   4956  C CB  . SER B 1 345 ? 42.967  -62.913 -26.894 1.00 47.30  ? 340 SER A CB  1 
ATOM   4957  O OG  . SER B 1 345 ? 43.628  -61.683 -27.176 1.00 47.90  ? 340 SER A OG  1 
ATOM   4958  N N   . LEU B 1 346 ? 40.743  -61.591 -25.608 1.00 49.38  ? 341 LEU A N   1 
ATOM   4959  C CA  . LEU B 1 346 ? 40.058  -60.466 -24.977 1.00 50.25  ? 341 LEU A CA  1 
ATOM   4960  C C   . LEU B 1 346 ? 40.640  -60.169 -23.595 1.00 50.41  ? 341 LEU A C   1 
ATOM   4961  O O   . LEU B 1 346 ? 40.886  -61.093 -22.816 1.00 49.98  ? 341 LEU A O   1 
ATOM   4962  C CB  . LEU B 1 346 ? 38.545  -60.743 -24.871 1.00 49.86  ? 341 LEU A CB  1 
ATOM   4963  C CG  . LEU B 1 346 ? 38.043  -61.945 -24.065 1.00 48.88  ? 341 LEU A CG  1 
ATOM   4964  C CD1 . LEU B 1 346 ? 36.526  -62.016 -24.129 1.00 47.21  ? 341 LEU A CD1 1 
ATOM   4965  C CD2 . LEU B 1 346 ? 38.647  -63.223 -24.622 1.00 51.13  ? 341 LEU A CD2 1 
ATOM   4966  N N   . GLY B 1 347 ? 40.901  -58.890 -23.312 1.00 49.20  ? 342 GLY A N   1 
ATOM   4967  C CA  . GLY B 1 347 ? 41.415  -58.532 -22.003 1.00 48.54  ? 342 GLY A CA  1 
ATOM   4968  C C   . GLY B 1 347 ? 42.526  -57.513 -21.815 1.00 48.22  ? 342 GLY A C   1 
ATOM   4969  O O   . GLY B 1 347 ? 42.602  -56.869 -20.769 1.00 48.32  ? 342 GLY A O   1 
ATOM   4970  N N   . GLY B 1 348 ? 43.392  -57.338 -22.800 1.00 47.78  ? 343 GLY A N   1 
ATOM   4971  C CA  . GLY B 1 348 ? 44.490  -56.395 -22.611 1.00 47.46  ? 343 GLY A CA  1 
ATOM   4972  C C   . GLY B 1 348 ? 44.174  -54.933 -22.337 1.00 44.91  ? 343 GLY A C   1 
ATOM   4973  O O   . GLY B 1 348 ? 43.026  -54.558 -22.094 1.00 44.10  ? 343 GLY A O   1 
ATOM   4974  N N   . PHE B 1 349 ? 45.218  -54.108 -22.351 1.00 42.49  ? 344 PHE A N   1 
ATOM   4975  C CA  . PHE B 1 349 ? 45.058  -52.677 -22.162 1.00 40.63  ? 344 PHE A CA  1 
ATOM   4976  C C   . PHE B 1 349 ? 44.746  -52.118 -23.541 1.00 40.52  ? 344 PHE A C   1 
ATOM   4977  O O   . PHE B 1 349 ? 44.435  -50.940 -23.685 1.00 41.82  ? 344 PHE A O   1 
ATOM   4978  C CB  . PHE B 1 349 ? 46.352  -52.015 -21.679 1.00 39.28  ? 344 PHE A CB  1 
ATOM   4979  C CG  . PHE B 1 349 ? 46.778  -52.411 -20.294 1.00 39.10  ? 344 PHE A CG  1 
ATOM   4980  C CD1 . PHE B 1 349 ? 45.871  -52.928 -19.381 1.00 39.20  ? 344 PHE A CD1 1 
ATOM   4981  C CD2 . PHE B 1 349 ? 48.094  -52.211 -19.886 1.00 38.20  ? 344 PHE A CD2 1 
ATOM   4982  C CE1 . PHE B 1 349 ? 46.273  -53.235 -18.082 1.00 37.96  ? 344 PHE A CE1 1 
ATOM   4983  C CE2 . PHE B 1 349 ? 48.500  -52.516 -18.594 1.00 35.07  ? 344 PHE A CE2 1 
ATOM   4984  C CZ  . PHE B 1 349 ? 47.589  -53.027 -17.692 1.00 35.51  ? 344 PHE A CZ  1 
ATOM   4985  N N   . GLU B 1 350 ? 44.849  -52.972 -24.555 1.00 40.85  ? 345 GLU A N   1 
ATOM   4986  C CA  . GLU B 1 350 ? 44.613  -52.567 -25.937 1.00 42.38  ? 345 GLU A CA  1 
ATOM   4987  C C   . GLU B 1 350 ? 43.272  -53.024 -26.482 1.00 39.79  ? 345 GLU A C   1 
ATOM   4988  O O   . GLU B 1 350 ? 42.840  -54.161 -26.253 1.00 38.00  ? 345 GLU A O   1 
ATOM   4989  C CB  . GLU B 1 350 ? 45.730  -53.106 -26.820 1.00 48.05  ? 345 GLU A CB  1 
ATOM   4990  C CG  . GLU B 1 350 ? 47.095  -52.732 -26.313 1.00 59.14  ? 345 GLU A CG  1 
ATOM   4991  C CD  . GLU B 1 350 ? 48.187  -53.577 -26.921 1.00 66.89  ? 345 GLU A CD  1 
ATOM   4992  O OE1 . GLU B 1 350 ? 48.397  -53.484 -28.154 1.00 70.82  ? 345 GLU A OE1 1 
ATOM   4993  O OE2 . GLU B 1 350 ? 48.832  -54.339 -26.158 1.00 71.86  ? 345 GLU A OE2 1 
ATOM   4994  N N   . SER B 1 351 ? 42.619  -52.125 -27.211 1.00 37.26  ? 346 SER A N   1 
ATOM   4995  C CA  . SER B 1 351 ? 41.316  -52.412 -27.795 1.00 36.36  ? 346 SER A CA  1 
ATOM   4996  C C   . SER B 1 351 ? 41.462  -53.381 -28.970 1.00 36.53  ? 346 SER A C   1 
ATOM   4997  O O   . SER B 1 351 ? 42.196  -53.121 -29.933 1.00 36.56  ? 346 SER A O   1 
ATOM   4998  C CB  . SER B 1 351 ? 40.640  -51.106 -28.239 1.00 35.95  ? 346 SER A CB  1 
ATOM   4999  O OG  . SER B 1 351 ? 40.437  -50.241 -27.133 1.00 33.52  ? 346 SER A OG  1 
ATOM   5000  N N   . LEU B 1 352 ? 40.747  -54.498 -28.876 1.00 35.61  ? 347 LEU A N   1 
ATOM   5001  C CA  . LEU B 1 352 ? 40.793  -55.545 -29.890 1.00 36.63  ? 347 LEU A CA  1 
ATOM   5002  C C   . LEU B 1 352 ? 39.475  -55.700 -30.658 1.00 37.22  ? 347 LEU A C   1 
ATOM   5003  O O   . LEU B 1 352 ? 38.398  -55.451 -30.114 1.00 36.06  ? 347 LEU A O   1 
ATOM   5004  C CB  . LEU B 1 352 ? 41.151  -56.867 -29.206 1.00 37.75  ? 347 LEU A CB  1 
ATOM   5005  C CG  . LEU B 1 352 ? 42.256  -56.763 -28.138 1.00 37.47  ? 347 LEU A CG  1 
ATOM   5006  C CD1 . LEU B 1 352 ? 42.373  -58.073 -27.379 1.00 36.14  ? 347 LEU A CD1 1 
ATOM   5007  C CD2 . LEU B 1 352 ? 43.576  -56.387 -28.798 1.00 36.46  ? 347 LEU A CD2 1 
ATOM   5008  N N   . ALA B 1 353 ? 39.577  -56.103 -31.925 1.00 38.09  ? 348 ALA A N   1 
ATOM   5009  C CA  . ALA B 1 353 ? 38.416  -56.322 -32.788 1.00 40.07  ? 348 ALA A CA  1 
ATOM   5010  C C   . ALA B 1 353 ? 38.477  -57.743 -33.324 1.00 44.20  ? 348 ALA A C   1 
ATOM   5011  O O   . ALA B 1 353 ? 39.541  -58.359 -33.368 1.00 45.14  ? 348 ALA A O   1 
ATOM   5012  C CB  . ALA B 1 353 ? 38.412  -55.343 -33.938 1.00 37.78  ? 348 ALA A CB  1 
ATOM   5013  N N   . GLU B 1 354 ? 37.334  -58.259 -33.753 1.00 48.17  ? 349 GLU A N   1 
ATOM   5014  C CA  . GLU B 1 354 ? 37.277  -59.619 -34.257 1.00 49.73  ? 349 GLU A CA  1 
ATOM   5015  C C   . GLU B 1 354 ? 35.985  -59.885 -35.020 1.00 50.31  ? 349 GLU A C   1 
ATOM   5016  O O   . GLU B 1 354 ? 34.956  -59.274 -34.738 1.00 51.76  ? 349 GLU A O   1 
ATOM   5017  C CB  . GLU B 1 354 ? 37.363  -60.583 -33.080 1.00 51.90  ? 349 GLU A CB  1 
ATOM   5018  C CG  . GLU B 1 354 ? 37.325  -62.028 -33.479 1.00 57.99  ? 349 GLU A CG  1 
ATOM   5019  C CD  . GLU B 1 354 ? 36.743  -62.903 -32.399 1.00 61.75  ? 349 GLU A CD  1 
ATOM   5020  O OE1 . GLU B 1 354 ? 36.884  -64.141 -32.505 1.00 65.41  ? 349 GLU A OE1 1 
ATOM   5021  O OE2 . GLU B 1 354 ? 36.136  -62.353 -31.452 1.00 63.36  ? 349 GLU A OE2 1 
ATOM   5022  N N   . LEU B 1 355 ? 36.049  -60.804 -35.984 1.00 50.23  ? 350 LEU A N   1 
ATOM   5023  C CA  . LEU B 1 355 ? 34.886  -61.205 -36.780 1.00 47.53  ? 350 LEU A CA  1 
ATOM   5024  C C   . LEU B 1 355 ? 34.777  -62.724 -36.632 1.00 44.80  ? 350 LEU A C   1 
ATOM   5025  O O   . LEU B 1 355 ? 35.283  -63.474 -37.459 1.00 44.48  ? 350 LEU A O   1 
ATOM   5026  C CB  . LEU B 1 355 ? 35.077  -60.826 -38.256 1.00 48.00  ? 350 LEU A CB  1 
ATOM   5027  C CG  . LEU B 1 355 ? 33.932  -61.137 -39.232 1.00 48.89  ? 350 LEU A CG  1 
ATOM   5028  C CD1 . LEU B 1 355 ? 32.696  -60.342 -38.860 1.00 47.94  ? 350 LEU A CD1 1 
ATOM   5029  C CD2 . LEU B 1 355 ? 34.359  -60.795 -40.644 1.00 48.73  ? 350 LEU A CD2 1 
ATOM   5030  N N   . PRO B 1 356 ? 34.115  -63.191 -35.563 1.00 44.03  ? 351 PRO A N   1 
ATOM   5031  C CA  . PRO B 1 356 ? 33.909  -64.605 -35.239 1.00 44.10  ? 351 PRO A CA  1 
ATOM   5032  C C   . PRO B 1 356 ? 33.589  -65.527 -36.405 1.00 44.75  ? 351 PRO A C   1 
ATOM   5033  O O   . PRO B 1 356 ? 33.993  -66.689 -36.399 1.00 45.65  ? 351 PRO A O   1 
ATOM   5034  C CB  . PRO B 1 356 ? 32.782  -64.556 -34.220 1.00 43.09  ? 351 PRO A CB  1 
ATOM   5035  C CG  . PRO B 1 356 ? 33.098  -63.314 -33.473 1.00 43.40  ? 351 PRO A CG  1 
ATOM   5036  C CD  . PRO B 1 356 ? 33.399  -62.340 -34.596 1.00 44.57  ? 351 PRO A CD  1 
ATOM   5037  N N   . ALA B 1 357 ? 32.864  -65.017 -37.397 1.00 45.36  ? 352 ALA A N   1 
ATOM   5038  C CA  . ALA B 1 357 ? 32.485  -65.818 -38.566 1.00 46.85  ? 352 ALA A CA  1 
ATOM   5039  C C   . ALA B 1 357 ? 33.683  -66.449 -39.284 1.00 48.81  ? 352 ALA A C   1 
ATOM   5040  O O   . ALA B 1 357 ? 33.569  -67.536 -39.845 1.00 47.74  ? 352 ALA A O   1 
ATOM   5041  C CB  . ALA B 1 357 ? 31.676  -64.969 -39.545 1.00 45.48  ? 352 ALA A CB  1 
ATOM   5042  N N   . ILE B 1 358 ? 34.823  -65.760 -39.266 1.00 52.43  ? 353 ILE A N   1 
ATOM   5043  C CA  . ILE B 1 358 ? 36.047  -66.251 -39.899 1.00 55.73  ? 353 ILE A CA  1 
ATOM   5044  C C   . ILE B 1 358 ? 37.248  -66.097 -38.969 1.00 58.57  ? 353 ILE A C   1 
ATOM   5045  O O   . ILE B 1 358 ? 38.350  -65.786 -39.420 1.00 58.11  ? 353 ILE A O   1 
ATOM   5046  C CB  . ILE B 1 358 ? 36.355  -65.487 -41.192 1.00 55.49  ? 353 ILE A CB  1 
ATOM   5047  C CG1 . ILE B 1 358 ? 36.292  -63.982 -40.921 1.00 56.18  ? 353 ILE A CG1 1 
ATOM   5048  C CG2 . ILE B 1 358 ? 35.399  -65.920 -42.298 1.00 55.23  ? 353 ILE A CG2 1 
ATOM   5049  C CD1 . ILE B 1 358 ? 36.413  -63.123 -42.172 1.00 56.58  ? 353 ILE A CD1 1 
ATOM   5050  N N   . MET B 1 359 ? 37.020  -66.303 -37.673 1.00 62.04  ? 354 MET A N   1 
ATOM   5051  C CA  . MET B 1 359 ? 38.062  -66.196 -36.650 1.00 64.56  ? 354 MET A CA  1 
ATOM   5052  C C   . MET B 1 359 ? 37.739  -67.097 -35.457 1.00 64.76  ? 354 MET A C   1 
ATOM   5053  O O   . MET B 1 359 ? 36.758  -67.844 -35.468 1.00 64.78  ? 354 MET A O   1 
ATOM   5054  C CB  . MET B 1 359 ? 38.209  -64.741 -36.162 1.00 67.02  ? 354 MET A CB  1 
ATOM   5055  C CG  . MET B 1 359 ? 38.897  -63.782 -37.148 1.00 70.21  ? 354 MET A CG  1 
ATOM   5056  S SD  . MET B 1 359 ? 39.373  -62.167 -36.418 1.00 73.58  ? 354 MET A SD  1 
ATOM   5057  C CE  . MET B 1 359 ? 38.581  -61.045 -37.521 1.00 74.26  ? 354 MET A CE  1 
ATOM   5058  N N   . LEU B 1 372 ? 24.507  -73.798 -39.250 1.00 78.43  ? 367 LEU A N   1 
ATOM   5059  C CA  . LEU B 1 372 ? 24.155  -72.379 -39.198 1.00 78.34  ? 367 LEU A CA  1 
ATOM   5060  C C   . LEU B 1 372 ? 25.111  -71.618 -38.272 1.00 76.80  ? 367 LEU A C   1 
ATOM   5061  O O   . LEU B 1 372 ? 24.918  -71.572 -37.053 1.00 77.12  ? 367 LEU A O   1 
ATOM   5062  C CB  . LEU B 1 372 ? 22.698  -72.221 -38.726 1.00 78.75  ? 367 LEU A CB  1 
ATOM   5063  C CG  . LEU B 1 372 ? 21.680  -71.534 -39.655 1.00 77.92  ? 367 LEU A CG  1 
ATOM   5064  C CD1 . LEU B 1 372 ? 21.863  -70.032 -39.581 1.00 77.28  ? 367 LEU A CD1 1 
ATOM   5065  C CD2 . LEU B 1 372 ? 21.831  -72.034 -41.094 1.00 77.07  ? 367 LEU A CD2 1 
ATOM   5066  N N   . GLY B 1 373 ? 26.139  -71.017 -38.867 1.00 75.24  ? 368 GLY A N   1 
ATOM   5067  C CA  . GLY B 1 373 ? 27.131  -70.285 -38.094 1.00 72.88  ? 368 GLY A CA  1 
ATOM   5068  C C   . GLY B 1 373 ? 26.796  -68.831 -37.806 1.00 70.07  ? 368 GLY A C   1 
ATOM   5069  O O   . GLY B 1 373 ? 25.943  -68.235 -38.466 1.00 70.78  ? 368 GLY A O   1 
ATOM   5070  N N   . ILE B 1 374 ? 27.482  -68.261 -36.816 1.00 66.67  ? 369 ILE A N   1 
ATOM   5071  C CA  . ILE B 1 374 ? 27.280  -66.875 -36.404 1.00 63.32  ? 369 ILE A CA  1 
ATOM   5072  C C   . ILE B 1 374 ? 27.114  -65.989 -37.626 1.00 60.95  ? 369 ILE A C   1 
ATOM   5073  O O   . ILE B 1 374 ? 27.780  -66.196 -38.640 1.00 60.32  ? 369 ILE A O   1 
ATOM   5074  C CB  . ILE B 1 374 ? 28.479  -66.337 -35.589 1.00 61.96  ? 369 ILE A CB  1 
ATOM   5075  C CG1 . ILE B 1 374 ? 29.239  -67.488 -34.924 1.00 63.28  ? 369 ILE A CG1 1 
ATOM   5076  C CG2 . ILE B 1 374 ? 27.988  -65.385 -34.518 1.00 60.49  ? 369 ILE A CG2 1 
ATOM   5077  C CD1 . ILE B 1 374 ? 30.081  -68.349 -35.882 1.00 64.69  ? 369 ILE A CD1 1 
ATOM   5078  N N   . SER B 1 375 ? 26.227  -65.002 -37.534 1.00 60.10  ? 370 SER A N   1 
ATOM   5079  C CA  . SER B 1 375 ? 26.011  -64.109 -38.664 1.00 60.30  ? 370 SER A CA  1 
ATOM   5080  C C   . SER B 1 375 ? 27.360  -63.503 -39.024 1.00 59.54  ? 370 SER A C   1 
ATOM   5081  O O   . SER B 1 375 ? 28.043  -62.942 -38.168 1.00 60.04  ? 370 SER A O   1 
ATOM   5082  C CB  . SER B 1 375 ? 25.006  -63.003 -38.311 1.00 58.67  ? 370 SER A CB  1 
ATOM   5083  O OG  . SER B 1 375 ? 25.607  -61.980 -37.547 1.00 57.39  ? 370 SER A OG  1 
ATOM   5084  N N   . ASP B 1 376 ? 27.753  -63.638 -40.286 1.00 59.23  ? 371 ASP A N   1 
ATOM   5085  C CA  . ASP B 1 376 ? 29.031  -63.103 -40.740 1.00 59.04  ? 371 ASP A CA  1 
ATOM   5086  C C   . ASP B 1 376 ? 29.020  -61.578 -40.791 1.00 55.89  ? 371 ASP A C   1 
ATOM   5087  O O   . ASP B 1 376 ? 29.848  -60.953 -41.456 1.00 55.01  ? 371 ASP A O   1 
ATOM   5088  C CB  . ASP B 1 376 ? 29.378  -63.682 -42.112 1.00 63.50  ? 371 ASP A CB  1 
ATOM   5089  C CG  . ASP B 1 376 ? 28.229  -63.590 -43.088 1.00 67.25  ? 371 ASP A CG  1 
ATOM   5090  O OD1 . ASP B 1 376 ? 27.899  -62.469 -43.533 1.00 70.11  ? 371 ASP A OD1 1 
ATOM   5091  O OD2 . ASP B 1 376 ? 27.648  -64.646 -43.405 1.00 70.19  ? 371 ASP A OD2 1 
ATOM   5092  N N   . THR B 1 377 ? 28.085  -60.987 -40.060 1.00 52.67  ? 372 THR A N   1 
ATOM   5093  C CA  . THR B 1 377 ? 27.958  -59.544 -40.015 1.00 50.54  ? 372 THR A CA  1 
ATOM   5094  C C   . THR B 1 377 ? 28.161  -59.055 -38.565 1.00 50.19  ? 372 THR A C   1 
ATOM   5095  O O   . THR B 1 377 ? 28.099  -57.856 -38.281 1.00 50.17  ? 372 THR A O   1 
ATOM   5096  C CB  . THR B 1 377 ? 26.569  -59.128 -40.571 1.00 49.33  ? 372 THR A CB  1 
ATOM   5097  O OG1 . THR B 1 377 ? 26.593  -57.752 -40.951 1.00 48.56  ? 372 THR A OG1 1 
ATOM   5098  C CG2 . THR B 1 377 ? 25.480  -59.348 -39.534 1.00 48.76  ? 372 THR A CG2 1 
ATOM   5099  N N   . LEU B 1 378 ? 28.434  -60.002 -37.665 1.00 49.35  ? 373 LEU A N   1 
ATOM   5100  C CA  . LEU B 1 378 ? 28.648  -59.735 -36.236 1.00 46.17  ? 373 LEU A CA  1 
ATOM   5101  C C   . LEU B 1 378 ? 30.105  -59.478 -35.869 1.00 45.04  ? 373 LEU A C   1 
ATOM   5102  O O   . LEU B 1 378 ? 31.005  -60.177 -36.324 1.00 46.74  ? 373 LEU A O   1 
ATOM   5103  C CB  . LEU B 1 378 ? 28.137  -60.915 -35.403 1.00 45.12  ? 373 LEU A CB  1 
ATOM   5104  C CG  . LEU B 1 378 ? 28.359  -60.905 -33.889 1.00 44.53  ? 373 LEU A CG  1 
ATOM   5105  C CD1 . LEU B 1 378 ? 27.494  -61.981 -33.280 1.00 45.12  ? 373 LEU A CD1 1 
ATOM   5106  C CD2 . LEU B 1 378 ? 29.818  -61.155 -33.535 1.00 43.52  ? 373 LEU A CD2 1 
ATOM   5107  N N   . ILE B 1 379 ? 30.325  -58.492 -35.010 1.00 42.99  ? 374 ILE A N   1 
ATOM   5108  C CA  . ILE B 1 379 ? 31.664  -58.138 -34.577 1.00 40.10  ? 374 ILE A CA  1 
ATOM   5109  C C   . ILE B 1 379 ? 31.747  -57.967 -33.069 1.00 40.28  ? 374 ILE A C   1 
ATOM   5110  O O   . ILE B 1 379 ? 30.917  -57.295 -32.464 1.00 39.74  ? 374 ILE A O   1 
ATOM   5111  C CB  . ILE B 1 379 ? 32.112  -56.834 -35.238 1.00 39.07  ? 374 ILE A CB  1 
ATOM   5112  C CG1 . ILE B 1 379 ? 32.174  -57.030 -36.750 1.00 40.31  ? 374 ILE A CG1 1 
ATOM   5113  C CG2 . ILE B 1 379 ? 33.461  -56.404 -34.696 1.00 36.00  ? 374 ILE A CG2 1 
ATOM   5114  C CD1 . ILE B 1 379 ? 32.266  -55.735 -37.528 1.00 42.36  ? 374 ILE A CD1 1 
ATOM   5115  N N   . ARG B 1 380 ? 32.748  -58.599 -32.462 1.00 41.47  ? 375 ARG A N   1 
ATOM   5116  C CA  . ARG B 1 380 ? 32.969  -58.489 -31.022 1.00 39.80  ? 375 ARG A CA  1 
ATOM   5117  C C   . ARG B 1 380 ? 34.202  -57.617 -30.800 1.00 39.37  ? 375 ARG A C   1 
ATOM   5118  O O   . ARG B 1 380 ? 35.263  -57.860 -31.380 1.00 39.21  ? 375 ARG A O   1 
ATOM   5119  C CB  . ARG B 1 380 ? 33.188  -59.868 -30.381 1.00 37.89  ? 375 ARG A CB  1 
ATOM   5120  C CG  . ARG B 1 380 ? 33.672  -59.787 -28.937 1.00 38.22  ? 375 ARG A CG  1 
ATOM   5121  C CD  . ARG B 1 380 ? 33.630  -61.127 -28.213 1.00 40.39  ? 375 ARG A CD  1 
ATOM   5122  N NE  . ARG B 1 380 ? 34.654  -62.089 -28.638 1.00 43.31  ? 375 ARG A NE  1 
ATOM   5123  C CZ  . ARG B 1 380 ? 35.962  -61.950 -28.433 1.00 42.15  ? 375 ARG A CZ  1 
ATOM   5124  N NH1 . ARG B 1 380 ? 36.429  -60.880 -27.814 1.00 44.38  ? 375 ARG A NH1 1 
ATOM   5125  N NH2 . ARG B 1 380 ? 36.804  -62.896 -28.821 1.00 42.37  ? 375 ARG A NH2 1 
ATOM   5126  N N   . LEU B 1 381 ? 34.047  -56.587 -29.977 1.00 38.07  ? 376 LEU A N   1 
ATOM   5127  C CA  . LEU B 1 381 ? 35.150  -55.694 -29.657 1.00 35.70  ? 376 LEU A CA  1 
ATOM   5128  C C   . LEU B 1 381 ? 35.563  -55.957 -28.228 1.00 35.94  ? 376 LEU A C   1 
ATOM   5129  O O   . LEU B 1 381 ? 34.759  -56.406 -27.411 1.00 36.49  ? 376 LEU A O   1 
ATOM   5130  C CB  . LEU B 1 381 ? 34.724  -54.230 -29.747 1.00 33.33  ? 376 LEU A CB  1 
ATOM   5131  C CG  . LEU B 1 381 ? 34.238  -53.689 -31.078 1.00 31.28  ? 376 LEU A CG  1 
ATOM   5132  C CD1 . LEU B 1 381 ? 33.938  -52.210 -30.892 1.00 29.89  ? 376 LEU A CD1 1 
ATOM   5133  C CD2 . LEU B 1 381 ? 35.293  -53.921 -32.164 1.00 27.82  ? 376 LEU A CD2 1 
ATOM   5134  N N   . SER B 1 382 ? 36.826  -55.689 -27.933 1.00 37.47  ? 377 SER A N   1 
ATOM   5135  C CA  . SER B 1 382 ? 37.338  -55.829 -26.578 1.00 36.45  ? 377 SER A CA  1 
ATOM   5136  C C   . SER B 1 382 ? 37.917  -54.453 -26.310 1.00 34.90  ? 377 SER A C   1 
ATOM   5137  O O   . SER B 1 382 ? 39.078  -54.202 -26.623 1.00 36.47  ? 377 SER A O   1 
ATOM   5138  C CB  . SER B 1 382 ? 38.435  -56.881 -26.511 1.00 36.41  ? 377 SER A CB  1 
ATOM   5139  O OG  . SER B 1 382 ? 38.804  -57.093 -25.161 1.00 38.40  ? 377 SER A OG  1 
ATOM   5140  N N   . VAL B 1 383 ? 37.102  -53.554 -25.763 1.00 33.19  ? 378 VAL A N   1 
ATOM   5141  C CA  . VAL B 1 383 ? 37.561  -52.196 -25.519 1.00 33.09  ? 378 VAL A CA  1 
ATOM   5142  C C   . VAL B 1 383 ? 38.576  -52.153 -24.400 1.00 32.32  ? 378 VAL A C   1 
ATOM   5143  O O   . VAL B 1 383 ? 38.326  -52.652 -23.309 1.00 33.11  ? 378 VAL A O   1 
ATOM   5144  C CB  . VAL B 1 383 ? 36.389  -51.245 -25.202 1.00 31.92  ? 378 VAL A CB  1 
ATOM   5145  C CG1 . VAL B 1 383 ? 36.901  -49.829 -25.027 1.00 30.47  ? 378 VAL A CG1 1 
ATOM   5146  C CG2 . VAL B 1 383 ? 35.397  -51.260 -26.342 1.00 32.13  ? 378 VAL A CG2 1 
ATOM   5147  N N   . GLY B 1 384 ? 39.729  -51.558 -24.697 1.00 31.53  ? 379 GLY A N   1 
ATOM   5148  C CA  . GLY B 1 384 ? 40.804  -51.451 -23.733 1.00 32.59  ? 379 GLY A CA  1 
ATOM   5149  C C   . GLY B 1 384 ? 40.814  -50.154 -22.947 1.00 33.76  ? 379 GLY A C   1 
ATOM   5150  O O   . GLY B 1 384 ? 39.759  -49.563 -22.707 1.00 34.56  ? 379 GLY A O   1 
ATOM   5151  N N   . LEU B 1 385 ? 42.009  -49.697 -22.572 1.00 33.53  ? 380 LEU A N   1 
ATOM   5152  C CA  . LEU B 1 385 ? 42.156  -48.485 -21.772 1.00 34.76  ? 380 LEU A CA  1 
ATOM   5153  C C   . LEU B 1 385 ? 42.643  -47.237 -22.503 1.00 34.86  ? 380 LEU A C   1 
ATOM   5154  O O   . LEU B 1 385 ? 43.103  -46.283 -21.871 1.00 35.46  ? 380 LEU A O   1 
ATOM   5155  C CB  . LEU B 1 385 ? 43.079  -48.769 -20.575 1.00 34.58  ? 380 LEU A CB  1 
ATOM   5156  C CG  . LEU B 1 385 ? 42.737  -49.997 -19.717 1.00 34.85  ? 380 LEU A CG  1 
ATOM   5157  C CD1 . LEU B 1 385 ? 43.650  -50.040 -18.514 1.00 33.85  ? 380 LEU A CD1 1 
ATOM   5158  C CD2 . LEU B 1 385 ? 41.283  -49.945 -19.264 1.00 36.31  ? 380 LEU A CD2 1 
ATOM   5159  N N   . GLU B 1 386 ? 42.539  -47.229 -23.825 1.00 35.60  ? 381 GLU A N   1 
ATOM   5160  C CA  . GLU B 1 386 ? 42.963  -46.067 -24.601 1.00 36.31  ? 381 GLU A CA  1 
ATOM   5161  C C   . GLU B 1 386 ? 42.024  -44.891 -24.353 1.00 37.75  ? 381 GLU A C   1 
ATOM   5162  O O   . GLU B 1 386 ? 41.045  -45.023 -23.623 1.00 38.04  ? 381 GLU A O   1 
ATOM   5163  C CB  . GLU B 1 386 ? 42.966  -46.395 -26.094 1.00 34.12  ? 381 GLU A CB  1 
ATOM   5164  C CG  . GLU B 1 386 ? 43.893  -47.525 -26.494 1.00 30.95  ? 381 GLU A CG  1 
ATOM   5165  C CD  . GLU B 1 386 ? 43.238  -48.890 -26.444 1.00 29.42  ? 381 GLU A CD  1 
ATOM   5166  O OE1 . GLU B 1 386 ? 43.835  -49.838 -26.992 1.00 32.10  ? 381 GLU A OE1 1 
ATOM   5167  O OE2 . GLU B 1 386 ? 42.142  -49.030 -25.865 1.00 26.90  ? 381 GLU A OE2 1 
ATOM   5168  N N   . ASP B 1 387 ? 42.330  -43.740 -24.953 1.00 40.64  ? 382 ASP A N   1 
ATOM   5169  C CA  . ASP B 1 387 ? 41.488  -42.548 -24.816 1.00 43.20  ? 382 ASP A CA  1 
ATOM   5170  C C   . ASP B 1 387 ? 40.158  -42.768 -25.532 1.00 43.83  ? 382 ASP A C   1 
ATOM   5171  O O   . ASP B 1 387 ? 40.128  -43.094 -26.717 1.00 45.26  ? 382 ASP A O   1 
ATOM   5172  C CB  . ASP B 1 387 ? 42.178  -41.319 -25.421 1.00 45.30  ? 382 ASP A CB  1 
ATOM   5173  C CG  . ASP B 1 387 ? 43.149  -40.661 -24.461 1.00 49.59  ? 382 ASP A CG  1 
ATOM   5174  O OD1 . ASP B 1 387 ? 42.699  -40.155 -23.406 1.00 52.68  ? 382 ASP A OD1 1 
ATOM   5175  O OD2 . ASP B 1 387 ? 44.361  -40.648 -24.758 1.00 50.05  ? 382 ASP A OD2 1 
ATOM   5176  N N   . GLU B 1 388 ? 39.059  -42.588 -24.817 1.00 44.53  ? 383 GLU A N   1 
ATOM   5177  C CA  . GLU B 1 388 ? 37.741  -42.770 -25.405 1.00 48.14  ? 383 GLU A CA  1 
ATOM   5178  C C   . GLU B 1 388 ? 37.577  -42.074 -26.758 1.00 48.24  ? 383 GLU A C   1 
ATOM   5179  O O   . GLU B 1 388 ? 37.047  -42.658 -27.703 1.00 47.50  ? 383 GLU A O   1 
ATOM   5180  C CB  . GLU B 1 388 ? 36.688  -42.265 -24.425 1.00 52.26  ? 383 GLU A CB  1 
ATOM   5181  C CG  . GLU B 1 388 ? 35.285  -42.191 -24.968 1.00 57.28  ? 383 GLU A CG  1 
ATOM   5182  C CD  . GLU B 1 388 ? 34.316  -41.687 -23.925 1.00 61.45  ? 383 GLU A CD  1 
ATOM   5183  O OE1 . GLU B 1 388 ? 33.158  -41.387 -24.282 1.00 65.18  ? 383 GLU A OE1 1 
ATOM   5184  O OE2 . GLU B 1 388 ? 34.714  -41.593 -22.741 1.00 64.30  ? 383 GLU A OE2 1 
ATOM   5185  N N   . GLU B 1 389 ? 38.028  -40.826 -26.843 1.00 50.49  ? 384 GLU A N   1 
ATOM   5186  C CA  . GLU B 1 389 ? 37.934  -40.048 -28.074 1.00 53.40  ? 384 GLU A CA  1 
ATOM   5187  C C   . GLU B 1 389 ? 38.554  -40.793 -29.247 1.00 50.32  ? 384 GLU A C   1 
ATOM   5188  O O   . GLU B 1 389 ? 37.916  -41.000 -30.284 1.00 49.01  ? 384 GLU A O   1 
ATOM   5189  C CB  . GLU B 1 389 ? 38.652  -38.715 -27.904 1.00 63.02  ? 384 GLU A CB  1 
ATOM   5190  C CG  . GLU B 1 389 ? 38.762  -37.903 -29.182 1.00 80.65  ? 384 GLU A CG  1 
ATOM   5191  C CD  . GLU B 1 389 ? 40.058  -37.099 -29.262 1.00 90.79  ? 384 GLU A CD  1 
ATOM   5192  O OE1 . GLU B 1 389 ? 40.202  -36.292 -30.210 1.00 97.39  ? 384 GLU A OE1 1 
ATOM   5193  O OE2 . GLU B 1 389 ? 40.936  -37.277 -28.385 1.00 96.80  ? 384 GLU A OE2 1 
ATOM   5194  N N   . ASP B 1 390 ? 39.812  -41.184 -29.076 1.00 47.13  ? 385 ASP A N   1 
ATOM   5195  C CA  . ASP B 1 390 ? 40.539  -41.899 -30.115 1.00 44.66  ? 385 ASP A CA  1 
ATOM   5196  C C   . ASP B 1 390 ? 39.851  -43.187 -30.526 1.00 43.32  ? 385 ASP A C   1 
ATOM   5197  O O   . ASP B 1 390 ? 39.810  -43.519 -31.708 1.00 43.95  ? 385 ASP A O   1 
ATOM   5198  C CB  . ASP B 1 390 ? 41.962  -42.215 -29.656 1.00 45.44  ? 385 ASP A CB  1 
ATOM   5199  C CG  . ASP B 1 390 ? 42.787  -40.967 -29.408 1.00 45.26  ? 385 ASP A CG  1 
ATOM   5200  O OD1 . ASP B 1 390 ? 42.366  -39.880 -29.848 1.00 47.26  ? 385 ASP A OD1 1 
ATOM   5201  O OD2 . ASP B 1 390 ? 43.863  -41.072 -28.784 1.00 46.44  ? 385 ASP A OD2 1 
ATOM   5202  N N   . LEU B 1 391 ? 39.322  -43.922 -29.556 1.00 41.64  ? 386 LEU A N   1 
ATOM   5203  C CA  . LEU B 1 391 ? 38.639  -45.169 -29.869 1.00 41.47  ? 386 LEU A CA  1 
ATOM   5204  C C   . LEU B 1 391 ? 37.463  -44.930 -30.819 1.00 42.01  ? 386 LEU A C   1 
ATOM   5205  O O   . LEU B 1 391 ? 37.323  -45.620 -31.832 1.00 41.01  ? 386 LEU A O   1 
ATOM   5206  C CB  . LEU B 1 391 ? 38.154  -45.848 -28.582 1.00 40.03  ? 386 LEU A CB  1 
ATOM   5207  C CG  . LEU B 1 391 ? 39.254  -46.527 -27.759 1.00 40.18  ? 386 LEU A CG  1 
ATOM   5208  C CD1 . LEU B 1 391 ? 38.679  -47.037 -26.441 1.00 38.55  ? 386 LEU A CD1 1 
ATOM   5209  C CD2 . LEU B 1 391 ? 39.874  -47.677 -28.576 1.00 38.68  ? 386 LEU A CD2 1 
ATOM   5210  N N   . LEU B 1 392 ? 36.630  -43.945 -30.488 1.00 43.13  ? 387 LEU A N   1 
ATOM   5211  C CA  . LEU B 1 392 ? 35.469  -43.600 -31.299 1.00 43.07  ? 387 LEU A CA  1 
ATOM   5212  C C   . LEU B 1 392 ? 35.866  -43.134 -32.690 1.00 45.63  ? 387 LEU A C   1 
ATOM   5213  O O   . LEU B 1 392 ? 35.263  -43.550 -33.676 1.00 45.38  ? 387 LEU A O   1 
ATOM   5214  C CB  . LEU B 1 392 ? 34.659  -42.507 -30.609 1.00 40.74  ? 387 LEU A CB  1 
ATOM   5215  C CG  . LEU B 1 392 ? 33.565  -42.906 -29.619 1.00 38.97  ? 387 LEU A CG  1 
ATOM   5216  C CD1 . LEU B 1 392 ? 33.944  -44.146 -28.823 1.00 38.79  ? 387 LEU A CD1 1 
ATOM   5217  C CD2 . LEU B 1 392 ? 33.317  -41.722 -28.708 1.00 38.75  ? 387 LEU A CD2 1 
ATOM   5218  N N   . GLU B 1 393 ? 36.871  -42.265 -32.770 1.00 49.61  ? 388 GLU A N   1 
ATOM   5219  C CA  . GLU B 1 393 ? 37.330  -41.763 -34.061 1.00 54.20  ? 388 GLU A CA  1 
ATOM   5220  C C   . GLU B 1 393 ? 37.804  -42.899 -34.955 1.00 53.70  ? 388 GLU A C   1 
ATOM   5221  O O   . GLU B 1 393 ? 37.549  -42.893 -36.156 1.00 54.92  ? 388 GLU A O   1 
ATOM   5222  C CB  . GLU B 1 393 ? 38.451  -40.737 -33.872 1.00 60.56  ? 388 GLU A CB  1 
ATOM   5223  C CG  . GLU B 1 393 ? 37.941  -39.323 -33.596 1.00 72.22  ? 388 GLU A CG  1 
ATOM   5224  C CD  . GLU B 1 393 ? 39.036  -38.350 -33.158 1.00 78.46  ? 388 GLU A CD  1 
ATOM   5225  O OE1 . GLU B 1 393 ? 40.107  -38.301 -33.807 1.00 82.27  ? 388 GLU A OE1 1 
ATOM   5226  O OE2 . GLU B 1 393 ? 38.817  -37.620 -32.164 1.00 81.99  ? 388 GLU A OE2 1 
ATOM   5227  N N   . ASP B 1 394 ? 38.482  -43.880 -34.369 1.00 52.64  ? 389 ASP A N   1 
ATOM   5228  C CA  . ASP B 1 394 ? 38.974  -45.021 -35.131 1.00 50.15  ? 389 ASP A CA  1 
ATOM   5229  C C   . ASP B 1 394 ? 37.807  -45.887 -35.624 1.00 49.75  ? 389 ASP A C   1 
ATOM   5230  O O   . ASP B 1 394 ? 37.871  -46.478 -36.704 1.00 49.70  ? 389 ASP A O   1 
ATOM   5231  C CB  . ASP B 1 394 ? 39.914  -45.867 -34.271 1.00 51.22  ? 389 ASP A CB  1 
ATOM   5232  C CG  . ASP B 1 394 ? 40.590  -46.965 -35.062 1.00 51.09  ? 389 ASP A CG  1 
ATOM   5233  O OD1 . ASP B 1 394 ? 41.327  -46.619 -36.006 1.00 52.12  ? 389 ASP A OD1 1 
ATOM   5234  O OD2 . ASP B 1 394 ? 40.388  -48.162 -34.751 1.00 48.37  ? 389 ASP A OD2 1 
ATOM   5235  N N   . LEU B 1 395 ? 36.747  -45.974 -34.829 1.00 47.52  ? 390 LEU A N   1 
ATOM   5236  C CA  . LEU B 1 395 ? 35.590  -46.764 -35.223 1.00 46.27  ? 390 LEU A CA  1 
ATOM   5237  C C   . LEU B 1 395 ? 34.861  -46.036 -36.330 1.00 48.43  ? 390 LEU A C   1 
ATOM   5238  O O   . LEU B 1 395 ? 34.427  -46.639 -37.311 1.00 48.98  ? 390 LEU A O   1 
ATOM   5239  C CB  . LEU B 1 395 ? 34.632  -46.963 -34.051 1.00 41.42  ? 390 LEU A CB  1 
ATOM   5240  C CG  . LEU B 1 395 ? 35.055  -47.923 -32.941 1.00 38.16  ? 390 LEU A CG  1 
ATOM   5241  C CD1 . LEU B 1 395 ? 33.972  -47.946 -31.881 1.00 35.67  ? 390 LEU A CD1 1 
ATOM   5242  C CD2 . LEU B 1 395 ? 35.274  -49.322 -33.506 1.00 34.78  ? 390 LEU A CD2 1 
ATOM   5243  N N   . ASP B 1 396 ? 34.735  -44.728 -36.154 1.00 49.86  ? 391 ASP A N   1 
ATOM   5244  C CA  . ASP B 1 396 ? 34.052  -43.859 -37.106 1.00 51.50  ? 391 ASP A CA  1 
ATOM   5245  C C   . ASP B 1 396 ? 34.715  -43.903 -38.482 1.00 51.94  ? 391 ASP A C   1 
ATOM   5246  O O   . ASP B 1 396 ? 34.053  -44.072 -39.510 1.00 51.19  ? 391 ASP A O   1 
ATOM   5247  C CB  . ASP B 1 396 ? 34.076  -42.431 -36.572 1.00 52.29  ? 391 ASP A CB  1 
ATOM   5248  C CG  . ASP B 1 396 ? 33.134  -41.529 -37.300 1.00 53.03  ? 391 ASP A CG  1 
ATOM   5249  O OD1 . ASP B 1 396 ? 31.918  -41.799 -37.249 1.00 54.18  ? 391 ASP A OD1 1 
ATOM   5250  O OD2 . ASP B 1 396 ? 33.608  -40.552 -37.916 1.00 54.73  ? 391 ASP A OD2 1 
ATOM   5251  N N   . GLN B 1 397 ? 36.031  -43.738 -38.475 1.00 51.98  ? 392 GLN A N   1 
ATOM   5252  C CA  . GLN B 1 397 ? 36.842  -43.744 -39.680 1.00 51.88  ? 392 GLN A CA  1 
ATOM   5253  C C   . GLN B 1 397 ? 36.704  -45.043 -40.496 1.00 53.55  ? 392 GLN A C   1 
ATOM   5254  O O   . GLN B 1 397 ? 36.521  -44.997 -41.714 1.00 54.52  ? 392 GLN A O   1 
ATOM   5255  C CB  . GLN B 1 397 ? 38.299  -43.483 -39.274 1.00 50.84  ? 392 GLN A CB  1 
ATOM   5256  C CG  . GLN B 1 397 ? 39.356  -43.739 -40.330 1.00 50.48  ? 392 GLN A CG  1 
ATOM   5257  C CD  . GLN B 1 397 ? 39.749  -45.201 -40.423 1.00 49.33  ? 392 GLN A CD  1 
ATOM   5258  O OE1 . GLN B 1 397 ? 39.835  -45.892 -39.406 1.00 45.60  ? 392 GLN A OE1 1 
ATOM   5259  N NE2 . GLN B 1 397 ? 40.007  -45.677 -41.648 1.00 49.48  ? 392 GLN A NE2 1 
ATOM   5260  N N   . ALA B 1 398 ? 36.776  -46.197 -39.835 1.00 53.47  ? 393 ALA A N   1 
ATOM   5261  C CA  . ALA B 1 398 ? 36.665  -47.481 -40.530 1.00 52.75  ? 393 ALA A CA  1 
ATOM   5262  C C   . ALA B 1 398 ? 35.237  -47.797 -40.989 1.00 53.73  ? 393 ALA A C   1 
ATOM   5263  O O   . ALA B 1 398 ? 35.040  -48.547 -41.939 1.00 53.77  ? 393 ALA A O   1 
ATOM   5264  C CB  . ALA B 1 398 ? 37.193  -48.607 -39.640 1.00 51.24  ? 393 ALA A CB  1 
ATOM   5265  N N   . LEU B 1 399 ? 34.240  -47.243 -40.307 1.00 55.10  ? 394 LEU A N   1 
ATOM   5266  C CA  . LEU B 1 399 ? 32.846  -47.470 -40.688 1.00 55.68  ? 394 LEU A CA  1 
ATOM   5267  C C   . LEU B 1 399 ? 32.540  -46.678 -41.958 1.00 58.61  ? 394 LEU A C   1 
ATOM   5268  O O   . LEU B 1 399 ? 31.782  -47.128 -42.824 1.00 57.83  ? 394 LEU A O   1 
ATOM   5269  C CB  . LEU B 1 399 ? 31.898  -47.028 -39.567 1.00 52.13  ? 394 LEU A CB  1 
ATOM   5270  C CG  . LEU B 1 399 ? 31.705  -48.015 -38.417 1.00 49.91  ? 394 LEU A CG  1 
ATOM   5271  C CD1 . LEU B 1 399 ? 30.883  -47.380 -37.305 1.00 48.83  ? 394 LEU A CD1 1 
ATOM   5272  C CD2 . LEU B 1 399 ? 31.016  -49.258 -38.950 1.00 48.73  ? 394 LEU A CD2 1 
ATOM   5273  N N   . LYS B 1 400 ? 33.131  -45.489 -42.056 1.00 60.16  ? 395 LYS A N   1 
ATOM   5274  C CA  . LYS B 1 400 ? 32.934  -44.644 -43.222 1.00 60.99  ? 395 LYS A CA  1 
ATOM   5275  C C   . LYS B 1 400 ? 33.654  -45.260 -44.410 1.00 62.05  ? 395 LYS A C   1 
ATOM   5276  O O   . LYS B 1 400 ? 33.254  -45.059 -45.553 1.00 63.95  ? 395 LYS A O   1 
ATOM   5277  C CB  . LYS B 1 400 ? 33.472  -43.231 -42.969 1.00 61.30  ? 395 LYS A CB  1 
ATOM   5278  C CG  . LYS B 1 400 ? 32.640  -42.407 -41.997 1.00 62.14  ? 395 LYS A CG  1 
ATOM   5279  C CD  . LYS B 1 400 ? 33.146  -40.969 -41.907 1.00 62.26  ? 395 LYS A CD  1 
ATOM   5280  C CE  . LYS B 1 400 ? 32.247  -40.101 -41.026 1.00 61.38  ? 395 LYS A CE  1 
ATOM   5281  N NZ  . LYS B 1 400 ? 32.799  -38.719 -40.849 1.00 61.05  ? 395 LYS A NZ  1 
ATOM   5282  N N   . ALA B 1 401 ? 34.714  -46.018 -44.140 1.00 61.83  ? 396 ALA A N   1 
ATOM   5283  C CA  . ALA B 1 401 ? 35.477  -46.648 -45.208 1.00 61.26  ? 396 ALA A CA  1 
ATOM   5284  C C   . ALA B 1 401 ? 34.732  -47.866 -45.739 1.00 61.79  ? 396 ALA A C   1 
ATOM   5285  O O   . ALA B 1 401 ? 34.788  -48.171 -46.928 1.00 60.84  ? 396 ALA A O   1 
ATOM   5286  C CB  . ALA B 1 401 ? 36.865  -47.045 -44.699 1.00 60.52  ? 396 ALA A CB  1 
ATOM   5287  N N   . ALA B 1 402 ? 34.024  -48.554 -44.851 1.00 63.97  ? 397 ALA A N   1 
ATOM   5288  C CA  . ALA B 1 402 ? 33.263  -49.735 -45.233 1.00 67.75  ? 397 ALA A CA  1 
ATOM   5289  C C   . ALA B 1 402 ? 32.018  -49.361 -46.031 1.00 72.02  ? 397 ALA A C   1 
ATOM   5290  O O   . ALA B 1 402 ? 31.332  -50.232 -46.569 1.00 70.87  ? 397 ALA A O   1 
ATOM   5291  C CB  . ALA B 1 402 ? 32.870  -50.519 -43.995 1.00 67.67  ? 397 ALA A CB  1 
ATOM   5292  N N   . HIS B 1 403 ? 31.728  -48.063 -46.091 1.00 77.41  ? 398 HIS A N   1 
ATOM   5293  C CA  . HIS B 1 403 ? 30.576  -47.540 -46.831 1.00 82.72  ? 398 HIS A CA  1 
ATOM   5294  C C   . HIS B 1 403 ? 30.942  -46.188 -47.448 1.00 88.71  ? 398 HIS A C   1 
ATOM   5295  O O   . HIS B 1 403 ? 30.575  -45.132 -46.920 1.00 89.89  ? 398 HIS A O   1 
ATOM   5296  C CB  . HIS B 1 403 ? 29.367  -47.382 -45.904 1.00 79.81  ? 398 HIS A CB  1 
ATOM   5297  C CG  . HIS B 1 403 ? 28.873  -48.677 -45.335 1.00 77.54  ? 398 HIS A CG  1 
ATOM   5298  N ND1 . HIS B 1 403 ? 28.457  -49.725 -46.126 1.00 76.59  ? 398 HIS A ND1 1 
ATOM   5299  C CD2 . HIS B 1 403 ? 28.723  -49.091 -44.055 1.00 76.49  ? 398 HIS A CD2 1 
ATOM   5300  C CE1 . HIS B 1 403 ? 28.072  -50.729 -45.359 1.00 75.14  ? 398 HIS A CE1 1 
ATOM   5301  N NE2 . HIS B 1 403 ? 28.222  -50.370 -44.098 1.00 74.99  ? 398 HIS A NE2 1 
ATOM   5302  N N   . PRO B 1 404 ? 31.676  -46.213 -48.579 1.00 93.85  ? 399 PRO A N   1 
ATOM   5303  C CA  . PRO B 1 404 ? 32.158  -45.061 -49.356 1.00 95.82  ? 399 PRO A CA  1 
ATOM   5304  C C   . PRO B 1 404 ? 31.108  -44.004 -49.695 1.00 97.31  ? 399 PRO A C   1 
ATOM   5305  O O   . PRO B 1 404 ? 30.815  -43.827 -50.900 1.00 97.43  ? 399 PRO A O   1 
ATOM   5306  C CB  . PRO B 1 404 ? 32.737  -45.714 -50.606 1.00 97.63  ? 399 PRO A CB  1 
ATOM   5307  C CG  . PRO B 1 404 ? 33.237  -47.025 -50.091 1.00 97.18  ? 399 PRO A CG  1 
ATOM   5308  C CD  . PRO B 1 404 ? 32.093  -47.473 -49.221 1.00 94.93  ? 399 PRO A CD  1 
ATOM   5309  N N   . GLN C 1 14  ? 31.743  -25.824 11.401  1.00 45.24  ? 9   GLN C N   1 
ATOM   5310  C CA  . GLN C 1 14  ? 31.772  -24.649 12.286  1.00 45.03  ? 9   GLN C CA  1 
ATOM   5311  C C   . GLN C 1 14  ? 32.865  -24.736 13.350  1.00 41.85  ? 9   GLN C C   1 
ATOM   5312  O O   . GLN C 1 14  ? 33.203  -25.785 13.857  1.00 54.02  ? 9   GLN C O   1 
ATOM   5313  C CB  . GLN C 1 14  ? 30.372  -24.470 12.953  1.00 40.96  ? 9   GLN C CB  1 
ATOM   5314  C CG  . GLN C 1 14  ? 30.119  -25.256 14.199  1.00 32.62  ? 9   GLN C CG  1 
ATOM   5315  C CD  . GLN C 1 14  ? 28.744  -25.872 14.466  1.00 34.06  ? 9   GLN C CD  1 
ATOM   5316  O OE1 . GLN C 1 14  ? 28.120  -26.525 13.611  1.00 40.26  ? 9   GLN C OE1 1 
ATOM   5317  N NE2 . GLN C 1 14  ? 28.306  -25.735 15.711  1.00 32.39  ? 9   GLN C NE2 1 
ATOM   5318  N N   . GLY C 1 15  ? 33.422  -23.559 13.608  1.00 62.59  ? 10  GLY C N   1 
ATOM   5319  C CA  . GLY C 1 15  ? 34.510  -23.305 14.526  1.00 65.06  ? 10  GLY C CA  1 
ATOM   5320  C C   . GLY C 1 15  ? 34.497  -21.828 14.836  1.00 63.53  ? 10  GLY C C   1 
ATOM   5321  O O   . GLY C 1 15  ? 35.527  -21.235 15.121  1.00 70.81  ? 10  GLY C O   1 
ATOM   5322  N N   . PHE C 1 16  ? 33.320  -21.226 14.702  1.00 64.87  ? 11  PHE C N   1 
ATOM   5323  C CA  . PHE C 1 16  ? 33.118  -19.801 14.955  1.00 60.19  ? 11  PHE C CA  1 
ATOM   5324  C C   . PHE C 1 16  ? 33.033  -19.609 16.468  1.00 57.68  ? 11  PHE C C   1 
ATOM   5325  O O   . PHE C 1 16  ? 32.932  -20.590 17.210  1.00 58.33  ? 11  PHE C O   1 
ATOM   5326  C CB  . PHE C 1 16  ? 31.797  -19.327 14.330  1.00 55.55  ? 11  PHE C CB  1 
ATOM   5327  C CG  . PHE C 1 16  ? 31.742  -19.413 12.836  1.00 50.53  ? 11  PHE C CG  1 
ATOM   5328  C CD1 . PHE C 1 16  ? 32.025  -18.294 12.063  1.00 48.07  ? 11  PHE C CD1 1 
ATOM   5329  C CD2 . PHE C 1 16  ? 31.325  -20.585 12.200  1.00 48.07  ? 11  PHE C CD2 1 
ATOM   5330  C CE1 . PHE C 1 16  ? 31.884  -18.332 10.675  1.00 45.87  ? 11  PHE C CE1 1 
ATOM   5331  C CE2 . PHE C 1 16  ? 31.183  -20.630 10.809  1.00 44.06  ? 11  PHE C CE2 1 
ATOM   5332  C CZ  . PHE C 1 16  ? 31.460  -19.500 10.050  1.00 43.59  ? 11  PHE C CZ  1 
ATOM   5333  N N   . LEU C 1 17  ? 33.079  -18.364 16.932  1.00 52.80  ? 12  LEU C N   1 
ATOM   5334  C CA  . LEU C 1 17  ? 32.978  -18.121 18.360  1.00 50.03  ? 12  LEU C CA  1 
ATOM   5335  C C   . LEU C 1 17  ? 31.638  -18.705 18.766  1.00 49.91  ? 12  LEU C C   1 
ATOM   5336  O O   . LEU C 1 17  ? 30.696  -18.755 17.964  1.00 50.98  ? 12  LEU C O   1 
ATOM   5337  C CB  . LEU C 1 17  ? 32.942  -16.633 18.656  1.00 46.46  ? 12  LEU C CB  1 
ATOM   5338  C CG  . LEU C 1 17  ? 33.964  -15.722 17.998  1.00 47.28  ? 12  LEU C CG  1 
ATOM   5339  C CD1 . LEU C 1 17  ? 33.436  -14.293 18.070  1.00 46.35  ? 12  LEU C CD1 1 
ATOM   5340  C CD2 . LEU C 1 17  ? 35.327  -15.862 18.668  1.00 44.11  ? 12  LEU C CD2 1 
ATOM   5341  N N   . PRO C 1 18  ? 31.524  -19.170 20.010  1.00 47.40  ? 13  PRO C N   1 
ATOM   5342  C CA  . PRO C 1 18  ? 30.218  -19.719 20.389  1.00 46.81  ? 13  PRO C CA  1 
ATOM   5343  C C   . PRO C 1 18  ? 29.198  -18.566 20.411  1.00 47.40  ? 13  PRO C C   1 
ATOM   5344  O O   . PRO C 1 18  ? 29.569  -17.391 20.556  1.00 45.66  ? 13  PRO C O   1 
ATOM   5345  C CB  . PRO C 1 18  ? 30.485  -20.318 21.765  1.00 46.38  ? 13  PRO C CB  1 
ATOM   5346  C CG  . PRO C 1 18  ? 31.604  -19.435 22.303  1.00 46.63  ? 13  PRO C CG  1 
ATOM   5347  C CD  . PRO C 1 18  ? 32.501  -19.276 21.105  1.00 46.46  ? 13  PRO C CD  1 
ATOM   5348  N N   . HIS C 1 19  ? 27.921  -18.892 20.247  1.00 46.43  ? 14  HIS C N   1 
ATOM   5349  C CA  . HIS C 1 19  ? 26.887  -17.865 20.243  1.00 45.63  ? 14  HIS C CA  1 
ATOM   5350  C C   . HIS C 1 19  ? 26.810  -17.136 21.566  1.00 43.39  ? 14  HIS C C   1 
ATOM   5351  O O   . HIS C 1 19  ? 26.902  -17.746 22.627  1.00 43.79  ? 14  HIS C O   1 
ATOM   5352  C CB  . HIS C 1 19  ? 25.531  -18.475 19.880  1.00 47.16  ? 14  HIS C CB  1 
ATOM   5353  C CG  . HIS C 1 19  ? 25.334  -18.634 18.405  1.00 50.25  ? 14  HIS C CG  1 
ATOM   5354  N ND1 . HIS C 1 19  ? 24.919  -19.814 17.829  1.00 50.73  ? 14  HIS C ND1 1 
ATOM   5355  C CD2 . HIS C 1 19  ? 25.541  -17.768 17.383  1.00 50.94  ? 14  HIS C CD2 1 
ATOM   5356  C CE1 . HIS C 1 19  ? 24.884  -19.673 16.515  1.00 51.54  ? 14  HIS C CE1 1 
ATOM   5357  N NE2 . HIS C 1 19  ? 25.257  -18.441 16.219  1.00 52.85  ? 14  HIS C NE2 1 
ATOM   5358  N N   . PHE C 1 20  ? 26.643  -15.822 21.485  1.00 41.48  ? 15  PHE C N   1 
ATOM   5359  C CA  . PHE C 1 20  ? 26.572  -14.973 22.664  1.00 40.44  ? 15  PHE C CA  1 
ATOM   5360  C C   . PHE C 1 20  ? 25.536  -15.433 23.682  1.00 39.50  ? 15  PHE C C   1 
ATOM   5361  O O   . PHE C 1 20  ? 24.373  -15.651 23.350  1.00 39.17  ? 15  PHE C O   1 
ATOM   5362  C CB  . PHE C 1 20  ? 26.299  -13.533 22.235  1.00 38.36  ? 15  PHE C CB  1 
ATOM   5363  C CG  . PHE C 1 20  ? 27.279  -13.013 21.216  1.00 39.21  ? 15  PHE C CG  1 
ATOM   5364  C CD1 . PHE C 1 20  ? 28.651  -13.184 21.400  1.00 37.32  ? 15  PHE C CD1 1 
ATOM   5365  C CD2 . PHE C 1 20  ? 26.833  -12.344 20.074  1.00 39.15  ? 15  PHE C CD2 1 
ATOM   5366  C CE1 . PHE C 1 20  ? 29.563  -12.699 20.469  1.00 37.15  ? 15  PHE C CE1 1 
ATOM   5367  C CE2 . PHE C 1 20  ? 27.736  -11.853 19.136  1.00 38.49  ? 15  PHE C CE2 1 
ATOM   5368  C CZ  . PHE C 1 20  ? 29.109  -12.033 19.336  1.00 39.26  ? 15  PHE C CZ  1 
ATOM   5369  N N   . GLN C 1 21  ? 25.975  -15.579 24.928  1.00 39.35  ? 16  GLN C N   1 
ATOM   5370  C CA  . GLN C 1 21  ? 25.104  -16.020 26.007  1.00 41.46  ? 16  GLN C CA  1 
ATOM   5371  C C   . GLN C 1 21  ? 23.973  -15.049 26.349  1.00 40.12  ? 16  GLN C C   1 
ATOM   5372  O O   . GLN C 1 21  ? 24.167  -13.832 26.390  1.00 39.73  ? 16  GLN C O   1 
ATOM   5373  C CB  . GLN C 1 21  ? 25.926  -16.286 27.274  1.00 44.50  ? 16  GLN C CB  1 
ATOM   5374  C CG  . GLN C 1 21  ? 26.456  -17.710 27.403  1.00 49.16  ? 16  GLN C CG  1 
ATOM   5375  C CD  . GLN C 1 21  ? 27.168  -17.947 28.729  1.00 52.22  ? 16  GLN C CD  1 
ATOM   5376  O OE1 . GLN C 1 21  ? 28.266  -17.432 28.961  1.00 54.01  ? 16  GLN C OE1 1 
ATOM   5377  N NE2 . GLN C 1 21  ? 26.538  -18.724 29.610  1.00 52.99  ? 16  GLN C NE2 1 
ATOM   5378  N N   . HIS C 1 22  ? 22.792  -15.613 26.586  1.00 38.14  ? 17  HIS C N   1 
ATOM   5379  C CA  . HIS C 1 22  ? 21.608  -14.858 26.971  1.00 37.40  ? 17  HIS C CA  1 
ATOM   5380  C C   . HIS C 1 22  ? 20.978  -13.968 25.908  1.00 37.98  ? 17  HIS C C   1 
ATOM   5381  O O   . HIS C 1 22  ? 19.897  -13.415 26.138  1.00 38.17  ? 17  HIS C O   1 
ATOM   5382  C CB  . HIS C 1 22  ? 21.934  -14.021 28.202  1.00 38.32  ? 17  HIS C CB  1 
ATOM   5383  C CG  . HIS C 1 22  ? 22.704  -14.772 29.240  1.00 40.21  ? 17  HIS C CG  1 
ATOM   5384  N ND1 . HIS C 1 22  ? 23.799  -14.238 29.889  1.00 41.18  ? 17  HIS C ND1 1 
ATOM   5385  C CD2 . HIS C 1 22  ? 22.561  -16.029 29.719  1.00 39.76  ? 17  HIS C CD2 1 
ATOM   5386  C CE1 . HIS C 1 22  ? 24.299  -15.135 30.718  1.00 41.97  ? 17  HIS C CE1 1 
ATOM   5387  N NE2 . HIS C 1 22  ? 23.566  -16.232 30.634  1.00 43.37  ? 17  HIS C NE2 1 
ATOM   5388  N N   . PHE C 1 23  ? 21.626  -13.841 24.750  1.00 35.91  ? 18  PHE C N   1 
ATOM   5389  C CA  . PHE C 1 23  ? 21.115  -12.997 23.666  1.00 33.25  ? 18  PHE C CA  1 
ATOM   5390  C C   . PHE C 1 23  ? 19.601  -13.076 23.451  1.00 34.19  ? 18  PHE C C   1 
ATOM   5391  O O   . PHE C 1 23  ? 18.899  -12.083 23.650  1.00 35.30  ? 18  PHE C O   1 
ATOM   5392  C CB  . PHE C 1 23  ? 21.807  -13.332 22.355  1.00 30.41  ? 18  PHE C CB  1 
ATOM   5393  C CG  . PHE C 1 23  ? 21.612  -12.291 21.294  1.00 25.86  ? 18  PHE C CG  1 
ATOM   5394  C CD1 . PHE C 1 23  ? 22.550  -11.288 21.112  1.00 22.54  ? 18  PHE C CD1 1 
ATOM   5395  C CD2 . PHE C 1 23  ? 20.485  -12.312 20.482  1.00 23.78  ? 18  PHE C CD2 1 
ATOM   5396  C CE1 . PHE C 1 23  ? 22.374  -10.318 20.135  1.00 22.44  ? 18  PHE C CE1 1 
ATOM   5397  C CE2 . PHE C 1 23  ? 20.298  -11.352 19.507  1.00 22.16  ? 18  PHE C CE2 1 
ATOM   5398  C CZ  . PHE C 1 23  ? 21.245  -10.350 19.330  1.00 22.09  ? 18  PHE C CZ  1 
ATOM   5399  N N   . ALA C 1 24  ? 19.100  -14.241 23.036  1.00 33.75  ? 19  ALA C N   1 
ATOM   5400  C CA  . ALA C 1 24  ? 17.660  -14.429 22.802  1.00 33.14  ? 19  ALA C CA  1 
ATOM   5401  C C   . ALA C 1 24  ? 16.808  -14.042 24.007  1.00 34.96  ? 19  ALA C C   1 
ATOM   5402  O O   . ALA C 1 24  ? 15.780  -13.375 23.874  1.00 35.77  ? 19  ALA C O   1 
ATOM   5403  C CB  . ALA C 1 24  ? 17.377  -15.859 22.434  1.00 31.08  ? 19  ALA C CB  1 
ATOM   5404  N N   . THR C 1 25  ? 17.236  -14.468 25.188  1.00 35.81  ? 20  THR C N   1 
ATOM   5405  C CA  . THR C 1 25  ? 16.507  -14.163 26.412  1.00 34.79  ? 20  THR C CA  1 
ATOM   5406  C C   . THR C 1 25  ? 16.449  -12.657 26.680  1.00 35.18  ? 20  THR C C   1 
ATOM   5407  O O   . THR C 1 25  ? 15.405  -12.127 27.069  1.00 33.00  ? 20  THR C O   1 
ATOM   5408  C CB  . THR C 1 25  ? 17.147  -14.888 27.608  1.00 33.97  ? 20  THR C CB  1 
ATOM   5409  O OG1 . THR C 1 25  ? 17.137  -16.300 27.357  1.00 33.41  ? 20  THR C OG1 1 
ATOM   5410  C CG2 . THR C 1 25  ? 16.370  -14.611 28.878  1.00 33.27  ? 20  THR C CG2 1 
ATOM   5411  N N   . GLN C 1 26  ? 17.573  -11.975 26.465  1.00 35.87  ? 21  GLN C N   1 
ATOM   5412  C CA  . GLN C 1 26  ? 17.649  -10.534 26.680  1.00 34.20  ? 21  GLN C CA  1 
ATOM   5413  C C   . GLN C 1 26  ? 16.807  -9.827  25.623  1.00 34.89  ? 21  GLN C C   1 
ATOM   5414  O O   . GLN C 1 26  ? 16.090  -8.878  25.926  1.00 34.86  ? 21  GLN C O   1 
ATOM   5415  C CB  . GLN C 1 26  ? 19.101  -10.054 26.593  1.00 32.42  ? 21  GLN C CB  1 
ATOM   5416  C CG  . GLN C 1 26  ? 20.073  -10.886 27.414  1.00 34.16  ? 21  GLN C CG  1 
ATOM   5417  C CD  . GLN C 1 26  ? 21.519  -10.439 27.259  1.00 36.09  ? 21  GLN C CD  1 
ATOM   5418  O OE1 . GLN C 1 26  ? 21.949  -10.063 26.170  1.00 37.56  ? 21  GLN C OE1 1 
ATOM   5419  N NE2 . GLN C 1 26  ? 22.279  -10.495 28.346  1.00 35.16  ? 21  GLN C NE2 1 
ATOM   5420  N N   . ALA C 1 27  ? 16.889  -10.300 24.384  1.00 34.80  ? 22  ALA C N   1 
ATOM   5421  C CA  . ALA C 1 27  ? 16.133  -9.699  23.293  1.00 35.04  ? 22  ALA C CA  1 
ATOM   5422  C C   . ALA C 1 27  ? 14.622  -9.751  23.559  1.00 36.00  ? 22  ALA C C   1 
ATOM   5423  O O   . ALA C 1 27  ? 13.886  -8.803  23.256  1.00 38.07  ? 22  ALA C O   1 
ATOM   5424  C CB  . ALA C 1 27  ? 16.466  -10.410 21.984  1.00 33.07  ? 22  ALA C CB  1 
ATOM   5425  N N   . ILE C 1 28  ? 14.164  -10.857 24.134  1.00 33.85  ? 23  ILE C N   1 
ATOM   5426  C CA  . ILE C 1 28  ? 12.752  -11.037 24.426  1.00 32.21  ? 23  ILE C CA  1 
ATOM   5427  C C   . ILE C 1 28  ? 12.306  -10.460 25.778  1.00 34.34  ? 23  ILE C C   1 
ATOM   5428  O O   . ILE C 1 28  ? 11.186  -9.970  25.908  1.00 35.05  ? 23  ILE C O   1 
ATOM   5429  C CB  . ILE C 1 28  ? 12.394  -12.535 24.394  1.00 30.11  ? 23  ILE C CB  1 
ATOM   5430  C CG1 . ILE C 1 28  ? 12.502  -13.058 22.967  1.00 30.73  ? 23  ILE C CG1 1 
ATOM   5431  C CG2 . ILE C 1 28  ? 11.006  -12.763 24.932  1.00 27.42  ? 23  ILE C CG2 1 
ATOM   5432  C CD1 . ILE C 1 28  ? 12.301  -14.557 22.843  1.00 28.38  ? 23  ILE C CD1 1 
ATOM   5433  N N   . HIS C 1 29  ? 13.185  -10.495 26.775  1.00 34.95  ? 24  HIS C N   1 
ATOM   5434  C CA  . HIS C 1 29  ? 12.825  -10.032 28.109  1.00 34.47  ? 24  HIS C CA  1 
ATOM   5435  C C   . HIS C 1 29  ? 13.353  -8.672  28.603  1.00 36.11  ? 24  HIS C C   1 
ATOM   5436  O O   . HIS C 1 29  ? 12.708  -8.033  29.429  1.00 37.42  ? 24  HIS C O   1 
ATOM   5437  C CB  . HIS C 1 29  ? 13.191  -11.135 29.127  1.00 33.37  ? 24  HIS C CB  1 
ATOM   5438  C CG  . HIS C 1 29  ? 12.389  -12.399 28.981  1.00 32.61  ? 24  HIS C CG  1 
ATOM   5439  N ND1 . HIS C 1 29  ? 11.105  -12.531 29.469  1.00 31.46  ? 24  HIS C ND1 1 
ATOM   5440  C CD2 . HIS C 1 29  ? 12.678  -13.578 28.375  1.00 32.74  ? 24  HIS C CD2 1 
ATOM   5441  C CE1 . HIS C 1 29  ? 10.639  -13.732 29.168  1.00 30.25  ? 24  HIS C CE1 1 
ATOM   5442  N NE2 . HIS C 1 29  ? 11.573  -14.388 28.503  1.00 28.89  ? 24  HIS C NE2 1 
ATOM   5443  N N   . VAL C 1 30  ? 14.499  -8.208  28.121  1.00 37.85  ? 25  VAL C N   1 
ATOM   5444  C CA  . VAL C 1 30  ? 15.031  -6.927  28.609  1.00 40.74  ? 25  VAL C CA  1 
ATOM   5445  C C   . VAL C 1 30  ? 14.191  -5.688  28.284  1.00 44.41  ? 25  VAL C C   1 
ATOM   5446  O O   . VAL C 1 30  ? 14.096  -5.280  27.131  1.00 45.56  ? 25  VAL C O   1 
ATOM   5447  C CB  . VAL C 1 30  ? 16.474  -6.656  28.087  1.00 39.88  ? 25  VAL C CB  1 
ATOM   5448  C CG1 . VAL C 1 30  ? 16.956  -5.296  28.575  1.00 37.45  ? 25  VAL C CG1 1 
ATOM   5449  C CG2 . VAL C 1 30  ? 17.419  -7.743  28.558  1.00 36.91  ? 25  VAL C CG2 1 
ATOM   5450  N N   . GLY C 1 31  ? 13.595  -5.087  29.308  1.00 48.15  ? 26  GLY C N   1 
ATOM   5451  C CA  . GLY C 1 31  ? 12.808  -3.886  29.096  1.00 54.10  ? 26  GLY C CA  1 
ATOM   5452  C C   . GLY C 1 31  ? 11.316  -4.097  28.965  1.00 58.99  ? 26  GLY C C   1 
ATOM   5453  O O   . GLY C 1 31  ? 10.547  -3.136  29.014  1.00 59.91  ? 26  GLY C O   1 
ATOM   5454  N N   . GLN C 1 32  ? 10.900  -5.349  28.800  1.00 62.72  ? 27  GLN C N   1 
ATOM   5455  C CA  . GLN C 1 32  ? 9.480   -5.666  28.656  1.00 65.84  ? 27  GLN C CA  1 
ATOM   5456  C C   . GLN C 1 32  ? 8.794   -5.731  30.022  1.00 68.32  ? 27  GLN C C   1 
ATOM   5457  O O   . GLN C 1 32  ? 9.453   -5.796  31.065  1.00 70.46  ? 27  GLN C O   1 
ATOM   5458  C CB  . GLN C 1 32  ? 9.298   -7.007  27.927  1.00 65.66  ? 27  GLN C CB  1 
ATOM   5459  C CG  . GLN C 1 32  ? 10.226  -7.220  26.731  1.00 62.79  ? 27  GLN C CG  1 
ATOM   5460  C CD  . GLN C 1 32  ? 10.205  -6.064  25.751  1.00 61.98  ? 27  GLN C CD  1 
ATOM   5461  O OE1 . GLN C 1 32  ? 9.150   -5.697  25.227  1.00 60.77  ? 27  GLN C OE1 1 
ATOM   5462  N NE2 . GLN C 1 32  ? 11.377  -5.483  25.494  1.00 60.38  ? 27  GLN C NE2 1 
ATOM   5463  N N   . GLY C 1 69  ? 13.431  12.164  25.795  1.00 61.10  ? 64  GLY C N   1 
ATOM   5464  C CA  . GLY C 1 69  ? 13.454  10.912  25.064  1.00 61.36  ? 64  GLY C CA  1 
ATOM   5465  C C   . GLY C 1 69  ? 12.265  10.058  25.431  1.00 61.76  ? 64  GLY C C   1 
ATOM   5466  O O   . GLY C 1 69  ? 11.473  9.678   24.568  1.00 63.14  ? 64  GLY C O   1 
ATOM   5467  N N   . ASN C 1 70  ? 12.167  9.743   26.721  1.00 60.24  ? 65  ASN C N   1 
ATOM   5468  C CA  . ASN C 1 70  ? 11.071  8.958   27.292  1.00 59.67  ? 65  ASN C CA  1 
ATOM   5469  C C   . ASN C 1 70  ? 11.111  7.429   27.112  1.00 54.92  ? 65  ASN C C   1 
ATOM   5470  O O   . ASN C 1 70  ? 11.930  6.903   26.360  1.00 53.81  ? 65  ASN C O   1 
ATOM   5471  C CB  . ASN C 1 70  ? 9.743   9.556   26.811  1.00 67.35  ? 65  ASN C CB  1 
ATOM   5472  C CG  . ASN C 1 70  ? 9.453   10.906  27.457  1.00 71.60  ? 65  ASN C CG  1 
ATOM   5473  O OD1 . ASN C 1 70  ? 10.354  11.732  27.608  1.00 74.38  ? 65  ASN C OD1 1 
ATOM   5474  N ND2 . ASN C 1 70  ? 8.195   11.136  27.835  1.00 75.24  ? 65  ASN C ND2 1 
ATOM   5475  N N   . PRO C 1 71  ? 10.217  6.704   27.818  1.00 50.20  ? 66  PRO C N   1 
ATOM   5476  C CA  . PRO C 1 71  ? 10.031  5.252   27.863  1.00 46.84  ? 66  PRO C CA  1 
ATOM   5477  C C   . PRO C 1 71  ? 10.485  4.372   26.720  1.00 44.49  ? 66  PRO C C   1 
ATOM   5478  O O   . PRO C 1 71  ? 11.575  3.797   26.754  1.00 46.02  ? 66  PRO C O   1 
ATOM   5479  C CB  . PRO C 1 71  ? 8.539   5.114   28.105  1.00 46.65  ? 66  PRO C CB  1 
ATOM   5480  C CG  . PRO C 1 71  ? 8.304   6.168   29.056  1.00 48.70  ? 66  PRO C CG  1 
ATOM   5481  C CD  . PRO C 1 71  ? 9.061   7.346   28.470  1.00 49.60  ? 66  PRO C CD  1 
ATOM   5482  N N   . THR C 1 72  ? 9.612   4.245   25.730  1.00 39.69  ? 67  THR C N   1 
ATOM   5483  C CA  . THR C 1 72  ? 9.851   3.407   24.577  1.00 34.51  ? 67  THR C CA  1 
ATOM   5484  C C   . THR C 1 72  ? 11.305  3.361   24.119  1.00 32.96  ? 67  THR C C   1 
ATOM   5485  O O   . THR C 1 72  ? 11.852  2.282   23.866  1.00 31.70  ? 67  THR C O   1 
ATOM   5486  C CB  . THR C 1 72  ? 8.930   3.848   23.435  1.00 33.96  ? 67  THR C CB  1 
ATOM   5487  O OG1 . THR C 1 72  ? 7.582   3.855   23.918  1.00 32.45  ? 67  THR C OG1 1 
ATOM   5488  C CG2 . THR C 1 72  ? 9.027   2.890   22.249  1.00 32.07  ? 67  THR C CG2 1 
ATOM   5489  N N   . ARG C 1 73  ? 11.932  4.526   24.038  1.00 31.34  ? 68  ARG C N   1 
ATOM   5490  C CA  . ARG C 1 73  ? 13.316  4.614   23.601  1.00 31.85  ? 68  ARG C CA  1 
ATOM   5491  C C   . ARG C 1 73  ? 14.282  4.047   24.635  1.00 33.94  ? 68  ARG C C   1 
ATOM   5492  O O   . ARG C 1 73  ? 15.247  3.362   24.280  1.00 33.18  ? 68  ARG C O   1 
ATOM   5493  C CB  . ARG C 1 73  ? 13.667  6.065   23.310  1.00 29.60  ? 68  ARG C CB  1 
ATOM   5494  C CG  . ARG C 1 73  ? 14.846  6.235   22.388  1.00 26.58  ? 68  ARG C CG  1 
ATOM   5495  C CD  . ARG C 1 73  ? 15.112  7.706   22.181  1.00 27.67  ? 68  ARG C CD  1 
ATOM   5496  N NE  . ARG C 1 73  ? 15.650  8.298   23.399  1.00 29.75  ? 68  ARG C NE  1 
ATOM   5497  C CZ  . ARG C 1 73  ? 15.888  9.595   23.576  1.00 31.78  ? 68  ARG C CZ  1 
ATOM   5498  N NH1 . ARG C 1 73  ? 15.628  10.478  22.615  1.00 30.59  ? 68  ARG C NH1 1 
ATOM   5499  N NH2 . ARG C 1 73  ? 16.417  10.005  24.721  1.00 34.64  ? 68  ARG C NH2 1 
ATOM   5500  N N   . ASN C 1 74  ? 14.018  4.333   25.909  1.00 37.88  ? 69  ASN C N   1 
ATOM   5501  C CA  . ASN C 1 74  ? 14.855  3.845   27.004  1.00 42.07  ? 69  ASN C CA  1 
ATOM   5502  C C   . ASN C 1 74  ? 14.871  2.319   27.055  1.00 40.99  ? 69  ASN C C   1 
ATOM   5503  O O   . ASN C 1 74  ? 15.907  1.718   27.335  1.00 43.09  ? 69  ASN C O   1 
ATOM   5504  C CB  . ASN C 1 74  ? 14.373  4.397   28.357  1.00 47.89  ? 69  ASN C CB  1 
ATOM   5505  C CG  . ASN C 1 74  ? 14.671  5.891   28.536  1.00 52.09  ? 69  ASN C CG  1 
ATOM   5506  O OD1 . ASN C 1 74  ? 14.142  6.737   27.812  1.00 55.61  ? 69  ASN C OD1 1 
ATOM   5507  N ND2 . ASN C 1 74  ? 15.519  6.213   29.509  1.00 54.49  ? 69  ASN C ND2 1 
ATOM   5508  N N   . CYS C 1 75  ? 13.733  1.689   26.788  1.00 38.75  ? 70  CYS C N   1 
ATOM   5509  C CA  . CYS C 1 75  ? 13.676  0.232   26.795  1.00 39.12  ? 70  CYS C CA  1 
ATOM   5510  C C   . CYS C 1 75  ? 14.360  -0.367  25.572  1.00 36.55  ? 70  CYS C C   1 
ATOM   5511  O O   . CYS C 1 75  ? 14.956  -1.443  25.644  1.00 35.18  ? 70  CYS C O   1 
ATOM   5512  C CB  . CYS C 1 75  ? 12.231  -0.245  26.866  1.00 41.45  ? 70  CYS C CB  1 
ATOM   5513  S SG  . CYS C 1 75  ? 11.523  -0.021  28.504  1.00 49.30  ? 70  CYS C SG  1 
ATOM   5514  N N   . LEU C 1 76  ? 14.256  0.317   24.441  1.00 33.52  ? 71  LEU C N   1 
ATOM   5515  C CA  . LEU C 1 76  ? 14.917  -0.161  23.243  1.00 31.00  ? 71  LEU C CA  1 
ATOM   5516  C C   . LEU C 1 76  ? 16.401  -0.092  23.538  1.00 33.53  ? 71  LEU C C   1 
ATOM   5517  O O   . LEU C 1 76  ? 17.154  -1.022  23.239  1.00 34.57  ? 71  LEU C O   1 
ATOM   5518  C CB  . LEU C 1 76  ? 14.622  0.740   22.049  1.00 28.00  ? 71  LEU C CB  1 
ATOM   5519  C CG  . LEU C 1 76  ? 15.350  0.356   20.753  1.00 25.32  ? 71  LEU C CG  1 
ATOM   5520  C CD1 . LEU C 1 76  ? 14.878  -1.010  20.262  1.00 23.23  ? 71  LEU C CD1 1 
ATOM   5521  C CD2 . LEU C 1 76  ? 15.071  1.403   19.699  1.00 25.08  ? 71  LEU C CD2 1 
ATOM   5522  N N   . GLU C 1 77  ? 16.815  1.017   24.144  1.00 33.25  ? 72  GLU C N   1 
ATOM   5523  C CA  . GLU C 1 77  ? 18.217  1.220   24.462  1.00 33.33  ? 72  GLU C CA  1 
ATOM   5524  C C   . GLU C 1 77  ? 18.756  0.237   25.498  1.00 34.70  ? 72  GLU C C   1 
ATOM   5525  O O   . GLU C 1 77  ? 19.903  -0.187  25.391  1.00 35.80  ? 72  GLU C O   1 
ATOM   5526  C CB  . GLU C 1 77  ? 18.446  2.676   24.890  1.00 31.63  ? 72  GLU C CB  1 
ATOM   5527  C CG  . GLU C 1 77  ? 18.069  3.673   23.782  1.00 28.47  ? 72  GLU C CG  1 
ATOM   5528  C CD  . GLU C 1 77  ? 18.369  5.126   24.125  1.00 28.38  ? 72  GLU C CD  1 
ATOM   5529  O OE1 . GLU C 1 77  ? 18.102  5.555   25.271  1.00 29.61  ? 72  GLU C OE1 1 
ATOM   5530  O OE2 . GLU C 1 77  ? 18.856  5.848   23.235  1.00 25.38  ? 72  GLU C OE2 1 
ATOM   5531  N N   . LYS C 1 78  ? 17.952  -0.138  26.492  1.00 36.10  ? 73  LYS C N   1 
ATOM   5532  C CA  . LYS C 1 78  ? 18.423  -1.104  27.490  1.00 38.78  ? 73  LYS C CA  1 
ATOM   5533  C C   . LYS C 1 78  ? 18.663  -2.423  26.782  1.00 34.46  ? 73  LYS C C   1 
ATOM   5534  O O   . LYS C 1 78  ? 19.688  -3.072  26.962  1.00 32.45  ? 73  LYS C O   1 
ATOM   5535  C CB  . LYS C 1 78  ? 17.391  -1.332  28.605  1.00 45.69  ? 73  LYS C CB  1 
ATOM   5536  C CG  . LYS C 1 78  ? 17.430  -0.316  29.745  1.00 57.88  ? 73  LYS C CG  1 
ATOM   5537  C CD  . LYS C 1 78  ? 16.841  -0.908  31.039  1.00 67.71  ? 73  LYS C CD  1 
ATOM   5538  C CE  . LYS C 1 78  ? 16.898  0.069   32.234  1.00 73.38  ? 73  LYS C CE  1 
ATOM   5539  N NZ  . LYS C 1 78  ? 15.823  1.111   32.237  1.00 77.71  ? 73  LYS C NZ  1 
ATOM   5540  N N   . ALA C 1 79  ? 17.685  -2.800  25.968  1.00 33.28  ? 74  ALA C N   1 
ATOM   5541  C CA  . ALA C 1 79  ? 17.716  -4.034  25.206  1.00 31.66  ? 74  ALA C CA  1 
ATOM   5542  C C   . ALA C 1 79  ? 18.933  -4.122  24.287  1.00 31.40  ? 74  ALA C C   1 
ATOM   5543  O O   . ALA C 1 79  ? 19.751  -5.032  24.420  1.00 31.28  ? 74  ALA C O   1 
ATOM   5544  C CB  . ALA C 1 79  ? 16.434  -4.166  24.392  1.00 27.79  ? 74  ALA C CB  1 
ATOM   5545  N N   . VAL C 1 80  ? 19.062  -3.180  23.359  1.00 29.30  ? 75  VAL C N   1 
ATOM   5546  C CA  . VAL C 1 80  ? 20.184  -3.219  22.434  1.00 26.80  ? 75  VAL C CA  1 
ATOM   5547  C C   . VAL C 1 80  ? 21.520  -3.148  23.162  1.00 28.76  ? 75  VAL C C   1 
ATOM   5548  O O   . VAL C 1 80  ? 22.500  -3.769  22.730  1.00 30.26  ? 75  VAL C O   1 
ATOM   5549  C CB  . VAL C 1 80  ? 20.094  -2.095  21.380  1.00 25.76  ? 75  VAL C CB  1 
ATOM   5550  C CG1 . VAL C 1 80  ? 21.312  -2.133  20.481  1.00 24.14  ? 75  VAL C CG1 1 
ATOM   5551  C CG2 . VAL C 1 80  ? 18.846  -2.279  20.536  1.00 23.44  ? 75  VAL C CG2 1 
ATOM   5552  N N   . ALA C 1 81  ? 21.572  -2.407  24.266  1.00 28.33  ? 76  ALA C N   1 
ATOM   5553  C CA  . ALA C 1 81  ? 22.811  -2.322  25.026  1.00 26.80  ? 76  ALA C CA  1 
ATOM   5554  C C   . ALA C 1 81  ? 23.209  -3.738  25.410  1.00 28.44  ? 76  ALA C C   1 
ATOM   5555  O O   . ALA C 1 81  ? 24.368  -4.120  25.269  1.00 30.00  ? 76  ALA C O   1 
ATOM   5556  C CB  . ALA C 1 81  ? 22.623  -1.491  26.269  1.00 27.12  ? 76  ALA C CB  1 
ATOM   5557  N N   . ALA C 1 82  ? 22.247  -4.527  25.880  1.00 27.25  ? 77  ALA C N   1 
ATOM   5558  C CA  . ALA C 1 82  ? 22.533  -5.904  26.273  1.00 28.16  ? 77  ALA C CA  1 
ATOM   5559  C C   . ALA C 1 82  ? 22.961  -6.771  25.088  1.00 30.62  ? 77  ALA C C   1 
ATOM   5560  O O   . ALA C 1 82  ? 23.921  -7.545  25.173  1.00 31.59  ? 77  ALA C O   1 
ATOM   5561  C CB  . ALA C 1 82  ? 21.322  -6.514  26.940  1.00 27.83  ? 77  ALA C CB  1 
ATOM   5562  N N   . LEU C 1 83  ? 22.244  -6.651  23.980  1.00 31.01  ? 78  LEU C N   1 
ATOM   5563  C CA  . LEU C 1 83  ? 22.575  -7.436  22.803  1.00 30.96  ? 78  LEU C CA  1 
ATOM   5564  C C   . LEU C 1 83  ? 23.980  -7.134  22.282  1.00 32.52  ? 78  LEU C C   1 
ATOM   5565  O O   . LEU C 1 83  ? 24.618  -7.991  21.677  1.00 34.09  ? 78  LEU C O   1 
ATOM   5566  C CB  . LEU C 1 83  ? 21.542  -7.205  21.693  1.00 26.27  ? 78  LEU C CB  1 
ATOM   5567  C CG  . LEU C 1 83  ? 20.100  -7.642  21.961  1.00 24.55  ? 78  LEU C CG  1 
ATOM   5568  C CD1 . LEU C 1 83  ? 19.402  -7.805  20.625  1.00 24.17  ? 78  LEU C CD1 1 
ATOM   5569  C CD2 . LEU C 1 83  ? 20.041  -8.946  22.722  1.00 19.29  ? 78  LEU C CD2 1 
ATOM   5570  N N   . ASP C 1 84  ? 24.460  -5.919  22.506  1.00 33.71  ? 79  ASP C N   1 
ATOM   5571  C CA  . ASP C 1 84  ? 25.790  -5.566  22.047  1.00 35.56  ? 79  ASP C CA  1 
ATOM   5572  C C   . ASP C 1 84  ? 26.808  -5.841  23.133  1.00 36.67  ? 79  ASP C C   1 
ATOM   5573  O O   . ASP C 1 84  ? 27.996  -5.572  22.954  1.00 37.67  ? 79  ASP C O   1 
ATOM   5574  C CB  . ASP C 1 84  ? 25.867  -4.086  21.666  1.00 37.82  ? 79  ASP C CB  1 
ATOM   5575  C CG  . ASP C 1 84  ? 25.260  -3.797  20.307  1.00 42.30  ? 79  ASP C CG  1 
ATOM   5576  O OD1 . ASP C 1 84  ? 25.372  -4.652  19.403  1.00 45.11  ? 79  ASP C OD1 1 
ATOM   5577  O OD2 . ASP C 1 84  ? 24.683  -2.705  20.131  1.00 45.00  ? 79  ASP C OD2 1 
ATOM   5578  N N   . GLY C 1 85  ? 26.347  -6.380  24.257  1.00 37.58  ? 80  GLY C N   1 
ATOM   5579  C CA  . GLY C 1 85  ? 27.246  -6.643  25.366  1.00 38.57  ? 80  GLY C CA  1 
ATOM   5580  C C   . GLY C 1 85  ? 27.877  -5.340  25.837  1.00 40.77  ? 80  GLY C C   1 
ATOM   5581  O O   . GLY C 1 85  ? 29.077  -5.288  26.121  1.00 43.15  ? 80  GLY C O   1 
ATOM   5582  N N   . ALA C 1 86  ? 27.069  -4.280  25.915  1.00 41.57  ? 81  ALA C N   1 
ATOM   5583  C CA  . ALA C 1 86  ? 27.541  -2.959  26.335  1.00 41.38  ? 81  ALA C CA  1 
ATOM   5584  C C   . ALA C 1 86  ? 26.745  -2.420  27.508  1.00 41.56  ? 81  ALA C C   1 
ATOM   5585  O O   . ALA C 1 86  ? 25.614  -2.827  27.742  1.00 40.00  ? 81  ALA C O   1 
ATOM   5586  C CB  . ALA C 1 86  ? 27.450  -1.984  25.181  1.00 41.37  ? 81  ALA C CB  1 
ATOM   5587  N N   . LYS C 1 87  ? 27.344  -1.485  28.236  1.00 45.46  ? 82  LYS C N   1 
ATOM   5588  C CA  . LYS C 1 87  ? 26.697  -0.879  29.398  1.00 48.28  ? 82  LYS C CA  1 
ATOM   5589  C C   . LYS C 1 87  ? 25.608  0.082   28.927  1.00 46.13  ? 82  LYS C C   1 
ATOM   5590  O O   . LYS C 1 87  ? 24.567  0.225   29.575  1.00 44.75  ? 82  LYS C O   1 
ATOM   5591  C CB  . LYS C 1 87  ? 27.732  -0.123  30.246  1.00 52.66  ? 82  LYS C CB  1 
ATOM   5592  C CG  . LYS C 1 87  ? 28.987  -0.940  30.572  1.00 61.56  ? 82  LYS C CG  1 
ATOM   5593  C CD  . LYS C 1 87  ? 30.131  -0.091  31.147  1.00 67.96  ? 82  LYS C CD  1 
ATOM   5594  C CE  . LYS C 1 87  ? 30.015  0.107   32.658  1.00 72.38  ? 82  LYS C CE  1 
ATOM   5595  N NZ  . LYS C 1 87  ? 31.121  0.945   33.216  1.00 75.28  ? 82  LYS C NZ  1 
ATOM   5596  N N   . TYR C 1 88  ? 25.846  0.730   27.790  1.00 44.28  ? 83  TYR C N   1 
ATOM   5597  C CA  . TYR C 1 88  ? 24.879  1.678   27.264  1.00 44.24  ? 83  TYR C CA  1 
ATOM   5598  C C   . TYR C 1 88  ? 24.645  1.569   25.764  1.00 42.30  ? 83  TYR C C   1 
ATOM   5599  O O   . TYR C 1 88  ? 25.333  0.842   25.053  1.00 41.57  ? 83  TYR C O   1 
ATOM   5600  C CB  . TYR C 1 88  ? 25.301  3.118   27.584  1.00 45.81  ? 83  TYR C CB  1 
ATOM   5601  C CG  . TYR C 1 88  ? 25.939  3.301   28.943  1.00 50.01  ? 83  TYR C CG  1 
ATOM   5602  C CD1 . TYR C 1 88  ? 27.313  3.120   29.118  1.00 51.58  ? 83  TYR C CD1 1 
ATOM   5603  C CD2 . TYR C 1 88  ? 25.172  3.644   30.060  1.00 50.19  ? 83  TYR C CD2 1 
ATOM   5604  C CE1 . TYR C 1 88  ? 27.909  3.274   30.372  1.00 51.26  ? 83  TYR C CE1 1 
ATOM   5605  C CE2 . TYR C 1 88  ? 25.759  3.799   31.316  1.00 50.86  ? 83  TYR C CE2 1 
ATOM   5606  C CZ  . TYR C 1 88  ? 27.127  3.612   31.464  1.00 51.42  ? 83  TYR C CZ  1 
ATOM   5607  O OH  . TYR C 1 88  ? 27.713  3.748   32.703  1.00 51.92  ? 83  TYR C OH  1 
ATOM   5608  N N   . CYS C 1 89  ? 23.651  2.323   25.311  1.00 41.24  ? 84  CYS C N   1 
ATOM   5609  C CA  . CYS C 1 89  ? 23.251  2.399   23.916  1.00 40.54  ? 84  CYS C CA  1 
ATOM   5610  C C   . CYS C 1 89  ? 22.338  3.616   23.747  1.00 40.60  ? 84  CYS C C   1 
ATOM   5611  O O   . CYS C 1 89  ? 21.465  3.879   24.576  1.00 41.49  ? 84  CYS C O   1 
ATOM   5612  C CB  . CYS C 1 89  ? 22.497  1.137   23.489  1.00 40.69  ? 84  CYS C CB  1 
ATOM   5613  S SG  . CYS C 1 89  ? 21.818  1.245   21.810  1.00 39.73  ? 84  CYS C SG  1 
ATOM   5614  N N   . LEU C 1 90  ? 22.553  4.364   22.676  1.00 38.80  ? 85  LEU C N   1 
ATOM   5615  C CA  . LEU C 1 90  ? 21.743  5.532   22.405  1.00 37.41  ? 85  LEU C CA  1 
ATOM   5616  C C   . LEU C 1 90  ? 21.172  5.370   21.002  1.00 36.73  ? 85  LEU C C   1 
ATOM   5617  O O   . LEU C 1 90  ? 21.902  5.036   20.071  1.00 37.92  ? 85  LEU C O   1 
ATOM   5618  C CB  . LEU C 1 90  ? 22.598  6.794   22.487  1.00 38.52  ? 85  LEU C CB  1 
ATOM   5619  C CG  . LEU C 1 90  ? 23.522  6.922   23.700  1.00 40.59  ? 85  LEU C CG  1 
ATOM   5620  C CD1 . LEU C 1 90  ? 24.808  6.139   23.444  1.00 42.41  ? 85  LEU C CD1 1 
ATOM   5621  C CD2 . LEU C 1 90  ? 23.856  8.386   23.936  1.00 40.05  ? 85  LEU C CD2 1 
ATOM   5622  N N   . ALA C 1 91  ? 19.872  5.604   20.853  1.00 34.32  ? 86  ALA C N   1 
ATOM   5623  C CA  . ALA C 1 91  ? 19.209  5.467   19.562  1.00 31.94  ? 86  ALA C CA  1 
ATOM   5624  C C   . ALA C 1 91  ? 19.046  6.797   18.828  1.00 31.11  ? 86  ALA C C   1 
ATOM   5625  O O   . ALA C 1 91  ? 18.730  7.816   19.438  1.00 30.66  ? 86  ALA C O   1 
ATOM   5626  C CB  . ALA C 1 91  ? 17.846  4.811   19.757  1.00 30.70  ? 86  ALA C CB  1 
ATOM   5627  N N   . PHE C 1 92  ? 19.257  6.775   17.514  1.00 30.56  ? 87  PHE C N   1 
ATOM   5628  C CA  . PHE C 1 92  ? 19.118  7.964   16.682  1.00 31.44  ? 87  PHE C CA  1 
ATOM   5629  C C   . PHE C 1 92  ? 18.196  7.667   15.518  1.00 31.57  ? 87  PHE C C   1 
ATOM   5630  O O   . PHE C 1 92  ? 17.891  6.516   15.245  1.00 33.04  ? 87  PHE C O   1 
ATOM   5631  C CB  . PHE C 1 92  ? 20.476  8.422   16.144  1.00 33.13  ? 87  PHE C CB  1 
ATOM   5632  C CG  . PHE C 1 92  ? 21.449  8.826   17.220  1.00 34.58  ? 87  PHE C CG  1 
ATOM   5633  C CD1 . PHE C 1 92  ? 22.179  7.869   17.919  1.00 34.24  ? 87  PHE C CD1 1 
ATOM   5634  C CD2 . PHE C 1 92  ? 21.609  10.159  17.561  1.00 34.42  ? 87  PHE C CD2 1 
ATOM   5635  C CE1 . PHE C 1 92  ? 23.048  8.236   18.934  1.00 33.58  ? 87  PHE C CE1 1 
ATOM   5636  C CE2 . PHE C 1 92  ? 22.482  10.528  18.581  1.00 35.47  ? 87  PHE C CE2 1 
ATOM   5637  C CZ  . PHE C 1 92  ? 23.200  9.563   19.266  1.00 32.53  ? 87  PHE C CZ  1 
ATOM   5638  N N   . ALA C 1 93  ? 17.767  8.719   14.831  1.00 33.31  ? 88  ALA C N   1 
ATOM   5639  C CA  . ALA C 1 93  ? 16.861  8.625   13.691  1.00 33.96  ? 88  ALA C CA  1 
ATOM   5640  C C   . ALA C 1 93  ? 17.279  7.623   12.621  1.00 34.99  ? 88  ALA C C   1 
ATOM   5641  O O   . ALA C 1 93  ? 16.455  6.866   12.104  1.00 34.84  ? 88  ALA C O   1 
ATOM   5642  C CB  . ALA C 1 93  ? 16.703  10.000  13.062  1.00 34.99  ? 88  ALA C CB  1 
ATOM   5643  N N   . SER C 1 94  ? 18.559  7.632   12.276  1.00 34.96  ? 89  SER C N   1 
ATOM   5644  C CA  . SER C 1 94  ? 19.076  6.727   11.255  1.00 35.27  ? 89  SER C CA  1 
ATOM   5645  C C   . SER C 1 94  ? 20.522  6.393   11.565  1.00 35.90  ? 89  SER C C   1 
ATOM   5646  O O   . SER C 1 94  ? 21.159  7.069   12.376  1.00 35.91  ? 89  SER C O   1 
ATOM   5647  C CB  . SER C 1 94  ? 19.015  7.400   9.888   1.00 34.26  ? 89  SER C CB  1 
ATOM   5648  O OG  . SER C 1 94  ? 19.794  8.589   9.892   1.00 33.70  ? 89  SER C OG  1 
ATOM   5649  N N   . GLY C 1 95  ? 21.038  5.350   10.922  1.00 35.30  ? 90  GLY C N   1 
ATOM   5650  C CA  . GLY C 1 95  ? 22.424  4.994   11.131  1.00 34.93  ? 90  GLY C CA  1 
ATOM   5651  C C   . GLY C 1 95  ? 23.282  6.166   10.684  1.00 35.95  ? 90  GLY C C   1 
ATOM   5652  O O   . GLY C 1 95  ? 24.321  6.458   11.288  1.00 35.62  ? 90  GLY C O   1 
ATOM   5653  N N   . LEU C 1 96  ? 22.841  6.846   9.624   1.00 36.60  ? 91  LEU C N   1 
ATOM   5654  C CA  . LEU C 1 96  ? 23.568  8.005   9.105   1.00 37.50  ? 91  LEU C CA  1 
ATOM   5655  C C   . LEU C 1 96  ? 23.622  9.114   10.158  1.00 37.26  ? 91  LEU C C   1 
ATOM   5656  O O   . LEU C 1 96  ? 24.657  9.762   10.330  1.00 38.26  ? 91  LEU C O   1 
ATOM   5657  C CB  . LEU C 1 96  ? 22.913  8.540   7.822   1.00 37.15  ? 91  LEU C CB  1 
ATOM   5658  C CG  . LEU C 1 96  ? 23.490  9.862   7.298   1.00 36.93  ? 91  LEU C CG  1 
ATOM   5659  C CD1 . LEU C 1 96  ? 24.962  9.704   6.995   1.00 37.90  ? 91  LEU C CD1 1 
ATOM   5660  C CD2 . LEU C 1 96  ? 22.750  10.290  6.055   1.00 37.87  ? 91  LEU C CD2 1 
ATOM   5661  N N   . ALA C 1 97  ? 22.508  9.325   10.860  1.00 36.36  ? 92  ALA C N   1 
ATOM   5662  C CA  . ALA C 1 97  ? 22.444  10.339  11.908  1.00 34.04  ? 92  ALA C CA  1 
ATOM   5663  C C   . ALA C 1 97  ? 23.397  9.924   13.019  1.00 32.38  ? 92  ALA C C   1 
ATOM   5664  O O   . ALA C 1 97  ? 24.176  10.736  13.513  1.00 33.17  ? 92  ALA C O   1 
ATOM   5665  C CB  . ALA C 1 97  ? 21.026  10.455  12.448  1.00 34.22  ? 92  ALA C CB  1 
ATOM   5666  N N   . ALA C 1 98  ? 23.345  8.654   13.405  1.00 30.51  ? 93  ALA C N   1 
ATOM   5667  C CA  . ALA C 1 98  ? 24.229  8.158   14.448  1.00 32.34  ? 93  ALA C CA  1 
ATOM   5668  C C   . ALA C 1 98  ? 25.680  8.451   14.066  1.00 32.81  ? 93  ALA C C   1 
ATOM   5669  O O   . ALA C 1 98  ? 26.478  8.880   14.903  1.00 34.14  ? 93  ALA C O   1 
ATOM   5670  C CB  . ALA C 1 98  ? 24.028  6.653   14.649  1.00 32.30  ? 93  ALA C CB  1 
ATOM   5671  N N   . THR C 1 99  ? 26.016  8.222   12.800  1.00 33.12  ? 94  THR C N   1 
ATOM   5672  C CA  . THR C 1 99  ? 27.368  8.467   12.305  1.00 32.80  ? 94  THR C CA  1 
ATOM   5673  C C   . THR C 1 99  ? 27.771  9.923   12.503  1.00 33.10  ? 94  THR C C   1 
ATOM   5674  O O   . THR C 1 99  ? 28.823  10.215  13.078  1.00 33.22  ? 94  THR C O   1 
ATOM   5675  C CB  . THR C 1 99  ? 27.480  8.124   10.818  1.00 31.79  ? 94  THR C CB  1 
ATOM   5676  O OG1 . THR C 1 99  ? 27.276  6.716   10.637  1.00 33.32  ? 94  THR C OG1 1 
ATOM   5677  C CG2 . THR C 1 99  ? 28.846  8.493   10.297  1.00 31.71  ? 94  THR C CG2 1 
ATOM   5678  N N   . VAL C 1 100 ? 26.935  10.835  12.021  1.00 31.71  ? 95  VAL C N   1 
ATOM   5679  C CA  . VAL C 1 100 ? 27.201  12.260  12.159  1.00 30.17  ? 95  VAL C CA  1 
ATOM   5680  C C   . VAL C 1 100 ? 27.381  12.608  13.642  1.00 33.30  ? 95  VAL C C   1 
ATOM   5681  O O   . VAL C 1 100 ? 28.284  13.364  14.013  1.00 34.14  ? 95  VAL C O   1 
ATOM   5682  C CB  . VAL C 1 100 ? 26.041  13.106  11.552  1.00 27.61  ? 95  VAL C CB  1 
ATOM   5683  C CG1 . VAL C 1 100 ? 26.141  14.541  11.994  1.00 28.68  ? 95  VAL C CG1 1 
ATOM   5684  C CG2 . VAL C 1 100 ? 26.113  13.075  10.052  1.00 26.09  ? 95  VAL C CG2 1 
ATOM   5685  N N   . THR C 1 101 ? 26.531  12.048  14.492  1.00 33.91  ? 96  THR C N   1 
ATOM   5686  C CA  . THR C 1 101 ? 26.623  12.329  15.918  1.00 36.42  ? 96  THR C CA  1 
ATOM   5687  C C   . THR C 1 101 ? 27.987  11.941  16.482  1.00 37.45  ? 96  THR C C   1 
ATOM   5688  O O   . THR C 1 101 ? 28.595  12.705  17.238  1.00 37.15  ? 96  THR C O   1 
ATOM   5689  C CB  . THR C 1 101 ? 25.534  11.578  16.714  1.00 38.09  ? 96  THR C CB  1 
ATOM   5690  O OG1 . THR C 1 101 ? 24.243  11.885  16.165  1.00 37.68  ? 96  THR C OG1 1 
ATOM   5691  C CG2 . THR C 1 101 ? 25.577  11.998  18.189  1.00 37.84  ? 96  THR C CG2 1 
ATOM   5692  N N   . ILE C 1 102 ? 28.455  10.751  16.107  1.00 37.75  ? 97  ILE C N   1 
ATOM   5693  C CA  . ILE C 1 102 ? 29.747  10.239  16.563  1.00 37.00  ? 97  ILE C CA  1 
ATOM   5694  C C   . ILE C 1 102 ? 30.886  11.150  16.120  1.00 39.21  ? 97  ILE C C   1 
ATOM   5695  O O   . ILE C 1 102 ? 31.843  11.343  16.859  1.00 38.77  ? 97  ILE C O   1 
ATOM   5696  C CB  . ILE C 1 102 ? 30.006  8.793   16.036  1.00 35.38  ? 97  ILE C CB  1 
ATOM   5697  C CG1 . ILE C 1 102 ? 29.027  7.813   16.689  1.00 33.86  ? 97  ILE C CG1 1 
ATOM   5698  C CG2 . ILE C 1 102 ? 31.420  8.363   16.346  1.00 35.12  ? 97  ILE C CG2 1 
ATOM   5699  C CD1 . ILE C 1 102 ? 29.243  6.378   16.306  1.00 30.67  ? 97  ILE C CD1 1 
ATOM   5700  N N   . THR C 1 103 ? 30.789  11.713  14.919  1.00 40.80  ? 98  THR C N   1 
ATOM   5701  C CA  . THR C 1 103 ? 31.838  12.604  14.447  1.00 42.12  ? 98  THR C CA  1 
ATOM   5702  C C   . THR C 1 103 ? 31.776  13.943  15.195  1.00 45.21  ? 98  THR C C   1 
ATOM   5703  O O   . THR C 1 103 ? 32.721  14.737  15.128  1.00 46.77  ? 98  THR C O   1 
ATOM   5704  C CB  . THR C 1 103 ? 31.732  12.880  12.929  1.00 42.12  ? 98  THR C CB  1 
ATOM   5705  O OG1 . THR C 1 103 ? 30.742  13.889  12.680  1.00 41.54  ? 98  THR C OG1 1 
ATOM   5706  C CG2 . THR C 1 103 ? 31.358  11.619  12.195  1.00 42.11  ? 98  THR C CG2 1 
ATOM   5707  N N   . HIS C 1 104 ? 30.674  14.207  15.898  1.00 44.93  ? 99  HIS C N   1 
ATOM   5708  C CA  . HIS C 1 104 ? 30.570  15.454  16.640  1.00 45.29  ? 99  HIS C CA  1 
ATOM   5709  C C   . HIS C 1 104 ? 31.389  15.375  17.919  1.00 47.36  ? 99  HIS C C   1 
ATOM   5710  O O   . HIS C 1 104 ? 31.590  16.374  18.603  1.00 47.37  ? 99  HIS C O   1 
ATOM   5711  C CB  . HIS C 1 104 ? 29.118  15.784  16.967  1.00 46.08  ? 99  HIS C CB  1 
ATOM   5712  C CG  . HIS C 1 104 ? 28.360  16.369  15.816  1.00 46.27  ? 99  HIS C CG  1 
ATOM   5713  N ND1 . HIS C 1 104 ? 28.982  16.847  14.683  1.00 46.94  ? 99  HIS C ND1 1 
ATOM   5714  C CD2 . HIS C 1 104 ? 27.032  16.560  15.627  1.00 45.94  ? 99  HIS C CD2 1 
ATOM   5715  C CE1 . HIS C 1 104 ? 28.069  17.304  13.843  1.00 46.00  ? 99  HIS C CE1 1 
ATOM   5716  N NE2 . HIS C 1 104 ? 26.878  17.142  14.391  1.00 45.78  ? 99  HIS C NE2 1 
ATOM   5717  N N   . LEU C 1 105 ? 31.862  14.177  18.242  1.00 49.05  ? 100 LEU C N   1 
ATOM   5718  C CA  . LEU C 1 105 ? 32.697  13.986  19.420  1.00 49.98  ? 100 LEU C CA  1 
ATOM   5719  C C   . LEU C 1 105 ? 34.042  14.639  19.150  1.00 53.51  ? 100 LEU C C   1 
ATOM   5720  O O   . LEU C 1 105 ? 34.816  14.879  20.074  1.00 54.26  ? 100 LEU C O   1 
ATOM   5721  C CB  . LEU C 1 105 ? 32.904  12.497  19.692  1.00 47.68  ? 100 LEU C CB  1 
ATOM   5722  C CG  . LEU C 1 105 ? 31.974  11.814  20.693  1.00 45.07  ? 100 LEU C CG  1 
ATOM   5723  C CD1 . LEU C 1 105 ? 30.603  12.434  20.632  1.00 44.82  ? 100 LEU C CD1 1 
ATOM   5724  C CD2 . LEU C 1 105 ? 31.920  10.322  20.403  1.00 43.19  ? 100 LEU C CD2 1 
ATOM   5725  N N   . LEU C 1 106 ? 34.319  14.910  17.874  1.00 56.66  ? 101 LEU C N   1 
ATOM   5726  C CA  . LEU C 1 106 ? 35.570  15.550  17.477  1.00 59.65  ? 101 LEU C CA  1 
ATOM   5727  C C   . LEU C 1 106 ? 35.349  17.032  17.193  1.00 64.81  ? 101 LEU C C   1 
ATOM   5728  O O   . LEU C 1 106 ? 34.218  17.477  16.970  1.00 65.38  ? 101 LEU C O   1 
ATOM   5729  C CB  . LEU C 1 106 ? 36.161  14.881  16.233  1.00 54.80  ? 101 LEU C CB  1 
ATOM   5730  C CG  . LEU C 1 106 ? 36.252  13.357  16.270  1.00 53.43  ? 101 LEU C CG  1 
ATOM   5731  C CD1 . LEU C 1 106 ? 37.253  12.909  15.222  1.00 51.08  ? 101 LEU C CD1 1 
ATOM   5732  C CD2 . LEU C 1 106 ? 36.669  12.870  17.651  1.00 49.63  ? 101 LEU C CD2 1 
ATOM   5733  N N   . LYS C 1 107 ? 36.442  17.789  17.204  1.00 70.26  ? 102 LYS C N   1 
ATOM   5734  C CA  . LYS C 1 107 ? 36.399  19.226  16.956  1.00 74.14  ? 102 LYS C CA  1 
ATOM   5735  C C   . LYS C 1 107 ? 37.244  19.572  15.733  1.00 72.35  ? 102 LYS C C   1 
ATOM   5736  O O   . LYS C 1 107 ? 38.109  18.795  15.331  1.00 72.75  ? 102 LYS C O   1 
ATOM   5737  C CB  . LYS C 1 107 ? 36.915  19.968  18.190  1.00 80.13  ? 102 LYS C CB  1 
ATOM   5738  C CG  . LYS C 1 107 ? 38.279  19.485  18.655  1.00 87.95  ? 102 LYS C CG  1 
ATOM   5739  C CD  . LYS C 1 107 ? 38.598  19.961  20.061  1.00 94.30  ? 102 LYS C CD  1 
ATOM   5740  C CE  . LYS C 1 107 ? 40.030  19.608  20.432  1.00 98.42  ? 102 LYS C CE  1 
ATOM   5741  N NZ  . LYS C 1 107 ? 40.330  18.167  20.197  1.00 101.18 ? 102 LYS C NZ  1 
ATOM   5742  N N   . ALA C 1 108 ? 36.986  20.733  15.139  1.00 70.58  ? 103 ALA C N   1 
ATOM   5743  C CA  . ALA C 1 108 ? 37.731  21.164  13.959  1.00 68.67  ? 103 ALA C CA  1 
ATOM   5744  C C   . ALA C 1 108 ? 39.220  20.870  14.118  1.00 66.95  ? 103 ALA C C   1 
ATOM   5745  O O   . ALA C 1 108 ? 39.778  20.983  15.210  1.00 65.54  ? 103 ALA C O   1 
ATOM   5746  C CB  . ALA C 1 108 ? 37.512  22.655  13.715  1.00 69.01  ? 103 ALA C CB  1 
ATOM   5747  N N   . GLY C 1 109 ? 39.860  20.488  13.022  1.00 65.16  ? 104 GLY C N   1 
ATOM   5748  C CA  . GLY C 1 109 ? 41.274  20.180  13.086  1.00 64.66  ? 104 GLY C CA  1 
ATOM   5749  C C   . GLY C 1 109 ? 41.550  18.712  13.368  1.00 63.88  ? 104 GLY C C   1 
ATOM   5750  O O   . GLY C 1 109 ? 42.673  18.239  13.172  1.00 65.34  ? 104 GLY C O   1 
ATOM   5751  N N   . ASP C 1 110 ? 40.540  17.980  13.831  1.00 61.98  ? 105 ASP C N   1 
ATOM   5752  C CA  . ASP C 1 110 ? 40.729  16.564  14.112  1.00 59.99  ? 105 ASP C CA  1 
ATOM   5753  C C   . ASP C 1 110 ? 40.674  15.728  12.838  1.00 58.50  ? 105 ASP C C   1 
ATOM   5754  O O   . ASP C 1 110 ? 40.054  16.113  11.848  1.00 56.80  ? 105 ASP C O   1 
ATOM   5755  C CB  . ASP C 1 110 ? 39.687  16.059  15.121  1.00 60.89  ? 105 ASP C CB  1 
ATOM   5756  C CG  . ASP C 1 110 ? 39.973  16.526  16.549  1.00 61.83  ? 105 ASP C CG  1 
ATOM   5757  O OD1 . ASP C 1 110 ? 41.164  16.631  16.909  1.00 63.22  ? 105 ASP C OD1 1 
ATOM   5758  O OD2 . ASP C 1 110 ? 39.013  16.771  17.317  1.00 61.56  ? 105 ASP C OD2 1 
ATOM   5759  N N   . GLN C 1 111 ? 41.336  14.580  12.874  1.00 59.27  ? 106 GLN C N   1 
ATOM   5760  C CA  . GLN C 1 111 ? 41.385  13.680  11.734  1.00 61.40  ? 106 GLN C CA  1 
ATOM   5761  C C   . GLN C 1 111 ? 40.657  12.374  12.016  1.00 59.56  ? 106 GLN C C   1 
ATOM   5762  O O   . GLN C 1 111 ? 40.589  11.922  13.161  1.00 59.97  ? 106 GLN C O   1 
ATOM   5763  C CB  . GLN C 1 111 ? 42.836  13.364  11.383  1.00 65.79  ? 106 GLN C CB  1 
ATOM   5764  C CG  . GLN C 1 111 ? 42.999  12.370  10.241  1.00 73.22  ? 106 GLN C CG  1 
ATOM   5765  C CD  . GLN C 1 111 ? 44.344  11.682  10.278  1.00 77.29  ? 106 GLN C CD  1 
ATOM   5766  O OE1 . GLN C 1 111 ? 45.386  12.336  10.318  1.00 81.42  ? 106 GLN C OE1 1 
ATOM   5767  N NE2 . GLN C 1 111 ? 44.332  10.354  10.270  1.00 79.50  ? 106 GLN C NE2 1 
ATOM   5768  N N   . ILE C 1 112 ? 40.133  11.760  10.959  1.00 57.86  ? 107 ILE C N   1 
ATOM   5769  C CA  . ILE C 1 112 ? 39.413  10.498  11.076  1.00 56.69  ? 107 ILE C CA  1 
ATOM   5770  C C   . ILE C 1 112 ? 39.764  9.548   9.932   1.00 54.09  ? 107 ILE C C   1 
ATOM   5771  O O   . ILE C 1 112 ? 39.748  9.931   8.760   1.00 52.92  ? 107 ILE C O   1 
ATOM   5772  C CB  . ILE C 1 112 ? 37.872  10.743  11.112  1.00 56.73  ? 107 ILE C CB  1 
ATOM   5773  C CG1 . ILE C 1 112 ? 37.122  9.452   10.775  1.00 58.74  ? 107 ILE C CG1 1 
ATOM   5774  C CG2 . ILE C 1 112 ? 37.497  11.863  10.163  1.00 55.26  ? 107 ILE C CG2 1 
ATOM   5775  C CD1 . ILE C 1 112 ? 35.613  9.605   10.718  1.00 59.48  ? 107 ILE C CD1 1 
ATOM   5776  N N   . ILE C 1 113 ? 40.092  8.311   10.289  1.00 52.50  ? 108 ILE C N   1 
ATOM   5777  C CA  . ILE C 1 113 ? 40.441  7.284   9.312   1.00 52.73  ? 108 ILE C CA  1 
ATOM   5778  C C   . ILE C 1 113 ? 39.239  6.377   9.066   1.00 53.02  ? 108 ILE C C   1 
ATOM   5779  O O   . ILE C 1 113 ? 38.550  5.977   10.004  1.00 51.60  ? 108 ILE C O   1 
ATOM   5780  C CB  . ILE C 1 113 ? 41.612  6.390   9.800   1.00 53.35  ? 108 ILE C CB  1 
ATOM   5781  C CG1 . ILE C 1 113 ? 42.843  7.246   10.100  1.00 53.08  ? 108 ILE C CG1 1 
ATOM   5782  C CG2 . ILE C 1 113 ? 41.939  5.336   8.736   1.00 52.13  ? 108 ILE C CG2 1 
ATOM   5783  C CD1 . ILE C 1 113 ? 43.361  7.999   8.899   1.00 55.19  ? 108 ILE C CD1 1 
ATOM   5784  N N   . CYS C 1 114 ? 38.998  6.048   7.802   1.00 53.53  ? 109 CYS C N   1 
ATOM   5785  C CA  . CYS C 1 114 ? 37.880  5.191   7.443   1.00 54.03  ? 109 CYS C CA  1 
ATOM   5786  C C   . CYS C 1 114 ? 38.316  4.010   6.606   1.00 55.33  ? 109 CYS C C   1 
ATOM   5787  O O   . CYS C 1 114 ? 39.217  4.125   5.776   1.00 56.72  ? 109 CYS C O   1 
ATOM   5788  C CB  . CYS C 1 114 ? 36.836  5.978   6.647   1.00 54.63  ? 109 CYS C CB  1 
ATOM   5789  S SG  . CYS C 1 114 ? 35.797  7.105   7.607   1.00 55.88  ? 109 CYS C SG  1 
ATOM   5790  N N   . MET C 1 115 ? 37.676  2.869   6.828   1.00 56.39  ? 110 MET C N   1 
ATOM   5791  C CA  . MET C 1 115 ? 37.966  1.690   6.035   1.00 56.97  ? 110 MET C CA  1 
ATOM   5792  C C   . MET C 1 115 ? 37.564  2.191   4.656   1.00 59.69  ? 110 MET C C   1 
ATOM   5793  O O   . MET C 1 115 ? 36.430  2.630   4.466   1.00 60.84  ? 110 MET C O   1 
ATOM   5794  C CB  . MET C 1 115 ? 37.059  0.529   6.448   1.00 54.84  ? 110 MET C CB  1 
ATOM   5795  C CG  . MET C 1 115 ? 37.705  -0.834  6.295   1.00 53.18  ? 110 MET C CG  1 
ATOM   5796  S SD  . MET C 1 115 ? 38.624  -0.973  4.758   1.00 53.22  ? 110 MET C SD  1 
ATOM   5797  C CE  . MET C 1 115 ? 38.135  -2.571  4.168   1.00 49.09  ? 110 MET C CE  1 
ATOM   5798  N N   . ASP C 1 116 ? 38.488  2.163   3.704   1.00 62.63  ? 111 ASP C N   1 
ATOM   5799  C CA  . ASP C 1 116 ? 38.188  2.648   2.358   1.00 65.80  ? 111 ASP C CA  1 
ATOM   5800  C C   . ASP C 1 116 ? 37.172  1.772   1.612   1.00 66.61  ? 111 ASP C C   1 
ATOM   5801  O O   . ASP C 1 116 ? 37.510  0.693   1.113   1.00 68.11  ? 111 ASP C O   1 
ATOM   5802  C CB  . ASP C 1 116 ? 39.493  2.776   1.549   1.00 65.84  ? 111 ASP C CB  1 
ATOM   5803  C CG  . ASP C 1 116 ? 39.263  3.237   0.115   1.00 66.21  ? 111 ASP C CG  1 
ATOM   5804  O OD1 . ASP C 1 116 ? 38.530  4.224   -0.101  1.00 66.31  ? 111 ASP C OD1 1 
ATOM   5805  O OD2 . ASP C 1 116 ? 39.832  2.612   -0.803  1.00 67.43  ? 111 ASP C OD2 1 
ATOM   5806  N N   . ASP C 1 117 ? 35.924  2.239   1.557   1.00 67.11  ? 112 ASP C N   1 
ATOM   5807  C CA  . ASP C 1 117 ? 34.869  1.523   0.851   1.00 68.36  ? 112 ASP C CA  1 
ATOM   5808  C C   . ASP C 1 117 ? 34.978  1.884   -0.626  1.00 67.76  ? 112 ASP C C   1 
ATOM   5809  O O   . ASP C 1 117 ? 34.476  2.918   -1.074  1.00 67.21  ? 112 ASP C O   1 
ATOM   5810  C CB  . ASP C 1 117 ? 33.490  1.924   1.359   1.00 70.09  ? 112 ASP C CB  1 
ATOM   5811  C CG  . ASP C 1 117 ? 32.374  1.196   0.628   1.00 72.07  ? 112 ASP C CG  1 
ATOM   5812  O OD1 . ASP C 1 117 ? 31.225  1.685   0.660   1.00 73.40  ? 112 ASP C OD1 1 
ATOM   5813  O OD2 . ASP C 1 117 ? 32.648  0.129   0.027   1.00 73.39  ? 112 ASP C OD2 1 
ATOM   5814  N N   . VAL C 1 118 ? 35.630  1.009   -1.375  1.00 67.76  ? 113 VAL C N   1 
ATOM   5815  C CA  . VAL C 1 118 ? 35.866  1.221   -2.792  1.00 68.02  ? 113 VAL C CA  1 
ATOM   5816  C C   . VAL C 1 118 ? 34.649  1.118   -3.712  1.00 67.95  ? 113 VAL C C   1 
ATOM   5817  O O   . VAL C 1 118 ? 34.284  2.090   -4.375  1.00 66.38  ? 113 VAL C O   1 
ATOM   5818  C CB  . VAL C 1 118 ? 36.984  0.259   -3.280  1.00 68.17  ? 113 VAL C CB  1 
ATOM   5819  C CG1 . VAL C 1 118 ? 36.737  -1.140  -2.735  1.00 69.34  ? 113 VAL C CG1 1 
ATOM   5820  C CG2 . VAL C 1 118 ? 37.045  0.245   -4.793  1.00 67.94  ? 113 VAL C CG2 1 
ATOM   5821  N N   . TYR C 1 119 ? 34.019  -0.050  -3.754  1.00 68.33  ? 114 TYR C N   1 
ATOM   5822  C CA  . TYR C 1 119 ? 32.872  -0.242  -4.633  1.00 68.89  ? 114 TYR C CA  1 
ATOM   5823  C C   . TYR C 1 119 ? 31.518  0.001   -3.985  1.00 69.82  ? 114 TYR C C   1 
ATOM   5824  O O   . TYR C 1 119 ? 30.500  0.020   -4.673  1.00 69.70  ? 114 TYR C O   1 
ATOM   5825  C CB  . TYR C 1 119 ? 32.912  -1.648  -5.238  1.00 68.62  ? 114 TYR C CB  1 
ATOM   5826  C CG  . TYR C 1 119 ? 34.173  -1.917  -6.023  1.00 67.36  ? 114 TYR C CG  1 
ATOM   5827  C CD1 . TYR C 1 119 ? 35.031  -2.958  -5.668  1.00 67.29  ? 114 TYR C CD1 1 
ATOM   5828  C CD2 . TYR C 1 119 ? 34.525  -1.112  -7.104  1.00 66.53  ? 114 TYR C CD2 1 
ATOM   5829  C CE1 . TYR C 1 119 ? 36.210  -3.189  -6.366  1.00 67.09  ? 114 TYR C CE1 1 
ATOM   5830  C CE2 . TYR C 1 119 ? 35.698  -1.333  -7.809  1.00 67.28  ? 114 TYR C CE2 1 
ATOM   5831  C CZ  . TYR C 1 119 ? 36.536  -2.372  -7.434  1.00 67.98  ? 114 TYR C CZ  1 
ATOM   5832  O OH  . TYR C 1 119 ? 37.704  -2.587  -8.127  1.00 70.49  ? 114 TYR C OH  1 
ATOM   5833  N N   . GLY C 1 120 ? 31.502  0.183   -2.668  1.00 70.43  ? 115 GLY C N   1 
ATOM   5834  C CA  . GLY C 1 120 ? 30.246  0.434   -1.982  1.00 70.99  ? 115 GLY C CA  1 
ATOM   5835  C C   . GLY C 1 120 ? 29.736  1.808   -2.360  1.00 71.61  ? 115 GLY C C   1 
ATOM   5836  O O   . GLY C 1 120 ? 30.111  2.346   -3.400  1.00 72.86  ? 115 GLY C O   1 
ATOM   5837  N N   . GLY C 1 121 ? 28.881  2.387   -1.530  1.00 70.90  ? 116 GLY C N   1 
ATOM   5838  C CA  . GLY C 1 121 ? 28.375  3.709   -1.842  1.00 70.52  ? 116 GLY C CA  1 
ATOM   5839  C C   . GLY C 1 121 ? 29.025  4.783   -0.990  1.00 69.93  ? 116 GLY C C   1 
ATOM   5840  O O   . GLY C 1 121 ? 29.397  5.850   -1.489  1.00 70.14  ? 116 GLY C O   1 
ATOM   5841  N N   . THR C 1 122 ? 29.159  4.486   0.302   1.00 68.50  ? 117 THR C N   1 
ATOM   5842  C CA  . THR C 1 122 ? 29.742  5.399   1.274   1.00 66.01  ? 117 THR C CA  1 
ATOM   5843  C C   . THR C 1 122 ? 31.047  6.005   0.781   1.00 67.23  ? 117 THR C C   1 
ATOM   5844  O O   . THR C 1 122 ? 31.549  5.637   -0.288  1.00 69.12  ? 117 THR C O   1 
ATOM   5845  C CB  . THR C 1 122 ? 30.006  4.684   2.600   1.00 64.74  ? 117 THR C CB  1 
ATOM   5846  O OG1 . THR C 1 122 ? 31.019  3.692   2.410   1.00 62.86  ? 117 THR C OG1 1 
ATOM   5847  C CG2 . THR C 1 122 ? 28.747  4.009   3.094   1.00 63.02  ? 117 THR C CG2 1 
ATOM   5848  N N   . ASN C 1 123 ? 31.587  6.917   1.589   1.00 66.16  ? 118 ASN C N   1 
ATOM   5849  C CA  . ASN C 1 123 ? 32.826  7.660   1.323   1.00 65.25  ? 118 ASN C CA  1 
ATOM   5850  C C   . ASN C 1 123 ? 32.430  9.063   0.921   1.00 65.97  ? 118 ASN C C   1 
ATOM   5851  O O   . ASN C 1 123 ? 33.066  10.023  1.348   1.00 66.58  ? 118 ASN C O   1 
ATOM   5852  C CB  . ASN C 1 123 ? 33.693  7.045   0.212   1.00 63.41  ? 118 ASN C CB  1 
ATOM   5853  C CG  . ASN C 1 123 ? 34.659  5.994   0.732   1.00 61.75  ? 118 ASN C CG  1 
ATOM   5854  O OD1 . ASN C 1 123 ? 35.629  5.645   0.060   1.00 60.79  ? 118 ASN C OD1 1 
ATOM   5855  N ND2 . ASN C 1 123 ? 34.393  5.477   1.926   1.00 61.63  ? 118 ASN C ND2 1 
ATOM   5856  N N   . ARG C 1 124 ? 31.394  9.190   0.091   1.00 67.26  ? 119 ARG C N   1 
ATOM   5857  C CA  . ARG C 1 124 ? 30.935  10.517  -0.291  1.00 68.18  ? 119 ARG C CA  1 
ATOM   5858  C C   . ARG C 1 124 ? 30.381  11.095  1.006   1.00 65.36  ? 119 ARG C C   1 
ATOM   5859  O O   . ARG C 1 124 ? 30.623  12.253  1.331   1.00 65.00  ? 119 ARG C O   1 
ATOM   5860  C CB  . ARG C 1 124 ? 29.858  10.465  -1.374  1.00 73.60  ? 119 ARG C CB  1 
ATOM   5861  C CG  . ARG C 1 124 ? 28.634  9.649   -1.037  1.00 82.35  ? 119 ARG C CG  1 
ATOM   5862  C CD  . ARG C 1 124 ? 27.447  10.083  -1.894  1.00 89.90  ? 119 ARG C CD  1 
ATOM   5863  N NE  . ARG C 1 124 ? 27.821  10.366  -3.280  1.00 95.85  ? 119 ARG C NE  1 
ATOM   5864  C CZ  . ARG C 1 124 ? 28.463  9.518   -4.082  1.00 98.87  ? 119 ARG C CZ  1 
ATOM   5865  N NH1 . ARG C 1 124 ? 28.816  8.312   -3.646  1.00 100.06 ? 119 ARG C NH1 1 
ATOM   5866  N NH2 . ARG C 1 124 ? 28.750  9.876   -5.328  1.00 99.86  ? 119 ARG C NH2 1 
ATOM   5867  N N   . TYR C 1 125 ? 29.639  10.286  1.760   1.00 62.68  ? 120 TYR C N   1 
ATOM   5868  C CA  . TYR C 1 125 ? 29.155  10.748  3.054   1.00 60.91  ? 120 TYR C CA  1 
ATOM   5869  C C   . TYR C 1 125 ? 30.490  10.742  3.786   1.00 57.87  ? 120 TYR C C   1 
ATOM   5870  O O   . TYR C 1 125 ? 31.489  10.403  3.171   1.00 60.50  ? 120 TYR C O   1 
ATOM   5871  C CB  . TYR C 1 125 ? 28.181  9.740   3.658   1.00 63.66  ? 120 TYR C CB  1 
ATOM   5872  C CG  . TYR C 1 125 ? 27.022  9.399   2.741   1.00 66.50  ? 120 TYR C CG  1 
ATOM   5873  C CD1 . TYR C 1 125 ? 27.125  8.365   1.805   1.00 67.37  ? 120 TYR C CD1 1 
ATOM   5874  C CD2 . TYR C 1 125 ? 25.840  10.147  2.767   1.00 67.68  ? 120 TYR C CD2 1 
ATOM   5875  C CE1 . TYR C 1 125 ? 26.087  8.087   0.914   1.00 67.78  ? 120 TYR C CE1 1 
ATOM   5876  C CE2 . TYR C 1 125 ? 24.796  9.878   1.877   1.00 68.25  ? 120 TYR C CE2 1 
ATOM   5877  C CZ  . TYR C 1 125 ? 24.931  8.849   0.953   1.00 68.42  ? 120 TYR C CZ  1 
ATOM   5878  O OH  . TYR C 1 125 ? 23.929  8.601   0.047   1.00 69.42  ? 120 TYR C OH  1 
ATOM   5879  N N   . PHE C 1 126 ? 30.553  11.076  5.066   1.00 53.45  ? 121 PHE C N   1 
ATOM   5880  C CA  . PHE C 1 126 ? 31.868  11.111  5.735   1.00 51.67  ? 121 PHE C CA  1 
ATOM   5881  C C   . PHE C 1 126 ? 32.642  12.308  5.181   1.00 51.90  ? 121 PHE C C   1 
ATOM   5882  O O   . PHE C 1 126 ? 32.997  13.235  5.908   1.00 53.08  ? 121 PHE C O   1 
ATOM   5883  C CB  . PHE C 1 126 ? 32.698  9.839   5.472   1.00 44.19  ? 121 PHE C CB  1 
ATOM   5884  C CG  . PHE C 1 126 ? 32.323  8.681   6.337   1.00 41.29  ? 121 PHE C CG  1 
ATOM   5885  C CD1 . PHE C 1 126 ? 32.466  8.758   7.722   1.00 40.28  ? 121 PHE C CD1 1 
ATOM   5886  C CD2 . PHE C 1 126 ? 31.786  7.523   5.778   1.00 40.84  ? 121 PHE C CD2 1 
ATOM   5887  C CE1 . PHE C 1 126 ? 32.073  7.701   8.543   1.00 38.32  ? 121 PHE C CE1 1 
ATOM   5888  C CE2 . PHE C 1 126 ? 31.387  6.453   6.585   1.00 39.02  ? 121 PHE C CE2 1 
ATOM   5889  C CZ  . PHE C 1 126 ? 31.529  6.543   7.970   1.00 40.47  ? 121 PHE C CZ  1 
ATOM   5890  N N   . ARG C 1 127 ? 32.907  12.275  3.883   1.00 52.66  ? 122 ARG C N   1 
ATOM   5891  C CA  . ARG C 1 127 ? 33.611  13.356  3.220   1.00 53.70  ? 122 ARG C CA  1 
ATOM   5892  C C   . ARG C 1 127 ? 32.731  14.617  3.302   1.00 51.97  ? 122 ARG C C   1 
ATOM   5893  O O   . ARG C 1 127 ? 33.212  15.691  3.666   1.00 52.11  ? 122 ARG C O   1 
ATOM   5894  C CB  . ARG C 1 127 ? 33.876  12.964  1.765   1.00 57.18  ? 122 ARG C CB  1 
ATOM   5895  C CG  . ARG C 1 127 ? 35.062  13.654  1.127   1.00 65.34  ? 122 ARG C CG  1 
ATOM   5896  C CD  . ARG C 1 127 ? 36.067  12.638  0.585   1.00 71.06  ? 122 ARG C CD  1 
ATOM   5897  N NE  . ARG C 1 127 ? 35.501  11.784  -0.457  1.00 75.29  ? 122 ARG C NE  1 
ATOM   5898  C CZ  . ARG C 1 127 ? 36.164  10.800  -1.062  1.00 77.81  ? 122 ARG C CZ  1 
ATOM   5899  N NH1 . ARG C 1 127 ? 35.565  10.073  -2.000  1.00 79.22  ? 122 ARG C NH1 1 
ATOM   5900  N NH2 . ARG C 1 127 ? 37.424  10.541  -0.730  1.00 78.24  ? 122 ARG C NH2 1 
ATOM   5901  N N   . GLN C 1 128 ? 31.440  14.481  2.990   1.00 50.89  ? 123 GLN C N   1 
ATOM   5902  C CA  . GLN C 1 128 ? 30.515  15.618  3.044   1.00 49.90  ? 123 GLN C CA  1 
ATOM   5903  C C   . GLN C 1 128 ? 30.359  16.072  4.486   1.00 49.43  ? 123 GLN C C   1 
ATOM   5904  O O   . GLN C 1 128 ? 30.093  17.247  4.756   1.00 49.88  ? 123 GLN C O   1 
ATOM   5905  C CB  . GLN C 1 128 ? 29.128  15.238  2.505   1.00 49.27  ? 123 GLN C CB  1 
ATOM   5906  C CG  . GLN C 1 128 ? 29.107  14.649  1.091   1.00 49.94  ? 123 GLN C CG  1 
ATOM   5907  C CD  . GLN C 1 128 ? 27.708  14.220  0.625   1.00 47.35  ? 123 GLN C CD  1 
ATOM   5908  O OE1 . GLN C 1 128 ? 26.899  13.719  1.413   1.00 47.13  ? 123 GLN C OE1 1 
ATOM   5909  N NE2 . GLN C 1 128 ? 27.433  14.397  -0.666  1.00 45.32  ? 123 GLN C NE2 1 
ATOM   5910  N N   . VAL C 1 129 ? 30.508  15.128  5.410   1.00 48.20  ? 124 VAL C N   1 
ATOM   5911  C CA  . VAL C 1 129 ? 30.376  15.414  6.830   1.00 47.27  ? 124 VAL C CA  1 
ATOM   5912  C C   . VAL C 1 129 ? 31.651  16.022  7.376   1.00 47.98  ? 124 VAL C C   1 
ATOM   5913  O O   . VAL C 1 129 ? 31.612  16.868  8.261   1.00 48.95  ? 124 VAL C O   1 
ATOM   5914  C CB  . VAL C 1 129 ? 30.041  14.137  7.613   1.00 48.16  ? 124 VAL C CB  1 
ATOM   5915  C CG1 . VAL C 1 129 ? 30.135  14.385  9.114   1.00 47.79  ? 124 VAL C CG1 1 
ATOM   5916  C CG2 . VAL C 1 129 ? 28.648  13.676  7.239   1.00 48.08  ? 124 VAL C CG2 1 
ATOM   5917  N N   . ALA C 1 130 ? 32.786  15.585  6.851   1.00 48.60  ? 125 ALA C N   1 
ATOM   5918  C CA  . ALA C 1 130 ? 34.067  16.119  7.284   1.00 48.53  ? 125 ALA C CA  1 
ATOM   5919  C C   . ALA C 1 130 ? 34.219  17.530  6.718   1.00 49.28  ? 125 ALA C C   1 
ATOM   5920  O O   . ALA C 1 130 ? 34.611  18.448  7.436   1.00 49.29  ? 125 ALA C O   1 
ATOM   5921  C CB  . ALA C 1 130 ? 35.198  15.226  6.795   1.00 47.55  ? 125 ALA C CB  1 
ATOM   5922  N N   . SER C 1 131 ? 33.904  17.697  5.432   1.00 50.33  ? 126 SER C N   1 
ATOM   5923  C CA  . SER C 1 131 ? 34.002  19.002  4.777   1.00 52.41  ? 126 SER C CA  1 
ATOM   5924  C C   . SER C 1 131 ? 33.329  20.051  5.646   1.00 53.51  ? 126 SER C C   1 
ATOM   5925  O O   . SER C 1 131 ? 33.903  21.090  5.966   1.00 52.64  ? 126 SER C O   1 
ATOM   5926  C CB  . SER C 1 131 ? 33.323  18.971  3.413   1.00 51.78  ? 126 SER C CB  1 
ATOM   5927  O OG  . SER C 1 131 ? 33.290  20.274  2.859   1.00 53.86  ? 126 SER C OG  1 
ATOM   5928  N N   . GLU C 1 132 ? 32.085  19.770  5.998   1.00 55.61  ? 127 GLU C N   1 
ATOM   5929  C CA  . GLU C 1 132 ? 31.317  20.634  6.871   1.00 57.40  ? 127 GLU C CA  1 
ATOM   5930  C C   . GLU C 1 132 ? 31.851  20.229  8.241   1.00 57.23  ? 127 GLU C C   1 
ATOM   5931  O O   . GLU C 1 132 ? 32.423  19.152  8.373   1.00 58.29  ? 127 GLU C O   1 
ATOM   5932  C CB  . GLU C 1 132 ? 29.841  20.286  6.735   1.00 60.10  ? 127 GLU C CB  1 
ATOM   5933  C CG  . GLU C 1 132 ? 28.938  20.964  7.726   1.00 64.73  ? 127 GLU C CG  1 
ATOM   5934  C CD  . GLU C 1 132 ? 27.490  20.603  7.496   1.00 67.09  ? 127 GLU C CD  1 
ATOM   5935  O OE1 . GLU C 1 132 ? 27.207  19.395  7.356   1.00 68.49  ? 127 GLU C OE1 1 
ATOM   5936  O OE2 . GLU C 1 132 ? 26.640  21.522  7.458   1.00 69.52  ? 127 GLU C OE2 1 
ATOM   5937  N N   . PHE C 1 133 ? 31.690  21.067  9.255   1.00 55.72  ? 128 PHE C N   1 
ATOM   5938  C CA  . PHE C 1 133 ? 32.202  20.723  10.584  1.00 55.18  ? 128 PHE C CA  1 
ATOM   5939  C C   . PHE C 1 133 ? 33.736  20.750  10.606  1.00 56.30  ? 128 PHE C C   1 
ATOM   5940  O O   . PHE C 1 133 ? 34.364  20.517  11.644  1.00 55.95  ? 128 PHE C O   1 
ATOM   5941  C CB  . PHE C 1 133 ? 31.684  19.341  11.024  1.00 52.65  ? 128 PHE C CB  1 
ATOM   5942  C CG  . PHE C 1 133 ? 30.184  19.234  11.030  1.00 49.99  ? 128 PHE C CG  1 
ATOM   5943  C CD1 . PHE C 1 133 ? 29.522  18.465  10.078  1.00 47.93  ? 128 PHE C CD1 1 
ATOM   5944  C CD2 . PHE C 1 133 ? 29.428  19.963  11.942  1.00 49.01  ? 128 PHE C CD2 1 
ATOM   5945  C CE1 . PHE C 1 133 ? 28.131  18.430  10.030  1.00 46.49  ? 128 PHE C CE1 1 
ATOM   5946  C CE2 . PHE C 1 133 ? 28.033  19.935  11.900  1.00 48.36  ? 128 PHE C CE2 1 
ATOM   5947  C CZ  . PHE C 1 133 ? 27.385  19.167  10.942  1.00 46.96  ? 128 PHE C CZ  1 
ATOM   5948  N N   . GLY C 1 134 ? 34.320  21.035  9.444   1.00 57.55  ? 129 GLY C N   1 
ATOM   5949  C CA  . GLY C 1 134 ? 35.763  21.138  9.292   1.00 58.97  ? 129 GLY C CA  1 
ATOM   5950  C C   . GLY C 1 134 ? 36.677  20.093  9.911   1.00 59.64  ? 129 GLY C C   1 
ATOM   5951  O O   . GLY C 1 134 ? 37.497  20.413  10.776  1.00 60.90  ? 129 GLY C O   1 
ATOM   5952  N N   . LEU C 1 135 ? 36.558  18.847  9.469   1.00 58.43  ? 130 LEU C N   1 
ATOM   5953  C CA  . LEU C 1 135 ? 37.415  17.793  9.988   1.00 56.97  ? 130 LEU C CA  1 
ATOM   5954  C C   . LEU C 1 135 ? 38.268  17.223  8.862   1.00 59.66  ? 130 LEU C C   1 
ATOM   5955  O O   . LEU C 1 135 ? 37.918  17.323  7.683   1.00 59.62  ? 130 LEU C O   1 
ATOM   5956  C CB  . LEU C 1 135 ? 36.581  16.681  10.614  1.00 52.60  ? 130 LEU C CB  1 
ATOM   5957  C CG  . LEU C 1 135 ? 35.663  17.073  11.764  1.00 48.26  ? 130 LEU C CG  1 
ATOM   5958  C CD1 . LEU C 1 135 ? 35.066  15.806  12.347  1.00 46.88  ? 130 LEU C CD1 1 
ATOM   5959  C CD2 . LEU C 1 135 ? 36.435  17.840  12.826  1.00 45.14  ? 130 LEU C CD2 1 
ATOM   5960  N N   . LYS C 1 136 ? 39.397  16.633  9.230   1.00 62.97  ? 131 LYS C N   1 
ATOM   5961  C CA  . LYS C 1 136 ? 40.300  16.046  8.251   1.00 66.59  ? 131 LYS C CA  1 
ATOM   5962  C C   . LYS C 1 136 ? 39.965  14.564  8.117   1.00 64.28  ? 131 LYS C C   1 
ATOM   5963  O O   . LYS C 1 136 ? 39.978  13.828  9.099   1.00 65.82  ? 131 LYS C O   1 
ATOM   5964  C CB  . LYS C 1 136 ? 41.758  16.249  8.706   1.00 71.52  ? 131 LYS C CB  1 
ATOM   5965  C CG  . LYS C 1 136 ? 42.812  15.455  7.927   1.00 79.03  ? 131 LYS C CG  1 
ATOM   5966  C CD  . LYS C 1 136 ? 42.815  15.794  6.440   1.00 85.20  ? 131 LYS C CD  1 
ATOM   5967  C CE  . LYS C 1 136 ? 43.821  14.941  5.662   1.00 88.71  ? 131 LYS C CE  1 
ATOM   5968  N NZ  . LYS C 1 136 ? 45.237  15.213  6.042   1.00 90.67  ? 131 LYS C NZ  1 
ATOM   5969  N N   . ILE C 1 137 ? 39.646  14.123  6.908   1.00 62.85  ? 132 ILE C N   1 
ATOM   5970  C CA  . ILE C 1 137 ? 39.320  12.720  6.719   1.00 63.81  ? 132 ILE C CA  1 
ATOM   5971  C C   . ILE C 1 137 ? 40.349  12.022  5.833   1.00 59.69  ? 132 ILE C C   1 
ATOM   5972  O O   . ILE C 1 137 ? 40.966  12.641  4.972   1.00 59.18  ? 132 ILE C O   1 
ATOM   5973  C CB  . ILE C 1 137 ? 37.906  12.557  6.117   1.00 65.19  ? 132 ILE C CB  1 
ATOM   5974  C CG1 . ILE C 1 137 ? 37.209  11.370  6.780   1.00 67.18  ? 132 ILE C CG1 1 
ATOM   5975  C CG2 . ILE C 1 137 ? 37.984  12.336  4.609   1.00 66.53  ? 132 ILE C CG2 1 
ATOM   5976  C CD1 . ILE C 1 137 ? 35.787  11.167  6.308   1.00 71.52  ? 132 ILE C CD1 1 
ATOM   5977  N N   . SER C 1 138 ? 40.526  10.727  6.048   1.00 57.01  ? 133 SER C N   1 
ATOM   5978  C CA  . SER C 1 138 ? 41.484  9.952   5.274   1.00 54.88  ? 133 SER C CA  1 
ATOM   5979  C C   . SER C 1 138 ? 40.956  8.523   5.104   1.00 52.63  ? 133 SER C C   1 
ATOM   5980  O O   . SER C 1 138 ? 40.392  7.951   6.035   1.00 53.76  ? 133 SER C O   1 
ATOM   5981  C CB  . SER C 1 138 ? 42.829  9.952   6.007   1.00 54.80  ? 133 SER C CB  1 
ATOM   5982  O OG  . SER C 1 138 ? 43.801  9.190   5.316   1.00 57.01  ? 133 SER C OG  1 
ATOM   5983  N N   . PHE C 1 139 ? 41.129  7.944   3.923   1.00 49.71  ? 134 PHE C N   1 
ATOM   5984  C CA  . PHE C 1 139 ? 40.644  6.589   3.686   1.00 48.41  ? 134 PHE C CA  1 
ATOM   5985  C C   . PHE C 1 139 ? 41.774  5.573   3.572   1.00 48.59  ? 134 PHE C C   1 
ATOM   5986  O O   . PHE C 1 139 ? 42.716  5.766   2.805   1.00 48.99  ? 134 PHE C O   1 
ATOM   5987  C CB  . PHE C 1 139 ? 39.777  6.580   2.433   1.00 47.84  ? 134 PHE C CB  1 
ATOM   5988  C CG  . PHE C 1 139 ? 38.525  7.389   2.576   1.00 45.53  ? 134 PHE C CG  1 
ATOM   5989  C CD1 . PHE C 1 139 ? 37.405  6.851   3.198   1.00 45.13  ? 134 PHE C CD1 1 
ATOM   5990  C CD2 . PHE C 1 139 ? 38.482  8.706   2.140   1.00 45.76  ? 134 PHE C CD2 1 
ATOM   5991  C CE1 . PHE C 1 139 ? 36.256  7.617   3.387   1.00 45.46  ? 134 PHE C CE1 1 
ATOM   5992  C CE2 . PHE C 1 139 ? 37.338  9.484   2.323   1.00 46.69  ? 134 PHE C CE2 1 
ATOM   5993  C CZ  . PHE C 1 139 ? 36.223  8.938   2.948   1.00 46.01  ? 134 PHE C CZ  1 
ATOM   5994  N N   . VAL C 1 140 ? 41.662  4.487   4.336   1.00 47.99  ? 135 VAL C N   1 
ATOM   5995  C CA  . VAL C 1 140 ? 42.686  3.447   4.372   1.00 47.12  ? 135 VAL C CA  1 
ATOM   5996  C C   . VAL C 1 140 ? 42.124  2.042   4.250   1.00 49.71  ? 135 VAL C C   1 
ATOM   5997  O O   . VAL C 1 140 ? 41.097  1.727   4.848   1.00 50.22  ? 135 VAL C O   1 
ATOM   5998  C CB  . VAL C 1 140 ? 43.466  3.505   5.692   1.00 45.16  ? 135 VAL C CB  1 
ATOM   5999  C CG1 . VAL C 1 140 ? 44.637  2.539   5.650   1.00 44.29  ? 135 VAL C CG1 1 
ATOM   6000  C CG2 . VAL C 1 140 ? 43.932  4.919   5.946   1.00 44.99  ? 135 VAL C CG2 1 
ATOM   6001  N N   . ASP C 1 141 ? 42.808  1.191   3.490   1.00 51.57  ? 136 ASP C N   1 
ATOM   6002  C CA  . ASP C 1 141 ? 42.361  -0.184  3.319   1.00 54.40  ? 136 ASP C CA  1 
ATOM   6003  C C   . ASP C 1 141 ? 42.690  -0.971  4.587   1.00 55.52  ? 136 ASP C C   1 
ATOM   6004  O O   . ASP C 1 141 ? 43.507  -1.897  4.557   1.00 55.91  ? 136 ASP C O   1 
ATOM   6005  C CB  . ASP C 1 141 ? 43.055  -0.826  2.118   1.00 58.34  ? 136 ASP C CB  1 
ATOM   6006  C CG  . ASP C 1 141 ? 42.551  -2.233  1.839   1.00 62.62  ? 136 ASP C CG  1 
ATOM   6007  O OD1 . ASP C 1 141 ? 43.053  -2.872  0.887   1.00 65.30  ? 136 ASP C OD1 1 
ATOM   6008  O OD2 . ASP C 1 141 ? 41.650  -2.700  2.572   1.00 64.29  ? 136 ASP C OD2 1 
ATOM   6009  N N   . CYS C 1 142 ? 42.041  -0.601  5.692   1.00 54.80  ? 137 CYS C N   1 
ATOM   6010  C CA  . CYS C 1 142 ? 42.263  -1.234  6.995   1.00 54.24  ? 137 CYS C CA  1 
ATOM   6011  C C   . CYS C 1 142 ? 42.248  -2.762  7.031   1.00 55.59  ? 137 CYS C C   1 
ATOM   6012  O O   . CYS C 1 142 ? 42.387  -3.359  8.102   1.00 54.56  ? 137 CYS C O   1 
ATOM   6013  C CB  . CYS C 1 142 ? 41.256  -0.703  8.016   1.00 53.31  ? 137 CYS C CB  1 
ATOM   6014  S SG  . CYS C 1 142 ? 41.286  1.081   8.227   1.00 49.43  ? 137 CYS C SG  1 
ATOM   6015  N N   . SER C 1 143 ? 42.059  -3.403  5.882   1.00 57.93  ? 138 SER C N   1 
ATOM   6016  C CA  . SER C 1 143 ? 42.085  -4.860  5.854   1.00 61.14  ? 138 SER C CA  1 
ATOM   6017  C C   . SER C 1 143 ? 43.571  -5.229  5.925   1.00 63.34  ? 138 SER C C   1 
ATOM   6018  O O   . SER C 1 143 ? 43.938  -6.373  6.217   1.00 63.91  ? 138 SER C O   1 
ATOM   6019  C CB  . SER C 1 143 ? 41.438  -5.392  4.570   1.00 60.24  ? 138 SER C CB  1 
ATOM   6020  O OG  . SER C 1 143 ? 42.016  -4.809  3.418   1.00 60.24  ? 138 SER C OG  1 
ATOM   6021  N N   . LYS C 1 144 ? 44.415  -4.228  5.661   1.00 66.00  ? 139 LYS C N   1 
ATOM   6022  C CA  . LYS C 1 144 ? 45.870  -4.363  5.708   1.00 68.29  ? 139 LYS C CA  1 
ATOM   6023  C C   . LYS C 1 144 ? 46.346  -3.582  6.930   1.00 66.00  ? 139 LYS C C   1 
ATOM   6024  O O   . LYS C 1 144 ? 46.779  -2.440  6.807   1.00 66.50  ? 139 LYS C O   1 
ATOM   6025  C CB  . LYS C 1 144 ? 46.512  -3.771  4.449   1.00 72.97  ? 139 LYS C CB  1 
ATOM   6026  C CG  . LYS C 1 144 ? 46.112  -4.451  3.148   1.00 80.48  ? 139 LYS C CG  1 
ATOM   6027  C CD  . LYS C 1 144 ? 46.385  -5.949  3.188   1.00 86.15  ? 139 LYS C CD  1 
ATOM   6028  C CE  . LYS C 1 144 ? 47.071  -6.421  1.916   1.00 90.72  ? 139 LYS C CE  1 
ATOM   6029  N NZ  . LYS C 1 144 ? 48.417  -5.788  1.746   1.00 93.56  ? 139 LYS C NZ  1 
ATOM   6030  N N   . ILE C 1 145 ? 46.263  -4.207  8.100   1.00 63.96  ? 140 ILE C N   1 
ATOM   6031  C CA  . ILE C 1 145 ? 46.643  -3.573  9.358   1.00 62.39  ? 140 ILE C CA  1 
ATOM   6032  C C   . ILE C 1 145 ? 47.915  -2.734  9.305   1.00 60.51  ? 140 ILE C C   1 
ATOM   6033  O O   . ILE C 1 145 ? 47.965  -1.654  9.889   1.00 59.50  ? 140 ILE C O   1 
ATOM   6034  C CB  . ILE C 1 145 ? 46.780  -4.621  10.489  1.00 63.19  ? 140 ILE C CB  1 
ATOM   6035  C CG1 . ILE C 1 145 ? 45.491  -5.448  10.585  1.00 64.10  ? 140 ILE C CG1 1 
ATOM   6036  C CG2 . ILE C 1 145 ? 47.027  -3.922  11.824  1.00 61.90  ? 140 ILE C CG2 1 
ATOM   6037  C CD1 . ILE C 1 145 ? 45.531  -6.550  11.639  1.00 64.59  ? 140 ILE C CD1 1 
ATOM   6038  N N   . LYS C 1 146 ? 48.942  -3.219  8.615   1.00 60.08  ? 141 LYS C N   1 
ATOM   6039  C CA  . LYS C 1 146 ? 50.191  -2.466  8.521   1.00 59.77  ? 141 LYS C CA  1 
ATOM   6040  C C   . LYS C 1 146 ? 49.929  -1.085  7.933   1.00 58.47  ? 141 LYS C C   1 
ATOM   6041  O O   . LYS C 1 146 ? 50.555  -0.094  8.330   1.00 57.36  ? 141 LYS C O   1 
ATOM   6042  C CB  . LYS C 1 146 ? 51.210  -3.202  7.645   1.00 61.01  ? 141 LYS C CB  1 
ATOM   6043  C CG  . LYS C 1 146 ? 51.650  -4.548  8.197   1.00 65.68  ? 141 LYS C CG  1 
ATOM   6044  C CD  . LYS C 1 146 ? 53.067  -4.920  7.749   1.00 68.90  ? 141 LYS C CD  1 
ATOM   6045  C CE  . LYS C 1 146 ? 53.208  -4.972  6.232   1.00 70.92  ? 141 LYS C CE  1 
ATOM   6046  N NZ  . LYS C 1 146 ? 54.592  -5.340  5.814   1.00 71.66  ? 141 LYS C NZ  1 
ATOM   6047  N N   . LEU C 1 147 ? 48.983  -1.036  6.997   1.00 57.70  ? 142 LEU C N   1 
ATOM   6048  C CA  . LEU C 1 147 ? 48.605  0.193   6.301   1.00 57.22  ? 142 LEU C CA  1 
ATOM   6049  C C   . LEU C 1 147 ? 47.879  1.212   7.184   1.00 57.17  ? 142 LEU C C   1 
ATOM   6050  O O   . LEU C 1 147 ? 47.918  2.419   6.925   1.00 56.74  ? 142 LEU C O   1 
ATOM   6051  C CB  . LEU C 1 147 ? 47.744  -0.162  5.088   1.00 55.62  ? 142 LEU C CB  1 
ATOM   6052  C CG  . LEU C 1 147 ? 48.145  0.526   3.788   1.00 53.50  ? 142 LEU C CG  1 
ATOM   6053  C CD1 . LEU C 1 147 ? 47.321  -0.057  2.657   1.00 53.97  ? 142 LEU C CD1 1 
ATOM   6054  C CD2 . LEU C 1 147 ? 47.946  2.035   3.907   1.00 52.75  ? 142 LEU C CD2 1 
ATOM   6055  N N   . LEU C 1 148 ? 47.208  0.726   8.219   1.00 58.10  ? 143 LEU C N   1 
ATOM   6056  C CA  . LEU C 1 148 ? 46.511  1.615   9.134   1.00 60.69  ? 143 LEU C CA  1 
ATOM   6057  C C   . LEU C 1 148 ? 47.588  2.318   9.962   1.00 63.94  ? 143 LEU C C   1 
ATOM   6058  O O   . LEU C 1 148 ? 47.573  3.543   10.104  1.00 64.07  ? 143 LEU C O   1 
ATOM   6059  C CB  . LEU C 1 148 ? 45.558  0.811   10.030  1.00 56.69  ? 143 LEU C CB  1 
ATOM   6060  C CG  . LEU C 1 148 ? 44.705  1.549   11.070  1.00 53.31  ? 143 LEU C CG  1 
ATOM   6061  C CD1 . LEU C 1 148 ? 43.967  2.726   10.437  1.00 50.74  ? 143 LEU C CD1 1 
ATOM   6062  C CD2 . LEU C 1 148 ? 43.727  0.562   11.685  1.00 50.30  ? 143 LEU C CD2 1 
ATOM   6063  N N   . GLU C 1 149 ? 48.528  1.529   10.488  1.00 68.81  ? 144 GLU C N   1 
ATOM   6064  C CA  . GLU C 1 149 ? 49.650  2.039   11.284  1.00 72.92  ? 144 GLU C CA  1 
ATOM   6065  C C   . GLU C 1 149 ? 50.246  3.287   10.646  1.00 71.55  ? 144 GLU C C   1 
ATOM   6066  O O   . GLU C 1 149 ? 50.376  4.331   11.286  1.00 72.13  ? 144 GLU C O   1 
ATOM   6067  C CB  . GLU C 1 149 ? 50.747  0.974   11.391  1.00 77.68  ? 144 GLU C CB  1 
ATOM   6068  C CG  . GLU C 1 149 ? 50.614  0.046   12.577  1.00 85.49  ? 144 GLU C CG  1 
ATOM   6069  C CD  . GLU C 1 149 ? 51.104  0.682   13.863  1.00 89.91  ? 144 GLU C CD  1 
ATOM   6070  O OE1 . GLU C 1 149 ? 50.660  1.811   14.181  1.00 92.94  ? 144 GLU C OE1 1 
ATOM   6071  O OE2 . GLU C 1 149 ? 51.931  0.049   14.556  1.00 91.88  ? 144 GLU C OE2 1 
ATOM   6072  N N   . ALA C 1 150 ? 50.612  3.156   9.376   1.00 69.32  ? 145 ALA C N   1 
ATOM   6073  C CA  . ALA C 1 150 ? 51.197  4.250   8.620   1.00 68.31  ? 145 ALA C CA  1 
ATOM   6074  C C   . ALA C 1 150 ? 50.290  5.480   8.606   1.00 67.80  ? 145 ALA C C   1 
ATOM   6075  O O   . ALA C 1 150 ? 50.764  6.620   8.618   1.00 68.19  ? 145 ALA C O   1 
ATOM   6076  C CB  . ALA C 1 150 ? 51.474  3.790   7.196   1.00 67.31  ? 145 ALA C CB  1 
ATOM   6077  N N   . ALA C 1 151 ? 48.984  5.244   8.593   1.00 66.28  ? 146 ALA C N   1 
ATOM   6078  C CA  . ALA C 1 151 ? 48.019  6.330   8.550   1.00 64.75  ? 146 ALA C CA  1 
ATOM   6079  C C   . ALA C 1 151 ? 47.815  7.080   9.869   1.00 63.69  ? 146 ALA C C   1 
ATOM   6080  O O   . ALA C 1 151 ? 47.467  8.264   9.856   1.00 62.39  ? 146 ALA C O   1 
ATOM   6081  C CB  . ALA C 1 151 ? 46.686  5.801   8.041   1.00 66.17  ? 146 ALA C CB  1 
ATOM   6082  N N   . ILE C 1 152 ? 48.020  6.403   10.999  1.00 62.15  ? 147 ILE C N   1 
ATOM   6083  C CA  . ILE C 1 152 ? 47.840  7.048   12.306  1.00 61.45  ? 147 ILE C CA  1 
ATOM   6084  C C   . ILE C 1 152 ? 48.615  8.364   12.338  1.00 63.01  ? 147 ILE C C   1 
ATOM   6085  O O   . ILE C 1 152 ? 49.769  8.428   11.909  1.00 62.92  ? 147 ILE C O   1 
ATOM   6086  C CB  . ILE C 1 152 ? 48.337  6.162   13.472  1.00 60.27  ? 147 ILE C CB  1 
ATOM   6087  C CG1 . ILE C 1 152 ? 47.599  4.817   13.478  1.00 57.89  ? 147 ILE C CG1 1 
ATOM   6088  C CG2 . ILE C 1 152 ? 48.128  6.894   14.797  1.00 57.44  ? 147 ILE C CG2 1 
ATOM   6089  C CD1 . ILE C 1 152 ? 46.142  4.906   13.869  1.00 55.75  ? 147 ILE C CD1 1 
ATOM   6090  N N   . THR C 1 153 ? 47.978  9.404   12.863  1.00 63.21  ? 148 THR C N   1 
ATOM   6091  C CA  . THR C 1 153 ? 48.575  10.733  12.912  1.00 64.20  ? 148 THR C CA  1 
ATOM   6092  C C   . THR C 1 153 ? 48.290  11.421  14.239  1.00 67.79  ? 148 THR C C   1 
ATOM   6093  O O   . THR C 1 153 ? 47.391  11.021  14.968  1.00 67.44  ? 148 THR C O   1 
ATOM   6094  C CB  . THR C 1 153 ? 48.018  11.580  11.733  1.00 61.98  ? 148 THR C CB  1 
ATOM   6095  O OG1 . THR C 1 153 ? 48.736  11.250  10.541  1.00 60.15  ? 148 THR C OG1 1 
ATOM   6096  C CG2 . THR C 1 153 ? 48.116  13.062  11.991  1.00 59.20  ? 148 THR C CG2 1 
ATOM   6097  N N   . PRO C 1 154 ? 49.082  12.446  14.586  1.00 70.62  ? 149 PRO C N   1 
ATOM   6098  C CA  . PRO C 1 154 ? 48.867  13.165  15.844  1.00 75.58  ? 149 PRO C CA  1 
ATOM   6099  C C   . PRO C 1 154 ? 47.426  13.674  15.973  1.00 78.84  ? 149 PRO C C   1 
ATOM   6100  O O   . PRO C 1 154 ? 46.831  13.625  17.052  1.00 79.18  ? 149 PRO C O   1 
ATOM   6101  C CB  . PRO C 1 154 ? 49.873  14.307  15.752  1.00 74.91  ? 149 PRO C CB  1 
ATOM   6102  C CG  . PRO C 1 154 ? 51.022  13.655  15.070  1.00 74.20  ? 149 PRO C CG  1 
ATOM   6103  C CD  . PRO C 1 154 ? 50.354  12.860  13.963  1.00 72.66  ? 149 PRO C CD  1 
ATOM   6104  N N   . GLU C 1 155 ? 46.871  14.157  14.864  1.00 81.22  ? 150 GLU C N   1 
ATOM   6105  C CA  . GLU C 1 155 ? 45.512  14.680  14.861  1.00 83.37  ? 150 GLU C CA  1 
ATOM   6106  C C   . GLU C 1 155 ? 44.459  13.588  14.663  1.00 80.60  ? 150 GLU C C   1 
ATOM   6107  O O   . GLU C 1 155 ? 43.263  13.875  14.639  1.00 80.96  ? 150 GLU C O   1 
ATOM   6108  C CB  . GLU C 1 155 ? 45.361  15.757  13.780  1.00 89.98  ? 150 GLU C CB  1 
ATOM   6109  C CG  . GLU C 1 155 ? 46.323  16.934  13.937  1.00 99.53  ? 150 GLU C CG  1 
ATOM   6110  C CD  . GLU C 1 155 ? 47.735  16.618  13.462  1.00 104.12 ? 150 GLU C CD  1 
ATOM   6111  O OE1 . GLU C 1 155 ? 48.674  17.362  13.820  1.00 107.05 ? 150 GLU C OE1 1 
ATOM   6112  O OE2 . GLU C 1 155 ? 47.906  15.633  12.719  1.00 107.41 ? 150 GLU C OE2 1 
ATOM   6113  N N   . THR C 1 156 ? 44.901  12.342  14.516  1.00 76.96  ? 151 THR C N   1 
ATOM   6114  C CA  . THR C 1 156 ? 43.970  11.232  14.351  1.00 72.71  ? 151 THR C CA  1 
ATOM   6115  C C   . THR C 1 156 ? 43.309  10.980  15.696  1.00 69.44  ? 151 THR C C   1 
ATOM   6116  O O   . THR C 1 156 ? 43.987  10.734  16.696  1.00 68.11  ? 151 THR C O   1 
ATOM   6117  C CB  . THR C 1 156 ? 44.681  9.943   13.920  1.00 72.66  ? 151 THR C CB  1 
ATOM   6118  O OG1 . THR C 1 156 ? 45.359  10.161  12.679  1.00 74.38  ? 151 THR C OG1 1 
ATOM   6119  C CG2 . THR C 1 156 ? 43.673  8.820   13.738  1.00 73.42  ? 151 THR C CG2 1 
ATOM   6120  N N   . LYS C 1 157 ? 41.983  11.049  15.719  1.00 68.00  ? 152 LYS C N   1 
ATOM   6121  C CA  . LYS C 1 157 ? 41.240  10.838  16.952  1.00 66.39  ? 152 LYS C CA  1 
ATOM   6122  C C   . LYS C 1 157 ? 40.071  9.881   16.785  1.00 61.08  ? 152 LYS C C   1 
ATOM   6123  O O   . LYS C 1 157 ? 39.406  9.529   17.759  1.00 59.88  ? 152 LYS C O   1 
ATOM   6124  C CB  . LYS C 1 157 ? 40.761  12.185  17.507  1.00 70.71  ? 152 LYS C CB  1 
ATOM   6125  C CG  . LYS C 1 157 ? 41.915  13.025  18.051  1.00 78.56  ? 152 LYS C CG  1 
ATOM   6126  C CD  . LYS C 1 157 ? 41.461  14.322  18.699  1.00 84.59  ? 152 LYS C CD  1 
ATOM   6127  C CE  . LYS C 1 157 ? 42.646  15.082  19.310  1.00 87.65  ? 152 LYS C CE  1 
ATOM   6128  N NZ  . LYS C 1 157 ? 43.249  14.376  20.483  1.00 89.08  ? 152 LYS C NZ  1 
ATOM   6129  N N   . LEU C 1 158 ? 39.842  9.445   15.550  1.00 55.20  ? 153 LEU C N   1 
ATOM   6130  C CA  . LEU C 1 158 ? 38.752  8.527   15.265  1.00 49.29  ? 153 LEU C CA  1 
ATOM   6131  C C   . LEU C 1 158 ? 39.015  7.621   14.058  1.00 47.56  ? 153 LEU C C   1 
ATOM   6132  O O   . LEU C 1 158 ? 39.470  8.086   13.006  1.00 46.34  ? 153 LEU C O   1 
ATOM   6133  C CB  . LEU C 1 158 ? 37.456  9.313   15.047  1.00 47.52  ? 153 LEU C CB  1 
ATOM   6134  C CG  . LEU C 1 158 ? 36.207  8.494   14.704  1.00 47.35  ? 153 LEU C CG  1 
ATOM   6135  C CD1 . LEU C 1 158 ? 35.898  7.507   15.830  1.00 46.25  ? 153 LEU C CD1 1 
ATOM   6136  C CD2 . LEU C 1 158 ? 35.030  9.432   14.494  1.00 47.97  ? 153 LEU C CD2 1 
ATOM   6137  N N   . VAL C 1 159 ? 38.734  6.325   14.237  1.00 44.86  ? 154 VAL C N   1 
ATOM   6138  C CA  . VAL C 1 159 ? 38.882  5.311   13.191  1.00 42.30  ? 154 VAL C CA  1 
ATOM   6139  C C   . VAL C 1 159 ? 37.560  4.566   12.992  1.00 41.40  ? 154 VAL C C   1 
ATOM   6140  O O   . VAL C 1 159 ? 37.112  3.839   13.879  1.00 41.37  ? 154 VAL C O   1 
ATOM   6141  C CB  . VAL C 1 159 ? 39.984  4.278   13.536  1.00 42.52  ? 154 VAL C CB  1 
ATOM   6142  C CG1 . VAL C 1 159 ? 39.849  3.052   12.642  1.00 39.47  ? 154 VAL C CG1 1 
ATOM   6143  C CG2 . VAL C 1 159 ? 41.367  4.904   13.331  1.00 42.94  ? 154 VAL C CG2 1 
ATOM   6144  N N   . TRP C 1 160 ? 36.952  4.758   11.819  1.00 40.19  ? 155 TRP C N   1 
ATOM   6145  C CA  . TRP C 1 160 ? 35.674  4.135   11.447  1.00 39.18  ? 155 TRP C CA  1 
ATOM   6146  C C   . TRP C 1 160 ? 35.887  2.870   10.597  1.00 37.79  ? 155 TRP C C   1 
ATOM   6147  O O   . TRP C 1 160 ? 36.506  2.920   9.541   1.00 37.74  ? 155 TRP C O   1 
ATOM   6148  C CB  . TRP C 1 160 ? 34.833  5.149   10.675  1.00 39.29  ? 155 TRP C CB  1 
ATOM   6149  C CG  . TRP C 1 160 ? 33.440  4.728   10.477  1.00 39.52  ? 155 TRP C CG  1 
ATOM   6150  C CD1 . TRP C 1 160 ? 32.968  3.870   9.532   1.00 38.87  ? 155 TRP C CD1 1 
ATOM   6151  C CD2 . TRP C 1 160 ? 32.321  5.110   11.276  1.00 41.17  ? 155 TRP C CD2 1 
ATOM   6152  N NE1 . TRP C 1 160 ? 31.615  3.695   9.688   1.00 41.79  ? 155 TRP C NE1 1 
ATOM   6153  C CE2 . TRP C 1 160 ? 31.189  4.454   10.747  1.00 41.94  ? 155 TRP C CE2 1 
ATOM   6154  C CE3 . TRP C 1 160 ? 32.160  5.965   12.375  1.00 41.78  ? 155 TRP C CE3 1 
ATOM   6155  C CZ2 . TRP C 1 160 ? 29.911  4.600   11.298  1.00 42.13  ? 155 TRP C CZ2 1 
ATOM   6156  C CZ3 . TRP C 1 160 ? 30.890  6.115   12.923  1.00 43.56  ? 155 TRP C CZ3 1 
ATOM   6157  C CH2 . TRP C 1 160 ? 29.778  5.441   12.374  1.00 43.24  ? 155 TRP C CH2 1 
ATOM   6158  N N   . ILE C 1 161 ? 35.348  1.746   11.048  1.00 38.59  ? 156 ILE C N   1 
ATOM   6159  C CA  . ILE C 1 161 ? 35.542  0.470   10.358  1.00 40.61  ? 156 ILE C CA  1 
ATOM   6160  C C   . ILE C 1 161 ? 34.261  -0.315  10.074  1.00 39.89  ? 156 ILE C C   1 
ATOM   6161  O O   . ILE C 1 161 ? 33.528  -0.645  10.997  1.00 40.76  ? 156 ILE C O   1 
ATOM   6162  C CB  . ILE C 1 161 ? 36.462  -0.462  11.217  1.00 42.79  ? 156 ILE C CB  1 
ATOM   6163  C CG1 . ILE C 1 161 ? 37.873  0.112   11.311  1.00 43.03  ? 156 ILE C CG1 1 
ATOM   6164  C CG2 . ILE C 1 161 ? 36.503  -1.861  10.638  1.00 43.61  ? 156 ILE C CG2 1 
ATOM   6165  C CD1 . ILE C 1 161 ? 38.621  0.077   10.013  1.00 46.52  ? 156 ILE C CD1 1 
ATOM   6166  N N   . GLU C 1 162 ? 33.995  -0.628  8.810   1.00 40.16  ? 157 GLU C N   1 
ATOM   6167  C CA  . GLU C 1 162 ? 32.826  -1.440  8.476   1.00 40.75  ? 157 GLU C CA  1 
ATOM   6168  C C   . GLU C 1 162 ? 33.385  -2.800  8.058   1.00 41.61  ? 157 GLU C C   1 
ATOM   6169  O O   . GLU C 1 162 ? 34.421  -2.872  7.391   1.00 42.56  ? 157 GLU C O   1 
ATOM   6170  C CB  . GLU C 1 162 ? 32.031  -0.848  7.312   1.00 41.69  ? 157 GLU C CB  1 
ATOM   6171  C CG  . GLU C 1 162 ? 31.902  0.654   7.343   1.00 45.97  ? 157 GLU C CG  1 
ATOM   6172  C CD  . GLU C 1 162 ? 33.002  1.323   6.562   1.00 47.80  ? 157 GLU C CD  1 
ATOM   6173  O OE1 . GLU C 1 162 ? 33.175  2.555   6.709   1.00 50.35  ? 157 GLU C OE1 1 
ATOM   6174  O OE2 . GLU C 1 162 ? 33.685  0.611   5.791   1.00 49.08  ? 157 GLU C OE2 1 
ATOM   6175  N N   . THR C 1 163 ? 32.712  -3.876  8.455   1.00 40.60  ? 158 THR C N   1 
ATOM   6176  C CA  . THR C 1 163 ? 33.165  -5.226  8.118   1.00 39.45  ? 158 THR C CA  1 
ATOM   6177  C C   . THR C 1 163 ? 32.051  -6.260  8.302   1.00 38.86  ? 158 THR C C   1 
ATOM   6178  O O   . THR C 1 163 ? 31.344  -6.253  9.311   1.00 40.24  ? 158 THR C O   1 
ATOM   6179  C CB  . THR C 1 163 ? 34.390  -5.637  8.985   1.00 37.99  ? 158 THR C CB  1 
ATOM   6180  O OG1 . THR C 1 163 ? 34.676  -7.024  8.784   1.00 37.32  ? 158 THR C OG1 1 
ATOM   6181  C CG2 . THR C 1 163 ? 34.119  -5.401  10.456  1.00 35.88  ? 158 THR C CG2 1 
ATOM   6182  N N   . PRO C 1 164 ? 31.870  -7.157  7.321   1.00 35.07  ? 159 PRO C N   1 
ATOM   6183  C CA  . PRO C 1 164 ? 32.631  -7.248  6.069   1.00 35.56  ? 159 PRO C CA  1 
ATOM   6184  C C   . PRO C 1 164 ? 32.320  -6.067  5.159   1.00 37.78  ? 159 PRO C C   1 
ATOM   6185  O O   . PRO C 1 164 ? 31.286  -5.428  5.328   1.00 38.21  ? 159 PRO C O   1 
ATOM   6186  C CB  . PRO C 1 164 ? 32.154  -8.570  5.474   1.00 32.88  ? 159 PRO C CB  1 
ATOM   6187  C CG  . PRO C 1 164 ? 31.758  -9.365  6.683   1.00 32.80  ? 159 PRO C CG  1 
ATOM   6188  C CD  . PRO C 1 164 ? 31.042  -8.358  7.520   1.00 33.26  ? 159 PRO C CD  1 
ATOM   6189  N N   . THR C 1 165 ? 33.204  -5.768  4.206   1.00 38.62  ? 160 THR C N   1 
ATOM   6190  C CA  . THR C 1 165 ? 32.955  -4.661  3.283   1.00 39.51  ? 160 THR C CA  1 
ATOM   6191  C C   . THR C 1 165 ? 31.814  -5.039  2.356   1.00 41.61  ? 160 THR C C   1 
ATOM   6192  O O   . THR C 1 165 ? 31.341  -6.173  2.373   1.00 43.76  ? 160 THR C O   1 
ATOM   6193  C CB  . THR C 1 165 ? 34.180  -4.316  2.394   1.00 39.06  ? 160 THR C CB  1 
ATOM   6194  O OG1 . THR C 1 165 ? 34.597  -5.473  1.657   1.00 37.75  ? 160 THR C OG1 1 
ATOM   6195  C CG2 . THR C 1 165 ? 35.312  -3.801  3.238   1.00 37.69  ? 160 THR C CG2 1 
ATOM   6196  N N   . ASN C 1 166 ? 31.378  -4.081  1.549   1.00 42.95  ? 161 ASN C N   1 
ATOM   6197  C CA  . ASN C 1 166 ? 30.290  -4.304  0.610   1.00 42.81  ? 161 ASN C CA  1 
ATOM   6198  C C   . ASN C 1 166 ? 30.706  -3.759  -0.754  1.00 44.10  ? 161 ASN C C   1 
ATOM   6199  O O   . ASN C 1 166 ? 31.163  -2.616  -0.864  1.00 45.18  ? 161 ASN C O   1 
ATOM   6200  C CB  . ASN C 1 166 ? 29.017  -3.604  1.117   1.00 41.71  ? 161 ASN C CB  1 
ATOM   6201  C CG  . ASN C 1 166 ? 27.912  -3.557  0.074   1.00 41.19  ? 161 ASN C CG  1 
ATOM   6202  O OD1 . ASN C 1 166 ? 27.529  -4.579  -0.503  1.00 39.21  ? 161 ASN C OD1 1 
ATOM   6203  N ND2 . ASN C 1 166 ? 27.390  -2.362  -0.168  1.00 42.40  ? 161 ASN C ND2 1 
ATOM   6204  N N   . PRO C 1 167 ? 30.570  -4.580  -1.811  1.00 44.71  ? 162 PRO C N   1 
ATOM   6205  C CA  . PRO C 1 167 ? 30.052  -5.953  -1.768  1.00 44.35  ? 162 PRO C CA  1 
ATOM   6206  C C   . PRO C 1 167 ? 31.158  -7.004  -1.926  1.00 43.43  ? 162 PRO C C   1 
ATOM   6207  O O   . PRO C 1 167 ? 30.876  -8.173  -2.166  1.00 44.53  ? 162 PRO C O   1 
ATOM   6208  C CB  . PRO C 1 167 ? 29.102  -5.973  -2.944  1.00 43.07  ? 162 PRO C CB  1 
ATOM   6209  C CG  . PRO C 1 167 ? 29.935  -5.247  -3.980  1.00 44.23  ? 162 PRO C CG  1 
ATOM   6210  C CD  . PRO C 1 167 ? 30.568  -4.078  -3.199  1.00 43.39  ? 162 PRO C CD  1 
ATOM   6211  N N   . THR C 1 168 ? 32.407  -6.575  -1.801  1.00 43.72  ? 163 THR C N   1 
ATOM   6212  C CA  . THR C 1 168 ? 33.553  -7.460  -1.951  1.00 44.56  ? 163 THR C CA  1 
ATOM   6213  C C   . THR C 1 168 ? 33.690  -8.395  -0.760  1.00 43.88  ? 163 THR C C   1 
ATOM   6214  O O   . THR C 1 168 ? 34.221  -9.499  -0.880  1.00 44.28  ? 163 THR C O   1 
ATOM   6215  C CB  . THR C 1 168 ? 34.841  -6.647  -2.061  1.00 46.38  ? 163 THR C CB  1 
ATOM   6216  O OG1 . THR C 1 168 ? 34.623  -5.534  -2.933  1.00 48.71  ? 163 THR C OG1 1 
ATOM   6217  C CG2 . THR C 1 168 ? 35.970  -7.507  -2.612  1.00 48.63  ? 163 THR C CG2 1 
ATOM   6218  N N   . GLN C 1 169 ? 33.219  -7.924  0.390   1.00 42.99  ? 164 GLN C N   1 
ATOM   6219  C CA  . GLN C 1 169 ? 33.259  -8.661  1.648   1.00 42.45  ? 164 GLN C CA  1 
ATOM   6220  C C   . GLN C 1 169 ? 34.663  -8.910  2.216   1.00 43.70  ? 164 GLN C C   1 
ATOM   6221  O O   . GLN C 1 169 ? 34.980  -10.014 2.658   1.00 44.34  ? 164 GLN C O   1 
ATOM   6222  C CB  . GLN C 1 169 ? 32.472  -9.982  1.526   1.00 39.25  ? 164 GLN C CB  1 
ATOM   6223  C CG  . GLN C 1 169 ? 30.989  -9.757  1.201   1.00 38.25  ? 164 GLN C CG  1 
ATOM   6224  C CD  . GLN C 1 169 ? 30.086  -10.938 1.542   1.00 37.77  ? 164 GLN C CD  1 
ATOM   6225  O OE1 . GLN C 1 169 ? 29.982  -11.359 2.703   1.00 38.01  ? 164 GLN C OE1 1 
ATOM   6226  N NE2 . GLN C 1 169 ? 29.414  -11.468 0.529   1.00 36.76  ? 164 GLN C NE2 1 
ATOM   6227  N N   . LYS C 1 170 ? 35.500  -7.877  2.206   1.00 44.39  ? 165 LYS C N   1 
ATOM   6228  C CA  . LYS C 1 170 ? 36.840  -7.986  2.776   1.00 46.89  ? 165 LYS C CA  1 
ATOM   6229  C C   . LYS C 1 170 ? 36.594  -7.895  4.276   1.00 45.71  ? 165 LYS C C   1 
ATOM   6230  O O   . LYS C 1 170 ? 35.800  -7.068  4.711   1.00 46.20  ? 165 LYS C O   1 
ATOM   6231  C CB  . LYS C 1 170 ? 37.722  -6.809  2.336   1.00 51.79  ? 165 LYS C CB  1 
ATOM   6232  C CG  . LYS C 1 170 ? 37.879  -6.654  0.817   1.00 59.70  ? 165 LYS C CG  1 
ATOM   6233  C CD  . LYS C 1 170 ? 38.798  -5.480  0.420   1.00 64.67  ? 165 LYS C CD  1 
ATOM   6234  C CE  . LYS C 1 170 ? 38.227  -4.123  0.835   1.00 68.29  ? 165 LYS C CE  1 
ATOM   6235  N NZ  . LYS C 1 170 ? 39.078  -2.981  0.381   1.00 70.30  ? 165 LYS C NZ  1 
ATOM   6236  N N   . VAL C 1 171 ? 37.249  -8.734  5.070   1.00 43.67  ? 166 VAL C N   1 
ATOM   6237  C CA  . VAL C 1 171 ? 37.047  -8.696  6.518   1.00 40.90  ? 166 VAL C CA  1 
ATOM   6238  C C   . VAL C 1 171 ? 38.192  -8.014  7.287   1.00 44.30  ? 166 VAL C C   1 
ATOM   6239  O O   . VAL C 1 171 ? 39.370  -8.329  7.086   1.00 44.94  ? 166 VAL C O   1 
ATOM   6240  C CB  . VAL C 1 171 ? 36.824  -10.116 7.076   1.00 38.06  ? 166 VAL C CB  1 
ATOM   6241  C CG1 . VAL C 1 171 ? 36.654  -10.064 8.579   1.00 36.68  ? 166 VAL C CG1 1 
ATOM   6242  C CG2 . VAL C 1 171 ? 35.594  -10.726 6.437   1.00 34.21  ? 166 VAL C CG2 1 
ATOM   6243  N N   . ILE C 1 172 ? 37.836  -7.064  8.154   1.00 45.33  ? 167 ILE C N   1 
ATOM   6244  C CA  . ILE C 1 172 ? 38.819  -6.332  8.953   1.00 46.60  ? 167 ILE C CA  1 
ATOM   6245  C C   . ILE C 1 172 ? 38.924  -6.949  10.348  1.00 49.08  ? 167 ILE C C   1 
ATOM   6246  O O   . ILE C 1 172 ? 37.917  -7.316  10.952  1.00 49.14  ? 167 ILE C O   1 
ATOM   6247  C CB  . ILE C 1 172 ? 38.446  -4.814  9.082   1.00 46.12  ? 167 ILE C CB  1 
ATOM   6248  C CG1 . ILE C 1 172 ? 38.650  -4.096  7.751   1.00 45.60  ? 167 ILE C CG1 1 
ATOM   6249  C CG2 . ILE C 1 172 ? 39.340  -4.129  10.095  1.00 44.93  ? 167 ILE C CG2 1 
ATOM   6250  C CD1 . ILE C 1 172 ? 37.798  -4.617  6.636   1.00 47.75  ? 167 ILE C CD1 1 
ATOM   6251  N N   . ASP C 1 173 ? 40.149  -7.075  10.849  1.00 52.54  ? 168 ASP C N   1 
ATOM   6252  C CA  . ASP C 1 173 ? 40.370  -7.643  12.173  1.00 55.81  ? 168 ASP C CA  1 
ATOM   6253  C C   . ASP C 1 173 ? 40.041  -6.566  13.208  1.00 54.95  ? 168 ASP C C   1 
ATOM   6254  O O   . ASP C 1 173 ? 40.855  -5.680  13.458  1.00 54.22  ? 168 ASP C O   1 
ATOM   6255  C CB  . ASP C 1 173 ? 41.832  -8.081  12.315  1.00 60.55  ? 168 ASP C CB  1 
ATOM   6256  C CG  . ASP C 1 173 ? 42.058  -8.985  13.516  1.00 64.97  ? 168 ASP C CG  1 
ATOM   6257  O OD1 . ASP C 1 173 ? 41.603  -8.632  14.624  1.00 67.74  ? 168 ASP C OD1 1 
ATOM   6258  O OD2 . ASP C 1 173 ? 42.695  -10.047 13.352  1.00 67.77  ? 168 ASP C OD2 1 
ATOM   6259  N N   . ILE C 1 174 ? 38.852  -6.633  13.803  1.00 54.15  ? 169 ILE C N   1 
ATOM   6260  C CA  . ILE C 1 174 ? 38.456  -5.629  14.792  1.00 52.60  ? 169 ILE C CA  1 
ATOM   6261  C C   . ILE C 1 174 ? 39.525  -5.519  15.877  1.00 52.95  ? 169 ILE C C   1 
ATOM   6262  O O   . ILE C 1 174 ? 39.969  -4.421  16.213  1.00 51.69  ? 169 ILE C O   1 
ATOM   6263  C CB  . ILE C 1 174 ? 37.102  -5.973  15.481  1.00 51.99  ? 169 ILE C CB  1 
ATOM   6264  C CG1 . ILE C 1 174 ? 36.039  -6.374  14.449  1.00 50.70  ? 169 ILE C CG1 1 
ATOM   6265  C CG2 . ILE C 1 174 ? 36.618  -4.775  16.277  1.00 50.39  ? 169 ILE C CG2 1 
ATOM   6266  C CD1 . ILE C 1 174 ? 35.670  -5.297  13.477  1.00 51.84  ? 169 ILE C CD1 1 
ATOM   6267  N N   . GLU C 1 175 ? 39.937  -6.668  16.411  1.00 53.99  ? 170 GLU C N   1 
ATOM   6268  C CA  . GLU C 1 175 ? 40.946  -6.727  17.466  1.00 56.50  ? 170 GLU C CA  1 
ATOM   6269  C C   . GLU C 1 175 ? 42.241  -6.036  17.054  1.00 56.73  ? 170 GLU C C   1 
ATOM   6270  O O   . GLU C 1 175 ? 42.730  -5.140  17.739  1.00 56.24  ? 170 GLU C O   1 
ATOM   6271  C CB  . GLU C 1 175 ? 41.259  -8.176  17.813  1.00 58.45  ? 170 GLU C CB  1 
ATOM   6272  C CG  . GLU C 1 175 ? 41.982  -8.337  19.130  1.00 63.46  ? 170 GLU C CG  1 
ATOM   6273  C CD  . GLU C 1 175 ? 41.018  -8.414  20.297  1.00 66.58  ? 170 GLU C CD  1 
ATOM   6274  O OE1 . GLU C 1 175 ? 40.255  -9.404  20.366  1.00 67.61  ? 170 GLU C OE1 1 
ATOM   6275  O OE2 . GLU C 1 175 ? 41.015  -7.489  21.141  1.00 68.67  ? 170 GLU C OE2 1 
ATOM   6276  N N   . GLY C 1 176 ? 42.802  -6.476  15.936  1.00 57.69  ? 171 GLY C N   1 
ATOM   6277  C CA  . GLY C 1 176 ? 44.030  -5.880  15.449  1.00 58.94  ? 171 GLY C CA  1 
ATOM   6278  C C   . GLY C 1 176 ? 43.930  -4.371  15.499  1.00 59.30  ? 171 GLY C C   1 
ATOM   6279  O O   . GLY C 1 176 ? 44.627  -3.731  16.281  1.00 61.18  ? 171 GLY C O   1 
ATOM   6280  N N   . CYS C 1 177 ? 43.057  -3.802  14.675  1.00 58.74  ? 172 CYS C N   1 
ATOM   6281  C CA  . CYS C 1 177 ? 42.871  -2.362  14.641  1.00 58.09  ? 172 CYS C CA  1 
ATOM   6282  C C   . CYS C 1 177 ? 42.727  -1.801  16.048  1.00 59.82  ? 172 CYS C C   1 
ATOM   6283  O O   . CYS C 1 177 ? 43.117  -0.659  16.306  1.00 59.25  ? 172 CYS C O   1 
ATOM   6284  C CB  . CYS C 1 177 ? 41.632  -2.012  13.829  1.00 57.90  ? 172 CYS C CB  1 
ATOM   6285  S SG  . CYS C 1 177 ? 41.775  -2.405  12.087  1.00 57.09  ? 172 CYS C SG  1 
ATOM   6286  N N   . ALA C 1 178 ? 42.164  -2.599  16.954  1.00 60.35  ? 173 ALA C N   1 
ATOM   6287  C CA  . ALA C 1 178 ? 41.984  -2.159  18.332  1.00 62.09  ? 173 ALA C CA  1 
ATOM   6288  C C   . ALA C 1 178 ? 43.353  -1.936  18.975  1.00 65.67  ? 173 ALA C C   1 
ATOM   6289  O O   . ALA C 1 178 ? 43.633  -0.854  19.498  1.00 65.09  ? 173 ALA C O   1 
ATOM   6290  C CB  . ALA C 1 178 ? 41.190  -3.194  19.119  1.00 57.80  ? 173 ALA C CB  1 
ATOM   6291  N N   . HIS C 1 179 ? 44.206  -2.959  18.918  1.00 70.07  ? 174 HIS C N   1 
ATOM   6292  C CA  . HIS C 1 179 ? 45.549  -2.880  19.495  1.00 74.11  ? 174 HIS C CA  1 
ATOM   6293  C C   . HIS C 1 179 ? 46.361  -1.768  18.854  1.00 70.54  ? 174 HIS C C   1 
ATOM   6294  O O   . HIS C 1 179 ? 47.032  -1.004  19.545  1.00 70.61  ? 174 HIS C O   1 
ATOM   6295  C CB  . HIS C 1 179 ? 46.289  -4.212  19.321  1.00 85.07  ? 174 HIS C CB  1 
ATOM   6296  C CG  . HIS C 1 179 ? 45.675  -5.350  20.078  1.00 97.22  ? 174 HIS C CG  1 
ATOM   6297  N ND1 . HIS C 1 179 ? 46.162  -6.638  20.011  1.00 101.67 ? 174 HIS C ND1 1 
ATOM   6298  C CD2 . HIS C 1 179 ? 44.609  -5.394  20.913  1.00 101.96 ? 174 HIS C CD2 1 
ATOM   6299  C CE1 . HIS C 1 179 ? 45.421  -7.426  20.771  1.00 105.24 ? 174 HIS C CE1 1 
ATOM   6300  N NE2 . HIS C 1 179 ? 44.473  -6.696  21.329  1.00 105.44 ? 174 HIS C NE2 1 
ATOM   6301  N N   . ILE C 1 180 ? 46.294  -1.688  17.531  1.00 66.94  ? 175 ILE C N   1 
ATOM   6302  C CA  . ILE C 1 180 ? 47.018  -0.678  16.773  1.00 63.77  ? 175 ILE C CA  1 
ATOM   6303  C C   . ILE C 1 180 ? 46.582  0.729   17.202  1.00 65.78  ? 175 ILE C C   1 
ATOM   6304  O O   . ILE C 1 180 ? 47.388  1.524   17.701  1.00 65.66  ? 175 ILE C O   1 
ATOM   6305  C CB  . ILE C 1 180 ? 46.753  -0.842  15.254  1.00 60.86  ? 175 ILE C CB  1 
ATOM   6306  C CG1 . ILE C 1 180 ? 46.888  -2.315  14.851  1.00 60.00  ? 175 ILE C CG1 1 
ATOM   6307  C CG2 . ILE C 1 180 ? 47.702  0.030   14.454  1.00 57.93  ? 175 ILE C CG2 1 
ATOM   6308  C CD1 . ILE C 1 180 ? 48.204  -2.970  15.220  1.00 59.29  ? 175 ILE C CD1 1 
ATOM   6309  N N   . VAL C 1 181 ? 45.298  1.022   17.008  1.00 66.69  ? 176 VAL C N   1 
ATOM   6310  C CA  . VAL C 1 181 ? 44.725  2.324   17.346  1.00 66.10  ? 176 VAL C CA  1 
ATOM   6311  C C   . VAL C 1 181 ? 44.925  2.710   18.812  1.00 68.13  ? 176 VAL C C   1 
ATOM   6312  O O   . VAL C 1 181 ? 45.477  3.770   19.106  1.00 67.87  ? 176 VAL C O   1 
ATOM   6313  C CB  . VAL C 1 181 ? 43.212  2.358   16.997  1.00 65.13  ? 176 VAL C CB  1 
ATOM   6314  C CG1 . VAL C 1 181 ? 42.572  3.617   17.537  1.00 64.54  ? 176 VAL C CG1 1 
ATOM   6315  C CG2 . VAL C 1 181 ? 43.030  2.294   15.491  1.00 62.37  ? 176 VAL C CG2 1 
ATOM   6316  N N   . HIS C 1 182 ? 44.482  1.852   19.726  1.00 69.73  ? 177 HIS C N   1 
ATOM   6317  C CA  . HIS C 1 182 ? 44.616  2.122   21.154  1.00 71.62  ? 177 HIS C CA  1 
ATOM   6318  C C   . HIS C 1 182 ? 46.057  2.329   21.595  1.00 76.04  ? 177 HIS C C   1 
ATOM   6319  O O   . HIS C 1 182 ? 46.326  3.146   22.477  1.00 76.94  ? 177 HIS C O   1 
ATOM   6320  C CB  . HIS C 1 182 ? 44.022  0.978   21.974  1.00 69.01  ? 177 HIS C CB  1 
ATOM   6321  C CG  . HIS C 1 182 ? 42.545  0.819   21.811  1.00 67.21  ? 177 HIS C CG  1 
ATOM   6322  N ND1 . HIS C 1 182 ? 41.680  1.893   21.790  1.00 66.33  ? 177 HIS C ND1 1 
ATOM   6323  C CD2 . HIS C 1 182 ? 41.772  -0.288  21.718  1.00 65.90  ? 177 HIS C CD2 1 
ATOM   6324  C CE1 . HIS C 1 182 ? 40.438  1.453   21.695  1.00 65.08  ? 177 HIS C CE1 1 
ATOM   6325  N NE2 . HIS C 1 182 ? 40.466  0.133   21.650  1.00 64.87  ? 177 HIS C NE2 1 
ATOM   6326  N N   . LYS C 1 183 ? 46.972  1.584   20.974  1.00 81.01  ? 178 LYS C N   1 
ATOM   6327  C CA  . LYS C 1 183 ? 48.400  1.631   21.296  1.00 85.21  ? 178 LYS C CA  1 
ATOM   6328  C C   . LYS C 1 183 ? 48.966  3.016   21.590  1.00 85.47  ? 178 LYS C C   1 
ATOM   6329  O O   . LYS C 1 183 ? 49.566  3.236   22.641  1.00 86.09  ? 178 LYS C O   1 
ATOM   6330  C CB  . LYS C 1 183 ? 49.213  0.976   20.175  1.00 88.44  ? 178 LYS C CB  1 
ATOM   6331  C CG  . LYS C 1 183 ? 50.650  0.656   20.565  1.00 93.14  ? 178 LYS C CG  1 
ATOM   6332  C CD  . LYS C 1 183 ? 51.280  -0.346  19.606  1.00 96.94  ? 178 LYS C CD  1 
ATOM   6333  C CE  . LYS C 1 183 ? 52.611  -0.860  20.136  1.00 99.25  ? 178 LYS C CE  1 
ATOM   6334  N NZ  . LYS C 1 183 ? 53.194  -1.914  19.260  1.00 100.87 ? 178 LYS C NZ  1 
ATOM   6335  N N   . HIS C 1 184 ? 48.792  3.951   20.667  1.00 87.68  ? 179 HIS C N   1 
ATOM   6336  C CA  . HIS C 1 184 ? 49.305  5.293   20.884  1.00 89.79  ? 179 HIS C CA  1 
ATOM   6337  C C   . HIS C 1 184 ? 48.211  6.350   20.909  1.00 88.19  ? 179 HIS C C   1 
ATOM   6338  O O   . HIS C 1 184 ? 47.252  6.293   20.141  1.00 87.64  ? 179 HIS C O   1 
ATOM   6339  C CB  . HIS C 1 184 ? 50.335  5.665   19.809  1.00 93.90  ? 179 HIS C CB  1 
ATOM   6340  C CG  . HIS C 1 184 ? 51.650  4.961   19.950  1.00 98.59  ? 179 HIS C CG  1 
ATOM   6341  N ND1 . HIS C 1 184 ? 51.959  3.810   19.257  1.00 100.36 ? 179 HIS C ND1 1 
ATOM   6342  C CD2 . HIS C 1 184 ? 52.741  5.252   20.700  1.00 100.22 ? 179 HIS C CD2 1 
ATOM   6343  C CE1 . HIS C 1 184 ? 53.184  3.425   19.571  1.00 101.53 ? 179 HIS C CE1 1 
ATOM   6344  N NE2 . HIS C 1 184 ? 53.680  4.283   20.445  1.00 101.48 ? 179 HIS C NE2 1 
ATOM   6345  N N   . GLY C 1 185 ? 48.368  7.311   21.811  1.00 86.82  ? 180 GLY C N   1 
ATOM   6346  C CA  . GLY C 1 185 ? 47.422  8.404   21.921  1.00 85.42  ? 180 GLY C CA  1 
ATOM   6347  C C   . GLY C 1 185 ? 45.977  8.082   22.254  1.00 84.14  ? 180 GLY C C   1 
ATOM   6348  O O   . GLY C 1 185 ? 45.597  6.926   22.468  1.00 84.13  ? 180 GLY C O   1 
ATOM   6349  N N   . ASP C 1 186 ? 45.180  9.148   22.302  1.00 82.27  ? 181 ASP C N   1 
ATOM   6350  C CA  . ASP C 1 186 ? 43.754  9.082   22.596  1.00 79.47  ? 181 ASP C CA  1 
ATOM   6351  C C   . ASP C 1 186 ? 42.968  9.014   21.291  1.00 76.36  ? 181 ASP C C   1 
ATOM   6352  O O   . ASP C 1 186 ? 42.861  10.006  20.569  1.00 77.64  ? 181 ASP C O   1 
ATOM   6353  C CB  . ASP C 1 186 ? 43.327  10.325  23.382  1.00 80.05  ? 181 ASP C CB  1 
ATOM   6354  C CG  . ASP C 1 186 ? 41.866  10.686  23.158  1.00 81.59  ? 181 ASP C CG  1 
ATOM   6355  O OD1 . ASP C 1 186 ? 40.985  9.911   23.590  1.00 82.58  ? 181 ASP C OD1 1 
ATOM   6356  O OD2 . ASP C 1 186 ? 41.603  11.743  22.539  1.00 81.40  ? 181 ASP C OD2 1 
ATOM   6357  N N   . ILE C 1 187 ? 42.416  7.847   20.988  1.00 71.50  ? 182 ILE C N   1 
ATOM   6358  C CA  . ILE C 1 187 ? 41.654  7.700   19.765  1.00 67.06  ? 182 ILE C CA  1 
ATOM   6359  C C   . ILE C 1 187 ? 40.569  6.630   19.856  1.00 61.80  ? 182 ILE C C   1 
ATOM   6360  O O   . ILE C 1 187 ? 40.761  5.550   20.422  1.00 60.11  ? 182 ILE C O   1 
ATOM   6361  C CB  . ILE C 1 187 ? 42.604  7.427   18.575  1.00 68.42  ? 182 ILE C CB  1 
ATOM   6362  C CG1 . ILE C 1 187 ? 41.802  6.969   17.355  1.00 69.77  ? 182 ILE C CG1 1 
ATOM   6363  C CG2 . ILE C 1 187 ? 43.676  6.437   18.989  1.00 68.49  ? 182 ILE C CG2 1 
ATOM   6364  C CD1 . ILE C 1 187 ? 42.644  6.709   16.124  1.00 70.85  ? 182 ILE C CD1 1 
ATOM   6365  N N   . ILE C 1 188 ? 39.420  6.964   19.288  1.00 56.79  ? 183 ILE C N   1 
ATOM   6366  C CA  . ILE C 1 188 ? 38.248  6.100   19.280  1.00 51.88  ? 183 ILE C CA  1 
ATOM   6367  C C   . ILE C 1 188 ? 38.188  5.151   18.078  1.00 50.23  ? 183 ILE C C   1 
ATOM   6368  O O   . ILE C 1 188 ? 38.490  5.523   16.943  1.00 48.56  ? 183 ILE C O   1 
ATOM   6369  C CB  . ILE C 1 188 ? 36.967  6.967   19.288  1.00 51.80  ? 183 ILE C CB  1 
ATOM   6370  C CG1 . ILE C 1 188 ? 37.010  7.918   20.487  1.00 50.13  ? 183 ILE C CG1 1 
ATOM   6371  C CG2 . ILE C 1 188 ? 35.731  6.085   19.332  1.00 50.07  ? 183 ILE C CG2 1 
ATOM   6372  C CD1 . ILE C 1 188 ? 36.353  9.251   20.239  1.00 50.61  ? 183 ILE C CD1 1 
ATOM   6373  N N   . LEU C 1 189 ? 37.807  3.911   18.337  1.00 48.02  ? 184 LEU C N   1 
ATOM   6374  C CA  . LEU C 1 189 ? 37.670  2.940   17.263  1.00 44.84  ? 184 LEU C CA  1 
ATOM   6375  C C   . LEU C 1 189 ? 36.203  2.550   17.165  1.00 43.76  ? 184 LEU C C   1 
ATOM   6376  O O   . LEU C 1 189 ? 35.677  1.861   18.041  1.00 42.63  ? 184 LEU C O   1 
ATOM   6377  C CB  . LEU C 1 189 ? 38.506  1.689   17.525  1.00 42.62  ? 184 LEU C CB  1 
ATOM   6378  C CG  . LEU C 1 189 ? 38.174  0.568   16.534  1.00 40.83  ? 184 LEU C CG  1 
ATOM   6379  C CD1 . LEU C 1 189 ? 38.469  1.021   15.114  1.00 40.35  ? 184 LEU C CD1 1 
ATOM   6380  C CD2 . LEU C 1 189 ? 38.977  -0.660  16.866  1.00 41.56  ? 184 LEU C CD2 1 
ATOM   6381  N N   . VAL C 1 190 ? 35.551  3.005   16.101  1.00 43.16  ? 185 VAL C N   1 
ATOM   6382  C CA  . VAL C 1 190 ? 34.144  2.706   15.881  1.00 43.12  ? 185 VAL C CA  1 
ATOM   6383  C C   . VAL C 1 190 ? 33.974  1.588   14.854  1.00 41.11  ? 185 VAL C C   1 
ATOM   6384  O O   . VAL C 1 190 ? 34.701  1.520   13.857  1.00 40.10  ? 185 VAL C O   1 
ATOM   6385  C CB  . VAL C 1 190 ? 33.387  3.952   15.369  1.00 42.92  ? 185 VAL C CB  1 
ATOM   6386  C CG1 . VAL C 1 190 ? 31.909  3.632   15.215  1.00 42.42  ? 185 VAL C CG1 1 
ATOM   6387  C CG2 . VAL C 1 190 ? 33.596  5.126   16.327  1.00 42.94  ? 185 VAL C CG2 1 
ATOM   6388  N N   . VAL C 1 191 ? 33.021  0.700   15.104  1.00 40.14  ? 186 VAL C N   1 
ATOM   6389  C CA  . VAL C 1 191 ? 32.758  -0.375  14.161  1.00 42.40  ? 186 VAL C CA  1 
ATOM   6390  C C   . VAL C 1 191 ? 31.288  -0.371  13.750  1.00 38.23  ? 186 VAL C C   1 
ATOM   6391  O O   . VAL C 1 191 ? 30.405  -0.488  14.599  1.00 38.26  ? 186 VAL C O   1 
ATOM   6392  C CB  . VAL C 1 191 ? 33.113  -1.769  14.756  1.00 45.00  ? 186 VAL C CB  1 
ATOM   6393  C CG1 . VAL C 1 191 ? 32.663  -2.885  13.808  1.00 45.23  ? 186 VAL C CG1 1 
ATOM   6394  C CG2 . VAL C 1 191 ? 34.611  -1.871  14.976  1.00 46.68  ? 186 VAL C CG2 1 
ATOM   6395  N N   . ASP C 1 192 ? 31.037  -0.209  12.452  1.00 36.09  ? 187 ASP C N   1 
ATOM   6396  C CA  . ASP C 1 192 ? 29.681  -0.234  11.917  1.00 36.25  ? 187 ASP C CA  1 
ATOM   6397  C C   . ASP C 1 192 ? 29.336  -1.722  11.847  1.00 34.48  ? 187 ASP C C   1 
ATOM   6398  O O   . ASP C 1 192 ? 29.861  -2.448  11.003  1.00 36.26  ? 187 ASP C O   1 
ATOM   6399  C CB  . ASP C 1 192 ? 29.640  0.373   10.514  1.00 38.87  ? 187 ASP C CB  1 
ATOM   6400  C CG  . ASP C 1 192 ? 28.225  0.483   9.969   1.00 41.07  ? 187 ASP C CG  1 
ATOM   6401  O OD1 . ASP C 1 192 ? 27.440  -0.475  10.139  1.00 40.54  ? 187 ASP C OD1 1 
ATOM   6402  O OD2 . ASP C 1 192 ? 27.900  1.525   9.363   1.00 43.47  ? 187 ASP C OD2 1 
ATOM   6403  N N   . ASN C 1 193 ? 28.452  -2.159  12.740  1.00 32.33  ? 188 ASN C N   1 
ATOM   6404  C CA  . ASN C 1 193 ? 28.052  -3.554  12.871  1.00 30.19  ? 188 ASN C CA  1 
ATOM   6405  C C   . ASN C 1 193 ? 26.791  -3.901  12.092  1.00 29.89  ? 188 ASN C C   1 
ATOM   6406  O O   . ASN C 1 193 ? 26.162  -4.937  12.323  1.00 29.27  ? 188 ASN C O   1 
ATOM   6407  C CB  . ASN C 1 193 ? 27.845  -3.849  14.358  1.00 29.71  ? 188 ASN C CB  1 
ATOM   6408  C CG  . ASN C 1 193 ? 28.132  -5.287  14.717  1.00 29.96  ? 188 ASN C CG  1 
ATOM   6409  O OD1 . ASN C 1 193 ? 29.057  -5.893  14.177  1.00 32.84  ? 188 ASN C OD1 1 
ATOM   6410  N ND2 . ASN C 1 193 ? 27.361  -5.837  15.648  1.00 28.79  ? 188 ASN C ND2 1 
ATOM   6411  N N   . THR C 1 194 ? 26.434  -3.035  11.157  1.00 31.23  ? 189 THR C N   1 
ATOM   6412  C CA  . THR C 1 194 ? 25.241  -3.212  10.344  1.00 34.16  ? 189 THR C CA  1 
ATOM   6413  C C   . THR C 1 194 ? 25.235  -4.469  9.477   1.00 33.62  ? 189 THR C C   1 
ATOM   6414  O O   . THR C 1 194 ? 24.232  -5.179  9.416   1.00 34.14  ? 189 THR C O   1 
ATOM   6415  C CB  . THR C 1 194 ? 25.027  -1.982  9.428   1.00 34.57  ? 189 THR C CB  1 
ATOM   6416  O OG1 . THR C 1 194 ? 24.926  -0.795  10.231  1.00 36.35  ? 189 THR C OG1 1 
ATOM   6417  C CG2 . THR C 1 194 ? 23.764  -2.147  8.600   1.00 33.60  ? 189 THR C CG2 1 
ATOM   6418  N N   . PHE C 1 195 ? 26.352  -4.745  8.812   1.00 34.05  ? 190 PHE C N   1 
ATOM   6419  C CA  . PHE C 1 195 ? 26.446  -5.900  7.927   1.00 35.20  ? 190 PHE C CA  1 
ATOM   6420  C C   . PHE C 1 195 ? 26.524  -7.263  8.592   1.00 33.25  ? 190 PHE C C   1 
ATOM   6421  O O   . PHE C 1 195 ? 26.544  -8.279  7.914   1.00 34.36  ? 190 PHE C O   1 
ATOM   6422  C CB  . PHE C 1 195 ? 27.633  -5.723  6.984   1.00 39.15  ? 190 PHE C CB  1 
ATOM   6423  C CG  . PHE C 1 195 ? 27.469  -4.580  6.032   1.00 45.27  ? 190 PHE C CG  1 
ATOM   6424  C CD1 . PHE C 1 195 ? 28.507  -3.687  5.811   1.00 48.45  ? 190 PHE C CD1 1 
ATOM   6425  C CD2 . PHE C 1 195 ? 26.269  -4.393  5.350   1.00 48.27  ? 190 PHE C CD2 1 
ATOM   6426  C CE1 . PHE C 1 195 ? 28.354  -2.625  4.922   1.00 50.62  ? 190 PHE C CE1 1 
ATOM   6427  C CE2 . PHE C 1 195 ? 26.105  -3.334  4.458   1.00 49.67  ? 190 PHE C CE2 1 
ATOM   6428  C CZ  . PHE C 1 195 ? 27.148  -2.450  4.244   1.00 50.33  ? 190 PHE C CZ  1 
ATOM   6429  N N   . MET C 1 196 ? 26.550  -7.289  9.915   1.00 31.99  ? 191 MET C N   1 
ATOM   6430  C CA  . MET C 1 196 ? 26.640  -8.541  10.644  1.00 30.61  ? 191 MET C CA  1 
ATOM   6431  C C   . MET C 1 196 ? 25.486  -8.703  11.617  1.00 31.07  ? 191 MET C C   1 
ATOM   6432  O O   . MET C 1 196 ? 24.925  -9.792  11.758  1.00 30.25  ? 191 MET C O   1 
ATOM   6433  C CB  . MET C 1 196 ? 27.955  -8.585  11.421  1.00 30.11  ? 191 MET C CB  1 
ATOM   6434  C CG  . MET C 1 196 ? 29.160  -8.804  10.555  1.00 33.25  ? 191 MET C CG  1 
ATOM   6435  S SD  . MET C 1 196 ? 29.049  -10.421 9.770   1.00 35.52  ? 191 MET C SD  1 
ATOM   6436  C CE  . MET C 1 196 ? 29.315  -11.466 11.208  1.00 35.23  ? 191 MET C CE  1 
ATOM   6437  N N   . SER C 1 197 ? 25.152  -7.596  12.276  1.00 30.76  ? 192 SER C N   1 
ATOM   6438  C CA  . SER C 1 197 ? 24.110  -7.518  13.291  1.00 30.22  ? 192 SER C CA  1 
ATOM   6439  C C   . SER C 1 197 ? 24.754  -7.951  14.605  1.00 30.95  ? 192 SER C C   1 
ATOM   6440  O O   . SER C 1 197 ? 25.689  -8.756  14.616  1.00 31.16  ? 192 SER C O   1 
ATOM   6441  C CB  . SER C 1 197 ? 22.933  -8.431  12.968  1.00 29.42  ? 192 SER C CB  1 
ATOM   6442  O OG  . SER C 1 197 ? 23.101  -9.705  13.562  1.00 32.56  ? 192 SER C OG  1 
ATOM   6443  N N   . PRO C 1 198 ? 24.272  -7.415  15.732  1.00 30.86  ? 193 PRO C N   1 
ATOM   6444  C CA  . PRO C 1 198 ? 24.859  -7.796  17.019  1.00 29.96  ? 193 PRO C CA  1 
ATOM   6445  C C   . PRO C 1 198 ? 24.802  -9.291  17.326  1.00 30.01  ? 193 PRO C C   1 
ATOM   6446  O O   . PRO C 1 198 ? 25.463  -9.766  18.250  1.00 31.32  ? 193 PRO C O   1 
ATOM   6447  C CB  . PRO C 1 198 ? 24.064  -6.953  18.021  1.00 30.79  ? 193 PRO C CB  1 
ATOM   6448  C CG  . PRO C 1 198 ? 22.753  -6.716  17.310  1.00 30.48  ? 193 PRO C CG  1 
ATOM   6449  C CD  . PRO C 1 198 ? 23.179  -6.445  15.906  1.00 29.04  ? 193 PRO C CD  1 
ATOM   6450  N N   . TYR C 1 199 ? 24.032  -10.030 16.539  1.00 28.86  ? 194 TYR C N   1 
ATOM   6451  C CA  . TYR C 1 199 ? 23.883  -11.460 16.763  1.00 30.91  ? 194 TYR C CA  1 
ATOM   6452  C C   . TYR C 1 199 ? 25.105  -12.284 16.372  1.00 31.77  ? 194 TYR C C   1 
ATOM   6453  O O   . TYR C 1 199 ? 25.409  -13.292 17.014  1.00 30.81  ? 194 TYR C O   1 
ATOM   6454  C CB  . TYR C 1 199 ? 22.671  -11.994 15.994  1.00 32.67  ? 194 TYR C CB  1 
ATOM   6455  C CG  . TYR C 1 199 ? 22.414  -13.471 16.234  1.00 33.44  ? 194 TYR C CG  1 
ATOM   6456  C CD1 . TYR C 1 199 ? 21.938  -13.917 17.464  1.00 33.40  ? 194 TYR C CD1 1 
ATOM   6457  C CD2 . TYR C 1 199 ? 22.643  -14.423 15.232  1.00 32.17  ? 194 TYR C CD2 1 
ATOM   6458  C CE1 . TYR C 1 199 ? 21.692  -15.268 17.697  1.00 34.12  ? 194 TYR C CE1 1 
ATOM   6459  C CE2 . TYR C 1 199 ? 22.399  -15.783 15.457  1.00 32.41  ? 194 TYR C CE2 1 
ATOM   6460  C CZ  . TYR C 1 199 ? 21.923  -16.193 16.695  1.00 33.75  ? 194 TYR C CZ  1 
ATOM   6461  O OH  . TYR C 1 199 ? 21.675  -17.520 16.955  1.00 35.43  ? 194 TYR C OH  1 
ATOM   6462  N N   . PHE C 1 200 ? 25.785  -11.850 15.312  1.00 32.03  ? 195 PHE C N   1 
ATOM   6463  C CA  . PHE C 1 200 ? 26.959  -12.537 14.777  1.00 31.54  ? 195 PHE C CA  1 
ATOM   6464  C C   . PHE C 1 200 ? 28.278  -11.823 15.055  1.00 32.23  ? 195 PHE C C   1 
ATOM   6465  O O   . PHE C 1 200 ? 29.346  -12.347 14.742  1.00 33.44  ? 195 PHE C O   1 
ATOM   6466  C CB  . PHE C 1 200 ? 26.828  -12.688 13.260  1.00 30.47  ? 195 PHE C CB  1 
ATOM   6467  C CG  . PHE C 1 200 ? 25.799  -13.692 12.820  1.00 30.10  ? 195 PHE C CG  1 
ATOM   6468  C CD1 . PHE C 1 200 ? 24.940  -13.399 11.761  1.00 28.65  ? 195 PHE C CD1 1 
ATOM   6469  C CD2 . PHE C 1 200 ? 25.732  -14.952 13.406  1.00 28.99  ? 195 PHE C CD2 1 
ATOM   6470  C CE1 . PHE C 1 200 ? 24.038  -14.345 11.293  1.00 28.55  ? 195 PHE C CE1 1 
ATOM   6471  C CE2 . PHE C 1 200 ? 24.827  -15.909 12.938  1.00 28.44  ? 195 PHE C CE2 1 
ATOM   6472  C CZ  . PHE C 1 200 ? 23.981  -15.605 11.882  1.00 27.57  ? 195 PHE C CZ  1 
ATOM   6473  N N   . GLN C 1 201 ? 28.221  -10.628 15.619  1.00 31.54  ? 196 GLN C N   1 
ATOM   6474  C CA  . GLN C 1 201 ? 29.454  -9.918  15.876  1.00 33.11  ? 196 GLN C CA  1 
ATOM   6475  C C   . GLN C 1 201 ? 29.284  -8.956  17.034  1.00 35.00  ? 196 GLN C C   1 
ATOM   6476  O O   . GLN C 1 201 ? 28.261  -8.280  17.145  1.00 34.80  ? 196 GLN C O   1 
ATOM   6477  C CB  . GLN C 1 201 ? 29.879  -9.169  14.620  1.00 34.38  ? 196 GLN C CB  1 
ATOM   6478  C CG  . GLN C 1 201 ? 31.335  -8.782  14.592  1.00 36.79  ? 196 GLN C CG  1 
ATOM   6479  C CD  . GLN C 1 201 ? 31.701  -7.992  13.353  1.00 39.28  ? 196 GLN C CD  1 
ATOM   6480  O OE1 . GLN C 1 201 ? 32.870  -7.927  12.971  1.00 43.93  ? 196 GLN C OE1 1 
ATOM   6481  N NE2 . GLN C 1 201 ? 30.706  -7.373  12.722  1.00 40.04  ? 196 GLN C NE2 1 
ATOM   6482  N N   . ARG C 1 202 ? 30.291  -8.902  17.899  1.00 35.65  ? 197 ARG C N   1 
ATOM   6483  C CA  . ARG C 1 202 ? 30.244  -8.034  19.064  1.00 35.94  ? 197 ARG C CA  1 
ATOM   6484  C C   . ARG C 1 202 ? 31.499  -7.168  19.155  1.00 36.41  ? 197 ARG C C   1 
ATOM   6485  O O   . ARG C 1 202 ? 32.386  -7.407  19.978  1.00 37.74  ? 197 ARG C O   1 
ATOM   6486  C CB  . ARG C 1 202 ? 30.069  -8.882  20.327  1.00 35.34  ? 197 ARG C CB  1 
ATOM   6487  C CG  . ARG C 1 202 ? 29.895  -8.074  21.590  1.00 35.58  ? 197 ARG C CG  1 
ATOM   6488  C CD  . ARG C 1 202 ? 29.408  -8.953  22.726  1.00 37.40  ? 197 ARG C CD  1 
ATOM   6489  N NE  . ARG C 1 202 ? 27.987  -9.274  22.626  1.00 35.97  ? 197 ARG C NE  1 
ATOM   6490  C CZ  . ARG C 1 202 ? 27.358  -10.097 23.460  1.00 35.03  ? 197 ARG C CZ  1 
ATOM   6491  N NH1 . ARG C 1 202 ? 28.035  -10.680 24.442  1.00 34.11  ? 197 ARG C NH1 1 
ATOM   6492  N NH2 . ARG C 1 202 ? 26.054  -10.322 23.328  1.00 32.66  ? 197 ARG C NH2 1 
ATOM   6493  N N   . PRO C 1 203 ? 31.574  -6.136  18.307  1.00 36.53  ? 198 PRO C N   1 
ATOM   6494  C CA  . PRO C 1 203 ? 32.686  -5.186  18.223  1.00 36.18  ? 198 PRO C CA  1 
ATOM   6495  C C   . PRO C 1 203 ? 33.283  -4.777  19.563  1.00 37.06  ? 198 PRO C C   1 
ATOM   6496  O O   . PRO C 1 203 ? 34.499  -4.750  19.715  1.00 38.15  ? 198 PRO C O   1 
ATOM   6497  C CB  . PRO C 1 203 ? 32.070  -4.004  17.486  1.00 37.46  ? 198 PRO C CB  1 
ATOM   6498  C CG  . PRO C 1 203 ? 31.116  -4.675  16.561  1.00 37.66  ? 198 PRO C CG  1 
ATOM   6499  C CD  . PRO C 1 203 ? 30.466  -5.723  17.432  1.00 35.10  ? 198 PRO C CD  1 
ATOM   6500  N N   . LEU C 1 204 ? 32.431  -4.455  20.528  1.00 37.84  ? 199 LEU C N   1 
ATOM   6501  C CA  . LEU C 1 204 ? 32.899  -4.043  21.850  1.00 37.98  ? 199 LEU C CA  1 
ATOM   6502  C C   . LEU C 1 204 ? 33.685  -5.134  22.586  1.00 38.43  ? 199 LEU C C   1 
ATOM   6503  O O   . LEU C 1 204 ? 34.609  -4.839  23.338  1.00 39.89  ? 199 LEU C O   1 
ATOM   6504  C CB  . LEU C 1 204 ? 31.719  -3.598  22.722  1.00 36.17  ? 199 LEU C CB  1 
ATOM   6505  C CG  . LEU C 1 204 ? 30.984  -2.328  22.319  1.00 32.39  ? 199 LEU C CG  1 
ATOM   6506  C CD1 . LEU C 1 204 ? 29.864  -2.108  23.289  1.00 32.88  ? 199 LEU C CD1 1 
ATOM   6507  C CD2 . LEU C 1 204 ? 31.918  -1.152  22.320  1.00 31.70  ? 199 LEU C CD2 1 
ATOM   6508  N N   . ALA C 1 205 ? 33.316  -6.389  22.378  1.00 38.41  ? 200 ALA C N   1 
ATOM   6509  C CA  . ALA C 1 205 ? 34.007  -7.486  23.030  1.00 37.52  ? 200 ALA C CA  1 
ATOM   6510  C C   . ALA C 1 205 ? 35.322  -7.780  22.323  1.00 39.17  ? 200 ALA C C   1 
ATOM   6511  O O   . ALA C 1 205 ? 36.136  -8.555  22.824  1.00 41.05  ? 200 ALA C O   1 
ATOM   6512  C CB  . ALA C 1 205 ? 33.136  -8.718  23.020  1.00 36.23  ? 200 ALA C CB  1 
ATOM   6513  N N   . LEU C 1 206 ? 35.531  -7.162  21.162  1.00 39.37  ? 201 LEU C N   1 
ATOM   6514  C CA  . LEU C 1 206 ? 36.750  -7.383  20.384  1.00 39.14  ? 201 LEU C CA  1 
ATOM   6515  C C   . LEU C 1 206 ? 37.689  -6.184  20.397  1.00 40.09  ? 201 LEU C C   1 
ATOM   6516  O O   . LEU C 1 206 ? 38.606  -6.107  19.580  1.00 38.82  ? 201 LEU C O   1 
ATOM   6517  C CB  . LEU C 1 206 ? 36.410  -7.730  18.930  1.00 39.11  ? 201 LEU C CB  1 
ATOM   6518  C CG  . LEU C 1 206 ? 35.544  -8.958  18.645  1.00 39.19  ? 201 LEU C CG  1 
ATOM   6519  C CD1 . LEU C 1 206 ? 35.077  -8.896  17.198  1.00 41.36  ? 201 LEU C CD1 1 
ATOM   6520  C CD2 . LEU C 1 206 ? 36.309  -10.233 18.908  1.00 37.67  ? 201 LEU C CD2 1 
ATOM   6521  N N   . GLY C 1 207 ? 37.451  -5.244  21.308  1.00 40.43  ? 202 GLY C N   1 
ATOM   6522  C CA  . GLY C 1 207 ? 38.319  -4.087  21.400  1.00 41.57  ? 202 GLY C CA  1 
ATOM   6523  C C   . GLY C 1 207 ? 37.729  -2.746  21.021  1.00 43.04  ? 202 GLY C C   1 
ATOM   6524  O O   . GLY C 1 207 ? 38.117  -1.722  21.572  1.00 43.87  ? 202 GLY C O   1 
ATOM   6525  N N   . ALA C 1 208 ? 36.799  -2.736  20.077  1.00 45.01  ? 203 ALA C N   1 
ATOM   6526  C CA  . ALA C 1 208 ? 36.181  -1.487  19.637  1.00 45.18  ? 203 ALA C CA  1 
ATOM   6527  C C   . ALA C 1 208 ? 35.628  -0.669  20.791  1.00 43.24  ? 203 ALA C C   1 
ATOM   6528  O O   . ALA C 1 208 ? 35.157  -1.223  21.783  1.00 43.12  ? 203 ALA C O   1 
ATOM   6529  C CB  . ALA C 1 208 ? 35.062  -1.783  18.649  1.00 47.36  ? 203 ALA C CB  1 
ATOM   6530  N N   . ASP C 1 209 ? 35.692  0.652   20.652  1.00 41.93  ? 204 ASP C N   1 
ATOM   6531  C CA  . ASP C 1 209 ? 35.163  1.549   21.669  1.00 42.71  ? 204 ASP C CA  1 
ATOM   6532  C C   . ASP C 1 209 ? 33.660  1.723   21.415  1.00 41.45  ? 204 ASP C C   1 
ATOM   6533  O O   . ASP C 1 209 ? 32.851  1.695   22.342  1.00 40.95  ? 204 ASP C O   1 
ATOM   6534  C CB  . ASP C 1 209 ? 35.841  2.928   21.602  1.00 45.47  ? 204 ASP C CB  1 
ATOM   6535  C CG  . ASP C 1 209 ? 37.333  2.882   21.928  1.00 49.01  ? 204 ASP C CG  1 
ATOM   6536  O OD1 . ASP C 1 209 ? 37.700  2.313   22.982  1.00 48.94  ? 204 ASP C OD1 1 
ATOM   6537  O OD2 . ASP C 1 209 ? 38.139  3.435   21.136  1.00 50.73  ? 204 ASP C OD2 1 
ATOM   6538  N N   . ILE C 1 210 ? 33.301  1.891   20.144  1.00 39.85  ? 205 ILE C N   1 
ATOM   6539  C CA  . ILE C 1 210 ? 31.914  2.091   19.738  1.00 37.78  ? 205 ILE C CA  1 
ATOM   6540  C C   . ILE C 1 210 ? 31.416  1.110   18.664  1.00 38.52  ? 205 ILE C C   1 
ATOM   6541  O O   . ILE C 1 210 ? 32.055  0.921   17.622  1.00 37.28  ? 205 ILE C O   1 
ATOM   6542  C CB  . ILE C 1 210 ? 31.708  3.530   19.199  1.00 37.25  ? 205 ILE C CB  1 
ATOM   6543  C CG1 . ILE C 1 210 ? 32.187  4.546   20.233  1.00 34.57  ? 205 ILE C CG1 1 
ATOM   6544  C CG2 . ILE C 1 210 ? 30.236  3.764   18.871  1.00 35.44  ? 205 ILE C CG2 1 
ATOM   6545  C CD1 . ILE C 1 210 ? 32.060  5.977   19.773  1.00 36.43  ? 205 ILE C CD1 1 
ATOM   6546  N N   . SER C 1 211 ? 30.268  0.494   18.937  1.00 38.82  ? 206 SER C N   1 
ATOM   6547  C CA  . SER C 1 211 ? 29.626  -0.434  18.010  1.00 39.50  ? 206 SER C CA  1 
ATOM   6548  C C   . SER C 1 211 ? 28.335  0.238   17.530  1.00 38.98  ? 206 SER C C   1 
ATOM   6549  O O   . SER C 1 211 ? 27.398  0.419   18.309  1.00 37.07  ? 206 SER C O   1 
ATOM   6550  C CB  . SER C 1 211 ? 29.294  -1.748  18.717  1.00 39.84  ? 206 SER C CB  1 
ATOM   6551  O OG  . SER C 1 211 ? 28.625  -2.635  17.836  1.00 40.50  ? 206 SER C OG  1 
ATOM   6552  N N   . MET C 1 212 ? 28.298  0.612   16.253  1.00 39.66  ? 207 MET C N   1 
ATOM   6553  C CA  . MET C 1 212 ? 27.138  1.293   15.679  1.00 41.78  ? 207 MET C CA  1 
ATOM   6554  C C   . MET C 1 212 ? 26.336  0.391   14.752  1.00 42.50  ? 207 MET C C   1 
ATOM   6555  O O   . MET C 1 212 ? 26.800  0.023   13.685  1.00 43.43  ? 207 MET C O   1 
ATOM   6556  C CB  . MET C 1 212 ? 27.599  2.547   14.920  1.00 42.10  ? 207 MET C CB  1 
ATOM   6557  C CG  . MET C 1 212 ? 26.481  3.455   14.402  1.00 44.22  ? 207 MET C CG  1 
ATOM   6558  S SD  . MET C 1 212 ? 25.629  2.836   12.918  1.00 45.76  ? 207 MET C SD  1 
ATOM   6559  C CE  . MET C 1 212 ? 26.486  3.761   11.627  1.00 42.54  ? 207 MET C CE  1 
ATOM   6560  N N   . TYR C 1 213 ? 25.129  0.034   15.169  1.00 45.81  ? 208 TYR C N   1 
ATOM   6561  C CA  . TYR C 1 213 ? 24.254  -0.824  14.370  1.00 47.96  ? 208 TYR C CA  1 
ATOM   6562  C C   . TYR C 1 213 ? 23.181  0.037   13.730  1.00 47.34  ? 208 TYR C C   1 
ATOM   6563  O O   . TYR C 1 213 ? 22.355  0.628   14.419  1.00 48.49  ? 208 TYR C O   1 
ATOM   6564  C CB  . TYR C 1 213 ? 23.595  -1.882  15.254  1.00 50.80  ? 208 TYR C CB  1 
ATOM   6565  C CG  . TYR C 1 213 ? 22.715  -2.843  14.499  1.00 54.11  ? 208 TYR C CG  1 
ATOM   6566  C CD1 . TYR C 1 213 ? 23.179  -3.478  13.349  1.00 55.60  ? 208 TYR C CD1 1 
ATOM   6567  C CD2 . TYR C 1 213 ? 21.430  -3.148  14.950  1.00 56.34  ? 208 TYR C CD2 1 
ATOM   6568  C CE1 . TYR C 1 213 ? 22.391  -4.396  12.665  1.00 56.71  ? 208 TYR C CE1 1 
ATOM   6569  C CE2 . TYR C 1 213 ? 20.629  -4.068  14.272  1.00 57.61  ? 208 TYR C CE2 1 
ATOM   6570  C CZ  . TYR C 1 213 ? 21.119  -4.689  13.130  1.00 58.10  ? 208 TYR C CZ  1 
ATOM   6571  O OH  . TYR C 1 213 ? 20.348  -5.611  12.456  1.00 59.53  ? 208 TYR C OH  1 
ATOM   6572  N N   . SER C 1 214 ? 23.187  0.103   12.409  1.00 44.07  ? 209 SER C N   1 
ATOM   6573  C CA  . SER C 1 214 ? 22.220  0.928   11.707  1.00 44.72  ? 209 SER C CA  1 
ATOM   6574  C C   . SER C 1 214 ? 21.276  0.115   10.863  1.00 46.71  ? 209 SER C C   1 
ATOM   6575  O O   . SER C 1 214 ? 21.695  -0.423  9.845   1.00 45.10  ? 209 SER C O   1 
ATOM   6576  C CB  . SER C 1 214 ? 22.952  1.912   10.803  1.00 47.51  ? 209 SER C CB  1 
ATOM   6577  O OG  . SER C 1 214 ? 22.174  2.198   9.654   1.00 49.67  ? 209 SER C OG  1 
ATOM   6578  N N   . ALA C 1 215 ? 20.006  0.045   11.238  1.00 39.75  ? 210 ALA C N   1 
ATOM   6579  C CA  . ALA C 1 215 ? 19.077  -0.733  10.429  1.00 38.68  ? 210 ALA C CA  1 
ATOM   6580  C C   . ALA C 1 215 ? 18.131  0.118   9.579   1.00 35.82  ? 210 ALA C C   1 
ATOM   6581  O O   . ALA C 1 215 ? 17.604  1.138   10.019  1.00 37.58  ? 210 ALA C O   1 
ATOM   6582  C CB  . ALA C 1 215 ? 18.288  -1.679  11.301  1.00 36.10  ? 210 ALA C CB  1 
ATOM   6583  N N   . THR C 1 216 ? 17.908  -0.350  8.357   1.00 44.02  ? 211 THR C N   1 
ATOM   6584  C CA  . THR C 1 216 ? 17.056  0.327   7.382   1.00 44.71  ? 211 THR C CA  1 
ATOM   6585  C C   . THR C 1 216 ? 15.621  -0.203  7.323   1.00 41.10  ? 211 THR C C   1 
ATOM   6586  O O   . THR C 1 216 ? 15.249  -1.137  8.044   1.00 43.79  ? 211 THR C O   1 
ATOM   6587  C CB  . THR C 1 216 ? 17.658  0.190   5.980   1.00 42.86  ? 211 THR C CB  1 
ATOM   6588  O OG1 . THR C 1 216 ? 17.638  -1.192  5.596   1.00 41.30  ? 211 THR C OG1 1 
ATOM   6589  C CG2 . THR C 1 216 ? 19.098  0.679   5.982   1.00 44.38  ? 211 THR C CG2 1 
ATOM   6590  N N   . LYS C 1 217 ? 14.829  0.405   6.442   1.00 42.83  ? 212 LYS C N   1 
ATOM   6591  C CA  . LYS C 1 217 ? 13.437  0.032   6.240   1.00 44.50  ? 212 LYS C CA  1 
ATOM   6592  C C   . LYS C 1 217 ? 13.326  -1.349  5.586   1.00 45.66  ? 212 LYS C C   1 
ATOM   6593  O O   . LYS C 1 217 ? 12.265  -1.723  5.089   1.00 44.62  ? 212 LYS C O   1 
ATOM   6594  C CB  . LYS C 1 217 ? 12.763  1.059   5.335   1.00 42.03  ? 212 LYS C CB  1 
ATOM   6595  C CG  . LYS C 1 217 ? 13.391  1.109   3.953   1.00 43.47  ? 212 LYS C CG  1 
ATOM   6596  C CD  . LYS C 1 217 ? 12.786  2.179   3.050   1.00 44.16  ? 212 LYS C CD  1 
ATOM   6597  C CE  . LYS C 1 217 ? 13.531  2.236   1.713   1.00 44.87  ? 212 LYS C CE  1 
ATOM   6598  N NZ  . LYS C 1 217 ? 13.073  3.341   0.812   1.00 46.43  ? 212 LYS C NZ  1 
ATOM   6599  N N   . TYR C 1 218 ? 14.406  -2.119  5.600   1.00 48.06  ? 213 TYR C N   1 
ATOM   6600  C CA  . TYR C 1 218 ? 14.369  -3.412  4.943   1.00 49.79  ? 213 TYR C CA  1 
ATOM   6601  C C   . TYR C 1 218 ? 14.306  -4.700  5.746   1.00 51.48  ? 213 TYR C C   1 
ATOM   6602  O O   . TYR C 1 218 ? 13.738  -5.665  5.232   1.00 53.28  ? 213 TYR C O   1 
ATOM   6603  C CB  . TYR C 1 218 ? 15.518  -3.518  3.935   1.00 50.57  ? 213 TYR C CB  1 
ATOM   6604  C CG  . TYR C 1 218 ? 15.417  -2.536  2.793   1.00 50.31  ? 213 TYR C CG  1 
ATOM   6605  C CD1 . TYR C 1 218 ? 16.233  -1.405  2.740   1.00 51.04  ? 213 TYR C CD1 1 
ATOM   6606  C CD2 . TYR C 1 218 ? 14.490  -2.727  1.771   1.00 52.38  ? 213 TYR C CD2 1 
ATOM   6607  C CE1 . TYR C 1 218 ? 16.132  -0.483  1.694   1.00 51.52  ? 213 TYR C CE1 1 
ATOM   6608  C CE2 . TYR C 1 218 ? 14.373  -1.813  0.720   1.00 52.73  ? 213 TYR C CE2 1 
ATOM   6609  C CZ  . TYR C 1 218 ? 15.196  -0.693  0.686   1.00 53.01  ? 213 TYR C CZ  1 
ATOM   6610  O OH  . TYR C 1 218 ? 15.076  0.206   -0.355  1.00 52.08  ? 213 TYR C OH  1 
ATOM   6611  N N   . MET C 1 219 ? 14.864  -4.773  6.962   1.00 52.09  ? 214 MET C N   1 
ATOM   6612  C CA  . MET C 1 219 ? 14.762  -6.057  7.674   1.00 52.72  ? 214 MET C CA  1 
ATOM   6613  C C   . MET C 1 219 ? 13.523  -6.162  8.536   1.00 54.71  ? 214 MET C C   1 
ATOM   6614  O O   . MET C 1 219 ? 12.781  -5.189  8.712   1.00 53.70  ? 214 MET C O   1 
ATOM   6615  C CB  . MET C 1 219 ? 16.005  -6.398  8.523   1.00 48.98  ? 214 MET C CB  1 
ATOM   6616  C CG  . MET C 1 219 ? 15.992  -7.868  9.127   1.00 38.36  ? 214 MET C CG  1 
ATOM   6617  S SD  . MET C 1 219 ? 16.028  -9.276  7.942   1.00 27.20  ? 214 MET C SD  1 
ATOM   6618  C CE  . MET C 1 219 ? 14.618  -10.156 8.278   1.00 23.75  ? 214 MET C CE  1 
ATOM   6619  N N   . ASN C 1 220 ? 13.323  -7.363  9.072   1.00 57.38  ? 215 ASN C N   1 
ATOM   6620  C CA  . ASN C 1 220 ? 12.162  -7.670  9.873   1.00 59.46  ? 215 ASN C CA  1 
ATOM   6621  C C   . ASN C 1 220 ? 11.065  -7.492  8.836   1.00 59.62  ? 215 ASN C C   1 
ATOM   6622  O O   . ASN C 1 220 ? 10.095  -6.770  9.050   1.00 61.13  ? 215 ASN C O   1 
ATOM   6623  C CB  . ASN C 1 220 ? 12.000  -6.671  11.015  1.00 61.10  ? 215 ASN C CB  1 
ATOM   6624  C CG  . ASN C 1 220 ? 11.009  -7.145  12.045  1.00 64.90  ? 215 ASN C CG  1 
ATOM   6625  O OD1 . ASN C 1 220 ? 11.208  -8.185  12.670  1.00 67.27  ? 215 ASN C OD1 1 
ATOM   6626  N ND2 . ASN C 1 220 ? 9.927   -6.396  12.225  1.00 68.16  ? 215 ASN C ND2 1 
ATOM   6627  N N   . GLY C 1 221 ? 11.251  -8.154  7.695   1.00 59.17  ? 216 GLY C N   1 
ATOM   6628  C CA  . GLY C 1 221 ? 10.302  -8.039  6.606   1.00 57.35  ? 216 GLY C CA  1 
ATOM   6629  C C   . GLY C 1 221 ? 10.547  -6.649  6.073   1.00 56.69  ? 216 GLY C C   1 
ATOM   6630  O O   . GLY C 1 221 ? 11.586  -6.061  6.362   1.00 56.04  ? 216 GLY C O   1 
ATOM   6631  N N   . HIS C 1 222 ? 9.620   -6.104  5.302   1.00 55.86  ? 217 HIS C N   1 
ATOM   6632  C CA  . HIS C 1 222 ? 9.832   -4.758  4.803   1.00 54.73  ? 217 HIS C CA  1 
ATOM   6633  C C   . HIS C 1 222 ? 9.188   -3.816  5.824   1.00 54.24  ? 217 HIS C C   1 
ATOM   6634  O O   . HIS C 1 222 ? 8.309   -3.025  5.495   1.00 53.74  ? 217 HIS C O   1 
ATOM   6635  C CB  . HIS C 1 222 ? 9.204   -4.591  3.413   1.00 54.38  ? 217 HIS C CB  1 
ATOM   6636  C CG  . HIS C 1 222 ? 9.790   -3.462  2.617   1.00 54.03  ? 217 HIS C CG  1 
ATOM   6637  N ND1 . HIS C 1 222 ? 9.712   -2.144  3.019   1.00 52.96  ? 217 HIS C ND1 1 
ATOM   6638  C CD2 . HIS C 1 222 ? 10.468  -3.457  1.445   1.00 53.22  ? 217 HIS C CD2 1 
ATOM   6639  C CE1 . HIS C 1 222 ? 10.315  -1.376  2.130   1.00 51.60  ? 217 HIS C CE1 1 
ATOM   6640  N NE2 . HIS C 1 222 ? 10.783  -2.148  1.165   1.00 53.70  ? 217 HIS C NE2 1 
ATOM   6641  N N   . SER C 1 223 ? 9.620   -3.945  7.076   1.00 53.86  ? 218 SER C N   1 
ATOM   6642  C CA  . SER C 1 223 ? 9.124   -3.119  8.176   1.00 53.96  ? 218 SER C CA  1 
ATOM   6643  C C   . SER C 1 223 ? 9.790   -1.769  7.962   1.00 53.06  ? 218 SER C C   1 
ATOM   6644  O O   . SER C 1 223 ? 11.013  -1.672  8.032   1.00 55.56  ? 218 SER C O   1 
ATOM   6645  C CB  . SER C 1 223 ? 9.565   -3.722  9.508   1.00 54.49  ? 218 SER C CB  1 
ATOM   6646  O OG  . SER C 1 223 ? 8.869   -3.136  10.588  1.00 58.93  ? 218 SER C OG  1 
ATOM   6647  N N   . ASP C 1 224 ? 9.006   -0.730  7.706   1.00 49.62  ? 219 ASP C N   1 
ATOM   6648  C CA  . ASP C 1 224 ? 9.594   0.569   7.423   1.00 47.97  ? 219 ASP C CA  1 
ATOM   6649  C C   . ASP C 1 224 ? 10.105  1.358   8.615   1.00 46.52  ? 219 ASP C C   1 
ATOM   6650  O O   . ASP C 1 224 ? 9.788   2.538   8.789   1.00 46.44  ? 219 ASP C O   1 
ATOM   6651  C CB  . ASP C 1 224 ? 8.620   1.412   6.615   1.00 49.94  ? 219 ASP C CB  1 
ATOM   6652  C CG  . ASP C 1 224 ? 8.255   0.761   5.303   1.00 51.33  ? 219 ASP C CG  1 
ATOM   6653  O OD1 . ASP C 1 224 ? 7.332   -0.079  5.306   1.00 54.07  ? 219 ASP C OD1 1 
ATOM   6654  O OD2 . ASP C 1 224 ? 8.895   1.071   4.271   1.00 53.19  ? 219 ASP C OD2 1 
ATOM   6655  N N   . VAL C 1 225 ? 10.927  0.692   9.416   1.00 42.65  ? 220 VAL C N   1 
ATOM   6656  C CA  . VAL C 1 225 ? 11.524  1.285   10.592  1.00 38.60  ? 220 VAL C CA  1 
ATOM   6657  C C   . VAL C 1 225 ? 12.983  1.612   10.320  1.00 39.24  ? 220 VAL C C   1 
ATOM   6658  O O   . VAL C 1 225 ? 13.761  0.750   9.914   1.00 38.00  ? 220 VAL C O   1 
ATOM   6659  C CB  . VAL C 1 225 ? 11.448  0.317   11.779  1.00 37.73  ? 220 VAL C CB  1 
ATOM   6660  C CG1 . VAL C 1 225 ? 12.332  0.804   12.918  1.00 33.92  ? 220 VAL C CG1 1 
ATOM   6661  C CG2 . VAL C 1 225 ? 10.005  0.179   12.225  1.00 35.96  ? 220 VAL C CG2 1 
ATOM   6662  N N   . VAL C 1 226 ? 13.344  2.871   10.527  1.00 38.67  ? 221 VAL C N   1 
ATOM   6663  C CA  . VAL C 1 226 ? 14.718  3.303   10.337  1.00 36.40  ? 221 VAL C CA  1 
ATOM   6664  C C   . VAL C 1 226 ? 15.220  3.593   11.738  1.00 36.79  ? 221 VAL C C   1 
ATOM   6665  O O   . VAL C 1 226 ? 14.454  4.046   12.601  1.00 37.39  ? 221 VAL C O   1 
ATOM   6666  C CB  . VAL C 1 226 ? 14.805  4.566   9.486   1.00 36.39  ? 221 VAL C CB  1 
ATOM   6667  C CG1 . VAL C 1 226 ? 16.258  4.931   9.257   1.00 36.11  ? 221 VAL C CG1 1 
ATOM   6668  C CG2 . VAL C 1 226 ? 14.091  4.345   8.169   1.00 35.33  ? 221 VAL C CG2 1 
ATOM   6669  N N   . MET C 1 227 ? 16.504  3.345   11.964  1.00 35.36  ? 222 MET C N   1 
ATOM   6670  C CA  . MET C 1 227 ? 17.070  3.521   13.288  1.00 33.63  ? 222 MET C CA  1 
ATOM   6671  C C   . MET C 1 227 ? 18.575  3.425   13.249  1.00 32.30  ? 222 MET C C   1 
ATOM   6672  O O   . MET C 1 227 ? 19.141  2.729   12.416  1.00 31.76  ? 222 MET C O   1 
ATOM   6673  C CB  . MET C 1 227 ? 16.544  2.416   14.209  1.00 34.25  ? 222 MET C CB  1 
ATOM   6674  C CG  . MET C 1 227 ? 16.882  2.564   15.678  1.00 34.74  ? 222 MET C CG  1 
ATOM   6675  S SD  . MET C 1 227 ? 15.724  3.677   16.483  1.00 38.07  ? 222 MET C SD  1 
ATOM   6676  C CE  . MET C 1 227 ? 14.208  2.649   16.470  1.00 32.46  ? 222 MET C CE  1 
ATOM   6677  N N   . GLY C 1 228 ? 19.206  4.122   14.180  1.00 31.07  ? 223 GLY C N   1 
ATOM   6678  C CA  . GLY C 1 228 ? 20.645  4.096   14.296  1.00 33.06  ? 223 GLY C CA  1 
ATOM   6679  C C   . GLY C 1 228 ? 20.910  3.853   15.766  1.00 34.35  ? 223 GLY C C   1 
ATOM   6680  O O   . GLY C 1 228 ? 20.539  4.682   16.592  1.00 36.56  ? 223 GLY C O   1 
ATOM   6681  N N   . LEU C 1 229 ? 21.528  2.720   16.098  1.00 33.90  ? 224 LEU C N   1 
ATOM   6682  C CA  . LEU C 1 229 ? 21.816  2.370   17.489  1.00 33.04  ? 224 LEU C CA  1 
ATOM   6683  C C   . LEU C 1 229 ? 23.308  2.451   17.788  1.00 33.35  ? 224 LEU C C   1 
ATOM   6684  O O   . LEU C 1 229 ? 24.124  1.854   17.086  1.00 32.40  ? 224 LEU C O   1 
ATOM   6685  C CB  . LEU C 1 229 ? 21.290  0.967   17.770  1.00 33.46  ? 224 LEU C CB  1 
ATOM   6686  C CG  . LEU C 1 229 ? 19.783  0.916   17.501  1.00 34.90  ? 224 LEU C CG  1 
ATOM   6687  C CD1 . LEU C 1 229 ? 19.291  -0.506  17.340  1.00 36.10  ? 224 LEU C CD1 1 
ATOM   6688  C CD2 . LEU C 1 229 ? 19.070  1.613   18.639  1.00 36.41  ? 224 LEU C CD2 1 
ATOM   6689  N N   . VAL C 1 230 ? 23.662  3.187   18.835  1.00 32.68  ? 225 VAL C N   1 
ATOM   6690  C CA  . VAL C 1 230 ? 25.062  3.361   19.192  1.00 31.84  ? 225 VAL C CA  1 
ATOM   6691  C C   . VAL C 1 230 ? 25.371  2.851   20.596  1.00 32.98  ? 225 VAL C C   1 
ATOM   6692  O O   . VAL C 1 230 ? 25.113  3.542   21.577  1.00 32.35  ? 225 VAL C O   1 
ATOM   6693  C CB  . VAL C 1 230 ? 25.458  4.850   19.107  1.00 31.58  ? 225 VAL C CB  1 
ATOM   6694  C CG1 . VAL C 1 230 ? 26.932  5.010   19.401  1.00 31.69  ? 225 VAL C CG1 1 
ATOM   6695  C CG2 . VAL C 1 230 ? 25.124  5.403   17.738  1.00 29.78  ? 225 VAL C CG2 1 
ATOM   6696  N N   . SER C 1 231 ? 25.936  1.648   20.678  1.00 34.10  ? 226 SER C N   1 
ATOM   6697  C CA  . SER C 1 231 ? 26.287  1.035   21.954  1.00 35.13  ? 226 SER C CA  1 
ATOM   6698  C C   . SER C 1 231 ? 27.694  1.398   22.379  1.00 36.48  ? 226 SER C C   1 
ATOM   6699  O O   . SER C 1 231 ? 28.595  1.522   21.551  1.00 36.75  ? 226 SER C O   1 
ATOM   6700  C CB  . SER C 1 231 ? 26.163  -0.478  21.869  1.00 35.23  ? 226 SER C CB  1 
ATOM   6701  O OG  . SER C 1 231 ? 24.804  -0.853  21.855  1.00 37.76  ? 226 SER C OG  1 
ATOM   6702  N N   . VAL C 1 232 ? 27.889  1.537   23.685  1.00 39.06  ? 227 VAL C N   1 
ATOM   6703  C CA  . VAL C 1 232 ? 29.190  1.930   24.209  1.00 39.42  ? 227 VAL C CA  1 
ATOM   6704  C C   . VAL C 1 232 ? 29.392  1.504   25.670  1.00 40.64  ? 227 VAL C C   1 
ATOM   6705  O O   . VAL C 1 232 ? 28.427  1.213   26.383  1.00 40.70  ? 227 VAL C O   1 
ATOM   6706  C CB  . VAL C 1 232 ? 29.337  3.476   24.056  1.00 39.18  ? 227 VAL C CB  1 
ATOM   6707  C CG1 . VAL C 1 232 ? 29.434  4.151   25.412  1.00 38.32  ? 227 VAL C CG1 1 
ATOM   6708  C CG2 . VAL C 1 232 ? 30.516  3.796   23.168  1.00 37.77  ? 227 VAL C CG2 1 
ATOM   6709  N N   . ASN C 1 233 ? 30.652  1.454   26.103  1.00 42.37  ? 228 ASN C N   1 
ATOM   6710  C CA  . ASN C 1 233 ? 30.987  1.089   27.485  1.00 43.19  ? 228 ASN C CA  1 
ATOM   6711  C C   . ASN C 1 233 ? 31.576  2.253   28.273  1.00 45.29  ? 228 ASN C C   1 
ATOM   6712  O O   . ASN C 1 233 ? 31.208  2.479   29.424  1.00 46.23  ? 228 ASN C O   1 
ATOM   6713  C CB  . ASN C 1 233 ? 31.993  -0.053  27.526  1.00 39.24  ? 228 ASN C CB  1 
ATOM   6714  C CG  . ASN C 1 233 ? 31.393  -1.363  27.124  1.00 39.73  ? 228 ASN C CG  1 
ATOM   6715  O OD1 . ASN C 1 233 ? 30.296  -1.719  27.562  1.00 39.92  ? 228 ASN C OD1 1 
ATOM   6716  N ND2 . ASN C 1 233 ? 32.113  -2.111  26.294  1.00 39.63  ? 228 ASN C ND2 1 
ATOM   6717  N N   . CYS C 1 234 ? 32.497  2.980   27.649  1.00 48.50  ? 229 CYS C N   1 
ATOM   6718  C CA  . CYS C 1 234 ? 33.152  4.103   28.303  1.00 52.11  ? 229 CYS C CA  1 
ATOM   6719  C C   . CYS C 1 234 ? 32.157  5.094   28.869  1.00 53.39  ? 229 CYS C C   1 
ATOM   6720  O O   . CYS C 1 234 ? 31.223  5.504   28.193  1.00 52.68  ? 229 CYS C O   1 
ATOM   6721  C CB  . CYS C 1 234 ? 34.082  4.829   27.336  1.00 53.10  ? 229 CYS C CB  1 
ATOM   6722  S SG  . CYS C 1 234 ? 34.994  6.165   28.132  1.00 59.25  ? 229 CYS C SG  1 
ATOM   6723  N N   . GLU C 1 235 ? 32.393  5.486   30.114  1.00 56.59  ? 230 GLU C N   1 
ATOM   6724  C CA  . GLU C 1 235 ? 31.536  6.419   30.825  1.00 60.17  ? 230 GLU C CA  1 
ATOM   6725  C C   . GLU C 1 235 ? 31.391  7.794   30.168  1.00 59.94  ? 230 GLU C C   1 
ATOM   6726  O O   . GLU C 1 235 ? 30.285  8.210   29.834  1.00 59.93  ? 230 GLU C O   1 
ATOM   6727  C CB  . GLU C 1 235 ? 32.052  6.596   32.252  1.00 64.27  ? 230 GLU C CB  1 
ATOM   6728  C CG  . GLU C 1 235 ? 31.001  7.101   33.209  1.00 69.89  ? 230 GLU C CG  1 
ATOM   6729  C CD  . GLU C 1 235 ? 29.870  6.115   33.354  1.00 72.90  ? 230 GLU C CD  1 
ATOM   6730  O OE1 . GLU C 1 235 ? 28.818  6.494   33.909  1.00 76.48  ? 230 GLU C OE1 1 
ATOM   6731  O OE2 . GLU C 1 235 ? 30.039  4.956   32.912  1.00 74.19  ? 230 GLU C OE2 1 
ATOM   6732  N N   . SER C 1 236 ? 32.497  8.508   29.990  1.00 59.48  ? 231 SER C N   1 
ATOM   6733  C CA  . SER C 1 236 ? 32.421  9.834   29.387  1.00 58.43  ? 231 SER C CA  1 
ATOM   6734  C C   . SER C 1 236 ? 32.014  9.763   27.919  1.00 56.17  ? 231 SER C C   1 
ATOM   6735  O O   . SER C 1 236 ? 31.394  10.689  27.400  1.00 57.09  ? 231 SER C O   1 
ATOM   6736  C CB  . SER C 1 236 ? 33.758  10.568  29.526  1.00 60.75  ? 231 SER C CB  1 
ATOM   6737  O OG  . SER C 1 236 ? 34.779  9.912   28.798  1.00 65.69  ? 231 SER C OG  1 
ATOM   6738  N N   . LEU C 1 237 ? 32.362  8.668   27.247  1.00 53.13  ? 232 LEU C N   1 
ATOM   6739  C CA  . LEU C 1 237 ? 32.000  8.501   25.841  1.00 48.55  ? 232 LEU C CA  1 
ATOM   6740  C C   . LEU C 1 237 ? 30.474  8.516   25.767  1.00 48.13  ? 232 LEU C C   1 
ATOM   6741  O O   . LEU C 1 237 ? 29.885  9.185   24.921  1.00 46.97  ? 232 LEU C O   1 
ATOM   6742  C CB  . LEU C 1 237 ? 32.551  7.173   25.314  1.00 45.77  ? 232 LEU C CB  1 
ATOM   6743  C CG  . LEU C 1 237 ? 32.622  6.974   23.801  1.00 43.94  ? 232 LEU C CG  1 
ATOM   6744  C CD1 . LEU C 1 237 ? 33.239  8.202   23.139  1.00 43.47  ? 232 LEU C CD1 1 
ATOM   6745  C CD2 . LEU C 1 237 ? 33.446  5.728   23.495  1.00 42.23  ? 232 LEU C CD2 1 
ATOM   6746  N N   . HIS C 1 238 ? 29.845  7.785   26.686  1.00 47.85  ? 233 HIS C N   1 
ATOM   6747  C CA  . HIS C 1 238 ? 28.393  7.698   26.777  1.00 46.16  ? 233 HIS C CA  1 
ATOM   6748  C C   . HIS C 1 238 ? 27.733  9.023   27.146  1.00 47.49  ? 233 HIS C C   1 
ATOM   6749  O O   . HIS C 1 238 ? 26.712  9.383   26.566  1.00 48.25  ? 233 HIS C O   1 
ATOM   6750  C CB  . HIS C 1 238 ? 28.004  6.635   27.805  1.00 44.93  ? 233 HIS C CB  1 
ATOM   6751  C CG  . HIS C 1 238 ? 26.575  6.706   28.242  1.00 44.30  ? 233 HIS C CG  1 
ATOM   6752  N ND1 . HIS C 1 238 ? 25.520  6.664   27.355  1.00 44.89  ? 233 HIS C ND1 1 
ATOM   6753  C CD2 . HIS C 1 238 ? 26.023  6.816   29.474  1.00 44.25  ? 233 HIS C CD2 1 
ATOM   6754  C CE1 . HIS C 1 238 ? 24.382  6.747   28.020  1.00 44.17  ? 233 HIS C CE1 1 
ATOM   6755  N NE2 . HIS C 1 238 ? 24.659  6.839   29.308  1.00 43.45  ? 233 HIS C NE2 1 
ATOM   6756  N N   . ASN C 1 239 ? 28.306  9.740   28.114  1.00 49.42  ? 234 ASN C N   1 
ATOM   6757  C CA  . ASN C 1 239 ? 27.749  11.020  28.556  1.00 50.40  ? 234 ASN C CA  1 
ATOM   6758  C C   . ASN C 1 239 ? 27.776  12.073  27.463  1.00 49.29  ? 234 ASN C C   1 
ATOM   6759  O O   . ASN C 1 239 ? 26.834  12.839  27.320  1.00 50.08  ? 234 ASN C O   1 
ATOM   6760  C CB  . ASN C 1 239 ? 28.500  11.568  29.772  1.00 54.25  ? 234 ASN C CB  1 
ATOM   6761  C CG  . ASN C 1 239 ? 28.241  10.770  31.036  1.00 57.43  ? 234 ASN C CG  1 
ATOM   6762  O OD1 . ASN C 1 239 ? 27.099  10.407  31.335  1.00 58.61  ? 234 ASN C OD1 1 
ATOM   6763  N ND2 . ASN C 1 239 ? 29.302  10.510  31.799  1.00 59.65  ? 234 ASN C ND2 1 
ATOM   6764  N N   . ARG C 1 240 ? 28.861  12.120  26.703  1.00 47.24  ? 235 ARG C N   1 
ATOM   6765  C CA  . ARG C 1 240 ? 28.975  13.095  25.627  1.00 47.03  ? 235 ARG C CA  1 
ATOM   6766  C C   . ARG C 1 240 ? 27.957  12.770  24.541  1.00 47.22  ? 235 ARG C C   1 
ATOM   6767  O O   . ARG C 1 240 ? 27.322  13.664  23.973  1.00 47.55  ? 235 ARG C O   1 
ATOM   6768  C CB  . ARG C 1 240 ? 30.390  13.070  25.041  1.00 46.64  ? 235 ARG C CB  1 
ATOM   6769  C CG  . ARG C 1 240 ? 31.478  13.485  26.026  1.00 46.58  ? 235 ARG C CG  1 
ATOM   6770  C CD  . ARG C 1 240 ? 32.849  12.963  25.616  1.00 47.39  ? 235 ARG C CD  1 
ATOM   6771  N NE  . ARG C 1 240 ? 33.307  13.505  24.340  1.00 49.43  ? 235 ARG C NE  1 
ATOM   6772  C CZ  . ARG C 1 240 ? 34.438  13.144  23.739  1.00 50.48  ? 235 ARG C CZ  1 
ATOM   6773  N NH1 . ARG C 1 240 ? 35.229  12.233  24.302  1.00 51.84  ? 235 ARG C NH1 1 
ATOM   6774  N NH2 . ARG C 1 240 ? 34.781  13.695  22.579  1.00 50.34  ? 235 ARG C NH2 1 
ATOM   6775  N N   . LEU C 1 241 ? 27.805  11.477  24.271  1.00 45.80  ? 236 LEU C N   1 
ATOM   6776  C CA  . LEU C 1 241 ? 26.885  10.986  23.255  1.00 44.30  ? 236 LEU C CA  1 
ATOM   6777  C C   . LEU C 1 241 ? 25.436  11.262  23.639  1.00 45.41  ? 236 LEU C C   1 
ATOM   6778  O O   . LEU C 1 241 ? 24.611  11.570  22.781  1.00 45.90  ? 236 LEU C O   1 
ATOM   6779  C CB  . LEU C 1 241 ? 27.108  9.485   23.057  1.00 41.06  ? 236 LEU C CB  1 
ATOM   6780  C CG  . LEU C 1 241 ? 27.702  8.947   21.747  1.00 37.81  ? 236 LEU C CG  1 
ATOM   6781  C CD1 . LEU C 1 241 ? 28.462  10.008  20.988  1.00 34.97  ? 236 LEU C CD1 1 
ATOM   6782  C CD2 . LEU C 1 241 ? 28.599  7.776   22.078  1.00 35.64  ? 236 LEU C CD2 1 
ATOM   6783  N N   . ARG C 1 242 ? 25.139  11.152  24.932  1.00 47.44  ? 237 ARG C N   1 
ATOM   6784  C CA  . ARG C 1 242 ? 23.790  11.392  25.460  1.00 49.19  ? 237 ARG C CA  1 
ATOM   6785  C C   . ARG C 1 242 ? 23.449  12.881  25.358  1.00 46.09  ? 237 ARG C C   1 
ATOM   6786  O O   . ARG C 1 242 ? 22.335  13.240  24.992  1.00 46.15  ? 237 ARG C O   1 
ATOM   6787  C CB  . ARG C 1 242 ? 23.699  10.931  26.931  1.00 54.29  ? 237 ARG C CB  1 
ATOM   6788  C CG  . ARG C 1 242 ? 22.280  10.840  27.526  1.00 61.76  ? 237 ARG C CG  1 
ATOM   6789  C CD  . ARG C 1 242 ? 21.419  9.773   26.811  1.00 71.83  ? 237 ARG C CD  1 
ATOM   6790  N NE  . ARG C 1 242 ? 20.068  9.623   27.374  1.00 76.86  ? 237 ARG C NE  1 
ATOM   6791  C CZ  . ARG C 1 242 ? 19.108  8.855   26.853  1.00 77.80  ? 237 ARG C CZ  1 
ATOM   6792  N NH1 . ARG C 1 242 ? 19.331  8.154   25.747  1.00 78.29  ? 237 ARG C NH1 1 
ATOM   6793  N NH2 . ARG C 1 242 ? 17.918  8.789   27.439  1.00 78.29  ? 237 ARG C NH2 1 
ATOM   6794  N N   . PHE C 1 243 ? 24.411  13.741  25.679  1.00 43.58  ? 238 PHE C N   1 
ATOM   6795  C CA  . PHE C 1 243 ? 24.199  15.181  25.614  1.00 41.91  ? 238 PHE C CA  1 
ATOM   6796  C C   . PHE C 1 243 ? 23.891  15.573  24.180  1.00 41.05  ? 238 PHE C C   1 
ATOM   6797  O O   . PHE C 1 243 ? 22.984  16.369  23.920  1.00 39.37  ? 238 PHE C O   1 
ATOM   6798  C CB  . PHE C 1 243 ? 25.445  15.940  26.081  1.00 42.69  ? 238 PHE C CB  1 
ATOM   6799  C CG  . PHE C 1 243 ? 25.321  17.442  25.962  1.00 44.26  ? 238 PHE C CG  1 
ATOM   6800  C CD1 . PHE C 1 243 ? 24.462  18.152  26.797  1.00 43.35  ? 238 PHE C CD1 1 
ATOM   6801  C CD2 . PHE C 1 243 ? 26.034  18.138  24.988  1.00 44.44  ? 238 PHE C CD2 1 
ATOM   6802  C CE1 . PHE C 1 243 ? 24.315  19.526  26.667  1.00 43.35  ? 238 PHE C CE1 1 
ATOM   6803  C CE2 . PHE C 1 243 ? 25.891  19.515  24.850  1.00 44.91  ? 238 PHE C CE2 1 
ATOM   6804  C CZ  . PHE C 1 243 ? 25.027  20.210  25.693  1.00 44.91  ? 238 PHE C CZ  1 
ATOM   6805  N N   . LEU C 1 244 ? 24.670  15.017  23.255  1.00 40.42  ? 239 LEU C N   1 
ATOM   6806  C CA  . LEU C 1 244 ? 24.486  15.285  21.837  1.00 40.09  ? 239 LEU C CA  1 
ATOM   6807  C C   . LEU C 1 244 ? 23.116  14.798  21.383  1.00 41.41  ? 239 LEU C C   1 
ATOM   6808  O O   . LEU C 1 244 ? 22.389  15.515  20.696  1.00 38.74  ? 239 LEU C O   1 
ATOM   6809  C CB  . LEU C 1 244 ? 25.568  14.580  21.024  1.00 38.99  ? 239 LEU C CB  1 
ATOM   6810  C CG  . LEU C 1 244 ? 26.932  15.265  20.991  1.00 37.94  ? 239 LEU C CG  1 
ATOM   6811  C CD1 . LEU C 1 244 ? 27.884  14.421  20.141  1.00 37.11  ? 239 LEU C CD1 1 
ATOM   6812  C CD2 . LEU C 1 244 ? 26.797  16.680  20.419  1.00 35.92  ? 239 LEU C CD2 1 
ATOM   6813  N N   . GLN C 1 245 ? 22.780  13.574  21.780  1.00 42.58  ? 240 GLN C N   1 
ATOM   6814  C CA  . GLN C 1 245 ? 21.505  12.965  21.431  1.00 44.19  ? 240 GLN C CA  1 
ATOM   6815  C C   . GLN C 1 245 ? 20.342  13.877  21.777  1.00 47.56  ? 240 GLN C C   1 
ATOM   6816  O O   . GLN C 1 245 ? 19.490  14.150  20.935  1.00 49.37  ? 240 GLN C O   1 
ATOM   6817  C CB  . GLN C 1 245 ? 21.324  11.632  22.166  1.00 42.15  ? 240 GLN C CB  1 
ATOM   6818  C CG  . GLN C 1 245 ? 20.100  10.835  21.731  1.00 37.38  ? 240 GLN C CG  1 
ATOM   6819  C CD  . GLN C 1 245 ? 19.836  9.629   22.613  1.00 37.01  ? 240 GLN C CD  1 
ATOM   6820  O OE1 . GLN C 1 245 ? 19.056  8.745   22.263  1.00 36.15  ? 240 GLN C OE1 1 
ATOM   6821  N NE2 . GLN C 1 245 ? 20.480  9.591   23.771  1.00 38.67  ? 240 GLN C NE2 1 
ATOM   6822  N N   . ASN C 1 246 ? 20.312  14.356  23.014  1.00 50.51  ? 241 ASN C N   1 
ATOM   6823  C CA  . ASN C 1 246 ? 19.222  15.214  23.457  1.00 53.20  ? 241 ASN C CA  1 
ATOM   6824  C C   . ASN C 1 246 ? 19.295  16.665  22.990  1.00 52.04  ? 241 ASN C C   1 
ATOM   6825  O O   . ASN C 1 246 ? 18.268  17.268  22.681  1.00 53.75  ? 241 ASN C O   1 
ATOM   6826  C CB  . ASN C 1 246 ? 19.115  15.176  24.986  1.00 57.39  ? 241 ASN C CB  1 
ATOM   6827  C CG  . ASN C 1 246 ? 18.946  13.766  25.526  1.00 61.70  ? 241 ASN C CG  1 
ATOM   6828  O OD1 . ASN C 1 246 ? 18.113  12.993  25.044  1.00 64.26  ? 241 ASN C OD1 1 
ATOM   6829  N ND2 . ASN C 1 246 ? 19.733  13.427  26.540  1.00 63.86  ? 241 ASN C ND2 1 
ATOM   6830  N N   . SER C 1 247 ? 20.495  17.230  22.927  1.00 49.98  ? 242 SER C N   1 
ATOM   6831  C CA  . SER C 1 247 ? 20.630  18.622  22.521  1.00 47.80  ? 242 SER C CA  1 
ATOM   6832  C C   . SER C 1 247 ? 20.449  18.917  21.032  1.00 45.88  ? 242 SER C C   1 
ATOM   6833  O O   . SER C 1 247 ? 20.159  20.057  20.671  1.00 45.91  ? 242 SER C O   1 
ATOM   6834  C CB  . SER C 1 247 ? 21.981  19.188  23.004  1.00 49.90  ? 242 SER C CB  1 
ATOM   6835  O OG  . SER C 1 247 ? 23.090  18.430  22.541  1.00 49.47  ? 242 SER C OG  1 
ATOM   6836  N N   . LEU C 1 248 ? 20.598  17.906  20.172  1.00 43.39  ? 243 LEU C N   1 
ATOM   6837  C CA  . LEU C 1 248 ? 20.472  18.104  18.724  1.00 39.95  ? 243 LEU C CA  1 
ATOM   6838  C C   . LEU C 1 248 ? 19.202  17.554  18.062  1.00 40.65  ? 243 LEU C C   1 
ATOM   6839  O O   . LEU C 1 248 ? 18.907  17.883  16.902  1.00 40.29  ? 243 LEU C O   1 
ATOM   6840  C CB  . LEU C 1 248 ? 21.710  17.550  18.028  1.00 36.37  ? 243 LEU C CB  1 
ATOM   6841  C CG  . LEU C 1 248 ? 22.981  18.274  18.470  1.00 33.00  ? 243 LEU C CG  1 
ATOM   6842  C CD1 . LEU C 1 248 ? 24.197  17.671  17.791  1.00 32.34  ? 243 LEU C CD1 1 
ATOM   6843  C CD2 . LEU C 1 248 ? 22.852  19.749  18.145  1.00 29.20  ? 243 LEU C CD2 1 
ATOM   6844  N N   . GLY C 1 249 ? 18.466  16.713  18.792  1.00 40.05  ? 244 GLY C N   1 
ATOM   6845  C CA  . GLY C 1 249 ? 17.206  16.173  18.299  1.00 37.40  ? 244 GLY C CA  1 
ATOM   6846  C C   . GLY C 1 249 ? 17.146  15.151  17.177  1.00 36.71  ? 244 GLY C C   1 
ATOM   6847  O O   . GLY C 1 249 ? 16.070  14.913  16.642  1.00 36.99  ? 244 GLY C O   1 
ATOM   6848  N N   . ALA C 1 250 ? 18.263  14.539  16.804  1.00 35.96  ? 245 ALA C N   1 
ATOM   6849  C CA  . ALA C 1 250 ? 18.232  13.535  15.739  1.00 36.05  ? 245 ALA C CA  1 
ATOM   6850  C C   . ALA C 1 250 ? 17.834  12.186  16.351  1.00 36.19  ? 245 ALA C C   1 
ATOM   6851  O O   . ALA C 1 250 ? 18.578  11.206  16.271  1.00 37.83  ? 245 ALA C O   1 
ATOM   6852  C CB  . ALA C 1 250 ? 19.602  13.441  15.080  1.00 35.71  ? 245 ALA C CB  1 
ATOM   6853  N N   . VAL C 1 251 ? 16.636  12.144  16.927  1.00 35.50  ? 246 VAL C N   1 
ATOM   6854  C CA  . VAL C 1 251 ? 16.127  10.971  17.632  1.00 34.90  ? 246 VAL C CA  1 
ATOM   6855  C C   . VAL C 1 251 ? 14.950  10.240  16.938  1.00 33.70  ? 246 VAL C C   1 
ATOM   6856  O O   . VAL C 1 251 ? 14.274  10.825  16.093  1.00 34.74  ? 246 VAL C O   1 
ATOM   6857  C CB  . VAL C 1 251 ? 15.752  11.453  19.060  1.00 37.11  ? 246 VAL C CB  1 
ATOM   6858  C CG1 . VAL C 1 251 ? 15.110  10.359  19.880  1.00 41.70  ? 246 VAL C CG1 1 
ATOM   6859  C CG2 . VAL C 1 251 ? 17.010  11.958  19.757  1.00 36.36  ? 246 VAL C CG2 1 
ATOM   6860  N N   . PRO C 1 252 ? 14.710  8.942   17.265  1.00 32.78  ? 247 PRO C N   1 
ATOM   6861  C CA  . PRO C 1 252 ? 13.603  8.194   16.647  1.00 32.08  ? 247 PRO C CA  1 
ATOM   6862  C C   . PRO C 1 252 ? 12.283  8.576   17.289  1.00 32.59  ? 247 PRO C C   1 
ATOM   6863  O O   . PRO C 1 252 ? 12.259  9.141   18.378  1.00 33.67  ? 247 PRO C O   1 
ATOM   6864  C CB  . PRO C 1 252 ? 13.911  6.735   16.978  1.00 31.42  ? 247 PRO C CB  1 
ATOM   6865  C CG  . PRO C 1 252 ? 15.284  6.730   17.552  1.00 33.02  ? 247 PRO C CG  1 
ATOM   6866  C CD  . PRO C 1 252 ? 15.465  8.065   18.176  1.00 32.43  ? 247 PRO C CD  1 
ATOM   6867  N N   . SER C 1 253 ? 11.178  8.254   16.639  1.00 32.58  ? 248 SER C N   1 
ATOM   6868  C CA  . SER C 1 253 ? 9.890   8.547   17.243  1.00 33.87  ? 248 SER C CA  1 
ATOM   6869  C C   . SER C 1 253 ? 9.591   7.380   18.176  1.00 33.06  ? 248 SER C C   1 
ATOM   6870  O O   . SER C 1 253 ? 10.217  6.336   18.095  1.00 32.24  ? 248 SER C O   1 
ATOM   6871  C CB  . SER C 1 253 ? 8.788   8.609   16.194  1.00 34.11  ? 248 SER C CB  1 
ATOM   6872  O OG  . SER C 1 253 ? 8.367   7.295   15.866  1.00 35.50  ? 248 SER C OG  1 
ATOM   6873  N N   . PRO C 1 254 ? 8.631   7.546   19.083  1.00 34.27  ? 249 PRO C N   1 
ATOM   6874  C CA  . PRO C 1 254 ? 8.306   6.449   19.993  1.00 35.23  ? 249 PRO C CA  1 
ATOM   6875  C C   . PRO C 1 254 ? 7.868   5.190   19.231  1.00 36.23  ? 249 PRO C C   1 
ATOM   6876  O O   . PRO C 1 254 ? 8.143   4.066   19.653  1.00 36.40  ? 249 PRO C O   1 
ATOM   6877  C CB  . PRO C 1 254 ? 7.176   7.033   20.836  1.00 36.13  ? 249 PRO C CB  1 
ATOM   6878  C CG  . PRO C 1 254 ? 7.537   8.479   20.908  1.00 36.16  ? 249 PRO C CG  1 
ATOM   6879  C CD  . PRO C 1 254 ? 7.945   8.786   19.486  1.00 35.17  ? 249 PRO C CD  1 
ATOM   6880  N N   . ILE C 1 255 ? 7.181   5.372   18.110  1.00 36.53  ? 250 ILE C N   1 
ATOM   6881  C CA  . ILE C 1 255 ? 6.733   4.222   17.340  1.00 37.30  ? 250 ILE C CA  1 
ATOM   6882  C C   . ILE C 1 255 ? 7.883   3.440   16.708  1.00 39.48  ? 250 ILE C C   1 
ATOM   6883  O O   . ILE C 1 255 ? 7.837   2.213   16.664  1.00 39.63  ? 250 ILE C O   1 
ATOM   6884  C CB  . ILE C 1 255 ? 5.724   4.638   16.275  1.00 35.22  ? 250 ILE C CB  1 
ATOM   6885  C CG1 . ILE C 1 255 ? 4.523   5.259   16.977  1.00 34.43  ? 250 ILE C CG1 1 
ATOM   6886  C CG2 . ILE C 1 255 ? 5.275   3.425   15.462  1.00 34.30  ? 250 ILE C CG2 1 
ATOM   6887  C CD1 . ILE C 1 255 ? 3.334   5.465   16.096  1.00 35.45  ? 250 ILE C CD1 1 
ATOM   6888  N N   . ASP C 1 256 ? 8.906   4.137   16.221  1.00 39.44  ? 251 ASP C N   1 
ATOM   6889  C CA  . ASP C 1 256 ? 10.062  3.460   15.645  1.00 41.36  ? 251 ASP C CA  1 
ATOM   6890  C C   . ASP C 1 256 ? 10.745  2.606   16.724  1.00 41.74  ? 251 ASP C C   1 
ATOM   6891  O O   . ASP C 1 256 ? 11.145  1.462   16.478  1.00 41.49  ? 251 ASP C O   1 
ATOM   6892  C CB  . ASP C 1 256 ? 11.085  4.470   15.128  1.00 46.37  ? 251 ASP C CB  1 
ATOM   6893  C CG  . ASP C 1 256 ? 10.568  5.280   13.982  1.00 51.41  ? 251 ASP C CG  1 
ATOM   6894  O OD1 . ASP C 1 256 ? 10.213  4.662   12.959  1.00 56.44  ? 251 ASP C OD1 1 
ATOM   6895  O OD2 . ASP C 1 256 ? 10.520  6.526   14.097  1.00 53.63  ? 251 ASP C OD2 1 
ATOM   6896  N N   . CYS C 1 257 ? 10.892  3.176   17.917  1.00 38.26  ? 252 CYS C N   1 
ATOM   6897  C CA  . CYS C 1 257 ? 11.538  2.468   19.011  1.00 36.29  ? 252 CYS C CA  1 
ATOM   6898  C C   . CYS C 1 257 ? 10.753  1.238   19.373  1.00 34.30  ? 252 CYS C C   1 
ATOM   6899  O O   . CYS C 1 257 ? 11.325  0.196   19.664  1.00 35.61  ? 252 CYS C O   1 
ATOM   6900  C CB  . CYS C 1 257 ? 11.664  3.365   20.237  1.00 34.94  ? 252 CYS C CB  1 
ATOM   6901  S SG  . CYS C 1 257 ? 12.705  4.794   19.962  1.00 38.00  ? 252 CYS C SG  1 
ATOM   6902  N N   . TYR C 1 258 ? 9.435   1.363   19.363  1.00 33.64  ? 253 TYR C N   1 
ATOM   6903  C CA  . TYR C 1 258 ? 8.584   0.238   19.693  1.00 33.43  ? 253 TYR C CA  1 
ATOM   6904  C C   . TYR C 1 258 ? 8.692   -0.839  18.623  1.00 32.53  ? 253 TYR C C   1 
ATOM   6905  O O   . TYR C 1 258 ? 8.839   -2.020  18.921  1.00 33.27  ? 253 TYR C O   1 
ATOM   6906  C CB  . TYR C 1 258 ? 7.129   0.675   19.804  1.00 34.47  ? 253 TYR C CB  1 
ATOM   6907  C CG  . TYR C 1 258 ? 6.223   -0.494  20.048  1.00 36.43  ? 253 TYR C CG  1 
ATOM   6908  C CD1 . TYR C 1 258 ? 6.268   -1.187  21.254  1.00 38.93  ? 253 TYR C CD1 1 
ATOM   6909  C CD2 . TYR C 1 258 ? 5.373   -0.961  19.048  1.00 38.49  ? 253 TYR C CD2 1 
ATOM   6910  C CE1 . TYR C 1 258 ? 5.494   -2.324  21.460  1.00 40.35  ? 253 TYR C CE1 1 
ATOM   6911  C CE2 . TYR C 1 258 ? 4.593   -2.098  19.241  1.00 39.98  ? 253 TYR C CE2 1 
ATOM   6912  C CZ  . TYR C 1 258 ? 4.661   -2.774  20.449  1.00 41.06  ? 253 TYR C CZ  1 
ATOM   6913  O OH  . TYR C 1 258 ? 3.909   -3.911  20.645  1.00 45.37  ? 253 TYR C OH  1 
ATOM   6914  N N   . LEU C 1 259 ? 8.606   -0.425  17.368  1.00 31.66  ? 254 LEU C N   1 
ATOM   6915  C CA  . LEU C 1 259 ? 8.685   -1.356  16.260  1.00 29.21  ? 254 LEU C CA  1 
ATOM   6916  C C   . LEU C 1 259 ? 10.047  -2.039  16.218  1.00 29.55  ? 254 LEU C C   1 
ATOM   6917  O O   . LEU C 1 259 ? 10.135  -3.254  16.057  1.00 27.52  ? 254 LEU C O   1 
ATOM   6918  C CB  . LEU C 1 259 ? 8.404   -0.607  14.957  1.00 28.23  ? 254 LEU C CB  1 
ATOM   6919  C CG  . LEU C 1 259 ? 6.979   -0.703  14.398  1.00 28.50  ? 254 LEU C CG  1 
ATOM   6920  C CD1 . LEU C 1 259 ? 5.960   -0.736  15.517  1.00 27.99  ? 254 LEU C CD1 1 
ATOM   6921  C CD2 . LEU C 1 259 ? 6.729   0.462   13.452  1.00 28.62  ? 254 LEU C CD2 1 
ATOM   6922  N N   . CYS C 1 260 ? 11.104  -1.247  16.375  1.00 30.39  ? 255 CYS C N   1 
ATOM   6923  C CA  . CYS C 1 260 ? 12.472  -1.756  16.354  1.00 31.73  ? 255 CYS C CA  1 
ATOM   6924  C C   . CYS C 1 260 ? 12.731  -2.791  17.448  1.00 33.56  ? 255 CYS C C   1 
ATOM   6925  O O   . CYS C 1 260 ? 13.366  -3.822  17.221  1.00 32.99  ? 255 CYS C O   1 
ATOM   6926  C CB  . CYS C 1 260 ? 13.443  -0.595  16.510  1.00 33.30  ? 255 CYS C CB  1 
ATOM   6927  S SG  . CYS C 1 260 ? 15.155  -1.053  16.300  1.00 31.25  ? 255 CYS C SG  1 
ATOM   6928  N N   . ASN C 1 261 ? 12.244  -2.505  18.646  1.00 36.15  ? 256 ASN C N   1 
ATOM   6929  C CA  . ASN C 1 261 ? 12.406  -3.421  19.759  1.00 38.16  ? 256 ASN C CA  1 
ATOM   6930  C C   . ASN C 1 261 ? 11.642  -4.712  19.439  1.00 37.86  ? 256 ASN C C   1 
ATOM   6931  O O   . ASN C 1 261 ? 12.127  -5.814  19.705  1.00 39.67  ? 256 ASN C O   1 
ATOM   6932  C CB  . ASN C 1 261 ? 11.863  -2.782  21.042  1.00 40.34  ? 256 ASN C CB  1 
ATOM   6933  C CG  . ASN C 1 261 ? 12.216  -3.573  22.288  1.00 43.18  ? 256 ASN C CG  1 
ATOM   6934  O OD1 . ASN C 1 261 ? 11.799  -4.719  22.453  1.00 46.16  ? 256 ASN C OD1 1 
ATOM   6935  N ND2 . ASN C 1 261 ? 12.990  -2.960  23.175  1.00 46.79  ? 256 ASN C ND2 1 
ATOM   6936  N N   . ARG C 1 262 ? 10.458  -4.572  18.853  1.00 36.50  ? 257 ARG C N   1 
ATOM   6937  C CA  . ARG C 1 262 ? 9.626   -5.722  18.503  1.00 37.20  ? 257 ARG C CA  1 
ATOM   6938  C C   . ARG C 1 262 ? 10.326  -6.692  17.547  1.00 35.02  ? 257 ARG C C   1 
ATOM   6939  O O   . ARG C 1 262 ? 10.199  -7.909  17.674  1.00 32.75  ? 257 ARG C O   1 
ATOM   6940  C CB  . ARG C 1 262 ? 8.307   -5.230  17.896  1.00 42.41  ? 257 ARG C CB  1 
ATOM   6941  C CG  . ARG C 1 262 ? 7.413   -6.305  17.312  1.00 48.51  ? 257 ARG C CG  1 
ATOM   6942  C CD  . ARG C 1 262 ? 5.946   -6.002  17.610  1.00 55.99  ? 257 ARG C CD  1 
ATOM   6943  N NE  . ARG C 1 262 ? 5.372   -7.036  18.469  1.00 63.34  ? 257 ARG C NE  1 
ATOM   6944  C CZ  . ARG C 1 262 ? 4.979   -8.236  18.042  1.00 65.76  ? 257 ARG C CZ  1 
ATOM   6945  N NH1 . ARG C 1 262 ? 5.084   -8.557  16.757  1.00 67.51  ? 257 ARG C NH1 1 
ATOM   6946  N NH2 . ARG C 1 262 ? 4.506   -9.128  18.907  1.00 66.16  ? 257 ARG C NH2 1 
ATOM   6947  N N   . GLY C 1 263 ? 11.069  -6.144  16.593  1.00 34.62  ? 258 GLY C N   1 
ATOM   6948  C CA  . GLY C 1 263 ? 11.773  -6.976  15.640  1.00 32.71  ? 258 GLY C CA  1 
ATOM   6949  C C   . GLY C 1 263 ? 12.961  -7.652  16.286  1.00 32.89  ? 258 GLY C C   1 
ATOM   6950  O O   . GLY C 1 263 ? 13.340  -8.756  15.907  1.00 34.56  ? 258 GLY C O   1 
ATOM   6951  N N   . LEU C 1 264 ? 13.555  -6.985  17.267  1.00 31.79  ? 259 LEU C N   1 
ATOM   6952  C CA  . LEU C 1 264 ? 14.702  -7.533  17.969  1.00 31.05  ? 259 LEU C CA  1 
ATOM   6953  C C   . LEU C 1 264 ? 14.405  -8.917  18.537  1.00 32.25  ? 259 LEU C C   1 
ATOM   6954  O O   . LEU C 1 264 ? 15.284  -9.772  18.615  1.00 32.46  ? 259 LEU C O   1 
ATOM   6955  C CB  . LEU C 1 264 ? 15.101  -6.590  19.098  1.00 31.90  ? 259 LEU C CB  1 
ATOM   6956  C CG  . LEU C 1 264 ? 16.330  -5.682  18.938  1.00 33.56  ? 259 LEU C CG  1 
ATOM   6957  C CD1 . LEU C 1 264 ? 16.438  -5.131  17.525  1.00 32.51  ? 259 LEU C CD1 1 
ATOM   6958  C CD2 . LEU C 1 264 ? 16.234  -4.557  19.955  1.00 33.23  ? 259 LEU C CD2 1 
ATOM   6959  N N   . LYS C 1 265 ? 13.153  -9.146  18.914  1.00 33.05  ? 260 LYS C N   1 
ATOM   6960  C CA  . LYS C 1 265 ? 12.747  -10.423 19.504  1.00 31.79  ? 260 LYS C CA  1 
ATOM   6961  C C   . LYS C 1 265 ? 12.869  -11.672 18.627  1.00 30.94  ? 260 LYS C C   1 
ATOM   6962  O O   . LYS C 1 265 ? 12.902  -12.785 19.140  1.00 31.56  ? 260 LYS C O   1 
ATOM   6963  C CB  . LYS C 1 265 ? 11.321  -10.293 20.044  1.00 31.49  ? 260 LYS C CB  1 
ATOM   6964  C CG  . LYS C 1 265 ? 11.176  -9.077  20.937  1.00 30.70  ? 260 LYS C CG  1 
ATOM   6965  C CD  . LYS C 1 265 ? 9.941   -9.108  21.793  1.00 30.94  ? 260 LYS C CD  1 
ATOM   6966  C CE  . LYS C 1 265 ? 9.984   -7.934  22.755  1.00 30.18  ? 260 LYS C CE  1 
ATOM   6967  N NZ  . LYS C 1 265 ? 8.960   -8.058  23.815  1.00 31.59  ? 260 LYS C NZ  1 
ATOM   6968  N N   . THR C 1 266 ? 12.941  -11.501 17.314  1.00 29.66  ? 261 THR C N   1 
ATOM   6969  C CA  . THR C 1 266 ? 13.074  -12.646 16.425  1.00 29.27  ? 261 THR C CA  1 
ATOM   6970  C C   . THR C 1 266 ? 14.362  -12.579 15.609  1.00 29.45  ? 261 THR C C   1 
ATOM   6971  O O   . THR C 1 266 ? 14.589  -13.389 14.711  1.00 27.04  ? 261 THR C O   1 
ATOM   6972  C CB  . THR C 1 266 ? 11.900  -12.728 15.459  1.00 32.07  ? 261 THR C CB  1 
ATOM   6973  O OG1 . THR C 1 266 ? 11.838  -11.526 14.673  1.00 33.53  ? 261 THR C OG1 1 
ATOM   6974  C CG2 . THR C 1 266 ? 10.607  -12.922 16.229  1.00 33.21  ? 261 THR C CG2 1 
ATOM   6975  N N   . LEU C 1 267 ? 15.206  -11.609 15.938  1.00 28.65  ? 262 LEU C N   1 
ATOM   6976  C CA  . LEU C 1 267 ? 16.465  -11.416 15.242  1.00 28.33  ? 262 LEU C CA  1 
ATOM   6977  C C   . LEU C 1 267 ? 17.335  -12.666 15.228  1.00 30.42  ? 262 LEU C C   1 
ATOM   6978  O O   . LEU C 1 267 ? 17.945  -12.991 14.211  1.00 30.61  ? 262 LEU C O   1 
ATOM   6979  C CB  . LEU C 1 267 ? 17.243  -10.266 15.880  1.00 25.85  ? 262 LEU C CB  1 
ATOM   6980  C CG  . LEU C 1 267 ? 18.650  -10.054 15.328  1.00 23.54  ? 262 LEU C CG  1 
ATOM   6981  C CD1 . LEU C 1 267 ? 18.562  -9.584  13.879  1.00 22.20  ? 262 LEU C CD1 1 
ATOM   6982  C CD2 . LEU C 1 267 ? 19.379  -9.044  16.179  1.00 22.89  ? 262 LEU C CD2 1 
ATOM   6983  N N   . HIS C 1 268 ? 17.408  -13.368 16.352  1.00 31.84  ? 263 HIS C N   1 
ATOM   6984  C CA  . HIS C 1 268 ? 18.235  -14.560 16.391  1.00 32.13  ? 263 HIS C CA  1 
ATOM   6985  C C   . HIS C 1 268 ? 17.743  -15.648 15.429  1.00 31.77  ? 263 HIS C C   1 
ATOM   6986  O O   . HIS C 1 268 ? 18.542  -16.196 14.667  1.00 32.93  ? 263 HIS C O   1 
ATOM   6987  C CB  . HIS C 1 268 ? 18.340  -15.108 17.820  1.00 33.22  ? 263 HIS C CB  1 
ATOM   6988  C CG  . HIS C 1 268 ? 17.033  -15.537 18.409  1.00 35.92  ? 263 HIS C CG  1 
ATOM   6989  N ND1 . HIS C 1 268 ? 16.951  -16.442 19.446  1.00 36.63  ? 263 HIS C ND1 1 
ATOM   6990  C CD2 . HIS C 1 268 ? 15.758  -15.185 18.116  1.00 36.37  ? 263 HIS C CD2 1 
ATOM   6991  C CE1 . HIS C 1 268 ? 15.683  -16.631 19.765  1.00 37.35  ? 263 HIS C CE1 1 
ATOM   6992  N NE2 . HIS C 1 268 ? 14.938  -15.879 18.972  1.00 37.67  ? 263 HIS C NE2 1 
ATOM   6993  N N   . VAL C 1 269 ? 16.444  -15.952 15.439  1.00 31.28  ? 264 VAL C N   1 
ATOM   6994  C CA  . VAL C 1 269 ? 15.916  -16.990 14.554  1.00 31.57  ? 264 VAL C CA  1 
ATOM   6995  C C   . VAL C 1 269 ? 15.990  -16.626 13.074  1.00 31.89  ? 264 VAL C C   1 
ATOM   6996  O O   . VAL C 1 269 ? 16.196  -17.498 12.228  1.00 32.48  ? 264 VAL C O   1 
ATOM   6997  C CB  . VAL C 1 269 ? 14.455  -17.363 14.890  1.00 30.78  ? 264 VAL C CB  1 
ATOM   6998  C CG1 . VAL C 1 269 ? 14.384  -17.957 16.275  1.00 31.61  ? 264 VAL C CG1 1 
ATOM   6999  C CG2 . VAL C 1 269 ? 13.564  -16.153 14.782  1.00 31.44  ? 264 VAL C CG2 1 
ATOM   7000  N N   . ARG C 1 270 ? 15.821  -15.345 12.759  1.00 31.82  ? 265 ARG C N   1 
ATOM   7001  C CA  . ARG C 1 270 ? 15.888  -14.903 11.372  1.00 31.22  ? 265 ARG C CA  1 
ATOM   7002  C C   . ARG C 1 270 ? 17.327  -14.932 10.888  1.00 32.06  ? 265 ARG C C   1 
ATOM   7003  O O   . ARG C 1 270 ? 17.592  -15.333 9.756   1.00 32.56  ? 265 ARG C O   1 
ATOM   7004  C CB  . ARG C 1 270 ? 15.328  -13.483 11.214  1.00 29.73  ? 265 ARG C CB  1 
ATOM   7005  C CG  . ARG C 1 270 ? 13.829  -13.402 11.355  1.00 29.22  ? 265 ARG C CG  1 
ATOM   7006  C CD  . ARG C 1 270 ? 13.292  -12.009 11.041  1.00 29.62  ? 265 ARG C CD  1 
ATOM   7007  N NE  . ARG C 1 270 ? 13.466  -11.055 12.136  1.00 29.67  ? 265 ARG C NE  1 
ATOM   7008  C CZ  . ARG C 1 270 ? 14.440  -10.152 12.199  1.00 29.05  ? 265 ARG C CZ  1 
ATOM   7009  N NH1 . ARG C 1 270 ? 15.344  -10.074 11.228  1.00 29.51  ? 265 ARG C NH1 1 
ATOM   7010  N NH2 . ARG C 1 270 ? 14.495  -9.315  13.224  1.00 27.41  ? 265 ARG C NH2 1 
ATOM   7011  N N   . MET C 1 271 ? 18.256  -14.507 11.740  1.00 32.18  ? 266 MET C N   1 
ATOM   7012  C CA  . MET C 1 271 ? 19.659  -14.492 11.357  1.00 33.39  ? 266 MET C CA  1 
ATOM   7013  C C   . MET C 1 271 ? 20.160  -15.914 11.172  1.00 35.71  ? 266 MET C C   1 
ATOM   7014  O O   . MET C 1 271 ? 20.998  -16.190 10.309  1.00 34.83  ? 266 MET C O   1 
ATOM   7015  C CB  . MET C 1 271 ? 20.504  -13.768 12.405  1.00 32.37  ? 266 MET C CB  1 
ATOM   7016  C CG  . MET C 1 271 ? 20.258  -12.271 12.476  1.00 33.66  ? 266 MET C CG  1 
ATOM   7017  S SD  . MET C 1 271 ? 20.109  -11.486 10.847  1.00 34.19  ? 266 MET C SD  1 
ATOM   7018  C CE  . MET C 1 271 ? 21.813  -11.384 10.363  1.00 33.70  ? 266 MET C CE  1 
ATOM   7019  N N   . GLU C 1 272 ? 19.637  -16.830 11.973  1.00 37.76  ? 267 GLU C N   1 
ATOM   7020  C CA  . GLU C 1 272 ? 20.058  -18.209 11.848  1.00 40.16  ? 267 GLU C CA  1 
ATOM   7021  C C   . GLU C 1 272 ? 19.657  -18.770 10.493  1.00 38.26  ? 267 GLU C C   1 
ATOM   7022  O O   . GLU C 1 272 ? 20.457  -19.428 9.824   1.00 37.64  ? 267 GLU C O   1 
ATOM   7023  C CB  . GLU C 1 272 ? 19.473  -19.052 12.986  1.00 46.31  ? 267 GLU C CB  1 
ATOM   7024  C CG  . GLU C 1 272 ? 20.380  -19.074 14.216  1.00 53.85  ? 267 GLU C CG  1 
ATOM   7025  C CD  . GLU C 1 272 ? 21.786  -19.592 13.895  1.00 58.50  ? 267 GLU C CD  1 
ATOM   7026  O OE1 . GLU C 1 272 ? 22.700  -19.376 14.718  1.00 60.66  ? 267 GLU C OE1 1 
ATOM   7027  O OE2 . GLU C 1 272 ? 21.981  -20.222 12.826  1.00 61.16  ? 267 GLU C OE2 1 
ATOM   7028  N N   . LYS C 1 273 ? 18.423  -18.499 10.082  1.00 36.71  ? 268 LYS C N   1 
ATOM   7029  C CA  . LYS C 1 273 ? 17.946  -18.985 8.799   1.00 35.15  ? 268 LYS C CA  1 
ATOM   7030  C C   . LYS C 1 273 ? 18.689  -18.291 7.657   1.00 35.42  ? 268 LYS C C   1 
ATOM   7031  O O   . LYS C 1 273 ? 18.956  -18.902 6.627   1.00 35.91  ? 268 LYS C O   1 
ATOM   7032  C CB  . LYS C 1 273 ? 16.431  -18.777 8.679   1.00 33.37  ? 268 LYS C CB  1 
ATOM   7033  C CG  . LYS C 1 273 ? 15.840  -19.242 7.365   1.00 33.34  ? 268 LYS C CG  1 
ATOM   7034  C CD  . LYS C 1 273 ? 16.314  -20.642 6.969   1.00 35.96  ? 268 LYS C CD  1 
ATOM   7035  C CE  . LYS C 1 273 ? 15.720  -21.742 7.839   1.00 39.32  ? 268 LYS C CE  1 
ATOM   7036  N NZ  . LYS C 1 273 ? 16.107  -23.109 7.371   1.00 38.86  ? 268 LYS C NZ  1 
ATOM   7037  N N   . HIS C 1 274 ? 19.034  -17.019 7.835   1.00 36.25  ? 269 HIS C N   1 
ATOM   7038  C CA  . HIS C 1 274 ? 19.763  -16.306 6.797   1.00 37.08  ? 269 HIS C CA  1 
ATOM   7039  C C   . HIS C 1 274 ? 21.085  -17.022 6.625   1.00 38.33  ? 269 HIS C C   1 
ATOM   7040  O O   . HIS C 1 274 ? 21.507  -17.321 5.511   1.00 39.01  ? 269 HIS C O   1 
ATOM   7041  C CB  . HIS C 1 274 ? 20.032  -14.851 7.202   1.00 39.34  ? 269 HIS C CB  1 
ATOM   7042  C CG  . HIS C 1 274 ? 18.901  -13.912 6.906   1.00 40.96  ? 269 HIS C CG  1 
ATOM   7043  N ND1 . HIS C 1 274 ? 18.393  -13.732 5.637   1.00 42.09  ? 269 HIS C ND1 1 
ATOM   7044  C CD2 . HIS C 1 274 ? 18.194  -13.088 7.713   1.00 41.06  ? 269 HIS C CD2 1 
ATOM   7045  C CE1 . HIS C 1 274 ? 17.422  -12.838 5.675   1.00 41.01  ? 269 HIS C CE1 1 
ATOM   7046  N NE2 . HIS C 1 274 ? 17.282  -12.431 6.923   1.00 41.67  ? 269 HIS C NE2 1 
ATOM   7047  N N   . PHE C 1 275 ? 21.728  -17.294 7.756   1.00 40.04  ? 270 PHE C N   1 
ATOM   7048  C CA  . PHE C 1 275 ? 23.015  -17.969 7.794   1.00 40.55  ? 270 PHE C CA  1 
ATOM   7049  C C   . PHE C 1 275 ? 22.936  -19.340 7.140   1.00 40.48  ? 270 PHE C C   1 
ATOM   7050  O O   . PHE C 1 275 ? 23.791  -19.686 6.320   1.00 41.05  ? 270 PHE C O   1 
ATOM   7051  C CB  . PHE C 1 275 ? 23.476  -18.088 9.248   1.00 43.00  ? 270 PHE C CB  1 
ATOM   7052  C CG  . PHE C 1 275 ? 24.830  -18.709 9.417   1.00 46.50  ? 270 PHE C CG  1 
ATOM   7053  C CD1 . PHE C 1 275 ? 25.852  -18.452 8.511   1.00 48.89  ? 270 PHE C CD1 1 
ATOM   7054  C CD2 . PHE C 1 275 ? 25.095  -19.529 10.509  1.00 47.99  ? 270 PHE C CD2 1 
ATOM   7055  C CE1 . PHE C 1 275 ? 27.121  -19.004 8.690   1.00 50.77  ? 270 PHE C CE1 1 
ATOM   7056  C CE2 . PHE C 1 275 ? 26.354  -20.084 10.699  1.00 49.43  ? 270 PHE C CE2 1 
ATOM   7057  C CZ  . PHE C 1 275 ? 27.370  -19.822 9.788   1.00 50.92  ? 270 PHE C CZ  1 
ATOM   7058  N N   . LYS C 1 276 ? 21.914  -20.118 7.494   1.00 39.38  ? 271 LYS C N   1 
ATOM   7059  C CA  . LYS C 1 276 ? 21.748  -21.439 6.907   1.00 38.29  ? 271 LYS C CA  1 
ATOM   7060  C C   . LYS C 1 276 ? 21.617  -21.340 5.400   1.00 37.54  ? 271 LYS C C   1 
ATOM   7061  O O   . LYS C 1 276 ? 22.456  -21.868 4.673   1.00 39.08  ? 271 LYS C O   1 
ATOM   7062  C CB  . LYS C 1 276 ? 20.521  -22.146 7.476   1.00 41.11  ? 271 LYS C CB  1 
ATOM   7063  C CG  . LYS C 1 276 ? 20.818  -23.001 8.696   1.00 46.36  ? 271 LYS C CG  1 
ATOM   7064  C CD  . LYS C 1 276 ? 19.640  -23.916 9.031   1.00 51.40  ? 271 LYS C CD  1 
ATOM   7065  C CE  . LYS C 1 276 ? 19.324  -24.889 7.888   1.00 53.24  ? 271 LYS C CE  1 
ATOM   7066  N NZ  . LYS C 1 276 ? 18.161  -25.784 8.193   1.00 53.10  ? 271 LYS C NZ  1 
ATOM   7067  N N   . ASN C 1 277 ? 20.569  -20.665 4.928   1.00 35.60  ? 272 ASN C N   1 
ATOM   7068  C CA  . ASN C 1 277 ? 20.356  -20.515 3.492   1.00 33.40  ? 272 ASN C CA  1 
ATOM   7069  C C   . ASN C 1 277 ? 21.598  -19.947 2.831   1.00 32.45  ? 272 ASN C C   1 
ATOM   7070  O O   . ASN C 1 277 ? 21.978  -20.377 1.747   1.00 31.89  ? 272 ASN C O   1 
ATOM   7071  C CB  . ASN C 1 277 ? 19.164  -19.597 3.194   1.00 36.05  ? 272 ASN C CB  1 
ATOM   7072  C CG  . ASN C 1 277 ? 17.827  -20.268 3.437   1.00 36.89  ? 272 ASN C CG  1 
ATOM   7073  O OD1 . ASN C 1 277 ? 17.720  -21.496 3.403   1.00 38.35  ? 272 ASN C OD1 1 
ATOM   7074  N ND2 . ASN C 1 277 ? 16.792  -19.463 3.663   1.00 36.34  ? 272 ASN C ND2 1 
ATOM   7075  N N   . GLY C 1 278 ? 22.224  -18.978 3.491   1.00 31.10  ? 273 GLY C N   1 
ATOM   7076  C CA  . GLY C 1 278 ? 23.425  -18.366 2.955   1.00 30.06  ? 273 GLY C CA  1 
ATOM   7077  C C   . GLY C 1 278 ? 24.550  -19.361 2.757   1.00 31.72  ? 273 GLY C C   1 
ATOM   7078  O O   . GLY C 1 278 ? 25.267  -19.300 1.758   1.00 31.51  ? 273 GLY C O   1 
ATOM   7079  N N   . MET C 1 279 ? 24.712  -20.276 3.711   1.00 32.75  ? 274 MET C N   1 
ATOM   7080  C CA  . MET C 1 279 ? 25.753  -21.293 3.637   1.00 32.68  ? 274 MET C CA  1 
ATOM   7081  C C   . MET C 1 279 ? 25.441  -22.236 2.482   1.00 32.38  ? 274 MET C C   1 
ATOM   7082  O O   . MET C 1 279 ? 26.311  -22.541 1.671   1.00 31.81  ? 274 MET C O   1 
ATOM   7083  C CB  . MET C 1 279 ? 25.809  -22.082 4.941   1.00 34.52  ? 274 MET C CB  1 
ATOM   7084  C CG  . MET C 1 279 ? 27.135  -22.764 5.195   1.00 36.48  ? 274 MET C CG  1 
ATOM   7085  S SD  . MET C 1 279 ? 28.476  -21.568 5.334   1.00 42.67  ? 274 MET C SD  1 
ATOM   7086  C CE  . MET C 1 279 ? 29.829  -22.549 4.700   1.00 43.02  ? 274 MET C CE  1 
ATOM   7087  N N   . ALA C 1 280 ? 24.194  -22.690 2.409   1.00 31.13  ? 275 ALA C N   1 
ATOM   7088  C CA  . ALA C 1 280 ? 23.762  -23.577 1.335   1.00 29.34  ? 275 ALA C CA  1 
ATOM   7089  C C   . ALA C 1 280 ? 24.029  -22.941 -0.029  1.00 30.25  ? 275 ALA C C   1 
ATOM   7090  O O   . ALA C 1 280 ? 24.718  -23.514 -0.872  1.00 30.61  ? 275 ALA C O   1 
ATOM   7091  C CB  . ALA C 1 280 ? 22.292  -23.868 1.476   1.00 27.64  ? 275 ALA C CB  1 
ATOM   7092  N N   . VAL C 1 281 ? 23.481  -21.749 -0.238  1.00 31.91  ? 276 VAL C N   1 
ATOM   7093  C CA  . VAL C 1 281 ? 23.646  -21.034 -1.500  1.00 31.65  ? 276 VAL C CA  1 
ATOM   7094  C C   . VAL C 1 281 ? 25.113  -20.937 -1.878  1.00 34.34  ? 276 VAL C C   1 
ATOM   7095  O O   . VAL C 1 281 ? 25.484  -21.293 -2.988  1.00 35.01  ? 276 VAL C O   1 
ATOM   7096  C CB  . VAL C 1 281 ? 23.036  -19.594 -1.436  1.00 31.13  ? 276 VAL C CB  1 
ATOM   7097  C CG1 . VAL C 1 281 ? 23.508  -18.767 -2.618  1.00 28.76  ? 276 VAL C CG1 1 
ATOM   7098  C CG2 . VAL C 1 281 ? 21.514  -19.664 -1.441  1.00 26.69  ? 276 VAL C CG2 1 
ATOM   7099  N N   . ALA C 1 282 ? 25.945  -20.466 -0.953  1.00 36.36  ? 277 ALA C N   1 
ATOM   7100  C CA  . ALA C 1 282 ? 27.376  -20.318 -1.215  1.00 38.74  ? 277 ALA C CA  1 
ATOM   7101  C C   . ALA C 1 282 ? 28.059  -21.636 -1.577  1.00 41.78  ? 277 ALA C C   1 
ATOM   7102  O O   . ALA C 1 282 ? 28.918  -21.670 -2.462  1.00 42.97  ? 277 ALA C O   1 
ATOM   7103  C CB  . ALA C 1 282 ? 28.077  -19.680 -0.016  1.00 35.99  ? 277 ALA C CB  1 
ATOM   7104  N N   . GLN C 1 283 ? 27.700  -22.721 -0.902  1.00 42.61  ? 278 GLN C N   1 
ATOM   7105  C CA  . GLN C 1 283 ? 28.326  -23.997 -1.224  1.00 44.76  ? 278 GLN C CA  1 
ATOM   7106  C C   . GLN C 1 283 ? 27.886  -24.473 -2.600  1.00 44.24  ? 278 GLN C C   1 
ATOM   7107  O O   . GLN C 1 283 ? 28.717  -24.875 -3.421  1.00 44.58  ? 278 GLN C O   1 
ATOM   7108  C CB  . GLN C 1 283 ? 28.001  -25.044 -0.158  1.00 47.41  ? 278 GLN C CB  1 
ATOM   7109  C CG  . GLN C 1 283 ? 28.649  -24.721 1.182   1.00 53.04  ? 278 GLN C CG  1 
ATOM   7110  C CD  . GLN C 1 283 ? 28.212  -25.646 2.302   1.00 55.57  ? 278 GLN C CD  1 
ATOM   7111  O OE1 . GLN C 1 283 ? 27.048  -26.060 2.373   1.00 57.77  ? 278 GLN C OE1 1 
ATOM   7112  N NE2 . GLN C 1 283 ? 29.140  -25.957 3.202   1.00 56.61  ? 278 GLN C NE2 1 
ATOM   7113  N N   . PHE C 1 284 ? 26.583  -24.411 -2.850  1.00 41.89  ? 279 PHE C N   1 
ATOM   7114  C CA  . PHE C 1 284 ? 26.020  -24.819 -4.130  1.00 39.43  ? 279 PHE C CA  1 
ATOM   7115  C C   . PHE C 1 284 ? 26.665  -24.092 -5.306  1.00 40.09  ? 279 PHE C C   1 
ATOM   7116  O O   . PHE C 1 284 ? 27.064  -24.717 -6.289  1.00 40.19  ? 279 PHE C O   1 
ATOM   7117  C CB  . PHE C 1 284 ? 24.522  -24.540 -4.162  1.00 37.67  ? 279 PHE C CB  1 
ATOM   7118  C CG  . PHE C 1 284 ? 23.910  -24.749 -5.506  1.00 35.33  ? 279 PHE C CG  1 
ATOM   7119  C CD1 . PHE C 1 284 ? 23.552  -26.018 -5.928  1.00 34.86  ? 279 PHE C CD1 1 
ATOM   7120  C CD2 . PHE C 1 284 ? 23.733  -23.678 -6.374  1.00 36.03  ? 279 PHE C CD2 1 
ATOM   7121  C CE1 . PHE C 1 284 ? 23.025  -26.222 -7.205  1.00 35.74  ? 279 PHE C CE1 1 
ATOM   7122  C CE2 . PHE C 1 284 ? 23.209  -23.869 -7.652  1.00 35.46  ? 279 PHE C CE2 1 
ATOM   7123  C CZ  . PHE C 1 284 ? 22.854  -25.144 -8.070  1.00 34.88  ? 279 PHE C CZ  1 
ATOM   7124  N N   . LEU C 1 285 ? 26.740  -22.769 -5.213  1.00 39.44  ? 280 LEU C N   1 
ATOM   7125  C CA  . LEU C 1 285 ? 27.330  -21.971 -6.280  1.00 40.44  ? 280 LEU C CA  1 
ATOM   7126  C C   . LEU C 1 285 ? 28.792  -22.319 -6.465  1.00 42.47  ? 280 LEU C C   1 
ATOM   7127  O O   . LEU C 1 285 ? 29.293  -22.356 -7.587  1.00 43.74  ? 280 LEU C O   1 
ATOM   7128  C CB  . LEU C 1 285 ? 27.209  -20.472 -5.976  1.00 37.68  ? 280 LEU C CB  1 
ATOM   7129  C CG  . LEU C 1 285 ? 25.808  -19.864 -6.072  1.00 36.23  ? 280 LEU C CG  1 
ATOM   7130  C CD1 . LEU C 1 285 ? 25.818  -18.450 -5.528  1.00 33.36  ? 280 LEU C CD1 1 
ATOM   7131  C CD2 . LEU C 1 285 ? 25.344  -19.891 -7.516  1.00 34.42  ? 280 LEU C CD2 1 
ATOM   7132  N N   . GLU C 1 286 ? 29.476  -22.574 -5.358  1.00 44.50  ? 281 GLU C N   1 
ATOM   7133  C CA  . GLU C 1 286 ? 30.896  -22.889 -5.412  1.00 45.34  ? 281 GLU C CA  1 
ATOM   7134  C C   . GLU C 1 286 ? 31.224  -24.184 -6.148  1.00 45.10  ? 281 GLU C C   1 
ATOM   7135  O O   . GLU C 1 286 ? 32.283  -24.296 -6.761  1.00 46.04  ? 281 GLU C O   1 
ATOM   7136  C CB  . GLU C 1 286 ? 31.475  -22.918 -3.998  1.00 46.29  ? 281 GLU C CB  1 
ATOM   7137  C CG  . GLU C 1 286 ? 32.921  -23.324 -3.944  1.00 47.71  ? 281 GLU C CG  1 
ATOM   7138  C CD  . GLU C 1 286 ? 33.660  -22.658 -2.813  1.00 48.69  ? 281 GLU C CD  1 
ATOM   7139  O OE1 . GLU C 1 286 ? 33.980  -21.459 -2.943  1.00 48.02  ? 281 GLU C OE1 1 
ATOM   7140  O OE2 . GLU C 1 286 ? 33.913  -23.330 -1.793  1.00 49.98  ? 281 GLU C OE2 1 
ATOM   7141  N N   . SER C 1 287 ? 30.322  -25.155 -6.105  1.00 44.17  ? 282 SER C N   1 
ATOM   7142  C CA  . SER C 1 287 ? 30.572  -26.414 -6.791  1.00 44.46  ? 282 SER C CA  1 
ATOM   7143  C C   . SER C 1 287 ? 29.812  -26.493 -8.123  1.00 43.16  ? 282 SER C C   1 
ATOM   7144  O O   . SER C 1 287 ? 29.738  -27.544 -8.762  1.00 43.19  ? 282 SER C O   1 
ATOM   7145  C CB  . SER C 1 287 ? 30.202  -27.590 -5.875  1.00 44.51  ? 282 SER C CB  1 
ATOM   7146  O OG  . SER C 1 287 ? 28.813  -27.642 -5.625  1.00 45.37  ? 282 SER C OG  1 
ATOM   7147  N N   . ASN C 1 288 ? 29.268  -25.363 -8.545  1.00 41.91  ? 283 ASN C N   1 
ATOM   7148  C CA  . ASN C 1 288 ? 28.527  -25.293 -9.788  1.00 43.16  ? 283 ASN C CA  1 
ATOM   7149  C C   . ASN C 1 288 ? 29.499  -24.965 -10.922 1.00 45.54  ? 283 ASN C C   1 
ATOM   7150  O O   . ASN C 1 288 ? 30.387  -24.131 -10.763 1.00 43.63  ? 283 ASN C O   1 
ATOM   7151  C CB  . ASN C 1 288 ? 27.433  -24.224 -9.665  1.00 42.45  ? 283 ASN C CB  1 
ATOM   7152  C CG  . ASN C 1 288 ? 26.596  -24.082 -10.924 1.00 41.01  ? 283 ASN C CG  1 
ATOM   7153  O OD1 . ASN C 1 288 ? 27.032  -23.489 -11.912 1.00 40.80  ? 283 ASN C OD1 1 
ATOM   7154  N ND2 . ASN C 1 288 ? 25.387  -24.628 -10.894 1.00 41.04  ? 283 ASN C ND2 1 
ATOM   7155  N N   . PRO C 1 289 ? 29.333  -25.624 -12.085 1.00 45.54  ? 284 PRO C N   1 
ATOM   7156  C CA  . PRO C 1 289 ? 30.146  -25.475 -13.300 1.00 47.77  ? 284 PRO C CA  1 
ATOM   7157  C C   . PRO C 1 289 ? 30.178  -24.074 -13.916 1.00 49.33  ? 284 PRO C C   1 
ATOM   7158  O O   . PRO C 1 289 ? 31.100  -23.741 -14.669 1.00 49.28  ? 284 PRO C O   1 
ATOM   7159  C CB  . PRO C 1 289 ? 29.515  -26.478 -14.266 1.00 46.63  ? 284 PRO C CB  1 
ATOM   7160  C CG  . PRO C 1 289 ? 28.890  -27.491 -13.368 1.00 48.19  ? 284 PRO C CG  1 
ATOM   7161  C CD  . PRO C 1 289 ? 28.279  -26.633 -12.301 1.00 47.26  ? 284 PRO C CD  1 
ATOM   7162  N N   . TRP C 1 290 ? 29.179  -23.258 -13.592 1.00 48.88  ? 285 TRP C N   1 
ATOM   7163  C CA  . TRP C 1 290 ? 29.071  -21.918 -14.159 1.00 47.51  ? 285 TRP C CA  1 
ATOM   7164  C C   . TRP C 1 290 ? 29.510  -20.789 -13.246 1.00 46.57  ? 285 TRP C C   1 
ATOM   7165  O O   . TRP C 1 290 ? 29.261  -19.618 -13.539 1.00 45.41  ? 285 TRP C O   1 
ATOM   7166  C CB  . TRP C 1 290 ? 27.635  -21.696 -14.608 1.00 47.68  ? 285 TRP C CB  1 
ATOM   7167  C CG  . TRP C 1 290 ? 27.152  -22.815 -15.472 1.00 48.30  ? 285 TRP C CG  1 
ATOM   7168  C CD1 . TRP C 1 290 ? 26.133  -23.689 -15.203 1.00 50.04  ? 285 TRP C CD1 1 
ATOM   7169  C CD2 . TRP C 1 290 ? 27.670  -23.185 -16.751 1.00 48.13  ? 285 TRP C CD2 1 
ATOM   7170  N NE1 . TRP C 1 290 ? 25.983  -24.578 -16.245 1.00 49.64  ? 285 TRP C NE1 1 
ATOM   7171  C CE2 . TRP C 1 290 ? 26.912  -24.287 -17.209 1.00 48.74  ? 285 TRP C CE2 1 
ATOM   7172  C CE3 . TRP C 1 290 ? 28.701  -22.687 -17.560 1.00 49.57  ? 285 TRP C CE3 1 
ATOM   7173  C CZ2 . TRP C 1 290 ? 27.156  -24.903 -18.440 1.00 50.25  ? 285 TRP C CZ2 1 
ATOM   7174  C CZ3 . TRP C 1 290 ? 28.945  -23.301 -18.787 1.00 50.74  ? 285 TRP C CZ3 1 
ATOM   7175  C CH2 . TRP C 1 290 ? 28.171  -24.395 -19.215 1.00 50.89  ? 285 TRP C CH2 1 
ATOM   7176  N N   . VAL C 1 291 ? 30.173  -21.146 -12.149 1.00 46.37  ? 286 VAL C N   1 
ATOM   7177  C CA  . VAL C 1 291 ? 30.660  -20.163 -11.185 1.00 47.29  ? 286 VAL C CA  1 
ATOM   7178  C C   . VAL C 1 291 ? 32.190  -20.116 -11.180 1.00 47.77  ? 286 VAL C C   1 
ATOM   7179  O O   . VAL C 1 291 ? 32.837  -21.139 -10.961 1.00 46.77  ? 286 VAL C O   1 
ATOM   7180  C CB  . VAL C 1 291 ? 30.159  -20.505 -9.750  1.00 46.35  ? 286 VAL C CB  1 
ATOM   7181  C CG1 . VAL C 1 291 ? 30.681  -19.481 -8.742  1.00 44.78  ? 286 VAL C CG1 1 
ATOM   7182  C CG2 . VAL C 1 291 ? 28.638  -20.544 -9.728  1.00 44.97  ? 286 VAL C CG2 1 
ATOM   7183  N N   . GLU C 1 292 ? 32.764  -18.938 -11.428 1.00 50.13  ? 287 GLU C N   1 
ATOM   7184  C CA  . GLU C 1 292 ? 34.218  -18.795 -11.421 1.00 55.23  ? 287 GLU C CA  1 
ATOM   7185  C C   . GLU C 1 292 ? 34.690  -19.018 -9.989  1.00 54.70  ? 287 GLU C C   1 
ATOM   7186  O O   . GLU C 1 292 ? 35.535  -19.883 -9.727  1.00 56.09  ? 287 GLU C O   1 
ATOM   7187  C CB  . GLU C 1 292 ? 34.645  -17.401 -11.883 1.00 60.23  ? 287 GLU C CB  1 
ATOM   7188  C CG  . GLU C 1 292 ? 35.596  -17.371 -13.094 1.00 70.85  ? 287 GLU C CG  1 
ATOM   7189  C CD  . GLU C 1 292 ? 36.860  -18.228 -12.934 1.00 76.71  ? 287 GLU C CD  1 
ATOM   7190  O OE1 . GLU C 1 292 ? 37.922  -17.822 -13.458 1.00 79.70  ? 287 GLU C OE1 1 
ATOM   7191  O OE2 . GLU C 1 292 ? 36.798  -19.310 -12.310 1.00 80.35  ? 287 GLU C OE2 1 
ATOM   7192  N N   . LYS C 1 293 ? 34.149  -18.222 -9.068  1.00 52.57  ? 288 LYS C N   1 
ATOM   7193  C CA  . LYS C 1 293 ? 34.469  -18.354 -7.650  1.00 49.76  ? 288 LYS C CA  1 
ATOM   7194  C C   . LYS C 1 293 ? 33.432  -17.674 -6.764  1.00 47.54  ? 288 LYS C C   1 
ATOM   7195  O O   . LYS C 1 293 ? 32.647  -16.840 -7.221  1.00 47.73  ? 288 LYS C O   1 
ATOM   7196  C CB  . LYS C 1 293 ? 35.868  -17.815 -7.341  1.00 50.41  ? 288 LYS C CB  1 
ATOM   7197  C CG  . LYS C 1 293 ? 36.001  -16.321 -7.252  1.00 49.99  ? 288 LYS C CG  1 
ATOM   7198  C CD  . LYS C 1 293 ? 37.412  -16.000 -6.795  1.00 52.57  ? 288 LYS C CD  1 
ATOM   7199  C CE  . LYS C 1 293 ? 37.672  -14.512 -6.724  1.00 52.81  ? 288 LYS C CE  1 
ATOM   7200  N NZ  . LYS C 1 293 ? 39.073  -14.244 -6.298  1.00 52.69  ? 288 LYS C NZ  1 
ATOM   7201  N N   . VAL C 1 294 ? 33.436  -18.041 -5.489  1.00 44.82  ? 289 VAL C N   1 
ATOM   7202  C CA  . VAL C 1 294 ? 32.481  -17.506 -4.525  1.00 40.35  ? 289 VAL C CA  1 
ATOM   7203  C C   . VAL C 1 294 ? 33.170  -16.760 -3.403  1.00 39.02  ? 289 VAL C C   1 
ATOM   7204  O O   . VAL C 1 294 ? 34.276  -17.114 -2.999  1.00 40.81  ? 289 VAL C O   1 
ATOM   7205  C CB  . VAL C 1 294 ? 31.645  -18.647 -3.897  1.00 39.37  ? 289 VAL C CB  1 
ATOM   7206  C CG1 . VAL C 1 294 ? 30.649  -18.085 -2.922  1.00 38.63  ? 289 VAL C CG1 1 
ATOM   7207  C CG2 . VAL C 1 294 ? 30.934  -19.444 -4.989  1.00 38.15  ? 289 VAL C CG2 1 
ATOM   7208  N N   . ILE C 1 295 ? 32.518  -15.717 -2.905  1.00 38.04  ? 290 ILE C N   1 
ATOM   7209  C CA  . ILE C 1 295 ? 33.059  -14.943 -1.798  1.00 36.38  ? 290 ILE C CA  1 
ATOM   7210  C C   . ILE C 1 295 ? 32.031  -14.941 -0.694  1.00 37.36  ? 290 ILE C C   1 
ATOM   7211  O O   . ILE C 1 295 ? 31.098  -14.149 -0.716  1.00 38.25  ? 290 ILE C O   1 
ATOM   7212  C CB  . ILE C 1 295 ? 33.336  -13.496 -2.178  1.00 35.64  ? 290 ILE C CB  1 
ATOM   7213  C CG1 . ILE C 1 295 ? 34.277  -13.453 -3.383  1.00 36.28  ? 290 ILE C CG1 1 
ATOM   7214  C CG2 . ILE C 1 295 ? 33.931  -12.763 -0.976  1.00 33.89  ? 290 ILE C CG2 1 
ATOM   7215  C CD1 . ILE C 1 295 ? 35.567  -14.242 -3.177  1.00 38.55  ? 290 ILE C CD1 1 
ATOM   7216  N N   . TYR C 1 296 ? 32.195  -15.846 0.261   1.00 39.25  ? 291 TYR C N   1 
ATOM   7217  C CA  . TYR C 1 296 ? 31.276  -15.958 1.386   1.00 39.60  ? 291 TYR C CA  1 
ATOM   7218  C C   . TYR C 1 296 ? 32.084  -16.299 2.640   1.00 40.85  ? 291 TYR C C   1 
ATOM   7219  O O   . TYR C 1 296 ? 32.745  -17.345 2.709   1.00 40.32  ? 291 TYR C O   1 
ATOM   7220  C CB  . TYR C 1 296 ? 30.231  -17.045 1.103   1.00 38.47  ? 291 TYR C CB  1 
ATOM   7221  C CG  . TYR C 1 296 ? 29.180  -17.141 2.178   1.00 37.94  ? 291 TYR C CG  1 
ATOM   7222  C CD1 . TYR C 1 296 ? 28.345  -16.060 2.454   1.00 38.67  ? 291 TYR C CD1 1 
ATOM   7223  C CD2 . TYR C 1 296 ? 29.059  -18.287 2.959   1.00 37.36  ? 291 TYR C CD2 1 
ATOM   7224  C CE1 . TYR C 1 296 ? 27.421  -16.115 3.489   1.00 39.69  ? 291 TYR C CE1 1 
ATOM   7225  C CE2 . TYR C 1 296 ? 28.142  -18.359 3.995   1.00 37.81  ? 291 TYR C CE2 1 
ATOM   7226  C CZ  . TYR C 1 296 ? 27.327  -17.268 4.259   1.00 39.37  ? 291 TYR C CZ  1 
ATOM   7227  O OH  . TYR C 1 296 ? 26.428  -17.320 5.298   1.00 38.92  ? 291 TYR C OH  1 
ATOM   7228  N N   . PRO C 1 297 ? 32.046  -15.414 3.651   1.00 41.27  ? 292 PRO C N   1 
ATOM   7229  C CA  . PRO C 1 297 ? 32.781  -15.616 4.908   1.00 40.32  ? 292 PRO C CA  1 
ATOM   7230  C C   . PRO C 1 297 ? 32.625  -16.998 5.549   1.00 40.17  ? 292 PRO C C   1 
ATOM   7231  O O   . PRO C 1 297 ? 33.572  -17.526 6.128   1.00 40.38  ? 292 PRO C O   1 
ATOM   7232  C CB  . PRO C 1 297 ? 32.251  -14.491 5.789   1.00 40.74  ? 292 PRO C CB  1 
ATOM   7233  C CG  . PRO C 1 297 ? 32.024  -13.392 4.791   1.00 40.58  ? 292 PRO C CG  1 
ATOM   7234  C CD  . PRO C 1 297 ? 31.315  -14.134 3.676   1.00 39.86  ? 292 PRO C CD  1 
ATOM   7235  N N   . GLY C 1 298 ? 31.437  -17.581 5.438   1.00 39.90  ? 293 GLY C N   1 
ATOM   7236  C CA  . GLY C 1 298 ? 31.198  -18.891 6.015   1.00 39.47  ? 293 GLY C CA  1 
ATOM   7237  C C   . GLY C 1 298 ? 31.995  -20.027 5.388   1.00 40.82  ? 293 GLY C C   1 
ATOM   7238  O O   . GLY C 1 298 ? 32.250  -21.032 6.057   1.00 42.01  ? 293 GLY C O   1 
ATOM   7239  N N   . LEU C 1 299 ? 32.388  -19.882 4.119   1.00 40.54  ? 294 LEU C N   1 
ATOM   7240  C CA  . LEU C 1 299 ? 33.158  -20.913 3.408   1.00 39.97  ? 294 LEU C CA  1 
ATOM   7241  C C   . LEU C 1 299 ? 34.647  -20.835 3.724   1.00 40.08  ? 294 LEU C C   1 
ATOM   7242  O O   . LEU C 1 299 ? 35.210  -19.743 3.781   1.00 40.70  ? 294 LEU C O   1 
ATOM   7243  C CB  . LEU C 1 299 ? 32.987  -20.773 1.893   1.00 37.90  ? 294 LEU C CB  1 
ATOM   7244  C CG  . LEU C 1 299 ? 31.608  -21.006 1.291   1.00 35.90  ? 294 LEU C CG  1 
ATOM   7245  C CD1 . LEU C 1 299 ? 31.667  -20.735 -0.206  1.00 34.85  ? 294 LEU C CD1 1 
ATOM   7246  C CD2 . LEU C 1 299 ? 31.159  -22.425 1.570   1.00 34.22  ? 294 LEU C CD2 1 
ATOM   7247  N N   . PRO C 1 300 ? 35.306  -22.000 3.916   1.00 41.29  ? 295 PRO C N   1 
ATOM   7248  C CA  . PRO C 1 300 ? 36.741  -22.051 4.227   1.00 40.45  ? 295 PRO C CA  1 
ATOM   7249  C C   . PRO C 1 300 ? 37.596  -21.487 3.103   1.00 41.05  ? 295 PRO C C   1 
ATOM   7250  O O   . PRO C 1 300 ? 38.792  -21.231 3.284   1.00 40.33  ? 295 PRO C O   1 
ATOM   7251  C CB  . PRO C 1 300 ? 36.988  -23.538 4.477   1.00 39.89  ? 295 PRO C CB  1 
ATOM   7252  C CG  . PRO C 1 300 ? 35.971  -24.198 3.604   1.00 39.72  ? 295 PRO C CG  1 
ATOM   7253  C CD  . PRO C 1 300 ? 34.742  -23.362 3.836   1.00 39.51  ? 295 PRO C CD  1 
ATOM   7254  N N   . SER C 1 301 ? 36.961  -21.288 1.948   1.00 42.02  ? 296 SER C N   1 
ATOM   7255  C CA  . SER C 1 301 ? 37.626  -20.740 0.768   1.00 42.51  ? 296 SER C CA  1 
ATOM   7256  C C   . SER C 1 301 ? 37.729  -19.219 0.836   1.00 42.86  ? 296 SER C C   1 
ATOM   7257  O O   . SER C 1 301 ? 38.402  -18.601 0.010   1.00 43.87  ? 296 SER C O   1 
ATOM   7258  C CB  . SER C 1 301 ? 36.873  -21.140 -0.503  1.00 42.10  ? 296 SER C CB  1 
ATOM   7259  O OG  . SER C 1 301 ? 35.518  -20.751 -0.436  1.00 42.19  ? 296 SER C OG  1 
ATOM   7260  N N   . HIS C 1 302 ? 37.060  -18.609 1.811   1.00 41.85  ? 297 HIS C N   1 
ATOM   7261  C CA  . HIS C 1 302 ? 37.127  -17.162 1.946   1.00 41.96  ? 297 HIS C CA  1 
ATOM   7262  C C   . HIS C 1 302 ? 38.527  -16.842 2.429   1.00 43.51  ? 297 HIS C C   1 
ATOM   7263  O O   . HIS C 1 302 ? 38.999  -17.426 3.406   1.00 43.92  ? 297 HIS C O   1 
ATOM   7264  C CB  . HIS C 1 302 ? 36.112  -16.644 2.966   1.00 41.10  ? 297 HIS C CB  1 
ATOM   7265  C CG  . HIS C 1 302 ? 36.107  -15.152 3.092   1.00 39.55  ? 297 HIS C CG  1 
ATOM   7266  N ND1 . HIS C 1 302 ? 35.268  -14.344 2.356   1.00 40.47  ? 297 HIS C ND1 1 
ATOM   7267  C CD2 . HIS C 1 302 ? 36.887  -14.318 3.818   1.00 39.67  ? 297 HIS C CD2 1 
ATOM   7268  C CE1 . HIS C 1 302 ? 35.532  -13.077 2.620   1.00 38.51  ? 297 HIS C CE1 1 
ATOM   7269  N NE2 . HIS C 1 302 ? 36.512  -13.034 3.505   1.00 40.26  ? 297 HIS C NE2 1 
ATOM   7270  N N   . PRO C 1 303 ? 39.217  -15.915 1.752   1.00 42.56  ? 298 PRO C N   1 
ATOM   7271  C CA  . PRO C 1 303 ? 40.577  -15.555 2.157   1.00 44.65  ? 298 PRO C CA  1 
ATOM   7272  C C   . PRO C 1 303 ? 40.785  -15.380 3.662   1.00 45.22  ? 298 PRO C C   1 
ATOM   7273  O O   . PRO C 1 303 ? 41.784  -15.859 4.205   1.00 48.26  ? 298 PRO C O   1 
ATOM   7274  C CB  . PRO C 1 303 ? 40.863  -14.276 1.354   1.00 43.36  ? 298 PRO C CB  1 
ATOM   7275  C CG  . PRO C 1 303 ? 39.503  -13.800 0.918   1.00 43.71  ? 298 PRO C CG  1 
ATOM   7276  C CD  . PRO C 1 303 ? 38.767  -15.073 0.637   1.00 42.83  ? 298 PRO C CD  1 
ATOM   7277  N N   . GLN C 1 304 ? 39.856  -14.716 4.342   1.00 43.94  ? 299 GLN C N   1 
ATOM   7278  C CA  . GLN C 1 304 ? 40.001  -14.513 5.786   1.00 44.61  ? 299 GLN C CA  1 
ATOM   7279  C C   . GLN C 1 304 ? 39.036  -15.357 6.611   1.00 43.72  ? 299 GLN C C   1 
ATOM   7280  O O   . GLN C 1 304 ? 38.544  -14.908 7.638   1.00 42.11  ? 299 GLN C O   1 
ATOM   7281  C CB  . GLN C 1 304 ? 39.808  -13.036 6.140   1.00 45.25  ? 299 GLN C CB  1 
ATOM   7282  C CG  . GLN C 1 304 ? 40.683  -12.101 5.333   1.00 48.27  ? 299 GLN C CG  1 
ATOM   7283  C CD  . GLN C 1 304 ? 39.890  -11.284 4.332   1.00 51.04  ? 299 GLN C CD  1 
ATOM   7284  O OE1 . GLN C 1 304 ? 39.301  -10.265 4.681   1.00 53.85  ? 299 GLN C OE1 1 
ATOM   7285  N NE2 . GLN C 1 304 ? 39.861  -11.734 3.083   1.00 52.83  ? 299 GLN C NE2 1 
ATOM   7286  N N   . HIS C 1 305 ? 38.776  -16.580 6.164   1.00 44.36  ? 300 HIS C N   1 
ATOM   7287  C CA  . HIS C 1 305 ? 37.866  -17.470 6.871   1.00 46.06  ? 300 HIS C CA  1 
ATOM   7288  C C   . HIS C 1 305 ? 38.324  -17.722 8.298   1.00 47.49  ? 300 HIS C C   1 
ATOM   7289  O O   . HIS C 1 305 ? 37.503  -17.951 9.184   1.00 47.05  ? 300 HIS C O   1 
ATOM   7290  C CB  . HIS C 1 305 ? 37.740  -18.812 6.139   1.00 45.93  ? 300 HIS C CB  1 
ATOM   7291  C CG  . HIS C 1 305 ? 36.812  -19.779 6.808   1.00 45.18  ? 300 HIS C CG  1 
ATOM   7292  N ND1 . HIS C 1 305 ? 35.486  -19.493 7.045   1.00 45.53  ? 300 HIS C ND1 1 
ATOM   7293  C CD2 . HIS C 1 305 ? 37.025  -21.015 7.320   1.00 46.51  ? 300 HIS C CD2 1 
ATOM   7294  C CE1 . HIS C 1 305 ? 34.922  -20.507 7.677   1.00 45.45  ? 300 HIS C CE1 1 
ATOM   7295  N NE2 . HIS C 1 305 ? 35.835  -21.444 7.856   1.00 45.90  ? 300 HIS C NE2 1 
ATOM   7296  N N   . GLU C 1 306 ? 39.633  -17.689 8.525   1.00 50.16  ? 301 GLU C N   1 
ATOM   7297  C CA  . GLU C 1 306 ? 40.154  -17.926 9.866   1.00 53.18  ? 301 GLU C CA  1 
ATOM   7298  C C   . GLU C 1 306 ? 39.792  -16.769 10.782  1.00 51.87  ? 301 GLU C C   1 
ATOM   7299  O O   . GLU C 1 306 ? 39.325  -16.981 11.900  1.00 51.18  ? 301 GLU C O   1 
ATOM   7300  C CB  . GLU C 1 306 ? 41.674  -18.118 9.839   1.00 57.48  ? 301 GLU C CB  1 
ATOM   7301  C CG  . GLU C 1 306 ? 42.131  -19.442 9.242   1.00 65.05  ? 301 GLU C CG  1 
ATOM   7302  C CD  . GLU C 1 306 ? 41.448  -20.652 9.873   1.00 69.97  ? 301 GLU C CD  1 
ATOM   7303  O OE1 . GLU C 1 306 ? 40.272  -20.920 9.540   1.00 73.39  ? 301 GLU C OE1 1 
ATOM   7304  O OE2 . GLU C 1 306 ? 42.083  -21.337 10.707  1.00 72.93  ? 301 GLU C OE2 1 
ATOM   7305  N N   . LEU C 1 307 ? 40.006  -15.548 10.296  1.00 50.45  ? 302 LEU C N   1 
ATOM   7306  C CA  . LEU C 1 307 ? 39.689  -14.343 11.064  1.00 47.73  ? 302 LEU C CA  1 
ATOM   7307  C C   . LEU C 1 307 ? 38.216  -14.409 11.454  1.00 48.44  ? 302 LEU C C   1 
ATOM   7308  O O   . LEU C 1 307 ? 37.855  -14.240 12.625  1.00 49.48  ? 302 LEU C O   1 
ATOM   7309  C CB  . LEU C 1 307 ? 39.920  -13.097 10.216  1.00 45.78  ? 302 LEU C CB  1 
ATOM   7310  C CG  . LEU C 1 307 ? 40.381  -11.858 10.975  1.00 45.02  ? 302 LEU C CG  1 
ATOM   7311  C CD1 . LEU C 1 307 ? 40.111  -10.628 10.127  1.00 43.32  ? 302 LEU C CD1 1 
ATOM   7312  C CD2 . LEU C 1 307 ? 39.657  -11.763 12.304  1.00 45.01  ? 302 LEU C CD2 1 
ATOM   7313  N N   . VAL C 1 308 ? 37.376  -14.653 10.450  1.00 46.39  ? 303 VAL C N   1 
ATOM   7314  C CA  . VAL C 1 308 ? 35.941  -14.777 10.636  1.00 43.42  ? 303 VAL C CA  1 
ATOM   7315  C C   . VAL C 1 308 ? 35.660  -15.617 11.870  1.00 44.90  ? 303 VAL C C   1 
ATOM   7316  O O   . VAL C 1 308 ? 35.207  -15.098 12.887  1.00 46.62  ? 303 VAL C O   1 
ATOM   7317  C CB  . VAL C 1 308 ? 35.274  -15.459 9.414   1.00 41.18  ? 303 VAL C CB  1 
ATOM   7318  C CG1 . VAL C 1 308 ? 33.812  -15.761 9.704   1.00 37.92  ? 303 VAL C CG1 1 
ATOM   7319  C CG2 . VAL C 1 308 ? 35.390  -14.564 8.196   1.00 39.58  ? 303 VAL C CG2 1 
ATOM   7320  N N   . LYS C 1 309 ? 35.947  -16.913 11.778  1.00 46.06  ? 304 LYS C N   1 
ATOM   7321  C CA  . LYS C 1 309 ? 35.706  -17.843 12.874  1.00 45.82  ? 304 LYS C CA  1 
ATOM   7322  C C   . LYS C 1 309 ? 36.107  -17.328 14.250  1.00 46.06  ? 304 LYS C C   1 
ATOM   7323  O O   . LYS C 1 309 ? 35.444  -17.642 15.236  1.00 47.51  ? 304 LYS C O   1 
ATOM   7324  C CB  . LYS C 1 309 ? 36.397  -19.187 12.608  1.00 47.41  ? 304 LYS C CB  1 
ATOM   7325  C CG  . LYS C 1 309 ? 35.769  -20.010 11.480  1.00 49.00  ? 304 LYS C CG  1 
ATOM   7326  C CD  . LYS C 1 309 ? 36.313  -21.438 11.435  1.00 50.91  ? 304 LYS C CD  1 
ATOM   7327  C CE  . LYS C 1 309 ? 37.835  -21.467 11.272  1.00 52.48  ? 304 LYS C CE  1 
ATOM   7328  N NZ  . LYS C 1 309 ? 38.394  -22.858 11.164  1.00 51.90  ? 304 LYS C NZ  1 
ATOM   7329  N N   . ARG C 1 310 ? 37.173  -16.541 14.340  1.00 45.04  ? 305 ARG C N   1 
ATOM   7330  C CA  . ARG C 1 310 ? 37.572  -16.043 15.650  1.00 46.94  ? 305 ARG C CA  1 
ATOM   7331  C C   . ARG C 1 310 ? 37.098  -14.611 15.909  1.00 45.82  ? 305 ARG C C   1 
ATOM   7332  O O   . ARG C 1 310 ? 37.605  -13.923 16.798  1.00 45.92  ? 305 ARG C O   1 
ATOM   7333  C CB  . ARG C 1 310 ? 39.092  -16.124 15.817  1.00 50.62  ? 305 ARG C CB  1 
ATOM   7334  C CG  . ARG C 1 310 ? 39.867  -15.128 14.984  1.00 55.38  ? 305 ARG C CG  1 
ATOM   7335  C CD  . ARG C 1 310 ? 41.217  -14.817 15.613  1.00 59.13  ? 305 ARG C CD  1 
ATOM   7336  N NE  . ARG C 1 310 ? 41.904  -13.760 14.881  1.00 62.67  ? 305 ARG C NE  1 
ATOM   7337  C CZ  . ARG C 1 310 ? 42.551  -13.950 13.735  1.00 65.62  ? 305 ARG C CZ  1 
ATOM   7338  N NH1 . ARG C 1 310 ? 42.611  -15.167 13.192  1.00 64.92  ? 305 ARG C NH1 1 
ATOM   7339  N NH2 . ARG C 1 310 ? 43.118  -12.915 13.121  1.00 66.66  ? 305 ARG C NH2 1 
ATOM   7340  N N   . GLN C 1 311 ? 36.111  -14.167 15.141  1.00 43.39  ? 306 GLN C N   1 
ATOM   7341  C CA  . GLN C 1 311 ? 35.590  -12.814 15.293  1.00 41.02  ? 306 GLN C CA  1 
ATOM   7342  C C   . GLN C 1 311 ? 34.065  -12.729 15.175  1.00 41.37  ? 306 GLN C C   1 
ATOM   7343  O O   . GLN C 1 311 ? 33.457  -11.757 15.633  1.00 40.27  ? 306 GLN C O   1 
ATOM   7344  C CB  . GLN C 1 311 ? 36.249  -11.894 14.258  1.00 38.11  ? 306 GLN C CB  1 
ATOM   7345  C CG  . GLN C 1 311 ? 35.588  -10.552 14.124  1.00 33.57  ? 306 GLN C CG  1 
ATOM   7346  C CD  . GLN C 1 311 ? 36.338  -9.625  13.204  1.00 32.83  ? 306 GLN C CD  1 
ATOM   7347  O OE1 . GLN C 1 311 ? 37.444  -9.171  13.519  1.00 30.42  ? 306 GLN C OE1 1 
ATOM   7348  N NE2 . GLN C 1 311 ? 35.740  -9.330  12.054  1.00 33.06  ? 306 GLN C NE2 1 
ATOM   7349  N N   . CYS C 1 312 ? 33.455  -13.750 14.576  1.00 40.10  ? 307 CYS C N   1 
ATOM   7350  C CA  . CYS C 1 312 ? 32.011  -13.778 14.385  1.00 39.16  ? 307 CYS C CA  1 
ATOM   7351  C C   . CYS C 1 312 ? 31.467  -15.092 14.881  1.00 37.53  ? 307 CYS C C   1 
ATOM   7352  O O   . CYS C 1 312 ? 32.211  -16.055 15.017  1.00 38.12  ? 307 CYS C O   1 
ATOM   7353  C CB  . CYS C 1 312 ? 31.675  -13.639 12.905  1.00 40.88  ? 307 CYS C CB  1 
ATOM   7354  S SG  . CYS C 1 312 ? 32.646  -12.379 12.037  1.00 48.36  ? 307 CYS C SG  1 
ATOM   7355  N N   . THR C 1 313 ? 30.165  -15.130 15.143  1.00 36.67  ? 308 THR C N   1 
ATOM   7356  C CA  . THR C 1 313 ? 29.511  -16.347 15.618  1.00 34.74  ? 308 THR C CA  1 
ATOM   7357  C C   . THR C 1 313 ? 28.816  -17.030 14.454  1.00 32.70  ? 308 THR C C   1 
ATOM   7358  O O   . THR C 1 313 ? 28.292  -18.135 14.597  1.00 33.39  ? 308 THR C O   1 
ATOM   7359  C CB  . THR C 1 313 ? 28.441  -16.049 16.703  1.00 35.46  ? 308 THR C CB  1 
ATOM   7360  O OG1 . THR C 1 313 ? 27.352  -15.323 16.117  1.00 35.46  ? 308 THR C OG1 1 
ATOM   7361  C CG2 . THR C 1 313 ? 29.040  -15.236 17.851  1.00 34.42  ? 308 THR C CG2 1 
ATOM   7362  N N   . GLY C 1 314 ? 28.820  -16.358 13.304  1.00 32.49  ? 309 GLY C N   1 
ATOM   7363  C CA  . GLY C 1 314 ? 28.175  -16.884 12.112  1.00 31.54  ? 309 GLY C CA  1 
ATOM   7364  C C   . GLY C 1 314 ? 28.208  -15.864 10.989  1.00 31.37  ? 309 GLY C C   1 
ATOM   7365  O O   . GLY C 1 314 ? 28.946  -14.887 11.072  1.00 29.67  ? 309 GLY C O   1 
ATOM   7366  N N   . CYS C 1 315 ? 27.409  -16.074 9.947   1.00 34.10  ? 310 CYS C N   1 
ATOM   7367  C CA  . CYS C 1 315 ? 27.393  -15.153 8.809   1.00 38.21  ? 310 CYS C CA  1 
ATOM   7368  C C   . CYS C 1 315 ? 26.005  -14.797 8.303   1.00 36.24  ? 310 CYS C C   1 
ATOM   7369  O O   . CYS C 1 315 ? 25.046  -15.540 8.485   1.00 34.49  ? 310 CYS C O   1 
ATOM   7370  C CB  . CYS C 1 315 ? 28.195  -15.732 7.632   1.00 41.99  ? 310 CYS C CB  1 
ATOM   7371  S SG  . CYS C 1 315 ? 29.878  -16.310 8.030   1.00 50.42  ? 310 CYS C SG  1 
ATOM   7372  N N   . THR C 1 316 ? 25.944  -13.652 7.631   1.00 36.92  ? 311 THR C N   1 
ATOM   7373  C CA  . THR C 1 316 ? 24.730  -13.080 7.038   1.00 37.60  ? 311 THR C CA  1 
ATOM   7374  C C   . THR C 1 316 ? 24.316  -13.859 5.788   1.00 36.59  ? 311 THR C C   1 
ATOM   7375  O O   . THR C 1 316 ? 24.947  -14.843 5.420   1.00 37.56  ? 311 THR C O   1 
ATOM   7376  C CB  . THR C 1 316 ? 25.005  -11.602 6.654   1.00 37.77  ? 311 THR C CB  1 
ATOM   7377  O OG1 . THR C 1 316 ? 25.319  -10.864 7.839   1.00 39.64  ? 311 THR C OG1 1 
ATOM   7378  C CG2 . THR C 1 316 ? 23.814  -10.964 5.975   1.00 41.96  ? 311 THR C CG2 1 
ATOM   7379  N N   . GLY C 1 317 ? 23.255  -13.420 5.129   1.00 36.02  ? 312 GLY C N   1 
ATOM   7380  C CA  . GLY C 1 317 ? 22.825  -14.099 3.923   1.00 35.31  ? 312 GLY C CA  1 
ATOM   7381  C C   . GLY C 1 317 ? 23.442  -13.494 2.671   1.00 35.26  ? 312 GLY C C   1 
ATOM   7382  O O   . GLY C 1 317 ? 23.096  -13.899 1.561   1.00 33.56  ? 312 GLY C O   1 
ATOM   7383  N N   . MET C 1 318 ? 24.343  -12.523 2.842   1.00 34.74  ? 313 MET C N   1 
ATOM   7384  C CA  . MET C 1 318 ? 24.993  -11.883 1.702   1.00 35.82  ? 313 MET C CA  1 
ATOM   7385  C C   . MET C 1 318 ? 26.084  -12.736 1.045   1.00 35.20  ? 313 MET C C   1 
ATOM   7386  O O   . MET C 1 318 ? 27.228  -12.789 1.507   1.00 35.53  ? 313 MET C O   1 
ATOM   7387  C CB  . MET C 1 318 ? 25.587  -10.531 2.105   1.00 39.71  ? 313 MET C CB  1 
ATOM   7388  C CG  . MET C 1 318 ? 26.469  -9.916  1.018   1.00 44.82  ? 313 MET C CG  1 
ATOM   7389  S SD  . MET C 1 318 ? 26.936  -8.194  1.291   1.00 51.07  ? 313 MET C SD  1 
ATOM   7390  C CE  . MET C 1 318 ? 28.261  -8.361  2.580   1.00 54.53  ? 313 MET C CE  1 
ATOM   7391  N N   . VAL C 1 319 ? 25.718  -13.399 -0.043  1.00 32.68  ? 314 VAL C N   1 
ATOM   7392  C CA  . VAL C 1 319 ? 26.648  -14.233 -0.778  1.00 30.50  ? 314 VAL C CA  1 
ATOM   7393  C C   . VAL C 1 319 ? 27.097  -13.542 -2.062  1.00 32.05  ? 314 VAL C C   1 
ATOM   7394  O O   . VAL C 1 319 ? 26.264  -13.154 -2.886  1.00 31.09  ? 314 VAL C O   1 
ATOM   7395  C CB  . VAL C 1 319 ? 26.004  -15.555 -1.167  1.00 29.37  ? 314 VAL C CB  1 
ATOM   7396  C CG1 . VAL C 1 319 ? 27.026  -16.435 -1.862  1.00 28.23  ? 314 VAL C CG1 1 
ATOM   7397  C CG2 . VAL C 1 319 ? 25.445  -16.237 0.060   1.00 29.51  ? 314 VAL C CG2 1 
ATOM   7398  N N   . THR C 1 320 ? 28.410  -13.392 -2.231  1.00 31.80  ? 315 THR C N   1 
ATOM   7399  C CA  . THR C 1 320 ? 28.969  -12.764 -3.432  1.00 30.18  ? 315 THR C CA  1 
ATOM   7400  C C   . THR C 1 320 ? 29.614  -13.823 -4.324  1.00 32.45  ? 315 THR C C   1 
ATOM   7401  O O   . THR C 1 320 ? 30.276  -14.733 -3.837  1.00 32.27  ? 315 THR C O   1 
ATOM   7402  C CB  . THR C 1 320 ? 30.023  -11.704 -3.064  1.00 28.39  ? 315 THR C CB  1 
ATOM   7403  O OG1 . THR C 1 320 ? 29.386  -10.628 -2.360  1.00 25.85  ? 315 THR C OG1 1 
ATOM   7404  C CG2 . THR C 1 320 ? 30.711  -11.169 -4.315  1.00 24.65  ? 315 THR C CG2 1 
ATOM   7405  N N   . PHE C 1 321 ? 29.414  -13.728 -5.631  1.00 33.19  ? 316 PHE C N   1 
ATOM   7406  C CA  . PHE C 1 321 ? 30.020  -14.721 -6.501  1.00 34.66  ? 316 PHE C CA  1 
ATOM   7407  C C   . PHE C 1 321 ? 30.220  -14.176 -7.896  1.00 37.06  ? 316 PHE C C   1 
ATOM   7408  O O   . PHE C 1 321 ? 29.545  -13.234 -8.307  1.00 37.33  ? 316 PHE C O   1 
ATOM   7409  C CB  . PHE C 1 321 ? 29.164  -15.995 -6.534  1.00 34.83  ? 316 PHE C CB  1 
ATOM   7410  C CG  . PHE C 1 321 ? 27.985  -15.927 -7.471  1.00 35.31  ? 316 PHE C CG  1 
ATOM   7411  C CD1 . PHE C 1 321 ? 28.142  -16.178 -8.834  1.00 34.28  ? 316 PHE C CD1 1 
ATOM   7412  C CD2 . PHE C 1 321 ? 26.708  -15.649 -6.986  1.00 34.66  ? 316 PHE C CD2 1 
ATOM   7413  C CE1 . PHE C 1 321 ? 27.039  -16.160 -9.700  1.00 35.73  ? 316 PHE C CE1 1 
ATOM   7414  C CE2 . PHE C 1 321 ? 25.593  -15.628 -7.845  1.00 35.47  ? 316 PHE C CE2 1 
ATOM   7415  C CZ  . PHE C 1 321 ? 25.759  -15.885 -9.204  1.00 35.08  ? 316 PHE C CZ  1 
ATOM   7416  N N   . TYR C 1 322 ? 31.163  -14.773 -8.616  1.00 38.74  ? 317 TYR C N   1 
ATOM   7417  C CA  . TYR C 1 322 ? 31.475  -14.364 -9.982  1.00 38.29  ? 317 TYR C CA  1 
ATOM   7418  C C   . TYR C 1 322 ? 30.947  -15.398 -10.950 1.00 39.15  ? 317 TYR C C   1 
ATOM   7419  O O   . TYR C 1 322 ? 31.306  -16.573 -10.859 1.00 39.79  ? 317 TYR C O   1 
ATOM   7420  C CB  . TYR C 1 322 ? 32.983  -14.239 -10.162 1.00 37.72  ? 317 TYR C CB  1 
ATOM   7421  C CG  . TYR C 1 322 ? 33.604  -13.196 -9.272  1.00 37.66  ? 317 TYR C CG  1 
ATOM   7422  C CD1 . TYR C 1 322 ? 33.776  -13.416 -7.900  1.00 36.65  ? 317 TYR C CD1 1 
ATOM   7423  C CD2 . TYR C 1 322 ? 34.008  -11.974 -9.799  1.00 37.78  ? 317 TYR C CD2 1 
ATOM   7424  C CE1 . TYR C 1 322 ? 34.342  -12.437 -7.082  1.00 35.33  ? 317 TYR C CE1 1 
ATOM   7425  C CE2 . TYR C 1 322 ? 34.570  -10.996 -8.997  1.00 37.35  ? 317 TYR C CE2 1 
ATOM   7426  C CZ  . TYR C 1 322 ? 34.739  -11.231 -7.648  1.00 37.05  ? 317 TYR C CZ  1 
ATOM   7427  O OH  . TYR C 1 322 ? 35.355  -10.259 -6.905  1.00 38.23  ? 317 TYR C OH  1 
ATOM   7428  N N   . ILE C 1 323 ? 30.094  -14.974 -11.875 1.00 39.27  ? 318 ILE C N   1 
ATOM   7429  C CA  . ILE C 1 323 ? 29.564  -15.917 -12.835 1.00 40.25  ? 318 ILE C CA  1 
ATOM   7430  C C   . ILE C 1 323 ? 30.617  -16.186 -13.907 1.00 42.91  ? 318 ILE C C   1 
ATOM   7431  O O   . ILE C 1 323 ? 31.309  -15.276 -14.364 1.00 41.81  ? 318 ILE C O   1 
ATOM   7432  C CB  . ILE C 1 323 ? 28.266  -15.403 -13.502 1.00 39.97  ? 318 ILE C CB  1 
ATOM   7433  C CG1 . ILE C 1 323 ? 27.599  -16.571 -14.249 1.00 41.93  ? 318 ILE C CG1 1 
ATOM   7434  C CG2 . ILE C 1 323 ? 28.573  -14.231 -14.445 1.00 37.09  ? 318 ILE C CG2 1 
ATOM   7435  C CD1 . ILE C 1 323 ? 26.153  -16.329 -14.689 1.00 41.19  ? 318 ILE C CD1 1 
ATOM   7436  N N   . LYS C 1 324 ? 30.761  -17.449 -14.282 1.00 45.96  ? 319 LYS C N   1 
ATOM   7437  C CA  . LYS C 1 324 ? 31.722  -17.811 -15.311 1.00 49.03  ? 319 LYS C CA  1 
ATOM   7438  C C   . LYS C 1 324 ? 31.224  -17.161 -16.606 1.00 49.07  ? 319 LYS C C   1 
ATOM   7439  O O   . LYS C 1 324 ? 30.038  -17.258 -16.933 1.00 50.19  ? 319 LYS C O   1 
ATOM   7440  C CB  . LYS C 1 324 ? 31.759  -19.335 -15.466 1.00 52.47  ? 319 LYS C CB  1 
ATOM   7441  C CG  . LYS C 1 324 ? 33.142  -19.954 -15.359 1.00 57.59  ? 319 LYS C CG  1 
ATOM   7442  C CD  . LYS C 1 324 ? 33.053  -21.476 -15.330 1.00 61.61  ? 319 LYS C CD  1 
ATOM   7443  C CE  . LYS C 1 324 ? 34.430  -22.116 -15.241 1.00 64.68  ? 319 LYS C CE  1 
ATOM   7444  N NZ  . LYS C 1 324 ? 35.187  -21.628 -14.055 1.00 68.22  ? 319 LYS C NZ  1 
ATOM   7445  N N   . GLY C 1 325 ? 32.106  -16.473 -17.327 1.00 47.89  ? 320 GLY C N   1 
ATOM   7446  C CA  . GLY C 1 325 ? 31.678  -15.862 -18.574 1.00 46.37  ? 320 GLY C CA  1 
ATOM   7447  C C   . GLY C 1 325 ? 31.873  -14.372 -18.761 1.00 45.15  ? 320 GLY C C   1 
ATOM   7448  O O   . GLY C 1 325 ? 32.883  -13.801 -18.352 1.00 45.91  ? 320 GLY C O   1 
ATOM   7449  N N   . THR C 1 326 ? 30.885  -13.745 -19.388 1.00 44.43  ? 321 THR C N   1 
ATOM   7450  C CA  . THR C 1 326 ? 30.924  -12.320 -19.684 1.00 45.56  ? 321 THR C CA  1 
ATOM   7451  C C   . THR C 1 326 ? 29.776  -11.553 -19.060 1.00 45.52  ? 321 THR C C   1 
ATOM   7452  O O   . THR C 1 326 ? 28.822  -12.142 -18.557 1.00 45.44  ? 321 THR C O   1 
ATOM   7453  C CB  . THR C 1 326 ? 30.858  -12.112 -21.190 1.00 45.53  ? 321 THR C CB  1 
ATOM   7454  O OG1 . THR C 1 326 ? 31.944  -12.820 -21.789 1.00 48.58  ? 321 THR C OG1 1 
ATOM   7455  C CG2 . THR C 1 326 ? 30.942  -10.632 -21.553 1.00 47.30  ? 321 THR C CG2 1 
ATOM   7456  N N   . LEU C 1 327 ? 29.874  -10.229 -19.101 1.00 45.23  ? 322 LEU C N   1 
ATOM   7457  C CA  . LEU C 1 327 ? 28.827  -9.372  -18.572 1.00 46.56  ? 322 LEU C CA  1 
ATOM   7458  C C   . LEU C 1 327 ? 27.484  -9.828  -19.138 1.00 51.34  ? 322 LEU C C   1 
ATOM   7459  O O   . LEU C 1 327 ? 26.440  -9.709  -18.485 1.00 51.14  ? 322 LEU C O   1 
ATOM   7460  C CB  . LEU C 1 327 ? 29.089  -7.928  -18.982 1.00 41.27  ? 322 LEU C CB  1 
ATOM   7461  C CG  . LEU C 1 327 ? 27.948  -6.938  -18.761 1.00 37.80  ? 322 LEU C CG  1 
ATOM   7462  C CD1 . LEU C 1 327 ? 27.593  -6.817  -17.288 1.00 36.22  ? 322 LEU C CD1 1 
ATOM   7463  C CD2 . LEU C 1 327 ? 28.380  -5.609  -19.305 1.00 35.16  ? 322 LEU C CD2 1 
ATOM   7464  N N   . GLN C 1 328 ? 27.518  -10.365 -20.355 1.00 56.76  ? 323 GLN C N   1 
ATOM   7465  C CA  . GLN C 1 328 ? 26.298  -10.816 -20.995 1.00 60.77  ? 323 GLN C CA  1 
ATOM   7466  C C   . GLN C 1 328 ? 25.742  -12.059 -20.326 1.00 57.68  ? 323 GLN C C   1 
ATOM   7467  O O   . GLN C 1 328 ? 24.534  -12.261 -20.323 1.00 59.24  ? 323 GLN C O   1 
ATOM   7468  C CB  . GLN C 1 328 ? 26.525  -11.077 -22.483 1.00 70.50  ? 323 GLN C CB  1 
ATOM   7469  C CG  . GLN C 1 328 ? 25.230  -11.002 -23.293 1.00 86.37  ? 323 GLN C CG  1 
ATOM   7470  C CD  . GLN C 1 328 ? 25.422  -11.264 -24.781 1.00 95.16  ? 323 GLN C CD  1 
ATOM   7471  O OE1 . GLN C 1 328 ? 24.472  -11.171 -25.564 1.00 101.44 ? 323 GLN C OE1 1 
ATOM   7472  N NE2 . GLN C 1 328 ? 26.648  -11.596 -25.177 1.00 100.46 ? 323 GLN C NE2 1 
ATOM   7473  N N   . HIS C 1 329 ? 26.607  -12.896 -19.761 1.00 55.27  ? 324 HIS C N   1 
ATOM   7474  C CA  . HIS C 1 329 ? 26.128  -14.096 -19.082 1.00 52.28  ? 324 HIS C CA  1 
ATOM   7475  C C   . HIS C 1 329 ? 25.483  -13.707 -17.761 1.00 49.73  ? 324 HIS C C   1 
ATOM   7476  O O   . HIS C 1 329 ? 24.467  -14.278 -17.372 1.00 48.05  ? 324 HIS C O   1 
ATOM   7477  C CB  . HIS C 1 329 ? 27.263  -15.077 -18.803 1.00 53.62  ? 324 HIS C CB  1 
ATOM   7478  C CG  . HIS C 1 329 ? 27.885  -15.650 -20.034 1.00 56.39  ? 324 HIS C CG  1 
ATOM   7479  N ND1 . HIS C 1 329 ? 28.689  -14.911 -20.875 1.00 57.50  ? 324 HIS C ND1 1 
ATOM   7480  C CD2 . HIS C 1 329 ? 27.838  -16.898 -20.557 1.00 57.00  ? 324 HIS C CD2 1 
ATOM   7481  C CE1 . HIS C 1 329 ? 29.114  -15.681 -21.861 1.00 57.88  ? 324 HIS C CE1 1 
ATOM   7482  N NE2 . HIS C 1 329 ? 28.612  -16.891 -21.692 1.00 57.07  ? 324 HIS C NE2 1 
ATOM   7483  N N   . ALA C 1 330 ? 26.080  -12.740 -17.070 1.00 48.22  ? 325 ALA C N   1 
ATOM   7484  C CA  . ALA C 1 330 ? 25.537  -12.280 -15.798 1.00 49.68  ? 325 ALA C CA  1 
ATOM   7485  C C   . ALA C 1 330 ? 24.129  -11.745 -16.036 1.00 51.63  ? 325 ALA C C   1 
ATOM   7486  O O   . ALA C 1 330 ? 23.226  -11.930 -15.212 1.00 49.92  ? 325 ALA C O   1 
ATOM   7487  C CB  . ALA C 1 330 ? 26.418  -11.193 -15.217 1.00 46.95  ? 325 ALA C CB  1 
ATOM   7488  N N   . GLU C 1 331 ? 23.956  -11.079 -17.175 1.00 55.02  ? 326 GLU C N   1 
ATOM   7489  C CA  . GLU C 1 331 ? 22.666  -10.527 -17.562 1.00 58.28  ? 326 GLU C CA  1 
ATOM   7490  C C   . GLU C 1 331 ? 21.654  -11.641 -17.793 1.00 54.67  ? 326 GLU C C   1 
ATOM   7491  O O   . GLU C 1 331 ? 20.532  -11.577 -17.295 1.00 52.83  ? 326 GLU C O   1 
ATOM   7492  C CB  . GLU C 1 331 ? 22.811  -9.690  -18.833 1.00 68.12  ? 326 GLU C CB  1 
ATOM   7493  C CG  . GLU C 1 331 ? 23.107  -8.230  -18.570 1.00 83.72  ? 326 GLU C CG  1 
ATOM   7494  C CD  . GLU C 1 331 ? 21.997  -7.559  -17.778 1.00 92.64  ? 326 GLU C CD  1 
ATOM   7495  O OE1 . GLU C 1 331 ? 20.845  -7.537  -18.264 1.00 98.94  ? 326 GLU C OE1 1 
ATOM   7496  O OE2 . GLU C 1 331 ? 22.272  -7.057  -16.667 1.00 98.25  ? 326 GLU C OE2 1 
ATOM   7497  N N   . ILE C 1 332 ? 22.049  -12.661 -18.550 1.00 51.21  ? 327 ILE C N   1 
ATOM   7498  C CA  . ILE C 1 332 ? 21.156  -13.785 -18.824 1.00 49.24  ? 327 ILE C CA  1 
ATOM   7499  C C   . ILE C 1 332 ? 20.716  -14.367 -17.485 1.00 51.14  ? 327 ILE C C   1 
ATOM   7500  O O   . ILE C 1 332 ? 19.527  -14.582 -17.252 1.00 51.76  ? 327 ILE C O   1 
ATOM   7501  C CB  . ILE C 1 332 ? 21.856  -14.911 -19.636 1.00 47.31  ? 327 ILE C CB  1 
ATOM   7502  C CG1 . ILE C 1 332 ? 22.449  -14.357 -20.943 1.00 46.61  ? 327 ILE C CG1 1 
ATOM   7503  C CG2 . ILE C 1 332 ? 20.867  -16.014 -19.936 1.00 41.89  ? 327 ILE C CG2 1 
ATOM   7504  C CD1 . ILE C 1 332 ? 21.438  -13.810 -21.921 1.00 45.38  ? 327 ILE C CD1 1 
ATOM   7505  N N   . PHE C 1 333 ? 21.688  -14.613 -16.607 1.00 51.60  ? 328 PHE C N   1 
ATOM   7506  C CA  . PHE C 1 333 ? 21.415  -15.156 -15.283 1.00 49.97  ? 328 PHE C CA  1 
ATOM   7507  C C   . PHE C 1 333 ? 20.325  -14.351 -14.575 1.00 48.98  ? 328 PHE C C   1 
ATOM   7508  O O   . PHE C 1 333 ? 19.288  -14.898 -14.209 1.00 48.49  ? 328 PHE C O   1 
ATOM   7509  C CB  . PHE C 1 333 ? 22.693  -15.153 -14.434 1.00 51.13  ? 328 PHE C CB  1 
ATOM   7510  C CG  . PHE C 1 333 ? 22.474  -15.568 -13.001 1.00 51.57  ? 328 PHE C CG  1 
ATOM   7511  C CD1 . PHE C 1 333 ? 22.016  -16.842 -12.692 1.00 51.87  ? 328 PHE C CD1 1 
ATOM   7512  C CD2 . PHE C 1 333 ? 22.720  -14.679 -11.961 1.00 52.48  ? 328 PHE C CD2 1 
ATOM   7513  C CE1 . PHE C 1 333 ? 21.805  -17.229 -11.367 1.00 51.75  ? 328 PHE C CE1 1 
ATOM   7514  C CE2 . PHE C 1 333 ? 22.513  -15.057 -10.630 1.00 52.73  ? 328 PHE C CE2 1 
ATOM   7515  C CZ  . PHE C 1 333 ? 22.054  -16.335 -10.335 1.00 51.40  ? 328 PHE C CZ  1 
ATOM   7516  N N   . LEU C 1 334 ? 20.557  -13.053 -14.398 1.00 48.16  ? 329 LEU C N   1 
ATOM   7517  C CA  . LEU C 1 334 ? 19.590  -12.194 -13.717 1.00 48.49  ? 329 LEU C CA  1 
ATOM   7518  C C   . LEU C 1 334 ? 18.190  -12.201 -14.315 1.00 50.65  ? 329 LEU C C   1 
ATOM   7519  O O   . LEU C 1 334 ? 17.198  -12.168 -13.581 1.00 50.55  ? 329 LEU C O   1 
ATOM   7520  C CB  . LEU C 1 334 ? 20.093  -10.756 -13.667 1.00 45.26  ? 329 LEU C CB  1 
ATOM   7521  C CG  . LEU C 1 334 ? 21.320  -10.511 -12.792 1.00 44.09  ? 329 LEU C CG  1 
ATOM   7522  C CD1 . LEU C 1 334 ? 21.620  -9.033  -12.794 1.00 43.82  ? 329 LEU C CD1 1 
ATOM   7523  C CD2 . LEU C 1 334 ? 21.072  -10.992 -11.368 1.00 42.40  ? 329 LEU C CD2 1 
ATOM   7524  N N   . LYS C 1 335 ? 18.108  -12.234 -15.641 1.00 51.97  ? 330 LYS C N   1 
ATOM   7525  C CA  . LYS C 1 335 ? 16.815  -12.232 -16.310 1.00 53.13  ? 330 LYS C CA  1 
ATOM   7526  C C   . LYS C 1 335 ? 16.090  -13.555 -16.142 1.00 51.14  ? 330 LYS C C   1 
ATOM   7527  O O   . LYS C 1 335 ? 14.859  -13.599 -16.169 1.00 49.64  ? 330 LYS C O   1 
ATOM   7528  C CB  . LYS C 1 335 ? 16.986  -11.925 -17.798 1.00 58.97  ? 330 LYS C CB  1 
ATOM   7529  C CG  . LYS C 1 335 ? 17.527  -10.532 -18.088 1.00 66.68  ? 330 LYS C CG  1 
ATOM   7530  C CD  . LYS C 1 335 ? 17.722  -10.326 -19.586 1.00 73.64  ? 330 LYS C CD  1 
ATOM   7531  C CE  . LYS C 1 335 ? 18.441  -9.019  -19.884 1.00 77.31  ? 330 LYS C CE  1 
ATOM   7532  N NZ  . LYS C 1 335 ? 17.706  -7.859  -19.313 1.00 80.84  ? 330 LYS C NZ  1 
ATOM   7533  N N   . ASN C 1 336 ? 16.850  -14.630 -15.958 1.00 49.27  ? 331 ASN C N   1 
ATOM   7534  C CA  . ASN C 1 336 ? 16.259  -15.952 -15.798 1.00 47.26  ? 331 ASN C CA  1 
ATOM   7535  C C   . ASN C 1 336 ? 15.771  -16.269 -14.391 1.00 46.96  ? 331 ASN C C   1 
ATOM   7536  O O   . ASN C 1 336 ? 14.889  -17.115 -14.214 1.00 48.11  ? 331 ASN C O   1 
ATOM   7537  C CB  . ASN C 1 336 ? 17.240  -17.021 -16.253 1.00 46.97  ? 331 ASN C CB  1 
ATOM   7538  C CG  . ASN C 1 336 ? 17.207  -17.226 -17.746 1.00 47.86  ? 331 ASN C CG  1 
ATOM   7539  O OD1 . ASN C 1 336 ? 16.183  -17.623 -18.306 1.00 48.81  ? 331 ASN C OD1 1 
ATOM   7540  N ND2 . ASN C 1 336 ? 18.324  -16.956 -18.405 1.00 47.04  ? 331 ASN C ND2 1 
ATOM   7541  N N   . LEU C 1 337 ? 16.341  -15.599 -13.390 1.00 44.58  ? 332 LEU C N   1 
ATOM   7542  C CA  . LEU C 1 337 ? 15.931  -15.821 -12.006 1.00 40.35  ? 332 LEU C CA  1 
ATOM   7543  C C   . LEU C 1 337 ? 14.419  -15.672 -11.903 1.00 40.21  ? 332 LEU C C   1 
ATOM   7544  O O   . LEU C 1 337 ? 13.843  -14.712 -12.417 1.00 40.97  ? 332 LEU C O   1 
ATOM   7545  C CB  . LEU C 1 337 ? 16.625  -14.820 -11.076 1.00 35.69  ? 332 LEU C CB  1 
ATOM   7546  C CG  . LEU C 1 337 ? 18.107  -15.078 -10.801 1.00 32.04  ? 332 LEU C CG  1 
ATOM   7547  C CD1 . LEU C 1 337 ? 18.719  -13.893 -10.093 1.00 28.00  ? 332 LEU C CD1 1 
ATOM   7548  C CD2 . LEU C 1 337 ? 18.254  -16.357 -9.979  1.00 29.90  ? 332 LEU C CD2 1 
ATOM   7549  N N   . LYS C 1 338 ? 13.779  -16.631 -11.247 1.00 40.85  ? 333 LYS C N   1 
ATOM   7550  C CA  . LYS C 1 338 ? 12.336  -16.605 -11.079 1.00 41.80  ? 333 LYS C CA  1 
ATOM   7551  C C   . LYS C 1 338 ? 11.920  -16.510 -9.610  1.00 40.82  ? 333 LYS C C   1 
ATOM   7552  O O   . LYS C 1 338 ? 10.842  -16.003 -9.309  1.00 41.21  ? 333 LYS C O   1 
ATOM   7553  C CB  . LYS C 1 338 ? 11.732  -17.845 -11.730 1.00 43.72  ? 333 LYS C CB  1 
ATOM   7554  C CG  . LYS C 1 338 ? 11.894  -17.851 -13.245 1.00 50.70  ? 333 LYS C CG  1 
ATOM   7555  C CD  . LYS C 1 338 ? 12.270  -19.229 -13.794 1.00 56.20  ? 333 LYS C CD  1 
ATOM   7556  C CE  . LYS C 1 338 ? 11.242  -20.302 -13.434 1.00 60.26  ? 333 LYS C CE  1 
ATOM   7557  N NZ  . LYS C 1 338 ? 11.680  -21.664 -13.884 1.00 63.30  ? 333 LYS C NZ  1 
ATOM   7558  N N   . LEU C 1 339 ? 12.774  -16.989 -8.700  1.00 39.64  ? 334 LEU C N   1 
ATOM   7559  C CA  . LEU C 1 339 ? 12.482  -16.942 -7.263  1.00 37.79  ? 334 LEU C CA  1 
ATOM   7560  C C   . LEU C 1 339 ? 13.161  -15.722 -6.666  1.00 38.26  ? 334 LEU C C   1 
ATOM   7561  O O   . LEU C 1 339 ? 12.539  -14.991 -5.899  1.00 39.00  ? 334 LEU C O   1 
ATOM   7562  C CB  . LEU C 1 339 ? 12.976  -18.213 -6.557  1.00 38.57  ? 334 LEU C CB  1 
ATOM   7563  C CG  . LEU C 1 339 ? 12.502  -18.551 -5.131  1.00 37.30  ? 334 LEU C CG  1 
ATOM   7564  C CD1 . LEU C 1 339 ? 13.057  -17.581 -4.135  1.00 40.02  ? 334 LEU C CD1 1 
ATOM   7565  C CD2 . LEU C 1 339 ? 11.000  -18.523 -5.072  1.00 40.08  ? 334 LEU C CD2 1 
ATOM   7566  N N   . PHE C 1 340 ? 14.433  -15.505 -7.011  1.00 37.07  ? 335 PHE C N   1 
ATOM   7567  C CA  . PHE C 1 340 ? 15.162  -14.333 -6.516  1.00 35.57  ? 335 PHE C CA  1 
ATOM   7568  C C   . PHE C 1 340 ? 14.556  -13.099 -7.155  1.00 37.77  ? 335 PHE C C   1 
ATOM   7569  O O   . PHE C 1 340 ? 14.061  -13.139 -8.287  1.00 36.55  ? 335 PHE C O   1 
ATOM   7570  C CB  . PHE C 1 340 ? 16.650  -14.376 -6.881  1.00 32.56  ? 335 PHE C CB  1 
ATOM   7571  C CG  . PHE C 1 340 ? 17.475  -15.222 -5.968  1.00 29.89  ? 335 PHE C CG  1 
ATOM   7572  C CD1 . PHE C 1 340 ? 17.380  -16.609 -6.004  1.00 29.60  ? 335 PHE C CD1 1 
ATOM   7573  C CD2 . PHE C 1 340 ? 18.339  -14.634 -5.062  1.00 30.54  ? 335 PHE C CD2 1 
ATOM   7574  C CE1 . PHE C 1 340 ? 18.135  -17.402 -5.146  1.00 30.94  ? 335 PHE C CE1 1 
ATOM   7575  C CE2 . PHE C 1 340 ? 19.103  -15.413 -4.196  1.00 32.73  ? 335 PHE C CE2 1 
ATOM   7576  C CZ  . PHE C 1 340 ? 19.001  -16.804 -4.237  1.00 32.46  ? 335 PHE C CZ  1 
ATOM   7577  N N   . THR C 1 341 ? 14.617  -11.997 -6.424  1.00 38.77  ? 336 THR C N   1 
ATOM   7578  C CA  . THR C 1 341 ? 14.068  -10.735 -6.886  1.00 38.51  ? 336 THR C CA  1 
ATOM   7579  C C   . THR C 1 341 ? 15.203  -9.747  -7.153  1.00 41.05  ? 336 THR C C   1 
ATOM   7580  O O   . THR C 1 341 ? 16.118  -9.617  -6.336  1.00 42.89  ? 336 THR C O   1 
ATOM   7581  C CB  . THR C 1 341 ? 13.123  -10.182 -5.816  1.00 38.25  ? 336 THR C CB  1 
ATOM   7582  O OG1 . THR C 1 341 ? 11.993  -11.052 -5.702  1.00 39.13  ? 336 THR C OG1 1 
ATOM   7583  C CG2 . THR C 1 341 ? 12.662  -8.802  -6.163  1.00 38.76  ? 336 THR C CG2 1 
ATOM   7584  N N   . LEU C 1 342 ? 15.166  -9.067  -8.296  1.00 40.80  ? 337 LEU C N   1 
ATOM   7585  C CA  . LEU C 1 342 ? 16.215  -8.104  -8.606  1.00 40.22  ? 337 LEU C CA  1 
ATOM   7586  C C   . LEU C 1 342 ? 16.015  -6.870  -7.745  1.00 39.70  ? 337 LEU C C   1 
ATOM   7587  O O   . LEU C 1 342 ? 14.934  -6.297  -7.730  1.00 40.15  ? 337 LEU C O   1 
ATOM   7588  C CB  . LEU C 1 342 ? 16.185  -7.730  -10.087 1.00 41.83  ? 337 LEU C CB  1 
ATOM   7589  C CG  . LEU C 1 342 ? 16.362  -8.917  -11.039 1.00 45.09  ? 337 LEU C CG  1 
ATOM   7590  C CD1 . LEU C 1 342 ? 16.411  -8.418  -12.463 1.00 46.52  ? 337 LEU C CD1 1 
ATOM   7591  C CD2 . LEU C 1 342 ? 17.646  -9.666  -10.715 1.00 47.70  ? 337 LEU C CD2 1 
ATOM   7592  N N   . ALA C 1 343 ? 17.056  -6.470  -7.017  1.00 39.41  ? 338 ALA C N   1 
ATOM   7593  C CA  . ALA C 1 343 ? 16.966  -5.305  -6.145  1.00 39.52  ? 338 ALA C CA  1 
ATOM   7594  C C   . ALA C 1 343 ? 18.351  -4.890  -5.647  1.00 40.94  ? 338 ALA C C   1 
ATOM   7595  O O   . ALA C 1 343 ? 19.265  -5.709  -5.620  1.00 39.81  ? 338 ALA C O   1 
ATOM   7596  C CB  . ALA C 1 343 ? 16.043  -5.620  -4.965  1.00 36.57  ? 338 ALA C CB  1 
ATOM   7597  N N   . GLU C 1 344 ? 18.503  -3.621  -5.256  1.00 44.19  ? 339 GLU C N   1 
ATOM   7598  C CA  . GLU C 1 344 ? 19.791  -3.109  -4.764  1.00 47.83  ? 339 GLU C CA  1 
ATOM   7599  C C   . GLU C 1 344 ? 19.876  -3.047  -3.247  1.00 46.42  ? 339 GLU C C   1 
ATOM   7600  O O   . GLU C 1 344 ? 20.922  -2.727  -2.681  1.00 45.40  ? 339 GLU C O   1 
ATOM   7601  C CB  . GLU C 1 344 ? 20.076  -1.707  -5.308  1.00 51.80  ? 339 GLU C CB  1 
ATOM   7602  C CG  . GLU C 1 344 ? 20.384  -1.644  -6.788  1.00 60.54  ? 339 GLU C CG  1 
ATOM   7603  C CD  . GLU C 1 344 ? 20.825  -0.258  -7.220  1.00 64.57  ? 339 GLU C CD  1 
ATOM   7604  O OE1 . GLU C 1 344 ? 20.638  0.082   -8.411  1.00 68.05  ? 339 GLU C OE1 1 
ATOM   7605  O OE2 . GLU C 1 344 ? 21.366  0.485   -6.369  1.00 66.24  ? 339 GLU C OE2 1 
ATOM   7606  N N   . SER C 1 345 ? 18.770  -3.337  -2.584  1.00 45.56  ? 340 SER C N   1 
ATOM   7607  C CA  . SER C 1 345 ? 18.764  -3.307  -1.136  1.00 45.12  ? 340 SER C CA  1 
ATOM   7608  C C   . SER C 1 345 ? 19.123  -4.692  -0.623  1.00 45.01  ? 340 SER C C   1 
ATOM   7609  O O   . SER C 1 345 ? 19.270  -5.634  -1.407  1.00 43.72  ? 340 SER C O   1 
ATOM   7610  C CB  . SER C 1 345 ? 17.379  -2.900  -0.632  1.00 44.50  ? 340 SER C CB  1 
ATOM   7611  O OG  . SER C 1 345 ? 16.371  -3.769  -1.123  1.00 44.71  ? 340 SER C OG  1 
ATOM   7612  N N   . LEU C 1 346 ? 19.284  -4.815  0.690   1.00 44.61  ? 341 LEU C N   1 
ATOM   7613  C CA  . LEU C 1 346 ? 19.587  -6.110  1.279   1.00 44.13  ? 341 LEU C CA  1 
ATOM   7614  C C   . LEU C 1 346 ? 18.942  -6.274  2.641   1.00 42.83  ? 341 LEU C C   1 
ATOM   7615  O O   . LEU C 1 346 ? 18.838  -5.315  3.405   1.00 40.94  ? 341 LEU C O   1 
ATOM   7616  C CB  . LEU C 1 346 ? 21.105  -6.332  1.392   1.00 43.54  ? 341 LEU C CB  1 
ATOM   7617  C CG  . LEU C 1 346 ? 21.945  -5.433  2.286   1.00 42.61  ? 341 LEU C CG  1 
ATOM   7618  C CD1 . LEU C 1 346 ? 23.389  -5.890  2.245   1.00 42.67  ? 341 LEU C CD1 1 
ATOM   7619  C CD2 . LEU C 1 346 ? 21.832  -4.004  1.810   1.00 44.94  ? 341 LEU C CD2 1 
ATOM   7620  N N   . GLY C 1 347 ? 18.468  -7.484  2.919   1.00 41.76  ? 342 GLY C N   1 
ATOM   7621  C CA  . GLY C 1 347 ? 17.892  -7.739  4.216   1.00 41.89  ? 342 GLY C CA  1 
ATOM   7622  C C   . GLY C 1 347 ? 16.488  -8.274  4.386   1.00 42.32  ? 342 GLY C C   1 
ATOM   7623  O O   . GLY C 1 347 ? 16.172  -8.794  5.451   1.00 45.65  ? 342 GLY C O   1 
ATOM   7624  N N   . GLY C 1 348 ? 15.625  -8.180  3.393   1.00 40.34  ? 343 GLY C N   1 
ATOM   7625  C CA  . GLY C 1 348 ? 14.283  -8.688  3.641   1.00 40.31  ? 343 GLY C CA  1 
ATOM   7626  C C   . GLY C 1 348 ? 14.154  -10.192 3.866   1.00 37.90  ? 343 GLY C C   1 
ATOM   7627  O O   . GLY C 1 348 ? 15.145  -10.922 3.929   1.00 37.46  ? 343 GLY C O   1 
ATOM   7628  N N   . PHE C 1 349 ? 12.918  -10.656 3.999   1.00 35.57  ? 344 PHE C N   1 
ATOM   7629  C CA  . PHE C 1 349 ? 12.657  -12.079 4.163   1.00 35.69  ? 344 PHE C CA  1 
ATOM   7630  C C   . PHE C 1 349 ? 12.806  -12.711 2.781   1.00 36.74  ? 344 PHE C C   1 
ATOM   7631  O O   . PHE C 1 349 ? 12.894  -13.931 2.623   1.00 35.39  ? 344 PHE C O   1 
ATOM   7632  C CB  . PHE C 1 349 ? 11.214  -12.315 4.620   1.00 32.10  ? 344 PHE C CB  1 
ATOM   7633  C CG  . PHE C 1 349 ? 10.905  -11.795 5.989   1.00 29.59  ? 344 PHE C CG  1 
ATOM   7634  C CD1 . PHE C 1 349 ? 11.916  -11.565 6.921   1.00 29.44  ? 344 PHE C CD1 1 
ATOM   7635  C CD2 . PHE C 1 349 ? 9.583   -11.603 6.375   1.00 27.75  ? 344 PHE C CD2 1 
ATOM   7636  C CE1 . PHE C 1 349 ? 11.604  -11.159 8.218   1.00 26.91  ? 344 PHE C CE1 1 
ATOM   7637  C CE2 . PHE C 1 349 ? 9.265   -11.199 7.658   1.00 25.40  ? 344 PHE C CE2 1 
ATOM   7638  C CZ  . PHE C 1 349 ? 10.277  -10.978 8.582   1.00 26.41  ? 344 PHE C CZ  1 
ATOM   7639  N N   . GLU C 1 350 ? 12.822  -11.835 1.791   1.00 38.94  ? 345 GLU C N   1 
ATOM   7640  C CA  . GLU C 1 350 ? 12.883  -12.180 0.385   1.00 42.45  ? 345 GLU C CA  1 
ATOM   7641  C C   . GLU C 1 350 ? 14.312  -12.232 -0.160  1.00 39.41  ? 345 GLU C C   1 
ATOM   7642  O O   . GLU C 1 350 ? 15.122  -11.365 0.144   1.00 40.38  ? 345 GLU C O   1 
ATOM   7643  C CB  . GLU C 1 350 ? 12.051  -11.121 -0.322  1.00 51.47  ? 345 GLU C CB  1 
ATOM   7644  C CG  . GLU C 1 350 ? 11.700  -11.320 -1.757  1.00 64.85  ? 345 GLU C CG  1 
ATOM   7645  C CD  . GLU C 1 350 ? 10.505  -10.456 -2.120  1.00 72.00  ? 345 GLU C CD  1 
ATOM   7646  O OE1 . GLU C 1 350 ? 10.275  -10.187 -3.322  1.00 78.03  ? 345 GLU C OE1 1 
ATOM   7647  O OE2 . GLU C 1 350 ? 9.787   -10.053 -1.179  1.00 74.90  ? 345 GLU C OE2 1 
ATOM   7648  N N   . SER C 1 351 ? 14.626  -13.245 -0.962  1.00 36.22  ? 346 SER C N   1 
ATOM   7649  C CA  . SER C 1 351 ? 15.970  -13.358 -1.526  1.00 33.86  ? 346 SER C CA  1 
ATOM   7650  C C   . SER C 1 351 ? 16.156  -12.455 -2.732  1.00 33.21  ? 346 SER C C   1 
ATOM   7651  O O   . SER C 1 351 ? 15.380  -12.516 -3.689  1.00 34.09  ? 346 SER C O   1 
ATOM   7652  C CB  . SER C 1 351 ? 16.273  -14.801 -1.918  1.00 33.61  ? 346 SER C CB  1 
ATOM   7653  O OG  . SER C 1 351 ? 16.432  -15.594 -0.759  1.00 33.49  ? 346 SER C OG  1 
ATOM   7654  N N   . LEU C 1 352 ? 17.203  -11.633 -2.687  1.00 31.37  ? 347 LEU C N   1 
ATOM   7655  C CA  . LEU C 1 352 ? 17.493  -10.685 -3.758  1.00 30.70  ? 347 LEU C CA  1 
ATOM   7656  C C   . LEU C 1 352 ? 18.795  -10.973 -4.521  1.00 31.06  ? 347 LEU C C   1 
ATOM   7657  O O   . LEU C 1 352 ? 19.696  -11.659 -4.021  1.00 31.24  ? 347 LEU C O   1 
ATOM   7658  C CB  . LEU C 1 352 ? 17.554  -9.270  -3.173  1.00 30.91  ? 347 LEU C CB  1 
ATOM   7659  C CG  . LEU C 1 352 ? 16.493  -8.926  -2.116  1.00 31.86  ? 347 LEU C CG  1 
ATOM   7660  C CD1 . LEU C 1 352 ? 16.830  -7.593  -1.484  1.00 30.70  ? 347 LEU C CD1 1 
ATOM   7661  C CD2 . LEU C 1 352 ? 15.098  -8.902  -2.744  1.00 33.23  ? 347 LEU C CD2 1 
ATOM   7662  N N   . ALA C 1 353 ? 18.878  -10.443 -5.737  1.00 28.87  ? 348 ALA C N   1 
ATOM   7663  C CA  . ALA C 1 353 ? 20.055  -10.605 -6.579  1.00 29.22  ? 348 ALA C CA  1 
ATOM   7664  C C   . ALA C 1 353 ? 20.363  -9.254  -7.203  1.00 30.59  ? 348 ALA C C   1 
ATOM   7665  O O   . ALA C 1 353 ? 19.457  -8.533  -7.612  1.00 28.44  ? 348 ALA C O   1 
ATOM   7666  C CB  . ALA C 1 353 ? 19.799  -11.635 -7.664  1.00 28.26  ? 348 ALA C CB  1 
ATOM   7667  N N   . GLU C 1 354 ? 21.645  -8.925  -7.292  1.00 34.30  ? 349 GLU C N   1 
ATOM   7668  C CA  . GLU C 1 354 ? 22.069  -7.641  -7.836  1.00 36.53  ? 349 GLU C CA  1 
ATOM   7669  C C   . GLU C 1 354 ? 23.366  -7.757  -8.629  1.00 37.59  ? 349 GLU C C   1 
ATOM   7670  O O   . GLU C 1 354 ? 24.229  -8.573  -8.303  1.00 37.55  ? 349 GLU C O   1 
ATOM   7671  C CB  . GLU C 1 354 ? 22.278  -6.671  -6.676  1.00 39.74  ? 349 GLU C CB  1 
ATOM   7672  C CG  . GLU C 1 354 ? 22.938  -5.355  -7.034  1.00 45.93  ? 349 GLU C CG  1 
ATOM   7673  C CD  . GLU C 1 354 ? 23.679  -4.736  -5.854  1.00 48.25  ? 349 GLU C CD  1 
ATOM   7674  O OE1 . GLU C 1 354 ? 24.141  -3.585  -5.977  1.00 50.97  ? 349 GLU C OE1 1 
ATOM   7675  O OE2 . GLU C 1 354 ? 23.810  -5.402  -4.806  1.00 50.28  ? 349 GLU C OE2 1 
ATOM   7676  N N   . LEU C 1 355 ? 23.490  -6.939  -9.672  1.00 38.34  ? 350 LEU C N   1 
ATOM   7677  C CA  . LEU C 1 355 ? 24.696  -6.894  -10.493 1.00 37.47  ? 350 LEU C CA  1 
ATOM   7678  C C   . LEU C 1 355 ? 25.234  -5.473  -10.375 1.00 38.12  ? 350 LEU C C   1 
ATOM   7679  O O   . LEU C 1 355 ? 24.856  -4.590  -11.150 1.00 38.59  ? 350 LEU C O   1 
ATOM   7680  C CB  . LEU C 1 355 ? 24.381  -7.206  -11.953 1.00 38.43  ? 350 LEU C CB  1 
ATOM   7681  C CG  . LEU C 1 355 ? 25.619  -7.346  -12.842 1.00 40.01  ? 350 LEU C CG  1 
ATOM   7682  C CD1 . LEU C 1 355 ? 25.463  -8.538  -13.743 1.00 40.10  ? 350 LEU C CD1 1 
ATOM   7683  C CD2 . LEU C 1 355 ? 25.828  -6.091  -13.654 1.00 42.72  ? 350 LEU C CD2 1 
ATOM   7684  N N   . PRO C 1 356 ? 26.125  -5.237  -9.392  1.00 38.85  ? 351 PRO C N   1 
ATOM   7685  C CA  . PRO C 1 356 ? 26.774  -3.959  -9.074  1.00 39.27  ? 351 PRO C CA  1 
ATOM   7686  C C   . PRO C 1 356 ? 27.376  -3.194  -10.247 1.00 42.14  ? 351 PRO C C   1 
ATOM   7687  O O   . PRO C 1 356 ? 27.389  -1.962  -10.239 1.00 41.68  ? 351 PRO C O   1 
ATOM   7688  C CB  . PRO C 1 356 ? 27.841  -4.358  -8.063  1.00 36.78  ? 351 PRO C CB  1 
ATOM   7689  C CG  . PRO C 1 356 ? 27.243  -5.535  -7.396  1.00 35.67  ? 351 PRO C CG  1 
ATOM   7690  C CD  . PRO C 1 356 ? 26.674  -6.308  -8.544  1.00 36.65  ? 351 PRO C CD  1 
ATOM   7691  N N   . ALA C 1 357 ? 27.879  -3.913  -11.245 1.00 44.92  ? 352 ALA C N   1 
ATOM   7692  C CA  . ALA C 1 357 ? 28.498  -3.267  -12.401 1.00 49.81  ? 352 ALA C CA  1 
ATOM   7693  C C   . ALA C 1 357 ? 27.573  -2.273  -13.086 1.00 52.71  ? 352 ALA C C   1 
ATOM   7694  O O   . ALA C 1 357 ? 28.035  -1.295  -13.674 1.00 50.38  ? 352 ALA C O   1 
ATOM   7695  C CB  . ALA C 1 357 ? 28.970  -4.320  -13.411 1.00 51.62  ? 352 ALA C CB  1 
ATOM   7696  N N   . ILE C 1 358 ? 26.267  -2.527  -13.004 1.00 57.10  ? 353 ILE C N   1 
ATOM   7697  C CA  . ILE C 1 358 ? 25.271  -1.651  -13.625 1.00 60.13  ? 353 ILE C CA  1 
ATOM   7698  C C   . ILE C 1 358 ? 24.105  -1.258  -12.717 1.00 62.04  ? 353 ILE C C   1 
ATOM   7699  O O   . ILE C 1 358 ? 22.972  -1.182  -13.175 1.00 63.77  ? 353 ILE C O   1 
ATOM   7700  C CB  . ILE C 1 358 ? 24.664  -2.297  -14.894 1.00 61.31  ? 353 ILE C CB  1 
ATOM   7701  C CG1 . ILE C 1 358 ? 23.974  -3.611  -14.532 1.00 60.61  ? 353 ILE C CG1 1 
ATOM   7702  C CG2 . ILE C 1 358 ? 25.743  -2.530  -15.929 1.00 62.54  ? 353 ILE C CG2 1 
ATOM   7703  C CD1 . ILE C 1 358 ? 23.434  -4.359  -15.729 1.00 61.60  ? 353 ILE C CD1 1 
ATOM   7704  N N   . MET C 1 359 ? 24.366  -1.006  -11.441 1.00 61.56  ? 354 MET C N   1 
ATOM   7705  C CA  . MET C 1 359 ? 23.293  -0.625  -10.532 1.00 60.71  ? 354 MET C CA  1 
ATOM   7706  C C   . MET C 1 359 ? 23.821  0.350   -9.487  1.00 61.80  ? 354 MET C C   1 
ATOM   7707  O O   . MET C 1 359 ? 24.751  1.120   -9.754  1.00 62.35  ? 354 MET C O   1 
ATOM   7708  C CB  . MET C 1 359 ? 22.683  -1.879  -9.865  1.00 59.83  ? 354 MET C CB  1 
ATOM   7709  C CG  . MET C 1 359 ? 21.918  -2.823  -10.842 1.00 58.98  ? 354 MET C CG  1 
ATOM   7710  S SD  . MET C 1 359 ? 21.164  -4.383  -10.173 1.00 59.71  ? 354 MET C SD  1 
ATOM   7711  C CE  . MET C 1 359 ? 19.413  -4.249  -10.666 1.00 56.42  ? 354 MET C CE  1 
ATOM   7712  N N   . LEU C 1 372 ? 38.795  2.599   -11.641 1.00 76.40  ? 367 LEU C N   1 
ATOM   7713  C CA  . LEU C 1 372 ? 38.271  1.397   -12.288 1.00 77.20  ? 367 LEU C CA  1 
ATOM   7714  C C   . LEU C 1 372 ? 36.885  0.982   -11.783 1.00 75.83  ? 367 LEU C C   1 
ATOM   7715  O O   . LEU C 1 372 ? 36.275  1.678   -10.963 1.00 76.27  ? 367 LEU C O   1 
ATOM   7716  C CB  . LEU C 1 372 ? 39.253  0.236   -12.113 1.00 78.77  ? 367 LEU C CB  1 
ATOM   7717  C CG  . LEU C 1 372 ? 39.987  -0.167  -13.396 1.00 80.46  ? 367 LEU C CG  1 
ATOM   7718  C CD1 . LEU C 1 372 ? 41.496  -0.062  -13.195 1.00 80.58  ? 367 LEU C CD1 1 
ATOM   7719  C CD2 . LEU C 1 372 ? 39.572  -1.583  -13.790 1.00 80.54  ? 367 LEU C CD2 1 
ATOM   7720  N N   . GLY C 1 373 ? 36.388  -0.151  -12.278 1.00 73.28  ? 368 GLY C N   1 
ATOM   7721  C CA  . GLY C 1 373 ? 35.074  -0.616  -11.867 1.00 69.35  ? 368 GLY C CA  1 
ATOM   7722  C C   . GLY C 1 373 ? 35.013  -2.074  -11.459 1.00 66.63  ? 368 GLY C C   1 
ATOM   7723  O O   . GLY C 1 373 ? 35.917  -2.862  -11.767 1.00 66.61  ? 368 GLY C O   1 
ATOM   7724  N N   . ILE C 1 374 ? 33.939  -2.429  -10.756 1.00 63.37  ? 369 ILE C N   1 
ATOM   7725  C CA  . ILE C 1 374 ? 33.725  -3.798  -10.293 1.00 60.69  ? 369 ILE C CA  1 
ATOM   7726  C C   . ILE C 1 374 ? 33.502  -4.695  -11.500 1.00 57.99  ? 369 ILE C C   1 
ATOM   7727  O O   . ILE C 1 374 ? 32.859  -4.289  -12.470 1.00 58.71  ? 369 ILE C O   1 
ATOM   7728  C CB  . ILE C 1 374 ? 32.474  -3.920  -9.386  1.00 60.78  ? 369 ILE C CB  1 
ATOM   7729  C CG1 . ILE C 1 374 ? 32.055  -2.544  -8.866  1.00 62.29  ? 369 ILE C CG1 1 
ATOM   7730  C CG2 . ILE C 1 374 ? 32.769  -4.841  -8.214  1.00 59.56  ? 369 ILE C CG2 1 
ATOM   7731  C CD1 . ILE C 1 374 ? 31.445  -1.643  -9.924  1.00 64.71  ? 369 ILE C CD1 1 
ATOM   7732  N N   . SER C 1 375 ? 34.026  -5.915  -11.438 1.00 55.33  ? 370 SER C N   1 
ATOM   7733  C CA  . SER C 1 375 ? 33.868  -6.848  -12.543 1.00 53.71  ? 370 SER C CA  1 
ATOM   7734  C C   . SER C 1 375 ? 32.404  -6.914  -12.955 1.00 53.11  ? 370 SER C C   1 
ATOM   7735  O O   . SER C 1 375 ? 31.502  -6.841  -12.119 1.00 50.31  ? 370 SER C O   1 
ATOM   7736  C CB  . SER C 1 375 ? 34.359  -8.241  -12.152 1.00 51.26  ? 370 SER C CB  1 
ATOM   7737  O OG  . SER C 1 375 ? 33.570  -8.762  -11.102 1.00 51.93  ? 370 SER C OG  1 
ATOM   7738  N N   . ASP C 1 376 ? 32.191  -7.041  -14.261 1.00 55.07  ? 371 ASP C N   1 
ATOM   7739  C CA  . ASP C 1 376 ? 30.864  -7.112  -14.846 1.00 57.35  ? 371 ASP C CA  1 
ATOM   7740  C C   . ASP C 1 376 ? 30.339  -8.525  -14.649 1.00 55.60  ? 371 ASP C C   1 
ATOM   7741  O O   . ASP C 1 376 ? 29.241  -8.872  -15.082 1.00 54.98  ? 371 ASP C O   1 
ATOM   7742  C CB  . ASP C 1 376 ? 30.957  -6.799  -16.335 1.00 62.46  ? 371 ASP C CB  1 
ATOM   7743  C CG  . ASP C 1 376 ? 32.082  -5.835  -16.655 1.00 67.47  ? 371 ASP C CG  1 
ATOM   7744  O OD1 . ASP C 1 376 ? 33.253  -6.192  -16.400 1.00 70.71  ? 371 ASP C OD1 1 
ATOM   7745  O OD2 . ASP C 1 376 ? 31.801  -4.723  -17.155 1.00 71.17  ? 371 ASP C OD2 1 
ATOM   7746  N N   . THR C 1 377 ? 31.143  -9.339  -13.984 1.00 54.18  ? 372 THR C N   1 
ATOM   7747  C CA  . THR C 1 377 ? 30.782  -10.719 -13.732 1.00 54.49  ? 372 THR C CA  1 
ATOM   7748  C C   . THR C 1 377 ? 30.421  -10.962 -12.252 1.00 50.58  ? 372 THR C C   1 
ATOM   7749  O O   . THR C 1 377 ? 29.986  -12.057 -11.884 1.00 49.28  ? 372 THR C O   1 
ATOM   7750  C CB  . THR C 1 377 ? 31.946  -11.641 -14.187 1.00 55.81  ? 372 THR C CB  1 
ATOM   7751  O OG1 . THR C 1 377 ? 31.703  -12.983 -13.751 1.00 61.25  ? 372 THR C OG1 1 
ATOM   7752  C CG2 . THR C 1 377 ? 33.281  -11.144 -13.629 1.00 57.56  ? 372 THR C CG2 1 
ATOM   7753  N N   . LEU C 1 378 ? 30.578  -9.928  -11.420 1.00 47.13  ? 373 LEU C N   1 
ATOM   7754  C CA  . LEU C 1 378 ? 30.289  -10.020 -9.987  1.00 43.27  ? 373 LEU C CA  1 
ATOM   7755  C C   . LEU C 1 378 ? 28.814  -9.811  -9.645  1.00 41.36  ? 373 LEU C C   1 
ATOM   7756  O O   . LEU C 1 378 ? 28.217  -8.794  -10.001 1.00 41.41  ? 373 LEU C O   1 
ATOM   7757  C CB  . LEU C 1 378 ? 31.145  -9.013  -9.207  1.00 41.92  ? 373 LEU C CB  1 
ATOM   7758  C CG  . LEU C 1 378 ? 30.979  -9.021  -7.681  1.00 42.27  ? 373 LEU C CG  1 
ATOM   7759  C CD1 . LEU C 1 378 ? 32.228  -8.451  -7.038  1.00 41.79  ? 373 LEU C CD1 1 
ATOM   7760  C CD2 . LEU C 1 378 ? 29.743  -8.228  -7.268  1.00 39.97  ? 373 LEU C CD2 1 
ATOM   7761  N N   . ILE C 1 379 ? 28.247  -10.784 -8.936  1.00 38.47  ? 374 ILE C N   1 
ATOM   7762  C CA  . ILE C 1 379 ? 26.846  -10.760 -8.523  1.00 34.99  ? 374 ILE C CA  1 
ATOM   7763  C C   . ILE C 1 379 ? 26.719  -10.911 -7.010  1.00 34.44  ? 374 ILE C C   1 
ATOM   7764  O O   . ILE C 1 379 ? 27.301  -11.830 -6.430  1.00 35.17  ? 374 ILE C O   1 
ATOM   7765  C CB  . ILE C 1 379 ? 26.060  -11.919 -9.178  1.00 33.01  ? 374 ILE C CB  1 
ATOM   7766  C CG1 . ILE C 1 379 ? 26.002  -11.721 -10.691 1.00 33.41  ? 374 ILE C CG1 1 
ATOM   7767  C CG2 . ILE C 1 379 ? 24.673  -11.994 -8.611  1.00 30.66  ? 374 ILE C CG2 1 
ATOM   7768  C CD1 . ILE C 1 379 ? 25.274  -12.818 -11.418 1.00 34.00  ? 374 ILE C CD1 1 
ATOM   7769  N N   . ARG C 1 380 ? 25.975  -10.009 -6.372  1.00 33.26  ? 375 ARG C N   1 
ATOM   7770  C CA  . ARG C 1 380 ? 25.759  -10.089 -4.930  1.00 32.89  ? 375 ARG C CA  1 
ATOM   7771  C C   . ARG C 1 380 ? 24.326  -10.509 -4.642  1.00 31.90  ? 375 ARG C C   1 
ATOM   7772  O O   . ARG C 1 380 ? 23.381  -9.933  -5.171  1.00 31.74  ? 375 ARG C O   1 
ATOM   7773  C CB  . ARG C 1 380 ? 26.030  -8.751  -4.230  1.00 32.57  ? 375 ARG C CB  1 
ATOM   7774  C CG  . ARG C 1 380 ? 25.515  -8.737  -2.784  1.00 33.48  ? 375 ARG C CG  1 
ATOM   7775  C CD  . ARG C 1 380 ? 25.975  -7.524  -1.978  1.00 37.57  ? 375 ARG C CD  1 
ATOM   7776  N NE  . ARG C 1 380 ? 25.299  -6.259  -2.299  1.00 41.54  ? 375 ARG C NE  1 
ATOM   7777  C CZ  . ARG C 1 380 ? 24.073  -5.919  -1.901  1.00 42.55  ? 375 ARG C CZ  1 
ATOM   7778  N NH1 . ARG C 1 380 ? 23.348  -6.746  -1.158  1.00 47.31  ? 375 ARG C NH1 1 
ATOM   7779  N NH2 . ARG C 1 380 ? 23.575  -4.735  -2.227  1.00 41.86  ? 375 ARG C NH2 1 
ATOM   7780  N N   . LEU C 1 381 ? 24.169  -11.519 -3.803  1.00 31.20  ? 376 LEU C N   1 
ATOM   7781  C CA  . LEU C 1 381 ? 22.844  -11.995 -3.448  1.00 32.72  ? 376 LEU C CA  1 
ATOM   7782  C C   . LEU C 1 381 ? 22.585  -11.734 -1.976  1.00 34.95  ? 376 LEU C C   1 
ATOM   7783  O O   . LEU C 1 381 ? 23.467  -11.942 -1.148  1.00 35.86  ? 376 LEU C O   1 
ATOM   7784  C CB  . LEU C 1 381 ? 22.730  -13.499 -3.672  1.00 32.96  ? 376 LEU C CB  1 
ATOM   7785  C CG  . LEU C 1 381 ? 23.181  -14.093 -4.999  1.00 33.50  ? 376 LEU C CG  1 
ATOM   7786  C CD1 . LEU C 1 381 ? 22.872  -15.584 -4.983  1.00 34.14  ? 376 LEU C CD1 1 
ATOM   7787  C CD2 . LEU C 1 381 ? 22.478  -13.405 -6.156  1.00 32.27  ? 376 LEU C CD2 1 
ATOM   7788  N N   . SER C 1 382 ? 21.385  -11.267 -1.644  1.00 35.45  ? 377 SER C N   1 
ATOM   7789  C CA  . SER C 1 382 ? 21.028  -11.068 -0.249  1.00 32.60  ? 377 SER C CA  1 
ATOM   7790  C C   . SER C 1 382 ? 20.018  -12.183 -0.018  1.00 33.64  ? 377 SER C C   1 
ATOM   7791  O O   . SER C 1 382 ? 18.829  -12.006 -0.289  1.00 34.83  ? 377 SER C O   1 
ATOM   7792  C CB  . SER C 1 382 ? 20.375  -9.716  -0.039  1.00 32.47  ? 377 SER C CB  1 
ATOM   7793  O OG  . SER C 1 382 ? 20.069  -9.546  1.334   1.00 33.05  ? 377 SER C OG  1 
ATOM   7794  N N   . VAL C 1 383 ? 20.506  -13.333 0.454   1.00 32.73  ? 378 VAL C N   1 
ATOM   7795  C CA  . VAL C 1 383 ? 19.679  -14.522 0.684   1.00 31.45  ? 378 VAL C CA  1 
ATOM   7796  C C   . VAL C 1 383 ? 18.646  -14.412 1.809   1.00 29.93  ? 378 VAL C C   1 
ATOM   7797  O O   . VAL C 1 383 ? 18.983  -14.111 2.963   1.00 28.13  ? 378 VAL C O   1 
ATOM   7798  C CB  . VAL C 1 383 ? 20.568  -15.756 0.945   1.00 33.33  ? 378 VAL C CB  1 
ATOM   7799  C CG1 . VAL C 1 383 ? 19.730  -17.035 0.919   1.00 32.92  ? 378 VAL C CG1 1 
ATOM   7800  C CG2 . VAL C 1 383 ? 21.657  -15.818 -0.101  1.00 33.66  ? 378 VAL C CG2 1 
ATOM   7801  N N   . GLY C 1 384 ? 17.394  -14.697 1.450   1.00 28.36  ? 379 GLY C N   1 
ATOM   7802  C CA  . GLY C 1 384 ? 16.280  -14.603 2.377   1.00 28.92  ? 379 GLY C CA  1 
ATOM   7803  C C   . GLY C 1 384 ? 15.945  -15.798 3.243   1.00 29.27  ? 379 GLY C C   1 
ATOM   7804  O O   . GLY C 1 384 ? 16.804  -16.626 3.529   1.00 30.46  ? 379 GLY C O   1 
ATOM   7805  N N   . LEU C 1 385 ? 14.685  -15.895 3.663   1.00 28.82  ? 380 LEU C N   1 
ATOM   7806  C CA  . LEU C 1 385 ? 14.271  -16.986 4.531   1.00 29.02  ? 380 LEU C CA  1 
ATOM   7807  C C   . LEU C 1 385 ? 13.392  -18.038 3.869   1.00 30.24  ? 380 LEU C C   1 
ATOM   7808  O O   . LEU C 1 385 ? 12.607  -18.701 4.551   1.00 30.01  ? 380 LEU C O   1 
ATOM   7809  C CB  . LEU C 1 385 ? 13.553  -16.429 5.761   1.00 27.50  ? 380 LEU C CB  1 
ATOM   7810  C CG  . LEU C 1 385 ? 14.264  -15.283 6.489   1.00 29.29  ? 380 LEU C CG  1 
ATOM   7811  C CD1 . LEU C 1 385 ? 13.430  -14.871 7.687   1.00 30.94  ? 380 LEU C CD1 1 
ATOM   7812  C CD2 . LEU C 1 385 ? 15.663  -15.690 6.941   1.00 27.87  ? 380 LEU C CD2 1 
ATOM   7813  N N   . GLU C 1 386 ? 13.529  -18.202 2.553   1.00 31.74  ? 381 GLU C N   1 
ATOM   7814  C CA  . GLU C 1 386 ? 12.739  -19.197 1.822   1.00 32.57  ? 381 GLU C CA  1 
ATOM   7815  C C   . GLU C 1 386 ? 13.336  -20.585 1.974   1.00 33.32  ? 381 GLU C C   1 
ATOM   7816  O O   . GLU C 1 386 ? 14.331  -20.765 2.680   1.00 32.59  ? 381 GLU C O   1 
ATOM   7817  C CB  . GLU C 1 386 ? 12.682  -18.874 0.329   1.00 31.38  ? 381 GLU C CB  1 
ATOM   7818  C CG  . GLU C 1 386 ? 12.113  -17.519 -0.029  1.00 30.28  ? 381 GLU C CG  1 
ATOM   7819  C CD  . GLU C 1 386 ? 13.181  -16.458 -0.126  1.00 30.22  ? 381 GLU C CD  1 
ATOM   7820  O OE1 . GLU C 1 386 ? 12.952  -15.462 -0.846  1.00 29.47  ? 381 GLU C OE1 1 
ATOM   7821  O OE2 . GLU C 1 386 ? 14.243  -16.616 0.518   1.00 30.08  ? 381 GLU C OE2 1 
ATOM   7822  N N   . ASP C 1 387 ? 12.723  -21.558 1.303   1.00 36.76  ? 382 ASP C N   1 
ATOM   7823  C CA  . ASP C 1 387 ? 13.206  -22.933 1.329   1.00 42.23  ? 382 ASP C CA  1 
ATOM   7824  C C   . ASP C 1 387 ? 14.508  -23.073 0.555   1.00 43.65  ? 382 ASP C C   1 
ATOM   7825  O O   . ASP C 1 387 ? 14.577  -22.753 -0.631  1.00 44.24  ? 382 ASP C O   1 
ATOM   7826  C CB  . ASP C 1 387 ? 12.160  -23.887 0.751   1.00 44.18  ? 382 ASP C CB  1 
ATOM   7827  C CG  . ASP C 1 387 ? 11.142  -24.316 1.788   1.00 50.44  ? 382 ASP C CG  1 
ATOM   7828  O OD1 . ASP C 1 387 ? 11.477  -25.158 2.655   1.00 53.17  ? 382 ASP C OD1 1 
ATOM   7829  O OD2 . ASP C 1 387 ? 10.009  -23.797 1.751   1.00 52.90  ? 382 ASP C OD2 1 
ATOM   7830  N N   . GLU C 1 388 ? 15.542  -23.539 1.248   1.00 46.44  ? 383 GLU C N   1 
ATOM   7831  C CA  . GLU C 1 388 ? 16.860  -23.740 0.667   1.00 49.89  ? 383 GLU C CA  1 
ATOM   7832  C C   . GLU C 1 388 ? 16.758  -24.421 -0.697  1.00 49.90  ? 383 GLU C C   1 
ATOM   7833  O O   . GLU C 1 388 ? 17.357  -23.984 -1.681  1.00 47.97  ? 383 GLU C O   1 
ATOM   7834  C CB  . GLU C 1 388 ? 17.691  -24.589 1.626   1.00 52.12  ? 383 GLU C CB  1 
ATOM   7835  C CG  . GLU C 1 388 ? 18.954  -25.164 1.039   1.00 57.91  ? 383 GLU C CG  1 
ATOM   7836  C CD  . GLU C 1 388 ? 19.686  -26.040 2.027   1.00 61.51  ? 383 GLU C CD  1 
ATOM   7837  O OE1 . GLU C 1 388 ? 20.714  -26.638 1.644   1.00 64.85  ? 383 GLU C OE1 1 
ATOM   7838  O OE2 . GLU C 1 388 ? 19.232  -26.129 3.191   1.00 64.89  ? 383 GLU C OE2 1 
ATOM   7839  N N   . GLU C 1 389 ? 15.985  -25.497 -0.737  1.00 52.22  ? 384 GLU C N   1 
ATOM   7840  C CA  . GLU C 1 389 ? 15.766  -26.266 -1.952  1.00 55.85  ? 384 GLU C CA  1 
ATOM   7841  C C   . GLU C 1 389 ? 15.356  -25.375 -3.130  1.00 50.50  ? 384 GLU C C   1 
ATOM   7842  O O   . GLU C 1 389 ? 16.001  -25.374 -4.176  1.00 49.49  ? 384 GLU C O   1 
ATOM   7843  C CB  . GLU C 1 389 ? 14.689  -27.318 -1.670  1.00 66.08  ? 384 GLU C CB  1 
ATOM   7844  C CG  . GLU C 1 389 ? 14.125  -28.049 -2.877  1.00 82.10  ? 384 GLU C CG  1 
ATOM   7845  C CD  . GLU C 1 389 ? 12.967  -28.969 -2.498  1.00 90.66  ? 384 GLU C CD  1 
ATOM   7846  O OE1 . GLU C 1 389 ? 13.215  -30.006 -1.845  1.00 96.19  ? 384 GLU C OE1 1 
ATOM   7847  O OE2 . GLU C 1 389 ? 11.807  -28.647 -2.842  1.00 96.31  ? 384 GLU C OE2 1 
ATOM   7848  N N   . ASP C 1 390 ? 14.289  -24.608 -2.950  1.00 46.12  ? 385 ASP C N   1 
ATOM   7849  C CA  . ASP C 1 390 ? 13.794  -23.734 -4.003  1.00 41.71  ? 385 ASP C CA  1 
ATOM   7850  C C   . ASP C 1 390 ? 14.792  -22.689 -4.452  1.00 38.59  ? 385 ASP C C   1 
ATOM   7851  O O   . ASP C 1 390 ? 14.824  -22.327 -5.628  1.00 37.12  ? 385 ASP C O   1 
ATOM   7852  C CB  . ASP C 1 390 ? 12.505  -23.055 -3.555  1.00 41.03  ? 385 ASP C CB  1 
ATOM   7853  C CG  . ASP C 1 390 ? 11.427  -24.054 -3.191  1.00 42.00  ? 385 ASP C CG  1 
ATOM   7854  O OD1 . ASP C 1 390 ? 11.434  -25.173 -3.756  1.00 43.42  ? 385 ASP C OD1 1 
ATOM   7855  O OD2 . ASP C 1 390 ? 10.568  -23.718 -2.350  1.00 43.71  ? 385 ASP C OD2 1 
ATOM   7856  N N   . LEU C 1 391 ? 15.599  -22.197 -3.520  1.00 36.41  ? 386 LEU C N   1 
ATOM   7857  C CA  . LEU C 1 391 ? 16.597  -21.195 -3.851  1.00 35.26  ? 386 LEU C CA  1 
ATOM   7858  C C   . LEU C 1 391 ? 17.672  -21.831 -4.710  1.00 36.15  ? 386 LEU C C   1 
ATOM   7859  O O   . LEU C 1 391 ? 18.064  -21.293 -5.740  1.00 37.23  ? 386 LEU C O   1 
ATOM   7860  C CB  . LEU C 1 391 ? 17.222  -20.627 -2.585  1.00 32.94  ? 386 LEU C CB  1 
ATOM   7861  C CG  . LEU C 1 391 ? 16.279  -19.846 -1.681  1.00 32.01  ? 386 LEU C CG  1 
ATOM   7862  C CD1 . LEU C 1 391 ? 17.061  -19.277 -0.504  1.00 30.39  ? 386 LEU C CD1 1 
ATOM   7863  C CD2 . LEU C 1 391 ? 15.616  -18.730 -2.488  1.00 31.70  ? 386 LEU C CD2 1 
ATOM   7864  N N   . LEU C 1 392 ? 18.146  -22.989 -4.275  1.00 38.07  ? 387 LEU C N   1 
ATOM   7865  C CA  . LEU C 1 392 ? 19.171  -23.718 -5.000  1.00 38.66  ? 387 LEU C CA  1 
ATOM   7866  C C   . LEU C 1 392 ? 18.735  -24.004 -6.435  1.00 40.63  ? 387 LEU C C   1 
ATOM   7867  O O   . LEU C 1 392 ? 19.516  -23.829 -7.371  1.00 41.85  ? 387 LEU C O   1 
ATOM   7868  C CB  . LEU C 1 392 ? 19.457  -25.030 -4.278  1.00 37.08  ? 387 LEU C CB  1 
ATOM   7869  C CG  . LEU C 1 392 ? 20.721  -25.168 -3.431  1.00 36.51  ? 387 LEU C CG  1 
ATOM   7870  C CD1 . LEU C 1 392 ? 21.101  -23.850 -2.763  1.00 34.70  ? 387 LEU C CD1 1 
ATOM   7871  C CD2 . LEU C 1 392 ? 20.473  -26.288 -2.416  1.00 36.45  ? 387 LEU C CD2 1 
ATOM   7872  N N   . GLU C 1 393 ? 17.483  -24.429 -6.600  1.00 42.77  ? 388 GLU C N   1 
ATOM   7873  C CA  . GLU C 1 393 ? 16.931  -24.763 -7.908  1.00 44.40  ? 388 GLU C CA  1 
ATOM   7874  C C   . GLU C 1 393 ? 16.702  -23.551 -8.780  1.00 43.17  ? 388 GLU C C   1 
ATOM   7875  O O   . GLU C 1 393 ? 16.807  -23.633 -10.001 1.00 44.37  ? 388 GLU C O   1 
ATOM   7876  C CB  . GLU C 1 393 ? 15.622  -25.525 -7.745  1.00 50.14  ? 388 GLU C CB  1 
ATOM   7877  C CG  . GLU C 1 393 ? 15.757  -26.774 -6.889  1.00 61.86  ? 388 GLU C CG  1 
ATOM   7878  C CD  . GLU C 1 393 ? 14.443  -27.523 -6.704  1.00 68.47  ? 388 GLU C CD  1 
ATOM   7879  O OE1 . GLU C 1 393 ? 13.375  -26.986 -7.093  1.00 72.63  ? 388 GLU C OE1 1 
ATOM   7880  O OE2 . GLU C 1 393 ? 14.483  -28.653 -6.161  1.00 71.29  ? 388 GLU C OE2 1 
ATOM   7881  N N   . ASP C 1 394 ? 16.381  -22.420 -8.170  1.00 41.64  ? 389 ASP C N   1 
ATOM   7882  C CA  . ASP C 1 394 ? 16.163  -21.224 -8.960  1.00 41.67  ? 389 ASP C CA  1 
ATOM   7883  C C   . ASP C 1 394 ? 17.492  -20.780 -9.553  1.00 41.76  ? 389 ASP C C   1 
ATOM   7884  O O   . ASP C 1 394 ? 17.580  -20.475 -10.742 1.00 42.38  ? 389 ASP C O   1 
ATOM   7885  C CB  . ASP C 1 394 ? 15.571  -20.104 -8.105  1.00 42.44  ? 389 ASP C CB  1 
ATOM   7886  C CG  . ASP C 1 394 ? 15.303  -18.843 -8.907  1.00 42.16  ? 389 ASP C CG  1 
ATOM   7887  O OD1 . ASP C 1 394 ? 14.666  -18.942 -9.976  1.00 43.63  ? 389 ASP C OD1 1 
ATOM   7888  O OD2 . ASP C 1 394 ? 15.724  -17.753 -8.473  1.00 42.19  ? 389 ASP C OD2 1 
ATOM   7889  N N   . LEU C 1 395 ? 18.528  -20.758 -8.720  1.00 41.34  ? 390 LEU C N   1 
ATOM   7890  C CA  . LEU C 1 395 ? 19.862  -20.356 -9.159  1.00 40.55  ? 390 LEU C CA  1 
ATOM   7891  C C   . LEU C 1 395 ? 20.368  -21.271 -10.257 1.00 42.48  ? 390 LEU C C   1 
ATOM   7892  O O   . LEU C 1 395 ? 20.854  -20.804 -11.289 1.00 41.06  ? 390 LEU C O   1 
ATOM   7893  C CB  . LEU C 1 395 ? 20.839  -20.384 -7.983  1.00 37.38  ? 390 LEU C CB  1 
ATOM   7894  C CG  . LEU C 1 395 ? 20.629  -19.310 -6.919  1.00 35.55  ? 390 LEU C CG  1 
ATOM   7895  C CD1 . LEU C 1 395 ? 21.589  -19.526 -5.764  1.00 34.74  ? 390 LEU C CD1 1 
ATOM   7896  C CD2 . LEU C 1 395 ? 20.842  -17.946 -7.544  1.00 34.99  ? 390 LEU C CD2 1 
ATOM   7897  N N   . ASP C 1 396 ? 20.248  -22.577 -10.019 1.00 46.14  ? 391 ASP C N   1 
ATOM   7898  C CA  . ASP C 1 396 ? 20.685  -23.604 -10.962 1.00 49.62  ? 391 ASP C CA  1 
ATOM   7899  C C   . ASP C 1 396 ? 19.983  -23.446 -12.307 1.00 48.86  ? 391 ASP C C   1 
ATOM   7900  O O   . ASP C 1 396 ? 20.603  -23.572 -13.360 1.00 49.64  ? 391 ASP C O   1 
ATOM   7901  C CB  . ASP C 1 396 ? 20.400  -24.990 -10.383 1.00 54.82  ? 391 ASP C CB  1 
ATOM   7902  C CG  . ASP C 1 396 ? 20.919  -26.111 -11.265 1.00 59.68  ? 391 ASP C CG  1 
ATOM   7903  O OD1 . ASP C 1 396 ? 22.123  -26.091 -11.607 1.00 63.06  ? 391 ASP C OD1 1 
ATOM   7904  O OD2 . ASP C 1 396 ? 20.126  -27.014 -11.610 1.00 61.87  ? 391 ASP C OD2 1 
ATOM   7905  N N   . GLN C 1 397 ? 18.683  -23.179 -12.254 1.00 47.74  ? 392 GLN C N   1 
ATOM   7906  C CA  . GLN C 1 397 ? 17.877  -22.963 -13.447 1.00 46.63  ? 392 GLN C CA  1 
ATOM   7907  C C   . GLN C 1 397 ? 18.403  -21.747 -14.223 1.00 45.49  ? 392 GLN C C   1 
ATOM   7908  O O   . GLN C 1 397 ? 18.579  -21.804 -15.442 1.00 45.73  ? 392 GLN C O   1 
ATOM   7909  C CB  . GLN C 1 397 ? 16.417  -22.746 -13.031 1.00 47.58  ? 392 GLN C CB  1 
ATOM   7910  C CG  . GLN C 1 397 ? 15.520  -22.075 -14.065 1.00 50.58  ? 392 GLN C CG  1 
ATOM   7911  C CD  . GLN C 1 397 ? 15.547  -20.550 -13.989 1.00 52.03  ? 392 GLN C CD  1 
ATOM   7912  O OE1 . GLN C 1 397 ? 15.493  -19.970 -12.898 1.00 51.11  ? 392 GLN C OE1 1 
ATOM   7913  N NE2 . GLN C 1 397 ? 15.607  -19.895 -15.153 1.00 52.01  ? 392 GLN C NE2 1 
ATOM   7914  N N   . ALA C 1 398 ? 18.668  -20.658 -13.504 1.00 43.76  ? 393 ALA C N   1 
ATOM   7915  C CA  . ALA C 1 398 ? 19.166  -19.424 -14.104 1.00 42.13  ? 393 ALA C CA  1 
ATOM   7916  C C   . ALA C 1 398 ? 20.580  -19.566 -14.653 1.00 41.41  ? 393 ALA C C   1 
ATOM   7917  O O   . ALA C 1 398 ? 20.898  -19.012 -15.702 1.00 41.10  ? 393 ALA C O   1 
ATOM   7918  C CB  . ALA C 1 398 ? 19.111  -18.290 -13.082 1.00 40.37  ? 393 ALA C CB  1 
ATOM   7919  N N   . LEU C 1 399 ? 21.434  -20.289 -13.937 1.00 41.80  ? 394 LEU C N   1 
ATOM   7920  C CA  . LEU C 1 399 ? 22.806  -20.502 -14.389 1.00 42.81  ? 394 LEU C CA  1 
ATOM   7921  C C   . LEU C 1 399 ? 22.791  -21.342 -15.669 1.00 45.74  ? 394 LEU C C   1 
ATOM   7922  O O   . LEU C 1 399 ? 23.477  -21.016 -16.636 1.00 44.41  ? 394 LEU C O   1 
ATOM   7923  C CB  . LEU C 1 399 ? 23.627  -21.207 -13.301 1.00 41.06  ? 394 LEU C CB  1 
ATOM   7924  C CG  . LEU C 1 399 ? 24.060  -20.345 -12.107 1.00 39.97  ? 394 LEU C CG  1 
ATOM   7925  C CD1 . LEU C 1 399 ? 24.496  -21.220 -10.936 1.00 36.17  ? 394 LEU C CD1 1 
ATOM   7926  C CD2 . LEU C 1 399 ? 25.186  -19.423 -12.542 1.00 37.65  ? 394 LEU C CD2 1 
ATOM   7927  N N   . LYS C 1 400 ? 22.005  -22.421 -15.670 1.00 48.71  ? 395 LYS C N   1 
ATOM   7928  C CA  . LYS C 1 400 ? 21.881  -23.300 -16.839 1.00 49.58  ? 395 LYS C CA  1 
ATOM   7929  C C   . LYS C 1 400 ? 21.382  -22.510 -18.046 1.00 52.25  ? 395 LYS C C   1 
ATOM   7930  O O   . LYS C 1 400 ? 21.829  -22.727 -19.175 1.00 52.24  ? 395 LYS C O   1 
ATOM   7931  C CB  . LYS C 1 400 ? 20.891  -24.436 -16.563 1.00 48.51  ? 395 LYS C CB  1 
ATOM   7932  C CG  . LYS C 1 400 ? 21.442  -25.605 -15.773 1.00 48.12  ? 395 LYS C CG  1 
ATOM   7933  C CD  . LYS C 1 400 ? 20.402  -26.713 -15.727 1.00 49.02  ? 395 LYS C CD  1 
ATOM   7934  C CE  . LYS C 1 400 ? 21.022  -28.068 -15.429 1.00 49.49  ? 395 LYS C CE  1 
ATOM   7935  N NZ  . LYS C 1 400 ? 21.761  -28.053 -14.139 1.00 50.08  ? 395 LYS C NZ  1 
ATOM   7936  N N   . ALA C 1 401 ? 20.444  -21.601 -17.791 1.00 54.22  ? 396 ALA C N   1 
ATOM   7937  C CA  . ALA C 1 401 ? 19.857  -20.770 -18.830 1.00 55.35  ? 396 ALA C CA  1 
ATOM   7938  C C   . ALA C 1 401 ? 20.883  -19.822 -19.421 1.00 56.76  ? 396 ALA C C   1 
ATOM   7939  O O   . ALA C 1 401 ? 20.829  -19.505 -20.606 1.00 57.88  ? 396 ALA C O   1 
ATOM   7940  C CB  . ALA C 1 401 ? 18.687  -19.979 -18.260 1.00 54.71  ? 396 ALA C CB  1 
ATOM   7941  N N   . ALA C 1 402 ? 21.817  -19.370 -18.592 1.00 59.34  ? 397 ALA C N   1 
ATOM   7942  C CA  . ALA C 1 402 ? 22.854  -18.451 -19.045 1.00 62.65  ? 397 ALA C CA  1 
ATOM   7943  C C   . ALA C 1 402 ? 23.996  -19.194 -19.731 1.00 65.71  ? 397 ALA C C   1 
ATOM   7944  O O   . ALA C 1 402 ? 25.041  -18.607 -20.017 1.00 65.36  ? 397 ALA C O   1 
ATOM   7945  C CB  . ALA C 1 402 ? 23.388  -17.630 -17.864 1.00 61.18  ? 397 ALA C CB  1 
ATOM   7946  N N   . HIS C 1 403 ? 23.786  -20.484 -19.987 1.00 70.45  ? 398 HIS C N   1 
ATOM   7947  C CA  . HIS C 1 403 ? 24.772  -21.344 -20.648 1.00 76.58  ? 398 HIS C CA  1 
ATOM   7948  C C   . HIS C 1 403 ? 24.049  -22.499 -21.353 1.00 83.63  ? 398 HIS C C   1 
ATOM   7949  O O   . HIS C 1 403 ? 23.830  -23.558 -20.762 1.00 82.03  ? 398 HIS C O   1 
ATOM   7950  C CB  . HIS C 1 403 ? 25.750  -21.910 -19.621 1.00 74.79  ? 398 HIS C CB  1 
ATOM   7951  C CG  . HIS C 1 403 ? 26.555  -20.868 -18.913 1.00 74.10  ? 398 HIS C CG  1 
ATOM   7952  N ND1 . HIS C 1 403 ? 27.708  -20.330 -19.442 1.00 74.05  ? 398 HIS C ND1 1 
ATOM   7953  C CD2 . HIS C 1 403 ? 26.372  -20.261 -17.716 1.00 74.44  ? 398 HIS C CD2 1 
ATOM   7954  C CE1 . HIS C 1 403 ? 28.203  -19.440 -18.600 1.00 74.48  ? 398 HIS C CE1 1 
ATOM   7955  N NE2 . HIS C 1 403 ? 27.411  -19.379 -17.545 1.00 74.68  ? 398 HIS C NE2 1 
ATOM   7956  N N   . PRO C 1 404 ? 23.660  -22.299 -22.625 1.00 86.66  ? 399 PRO C N   1 
ATOM   7957  C CA  . PRO C 1 404 ? 22.953  -23.275 -23.469 1.00 92.20  ? 399 PRO C CA  1 
ATOM   7958  C C   . PRO C 1 404 ? 23.690  -24.593 -23.775 1.00 95.19  ? 399 PRO C C   1 
ATOM   7959  O O   . PRO C 1 404 ? 24.114  -24.782 -24.938 1.00 96.50  ? 399 PRO C O   1 
ATOM   7960  C CB  . PRO C 1 404 ? 22.650  -22.472 -24.735 1.00 92.90  ? 399 PRO C CB  1 
ATOM   7961  C CG  . PRO C 1 404 ? 22.510  -21.067 -24.211 1.00 91.68  ? 399 PRO C CG  1 
ATOM   7962  C CD  . PRO C 1 404 ? 23.690  -20.980 -23.283 1.00 89.55  ? 399 PRO C CD  1 
ATOM   7963  N N   . GLN D 1 14  ? 16.368  -36.469 12.538  1.00 52.75  ? 9   GLN D N   1 
ATOM   7964  C CA  . GLN D 1 14  ? 16.013  -37.949 12.651  1.00 49.84  ? 9   GLN D CA  1 
ATOM   7965  C C   . GLN D 1 14  ? 14.534  -38.189 12.113  1.00 44.54  ? 9   GLN D C   1 
ATOM   7966  O O   . GLN D 1 14  ? 13.973  -37.423 11.352  1.00 60.44  ? 9   GLN D O   1 
ATOM   7967  C CB  . GLN D 1 14  ? 16.208  -38.378 14.169  1.00 45.64  ? 9   GLN D CB  1 
ATOM   7968  C CG  . GLN D 1 14  ? 16.462  -39.941 14.518  1.00 35.01  ? 9   GLN D CG  1 
ATOM   7969  C CD  . GLN D 1 14  ? 17.924  -40.230 14.985  1.00 35.35  ? 9   GLN D CD  1 
ATOM   7970  O OE1 . GLN D 1 14  ? 18.200  -40.451 16.195  1.00 34.09  ? 9   GLN D OE1 1 
ATOM   7971  N NE2 . GLN D 1 14  ? 18.866  -40.211 14.014  1.00 31.79  ? 9   GLN D NE2 1 
ATOM   7972  N N   . GLY D 1 15  ? 13.942  -39.295 12.523  1.00 68.84  ? 10  GLY D N   1 
ATOM   7973  C CA  . GLY D 1 15  ? 12.592  -39.739 12.128  1.00 69.38  ? 10  GLY D CA  1 
ATOM   7974  C C   . GLY D 1 15  ? 11.199  -39.122 11.785  1.00 66.71  ? 10  GLY D C   1 
ATOM   7975  O O   . GLY D 1 15  ? 10.327  -39.920 11.404  1.00 76.03  ? 10  GLY D O   1 
ATOM   7976  N N   . PHE D 1 16  ? 10.916  -37.813 11.881  1.00 68.31  ? 11  PHE D N   1 
ATOM   7977  C CA  . PHE D 1 16  ? 9.550   -37.345 11.554  1.00 63.35  ? 11  PHE D CA  1 
ATOM   7978  C C   . PHE D 1 16  ? 9.320   -37.254 10.044  1.00 60.49  ? 11  PHE D C   1 
ATOM   7979  O O   . PHE D 1 16  ? 10.265  -37.371 9.271   1.00 59.63  ? 11  PHE D O   1 
ATOM   7980  C CB  . PHE D 1 16  ? 9.260   -35.971 12.178  1.00 59.00  ? 11  PHE D CB  1 
ATOM   7981  C CG  . PHE D 1 16  ? 9.435   -35.920 13.668  1.00 53.85  ? 11  PHE D CG  1 
ATOM   7982  C CD1 . PHE D 1 16  ? 8.336   -35.977 14.524  1.00 51.63  ? 11  PHE D CD1 1 
ATOM   7983  C CD2 . PHE D 1 16  ? 10.708  -35.831 14.215  1.00 51.55  ? 11  PHE D CD2 1 
ATOM   7984  C CE1 . PHE D 1 16  ? 8.508   -35.947 15.914  1.00 50.23  ? 11  PHE D CE1 1 
ATOM   7985  C CE2 . PHE D 1 16  ? 10.892  -35.802 15.596  1.00 51.53  ? 11  PHE D CE2 1 
ATOM   7986  C CZ  . PHE D 1 16  ? 9.790   -35.860 16.450  1.00 50.23  ? 11  PHE D CZ  1 
ATOM   7987  N N   . LEU D 1 17  ? 8.072   -37.048 9.619   1.00 57.82  ? 12  LEU D N   1 
ATOM   7988  C CA  . LEU D 1 17  ? 7.782   -36.908 8.193   1.00 55.36  ? 12  LEU D CA  1 
ATOM   7989  C C   . LEU D 1 17  ? 8.627   -35.743 7.721   1.00 55.75  ? 12  LEU D C   1 
ATOM   7990  O O   . LEU D 1 17  ? 8.786   -34.754 8.439   1.00 55.34  ? 12  LEU D O   1 
ATOM   7991  C CB  . LEU D 1 17  ? 6.311   -36.567 7.952   1.00 53.26  ? 12  LEU D CB  1 
ATOM   7992  C CG  . LEU D 1 17  ? 5.303   -37.584 8.469   1.00 53.36  ? 12  LEU D CG  1 
ATOM   7993  C CD1 . LEU D 1 17  ? 3.945   -36.945 8.517   1.00 53.71  ? 12  LEU D CD1 1 
ATOM   7994  C CD2 . LEU D 1 17  ? 5.299   -38.818 7.590   1.00 53.39  ? 12  LEU D CD2 1 
ATOM   7995  N N   . PRO D 1 18  ? 9.194   -35.844 6.513   1.00 54.14  ? 13  PRO D N   1 
ATOM   7996  C CA  . PRO D 1 18  ? 10.016  -34.742 6.010   1.00 54.10  ? 13  PRO D CA  1 
ATOM   7997  C C   . PRO D 1 18  ? 9.163   -33.471 5.894   1.00 54.24  ? 13  PRO D C   1 
ATOM   7998  O O   . PRO D 1 18  ? 8.020   -33.522 5.435   1.00 53.27  ? 13  PRO D O   1 
ATOM   7999  C CB  . PRO D 1 18  ? 10.505  -35.274 4.662   1.00 53.61  ? 13  PRO D CB  1 
ATOM   8000  C CG  . PRO D 1 18  ? 9.399   -36.191 4.241   1.00 53.32  ? 13  PRO D CG  1 
ATOM   8001  C CD  . PRO D 1 18  ? 9.081   -36.919 5.515   1.00 53.90  ? 13  PRO D CD  1 
ATOM   8002  N N   . HIS D 1 19  ? 9.713   -32.340 6.327   1.00 53.47  ? 14  HIS D N   1 
ATOM   8003  C CA  . HIS D 1 19  ? 8.987   -31.080 6.279   1.00 52.11  ? 14  HIS D CA  1 
ATOM   8004  C C   . HIS D 1 19  ? 8.363   -30.815 4.937   1.00 49.75  ? 14  HIS D C   1 
ATOM   8005  O O   . HIS D 1 19  ? 8.940   -31.122 3.903   1.00 51.31  ? 14  HIS D O   1 
ATOM   8006  C CB  . HIS D 1 19  ? 9.901   -29.912 6.641   1.00 55.67  ? 14  HIS D CB  1 
ATOM   8007  C CG  . HIS D 1 19  ? 10.157  -29.792 8.108   1.00 58.90  ? 14  HIS D CG  1 
ATOM   8008  N ND1 . HIS D 1 19  ? 11.391  -30.036 8.673   1.00 60.48  ? 14  HIS D ND1 1 
ATOM   8009  C CD2 . HIS D 1 19  ? 9.325   -29.494 9.134   1.00 58.63  ? 14  HIS D CD2 1 
ATOM   8010  C CE1 . HIS D 1 19  ? 11.307  -29.895 9.983   1.00 60.97  ? 14  HIS D CE1 1 
ATOM   8011  N NE2 . HIS D 1 19  ? 10.064  -29.567 10.288  1.00 60.99  ? 14  HIS D NE2 1 
ATOM   8012  N N   . PHE D 1 20  ? 7.179   -30.225 4.966   1.00 46.57  ? 15  PHE D N   1 
ATOM   8013  C CA  . PHE D 1 20  ? 6.449   -29.906 3.756   1.00 43.85  ? 15  PHE D CA  1 
ATOM   8014  C C   . PHE D 1 20  ? 7.253   -28.986 2.852   1.00 44.86  ? 15  PHE D C   1 
ATOM   8015  O O   . PHE D 1 20  ? 7.720   -27.941 3.277   1.00 44.84  ? 15  PHE D O   1 
ATOM   8016  C CB  . PHE D 1 20  ? 5.134   -29.264 4.147   1.00 40.40  ? 15  PHE D CB  1 
ATOM   8017  C CG  . PHE D 1 20  ? 4.422   -30.004 5.236   1.00 37.31  ? 15  PHE D CG  1 
ATOM   8018  C CD1 . PHE D 1 20  ? 3.862   -31.250 4.993   1.00 33.97  ? 15  PHE D CD1 1 
ATOM   8019  C CD2 . PHE D 1 20  ? 4.355   -29.479 6.521   1.00 36.50  ? 15  PHE D CD2 1 
ATOM   8020  C CE1 . PHE D 1 20  ? 3.250   -31.963 6.010   1.00 33.86  ? 15  PHE D CE1 1 
ATOM   8021  C CE2 . PHE D 1 20  ? 3.742   -30.190 7.552   1.00 35.95  ? 15  PHE D CE2 1 
ATOM   8022  C CZ  . PHE D 1 20  ? 3.189   -31.434 7.294   1.00 34.70  ? 15  PHE D CZ  1 
ATOM   8023  N N   . GLN D 1 21  ? 7.422   -29.400 1.602   1.00 48.09  ? 16  GLN D N   1 
ATOM   8024  C CA  . GLN D 1 21  ? 8.171   -28.631 0.617   1.00 50.35  ? 16  GLN D CA  1 
ATOM   8025  C C   . GLN D 1 21  ? 7.578   -27.258 0.364   1.00 46.96  ? 16  GLN D C   1 
ATOM   8026  O O   . GLN D 1 21  ? 6.363   -27.078 0.425   1.00 46.09  ? 16  GLN D O   1 
ATOM   8027  C CB  . GLN D 1 21  ? 8.198   -29.363 -0.720  1.00 57.45  ? 16  GLN D CB  1 
ATOM   8028  C CG  . GLN D 1 21  ? 9.170   -30.503 -0.843  1.00 69.67  ? 16  GLN D CG  1 
ATOM   8029  C CD  . GLN D 1 21  ? 9.098   -31.129 -2.219  1.00 76.20  ? 16  GLN D CD  1 
ATOM   8030  O OE1 . GLN D 1 21  ? 8.089   -31.738 -2.582  1.00 80.43  ? 16  GLN D OE1 1 
ATOM   8031  N NE2 . GLN D 1 21  ? 10.159  -30.967 -3.003  1.00 80.47  ? 16  GLN D NE2 1 
ATOM   8032  N N   . HIS D 1 22  ? 8.456   -26.306 0.055   1.00 43.89  ? 17  HIS D N   1 
ATOM   8033  C CA  . HIS D 1 22  ? 8.085   -24.925 -0.268  1.00 41.17  ? 17  HIS D CA  1 
ATOM   8034  C C   . HIS D 1 22  ? 7.345   -24.097 0.793   1.00 38.56  ? 17  HIS D C   1 
ATOM   8035  O O   . HIS D 1 22  ? 7.068   -22.918 0.559   1.00 37.51  ? 17  HIS D O   1 
ATOM   8036  C CB  . HIS D 1 22  ? 7.246   -24.887 -1.555  1.00 43.52  ? 17  HIS D CB  1 
ATOM   8037  C CG  . HIS D 1 22  ? 7.743   -25.790 -2.643  1.00 43.74  ? 17  HIS D CG  1 
ATOM   8038  N ND1 . HIS D 1 22  ? 7.470   -27.138 -2.672  1.00 44.38  ? 17  HIS D ND1 1 
ATOM   8039  C CD2 . HIS D 1 22  ? 8.494   -25.534 -3.741  1.00 44.50  ? 17  HIS D CD2 1 
ATOM   8040  C CE1 . HIS D 1 22  ? 8.031   -27.678 -3.740  1.00 43.81  ? 17  HIS D CE1 1 
ATOM   8041  N NE2 . HIS D 1 22  ? 8.657   -26.725 -4.405  1.00 44.70  ? 17  HIS D NE2 1 
ATOM   8042  N N   . PHE D 1 23  ? 7.027   -24.695 1.940   1.00 36.01  ? 18  PHE D N   1 
ATOM   8043  C CA  . PHE D 1 23  ? 6.299   -23.994 2.997   1.00 32.86  ? 18  PHE D CA  1 
ATOM   8044  C C   . PHE D 1 23  ? 6.787   -22.565 3.190   1.00 32.26  ? 18  PHE D C   1 
ATOM   8045  O O   . PHE D 1 23  ? 6.022   -21.616 3.015   1.00 33.52  ? 18  PHE D O   1 
ATOM   8046  C CB  . PHE D 1 23  ? 6.418   -24.743 4.317   1.00 33.57  ? 18  PHE D CB  1 
ATOM   8047  C CG  . PHE D 1 23  ? 5.469   -24.255 5.377   1.00 34.62  ? 18  PHE D CG  1 
ATOM   8048  C CD1 . PHE D 1 23  ? 4.195   -24.796 5.490   1.00 33.73  ? 18  PHE D CD1 1 
ATOM   8049  C CD2 . PHE D 1 23  ? 5.851   -23.254 6.261   1.00 35.10  ? 18  PHE D CD2 1 
ATOM   8050  C CE1 . PHE D 1 23  ? 3.311   -24.350 6.472   1.00 36.76  ? 18  PHE D CE1 1 
ATOM   8051  C CE2 . PHE D 1 23  ? 4.974   -22.796 7.251   1.00 37.02  ? 18  PHE D CE2 1 
ATOM   8052  C CZ  . PHE D 1 23  ? 3.702   -23.345 7.357   1.00 36.86  ? 18  PHE D CZ  1 
ATOM   8053  N N   . ALA D 1 24  ? 8.061   -22.417 3.546   1.00 31.55  ? 19  ALA D N   1 
ATOM   8054  C CA  . ALA D 1 24  ? 8.669   -21.099 3.763   1.00 30.83  ? 19  ALA D CA  1 
ATOM   8055  C C   . ALA D 1 24  ? 8.591   -20.197 2.533   1.00 30.94  ? 19  ALA D C   1 
ATOM   8056  O O   . ALA D 1 24  ? 8.292   -19.006 2.642   1.00 32.33  ? 19  ALA D O   1 
ATOM   8057  C CB  . ALA D 1 24  ? 10.115  -21.259 4.181   1.00 29.28  ? 19  ALA D CB  1 
ATOM   8058  N N   . THR D 1 25  ? 8.864   -20.765 1.365   1.00 30.66  ? 20  THR D N   1 
ATOM   8059  C CA  . THR D 1 25  ? 8.821   -20.005 0.130   1.00 29.52  ? 20  THR D CA  1 
ATOM   8060  C C   . THR D 1 25  ? 7.429   -19.462 -0.113  1.00 29.32  ? 20  THR D C   1 
ATOM   8061  O O   . THR D 1 25  ? 7.271   -18.282 -0.409  1.00 30.23  ? 20  THR D O   1 
ATOM   8062  C CB  . THR D 1 25  ? 9.237   -20.869 -1.073  1.00 29.89  ? 20  THR D CB  1 
ATOM   8063  O OG1 . THR D 1 25  ? 10.590  -21.298 -0.899  1.00 29.63  ? 20  THR D OG1 1 
ATOM   8064  C CG2 . THR D 1 25  ? 9.143   -20.073 -2.364  1.00 28.31  ? 20  THR D CG2 1 
ATOM   8065  N N   . GLN D 1 26  ? 6.426   -20.328 0.014   1.00 30.90  ? 21  GLN D N   1 
ATOM   8066  C CA  . GLN D 1 26  ? 5.029   -19.947 -0.192  1.00 32.85  ? 21  GLN D CA  1 
ATOM   8067  C C   . GLN D 1 26  ? 4.576   -18.926 0.859   1.00 34.98  ? 21  GLN D C   1 
ATOM   8068  O O   . GLN D 1 26  ? 3.922   -17.916 0.541   1.00 33.98  ? 21  GLN D O   1 
ATOM   8069  C CB  . GLN D 1 26  ? 4.120   -21.178 -0.099  1.00 33.57  ? 21  GLN D CB  1 
ATOM   8070  C CG  . GLN D 1 26  ? 4.549   -22.352 -0.947  1.00 37.59  ? 21  GLN D CG  1 
ATOM   8071  C CD  . GLN D 1 26  ? 3.642   -23.559 -0.774  1.00 40.83  ? 21  GLN D CD  1 
ATOM   8072  O OE1 . GLN D 1 26  ? 3.439   -24.049 0.341   1.00 40.61  ? 21  GLN D OE1 1 
ATOM   8073  N NE2 . GLN D 1 26  ? 3.092   -24.048 -1.883  1.00 42.17  ? 21  GLN D NE2 1 
ATOM   8074  N N   . ALA D 1 27  ? 4.925   -19.202 2.115   1.00 34.69  ? 22  ALA D N   1 
ATOM   8075  C CA  . ALA D 1 27  ? 4.553   -18.334 3.229   1.00 34.97  ? 22  ALA D CA  1 
ATOM   8076  C C   . ALA D 1 27  ? 5.037   -16.898 3.017   1.00 35.41  ? 22  ALA D C   1 
ATOM   8077  O O   . ALA D 1 27  ? 4.437   -15.932 3.503   1.00 36.23  ? 22  ALA D O   1 
ATOM   8078  C CB  . ALA D 1 27  ? 5.124   -18.894 4.530   1.00 33.14  ? 22  ALA D CB  1 
ATOM   8079  N N   . ILE D 1 28  ? 6.126   -16.765 2.276   1.00 33.53  ? 23  ILE D N   1 
ATOM   8080  C CA  . ILE D 1 28  ? 6.698   -15.464 2.022   1.00 31.92  ? 23  ILE D CA  1 
ATOM   8081  C C   . ILE D 1 28  ? 6.251   -14.848 0.701   1.00 32.91  ? 23  ILE D C   1 
ATOM   8082  O O   . ILE D 1 28  ? 5.903   -13.666 0.640   1.00 32.96  ? 23  ILE D O   1 
ATOM   8083  C CB  . ILE D 1 28  ? 8.236   -15.560 2.051   1.00 30.58  ? 23  ILE D CB  1 
ATOM   8084  C CG1 . ILE D 1 28  ? 8.684   -16.069 3.429   1.00 28.79  ? 23  ILE D CG1 1 
ATOM   8085  C CG2 . ILE D 1 28  ? 8.856   -14.215 1.698   1.00 28.78  ? 23  ILE D CG2 1 
ATOM   8086  C CD1 . ILE D 1 28  ? 10.185  -16.245 3.600   1.00 25.15  ? 23  ILE D CD1 1 
ATOM   8087  N N   . HIS D 1 29  ? 6.232   -15.651 -0.355  1.00 33.99  ? 24  HIS D N   1 
ATOM   8088  C CA  . HIS D 1 29  ? 5.867   -15.138 -1.665  1.00 35.74  ? 24  HIS D CA  1 
ATOM   8089  C C   . HIS D 1 29  ? 4.411   -15.228 -2.092  1.00 37.14  ? 24  HIS D C   1 
ATOM   8090  O O   . HIS D 1 29  ? 3.901   -14.301 -2.711  1.00 36.25  ? 24  HIS D O   1 
ATOM   8091  C CB  . HIS D 1 29  ? 6.759   -15.791 -2.715  1.00 34.97  ? 24  HIS D CB  1 
ATOM   8092  C CG  . HIS D 1 29  ? 8.209   -15.486 -2.526  1.00 36.58  ? 24  HIS D CG  1 
ATOM   8093  N ND1 . HIS D 1 29  ? 8.722   -14.212 -2.658  1.00 37.28  ? 24  HIS D ND1 1 
ATOM   8094  C CD2 . HIS D 1 29  ? 9.243   -16.268 -2.139  1.00 38.07  ? 24  HIS D CD2 1 
ATOM   8095  C CE1 . HIS D 1 29  ? 10.007  -14.223 -2.355  1.00 37.40  ? 24  HIS D CE1 1 
ATOM   8096  N NE2 . HIS D 1 29  ? 10.349  -15.459 -2.036  1.00 39.14  ? 24  HIS D NE2 1 
ATOM   8097  N N   . VAL D 1 30  ? 3.733   -16.320 -1.760  1.00 38.76  ? 25  VAL D N   1 
ATOM   8098  C CA  . VAL D 1 30  ? 2.343   -16.475 -2.174  1.00 41.66  ? 25  VAL D CA  1 
ATOM   8099  C C   . VAL D 1 30  ? 1.453   -15.284 -1.819  1.00 47.26  ? 25  VAL D C   1 
ATOM   8100  O O   . VAL D 1 30  ? 1.346   -14.893 -0.655  1.00 46.65  ? 25  VAL D O   1 
ATOM   8101  C CB  . VAL D 1 30  ? 1.721   -17.771 -1.598  1.00 38.38  ? 25  VAL D CB  1 
ATOM   8102  C CG1 . VAL D 1 30  ? 0.253   -17.859 -1.978  1.00 35.68  ? 25  VAL D CG1 1 
ATOM   8103  C CG2 . VAL D 1 30  ? 2.454   -18.974 -2.149  1.00 35.08  ? 25  VAL D CG2 1 
ATOM   8104  N N   . GLY D 1 31  ? 0.822   -14.716 -2.847  1.00 51.50  ? 26  GLY D N   1 
ATOM   8105  C CA  . GLY D 1 31  ? -0.069  -13.582 -2.667  1.00 56.88  ? 26  GLY D CA  1 
ATOM   8106  C C   . GLY D 1 31  ? 0.613   -12.257 -2.379  1.00 60.90  ? 26  GLY D C   1 
ATOM   8107  O O   . GLY D 1 31  ? -0.050  -11.296 -1.983  1.00 62.44  ? 26  GLY D O   1 
ATOM   8108  N N   . GLN D 1 32  ? 1.929   -12.201 -2.585  1.00 63.84  ? 27  GLN D N   1 
ATOM   8109  C CA  . GLN D 1 32  ? 2.716   -10.990 -2.334  1.00 65.20  ? 27  GLN D CA  1 
ATOM   8110  C C   . GLN D 1 32  ? 3.190   -10.312 -3.621  1.00 65.65  ? 27  GLN D C   1 
ATOM   8111  O O   . GLN D 1 32  ? 2.458   -10.230 -4.607  1.00 67.15  ? 27  GLN D O   1 
ATOM   8112  C CB  . GLN D 1 32  ? 3.936   -11.328 -1.472  1.00 66.24  ? 27  GLN D CB  1 
ATOM   8113  C CG  . GLN D 1 32  ? 3.612   -12.041 -0.166  1.00 69.06  ? 27  GLN D CG  1 
ATOM   8114  C CD  . GLN D 1 32  ? 2.846   -11.171 0.820   1.00 69.88  ? 27  GLN D CD  1 
ATOM   8115  O OE1 . GLN D 1 32  ? 3.317   -10.102 1.221   1.00 70.80  ? 27  GLN D OE1 1 
ATOM   8116  N NE2 . GLN D 1 32  ? 1.664   -11.629 1.222   1.00 69.63  ? 27  GLN D NE2 1 
ATOM   8117  N N   . GLY D 1 69  ? -14.713 -9.451  1.627   1.00 77.02  ? 64  GLY D N   1 
ATOM   8118  C CA  . GLY D 1 69  ? -13.331 -9.746  1.958   1.00 75.72  ? 64  GLY D CA  1 
ATOM   8119  C C   . GLY D 1 69  ? -12.379 -8.816  1.242   1.00 74.04  ? 64  GLY D C   1 
ATOM   8120  O O   . GLY D 1 69  ? -11.883 -7.852  1.829   1.00 77.06  ? 64  GLY D O   1 
ATOM   8121  N N   . ASN D 1 70  ? -12.122 -9.118  -0.028  1.00 70.11  ? 65  ASN D N   1 
ATOM   8122  C CA  . ASN D 1 70  ? -11.252 -8.317  -0.887  1.00 64.75  ? 65  ASN D CA  1 
ATOM   8123  C C   . ASN D 1 70  ? -9.753  -8.608  -0.768  1.00 59.51  ? 65  ASN D C   1 
ATOM   8124  O O   . ASN D 1 70  ? -9.328  -9.358  0.109   1.00 59.09  ? 65  ASN D O   1 
ATOM   8125  C CB  . ASN D 1 70  ? -11.565 -6.831  -0.692  1.00 65.90  ? 65  ASN D CB  1 
ATOM   8126  C CG  . ASN D 1 70  ? -12.941 -6.465  -1.215  1.00 66.67  ? 65  ASN D CG  1 
ATOM   8127  O OD1 . ASN D 1 70  ? -13.955 -6.865  -0.646  1.00 68.91  ? 65  ASN D OD1 1 
ATOM   8128  N ND2 . ASN D 1 70  ? -12.984 -5.720  -2.317  1.00 67.53  ? 65  ASN D ND2 1 
ATOM   8129  N N   . PRO D 1 71  ? -8.933  -8.003  -1.652  1.00 55.46  ? 66  PRO D N   1 
ATOM   8130  C CA  . PRO D 1 71  ? -7.484  -8.199  -1.680  1.00 52.12  ? 66  PRO D CA  1 
ATOM   8131  C C   . PRO D 1 71  ? -6.798  -8.773  -0.455  1.00 48.39  ? 66  PRO D C   1 
ATOM   8132  O O   . PRO D 1 71  ? -6.277  -9.884  -0.490  1.00 47.98  ? 66  PRO D O   1 
ATOM   8133  C CB  . PRO D 1 71  ? -6.968  -6.818  -2.052  1.00 51.95  ? 66  PRO D CB  1 
ATOM   8134  C CG  . PRO D 1 71  ? -7.948  -6.404  -3.059  1.00 53.10  ? 66  PRO D CG  1 
ATOM   8135  C CD  . PRO D 1 71  ? -9.273  -6.783  -2.414  1.00 54.45  ? 66  PRO D CD  1 
ATOM   8136  N N   . THR D 1 72  ? -6.794  -8.017  0.628   1.00 45.22  ? 67  THR D N   1 
ATOM   8137  C CA  . THR D 1 72  ? -6.125  -8.459  1.831   1.00 43.58  ? 67  THR D CA  1 
ATOM   8138  C C   . THR D 1 72  ? -6.519  -9.877  2.244   1.00 42.88  ? 67  THR D C   1 
ATOM   8139  O O   . THR D 1 72  ? -5.653  -10.738 2.436   1.00 42.52  ? 67  THR D O   1 
ATOM   8140  C CB  . THR D 1 72  ? -6.413  -7.496  2.971   1.00 43.36  ? 67  THR D CB  1 
ATOM   8141  O OG1 . THR D 1 72  ? -6.625  -6.187  2.430   1.00 44.13  ? 67  THR D OG1 1 
ATOM   8142  C CG2 . THR D 1 72  ? -5.237  -7.446  3.918   1.00 42.46  ? 67  THR D CG2 1 
ATOM   8143  N N   . ARG D 1 73  ? -7.819  -10.128 2.361   1.00 40.93  ? 68  ARG D N   1 
ATOM   8144  C CA  . ARG D 1 73  ? -8.280  -11.443 2.774   1.00 40.68  ? 68  ARG D CA  1 
ATOM   8145  C C   . ARG D 1 73  ? -7.946  -12.533 1.773   1.00 40.37  ? 68  ARG D C   1 
ATOM   8146  O O   . ARG D 1 73  ? -7.478  -13.603 2.154   1.00 41.34  ? 68  ARG D O   1 
ATOM   8147  C CB  . ARG D 1 73  ? -9.783  -11.432 3.026   1.00 39.44  ? 68  ARG D CB  1 
ATOM   8148  C CG  . ARG D 1 73  ? -10.242 -12.614 3.854   1.00 39.23  ? 68  ARG D CG  1 
ATOM   8149  C CD  . ARG D 1 73  ? -11.710 -12.496 4.189   1.00 41.65  ? 68  ARG D CD  1 
ATOM   8150  N NE  . ARG D 1 73  ? -12.547 -12.770 3.029   1.00 42.38  ? 68  ARG D NE  1 
ATOM   8151  C CZ  . ARG D 1 73  ? -13.852 -12.529 2.977   1.00 42.62  ? 68  ARG D CZ  1 
ATOM   8152  N NH1 . ARG D 1 73  ? -14.477 -12.001 4.021   1.00 42.37  ? 68  ARG D NH1 1 
ATOM   8153  N NH2 . ARG D 1 73  ? -14.535 -12.818 1.878   1.00 44.32  ? 68  ARG D NH2 1 
ATOM   8154  N N   . ASN D 1 74  ? -8.192  -12.265 0.495   1.00 40.85  ? 69  ASN D N   1 
ATOM   8155  C CA  . ASN D 1 74  ? -7.906  -13.232 -0.560  1.00 42.68  ? 69  ASN D CA  1 
ATOM   8156  C C   . ASN D 1 74  ? -6.446  -13.672 -0.537  1.00 40.93  ? 69  ASN D C   1 
ATOM   8157  O O   . ASN D 1 74  ? -6.152  -14.868 -0.629  1.00 39.19  ? 69  ASN D O   1 
ATOM   8158  C CB  . ASN D 1 74  ? -8.243  -12.625 -1.917  1.00 46.68  ? 69  ASN D CB  1 
ATOM   8159  C CG  . ASN D 1 74  ? -9.710  -12.266 -2.035  1.00 50.64  ? 69  ASN D CG  1 
ATOM   8160  O OD1 . ASN D 1 74  ? -10.362 -11.941 -1.041  1.00 53.14  ? 69  ASN D OD1 1 
ATOM   8161  N ND2 . ASN D 1 74  ? -10.235 -12.308 -3.253  1.00 53.47  ? 69  ASN D ND2 1 
ATOM   8162  N N   . CYS D 1 75  ? -5.538  -12.705 -0.414  1.00 39.36  ? 70  CYS D N   1 
ATOM   8163  C CA  . CYS D 1 75  ? -4.107  -12.994 -0.364  1.00 38.98  ? 70  CYS D CA  1 
ATOM   8164  C C   . CYS D 1 75  ? -3.798  -13.864 0.832   1.00 37.72  ? 70  CYS D C   1 
ATOM   8165  O O   . CYS D 1 75  ? -3.059  -14.842 0.715   1.00 37.15  ? 70  CYS D O   1 
ATOM   8166  C CB  . CYS D 1 75  ? -3.297  -11.705 -0.279  1.00 40.27  ? 70  CYS D CB  1 
ATOM   8167  S SG  . CYS D 1 75  ? -3.337  -10.753 -1.807  1.00 46.73  ? 70  CYS D SG  1 
ATOM   8168  N N   . LEU D 1 76  ? -4.364  -13.504 1.982   1.00 36.09  ? 71  LEU D N   1 
ATOM   8169  C CA  . LEU D 1 76  ? -4.164  -14.277 3.206   1.00 33.53  ? 71  LEU D CA  1 
ATOM   8170  C C   . LEU D 1 76  ? -4.628  -15.703 2.976   1.00 34.13  ? 71  LEU D C   1 
ATOM   8171  O O   . LEU D 1 76  ? -3.918  -16.653 3.306   1.00 34.39  ? 71  LEU D O   1 
ATOM   8172  C CB  . LEU D 1 76  ? -4.964  -13.692 4.370   1.00 30.17  ? 71  LEU D CB  1 
ATOM   8173  C CG  . LEU D 1 76  ? -4.862  -14.513 5.657   1.00 25.32  ? 71  LEU D CG  1 
ATOM   8174  C CD1 . LEU D 1 76  ? -3.454  -14.454 6.177   1.00 23.36  ? 71  LEU D CD1 1 
ATOM   8175  C CD2 . LEU D 1 76  ? -5.825  -13.974 6.696   1.00 26.78  ? 71  LEU D CD2 1 
ATOM   8176  N N   . GLU D 1 77  ? -5.825  -15.842 2.412   1.00 33.99  ? 72  GLU D N   1 
ATOM   8177  C CA  . GLU D 1 77  ? -6.391  -17.153 2.138   1.00 35.17  ? 72  GLU D CA  1 
ATOM   8178  C C   . GLU D 1 77  ? -5.548  -17.905 1.103   1.00 36.57  ? 72  GLU D C   1 
ATOM   8179  O O   . GLU D 1 77  ? -5.213  -19.070 1.316   1.00 36.82  ? 72  GLU D O   1 
ATOM   8180  C CB  . GLU D 1 77  ? -7.850  -17.012 1.677   1.00 35.21  ? 72  GLU D CB  1 
ATOM   8181  C CG  . GLU D 1 77  ? -8.740  -16.319 2.716   1.00 36.35  ? 72  GLU D CG  1 
ATOM   8182  C CD  . GLU D 1 77  ? -10.197 -16.176 2.292   1.00 37.49  ? 72  GLU D CD  1 
ATOM   8183  O OE1 . GLU D 1 77  ? -10.456 -15.739 1.153   1.00 39.86  ? 72  GLU D OE1 1 
ATOM   8184  O OE2 . GLU D 1 77  ? -11.091 -16.484 3.109   1.00 37.65  ? 72  GLU D OE2 1 
ATOM   8185  N N   . LYS D 1 78  ? -5.180  -17.249 0.002   1.00 37.49  ? 73  LYS D N   1 
ATOM   8186  C CA  . LYS D 1 78  ? -4.359  -17.917 -1.009  1.00 39.47  ? 73  LYS D CA  1 
ATOM   8187  C C   . LYS D 1 78  ? -3.162  -18.559 -0.330  1.00 38.59  ? 73  LYS D C   1 
ATOM   8188  O O   . LYS D 1 78  ? -2.915  -19.752 -0.472  1.00 38.62  ? 73  LYS D O   1 
ATOM   8189  C CB  . LYS D 1 78  ? -3.828  -16.935 -2.064  1.00 44.10  ? 73  LYS D CB  1 
ATOM   8190  C CG  . LYS D 1 78  ? -4.807  -16.521 -3.150  1.00 52.01  ? 73  LYS D CG  1 
ATOM   8191  C CD  . LYS D 1 78  ? -4.086  -15.829 -4.326  1.00 57.43  ? 73  LYS D CD  1 
ATOM   8192  C CE  . LYS D 1 78  ? -5.073  -15.198 -5.329  1.00 61.16  ? 73  LYS D CE  1 
ATOM   8193  N NZ  . LYS D 1 78  ? -5.836  -14.013 -4.796  1.00 62.03  ? 73  LYS D NZ  1 
ATOM   8194  N N   . ALA D 1 79  ? -2.426  -17.744 0.414   1.00 36.49  ? 74  ALA D N   1 
ATOM   8195  C CA  . ALA D 1 79  ? -1.230  -18.186 1.112   1.00 35.41  ? 74  ALA D CA  1 
ATOM   8196  C C   . ALA D 1 79  ? -1.479  -19.289 2.142   1.00 34.83  ? 74  ALA D C   1 
ATOM   8197  O O   . ALA D 1 79  ? -0.710  -20.251 2.219   1.00 33.67  ? 74  ALA D O   1 
ATOM   8198  C CB  . ALA D 1 79  ? -0.543  -16.978 1.776   1.00 33.21  ? 74  ALA D CB  1 
ATOM   8199  N N   . VAL D 1 80  ? -2.541  -19.158 2.933   1.00 34.58  ? 75  VAL D N   1 
ATOM   8200  C CA  . VAL D 1 80  ? -2.824  -20.167 3.946   1.00 34.69  ? 75  VAL D CA  1 
ATOM   8201  C C   . VAL D 1 80  ? -3.200  -21.469 3.259   1.00 34.89  ? 75  VAL D C   1 
ATOM   8202  O O   . VAL D 1 80  ? -2.815  -22.550 3.706   1.00 34.75  ? 75  VAL D O   1 
ATOM   8203  C CB  . VAL D 1 80  ? -3.958  -19.726 4.899   1.00 35.28  ? 75  VAL D CB  1 
ATOM   8204  C CG1 . VAL D 1 80  ? -4.231  -20.817 5.931   1.00 32.77  ? 75  VAL D CG1 1 
ATOM   8205  C CG2 . VAL D 1 80  ? -3.570  -18.435 5.599   1.00 34.84  ? 75  VAL D CG2 1 
ATOM   8206  N N   . ALA D 1 81  ? -3.938  -21.366 2.161   1.00 34.67  ? 76  ALA D N   1 
ATOM   8207  C CA  . ALA D 1 81  ? -4.327  -22.554 1.412   1.00 34.85  ? 76  ALA D CA  1 
ATOM   8208  C C   . ALA D 1 81  ? -3.066  -23.357 1.090   1.00 35.36  ? 76  ALA D C   1 
ATOM   8209  O O   . ALA D 1 81  ? -2.982  -24.549 1.368   1.00 35.58  ? 76  ALA D O   1 
ATOM   8210  C CB  . ALA D 1 81  ? -5.033  -22.155 0.128   1.00 33.04  ? 76  ALA D CB  1 
ATOM   8211  N N   . ALA D 1 82  ? -2.077  -22.677 0.526   1.00 36.09  ? 77  ALA D N   1 
ATOM   8212  C CA  . ALA D 1 82  ? -0.820  -23.302 0.154   1.00 36.34  ? 77  ALA D CA  1 
ATOM   8213  C C   . ALA D 1 82  ? -0.124  -23.995 1.323   1.00 36.88  ? 77  ALA D C   1 
ATOM   8214  O O   . ALA D 1 82  ? 0.284   -25.151 1.210   1.00 37.33  ? 77  ALA D O   1 
ATOM   8215  C CB  . ALA D 1 82  ? 0.104   -22.258 -0.460  1.00 36.38  ? 77  ALA D CB  1 
ATOM   8216  N N   . LEU D 1 83  ? 0.013   -23.289 2.441   1.00 37.10  ? 78  LEU D N   1 
ATOM   8217  C CA  . LEU D 1 83  ? 0.680   -23.843 3.620   1.00 36.58  ? 78  LEU D CA  1 
ATOM   8218  C C   . LEU D 1 83  ? -0.040  -25.080 4.166   1.00 38.66  ? 78  LEU D C   1 
ATOM   8219  O O   . LEU D 1 83  ? 0.589   -25.977 4.736   1.00 37.94  ? 78  LEU D O   1 
ATOM   8220  C CB  . LEU D 1 83  ? 0.804   -22.761 4.703   1.00 32.94  ? 78  LEU D CB  1 
ATOM   8221  C CG  . LEU D 1 83  ? 1.589   -21.523 4.256   1.00 27.96  ? 78  LEU D CG  1 
ATOM   8222  C CD1 . LEU D 1 83  ? 1.650   -20.532 5.370   1.00 24.85  ? 78  LEU D CD1 1 
ATOM   8223  C CD2 . LEU D 1 83  ? 2.993   -21.919 3.847   1.00 27.39  ? 78  LEU D CD2 1 
ATOM   8224  N N   . ASP D 1 84  ? -1.359  -25.120 3.986   1.00 39.99  ? 79  ASP D N   1 
ATOM   8225  C CA  . ASP D 1 84  ? -2.164  -26.254 4.430   1.00 39.42  ? 79  ASP D CA  1 
ATOM   8226  C C   . ASP D 1 84  ? -2.170  -27.324 3.353   1.00 40.36  ? 79  ASP D C   1 
ATOM   8227  O O   . ASP D 1 84  ? -2.772  -28.380 3.526   1.00 39.18  ? 79  ASP D O   1 
ATOM   8228  C CB  . ASP D 1 84  ? -3.613  -25.842 4.690   1.00 39.67  ? 79  ASP D CB  1 
ATOM   8229  C CG  . ASP D 1 84  ? -3.804  -25.169 6.030   1.00 39.93  ? 79  ASP D CG  1 
ATOM   8230  O OD1 . ASP D 1 84  ? -3.094  -25.534 6.990   1.00 39.41  ? 79  ASP D OD1 1 
ATOM   8231  O OD2 . ASP D 1 84  ? -4.687  -24.290 6.127   1.00 41.23  ? 79  ASP D OD2 1 
ATOM   8232  N N   . GLY D 1 85  ? -1.504  -27.042 2.239   1.00 40.52  ? 80  GLY D N   1 
ATOM   8233  C CA  . GLY D 1 85  ? -1.475  -27.995 1.148   1.00 41.50  ? 80  GLY D CA  1 
ATOM   8234  C C   . GLY D 1 85  ? -2.868  -28.109 0.563   1.00 42.32  ? 80  GLY D C   1 
ATOM   8235  O O   . GLY D 1 85  ? -3.151  -29.003 -0.226  1.00 42.12  ? 80  GLY D O   1 
ATOM   8236  N N   . ALA D 1 86  ? -3.738  -27.186 0.961   1.00 44.00  ? 81  ALA D N   1 
ATOM   8237  C CA  . ALA D 1 86  ? -5.121  -27.158 0.497   1.00 44.91  ? 81  ALA D CA  1 
ATOM   8238  C C   . ALA D 1 86  ? -5.279  -26.375 -0.796  1.00 45.43  ? 81  ALA D C   1 
ATOM   8239  O O   . ALA D 1 86  ? -4.454  -25.529 -1.133  1.00 44.20  ? 81  ALA D O   1 
ATOM   8240  C CB  . ALA D 1 86  ? -6.016  -26.544 1.563   1.00 46.25  ? 81  ALA D CB  1 
ATOM   8241  N N   . LYS D 1 87  ? -6.362  -26.659 -1.510  1.00 46.99  ? 82  LYS D N   1 
ATOM   8242  C CA  . LYS D 1 87  ? -6.634  -25.977 -2.758  1.00 48.54  ? 82  LYS D CA  1 
ATOM   8243  C C   . LYS D 1 87  ? -7.367  -24.674 -2.443  1.00 48.58  ? 82  LYS D C   1 
ATOM   8244  O O   . LYS D 1 87  ? -7.231  -23.682 -3.168  1.00 48.19  ? 82  LYS D O   1 
ATOM   8245  C CB  . LYS D 1 87  ? -7.477  -26.865 -3.686  1.00 49.26  ? 82  LYS D CB  1 
ATOM   8246  C CG  . LYS D 1 87  ? -7.625  -26.279 -5.086  1.00 55.01  ? 82  LYS D CG  1 
ATOM   8247  C CD  . LYS D 1 87  ? -8.309  -27.220 -6.083  1.00 59.44  ? 82  LYS D CD  1 
ATOM   8248  C CE  . LYS D 1 87  ? -8.358  -26.594 -7.500  1.00 61.19  ? 82  LYS D CE  1 
ATOM   8249  N NZ  . LYS D 1 87  ? -9.003  -27.456 -8.547  1.00 61.09  ? 82  LYS D NZ  1 
ATOM   8250  N N   . TYR D 1 88  ? -8.118  -24.673 -1.341  1.00 48.67  ? 83  TYR D N   1 
ATOM   8251  C CA  . TYR D 1 88  ? -8.886  -23.494 -0.931  1.00 48.92  ? 83  TYR D CA  1 
ATOM   8252  C C   . TYR D 1 88  ? -8.760  -23.159 0.566   1.00 45.75  ? 83  TYR D C   1 
ATOM   8253  O O   . TYR D 1 88  ? -8.380  -24.004 1.379   1.00 44.31  ? 83  TYR D O   1 
ATOM   8254  C CB  . TYR D 1 88  ? -10.374 -23.705 -1.250  1.00 53.92  ? 83  TYR D CB  1 
ATOM   8255  C CG  . TYR D 1 88  ? -10.692 -24.132 -2.670  1.00 59.61  ? 83  TYR D CG  1 
ATOM   8256  C CD1 . TYR D 1 88  ? -11.536 -25.213 -2.915  1.00 62.51  ? 83  TYR D CD1 1 
ATOM   8257  C CD2 . TYR D 1 88  ? -10.182 -23.443 -3.764  1.00 62.43  ? 83  TYR D CD2 1 
ATOM   8258  C CE1 . TYR D 1 88  ? -11.870 -25.598 -4.216  1.00 64.51  ? 83  TYR D CE1 1 
ATOM   8259  C CE2 . TYR D 1 88  ? -10.509 -23.820 -5.070  1.00 65.25  ? 83  TYR D CE2 1 
ATOM   8260  C CZ  . TYR D 1 88  ? -11.354 -24.898 -5.286  1.00 64.75  ? 83  TYR D CZ  1 
ATOM   8261  O OH  . TYR D 1 88  ? -11.681 -25.274 -6.567  1.00 63.62  ? 83  TYR D OH  1 
ATOM   8262  N N   . CYS D 1 89  ? -9.076  -21.914 0.917   1.00 43.20  ? 84  CYS D N   1 
ATOM   8263  C CA  . CYS D 1 89  ? -9.063  -21.484 2.316   1.00 40.77  ? 84  CYS D CA  1 
ATOM   8264  C C   . CYS D 1 89  ? -10.085 -20.377 2.566   1.00 39.25  ? 84  CYS D C   1 
ATOM   8265  O O   . CYS D 1 89  ? -10.382 -19.588 1.672   1.00 39.07  ? 84  CYS D O   1 
ATOM   8266  C CB  . CYS D 1 89  ? -7.682  -21.003 2.755   1.00 40.00  ? 84  CYS D CB  1 
ATOM   8267  S SG  . CYS D 1 89  ? -7.608  -20.718 4.550   1.00 34.41  ? 84  CYS D SG  1 
ATOM   8268  N N   . LEU D 1 90  ? -10.618 -20.339 3.786   1.00 38.43  ? 85  LEU D N   1 
ATOM   8269  C CA  . LEU D 1 90  ? -11.620 -19.356 4.192   1.00 36.13  ? 85  LEU D CA  1 
ATOM   8270  C C   . LEU D 1 90  ? -11.251 -18.780 5.552   1.00 36.96  ? 85  LEU D C   1 
ATOM   8271  O O   . LEU D 1 90  ? -11.013 -19.527 6.497   1.00 37.92  ? 85  LEU D O   1 
ATOM   8272  C CB  . LEU D 1 90  ? -12.980 -20.034 4.278   1.00 35.78  ? 85  LEU D CB  1 
ATOM   8273  C CG  . LEU D 1 90  ? -13.377 -20.717 2.971   1.00 34.79  ? 85  LEU D CG  1 
ATOM   8274  C CD1 . LEU D 1 90  ? -14.258 -21.892 3.251   1.00 35.27  ? 85  LEU D CD1 1 
ATOM   8275  C CD2 . LEU D 1 90  ? -14.064 -19.724 2.075   1.00 35.27  ? 85  LEU D CD2 1 
ATOM   8276  N N   . ALA D 1 91  ? -11.208 -17.452 5.650   1.00 36.30  ? 86  ALA D N   1 
ATOM   8277  C CA  . ALA D 1 91  ? -10.852 -16.776 6.895   1.00 34.85  ? 86  ALA D CA  1 
ATOM   8278  C C   . ALA D 1 91  ? -12.066 -16.265 7.665   1.00 34.93  ? 86  ALA D C   1 
ATOM   8279  O O   . ALA D 1 91  ? -12.978 -15.676 7.085   1.00 34.05  ? 86  ALA D O   1 
ATOM   8280  C CB  . ALA D 1 91  ? -9.917  -15.623 6.597   1.00 34.05  ? 86  ALA D CB  1 
ATOM   8281  N N   . PHE D 1 92  ? -12.062 -16.490 8.978   1.00 35.01  ? 87  PHE D N   1 
ATOM   8282  C CA  . PHE D 1 92  ? -13.153 -16.057 9.845   1.00 34.64  ? 87  PHE D CA  1 
ATOM   8283  C C   . PHE D 1 92  ? -12.619 -15.242 11.011  1.00 34.57  ? 87  PHE D C   1 
ATOM   8284  O O   . PHE D 1 92  ? -11.437 -15.310 11.328  1.00 33.93  ? 87  PHE D O   1 
ATOM   8285  C CB  . PHE D 1 92  ? -13.951 -17.262 10.363  1.00 35.40  ? 87  PHE D CB  1 
ATOM   8286  C CG  . PHE D 1 92  ? -14.623 -18.049 9.272   1.00 36.15  ? 87  PHE D CG  1 
ATOM   8287  C CD1 . PHE D 1 92  ? -13.950 -19.078 8.622   1.00 36.75  ? 87  PHE D CD1 1 
ATOM   8288  C CD2 . PHE D 1 92  ? -15.903 -17.716 8.844   1.00 36.43  ? 87  PHE D CD2 1 
ATOM   8289  C CE1 . PHE D 1 92  ? -14.537 -19.759 7.555   1.00 37.27  ? 87  PHE D CE1 1 
ATOM   8290  C CE2 . PHE D 1 92  ? -16.502 -18.395 7.772   1.00 37.91  ? 87  PHE D CE2 1 
ATOM   8291  C CZ  . PHE D 1 92  ? -15.816 -19.415 7.130   1.00 37.22  ? 87  PHE D CZ  1 
ATOM   8292  N N   . ALA D 1 93  ? -13.501 -14.468 11.639  1.00 34.05  ? 88  ALA D N   1 
ATOM   8293  C CA  . ALA D 1 93  ? -13.145 -13.603 12.755  1.00 33.15  ? 88  ALA D CA  1 
ATOM   8294  C C   . ALA D 1 93  ? -12.391 -14.301 13.895  1.00 34.57  ? 88  ALA D C   1 
ATOM   8295  O O   . ALA D 1 93  ? -11.527 -13.709 14.550  1.00 34.04  ? 88  ALA D O   1 
ATOM   8296  C CB  . ALA D 1 93  ? -14.405 -12.934 13.288  1.00 31.63  ? 88  ALA D CB  1 
ATOM   8297  N N   . SER D 1 94  ? -12.716 -15.563 14.130  1.00 35.53  ? 89  SER D N   1 
ATOM   8298  C CA  . SER D 1 94  ? -12.073 -16.308 15.199  1.00 34.96  ? 89  SER D CA  1 
ATOM   8299  C C   . SER D 1 94  ? -12.151 -17.797 14.911  1.00 35.16  ? 89  SER D C   1 
ATOM   8300  O O   . SER D 1 94  ? -12.944 -18.230 14.075  1.00 36.05  ? 89  SER D O   1 
ATOM   8301  C CB  . SER D 1 94  ? -12.795 -16.024 16.506  1.00 36.05  ? 89  SER D CB  1 
ATOM   8302  O OG  . SER D 1 94  ? -14.099 -16.582 16.471  1.00 34.89  ? 89  SER D OG  1 
ATOM   8303  N N   . GLY D 1 95  ? -11.340 -18.580 15.611  1.00 34.40  ? 90  GLY D N   1 
ATOM   8304  C CA  . GLY D 1 95  ? -11.375 -20.017 15.415  1.00 35.02  ? 90  GLY D CA  1 
ATOM   8305  C C   . GLY D 1 95  ? -12.753 -20.558 15.767  1.00 35.38  ? 90  GLY D C   1 
ATOM   8306  O O   . GLY D 1 95  ? -13.261 -21.480 15.119  1.00 34.43  ? 90  GLY D O   1 
ATOM   8307  N N   . LEU D 1 96  ? -13.360 -19.974 16.796  1.00 35.84  ? 91  LEU D N   1 
ATOM   8308  C CA  . LEU D 1 96  ? -14.693 -20.379 17.235  1.00 36.87  ? 91  LEU D CA  1 
ATOM   8309  C C   . LEU D 1 96  ? -15.715 -20.099 16.137  1.00 37.48  ? 91  LEU D C   1 
ATOM   8310  O O   . LEU D 1 96  ? -16.555 -20.951 15.833  1.00 37.83  ? 91  LEU D O   1 
ATOM   8311  C CB  . LEU D 1 96  ? -15.106 -19.622 18.496  1.00 36.63  ? 91  LEU D CB  1 
ATOM   8312  C CG  . LEU D 1 96  ? -16.345 -20.167 19.203  1.00 36.56  ? 91  LEU D CG  1 
ATOM   8313  C CD1 . LEU D 1 96  ? -15.958 -21.387 20.023  1.00 37.36  ? 91  LEU D CD1 1 
ATOM   8314  C CD2 . LEU D 1 96  ? -16.918 -19.111 20.115  1.00 36.82  ? 91  LEU D CD2 1 
ATOM   8315  N N   . ALA D 1 97  ? -15.647 -18.902 15.557  1.00 36.66  ? 92  ALA D N   1 
ATOM   8316  C CA  . ALA D 1 97  ? -16.561 -18.514 14.482  1.00 36.23  ? 92  ALA D CA  1 
ATOM   8317  C C   . ALA D 1 97  ? -16.340 -19.452 13.306  1.00 36.36  ? 92  ALA D C   1 
ATOM   8318  O O   . ALA D 1 97  ? -17.259 -19.741 12.529  1.00 34.37  ? 92  ALA D O   1 
ATOM   8319  C CB  . ALA D 1 97  ? -16.300 -17.070 14.056  1.00 37.43  ? 92  ALA D CB  1 
ATOM   8320  N N   . ALA D 1 98  ? -15.103 -19.915 13.173  1.00 36.52  ? 93  ALA D N   1 
ATOM   8321  C CA  . ALA D 1 98  ? -14.773 -20.846 12.109  1.00 37.53  ? 93  ALA D CA  1 
ATOM   8322  C C   . ALA D 1 98  ? -15.572 -22.102 12.416  1.00 37.36  ? 93  ALA D C   1 
ATOM   8323  O O   . ALA D 1 98  ? -16.344 -22.569 11.584  1.00 37.66  ? 93  ALA D O   1 
ATOM   8324  C CB  . ALA D 1 98  ? -13.273 -21.154 12.107  1.00 37.64  ? 93  ALA D CB  1 
ATOM   8325  N N   . THR D 1 99  ? -15.397 -22.620 13.631  1.00 37.58  ? 94  THR D N   1 
ATOM   8326  C CA  . THR D 1 99  ? -16.092 -23.821 14.088  1.00 38.02  ? 94  THR D CA  1 
ATOM   8327  C C   . THR D 1 99  ? -17.609 -23.761 13.875  1.00 39.12  ? 94  THR D C   1 
ATOM   8328  O O   . THR D 1 99  ? -18.202 -24.696 13.327  1.00 39.55  ? 94  THR D O   1 
ATOM   8329  C CB  . THR D 1 99  ? -15.843 -24.062 15.571  1.00 37.68  ? 94  THR D CB  1 
ATOM   8330  O OG1 . THR D 1 99  ? -14.445 -23.931 15.848  1.00 36.45  ? 94  THR D OG1 1 
ATOM   8331  C CG2 . THR D 1 99  ? -16.317 -25.460 15.957  1.00 37.89  ? 94  THR D CG2 1 
ATOM   8332  N N   . VAL D 1 100 ? -18.234 -22.675 14.327  1.00 38.25  ? 95  VAL D N   1 
ATOM   8333  C CA  . VAL D 1 100 ? -19.674 -22.504 14.159  1.00 36.63  ? 95  VAL D CA  1 
ATOM   8334  C C   . VAL D 1 100 ? -20.001 -22.666 12.683  1.00 36.18  ? 95  VAL D C   1 
ATOM   8335  O O   . VAL D 1 100 ? -20.790 -23.521 12.298  1.00 36.99  ? 95  VAL D O   1 
ATOM   8336  C CB  . VAL D 1 100 ? -20.151 -21.088 14.606  1.00 36.88  ? 95  VAL D CB  1 
ATOM   8337  C CG1 . VAL D 1 100 ? -21.645 -20.921 14.339  1.00 33.07  ? 95  VAL D CG1 1 
ATOM   8338  C CG2 . VAL D 1 100 ? -19.862 -20.876 16.085  1.00 37.63  ? 95  VAL D CG2 1 
ATOM   8339  N N   . THR D 1 101 ? -19.380 -21.839 11.857  1.00 35.02  ? 96  THR D N   1 
ATOM   8340  C CA  . THR D 1 101 ? -19.618 -21.886 10.427  1.00 35.61  ? 96  THR D CA  1 
ATOM   8341  C C   . THR D 1 101 ? -19.480 -23.296 9.857   1.00 36.60  ? 96  THR D C   1 
ATOM   8342  O O   . THR D 1 101 ? -20.229 -23.679 8.959   1.00 36.54  ? 96  THR D O   1 
ATOM   8343  C CB  . THR D 1 101 ? -18.659 -20.944 9.700   1.00 34.76  ? 96  THR D CB  1 
ATOM   8344  O OG1 . THR D 1 101 ? -18.822 -19.622 10.226  1.00 35.09  ? 96  THR D OG1 1 
ATOM   8345  C CG2 . THR D 1 101 ? -18.950 -20.931 8.203   1.00 34.34  ? 96  THR D CG2 1 
ATOM   8346  N N   . ILE D 1 102 ? -18.520 -24.067 10.362  1.00 37.56  ? 97  ILE D N   1 
ATOM   8347  C CA  . ILE D 1 102 ? -18.331 -25.435 9.879   1.00 38.56  ? 97  ILE D CA  1 
ATOM   8348  C C   . ILE D 1 102 ? -19.616 -26.196 10.193  1.00 40.27  ? 97  ILE D C   1 
ATOM   8349  O O   . ILE D 1 102 ? -20.203 -26.820 9.320   1.00 40.47  ? 97  ILE D O   1 
ATOM   8350  C CB  . ILE D 1 102 ? -17.147 -26.169 10.590  1.00 38.29  ? 97  ILE D CB  1 
ATOM   8351  C CG1 . ILE D 1 102 ? -15.797 -25.531 10.229  1.00 36.68  ? 97  ILE D CG1 1 
ATOM   8352  C CG2 . ILE D 1 102 ? -17.156 -27.635 10.213  1.00 37.53  ? 97  ILE D CG2 1 
ATOM   8353  C CD1 . ILE D 1 102 ? -15.428 -25.627 8.785   1.00 36.57  ? 97  ILE D CD1 1 
ATOM   8354  N N   . THR D 1 103 ? -20.064 -26.125 11.442  1.00 40.82  ? 98  THR D N   1 
ATOM   8355  C CA  . THR D 1 103 ? -21.279 -26.830 11.825  1.00 42.28  ? 98  THR D CA  1 
ATOM   8356  C C   . THR D 1 103 ? -22.522 -26.350 11.067  1.00 44.03  ? 98  THR D C   1 
ATOM   8357  O O   . THR D 1 103 ? -23.453 -27.125 10.865  1.00 43.97  ? 98  THR D O   1 
ATOM   8358  C CB  . THR D 1 103 ? -21.538 -26.743 13.362  1.00 41.10  ? 98  THR D CB  1 
ATOM   8359  O OG1 . THR D 1 103 ? -21.874 -25.404 13.735  1.00 42.05  ? 98  THR D OG1 1 
ATOM   8360  C CG2 . THR D 1 103 ? -20.307 -27.175 14.128  1.00 39.71  ? 98  THR D CG2 1 
ATOM   8361  N N   . HIS D 1 104 ? -22.550 -25.086 10.646  1.00 46.38  ? 99  HIS D N   1 
ATOM   8362  C CA  . HIS D 1 104 ? -23.707 -24.574 9.901   1.00 47.93  ? 99  HIS D CA  1 
ATOM   8363  C C   . HIS D 1 104 ? -23.874 -25.384 8.623   1.00 48.90  ? 99  HIS D C   1 
ATOM   8364  O O   . HIS D 1 104 ? -24.878 -25.268 7.914   1.00 49.08  ? 99  HIS D O   1 
ATOM   8365  C CB  . HIS D 1 104 ? -23.524 -23.103 9.523   1.00 48.73  ? 99  HIS D CB  1 
ATOM   8366  C CG  . HIS D 1 104 ? -23.774 -22.151 10.648  1.00 49.43  ? 99  HIS D CG  1 
ATOM   8367  N ND1 . HIS D 1 104 ? -24.720 -22.385 11.621  1.00 49.95  ? 99  HIS D ND1 1 
ATOM   8368  C CD2 . HIS D 1 104 ? -23.252 -20.931 10.914  1.00 50.38  ? 99  HIS D CD2 1 
ATOM   8369  C CE1 . HIS D 1 104 ? -24.772 -21.349 12.438  1.00 50.74  ? 99  HIS D CE1 1 
ATOM   8370  N NE2 . HIS D 1 104 ? -23.892 -20.452 12.031  1.00 51.26  ? 99  HIS D NE2 1 
ATOM   8371  N N   . LEU D 1 105 ? -22.864 -26.193 8.332   1.00 49.29  ? 100 LEU D N   1 
ATOM   8372  C CA  . LEU D 1 105 ? -22.863 -27.046 7.157   1.00 49.79  ? 100 LEU D CA  1 
ATOM   8373  C C   . LEU D 1 105 ? -23.916 -28.136 7.318   1.00 51.78  ? 100 LEU D C   1 
ATOM   8374  O O   . LEU D 1 105 ? -24.553 -28.536 6.345   1.00 53.45  ? 100 LEU D O   1 
ATOM   8375  C CB  . LEU D 1 105 ? -21.483 -27.677 6.994   1.00 48.18  ? 100 LEU D CB  1 
ATOM   8376  C CG  . LEU D 1 105 ? -20.628 -27.381 5.763   1.00 46.47  ? 100 LEU D CG  1 
ATOM   8377  C CD1 . LEU D 1 105 ? -20.865 -25.970 5.252   1.00 44.65  ? 100 LEU D CD1 1 
ATOM   8378  C CD2 . LEU D 1 105 ? -19.173 -27.603 6.138   1.00 43.83  ? 100 LEU D CD2 1 
ATOM   8379  N N   . LEU D 1 106 ? -24.091 -28.607 8.551   1.00 53.30  ? 101 LEU D N   1 
ATOM   8380  C CA  . LEU D 1 106 ? -25.060 -29.656 8.867   1.00 54.96  ? 101 LEU D CA  1 
ATOM   8381  C C   . LEU D 1 106 ? -26.477 -29.118 9.007   1.00 58.75  ? 101 LEU D C   1 
ATOM   8382  O O   . LEU D 1 106 ? -26.684 -27.923 9.206   1.00 58.64  ? 101 LEU D O   1 
ATOM   8383  C CB  . LEU D 1 106 ? -24.674 -30.365 10.173  1.00 50.58  ? 101 LEU D CB  1 
ATOM   8384  C CG  . LEU D 1 106 ? -23.270 -30.968 10.232  1.00 48.54  ? 101 LEU D CG  1 
ATOM   8385  C CD1 . LEU D 1 106 ? -23.063 -31.682 11.567  1.00 45.72  ? 101 LEU D CD1 1 
ATOM   8386  C CD2 . LEU D 1 106 ? -23.089 -31.931 9.065   1.00 46.51  ? 101 LEU D CD2 1 
ATOM   8387  N N   . LYS D 1 107 ? -27.452 -30.015 8.905   1.00 64.21  ? 102 LYS D N   1 
ATOM   8388  C CA  . LYS D 1 107 ? -28.859 -29.647 9.039   1.00 69.16  ? 102 LYS D CA  1 
ATOM   8389  C C   . LYS D 1 107 ? -29.393 -30.166 10.372  1.00 69.16  ? 102 LYS D C   1 
ATOM   8390  O O   . LYS D 1 107 ? -28.813 -31.083 10.959  1.00 69.96  ? 102 LYS D O   1 
ATOM   8391  C CB  . LYS D 1 107 ? -29.670 -30.229 7.874   1.00 75.02  ? 102 LYS D CB  1 
ATOM   8392  C CG  . LYS D 1 107 ? -29.206 -31.612 7.409   1.00 83.02  ? 102 LYS D CG  1 
ATOM   8393  C CD  . LYS D 1 107 ? -30.044 -32.131 6.240   1.00 88.26  ? 102 LYS D CD  1 
ATOM   8394  C CE  . LYS D 1 107 ? -29.453 -33.402 5.622   1.00 90.64  ? 102 LYS D CE  1 
ATOM   8395  N NZ  . LYS D 1 107 ? -29.349 -34.533 6.585   1.00 91.61  ? 102 LYS D NZ  1 
ATOM   8396  N N   . ALA D 1 108 ? -30.484 -29.575 10.856  1.00 67.98  ? 103 ALA D N   1 
ATOM   8397  C CA  . ALA D 1 108 ? -31.074 -29.996 12.128  1.00 66.13  ? 103 ALA D CA  1 
ATOM   8398  C C   . ALA D 1 108 ? -31.226 -31.514 12.152  1.00 65.47  ? 103 ALA D C   1 
ATOM   8399  O O   . ALA D 1 108 ? -31.674 -32.120 11.177  1.00 65.38  ? 103 ALA D O   1 
ATOM   8400  C CB  . ALA D 1 108 ? -32.425 -29.329 12.324  1.00 64.85  ? 103 ALA D CB  1 
ATOM   8401  N N   . GLY D 1 109 ? -30.836 -32.132 13.260  1.00 64.74  ? 104 GLY D N   1 
ATOM   8402  C CA  . GLY D 1 109 ? -30.946 -33.573 13.350  1.00 64.41  ? 104 GLY D CA  1 
ATOM   8403  C C   . GLY D 1 109 ? -29.625 -34.313 13.240  1.00 65.62  ? 104 GLY D C   1 
ATOM   8404  O O   . GLY D 1 109 ? -29.391 -35.262 13.995  1.00 66.67  ? 104 GLY D O   1 
ATOM   8405  N N   . ASP D 1 110 ? -28.765 -33.900 12.309  1.00 65.88  ? 105 ASP D N   1 
ATOM   8406  C CA  . ASP D 1 110 ? -27.465 -34.550 12.127  1.00 66.89  ? 105 ASP D CA  1 
ATOM   8407  C C   . ASP D 1 110 ? -26.705 -34.660 13.440  1.00 66.27  ? 105 ASP D C   1 
ATOM   8408  O O   . ASP D 1 110 ? -26.862 -33.829 14.337  1.00 63.87  ? 105 ASP D O   1 
ATOM   8409  C CB  . ASP D 1 110 ? -26.596 -33.772 11.138  1.00 70.37  ? 105 ASP D CB  1 
ATOM   8410  C CG  . ASP D 1 110 ? -27.146 -33.792 9.734   1.00 74.49  ? 105 ASP D CG  1 
ATOM   8411  O OD1 . ASP D 1 110 ? -28.273 -33.302 9.530   1.00 78.11  ? 105 ASP D OD1 1 
ATOM   8412  O OD2 . ASP D 1 110 ? -26.448 -34.295 8.830   1.00 77.32  ? 105 ASP D OD2 1 
ATOM   8413  N N   . GLN D 1 111 ? -25.883 -35.697 13.553  1.00 67.28  ? 106 GLN D N   1 
ATOM   8414  C CA  . GLN D 1 111 ? -25.085 -35.878 14.755  1.00 68.53  ? 106 GLN D CA  1 
ATOM   8415  C C   . GLN D 1 111 ? -23.630 -35.543 14.493  1.00 68.37  ? 106 GLN D C   1 
ATOM   8416  O O   . GLN D 1 111 ? -23.076 -35.889 13.446  1.00 68.96  ? 106 GLN D O   1 
ATOM   8417  C CB  . GLN D 1 111 ? -25.139 -37.308 15.282  1.00 69.65  ? 106 GLN D CB  1 
ATOM   8418  C CG  . GLN D 1 111 ? -24.225 -37.460 16.496  1.00 71.95  ? 106 GLN D CG  1 
ATOM   8419  C CD  . GLN D 1 111 ? -24.059 -38.882 16.955  1.00 73.19  ? 106 GLN D CD  1 
ATOM   8420  O OE1 . GLN D 1 111 ? -23.595 -39.738 16.202  1.00 75.08  ? 106 GLN D OE1 1 
ATOM   8421  N NE2 . GLN D 1 111 ? -24.429 -39.146 18.205  1.00 73.46  ? 106 GLN D NE2 1 
ATOM   8422  N N   . ILE D 1 112 ? -23.015 -34.879 15.463  1.00 67.08  ? 107 ILE D N   1 
ATOM   8423  C CA  . ILE D 1 112 ? -21.620 -34.499 15.365  1.00 64.93  ? 107 ILE D CA  1 
ATOM   8424  C C   . ILE D 1 112 ? -20.851 -35.178 16.496  1.00 63.28  ? 107 ILE D C   1 
ATOM   8425  O O   . ILE D 1 112 ? -21.218 -35.083 17.667  1.00 62.99  ? 107 ILE D O   1 
ATOM   8426  C CB  . ILE D 1 112 ? -21.468 -32.937 15.405  1.00 65.85  ? 107 ILE D CB  1 
ATOM   8427  C CG1 . ILE D 1 112 ? -20.069 -32.544 15.874  1.00 66.59  ? 107 ILE D CG1 1 
ATOM   8428  C CG2 . ILE D 1 112 ? -22.543 -32.324 16.278  1.00 65.39  ? 107 ILE D CG2 1 
ATOM   8429  C CD1 . ILE D 1 112 ? -18.964 -33.002 14.955  1.00 68.43  ? 107 ILE D CD1 1 
ATOM   8430  N N   . ILE D 1 113 ? -19.797 -35.896 16.129  1.00 61.35  ? 108 ILE D N   1 
ATOM   8431  C CA  . ILE D 1 113 ? -18.980 -36.594 17.106  1.00 59.26  ? 108 ILE D CA  1 
ATOM   8432  C C   . ILE D 1 113 ? -17.689 -35.817 17.296  1.00 57.94  ? 108 ILE D C   1 
ATOM   8433  O O   . ILE D 1 113 ? -16.948 -35.585 16.337  1.00 58.09  ? 108 ILE D O   1 
ATOM   8434  C CB  . ILE D 1 113 ? -18.650 -38.027 16.627  1.00 59.64  ? 108 ILE D CB  1 
ATOM   8435  C CG1 . ILE D 1 113 ? -19.949 -38.746 16.243  1.00 60.43  ? 108 ILE D CG1 1 
ATOM   8436  C CG2 . ILE D 1 113 ? -17.908 -38.797 17.727  1.00 57.38  ? 108 ILE D CG2 1 
ATOM   8437  C CD1 . ILE D 1 113 ? -19.757 -40.134 15.656  1.00 61.08  ? 108 ILE D CD1 1 
ATOM   8438  N N   . CYS D 1 114 ? -17.428 -35.410 18.533  1.00 56.98  ? 109 CYS D N   1 
ATOM   8439  C CA  . CYS D 1 114 ? -16.220 -34.654 18.850  1.00 57.60  ? 109 CYS D CA  1 
ATOM   8440  C C   . CYS D 1 114 ? -15.231 -35.444 19.679  1.00 56.72  ? 109 CYS D C   1 
ATOM   8441  O O   . CYS D 1 114 ? -15.619 -36.320 20.443  1.00 56.38  ? 109 CYS D O   1 
ATOM   8442  C CB  . CYS D 1 114 ? -16.568 -33.392 19.641  1.00 57.25  ? 109 CYS D CB  1 
ATOM   8443  S SG  . CYS D 1 114 ? -17.359 -32.103 18.708  1.00 56.57  ? 109 CYS D SG  1 
ATOM   8444  N N   . MET D 1 115 ? -13.949 -35.130 19.528  1.00 58.01  ? 110 MET D N   1 
ATOM   8445  C CA  . MET D 1 115 ? -12.933 -35.778 20.341  1.00 60.17  ? 110 MET D CA  1 
ATOM   8446  C C   . MET D 1 115 ? -13.365 -35.309 21.732  1.00 61.64  ? 110 MET D C   1 
ATOM   8447  O O   . MET D 1 115 ? -13.911 -34.211 21.874  1.00 60.59  ? 110 MET D O   1 
ATOM   8448  C CB  . MET D 1 115 ? -11.544 -35.226 20.017  1.00 59.38  ? 110 MET D CB  1 
ATOM   8449  C CG  . MET D 1 115 ? -10.426 -36.253 20.054  1.00 60.76  ? 110 MET D CG  1 
ATOM   8450  S SD  . MET D 1 115 ? -10.305 -37.167 21.592  1.00 62.59  ? 110 MET D SD  1 
ATOM   8451  C CE  . MET D 1 115 ? -9.598  -35.937 22.648  1.00 64.13  ? 110 MET D CE  1 
ATOM   8452  N N   . ASP D 1 116 ? -13.154 -36.126 22.754  1.00 64.05  ? 111 ASP D N   1 
ATOM   8453  C CA  . ASP D 1 116 ? -13.571 -35.716 24.082  1.00 67.19  ? 111 ASP D CA  1 
ATOM   8454  C C   . ASP D 1 116 ? -12.461 -34.952 24.776  1.00 68.99  ? 111 ASP D C   1 
ATOM   8455  O O   . ASP D 1 116 ? -11.414 -35.513 25.098  1.00 68.25  ? 111 ASP D O   1 
ATOM   8456  C CB  . ASP D 1 116 ? -13.992 -36.933 24.907  1.00 67.65  ? 111 ASP D CB  1 
ATOM   8457  C CG  . ASP D 1 116 ? -14.547 -36.551 26.265  1.00 67.94  ? 111 ASP D CG  1 
ATOM   8458  O OD1 . ASP D 1 116 ? -15.221 -35.504 26.359  1.00 68.08  ? 111 ASP D OD1 1 
ATOM   8459  O OD2 . ASP D 1 116 ? -14.323 -37.305 27.235  1.00 68.89  ? 111 ASP D OD2 1 
ATOM   8460  N N   . ASP D 1 117 ? -12.695 -33.658 24.979  1.00 71.90  ? 112 ASP D N   1 
ATOM   8461  C CA  . ASP D 1 117 ? -11.726 -32.789 25.638  1.00 74.56  ? 112 ASP D CA  1 
ATOM   8462  C C   . ASP D 1 117 ? -12.003 -32.844 27.131  1.00 74.34  ? 112 ASP D C   1 
ATOM   8463  O O   . ASP D 1 117 ? -12.635 -31.950 27.700  1.00 74.81  ? 112 ASP D O   1 
ATOM   8464  C CB  . ASP D 1 117 ? -11.863 -31.346 25.138  1.00 78.88  ? 112 ASP D CB  1 
ATOM   8465  C CG  . ASP D 1 117 ? -10.699 -30.466 25.569  1.00 82.48  ? 112 ASP D CG  1 
ATOM   8466  O OD1 . ASP D 1 117 ? -10.794 -29.230 25.413  1.00 84.53  ? 112 ASP D OD1 1 
ATOM   8467  O OD2 . ASP D 1 117 ? -9.685  -31.014 26.056  1.00 84.67  ? 112 ASP D OD2 1 
ATOM   8468  N N   . VAL D 1 118 ? -11.523 -33.910 27.756  1.00 72.26  ? 113 VAL D N   1 
ATOM   8469  C CA  . VAL D 1 118 ? -11.726 -34.127 29.176  1.00 68.38  ? 113 VAL D CA  1 
ATOM   8470  C C   . VAL D 1 118 ? -11.195 -33.015 30.082  1.00 69.86  ? 113 VAL D C   1 
ATOM   8471  O O   . VAL D 1 118 ? -11.977 -32.257 30.649  1.00 69.96  ? 113 VAL D O   1 
ATOM   8472  C CB  . VAL D 1 118 ? -11.125 -35.493 29.594  1.00 66.98  ? 113 VAL D CB  1 
ATOM   8473  C CG1 . VAL D 1 118 ? -9.784  -35.708 28.897  1.00 64.90  ? 113 VAL D CG1 1 
ATOM   8474  C CG2 . VAL D 1 118 ? -10.972 -35.558 31.108  1.00 64.33  ? 113 VAL D CG2 1 
ATOM   8475  N N   . TYR D 1 119 ? -9.878  -32.909 30.217  1.00 70.99  ? 114 TYR D N   1 
ATOM   8476  C CA  . TYR D 1 119 ? -9.295  -31.894 31.090  1.00 71.28  ? 114 TYR D CA  1 
ATOM   8477  C C   . TYR D 1 119 ? -9.230  -30.514 30.457  1.00 70.29  ? 114 TYR D C   1 
ATOM   8478  O O   . TYR D 1 119 ? -9.136  -29.506 31.157  1.00 68.72  ? 114 TYR D O   1 
ATOM   8479  C CB  . TYR D 1 119 ? -7.895  -32.322 31.537  1.00 74.33  ? 114 TYR D CB  1 
ATOM   8480  C CG  . TYR D 1 119 ? -7.868  -33.603 32.342  1.00 78.12  ? 114 TYR D CG  1 
ATOM   8481  C CD1 . TYR D 1 119 ? -7.277  -34.760 31.832  1.00 80.32  ? 114 TYR D CD1 1 
ATOM   8482  C CD2 . TYR D 1 119 ? -8.423  -33.659 33.618  1.00 79.84  ? 114 TYR D CD2 1 
ATOM   8483  C CE1 . TYR D 1 119 ? -7.235  -35.940 32.577  1.00 81.98  ? 114 TYR D CE1 1 
ATOM   8484  C CE2 . TYR D 1 119 ? -8.388  -34.831 34.370  1.00 81.80  ? 114 TYR D CE2 1 
ATOM   8485  C CZ  . TYR D 1 119 ? -7.792  -35.966 33.844  1.00 82.51  ? 114 TYR D CZ  1 
ATOM   8486  O OH  . TYR D 1 119 ? -7.752  -37.125 34.587  1.00 83.97  ? 114 TYR D OH  1 
ATOM   8487  N N   . GLY D 1 120 ? -9.280  -30.471 29.130  1.00 70.76  ? 115 GLY D N   1 
ATOM   8488  C CA  . GLY D 1 120 ? -9.225  -29.198 28.430  1.00 70.09  ? 115 GLY D CA  1 
ATOM   8489  C C   . GLY D 1 120 ? -10.443 -28.333 28.686  1.00 69.20  ? 115 GLY D C   1 
ATOM   8490  O O   . GLY D 1 120 ? -11.312 -28.674 29.492  1.00 69.71  ? 115 GLY D O   1 
ATOM   8491  N N   . GLY D 1 121 ? -10.518 -27.209 27.987  1.00 68.79  ? 116 GLY D N   1 
ATOM   8492  C CA  . GLY D 1 121 ? -11.643 -26.316 28.180  1.00 68.96  ? 116 GLY D CA  1 
ATOM   8493  C C   . GLY D 1 121 ? -12.877 -26.609 27.347  1.00 67.85  ? 116 GLY D C   1 
ATOM   8494  O O   . GLY D 1 121 ? -13.973 -26.755 27.889  1.00 67.48  ? 116 GLY D O   1 
ATOM   8495  N N   . THR D 1 122 ? -12.697 -26.695 26.031  1.00 67.34  ? 117 THR D N   1 
ATOM   8496  C CA  . THR D 1 122 ? -13.802 -26.936 25.114  1.00 67.82  ? 117 THR D CA  1 
ATOM   8497  C C   . THR D 1 122 ? -14.739 -28.046 25.571  1.00 65.28  ? 117 THR D C   1 
ATOM   8498  O O   . THR D 1 122 ? -14.521 -28.673 26.610  1.00 65.82  ? 117 THR D O   1 
ATOM   8499  C CB  . THR D 1 122 ? -13.295 -27.256 23.688  1.00 69.95  ? 117 THR D CB  1 
ATOM   8500  O OG1 . THR D 1 122 ? -13.620 -28.609 23.352  1.00 73.18  ? 117 THR D OG1 1 
ATOM   8501  C CG2 . THR D 1 122 ? -11.791 -27.067 23.597  1.00 71.54  ? 117 THR D CG2 1 
ATOM   8502  N N   . ASN D 1 123 ? -15.771 -28.275 24.764  1.00 62.53  ? 118 ASN D N   1 
ATOM   8503  C CA  . ASN D 1 123 ? -16.822 -29.262 25.011  1.00 61.21  ? 118 ASN D CA  1 
ATOM   8504  C C   . ASN D 1 123 ? -18.072 -28.494 25.436  1.00 60.64  ? 118 ASN D C   1 
ATOM   8505  O O   . ASN D 1 123 ? -19.176 -28.829 25.008  1.00 60.38  ? 118 ASN D O   1 
ATOM   8506  C CB  . ASN D 1 123 ? -16.432 -30.291 26.087  1.00 59.23  ? 118 ASN D CB  1 
ATOM   8507  C CG  . ASN D 1 123 ? -16.134 -31.664 25.500  1.00 56.72  ? 118 ASN D CG  1 
ATOM   8508  O OD1 . ASN D 1 123 ? -16.870 -32.153 24.652  1.00 55.02  ? 118 ASN D OD1 1 
ATOM   8509  N ND2 . ASN D 1 123 ? -15.059 -32.291 25.959  1.00 56.47  ? 118 ASN D ND2 1 
ATOM   8510  N N   . ARG D 1 124 ? -17.908 -27.474 26.281  1.00 59.67  ? 119 ARG D N   1 
ATOM   8511  C CA  . ARG D 1 124 ? -19.048 -26.653 26.669  1.00 60.53  ? 119 ARG D CA  1 
ATOM   8512  C C   . ARG D 1 124 ? -19.458 -25.996 25.353  1.00 57.62  ? 119 ARG D C   1 
ATOM   8513  O O   . ARG D 1 124 ? -20.643 -25.870 25.049  1.00 56.64  ? 119 ARG D O   1 
ATOM   8514  C CB  . ARG D 1 124 ? -18.656 -25.607 27.721  1.00 66.01  ? 119 ARG D CB  1 
ATOM   8515  C CG  . ARG D 1 124 ? -17.250 -25.039 27.580  1.00 74.44  ? 119 ARG D CG  1 
ATOM   8516  C CD  . ARG D 1 124 ? -16.941 -24.025 28.679  1.00 81.54  ? 119 ARG D CD  1 
ATOM   8517  N NE  . ARG D 1 124 ? -17.159 -24.562 30.022  1.00 89.21  ? 119 ARG D NE  1 
ATOM   8518  C CZ  . ARG D 1 124 ? -16.464 -25.559 30.568  1.00 92.46  ? 119 ARG D CZ  1 
ATOM   8519  N NH1 . ARG D 1 124 ? -15.487 -26.150 29.893  1.00 94.44  ? 119 ARG D NH1 1 
ATOM   8520  N NH2 . ARG D 1 124 ? -16.747 -25.965 31.799  1.00 93.98  ? 119 ARG D NH2 1 
ATOM   8521  N N   . TYR D 1 125 ? -18.465 -25.583 24.565  1.00 56.03  ? 120 TYR D N   1 
ATOM   8522  C CA  . TYR D 1 125 ? -18.739 -25.025 23.246  1.00 54.81  ? 120 TYR D CA  1 
ATOM   8523  C C   . TYR D 1 125 ? -19.073 -26.310 22.515  1.00 53.96  ? 120 TYR D C   1 
ATOM   8524  O O   . TYR D 1 125 ? -18.844 -27.389 23.055  1.00 56.72  ? 120 TYR D O   1 
ATOM   8525  C CB  . TYR D 1 125 ? -17.495 -24.402 22.624  1.00 55.50  ? 120 TYR D CB  1 
ATOM   8526  C CG  . TYR D 1 125 ? -16.768 -23.444 23.531  1.00 57.38  ? 120 TYR D CG  1 
ATOM   8527  C CD1 . TYR D 1 125 ? -15.800 -23.907 24.430  1.00 58.08  ? 120 TYR D CD1 1 
ATOM   8528  C CD2 . TYR D 1 125 ? -17.063 -22.079 23.518  1.00 57.88  ? 120 TYR D CD2 1 
ATOM   8529  C CE1 . TYR D 1 125 ? -15.143 -23.035 25.295  1.00 58.61  ? 120 TYR D CE1 1 
ATOM   8530  C CE2 . TYR D 1 125 ? -16.412 -21.193 24.384  1.00 59.07  ? 120 TYR D CE2 1 
ATOM   8531  C CZ  . TYR D 1 125 ? -15.454 -21.680 25.270  1.00 59.24  ? 120 TYR D CZ  1 
ATOM   8532  O OH  . TYR D 1 125 ? -14.812 -20.821 26.134  1.00 58.96  ? 120 TYR D OH  1 
ATOM   8533  N N   . PHE D 1 126 ? -19.576 -26.238 21.295  1.00 51.70  ? 121 PHE D N   1 
ATOM   8534  C CA  . PHE D 1 126 ? -19.953 -27.474 20.605  1.00 51.33  ? 121 PHE D CA  1 
ATOM   8535  C C   . PHE D 1 126 ? -21.289 -27.860 21.222  1.00 51.30  ? 121 PHE D C   1 
ATOM   8536  O O   . PHE D 1 126 ? -22.307 -27.915 20.537  1.00 51.20  ? 121 PHE D O   1 
ATOM   8537  C CB  . PHE D 1 126 ? -18.953 -28.624 20.857  1.00 48.31  ? 121 PHE D CB  1 
ATOM   8538  C CG  . PHE D 1 126 ? -17.665 -28.516 20.082  1.00 46.43  ? 121 PHE D CG  1 
ATOM   8539  C CD1 . PHE D 1 126 ? -17.668 -28.510 18.685  1.00 45.23  ? 121 PHE D CD1 1 
ATOM   8540  C CD2 . PHE D 1 126 ? -16.442 -28.437 20.749  1.00 46.56  ? 121 PHE D CD2 1 
ATOM   8541  C CE1 . PHE D 1 126 ? -16.466 -28.424 17.956  1.00 43.67  ? 121 PHE D CE1 1 
ATOM   8542  C CE2 . PHE D 1 126 ? -15.233 -28.351 20.032  1.00 45.51  ? 121 PHE D CE2 1 
ATOM   8543  C CZ  . PHE D 1 126 ? -15.249 -28.344 18.633  1.00 43.91  ? 121 PHE D CZ  1 
ATOM   8544  N N   . ARG D 1 127 ? -21.279 -28.120 22.527  1.00 52.18  ? 122 ARG D N   1 
ATOM   8545  C CA  . ARG D 1 127 ? -22.496 -28.490 23.236  1.00 54.09  ? 122 ARG D CA  1 
ATOM   8546  C C   . ARG D 1 127 ? -23.500 -27.337 23.128  1.00 55.30  ? 122 ARG D C   1 
ATOM   8547  O O   . ARG D 1 127 ? -24.681 -27.568 22.865  1.00 55.46  ? 122 ARG D O   1 
ATOM   8548  C CB  . ARG D 1 127 ? -22.175 -28.807 24.701  1.00 54.24  ? 122 ARG D CB  1 
ATOM   8549  C CG  . ARG D 1 127 ? -23.011 -29.937 25.313  1.00 56.80  ? 122 ARG D CG  1 
ATOM   8550  C CD  . ARG D 1 127 ? -22.167 -30.825 26.245  1.00 57.98  ? 122 ARG D CD  1 
ATOM   8551  N NE  . ARG D 1 127 ? -21.492 -30.065 27.303  1.00 61.78  ? 122 ARG D NE  1 
ATOM   8552  C CZ  . ARG D 1 127 ? -20.427 -30.495 27.986  1.00 63.67  ? 122 ARG D CZ  1 
ATOM   8553  N NH1 . ARG D 1 127 ? -19.885 -29.726 28.929  1.00 62.88  ? 122 ARG D NH1 1 
ATOM   8554  N NH2 . ARG D 1 127 ? -19.894 -31.688 27.726  1.00 63.20  ? 122 ARG D NH2 1 
ATOM   8555  N N   . GLN D 1 128 ? -23.029 -26.100 23.302  1.00 55.92  ? 123 GLN D N   1 
ATOM   8556  C CA  . GLN D 1 128 ? -23.910 -24.930 23.197  1.00 56.81  ? 123 GLN D CA  1 
ATOM   8557  C C   . GLN D 1 128 ? -24.289 -24.682 21.734  1.00 56.38  ? 123 GLN D C   1 
ATOM   8558  O O   . GLN D 1 128 ? -25.422 -24.289 21.429  1.00 56.03  ? 123 GLN D O   1 
ATOM   8559  C CB  . GLN D 1 128 ? -23.230 -23.673 23.751  1.00 58.81  ? 123 GLN D CB  1 
ATOM   8560  C CG  . GLN D 1 128 ? -22.717 -23.800 25.171  1.00 64.11  ? 123 GLN D CG  1 
ATOM   8561  C CD  . GLN D 1 128 ? -22.048 -22.525 25.672  1.00 66.48  ? 123 GLN D CD  1 
ATOM   8562  O OE1 . GLN D 1 128 ? -21.329 -21.856 24.927  1.00 67.70  ? 123 GLN D OE1 1 
ATOM   8563  N NE2 . GLN D 1 128 ? -22.267 -22.197 26.945  1.00 66.97  ? 123 GLN D NE2 1 
ATOM   8564  N N   . VAL D 1 129 ? -23.331 -24.899 20.833  1.00 54.52  ? 124 VAL D N   1 
ATOM   8565  C CA  . VAL D 1 129 ? -23.565 -24.710 19.404  1.00 52.17  ? 124 VAL D CA  1 
ATOM   8566  C C   . VAL D 1 129 ? -24.497 -25.810 18.916  1.00 54.05  ? 124 VAL D C   1 
ATOM   8567  O O   . VAL D 1 129 ? -25.269 -25.610 17.984  1.00 54.78  ? 124 VAL D O   1 
ATOM   8568  C CB  . VAL D 1 129 ? -22.230 -24.749 18.592  1.00 50.06  ? 124 VAL D CB  1 
ATOM   8569  C CG1 . VAL D 1 129 ? -22.507 -24.758 17.091  1.00 46.93  ? 124 VAL D CG1 1 
ATOM   8570  C CG2 . VAL D 1 129 ? -21.387 -23.542 18.939  1.00 46.71  ? 124 VAL D CG2 1 
ATOM   8571  N N   . ALA D 1 130 ? -24.427 -26.971 19.556  1.00 55.47  ? 125 ALA D N   1 
ATOM   8572  C CA  . ALA D 1 130 ? -25.276 -28.087 19.184  1.00 57.25  ? 125 ALA D CA  1 
ATOM   8573  C C   . ALA D 1 130 ? -26.692 -27.774 19.655  1.00 59.35  ? 125 ALA D C   1 
ATOM   8574  O O   . ALA D 1 130 ? -27.648 -27.896 18.888  1.00 60.60  ? 125 ALA D O   1 
ATOM   8575  C CB  . ALA D 1 130 ? -24.770 -29.367 19.829  1.00 57.47  ? 125 ALA D CB  1 
ATOM   8576  N N   . SER D 1 131 ? -26.816 -27.366 20.918  1.00 61.06  ? 126 SER D N   1 
ATOM   8577  C CA  . SER D 1 131 ? -28.113 -27.011 21.497  1.00 62.48  ? 126 SER D CA  1 
ATOM   8578  C C   . SER D 1 131 ? -28.859 -26.100 20.528  1.00 62.52  ? 126 SER D C   1 
ATOM   8579  O O   . SER D 1 131 ? -29.837 -26.508 19.900  1.00 62.66  ? 126 SER D O   1 
ATOM   8580  C CB  . SER D 1 131 ? -27.920 -26.286 22.824  1.00 63.27  ? 126 SER D CB  1 
ATOM   8581  O OG  . SER D 1 131 ? -29.145 -25.720 23.249  1.00 66.15  ? 126 SER D OG  1 
ATOM   8582  N N   . GLU D 1 132 ? -28.398 -24.858 20.430  1.00 61.95  ? 127 GLU D N   1 
ATOM   8583  C CA  . GLU D 1 132 ? -28.969 -23.901 19.495  1.00 61.84  ? 127 GLU D CA  1 
ATOM   8584  C C   . GLU D 1 132 ? -28.710 -24.560 18.143  1.00 62.05  ? 127 GLU D C   1 
ATOM   8585  O O   . GLU D 1 132 ? -27.907 -25.487 18.063  1.00 63.70  ? 127 GLU D O   1 
ATOM   8586  C CB  . GLU D 1 132 ? -28.211 -22.579 19.607  1.00 62.39  ? 127 GLU D CB  1 
ATOM   8587  C CG  . GLU D 1 132 ? -28.447 -21.584 18.490  1.00 61.90  ? 127 GLU D CG  1 
ATOM   8588  C CD  . GLU D 1 132 ? -27.687 -20.287 18.719  1.00 61.64  ? 127 GLU D CD  1 
ATOM   8589  O OE1 . GLU D 1 132 ? -26.504 -20.364 19.116  1.00 60.92  ? 127 GLU D OE1 1 
ATOM   8590  O OE2 . GLU D 1 132 ? -28.265 -19.197 18.500  1.00 61.14  ? 127 GLU D OE2 1 
ATOM   8591  N N   . PHE D 1 133 ? -29.381 -24.119 17.086  1.00 61.19  ? 128 PHE D N   1 
ATOM   8592  C CA  . PHE D 1 133 ? -29.165 -24.731 15.770  1.00 61.73  ? 128 PHE D CA  1 
ATOM   8593  C C   . PHE D 1 133 ? -29.739 -26.157 15.669  1.00 61.87  ? 128 PHE D C   1 
ATOM   8594  O O   . PHE D 1 133 ? -29.827 -26.725 14.575  1.00 62.35  ? 128 PHE D O   1 
ATOM   8595  C CB  . PHE D 1 133 ? -27.665 -24.760 15.443  1.00 59.83  ? 128 PHE D CB  1 
ATOM   8596  C CG  . PHE D 1 133 ? -27.003 -23.416 15.518  1.00 56.81  ? 128 PHE D CG  1 
ATOM   8597  C CD1 . PHE D 1 133 ? -25.703 -23.299 15.981  1.00 55.94  ? 128 PHE D CD1 1 
ATOM   8598  C CD2 . PHE D 1 133 ? -27.685 -22.267 15.139  1.00 56.24  ? 128 PHE D CD2 1 
ATOM   8599  C CE1 . PHE D 1 133 ? -25.096 -22.062 16.070  1.00 56.50  ? 128 PHE D CE1 1 
ATOM   8600  C CE2 . PHE D 1 133 ? -27.087 -21.024 15.222  1.00 55.52  ? 128 PHE D CE2 1 
ATOM   8601  C CZ  . PHE D 1 133 ? -25.790 -20.919 15.690  1.00 56.60  ? 128 PHE D CZ  1 
ATOM   8602  N N   . GLY D 1 134 ? -30.107 -26.730 16.814  1.00 61.56  ? 129 GLY D N   1 
ATOM   8603  C CA  . GLY D 1 134 ? -30.699 -28.060 16.851  1.00 61.32  ? 129 GLY D CA  1 
ATOM   8604  C C   . GLY D 1 134 ? -29.925 -29.221 16.256  1.00 61.25  ? 129 GLY D C   1 
ATOM   8605  O O   . GLY D 1 134 ? -30.325 -29.791 15.231  1.00 60.95  ? 129 GLY D O   1 
ATOM   8606  N N   . LEU D 1 135 ? -28.825 -29.583 16.910  1.00 60.65  ? 130 LEU D N   1 
ATOM   8607  C CA  . LEU D 1 135 ? -27.987 -30.689 16.465  1.00 61.54  ? 130 LEU D CA  1 
ATOM   8608  C C   . LEU D 1 135 ? -27.716 -31.641 17.629  1.00 62.52  ? 130 LEU D C   1 
ATOM   8609  O O   . LEU D 1 135 ? -27.865 -31.271 18.800  1.00 60.51  ? 130 LEU D O   1 
ATOM   8610  C CB  . LEU D 1 135 ? -26.653 -30.168 15.908  1.00 60.83  ? 130 LEU D CB  1 
ATOM   8611  C CG  . LEU D 1 135 ? -26.660 -29.370 14.604  1.00 59.25  ? 130 LEU D CG  1 
ATOM   8612  C CD1 . LEU D 1 135 ? -25.243 -28.958 14.264  1.00 59.49  ? 130 LEU D CD1 1 
ATOM   8613  C CD2 . LEU D 1 135 ? -27.243 -30.213 13.484  1.00 59.00  ? 130 LEU D CD2 1 
ATOM   8614  N N   . LYS D 1 136 ? -27.327 -32.867 17.296  1.00 63.92  ? 131 LYS D N   1 
ATOM   8615  C CA  . LYS D 1 136 ? -27.027 -33.884 18.295  1.00 66.66  ? 131 LYS D CA  1 
ATOM   8616  C C   . LYS D 1 136 ? -25.510 -34.006 18.425  1.00 67.15  ? 131 LYS D C   1 
ATOM   8617  O O   . LYS D 1 136 ? -24.818 -34.293 17.448  1.00 67.84  ? 131 LYS D O   1 
ATOM   8618  C CB  . LYS D 1 136 ? -27.618 -35.226 17.860  1.00 70.17  ? 131 LYS D CB  1 
ATOM   8619  C CG  . LYS D 1 136 ? -27.357 -36.388 18.812  1.00 75.98  ? 131 LYS D CG  1 
ATOM   8620  C CD  . LYS D 1 136 ? -28.496 -36.576 19.798  1.00 80.41  ? 131 LYS D CD  1 
ATOM   8621  C CE  . LYS D 1 136 ? -28.316 -37.850 20.605  1.00 82.55  ? 131 LYS D CE  1 
ATOM   8622  N NZ  . LYS D 1 136 ? -29.463 -38.095 21.515  1.00 83.68  ? 131 LYS D NZ  1 
ATOM   8623  N N   . ILE D 1 137 ? -24.993 -33.785 19.629  1.00 66.78  ? 132 ILE D N   1 
ATOM   8624  C CA  . ILE D 1 137 ? -23.557 -33.874 19.861  1.00 66.41  ? 132 ILE D CA  1 
ATOM   8625  C C   . ILE D 1 137 ? -23.232 -35.133 20.661  1.00 66.31  ? 132 ILE D C   1 
ATOM   8626  O O   . ILE D 1 137 ? -23.961 -35.509 21.579  1.00 65.93  ? 132 ILE D O   1 
ATOM   8627  C CB  . ILE D 1 137 ? -23.023 -32.611 20.621  1.00 65.69  ? 132 ILE D CB  1 
ATOM   8628  C CG1 . ILE D 1 137 ? -21.491 -32.574 20.601  1.00 64.76  ? 132 ILE D CG1 1 
ATOM   8629  C CG2 . ILE D 1 137 ? -23.487 -32.627 22.070  1.00 65.58  ? 132 ILE D CG2 1 
ATOM   8630  C CD1 . ILE D 1 137 ? -20.894 -32.434 19.231  1.00 62.74  ? 132 ILE D CD1 1 
ATOM   8631  N N   . SER D 1 138 ? -22.143 -35.791 20.283  1.00 67.62  ? 133 SER D N   1 
ATOM   8632  C CA  . SER D 1 138 ? -21.693 -36.995 20.962  1.00 69.24  ? 133 SER D CA  1 
ATOM   8633  C C   . SER D 1 138 ? -20.175 -36.921 21.106  1.00 68.18  ? 133 SER D C   1 
ATOM   8634  O O   . SER D 1 138 ? -19.449 -36.923 20.110  1.00 69.72  ? 133 SER D O   1 
ATOM   8635  C CB  . SER D 1 138 ? -22.085 -38.236 20.158  1.00 70.73  ? 133 SER D CB  1 
ATOM   8636  O OG  . SER D 1 138 ? -21.647 -39.417 20.810  1.00 73.35  ? 133 SER D OG  1 
ATOM   8637  N N   . PHE D 1 139 ? -19.702 -36.841 22.346  1.00 66.75  ? 134 PHE D N   1 
ATOM   8638  C CA  . PHE D 1 139 ? -18.274 -36.754 22.613  1.00 66.14  ? 134 PHE D CA  1 
ATOM   8639  C C   . PHE D 1 139 ? -17.674 -38.138 22.810  1.00 65.02  ? 134 PHE D C   1 
ATOM   8640  O O   . PHE D 1 139 ? -18.092 -38.898 23.678  1.00 64.96  ? 134 PHE D O   1 
ATOM   8641  C CB  . PHE D 1 139 ? -18.034 -35.869 23.836  1.00 68.89  ? 134 PHE D CB  1 
ATOM   8642  C CG  . PHE D 1 139 ? -18.564 -34.471 23.673  1.00 73.03  ? 134 PHE D CG  1 
ATOM   8643  C CD1 . PHE D 1 139 ? -18.118 -33.662 22.628  1.00 75.53  ? 134 PHE D CD1 1 
ATOM   8644  C CD2 . PHE D 1 139 ? -19.532 -33.970 24.535  1.00 74.63  ? 134 PHE D CD2 1 
ATOM   8645  C CE1 . PHE D 1 139 ? -18.634 -32.373 22.443  1.00 77.07  ? 134 PHE D CE1 1 
ATOM   8646  C CE2 . PHE D 1 139 ? -20.053 -32.683 24.357  1.00 76.52  ? 134 PHE D CE2 1 
ATOM   8647  C CZ  . PHE D 1 139 ? -19.603 -31.885 23.310  1.00 76.78  ? 134 PHE D CZ  1 
ATOM   8648  N N   . VAL D 1 140 ? -16.681 -38.457 21.991  1.00 63.29  ? 135 VAL D N   1 
ATOM   8649  C CA  . VAL D 1 140 ? -16.041 -39.759 22.036  1.00 61.23  ? 135 VAL D CA  1 
ATOM   8650  C C   . VAL D 1 140 ? -14.520 -39.674 22.043  1.00 62.30  ? 135 VAL D C   1 
ATOM   8651  O O   . VAL D 1 140 ? -13.930 -38.971 21.224  1.00 62.18  ? 135 VAL D O   1 
ATOM   8652  C CB  . VAL D 1 140 ? -16.474 -40.594 20.818  1.00 60.62  ? 135 VAL D CB  1 
ATOM   8653  C CG1 . VAL D 1 140 ? -15.627 -41.857 20.713  1.00 60.12  ? 135 VAL D CG1 1 
ATOM   8654  C CG2 . VAL D 1 140 ? -17.954 -40.929 20.932  1.00 60.26  ? 135 VAL D CG2 1 
ATOM   8655  N N   . ASP D 1 141 ? -13.888 -40.400 22.963  1.00 61.84  ? 136 ASP D N   1 
ATOM   8656  C CA  . ASP D 1 141 ? -12.432 -40.411 23.039  1.00 61.60  ? 136 ASP D CA  1 
ATOM   8657  C C   . ASP D 1 141 ? -11.889 -41.149 21.818  1.00 60.87  ? 136 ASP D C   1 
ATOM   8658  O O   . ASP D 1 141 ? -11.905 -42.374 21.763  1.00 61.85  ? 136 ASP D O   1 
ATOM   8659  C CB  . ASP D 1 141 ? -11.961 -41.100 24.326  1.00 61.18  ? 136 ASP D CB  1 
ATOM   8660  C CG  . ASP D 1 141 ? -10.449 -41.221 24.404  1.00 62.29  ? 136 ASP D CG  1 
ATOM   8661  O OD1 . ASP D 1 141 ? -9.920  -41.394 25.520  1.00 63.69  ? 136 ASP D OD1 1 
ATOM   8662  O OD2 . ASP D 1 141 ? -9.784  -41.153 23.349  1.00 61.30  ? 136 ASP D OD2 1 
ATOM   8663  N N   . CYS D 1 142 ? -11.404 -40.394 20.841  1.00 60.77  ? 137 CYS D N   1 
ATOM   8664  C CA  . CYS D 1 142 ? -10.883 -40.982 19.621  1.00 60.75  ? 137 CYS D CA  1 
ATOM   8665  C C   . CYS D 1 142 ? -9.429  -41.419 19.730  1.00 61.05  ? 137 CYS D C   1 
ATOM   8666  O O   . CYS D 1 142 ? -8.769  -41.661 18.719  1.00 59.67  ? 137 CYS D O   1 
ATOM   8667  C CB  . CYS D 1 142 ? -11.070 -40.001 18.468  1.00 61.30  ? 137 CYS D CB  1 
ATOM   8668  S SG  . CYS D 1 142 ? -12.798 -39.468 18.299  1.00 61.96  ? 137 CYS D SG  1 
ATOM   8669  N N   . SER D 1 143 ? -8.936  -41.515 20.964  1.00 62.97  ? 138 SER D N   1 
ATOM   8670  C CA  . SER D 1 143 ? -7.570  -41.970 21.219  1.00 64.82  ? 138 SER D CA  1 
ATOM   8671  C C   . SER D 1 143 ? -7.588  -43.449 20.855  1.00 66.24  ? 138 SER D C   1 
ATOM   8672  O O   . SER D 1 143 ? -6.563  -44.053 20.536  1.00 65.79  ? 138 SER D O   1 
ATOM   8673  C CB  . SER D 1 143 ? -7.219  -41.800 22.702  1.00 65.19  ? 138 SER D CB  1 
ATOM   8674  O OG  . SER D 1 143 ? -5.996  -42.437 23.028  1.00 67.40  ? 138 SER D OG  1 
ATOM   8675  N N   . LYS D 1 144 ? -8.792  -44.009 20.904  1.00 68.14  ? 139 LYS D N   1 
ATOM   8676  C CA  . LYS D 1 144 ? -9.037  -45.405 20.591  1.00 70.48  ? 139 LYS D CA  1 
ATOM   8677  C C   . LYS D 1 144 ? -9.862  -45.458 19.307  1.00 73.55  ? 139 LYS D C   1 
ATOM   8678  O O   . LYS D 1 144 ? -11.087 -45.324 19.344  1.00 72.01  ? 139 LYS D O   1 
ATOM   8679  C CB  . LYS D 1 144 ? -9.816  -46.057 21.736  1.00 68.46  ? 139 LYS D CB  1 
ATOM   8680  C CG  . LYS D 1 144 ? -9.313  -45.675 23.120  1.00 66.37  ? 139 LYS D CG  1 
ATOM   8681  C CD  . LYS D 1 144 ? -7.854  -46.062 23.320  1.00 65.64  ? 139 LYS D CD  1 
ATOM   8682  C CE  . LYS D 1 144 ? -7.281  -45.413 24.578  1.00 65.33  ? 139 LYS D CE  1 
ATOM   8683  N NZ  . LYS D 1 144 ? -8.108  -45.694 25.788  1.00 64.89  ? 139 LYS D NZ  1 
ATOM   8684  N N   . ILE D 1 145 ? -9.183  -45.647 18.176  1.00 78.04  ? 140 ILE D N   1 
ATOM   8685  C CA  . ILE D 1 145 ? -9.842  -45.709 16.872  1.00 83.35  ? 140 ILE D CA  1 
ATOM   8686  C C   . ILE D 1 145 ? -11.094 -46.573 16.916  1.00 82.15  ? 140 ILE D C   1 
ATOM   8687  O O   . ILE D 1 145 ? -12.114 -46.237 16.312  1.00 82.14  ? 140 ILE D O   1 
ATOM   8688  C CB  . ILE D 1 145 ? -8.887  -46.267 15.775  1.00 88.18  ? 140 ILE D CB  1 
ATOM   8689  C CG1 . ILE D 1 145 ? -7.808  -45.232 15.432  1.00 92.81  ? 140 ILE D CG1 1 
ATOM   8690  C CG2 . ILE D 1 145 ? -9.677  -46.614 14.513  1.00 90.73  ? 140 ILE D CG2 1 
ATOM   8691  C CD1 . ILE D 1 145 ? -6.878  -44.873 16.584  1.00 97.41  ? 140 ILE D CD1 1 
ATOM   8692  N N   . LYS D 1 146 ? -11.013 -47.685 17.635  1.00 80.92  ? 141 LYS D N   1 
ATOM   8693  C CA  . LYS D 1 146 ? -12.148 -48.588 17.749  1.00 79.52  ? 141 LYS D CA  1 
ATOM   8694  C C   . LYS D 1 146 ? -13.383 -47.873 18.312  1.00 77.77  ? 141 LYS D C   1 
ATOM   8695  O O   . LYS D 1 146 ? -14.494 -48.075 17.820  1.00 77.48  ? 141 LYS D O   1 
ATOM   8696  C CB  . LYS D 1 146 ? -11.758 -49.805 18.605  1.00 80.77  ? 141 LYS D CB  1 
ATOM   8697  C CG  . LYS D 1 146 ? -10.945 -50.853 17.830  1.00 81.89  ? 141 LYS D CG  1 
ATOM   8698  C CD  . LYS D 1 146 ? -10.236 -51.864 18.738  1.00 82.68  ? 141 LYS D CD  1 
ATOM   8699  C CE  . LYS D 1 146 ? -8.971  -51.271 19.365  1.00 82.94  ? 141 LYS D CE  1 
ATOM   8700  N NZ  . LYS D 1 146 ? -8.214  -52.227 20.230  1.00 81.83  ? 141 LYS D NZ  1 
ATOM   8701  N N   . LEU D 1 147 ? -13.187 -47.025 19.320  1.00 75.02  ? 142 LEU D N   1 
ATOM   8702  C CA  . LEU D 1 147 ? -14.293 -46.275 19.929  1.00 71.71  ? 142 LEU D CA  1 
ATOM   8703  C C   . LEU D 1 147 ? -15.048 -45.398 18.928  1.00 71.23  ? 142 LEU D C   1 
ATOM   8704  O O   . LEU D 1 147 ? -16.269 -45.258 19.007  1.00 69.84  ? 142 LEU D O   1 
ATOM   8705  C CB  . LEU D 1 147 ? -13.771 -45.408 21.079  1.00 69.38  ? 142 LEU D CB  1 
ATOM   8706  C CG  . LEU D 1 147 ? -13.763 -46.085 22.452  1.00 67.72  ? 142 LEU D CG  1 
ATOM   8707  C CD1 . LEU D 1 147 ? -12.777 -45.398 23.385  1.00 65.14  ? 142 LEU D CD1 1 
ATOM   8708  C CD2 . LEU D 1 147 ? -15.178 -46.058 23.026  1.00 64.96  ? 142 LEU D CD2 1 
ATOM   8709  N N   . LEU D 1 148 ? -14.315 -44.806 17.990  1.00 71.01  ? 143 LEU D N   1 
ATOM   8710  C CA  . LEU D 1 148 ? -14.923 -43.959 16.972  1.00 70.72  ? 143 LEU D CA  1 
ATOM   8711  C C   . LEU D 1 148 ? -15.740 -44.834 16.020  1.00 73.21  ? 143 LEU D C   1 
ATOM   8712  O O   . LEU D 1 148 ? -16.843 -44.463 15.623  1.00 73.39  ? 143 LEU D O   1 
ATOM   8713  C CB  . LEU D 1 148 ? -13.840 -43.202 16.197  1.00 66.78  ? 143 LEU D CB  1 
ATOM   8714  C CG  . LEU D 1 148 ? -14.315 -42.190 15.152  1.00 63.12  ? 143 LEU D CG  1 
ATOM   8715  C CD1 . LEU D 1 148 ? -15.150 -41.118 15.825  1.00 60.71  ? 143 LEU D CD1 1 
ATOM   8716  C CD2 . LEU D 1 148 ? -13.116 -41.575 14.453  1.00 60.66  ? 143 LEU D CD2 1 
ATOM   8717  N N   . GLU D 1 149 ? -15.191 -45.994 15.657  1.00 76.59  ? 144 GLU D N   1 
ATOM   8718  C CA  . GLU D 1 149 ? -15.880 -46.936 14.770  1.00 78.78  ? 144 GLU D CA  1 
ATOM   8719  C C   . GLU D 1 149 ? -17.279 -47.176 15.308  1.00 76.47  ? 144 GLU D C   1 
ATOM   8720  O O   . GLU D 1 149 ? -18.258 -47.200 14.564  1.00 75.88  ? 144 GLU D O   1 
ATOM   8721  C CB  . GLU D 1 149 ? -15.152 -48.284 14.730  1.00 84.34  ? 144 GLU D CB  1 
ATOM   8722  C CG  . GLU D 1 149 ? -14.061 -48.411 13.688  1.00 92.90  ? 144 GLU D CG  1 
ATOM   8723  C CD  . GLU D 1 149 ? -14.245 -49.645 12.820  1.00 97.54  ? 144 GLU D CD  1 
ATOM   8724  O OE1 . GLU D 1 149 ? -15.264 -49.719 12.095  1.00 100.37 ? 144 GLU D OE1 1 
ATOM   8725  O OE2 . GLU D 1 149 ? -13.375 -50.542 12.867  1.00 100.17 ? 144 GLU D OE2 1 
ATOM   8726  N N   . ALA D 1 150 ? -17.344 -47.356 16.622  1.00 74.20  ? 145 ALA D N   1 
ATOM   8727  C CA  . ALA D 1 150 ? -18.585 -47.617 17.328  1.00 72.23  ? 145 ALA D CA  1 
ATOM   8728  C C   . ALA D 1 150 ? -19.576 -46.460 17.270  1.00 71.21  ? 145 ALA D C   1 
ATOM   8729  O O   . ALA D 1 150 ? -20.605 -46.556 16.601  1.00 71.28  ? 145 ALA D O   1 
ATOM   8730  C CB  . ALA D 1 150 ? -18.276 -47.972 18.781  1.00 71.36  ? 145 ALA D CB  1 
ATOM   8731  N N   . ALA D 1 151 ? -19.253 -45.372 17.970  1.00 70.42  ? 146 ALA D N   1 
ATOM   8732  C CA  . ALA D 1 151 ? -20.103 -44.180 18.047  1.00 69.14  ? 146 ALA D CA  1 
ATOM   8733  C C   . ALA D 1 151 ? -20.765 -43.711 16.748  1.00 68.99  ? 146 ALA D C   1 
ATOM   8734  O O   . ALA D 1 151 ? -21.801 -43.043 16.792  1.00 68.26  ? 146 ALA D O   1 
ATOM   8735  C CB  . ALA D 1 151 ? -19.311 -43.032 18.661  1.00 68.47  ? 146 ALA D CB  1 
ATOM   8736  N N   . ILE D 1 152 ? -20.176 -44.053 15.603  1.00 69.63  ? 147 ILE D N   1 
ATOM   8737  C CA  . ILE D 1 152 ? -20.724 -43.648 14.307  1.00 70.92  ? 147 ILE D CA  1 
ATOM   8738  C C   . ILE D 1 152 ? -22.187 -44.061 14.149  1.00 73.11  ? 147 ILE D C   1 
ATOM   8739  O O   . ILE D 1 152 ? -22.514 -45.245 14.061  1.00 73.40  ? 147 ILE D O   1 
ATOM   8740  C CB  . ILE D 1 152 ? -19.908 -44.239 13.128  1.00 69.75  ? 147 ILE D CB  1 
ATOM   8741  C CG1 . ILE D 1 152 ? -18.437 -43.831 13.246  1.00 69.67  ? 147 ILE D CG1 1 
ATOM   8742  C CG2 . ILE D 1 152 ? -20.465 -43.734 11.803  1.00 68.45  ? 147 ILE D CG2 1 
ATOM   8743  C CD1 . ILE D 1 152 ? -18.201 -42.342 13.174  1.00 69.93  ? 147 ILE D CD1 1 
ATOM   8744  N N   . THR D 1 153 ? -23.054 -43.057 14.111  1.00 75.33  ? 148 THR D N   1 
ATOM   8745  C CA  . THR D 1 153 ? -24.494 -43.232 13.976  1.00 78.88  ? 148 THR D CA  1 
ATOM   8746  C C   . THR D 1 153 ? -24.914 -42.844 12.560  1.00 83.24  ? 148 THR D C   1 
ATOM   8747  O O   . THR D 1 153 ? -24.246 -42.048 11.903  1.00 81.19  ? 148 THR D O   1 
ATOM   8748  C CB  . THR D 1 153 ? -25.220 -42.321 14.988  1.00 77.68  ? 148 THR D CB  1 
ATOM   8749  O OG1 . THR D 1 153 ? -24.832 -42.698 16.314  1.00 78.20  ? 148 THR D OG1 1 
ATOM   8750  C CG2 . THR D 1 153 ? -26.725 -42.420 14.851  1.00 77.22  ? 148 THR D CG2 1 
ATOM   8751  N N   . PRO D 1 154 ? -26.020 -43.414 12.063  1.00 83.79  ? 149 PRO D N   1 
ATOM   8752  C CA  . PRO D 1 154 ? -26.464 -43.066 10.709  1.00 89.02  ? 149 PRO D CA  1 
ATOM   8753  C C   . PRO D 1 154 ? -26.718 -41.561 10.546  1.00 93.18  ? 149 PRO D C   1 
ATOM   8754  O O   . PRO D 1 154 ? -26.904 -41.070 9.432   1.00 92.52  ? 149 PRO D O   1 
ATOM   8755  C CB  . PRO D 1 154 ? -27.735 -43.892 10.548  1.00 87.93  ? 149 PRO D CB  1 
ATOM   8756  C CG  . PRO D 1 154 ? -27.418 -45.122 11.338  1.00 87.48  ? 149 PRO D CG  1 
ATOM   8757  C CD  . PRO D 1 154 ? -26.794 -44.553 12.591  1.00 86.13  ? 149 PRO D CD  1 
ATOM   8758  N N   . GLU D 1 155 ? -26.725 -40.838 11.663  1.00 95.12  ? 150 GLU D N   1 
ATOM   8759  C CA  . GLU D 1 155 ? -26.954 -39.393 11.655  1.00 97.12  ? 150 GLU D CA  1 
ATOM   8760  C C   . GLU D 1 155 ? -25.632 -38.624 11.672  1.00 94.55  ? 150 GLU D C   1 
ATOM   8761  O O   . GLU D 1 155 ? -25.588 -37.426 11.375  1.00 95.19  ? 150 GLU D O   1 
ATOM   8762  C CB  . GLU D 1 155 ? -27.810 -38.982 12.860  1.00 103.70 ? 150 GLU D CB  1 
ATOM   8763  C CG  . GLU D 1 155 ? -29.288 -39.333 12.733  1.00 111.86 ? 150 GLU D CG  1 
ATOM   8764  C CD  . GLU D 1 155 ? -29.554 -40.829 12.714  1.00 116.75 ? 150 GLU D CD  1 
ATOM   8765  O OE1 . GLU D 1 155 ? -30.715 -41.223 12.470  1.00 119.28 ? 150 GLU D OE1 1 
ATOM   8766  O OE2 . GLU D 1 155 ? -28.613 -41.615 12.949  1.00 119.40 ? 150 GLU D OE2 1 
ATOM   8767  N N   . THR D 1 156 ? -24.559 -39.328 12.023  1.00 89.03  ? 151 THR D N   1 
ATOM   8768  C CA  . THR D 1 156 ? -23.227 -38.745 12.080  1.00 80.89  ? 151 THR D CA  1 
ATOM   8769  C C   . THR D 1 156 ? -22.808 -38.183 10.724  1.00 79.69  ? 151 THR D C   1 
ATOM   8770  O O   . THR D 1 156 ? -22.603 -38.930 9.763   1.00 79.25  ? 151 THR D O   1 
ATOM   8771  C CB  . THR D 1 156 ? -22.191 -39.798 12.529  1.00 78.73  ? 151 THR D CB  1 
ATOM   8772  O OG1 . THR D 1 156 ? -22.471 -40.193 13.875  1.00 74.86  ? 151 THR D OG1 1 
ATOM   8773  C CG2 . THR D 1 156 ? -20.785 -39.239 12.463  1.00 75.20  ? 151 THR D CG2 1 
ATOM   8774  N N   . LYS D 1 157 ? -22.687 -36.860 10.655  1.00 77.17  ? 152 LYS D N   1 
ATOM   8775  C CA  . LYS D 1 157 ? -22.279 -36.193 9.426   1.00 74.20  ? 152 LYS D CA  1 
ATOM   8776  C C   . LYS D 1 157 ? -20.987 -35.391 9.612   1.00 70.07  ? 152 LYS D C   1 
ATOM   8777  O O   . LYS D 1 157 ? -20.489 -34.774 8.669   1.00 71.03  ? 152 LYS D O   1 
ATOM   8778  C CB  . LYS D 1 157 ? -23.399 -35.278 8.917   1.00 75.82  ? 152 LYS D CB  1 
ATOM   8779  C CG  . LYS D 1 157 ? -24.061 -35.769 7.630   1.00 78.77  ? 152 LYS D CG  1 
ATOM   8780  C CD  . LYS D 1 157 ? -24.904 -37.022 7.856   1.00 79.93  ? 152 LYS D CD  1 
ATOM   8781  C CE  . LYS D 1 157 ? -25.280 -37.700 6.539   1.00 80.10  ? 152 LYS D CE  1 
ATOM   8782  N NZ  . LYS D 1 157 ? -25.920 -36.792 5.543   1.00 80.12  ? 152 LYS D NZ  1 
ATOM   8783  N N   . LEU D 1 158 ? -20.444 -35.406 10.826  1.00 64.65  ? 153 LEU D N   1 
ATOM   8784  C CA  . LEU D 1 158 ? -19.205 -34.687 11.117  1.00 59.08  ? 153 LEU D CA  1 
ATOM   8785  C C   . LEU D 1 158 ? -18.455 -35.275 12.313  1.00 56.16  ? 153 LEU D C   1 
ATOM   8786  O O   . LEU D 1 158 ? -19.059 -35.668 13.313  1.00 54.85  ? 153 LEU D O   1 
ATOM   8787  C CB  . LEU D 1 158 ? -19.490 -33.200 11.394  1.00 55.29  ? 153 LEU D CB  1 
ATOM   8788  C CG  . LEU D 1 158 ? -18.275 -32.326 11.761  1.00 51.82  ? 153 LEU D CG  1 
ATOM   8789  C CD1 . LEU D 1 158 ? -17.399 -32.092 10.537  1.00 49.33  ? 153 LEU D CD1 1 
ATOM   8790  C CD2 . LEU D 1 158 ? -18.746 -30.997 12.311  1.00 49.24  ? 153 LEU D CD2 1 
ATOM   8791  N N   . VAL D 1 159 ? -17.134 -35.338 12.194  1.00 54.07  ? 154 VAL D N   1 
ATOM   8792  C CA  . VAL D 1 159 ? -16.288 -35.831 13.272  1.00 53.96  ? 154 VAL D CA  1 
ATOM   8793  C C   . VAL D 1 159 ? -15.250 -34.747 13.512  1.00 51.78  ? 154 VAL D C   1 
ATOM   8794  O O   . VAL D 1 159 ? -14.447 -34.452 12.631  1.00 52.31  ? 154 VAL D O   1 
ATOM   8795  C CB  . VAL D 1 159 ? -15.551 -37.127 12.889  1.00 54.70  ? 154 VAL D CB  1 
ATOM   8796  C CG1 . VAL D 1 159 ? -14.672 -37.575 14.043  1.00 53.46  ? 154 VAL D CG1 1 
ATOM   8797  C CG2 . VAL D 1 159 ? -16.546 -38.211 12.530  1.00 55.04  ? 154 VAL D CG2 1 
ATOM   8798  N N   . TRP D 1 160 ? -15.276 -34.146 14.694  1.00 50.13  ? 155 TRP D N   1 
ATOM   8799  C CA  . TRP D 1 160 ? -14.331 -33.090 15.017  1.00 49.33  ? 155 TRP D CA  1 
ATOM   8800  C C   . TRP D 1 160 ? -13.249 -33.615 15.953  1.00 50.67  ? 155 TRP D C   1 
ATOM   8801  O O   . TRP D 1 160 ? -13.544 -34.129 17.039  1.00 48.58  ? 155 TRP D O   1 
ATOM   8802  C CB  . TRP D 1 160 ? -15.059 -31.907 15.661  1.00 47.47  ? 155 TRP D CB  1 
ATOM   8803  C CG  . TRP D 1 160 ? -14.203 -30.673 15.779  1.00 46.11  ? 155 TRP D CG  1 
ATOM   8804  C CD1 . TRP D 1 160 ? -13.150 -30.475 16.633  1.00 43.46  ? 155 TRP D CD1 1 
ATOM   8805  C CD2 . TRP D 1 160 ? -14.304 -29.486 14.988  1.00 44.63  ? 155 TRP D CD2 1 
ATOM   8806  N NE1 . TRP D 1 160 ? -12.596 -29.238 16.422  1.00 43.01  ? 155 TRP D NE1 1 
ATOM   8807  C CE2 . TRP D 1 160 ? -13.286 -28.606 15.423  1.00 43.56  ? 155 TRP D CE2 1 
ATOM   8808  C CE3 . TRP D 1 160 ? -15.164 -29.075 13.963  1.00 44.61  ? 155 TRP D CE3 1 
ATOM   8809  C CZ2 . TRP D 1 160 ? -13.094 -27.344 14.856  1.00 42.57  ? 155 TRP D CZ2 1 
ATOM   8810  C CZ3 . TRP D 1 160 ? -14.974 -27.818 13.399  1.00 45.39  ? 155 TRP D CZ3 1 
ATOM   8811  C CH2 . TRP D 1 160 ? -13.948 -26.965 13.854  1.00 44.15  ? 155 TRP D CH2 1 
ATOM   8812  N N   . ILE D 1 161 ? -11.996 -33.476 15.521  1.00 52.01  ? 156 ILE D N   1 
ATOM   8813  C CA  . ILE D 1 161 ? -10.848 -33.945 16.294  1.00 52.89  ? 156 ILE D CA  1 
ATOM   8814  C C   . ILE D 1 161 ? -9.778  -32.883 16.546  1.00 51.43  ? 156 ILE D C   1 
ATOM   8815  O O   . ILE D 1 161 ? -9.542  -32.014 15.707  1.00 50.95  ? 156 ILE D O   1 
ATOM   8816  C CB  . ILE D 1 161 ? -10.179 -35.152 15.587  1.00 55.30  ? 156 ILE D CB  1 
ATOM   8817  C CG1 . ILE D 1 161 ? -11.121 -36.352 15.652  1.00 56.43  ? 156 ILE D CG1 1 
ATOM   8818  C CG2 . ILE D 1 161 ? -8.806  -35.447 16.197  1.00 56.09  ? 156 ILE D CG2 1 
ATOM   8819  C CD1 . ILE D 1 161 ? -10.431 -37.677 15.882  1.00 60.53  ? 156 ILE D CD1 1 
ATOM   8820  N N   . GLU D 1 162 ? -9.143  -32.967 17.713  1.00 49.85  ? 157 GLU D N   1 
ATOM   8821  C CA  . GLU D 1 162 ? -8.058  -32.058 18.083  1.00 49.40  ? 157 GLU D CA  1 
ATOM   8822  C C   . GLU D 1 162 ? -6.872  -32.924 18.537  1.00 48.51  ? 157 GLU D C   1 
ATOM   8823  O O   . GLU D 1 162 ? -7.022  -33.785 19.405  1.00 49.56  ? 157 GLU D O   1 
ATOM   8824  C CB  . GLU D 1 162 ? -8.465  -31.126 19.239  1.00 49.39  ? 157 GLU D CB  1 
ATOM   8825  C CG  . GLU D 1 162 ? -9.764  -30.367 19.054  1.00 49.22  ? 157 GLU D CG  1 
ATOM   8826  C CD  . GLU D 1 162 ? -10.914 -31.015 19.801  1.00 49.93  ? 157 GLU D CD  1 
ATOM   8827  O OE1 . GLU D 1 162 ? -12.066 -30.538 19.676  1.00 49.08  ? 157 GLU D OE1 1 
ATOM   8828  O OE2 . GLU D 1 162 ? -10.657 -32.004 20.520  1.00 50.98  ? 157 GLU D OE2 1 
ATOM   8829  N N   . THR D 1 163 ? -5.697  -32.707 17.956  1.00 46.16  ? 158 THR D N   1 
ATOM   8830  C CA  . THR D 1 163 ? -4.525  -33.488 18.335  1.00 45.26  ? 158 THR D CA  1 
ATOM   8831  C C   . THR D 1 163 ? -3.206  -32.745 18.094  1.00 45.89  ? 158 THR D C   1 
ATOM   8832  O O   . THR D 1 163 ? -2.976  -32.188 17.020  1.00 47.58  ? 158 THR D O   1 
ATOM   8833  C CB  . THR D 1 163 ? -4.488  -34.816 17.571  1.00 44.46  ? 158 THR D CB  1 
ATOM   8834  O OG1 . THR D 1 163 ? -3.257  -35.498 17.846  1.00 42.22  ? 158 THR D OG1 1 
ATOM   8835  C CG2 . THR D 1 163 ? -4.601  -34.563 16.076  1.00 43.71  ? 158 THR D CG2 1 
ATOM   8836  N N   . PRO D 1 164 ? -2.303  -32.753 19.086  1.00 46.26  ? 159 PRO D N   1 
ATOM   8837  C CA  . PRO D 1 164 ? -2.456  -33.397 20.396  1.00 45.99  ? 159 PRO D CA  1 
ATOM   8838  C C   . PRO D 1 164 ? -3.608  -32.800 21.196  1.00 46.40  ? 159 PRO D C   1 
ATOM   8839  O O   . PRO D 1 164 ? -4.212  -31.819 20.780  1.00 47.18  ? 159 PRO D O   1 
ATOM   8840  C CB  . PRO D 1 164 ? -1.109  -33.130 21.071  1.00 44.30  ? 159 PRO D CB  1 
ATOM   8841  C CG  . PRO D 1 164 ? -0.167  -32.983 19.931  1.00 44.92  ? 159 PRO D CG  1 
ATOM   8842  C CD  . PRO D 1 164 ? -0.961  -32.171 18.942  1.00 45.27  ? 159 PRO D CD  1 
ATOM   8843  N N   . THR D 1 165 ? -3.921  -33.403 22.337  1.00 47.24  ? 160 THR D N   1 
ATOM   8844  C CA  . THR D 1 165 ? -4.974  -32.877 23.196  1.00 47.88  ? 160 THR D CA  1 
ATOM   8845  C C   . THR D 1 165 ? -4.314  -31.929 24.195  1.00 49.19  ? 160 THR D C   1 
ATOM   8846  O O   . THR D 1 165 ? -3.090  -31.914 24.345  1.00 47.46  ? 160 THR D O   1 
ATOM   8847  C CB  . THR D 1 165 ? -5.698  -33.978 24.003  1.00 48.61  ? 160 THR D CB  1 
ATOM   8848  O OG1 . THR D 1 165 ? -4.758  -34.644 24.864  1.00 48.17  ? 160 THR D OG1 1 
ATOM   8849  C CG2 . THR D 1 165 ? -6.373  -34.969 23.065  1.00 48.14  ? 160 THR D CG2 1 
ATOM   8850  N N   . ASN D 1 166 ? -5.139  -31.152 24.885  1.00 50.14  ? 161 ASN D N   1 
ATOM   8851  C CA  . ASN D 1 166 ? -4.656  -30.189 25.859  1.00 51.26  ? 161 ASN D CA  1 
ATOM   8852  C C   . ASN D 1 166 ? -5.255  -30.497 27.233  1.00 51.79  ? 161 ASN D C   1 
ATOM   8853  O O   . ASN D 1 166 ? -6.476  -30.579 27.379  1.00 52.52  ? 161 ASN D O   1 
ATOM   8854  C CB  . ASN D 1 166 ? -5.046  -28.784 25.386  1.00 53.05  ? 161 ASN D CB  1 
ATOM   8855  C CG  . ASN D 1 166 ? -4.524  -27.690 26.293  1.00 55.44  ? 161 ASN D CG  1 
ATOM   8856  O OD1 . ASN D 1 166 ? -3.428  -27.794 26.856  1.00 57.12  ? 161 ASN D OD1 1 
ATOM   8857  N ND2 . ASN D 1 166 ? -5.298  -26.618 26.425  1.00 55.78  ? 161 ASN D ND2 1 
ATOM   8858  N N   . PRO D 1 167 ? -4.406  -30.655 28.265  1.00 51.79  ? 162 PRO D N   1 
ATOM   8859  C CA  . PRO D 1 167 ? -2.941  -30.570 28.243  1.00 52.07  ? 162 PRO D CA  1 
ATOM   8860  C C   . PRO D 1 167 ? -2.215  -31.925 28.310  1.00 53.41  ? 162 PRO D C   1 
ATOM   8861  O O   . PRO D 1 167 ? -0.988  -31.965 28.440  1.00 51.39  ? 162 PRO D O   1 
ATOM   8862  C CB  . PRO D 1 167 ? -2.654  -29.729 29.476  1.00 50.96  ? 162 PRO D CB  1 
ATOM   8863  C CG  . PRO D 1 167 ? -3.605  -30.347 30.472  1.00 49.41  ? 162 PRO D CG  1 
ATOM   8864  C CD  . PRO D 1 167 ? -4.896  -30.571 29.655  1.00 50.34  ? 162 PRO D CD  1 
ATOM   8865  N N   . THR D 1 168 ? -2.971  -33.023 28.233  1.00 55.35  ? 163 THR D N   1 
ATOM   8866  C CA  . THR D 1 168 ? -2.388  -34.369 28.310  1.00 56.31  ? 163 THR D CA  1 
ATOM   8867  C C   . THR D 1 168 ? -1.608  -34.737 27.057  1.00 56.21  ? 163 THR D C   1 
ATOM   8868  O O   . THR D 1 168 ? -0.688  -35.556 27.103  1.00 56.31  ? 163 THR D O   1 
ATOM   8869  C CB  . THR D 1 168 ? -3.474  -35.438 28.555  1.00 56.18  ? 163 THR D CB  1 
ATOM   8870  O OG1 . THR D 1 168 ? -4.101  -35.185 29.815  1.00 56.35  ? 163 THR D OG1 1 
ATOM   8871  C CG2 . THR D 1 168 ? -2.860  -36.841 28.579  1.00 56.02  ? 163 THR D CG2 1 
ATOM   8872  N N   . GLN D 1 169 ? -1.990  -34.129 25.940  1.00 55.46  ? 164 GLN D N   1 
ATOM   8873  C CA  . GLN D 1 169 ? -1.324  -34.356 24.664  1.00 53.80  ? 164 GLN D CA  1 
ATOM   8874  C C   . GLN D 1 169 ? -1.422  -35.783 24.126  1.00 53.14  ? 164 GLN D C   1 
ATOM   8875  O O   . GLN D 1 169 ? -0.412  -36.383 23.755  1.00 51.86  ? 164 GLN D O   1 
ATOM   8876  C CB  . GLN D 1 169 ? 0.157   -33.945 24.753  1.00 52.38  ? 164 GLN D CB  1 
ATOM   8877  C CG  . GLN D 1 169 ? 0.391   -32.485 25.126  1.00 50.59  ? 164 GLN D CG  1 
ATOM   8878  C CD  . GLN D 1 169 ? 1.788   -31.989 24.762  1.00 50.46  ? 164 GLN D CD  1 
ATOM   8879  O OE1 . GLN D 1 169 ? 2.147   -31.880 23.581  1.00 48.88  ? 164 GLN D OE1 1 
ATOM   8880  N NE2 . GLN D 1 169 ? 2.582   -31.682 25.780  1.00 50.16  ? 164 GLN D NE2 1 
ATOM   8881  N N   . LYS D 1 170 ? -2.632  -36.332 24.094  1.00 52.17  ? 165 LYS D N   1 
ATOM   8882  C CA  . LYS D 1 170 ? -2.821  -37.669 23.545  1.00 52.62  ? 165 LYS D CA  1 
ATOM   8883  C C   . LYS D 1 170 ? -2.961  -37.478 22.035  1.00 49.68  ? 165 LYS D C   1 
ATOM   8884  O O   . LYS D 1 170 ? -3.850  -36.758 21.580  1.00 50.97  ? 165 LYS D O   1 
ATOM   8885  C CB  . LYS D 1 170 ? -4.084  -38.337 24.119  1.00 56.09  ? 165 LYS D CB  1 
ATOM   8886  C CG  . LYS D 1 170 ? -3.889  -38.965 25.507  1.00 60.44  ? 165 LYS D CG  1 
ATOM   8887  C CD  . LYS D 1 170 ? -5.101  -39.781 25.959  1.00 64.29  ? 165 LYS D CD  1 
ATOM   8888  C CE  . LYS D 1 170 ? -6.319  -38.897 26.223  1.00 68.26  ? 165 LYS D CE  1 
ATOM   8889  N NZ  . LYS D 1 170 ? -7.482  -39.635 26.811  1.00 69.51  ? 165 LYS D NZ  1 
ATOM   8890  N N   . VAL D 1 171 ? -2.075  -38.102 21.261  1.00 45.69  ? 166 VAL D N   1 
ATOM   8891  C CA  . VAL D 1 171 ? -2.111  -37.969 19.808  1.00 41.00  ? 166 VAL D CA  1 
ATOM   8892  C C   . VAL D 1 171 ? -3.171  -38.853 19.178  1.00 41.97  ? 166 VAL D C   1 
ATOM   8893  O O   . VAL D 1 171 ? -3.225  -40.046 19.452  1.00 42.65  ? 166 VAL D O   1 
ATOM   8894  C CB  . VAL D 1 171 ? -0.762  -38.335 19.168  1.00 37.96  ? 166 VAL D CB  1 
ATOM   8895  C CG1 . VAL D 1 171 ? -0.785  -37.966 17.699  1.00 35.11  ? 166 VAL D CG1 1 
ATOM   8896  C CG2 . VAL D 1 171 ? 0.369   -37.621 19.877  1.00 35.53  ? 166 VAL D CG2 1 
ATOM   8897  N N   . ILE D 1 172 ? -4.020  -38.267 18.341  1.00 42.83  ? 167 ILE D N   1 
ATOM   8898  C CA  . ILE D 1 172 ? -5.068  -39.022 17.657  1.00 43.11  ? 167 ILE D CA  1 
ATOM   8899  C C   . ILE D 1 172 ? -4.571  -39.404 16.259  1.00 47.37  ? 167 ILE D C   1 
ATOM   8900  O O   . ILE D 1 172 ? -3.986  -38.578 15.558  1.00 46.22  ? 167 ILE D O   1 
ATOM   8901  C CB  . ILE D 1 172 ? -6.369  -38.193 17.516  1.00 39.64  ? 167 ILE D CB  1 
ATOM   8902  C CG1 . ILE D 1 172 ? -7.122  -38.154 18.846  1.00 36.89  ? 167 ILE D CG1 1 
ATOM   8903  C CG2 . ILE D 1 172 ? -7.240  -38.770 16.419  1.00 39.67  ? 167 ILE D CG2 1 
ATOM   8904  C CD1 . ILE D 1 172 ? -6.479  -37.284 19.895  1.00 33.57  ? 167 ILE D CD1 1 
ATOM   8905  N N   . ASP D 1 173 ? -4.791  -40.654 15.861  1.00 52.26  ? 168 ASP D N   1 
ATOM   8906  C CA  . ASP D 1 173 ? -4.358  -41.097 14.541  1.00 56.49  ? 168 ASP D CA  1 
ATOM   8907  C C   . ASP D 1 173 ? -5.345  -40.565 13.505  1.00 58.06  ? 168 ASP D C   1 
ATOM   8908  O O   . ASP D 1 173 ? -6.380  -41.179 13.217  1.00 58.03  ? 168 ASP D O   1 
ATOM   8909  C CB  . ASP D 1 173 ? -4.288  -42.622 14.473  1.00 60.09  ? 168 ASP D CB  1 
ATOM   8910  C CG  . ASP D 1 173 ? -3.595  -43.116 13.216  1.00 63.53  ? 168 ASP D CG  1 
ATOM   8911  O OD1 . ASP D 1 173 ? -4.064  -42.785 12.108  1.00 66.04  ? 168 ASP D OD1 1 
ATOM   8912  O OD2 . ASP D 1 173 ? -2.579  -43.834 13.332  1.00 65.90  ? 168 ASP D OD2 1 
ATOM   8913  N N   . ILE D 1 174 ? -5.007  -39.401 12.962  1.00 59.35  ? 169 ILE D N   1 
ATOM   8914  C CA  . ILE D 1 174 ? -5.832  -38.728 11.969  1.00 59.76  ? 169 ILE D CA  1 
ATOM   8915  C C   . ILE D 1 174 ? -6.111  -39.640 10.775  1.00 61.46  ? 169 ILE D C   1 
ATOM   8916  O O   . ILE D 1 174 ? -7.248  -39.747 10.326  1.00 62.60  ? 169 ILE D O   1 
ATOM   8917  C CB  . ILE D 1 174 ? -5.144  -37.420 11.487  1.00 57.76  ? 169 ILE D CB  1 
ATOM   8918  C CG1 . ILE D 1 174 ? -4.716  -36.584 12.700  1.00 55.50  ? 169 ILE D CG1 1 
ATOM   8919  C CG2 . ILE D 1 174 ? -6.097  -36.613 10.614  1.00 55.30  ? 169 ILE D CG2 1 
ATOM   8920  C CD1 . ILE D 1 174 ? -3.902  -35.351 12.352  1.00 54.08  ? 169 ILE D CD1 1 
ATOM   8921  N N   . GLU D 1 175 ? -5.078  -40.302 10.268  1.00 64.65  ? 170 GLU D N   1 
ATOM   8922  C CA  . GLU D 1 175 ? -5.247  -41.194 9.130   1.00 68.04  ? 170 GLU D CA  1 
ATOM   8923  C C   . GLU D 1 175 ? -6.199  -42.332 9.496   1.00 68.79  ? 170 GLU D C   1 
ATOM   8924  O O   . GLU D 1 175 ? -7.058  -42.719 8.697   1.00 69.15  ? 170 GLU D O   1 
ATOM   8925  C CB  . GLU D 1 175 ? -3.896  -41.764 8.695   1.00 70.67  ? 170 GLU D CB  1 
ATOM   8926  C CG  . GLU D 1 175 ? -3.959  -42.552 7.399   1.00 75.36  ? 170 GLU D CG  1 
ATOM   8927  C CD  . GLU D 1 175 ? -4.326  -41.682 6.208   1.00 78.52  ? 170 GLU D CD  1 
ATOM   8928  O OE1 . GLU D 1 175 ? -3.467  -40.883 5.770   1.00 79.78  ? 170 GLU D OE1 1 
ATOM   8929  O OE2 . GLU D 1 175 ? -5.474  -41.793 5.716   1.00 79.38  ? 170 GLU D OE2 1 
ATOM   8930  N N   . GLY D 1 176 ? -6.045  -42.860 10.709  1.00 68.86  ? 171 GLY D N   1 
ATOM   8931  C CA  . GLY D 1 176 ? -6.902  -43.941 11.163  1.00 68.48  ? 171 GLY D CA  1 
ATOM   8932  C C   . GLY D 1 176 ? -8.360  -43.518 11.165  1.00 68.35  ? 171 GLY D C   1 
ATOM   8933  O O   . GLY D 1 176 ? -9.231  -44.230 10.654  1.00 68.40  ? 171 GLY D O   1 
ATOM   8934  N N   . CYS D 1 177 ? -8.621  -42.345 11.734  1.00 67.00  ? 172 CYS D N   1 
ATOM   8935  C CA  . CYS D 1 177 ? -9.974  -41.810 11.811  1.00 66.24  ? 172 CYS D CA  1 
ATOM   8936  C C   . CYS D 1 177 ? -10.536 -41.466 10.431  1.00 67.20  ? 172 CYS D C   1 
ATOM   8937  O O   . CYS D 1 177 ? -11.742 -41.547 10.204  1.00 65.63  ? 172 CYS D O   1 
ATOM   8938  C CB  . CYS D 1 177 ? -9.987  -40.568 12.705  1.00 65.47  ? 172 CYS D CB  1 
ATOM   8939  S SG  . CYS D 1 177 ? -9.372  -40.841 14.395  1.00 64.98  ? 172 CYS D SG  1 
ATOM   8940  N N   . ALA D 1 178 ? -9.660  -41.081 9.511   1.00 69.12  ? 173 ALA D N   1 
ATOM   8941  C CA  . ALA D 1 178 ? -10.085 -40.729 8.161   1.00 72.48  ? 173 ALA D CA  1 
ATOM   8942  C C   . ALA D 1 178 ? -10.688 -41.935 7.450   1.00 76.68  ? 173 ALA D C   1 
ATOM   8943  O O   . ALA D 1 178 ? -11.775 -41.846 6.878   1.00 75.20  ? 173 ALA D O   1 
ATOM   8944  C CB  . ALA D 1 178 ? -8.904  -40.191 7.367   1.00 70.27  ? 173 ALA D CB  1 
ATOM   8945  N N   . HIS D 1 179 ? -9.975  -43.060 7.491   1.00 81.56  ? 174 HIS D N   1 
ATOM   8946  C CA  . HIS D 1 179 ? -10.433 -44.287 6.850   1.00 86.11  ? 174 HIS D CA  1 
ATOM   8947  C C   . HIS D 1 179 ? -11.695 -44.820 7.505   1.00 84.91  ? 174 HIS D C   1 
ATOM   8948  O O   . HIS D 1 179 ? -12.602 -45.298 6.821   1.00 85.86  ? 174 HIS D O   1 
ATOM   8949  C CB  . HIS D 1 179 ? -9.334  -45.348 6.887   1.00 95.16  ? 174 HIS D CB  1 
ATOM   8950  C CG  . HIS D 1 179 ? -8.315  -45.190 5.803   1.00 104.77 ? 174 HIS D CG  1 
ATOM   8951  N ND1 . HIS D 1 179 ? -7.087  -45.814 5.836   1.00 109.34 ? 174 HIS D ND1 1 
ATOM   8952  C CD2 . HIS D 1 179 ? -8.349  -44.489 4.644   1.00 108.52 ? 174 HIS D CD2 1 
ATOM   8953  C CE1 . HIS D 1 179 ? -6.407  -45.504 4.746   1.00 111.60 ? 174 HIS D CE1 1 
ATOM   8954  N NE2 . HIS D 1 179 ? -7.150  -44.702 4.006   1.00 111.31 ? 174 HIS D NE2 1 
ATOM   8955  N N   . ILE D 1 180 ? -11.752 -44.735 8.829   1.00 81.53  ? 175 ILE D N   1 
ATOM   8956  C CA  . ILE D 1 180 ? -12.923 -45.197 9.565   1.00 76.47  ? 175 ILE D CA  1 
ATOM   8957  C C   . ILE D 1 180 ? -14.139 -44.335 9.200   1.00 77.81  ? 175 ILE D C   1 
ATOM   8958  O O   . ILE D 1 180 ? -15.219 -44.859 8.919   1.00 78.61  ? 175 ILE D O   1 
ATOM   8959  C CB  . ILE D 1 180 ? -12.693 -45.111 11.096  1.00 73.34  ? 175 ILE D CB  1 
ATOM   8960  C CG1 . ILE D 1 180 ? -11.513 -46.001 11.508  1.00 69.86  ? 175 ILE D CG1 1 
ATOM   8961  C CG2 . ILE D 1 180 ? -13.964 -45.487 11.834  1.00 69.92  ? 175 ILE D CG2 1 
ATOM   8962  C CD1 . ILE D 1 180 ? -11.708 -47.473 11.220  1.00 67.13  ? 175 ILE D CD1 1 
ATOM   8963  N N   . VAL D 1 181 ? -13.944 -43.015 9.194   1.00 78.01  ? 176 VAL D N   1 
ATOM   8964  C CA  . VAL D 1 181 ? -15.001 -42.046 8.881   1.00 76.45  ? 176 VAL D CA  1 
ATOM   8965  C C   . VAL D 1 181 ? -15.453 -42.061 7.418   1.00 78.48  ? 176 VAL D C   1 
ATOM   8966  O O   . VAL D 1 181 ? -16.645 -41.976 7.126   1.00 77.74  ? 176 VAL D O   1 
ATOM   8967  C CB  . VAL D 1 181 ? -14.552 -40.599 9.236   1.00 74.58  ? 176 VAL D CB  1 
ATOM   8968  C CG1 . VAL D 1 181 ? -15.565 -39.593 8.722   1.00 72.07  ? 176 VAL D CG1 1 
ATOM   8969  C CG2 . VAL D 1 181 ? -14.399 -40.452 10.739  1.00 72.52  ? 176 VAL D CG2 1 
ATOM   8970  N N   . HIS D 1 182 ? -14.503 -42.165 6.498   1.00 80.54  ? 177 HIS D N   1 
ATOM   8971  C CA  . HIS D 1 182 ? -14.838 -42.171 5.082   1.00 83.06  ? 177 HIS D CA  1 
ATOM   8972  C C   . HIS D 1 182 ? -15.376 -43.504 4.584   1.00 84.80  ? 177 HIS D C   1 
ATOM   8973  O O   . HIS D 1 182 ? -16.049 -43.556 3.555   1.00 84.00  ? 177 HIS D O   1 
ATOM   8974  C CB  . HIS D 1 182 ? -13.616 -41.752 4.263   1.00 83.79  ? 177 HIS D CB  1 
ATOM   8975  C CG  . HIS D 1 182 ? -13.277 -40.300 4.399   1.00 84.49  ? 177 HIS D CG  1 
ATOM   8976  N ND1 . HIS D 1 182 ? -13.062 -39.699 5.621   1.00 84.58  ? 177 HIS D ND1 1 
ATOM   8977  C CD2 . HIS D 1 182 ? -13.156 -39.321 3.472   1.00 84.74  ? 177 HIS D CD2 1 
ATOM   8978  C CE1 . HIS D 1 182 ? -12.826 -38.413 5.440   1.00 84.75  ? 177 HIS D CE1 1 
ATOM   8979  N NE2 . HIS D 1 182 ? -12.877 -38.157 4.145   1.00 84.69  ? 177 HIS D NE2 1 
ATOM   8980  N N   . LYS D 1 183 ? -15.089 -44.573 5.323   1.00 88.02  ? 178 LYS D N   1 
ATOM   8981  C CA  . LYS D 1 183 ? -15.537 -45.917 4.960   1.00 91.62  ? 178 LYS D CA  1 
ATOM   8982  C C   . LYS D 1 183 ? -17.015 -45.993 4.587   1.00 91.74  ? 178 LYS D C   1 
ATOM   8983  O O   . LYS D 1 183 ? -17.373 -46.604 3.578   1.00 90.54  ? 178 LYS D O   1 
ATOM   8984  C CB  . LYS D 1 183 ? -15.267 -46.897 6.105   1.00 95.61  ? 178 LYS D CB  1 
ATOM   8985  C CG  . LYS D 1 183 ? -15.820 -48.297 5.854   1.00 102.14 ? 178 LYS D CG  1 
ATOM   8986  C CD  . LYS D 1 183 ? -15.654 -49.207 7.062   1.00 107.69 ? 178 LYS D CD  1 
ATOM   8987  C CE  . LYS D 1 183 ? -14.191 -49.501 7.349   1.00 111.37 ? 178 LYS D CE  1 
ATOM   8988  N NZ  . LYS D 1 183 ? -14.029 -50.393 8.532   1.00 114.74 ? 178 LYS D NZ  1 
ATOM   8989  N N   . HIS D 1 184 ? -17.870 -45.383 5.407   1.00 93.60  ? 179 HIS D N   1 
ATOM   8990  C CA  . HIS D 1 184 ? -19.307 -45.403 5.151   1.00 95.48  ? 179 HIS D CA  1 
ATOM   8991  C C   . HIS D 1 184 ? -19.990 -44.044 5.092   1.00 94.17  ? 179 HIS D C   1 
ATOM   8992  O O   . HIS D 1 184 ? -19.654 -43.131 5.839   1.00 92.72  ? 179 HIS D O   1 
ATOM   8993  C CB  . HIS D 1 184 ? -20.022 -46.262 6.196   1.00 99.33  ? 179 HIS D CB  1 
ATOM   8994  C CG  . HIS D 1 184 ? -20.240 -47.680 5.768   1.00 104.35 ? 179 HIS D CG  1 
ATOM   8995  N ND1 . HIS D 1 184 ? -19.220 -48.606 5.707   1.00 106.93 ? 179 HIS D ND1 1 
ATOM   8996  C CD2 . HIS D 1 184 ? -21.360 -48.327 5.370   1.00 106.39 ? 179 HIS D CD2 1 
ATOM   8997  C CE1 . HIS D 1 184 ? -19.704 -49.763 5.291   1.00 108.26 ? 179 HIS D CE1 1 
ATOM   8998  N NE2 . HIS D 1 184 ? -21.000 -49.621 5.079   1.00 108.24 ? 179 HIS D NE2 1 
ATOM   8999  N N   . GLY D 1 185 ? -20.962 -43.939 4.190   1.00 94.53  ? 180 GLY D N   1 
ATOM   9000  C CA  . GLY D 1 185 ? -21.737 -42.723 4.025   1.00 95.61  ? 180 GLY D CA  1 
ATOM   9001  C C   . GLY D 1 185 ? -20.978 -41.439 3.766   1.00 96.52  ? 180 GLY D C   1 
ATOM   9002  O O   . GLY D 1 185 ? -19.752 -41.426 3.656   1.00 97.53  ? 180 GLY D O   1 
ATOM   9003  N N   . ASP D 1 186 ? -21.734 -40.351 3.659   1.00 96.60  ? 181 ASP D N   1 
ATOM   9004  C CA  . ASP D 1 186 ? -21.182 -39.024 3.424   1.00 95.30  ? 181 ASP D CA  1 
ATOM   9005  C C   . ASP D 1 186 ? -21.009 -38.318 4.766   1.00 91.17  ? 181 ASP D C   1 
ATOM   9006  O O   . ASP D 1 186 ? -21.973 -37.833 5.357   1.00 92.21  ? 181 ASP D O   1 
ATOM   9007  C CB  . ASP D 1 186 ? -22.121 -38.222 2.516   1.00 100.70 ? 181 ASP D CB  1 
ATOM   9008  C CG  . ASP D 1 186 ? -21.923 -36.722 2.643   1.00 104.40 ? 181 ASP D CG  1 
ATOM   9009  O OD1 . ASP D 1 186 ? -20.789 -36.246 2.420   1.00 105.67 ? 181 ASP D OD1 1 
ATOM   9010  O OD2 . ASP D 1 186 ? -22.911 -36.023 2.966   1.00 107.13 ? 181 ASP D OD2 1 
ATOM   9011  N N   . ILE D 1 187 ? -19.771 -38.274 5.242   1.00 86.04  ? 182 ILE D N   1 
ATOM   9012  C CA  . ILE D 1 187 ? -19.460 -37.641 6.519   1.00 79.28  ? 182 ILE D CA  1 
ATOM   9013  C C   . ILE D 1 187 ? -18.159 -36.826 6.441   1.00 72.85  ? 182 ILE D C   1 
ATOM   9014  O O   . ILE D 1 187 ? -17.238 -37.153 5.682   1.00 71.56  ? 182 ILE D O   1 
ATOM   9015  C CB  . ILE D 1 187 ? -19.359 -38.710 7.636   1.00 79.89  ? 182 ILE D CB  1 
ATOM   9016  C CG1 . ILE D 1 187 ? -18.949 -38.061 8.957   1.00 80.40  ? 182 ILE D CG1 1 
ATOM   9017  C CG2 . ILE D 1 187 ? -18.382 -39.795 7.225   1.00 79.65  ? 182 ILE D CG2 1 
ATOM   9018  C CD1 . ILE D 1 187 ? -18.721 -39.055 10.069  1.00 81.05  ? 182 ILE D CD1 1 
ATOM   9019  N N   . ILE D 1 188 ? -18.094 -35.765 7.237   1.00 65.87  ? 183 ILE D N   1 
ATOM   9020  C CA  . ILE D 1 188 ? -16.936 -34.887 7.236   1.00 59.69  ? 183 ILE D CA  1 
ATOM   9021  C C   . ILE D 1 188 ? -15.986 -35.047 8.414   1.00 57.25  ? 183 ILE D C   1 
ATOM   9022  O O   . ILE D 1 188 ? -16.407 -35.120 9.570   1.00 56.21  ? 183 ILE D O   1 
ATOM   9023  C CB  . ILE D 1 188 ? -17.382 -33.416 7.176   1.00 57.29  ? 183 ILE D CB  1 
ATOM   9024  C CG1 . ILE D 1 188 ? -18.240 -33.198 5.934   1.00 54.97  ? 183 ILE D CG1 1 
ATOM   9025  C CG2 . ILE D 1 188 ? -16.173 -32.503 7.140   1.00 55.43  ? 183 ILE D CG2 1 
ATOM   9026  C CD1 . ILE D 1 188 ? -18.867 -31.835 5.857   1.00 55.15  ? 183 ILE D CD1 1 
ATOM   9027  N N   . LEU D 1 189 ? -14.693 -35.105 8.106   1.00 54.19  ? 184 LEU D N   1 
ATOM   9028  C CA  . LEU D 1 189 ? -13.676 -35.216 9.139   1.00 51.49  ? 184 LEU D CA  1 
ATOM   9029  C C   . LEU D 1 189 ? -12.988 -33.861 9.236   1.00 49.99  ? 184 LEU D C   1 
ATOM   9030  O O   . LEU D 1 189 ? -12.491 -33.328 8.238   1.00 48.92  ? 184 LEU D O   1 
ATOM   9031  C CB  . LEU D 1 189 ? -12.635 -36.288 8.800   1.00 50.59  ? 184 LEU D CB  1 
ATOM   9032  C CG  . LEU D 1 189 ? -11.547 -36.372 9.881   1.00 49.45  ? 184 LEU D CG  1 
ATOM   9033  C CD1 . LEU D 1 189 ? -12.138 -36.956 11.149  1.00 48.82  ? 184 LEU D CD1 1 
ATOM   9034  C CD2 . LEU D 1 189 ? -10.390 -37.214 9.407   1.00 49.58  ? 184 LEU D CD2 1 
ATOM   9035  N N   . VAL D 1 190 ? -12.978 -33.304 10.442  1.00 48.09  ? 185 VAL D N   1 
ATOM   9036  C CA  . VAL D 1 190 ? -12.361 -32.009 10.685  1.00 44.36  ? 185 VAL D CA  1 
ATOM   9037  C C   . VAL D 1 190 ? -11.293 -32.133 11.763  1.00 44.10  ? 185 VAL D C   1 
ATOM   9038  O O   . VAL D 1 190 ? -11.533 -32.670 12.854  1.00 42.71  ? 185 VAL D O   1 
ATOM   9039  C CB  . VAL D 1 190 ? -13.411 -30.950 11.138  1.00 44.56  ? 185 VAL D CB  1 
ATOM   9040  C CG1 . VAL D 1 190 ? -12.728 -29.617 11.431  1.00 45.03  ? 185 VAL D CG1 1 
ATOM   9041  C CG2 . VAL D 1 190 ? -14.453 -30.756 10.058  1.00 44.30  ? 185 VAL D CG2 1 
ATOM   9042  N N   . VAL D 1 191 ? -10.102 -31.645 11.444  1.00 42.75  ? 186 VAL D N   1 
ATOM   9043  C CA  . VAL D 1 191 ? -9.014  -31.676 12.396  1.00 41.84  ? 186 VAL D CA  1 
ATOM   9044  C C   . VAL D 1 191 ? -8.692  -30.237 12.747  1.00 41.57  ? 186 VAL D C   1 
ATOM   9045  O O   . VAL D 1 191 ? -8.614  -29.381 11.859  1.00 41.49  ? 186 VAL D O   1 
ATOM   9046  C CB  . VAL D 1 191 ? -7.752  -32.342 11.810  1.00 41.91  ? 186 VAL D CB  1 
ATOM   9047  C CG1 . VAL D 1 191 ? -6.622  -32.296 12.826  1.00 41.30  ? 186 VAL D CG1 1 
ATOM   9048  C CG2 . VAL D 1 191 ? -8.052  -33.777 11.423  1.00 41.95  ? 186 VAL D CG2 1 
ATOM   9049  N N   . ASP D 1 192 ? -8.538  -29.977 14.045  1.00 41.24  ? 187 ASP D N   1 
ATOM   9050  C CA  . ASP D 1 192 ? -8.205  -28.651 14.553  1.00 39.94  ? 187 ASP D CA  1 
ATOM   9051  C C   . ASP D 1 192 ? -6.694  -28.614 14.721  1.00 39.36  ? 187 ASP D C   1 
ATOM   9052  O O   . ASP D 1 192 ? -6.162  -28.924 15.789  1.00 39.90  ? 187 ASP D O   1 
ATOM   9053  C CB  . ASP D 1 192 ? -8.878  -28.410 15.897  1.00 40.28  ? 187 ASP D CB  1 
ATOM   9054  C CG  . ASP D 1 192 ? -8.518  -27.072 16.486  1.00 41.49  ? 187 ASP D CG  1 
ATOM   9055  O OD1 . ASP D 1 192 ? -7.621  -26.403 15.933  1.00 42.70  ? 187 ASP D OD1 1 
ATOM   9056  O OD2 . ASP D 1 192 ? -9.125  -26.688 17.501  1.00 42.79  ? 187 ASP D OD2 1 
ATOM   9057  N N   . ASN D 1 193 ? -6.014  -28.218 13.653  1.00 38.77  ? 188 ASN D N   1 
ATOM   9058  C CA  . ASN D 1 193 ? -4.560  -28.173 13.612  1.00 38.72  ? 188 ASN D CA  1 
ATOM   9059  C C   . ASN D 1 193 ? -3.940  -27.118 14.508  1.00 38.27  ? 188 ASN D C   1 
ATOM   9060  O O   . ASN D 1 193 ? -2.722  -27.037 14.627  1.00 39.14  ? 188 ASN D O   1 
ATOM   9061  C CB  . ASN D 1 193 ? -4.114  -27.958 12.164  1.00 38.20  ? 188 ASN D CB  1 
ATOM   9062  C CG  . ASN D 1 193 ? -2.871  -28.743 11.812  1.00 37.33  ? 188 ASN D CG  1 
ATOM   9063  O OD1 . ASN D 1 193 ? -2.661  -29.850 12.303  1.00 38.84  ? 188 ASN D OD1 1 
ATOM   9064  N ND2 . ASN D 1 193 ? -2.049  -28.185 10.939  1.00 38.24  ? 188 ASN D ND2 1 
ATOM   9065  N N   . THR D 1 194 ? -4.775  -26.321 15.157  1.00 38.63  ? 189 THR D N   1 
ATOM   9066  C CA  . THR D 1 194 ? -4.277  -25.259 16.017  1.00 40.08  ? 189 THR D CA  1 
ATOM   9067  C C   . THR D 1 194 ? -3.079  -25.612 16.908  1.00 42.05  ? 189 THR D C   1 
ATOM   9068  O O   . THR D 1 194 ? -2.081  -24.881 16.923  1.00 43.74  ? 189 THR D O   1 
ATOM   9069  C CB  . THR D 1 194 ? -5.404  -24.702 16.896  1.00 38.20  ? 189 THR D CB  1 
ATOM   9070  O OG1 . THR D 1 194 ? -6.450  -24.205 16.057  1.00 39.63  ? 189 THR D OG1 1 
ATOM   9071  C CG2 . THR D 1 194 ? -4.898  -23.568 17.753  1.00 36.90  ? 189 THR D CG2 1 
ATOM   9072  N N   . PHE D 1 195 ? -3.158  -26.726 17.629  1.00 43.48  ? 190 PHE D N   1 
ATOM   9073  C CA  . PHE D 1 195 ? -2.079  -27.120 18.540  1.00 45.49  ? 190 PHE D CA  1 
ATOM   9074  C C   . PHE D 1 195 ? -0.769  -27.543 17.892  1.00 42.30  ? 190 PHE D C   1 
ATOM   9075  O O   . PHE D 1 195 ? 0.223   -27.756 18.588  1.00 40.65  ? 190 PHE D O   1 
ATOM   9076  C CB  . PHE D 1 195 ? -2.561  -28.240 19.465  1.00 52.59  ? 190 PHE D CB  1 
ATOM   9077  C CG  . PHE D 1 195 ? -3.732  -27.851 20.322  1.00 60.84  ? 190 PHE D CG  1 
ATOM   9078  C CD1 . PHE D 1 195 ? -4.871  -28.652 20.374  1.00 64.40  ? 190 PHE D CD1 1 
ATOM   9079  C CD2 . PHE D 1 195 ? -3.705  -26.673 21.063  1.00 63.35  ? 190 PHE D CD2 1 
ATOM   9080  C CE1 . PHE D 1 195 ? -5.965  -28.283 21.147  1.00 67.97  ? 190 PHE D CE1 1 
ATOM   9081  C CE2 . PHE D 1 195 ? -4.792  -26.294 21.839  1.00 66.41  ? 190 PHE D CE2 1 
ATOM   9082  C CZ  . PHE D 1 195 ? -5.924  -27.099 21.882  1.00 68.87  ? 190 PHE D CZ  1 
ATOM   9083  N N   . MET D 1 196 ? -0.764  -27.655 16.567  1.00 39.51  ? 191 MET D N   1 
ATOM   9084  C CA  . MET D 1 196 ? 0.430   -28.069 15.834  1.00 36.77  ? 191 MET D CA  1 
ATOM   9085  C C   . MET D 1 196 ? 0.892   -27.037 14.808  1.00 35.18  ? 191 MET D C   1 
ATOM   9086  O O   . MET D 1 196 ? 2.098   -26.855 14.602  1.00 32.60  ? 191 MET D O   1 
ATOM   9087  C CB  . MET D 1 196 ? 0.162   -29.393 15.106  1.00 36.38  ? 191 MET D CB  1 
ATOM   9088  C CG  . MET D 1 196 ? 0.065   -30.629 15.996  1.00 36.10  ? 191 MET D CG  1 
ATOM   9089  S SD  . MET D 1 196 ? 1.652   -31.111 16.730  1.00 34.56  ? 191 MET D SD  1 
ATOM   9090  C CE  . MET D 1 196 ? 2.672   -31.169 15.286  1.00 32.34  ? 191 MET D CE  1 
ATOM   9091  N N   . SER D 1 197 ? -0.088  -26.389 14.168  1.00 33.16  ? 192 SER D N   1 
ATOM   9092  C CA  . SER D 1 197 ? 0.115   -25.384 13.121  1.00 32.89  ? 192 SER D CA  1 
ATOM   9093  C C   . SER D 1 197 ? 0.460   -26.087 11.809  1.00 32.43  ? 192 SER D C   1 
ATOM   9094  O O   . SER D 1 197 ? 1.093   -27.135 11.807  1.00 33.13  ? 192 SER D O   1 
ATOM   9095  C CB  . SER D 1 197 ? 1.230   -24.400 13.489  1.00 30.49  ? 192 SER D CB  1 
ATOM   9096  O OG  . SER D 1 197 ? 2.489   -24.897 13.101  1.00 30.90  ? 192 SER D OG  1 
ATOM   9097  N N   . PRO D 1 198 ? 0.045   -25.516 10.671  1.00 32.80  ? 193 PRO D N   1 
ATOM   9098  C CA  . PRO D 1 198 ? 0.333   -26.132 9.370   1.00 34.27  ? 193 PRO D CA  1 
ATOM   9099  C C   . PRO D 1 198 ? 1.797   -26.469 9.076   1.00 33.61  ? 193 PRO D C   1 
ATOM   9100  O O   . PRO D 1 198 ? 2.092   -27.169 8.111   1.00 33.85  ? 193 PRO D O   1 
ATOM   9101  C CB  . PRO D 1 198 ? -0.249  -25.123 8.368   1.00 32.68  ? 193 PRO D CB  1 
ATOM   9102  C CG  . PRO D 1 198 ? -0.243  -23.828 9.125   1.00 34.16  ? 193 PRO D CG  1 
ATOM   9103  C CD  . PRO D 1 198 ? -0.680  -24.245 10.499  1.00 33.97  ? 193 PRO D CD  1 
ATOM   9104  N N   . TYR D 1 199 ? 2.713   -25.983 9.900   1.00 33.74  ? 194 TYR D N   1 
ATOM   9105  C CA  . TYR D 1 199 ? 4.124   -26.249 9.668   1.00 35.34  ? 194 TYR D CA  1 
ATOM   9106  C C   . TYR D 1 199 ? 4.547   -27.641 10.134  1.00 35.78  ? 194 TYR D C   1 
ATOM   9107  O O   . TYR D 1 199 ? 5.411   -28.275 9.526   1.00 36.15  ? 194 TYR D O   1 
ATOM   9108  C CB  . TYR D 1 199 ? 4.989   -25.186 10.364  1.00 35.47  ? 194 TYR D CB  1 
ATOM   9109  C CG  . TYR D 1 199 ? 6.486   -25.370 10.150  1.00 34.82  ? 194 TYR D CG  1 
ATOM   9110  C CD1 . TYR D 1 199 ? 7.080   -25.076 8.921   1.00 33.46  ? 194 TYR D CD1 1 
ATOM   9111  C CD2 . TYR D 1 199 ? 7.300   -25.869 11.171  1.00 33.63  ? 194 TYR D CD2 1 
ATOM   9112  C CE1 . TYR D 1 199 ? 8.443   -25.275 8.715   1.00 33.11  ? 194 TYR D CE1 1 
ATOM   9113  C CE2 . TYR D 1 199 ? 8.664   -26.073 10.973  1.00 32.35  ? 194 TYR D CE2 1 
ATOM   9114  C CZ  . TYR D 1 199 ? 9.229   -25.775 9.746   1.00 33.22  ? 194 TYR D CZ  1 
ATOM   9115  O OH  . TYR D 1 199 ? 10.579  -25.973 9.548   1.00 34.12  ? 194 TYR D OH  1 
ATOM   9116  N N   . PHE D 1 200 ? 3.939   -28.113 11.215  1.00 35.72  ? 195 PHE D N   1 
ATOM   9117  C CA  . PHE D 1 200 ? 4.272   -29.423 11.753  1.00 36.13  ? 195 PHE D CA  1 
ATOM   9118  C C   . PHE D 1 200 ? 3.235   -30.491 11.424  1.00 36.21  ? 195 PHE D C   1 
ATOM   9119  O O   . PHE D 1 200 ? 3.525   -31.675 11.511  1.00 38.51  ? 195 PHE D O   1 
ATOM   9120  C CB  . PHE D 1 200 ? 4.432   -29.340 13.271  1.00 35.33  ? 195 PHE D CB  1 
ATOM   9121  C CG  . PHE D 1 200 ? 5.680   -28.653 13.715  1.00 33.28  ? 195 PHE D CG  1 
ATOM   9122  C CD1 . PHE D 1 200 ? 5.664   -27.804 14.815  1.00 32.52  ? 195 PHE D CD1 1 
ATOM   9123  C CD2 . PHE D 1 200 ? 6.880   -28.869 13.055  1.00 32.99  ? 195 PHE D CD2 1 
ATOM   9124  C CE1 . PHE D 1 200 ? 6.827   -27.177 15.254  1.00 32.28  ? 195 PHE D CE1 1 
ATOM   9125  C CE2 . PHE D 1 200 ? 8.056   -28.243 13.491  1.00 32.32  ? 195 PHE D CE2 1 
ATOM   9126  C CZ  . PHE D 1 200 ? 8.026   -27.396 14.593  1.00 31.05  ? 195 PHE D CZ  1 
ATOM   9127  N N   . GLN D 1 201 ? 2.032   -30.087 11.045  1.00 35.07  ? 196 GLN D N   1 
ATOM   9128  C CA  . GLN D 1 201 ? 0.997   -31.063 10.753  1.00 36.37  ? 196 GLN D CA  1 
ATOM   9129  C C   . GLN D 1 201 ? 0.077   -30.597 9.623   1.00 36.21  ? 196 GLN D C   1 
ATOM   9130  O O   . GLN D 1 201 ? -0.371  -29.450 9.606   1.00 34.69  ? 196 GLN D O   1 
ATOM   9131  C CB  . GLN D 1 201 ? 0.212   -31.340 12.036  1.00 35.66  ? 196 GLN D CB  1 
ATOM   9132  C CG  . GLN D 1 201 ? -0.799  -32.448 11.957  1.00 36.61  ? 196 GLN D CG  1 
ATOM   9133  C CD  . GLN D 1 201 ? -1.392  -32.753 13.317  1.00 39.85  ? 196 GLN D CD  1 
ATOM   9134  O OE1 . GLN D 1 201 ? -0.692  -33.197 14.226  1.00 40.74  ? 196 GLN D OE1 1 
ATOM   9135  N NE2 . GLN D 1 201 ? -2.686  -32.508 13.467  1.00 41.17  ? 196 GLN D NE2 1 
ATOM   9136  N N   . ARG D 1 202 ? -0.200  -31.502 8.686   1.00 37.01  ? 197 ARG D N   1 
ATOM   9137  C CA  . ARG D 1 202 ? -1.031  -31.195 7.527   1.00 37.27  ? 197 ARG D CA  1 
ATOM   9138  C C   . ARG D 1 202 ? -2.175  -32.184 7.374   1.00 39.74  ? 197 ARG D C   1 
ATOM   9139  O O   . ARG D 1 202 ? -2.121  -33.108 6.556   1.00 41.41  ? 197 ARG D O   1 
ATOM   9140  C CB  . ARG D 1 202 ? -0.155  -31.189 6.270   1.00 35.82  ? 197 ARG D CB  1 
ATOM   9141  C CG  . ARG D 1 202 ? -0.869  -30.878 4.977   1.00 34.30  ? 197 ARG D CG  1 
ATOM   9142  C CD  . ARG D 1 202 ? 0.140   -30.650 3.856   1.00 33.83  ? 197 ARG D CD  1 
ATOM   9143  N NE  . ARG D 1 202 ? 0.774   -29.344 3.974   1.00 34.26  ? 197 ARG D NE  1 
ATOM   9144  C CZ  . ARG D 1 202 ? 1.776   -28.916 3.209   1.00 34.83  ? 197 ARG D CZ  1 
ATOM   9145  N NH1 . ARG D 1 202 ? 2.276   -29.696 2.260   1.00 33.62  ? 197 ARG D NH1 1 
ATOM   9146  N NH2 . ARG D 1 202 ? 2.270   -27.695 3.387   1.00 32.21  ? 197 ARG D NH2 1 
ATOM   9147  N N   . PRO D 1 203 ? -3.242  -31.994 8.164   1.00 40.96  ? 198 PRO D N   1 
ATOM   9148  C CA  . PRO D 1 203 ? -4.432  -32.848 8.154   1.00 41.21  ? 198 PRO D CA  1 
ATOM   9149  C C   . PRO D 1 203 ? -4.955  -33.238 6.770   1.00 42.34  ? 198 PRO D C   1 
ATOM   9150  O O   . PRO D 1 203 ? -5.112  -34.417 6.480   1.00 44.11  ? 198 PRO D O   1 
ATOM   9151  C CB  . PRO D 1 203 ? -5.436  -32.027 8.954   1.00 41.24  ? 198 PRO D CB  1 
ATOM   9152  C CG  . PRO D 1 203 ? -4.558  -31.400 9.988   1.00 41.04  ? 198 PRO D CG  1 
ATOM   9153  C CD  . PRO D 1 203 ? -3.393  -30.912 9.154   1.00 40.79  ? 198 PRO D CD  1 
ATOM   9154  N N   . LEU D 1 204 ? -5.234  -32.256 5.922   1.00 42.33  ? 199 LEU D N   1 
ATOM   9155  C CA  . LEU D 1 204 ? -5.743  -32.537 4.585   1.00 43.22  ? 199 LEU D CA  1 
ATOM   9156  C C   . LEU D 1 204 ? -4.975  -33.649 3.867   1.00 44.40  ? 199 LEU D C   1 
ATOM   9157  O O   . LEU D 1 204 ? -5.565  -34.443 3.134   1.00 43.84  ? 199 LEU D O   1 
ATOM   9158  C CB  . LEU D 1 204 ? -5.711  -31.267 3.731   1.00 42.92  ? 199 LEU D CB  1 
ATOM   9159  C CG  . LEU D 1 204 ? -6.723  -30.173 4.071   1.00 42.70  ? 199 LEU D CG  1 
ATOM   9160  C CD1 . LEU D 1 204 ? -6.433  -28.969 3.229   1.00 42.22  ? 199 LEU D CD1 1 
ATOM   9161  C CD2 . LEU D 1 204 ? -8.143  -30.657 3.817   1.00 42.25  ? 199 LEU D CD2 1 
ATOM   9162  N N   . ALA D 1 205 ? -3.661  -33.702 4.074   1.00 44.78  ? 200 ALA D N   1 
ATOM   9163  C CA  . ALA D 1 205 ? -2.837  -34.722 3.433   1.00 46.59  ? 200 ALA D CA  1 
ATOM   9164  C C   . ALA D 1 205 ? -3.052  -36.096 4.082   1.00 48.48  ? 200 ALA D C   1 
ATOM   9165  O O   . ALA D 1 205 ? -2.867  -37.137 3.442   1.00 49.35  ? 200 ALA D O   1 
ATOM   9166  C CB  . ALA D 1 205 ? -1.370  -34.326 3.511   1.00 43.29  ? 200 ALA D CB  1 
ATOM   9167  N N   . LEU D 1 206 ? -3.449  -36.091 5.353   1.00 48.96  ? 201 LEU D N   1 
ATOM   9168  C CA  . LEU D 1 206 ? -3.688  -37.325 6.095   1.00 47.66  ? 201 LEU D CA  1 
ATOM   9169  C C   . LEU D 1 206 ? -5.129  -37.795 5.989   1.00 47.33  ? 201 LEU D C   1 
ATOM   9170  O O   . LEU D 1 206 ? -5.600  -38.543 6.838   1.00 48.04  ? 201 LEU D O   1 
ATOM   9171  C CB  . LEU D 1 206 ? -3.333  -37.141 7.570   1.00 47.35  ? 201 LEU D CB  1 
ATOM   9172  C CG  . LEU D 1 206 ? -1.878  -36.785 7.877   1.00 48.50  ? 201 LEU D CG  1 
ATOM   9173  C CD1 . LEU D 1 206 ? -1.736  -36.533 9.365   1.00 49.40  ? 201 LEU D CD1 1 
ATOM   9174  C CD2 . LEU D 1 206 ? -0.960  -37.908 7.430   1.00 47.64  ? 201 LEU D CD2 1 
ATOM   9175  N N   . GLY D 1 207 ? -5.833  -37.344 4.958   1.00 47.86  ? 202 GLY D N   1 
ATOM   9176  C CA  . GLY D 1 207 ? -7.206  -37.774 4.774   1.00 47.47  ? 202 GLY D CA  1 
ATOM   9177  C C   . GLY D 1 207 ? -8.298  -36.876 5.313   1.00 47.51  ? 202 GLY D C   1 
ATOM   9178  O O   . GLY D 1 207 ? -9.461  -37.089 4.996   1.00 48.19  ? 202 GLY D O   1 
ATOM   9179  N N   . ALA D 1 208 ? -7.948  -35.883 6.125   1.00 48.24  ? 203 ALA D N   1 
ATOM   9180  C CA  . ALA D 1 208 ? -8.948  -34.973 6.686   1.00 47.46  ? 203 ALA D CA  1 
ATOM   9181  C C   . ALA D 1 208 ? -9.662  -34.240 5.560   1.00 47.05  ? 203 ALA D C   1 
ATOM   9182  O O   . ALA D 1 208 ? -9.108  -34.087 4.475   1.00 48.11  ? 203 ALA D O   1 
ATOM   9183  C CB  . ALA D 1 208 ? -8.282  -33.968 7.608   1.00 48.39  ? 203 ALA D CB  1 
ATOM   9184  N N   . ASP D 1 209 ? -10.886 -33.789 5.818   1.00 45.79  ? 204 ASP D N   1 
ATOM   9185  C CA  . ASP D 1 209 ? -11.663 -33.066 4.815   1.00 44.93  ? 204 ASP D CA  1 
ATOM   9186  C C   . ASP D 1 209 ? -11.564 -31.564 5.041   1.00 44.41  ? 204 ASP D C   1 
ATOM   9187  O O   . ASP D 1 209 ? -11.785 -30.758 4.129   1.00 42.57  ? 204 ASP D O   1 
ATOM   9188  C CB  . ASP D 1 209 ? -13.129 -33.484 4.887   1.00 47.69  ? 204 ASP D CB  1 
ATOM   9189  C CG  . ASP D 1 209 ? -13.323 -34.951 4.608   1.00 50.27  ? 204 ASP D CG  1 
ATOM   9190  O OD1 . ASP D 1 209 ? -12.912 -35.400 3.517   1.00 52.04  ? 204 ASP D OD1 1 
ATOM   9191  O OD2 . ASP D 1 209 ? -13.884 -35.653 5.478   1.00 53.69  ? 204 ASP D OD2 1 
ATOM   9192  N N   . ILE D 1 210 ? -11.229 -31.202 6.273   1.00 43.67  ? 205 ILE D N   1 
ATOM   9193  C CA  . ILE D 1 210 ? -11.109 -29.812 6.668   1.00 41.98  ? 205 ILE D CA  1 
ATOM   9194  C C   . ILE D 1 210 ? -10.021 -29.648 7.727   1.00 43.43  ? 205 ILE D C   1 
ATOM   9195  O O   . ILE D 1 210 ? -10.069 -30.287 8.786   1.00 43.78  ? 205 ILE D O   1 
ATOM   9196  C CB  . ILE D 1 210 ? -12.448 -29.297 7.255   1.00 40.61  ? 205 ILE D CB  1 
ATOM   9197  C CG1 . ILE D 1 210 ? -13.496 -29.170 6.148   1.00 40.34  ? 205 ILE D CG1 1 
ATOM   9198  C CG2 . ILE D 1 210 ? -12.239 -27.970 7.953   1.00 40.82  ? 205 ILE D CG2 1 
ATOM   9199  C CD1 . ILE D 1 210 ? -14.876 -28.745 6.644   1.00 39.84  ? 205 ILE D CD1 1 
ATOM   9200  N N   . SER D 1 211 ? -9.032  -28.805 7.429   1.00 44.21  ? 206 SER D N   1 
ATOM   9201  C CA  . SER D 1 211 ? -7.962  -28.520 8.382   1.00 44.10  ? 206 SER D CA  1 
ATOM   9202  C C   . SER D 1 211 ? -8.237  -27.115 8.873   1.00 43.72  ? 206 SER D C   1 
ATOM   9203  O O   . SER D 1 211 ? -8.148  -26.148 8.112   1.00 42.77  ? 206 SER D O   1 
ATOM   9204  C CB  . SER D 1 211 ? -6.586  -28.560 7.729   1.00 43.42  ? 206 SER D CB  1 
ATOM   9205  O OG  . SER D 1 211 ? -5.578  -28.472 8.723   1.00 41.43  ? 206 SER D OG  1 
ATOM   9206  N N   . MET D 1 212 ? -8.589  -27.009 10.146  1.00 45.07  ? 207 MET D N   1 
ATOM   9207  C CA  . MET D 1 212 ? -8.912  -25.720 10.727  1.00 46.96  ? 207 MET D CA  1 
ATOM   9208  C C   . MET D 1 212 ? -7.768  -25.214 11.584  1.00 47.51  ? 207 MET D C   1 
ATOM   9209  O O   . MET D 1 212 ? -7.245  -25.941 12.425  1.00 47.85  ? 207 MET D O   1 
ATOM   9210  C CB  . MET D 1 212 ? -10.191 -25.848 11.559  1.00 46.76  ? 207 MET D CB  1 
ATOM   9211  C CG  . MET D 1 212 ? -10.828 -24.532 11.950  1.00 47.01  ? 207 MET D CG  1 
ATOM   9212  S SD  . MET D 1 212 ? -10.086 -23.778 13.402  1.00 51.29  ? 207 MET D SD  1 
ATOM   9213  C CE  . MET D 1 212 ? -11.270 -24.212 14.685  1.00 48.94  ? 207 MET D CE  1 
ATOM   9214  N N   . TYR D 1 213 ? -7.356  -23.975 11.341  1.00 49.80  ? 208 TYR D N   1 
ATOM   9215  C CA  . TYR D 1 213 ? -6.287  -23.369 12.124  1.00 52.24  ? 208 TYR D CA  1 
ATOM   9216  C C   . TYR D 1 213 ? -6.847  -22.147 12.831  1.00 49.69  ? 208 TYR D C   1 
ATOM   9217  O O   . TYR D 1 213 ? -7.294  -21.196 12.191  1.00 50.60  ? 208 TYR D O   1 
ATOM   9218  C CB  . TYR D 1 213 ? -5.107  -22.959 11.246  1.00 56.60  ? 208 TYR D CB  1 
ATOM   9219  C CG  . TYR D 1 213 ? -3.972  -22.382 12.058  1.00 63.30  ? 208 TYR D CG  1 
ATOM   9220  C CD1 . TYR D 1 213 ? -3.606  -22.960 13.271  1.00 66.01  ? 208 TYR D CD1 1 
ATOM   9221  C CD2 . TYR D 1 213 ? -3.257  -21.266 11.619  1.00 66.15  ? 208 TYR D CD2 1 
ATOM   9222  C CE1 . TYR D 1 213 ? -2.564  -22.447 14.029  1.00 68.52  ? 208 TYR D CE1 1 
ATOM   9223  C CE2 . TYR D 1 213 ? -2.206  -20.743 12.373  1.00 68.16  ? 208 TYR D CE2 1 
ATOM   9224  C CZ  . TYR D 1 213 ? -1.869  -21.342 13.577  1.00 69.12  ? 208 TYR D CZ  1 
ATOM   9225  O OH  . TYR D 1 213 ? -0.838  -20.846 14.342  1.00 71.21  ? 208 TYR D OH  1 
ATOM   9226  N N   . SER D 1 214 ? -6.827  -22.178 14.155  1.00 44.55  ? 209 SER D N   1 
ATOM   9227  C CA  . SER D 1 214 ? -7.361  -21.081 14.945  1.00 44.26  ? 209 SER D CA  1 
ATOM   9228  C C   . SER D 1 214 ? -6.284  -20.335 15.713  1.00 46.02  ? 209 SER D C   1 
ATOM   9229  O O   . SER D 1 214 ? -5.823  -20.811 16.749  1.00 41.60  ? 209 SER D O   1 
ATOM   9230  C CB  . SER D 1 214 ? -8.406  -21.620 15.917  1.00 44.05  ? 209 SER D CB  1 
ATOM   9231  O OG  . SER D 1 214 ? -8.556  -20.741 17.014  1.00 48.56  ? 209 SER D OG  1 
ATOM   9232  N N   . ALA D 1 215 ? -5.905  -19.157 15.228  1.00 38.87  ? 210 ALA D N   1 
ATOM   9233  C CA  . ALA D 1 215 ? -4.864  -18.384 15.898  1.00 37.14  ? 210 ALA D CA  1 
ATOM   9234  C C   . ALA D 1 215 ? -5.408  -17.271 16.788  1.00 34.71  ? 210 ALA D C   1 
ATOM   9235  O O   . ALA D 1 215 ? -6.207  -16.448 16.372  1.00 36.13  ? 210 ALA D O   1 
ATOM   9236  C CB  . ALA D 1 215 ? -3.904  -17.805 14.883  1.00 33.08  ? 210 ALA D CB  1 
ATOM   9237  N N   . THR D 1 216 ? -4.910  -17.247 18.013  1.00 41.49  ? 211 THR D N   1 
ATOM   9238  C CA  . THR D 1 216 ? -5.301  -16.280 19.026  1.00 44.59  ? 211 THR D CA  1 
ATOM   9239  C C   . THR D 1 216 ? -4.386  -15.062 19.061  1.00 42.03  ? 211 THR D C   1 
ATOM   9240  O O   . THR D 1 216 ? -3.411  -14.979 18.318  1.00 45.50  ? 211 THR D O   1 
ATOM   9241  C CB  . THR D 1 216 ? -5.276  -16.940 20.421  1.00 45.30  ? 211 THR D CB  1 
ATOM   9242  O OG1 . THR D 1 216 ? -3.953  -17.445 20.681  1.00 46.20  ? 211 THR D OG1 1 
ATOM   9243  C CG2 . THR D 1 216 ? -6.290  -18.100 20.483  1.00 45.44  ? 211 THR D CG2 1 
ATOM   9244  N N   . LYS D 1 217 ? -4.716  -14.118 19.937  1.00 44.30  ? 212 LYS D N   1 
ATOM   9245  C CA  . LYS D 1 217 ? -3.942  -12.893 20.104  1.00 45.64  ? 212 LYS D CA  1 
ATOM   9246  C C   . LYS D 1 217 ? -2.620  -13.206 20.801  1.00 48.13  ? 212 LYS D C   1 
ATOM   9247  O O   . LYS D 1 217 ? -2.131  -12.395 21.582  1.00 48.64  ? 212 LYS D O   1 
ATOM   9248  C CB  . LYS D 1 217 ? -4.714  -11.902 20.977  1.00 42.22  ? 212 LYS D CB  1 
ATOM   9249  C CG  . LYS D 1 217 ? -4.942  -12.442 22.387  1.00 39.05  ? 212 LYS D CG  1 
ATOM   9250  C CD  . LYS D 1 217 ? -5.721  -11.505 23.274  1.00 37.06  ? 212 LYS D CD  1 
ATOM   9251  C CE  . LYS D 1 217 ? -5.968  -12.160 24.629  1.00 36.56  ? 212 LYS D CE  1 
ATOM   9252  N NZ  . LYS D 1 217 ? -6.685  -11.273 25.590  1.00 34.80  ? 212 LYS D NZ  1 
ATOM   9253  N N   . TYR D 1 218 ? -2.024  -14.362 20.525  1.00 51.94  ? 213 TYR D N   1 
ATOM   9254  C CA  . TYR D 1 218 ? -0.789  -14.697 21.215  1.00 53.60  ? 213 TYR D CA  1 
ATOM   9255  C C   . TYR D 1 218 ? 0.491   -15.106 20.494  1.00 53.77  ? 213 TYR D C   1 
ATOM   9256  O O   . TYR D 1 218 ? 1.548   -14.903 21.085  1.00 54.01  ? 213 TYR D O   1 
ATOM   9257  C CB  . TYR D 1 218 ? -1.054  -15.773 22.278  1.00 57.54  ? 213 TYR D CB  1 
ATOM   9258  C CG  . TYR D 1 218 ? -1.838  -15.325 23.490  1.00 59.67  ? 213 TYR D CG  1 
ATOM   9259  C CD1 . TYR D 1 218 ? -3.191  -15.627 23.619  1.00 61.57  ? 213 TYR D CD1 1 
ATOM   9260  C CD2 . TYR D 1 218 ? -1.223  -14.614 24.516  1.00 61.50  ? 213 TYR D CD2 1 
ATOM   9261  C CE1 . TYR D 1 218 ? -3.916  -15.232 24.746  1.00 63.91  ? 213 TYR D CE1 1 
ATOM   9262  C CE2 . TYR D 1 218 ? -1.935  -14.210 25.647  1.00 63.36  ? 213 TYR D CE2 1 
ATOM   9263  C CZ  . TYR D 1 218 ? -3.282  -14.521 25.757  1.00 64.76  ? 213 TYR D CZ  1 
ATOM   9264  O OH  . TYR D 1 218 ? -3.998  -14.106 26.865  1.00 65.40  ? 213 TYR D OH  1 
ATOM   9265  N N   . MET D 1 219 ? 0.466   -15.648 19.267  1.00 52.60  ? 214 MET D N   1 
ATOM   9266  C CA  . MET D 1 219 ? 1.764   -16.096 18.710  1.00 52.76  ? 214 MET D CA  1 
ATOM   9267  C C   . MET D 1 219 ? 2.805   -15.175 18.084  1.00 53.64  ? 214 MET D C   1 
ATOM   9268  O O   . MET D 1 219 ? 3.913   -15.085 18.620  1.00 56.05  ? 214 MET D O   1 
ATOM   9269  C CB  . MET D 1 219 ? 1.624   -17.305 17.770  1.00 47.57  ? 214 MET D CB  1 
ATOM   9270  C CG  . MET D 1 219 ? 3.026   -17.881 17.318  1.00 36.69  ? 214 MET D CG  1 
ATOM   9271  S SD  . MET D 1 219 ? 4.305   -18.163 18.628  1.00 23.09  ? 214 MET D SD  1 
ATOM   9272  C CE  . MET D 1 219 ? 5.694   -17.402 18.018  1.00 22.97  ? 214 MET D CE  1 
ATOM   9273  N N   . ASN D 1 220 ? 2.522   -14.543 16.951  1.00 52.72  ? 215 ASN D N   1 
ATOM   9274  C CA  . ASN D 1 220 ? 3.548   -13.688 16.373  1.00 53.07  ? 215 ASN D CA  1 
ATOM   9275  C C   . ASN D 1 220 ? 3.778   -12.598 17.410  1.00 54.62  ? 215 ASN D C   1 
ATOM   9276  O O   . ASN D 1 220 ? 3.390   -11.444 17.223  1.00 55.80  ? 215 ASN D O   1 
ATOM   9277  C CB  . ASN D 1 220 ? 3.079   -13.112 15.040  1.00 51.04  ? 215 ASN D CB  1 
ATOM   9278  C CG  . ASN D 1 220 ? 4.173   -12.366 14.329  1.00 50.66  ? 215 ASN D CG  1 
ATOM   9279  O OD1 . ASN D 1 220 ? 5.338   -12.743 14.415  1.00 51.13  ? 215 ASN D OD1 1 
ATOM   9280  N ND2 . ASN D 1 220 ? 3.811   -11.305 13.613  1.00 52.05  ? 215 ASN D ND2 1 
ATOM   9281  N N   . GLY D 1 221 ? 4.435   -12.986 18.503  1.00 55.97  ? 216 GLY D N   1 
ATOM   9282  C CA  . GLY D 1 221 ? 4.653   -12.085 19.617  1.00 57.05  ? 216 GLY D CA  1 
ATOM   9283  C C   . GLY D 1 221 ? 3.248   -12.001 20.176  1.00 56.82  ? 216 GLY D C   1 
ATOM   9284  O O   . GLY D 1 221 ? 2.362   -12.720 19.712  1.00 58.94  ? 216 GLY D O   1 
ATOM   9285  N N   . HIS D 1 222 ? 3.007   -11.157 21.162  1.00 55.72  ? 217 HIS D N   1 
ATOM   9286  C CA  . HIS D 1 222 ? 1.651   -11.056 21.672  1.00 54.29  ? 217 HIS D CA  1 
ATOM   9287  C C   . HIS D 1 222 ? 0.937   -10.161 20.671  1.00 52.41  ? 217 HIS D C   1 
ATOM   9288  O O   . HIS D 1 222 ? 0.407   -9.117  21.030  1.00 51.02  ? 217 HIS D O   1 
ATOM   9289  C CB  . HIS D 1 222 ? 1.645   -10.413 23.057  1.00 55.91  ? 217 HIS D CB  1 
ATOM   9290  C CG  . HIS D 1 222 ? 0.356   -10.586 23.800  1.00 57.20  ? 217 HIS D CG  1 
ATOM   9291  N ND1 . HIS D 1 222 ? -0.869  -10.263 23.255  1.00 56.75  ? 217 HIS D ND1 1 
ATOM   9292  C CD2 . HIS D 1 222 ? 0.105   -11.027 25.056  1.00 57.73  ? 217 HIS D CD2 1 
ATOM   9293  C CE1 . HIS D 1 222 ? -1.820  -10.496 24.144  1.00 57.77  ? 217 HIS D CE1 1 
ATOM   9294  N NE2 . HIS D 1 222 ? -1.255  -10.960 25.244  1.00 59.25  ? 217 HIS D NE2 1 
ATOM   9295  N N   . SER D 1 223 ? 0.963   -10.563 19.404  1.00 51.77  ? 218 SER D N   1 
ATOM   9296  C CA  . SER D 1 223 ? 0.327   -9.800  18.335  1.00 51.87  ? 218 SER D CA  1 
ATOM   9297  C C   . SER D 1 223 ? -1.169  -10.072 18.368  1.00 50.43  ? 218 SER D C   1 
ATOM   9298  O O   . SER D 1 223 ? -1.628  -11.124 17.921  1.00 52.66  ? 218 SER D O   1 
ATOM   9299  C CB  . SER D 1 223 ? 0.904   -10.208 16.977  1.00 52.92  ? 218 SER D CB  1 
ATOM   9300  O OG  . SER D 1 223 ? 0.397   -9.389  15.941  1.00 57.14  ? 218 SER D OG  1 
ATOM   9301  N N   . ASP D 1 224 ? -1.916  -9.107  18.895  1.00 47.28  ? 219 ASP D N   1 
ATOM   9302  C CA  . ASP D 1 224 ? -3.359  -9.208  19.046  1.00 44.89  ? 219 ASP D CA  1 
ATOM   9303  C C   . ASP D 1 224 ? -4.170  -9.412  17.776  1.00 42.16  ? 219 ASP D C   1 
ATOM   9304  O O   . ASP D 1 224 ? -5.086  -8.650  17.470  1.00 40.81  ? 219 ASP D O   1 
ATOM   9305  C CB  . ASP D 1 224 ? -3.877  -7.980  19.792  1.00 48.70  ? 219 ASP D CB  1 
ATOM   9306  C CG  . ASP D 1 224 ? -3.182  -7.781  21.123  1.00 51.02  ? 219 ASP D CG  1 
ATOM   9307  O OD1 . ASP D 1 224 ? -2.260  -6.937  21.187  1.00 52.60  ? 219 ASP D OD1 1 
ATOM   9308  O OD2 . ASP D 1 224 ? -3.547  -8.478  22.101  1.00 53.79  ? 219 ASP D OD2 1 
ATOM   9309  N N   . VAL D 1 225 ? -3.840  -10.465 17.049  1.00 39.91  ? 220 VAL D N   1 
ATOM   9310  C CA  . VAL D 1 225 ? -4.543  -10.791 15.827  1.00 38.96  ? 220 VAL D CA  1 
ATOM   9311  C C   . VAL D 1 225 ? -5.303  -12.085 16.066  1.00 37.77  ? 220 VAL D C   1 
ATOM   9312  O O   . VAL D 1 225 ? -4.708  -13.114 16.385  1.00 37.06  ? 220 VAL D O   1 
ATOM   9313  C CB  . VAL D 1 225 ? -3.561  -11.000 14.656  1.00 39.62  ? 220 VAL D CB  1 
ATOM   9314  C CG1 . VAL D 1 225 ? -4.323  -11.379 13.385  1.00 38.80  ? 220 VAL D CG1 1 
ATOM   9315  C CG2 . VAL D 1 225 ? -2.734  -9.741  14.444  1.00 40.78  ? 220 VAL D CG2 1 
ATOM   9316  N N   . VAL D 1 226 ? -6.620  -12.022 15.938  1.00 36.53  ? 221 VAL D N   1 
ATOM   9317  C CA  . VAL D 1 226 ? -7.450  -13.200 16.109  1.00 36.26  ? 221 VAL D CA  1 
ATOM   9318  C C   . VAL D 1 226 ? -7.823  -13.642 14.693  1.00 36.86  ? 221 VAL D C   1 
ATOM   9319  O O   . VAL D 1 226 ? -7.950  -12.803 13.794  1.00 38.49  ? 221 VAL D O   1 
ATOM   9320  C CB  . VAL D 1 226 ? -8.704  -12.864 16.910  1.00 35.34  ? 221 VAL D CB  1 
ATOM   9321  C CG1 . VAL D 1 226 ? -9.425  -14.139 17.317  1.00 35.22  ? 221 VAL D CG1 1 
ATOM   9322  C CG2 . VAL D 1 226 ? -8.317  -12.052 18.119  1.00 35.91  ? 221 VAL D CG2 1 
ATOM   9323  N N   . MET D 1 227 ? -8.001  -14.945 14.484  1.00 36.18  ? 222 MET D N   1 
ATOM   9324  C CA  . MET D 1 227 ? -8.314  -15.430 13.150  1.00 35.35  ? 222 MET D CA  1 
ATOM   9325  C C   . MET D 1 227 ? -8.757  -16.889 13.132  1.00 34.60  ? 222 MET D C   1 
ATOM   9326  O O   . MET D 1 227 ? -8.268  -17.715 13.906  1.00 34.15  ? 222 MET D O   1 
ATOM   9327  C CB  . MET D 1 227 ? -7.076  -15.264 12.266  1.00 36.01  ? 222 MET D CB  1 
ATOM   9328  C CG  . MET D 1 227 ? -7.267  -15.585 10.797  1.00 35.67  ? 222 MET D CG  1 
ATOM   9329  S SD  . MET D 1 227 ? -7.925  -14.172 9.910   1.00 39.83  ? 222 MET D SD  1 
ATOM   9330  C CE  . MET D 1 227 ? -6.650  -12.956 10.198  1.00 34.14  ? 222 MET D CE  1 
ATOM   9331  N N   . GLY D 1 228 ? -9.681  -17.193 12.228  1.00 34.51  ? 223 GLY D N   1 
ATOM   9332  C CA  . GLY D 1 228 ? -10.186 -18.545 12.083  1.00 35.98  ? 223 GLY D CA  1 
ATOM   9333  C C   . GLY D 1 228 ? -9.942  -18.952 10.644  1.00 36.92  ? 223 GLY D C   1 
ATOM   9334  O O   . GLY D 1 228 ? -10.577 -18.426 9.734   1.00 36.87  ? 223 GLY D O   1 
ATOM   9335  N N   . LEU D 1 229 ? -9.012  -19.879 10.438  1.00 36.91  ? 224 LEU D N   1 
ATOM   9336  C CA  . LEU D 1 229 ? -8.661  -20.338 9.096   1.00 36.29  ? 224 LEU D CA  1 
ATOM   9337  C C   . LEU D 1 229 ? -9.149  -21.761 8.797   1.00 37.80  ? 224 LEU D C   1 
ATOM   9338  O O   . LEU D 1 229 ? -8.776  -22.729 9.467   1.00 37.90  ? 224 LEU D O   1 
ATOM   9339  C CB  . LEU D 1 229 ? -7.142  -20.233 8.909   1.00 33.09  ? 224 LEU D CB  1 
ATOM   9340  C CG  . LEU D 1 229 ? -6.597  -18.800 8.951   1.00 30.92  ? 224 LEU D CG  1 
ATOM   9341  C CD1 . LEU D 1 229 ? -5.082  -18.791 9.104   1.00 27.53  ? 224 LEU D CD1 1 
ATOM   9342  C CD2 . LEU D 1 229 ? -7.019  -18.081 7.675   1.00 29.41  ? 224 LEU D CD2 1 
ATOM   9343  N N   . VAL D 1 230 ? -9.988  -21.868 7.773   1.00 39.14  ? 225 VAL D N   1 
ATOM   9344  C CA  . VAL D 1 230 ? -10.562 -23.139 7.360   1.00 39.36  ? 225 VAL D CA  1 
ATOM   9345  C C   . VAL D 1 230 ? -10.090 -23.469 5.961   1.00 39.91  ? 225 VAL D C   1 
ATOM   9346  O O   . VAL D 1 230 ? -10.370 -22.728 5.026   1.00 39.88  ? 225 VAL D O   1 
ATOM   9347  C CB  . VAL D 1 230 ? -12.097 -23.062 7.330   1.00 39.26  ? 225 VAL D CB  1 
ATOM   9348  C CG1 . VAL D 1 230 ? -12.666 -24.379 6.860   1.00 37.48  ? 225 VAL D CG1 1 
ATOM   9349  C CG2 . VAL D 1 230 ? -12.629 -22.693 8.711   1.00 38.57  ? 225 VAL D CG2 1 
ATOM   9350  N N   . SER D 1 231 ? -9.373  -24.576 5.814   1.00 41.84  ? 226 SER D N   1 
ATOM   9351  C CA  . SER D 1 231 ? -8.889  -24.978 4.497   1.00 44.01  ? 226 SER D CA  1 
ATOM   9352  C C   . SER D 1 231 ? -9.541  -26.282 4.054   1.00 44.92  ? 226 SER D C   1 
ATOM   9353  O O   . SER D 1 231 ? -10.025 -27.064 4.876   1.00 45.30  ? 226 SER D O   1 
ATOM   9354  C CB  . SER D 1 231 ? -7.363  -25.119 4.495   1.00 43.91  ? 226 SER D CB  1 
ATOM   9355  O OG  . SER D 1 231 ? -6.725  -23.847 4.524   1.00 44.23  ? 226 SER D OG  1 
ATOM   9356  N N   . VAL D 1 232 ? -9.553  -26.515 2.747   1.00 46.08  ? 227 VAL D N   1 
ATOM   9357  C CA  . VAL D 1 232 ? -10.177 -27.713 2.213   1.00 46.92  ? 227 VAL D CA  1 
ATOM   9358  C C   . VAL D 1 232 ? -9.844  -27.855 0.727   1.00 46.69  ? 227 VAL D C   1 
ATOM   9359  O O   . VAL D 1 232 ? -9.408  -26.895 0.094   1.00 46.75  ? 227 VAL D O   1 
ATOM   9360  C CB  . VAL D 1 232 ? -11.716 -27.638 2.422   1.00 47.37  ? 227 VAL D CB  1 
ATOM   9361  C CG1 . VAL D 1 232 ? -12.295 -26.466 1.643   1.00 46.48  ? 227 VAL D CG1 1 
ATOM   9362  C CG2 . VAL D 1 232 ? -12.370 -28.941 1.998   1.00 51.33  ? 227 VAL D CG2 1 
ATOM   9363  N N   . ASN D 1 233 ? -10.034 -29.055 0.178   1.00 47.06  ? 228 ASN D N   1 
ATOM   9364  C CA  . ASN D 1 233 ? -9.755  -29.317 -1.235  1.00 46.88  ? 228 ASN D CA  1 
ATOM   9365  C C   . ASN D 1 233 ? -11.050 -29.556 -2.026  1.00 49.36  ? 228 ASN D C   1 
ATOM   9366  O O   . ASN D 1 233 ? -11.114 -29.284 -3.235  1.00 48.22  ? 228 ASN D O   1 
ATOM   9367  C CB  . ASN D 1 233 ? -8.854  -30.546 -1.379  1.00 45.12  ? 228 ASN D CB  1 
ATOM   9368  C CG  . ASN D 1 233 ? -7.482  -30.362 -0.733  1.00 45.81  ? 228 ASN D CG  1 
ATOM   9369  O OD1 . ASN D 1 233 ? -6.712  -29.470 -1.111  1.00 45.07  ? 228 ASN D OD1 1 
ATOM   9370  N ND2 . ASN D 1 233 ? -7.164  -31.221 0.238   1.00 43.41  ? 228 ASN D ND2 1 
ATOM   9371  N N   . CYS D 1 234 ? -12.076 -30.061 -1.336  1.00 52.00  ? 229 CYS D N   1 
ATOM   9372  C CA  . CYS D 1 234 ? -13.362 -30.358 -1.967  1.00 55.87  ? 229 CYS D CA  1 
ATOM   9373  C C   . CYS D 1 234 ? -13.886 -29.153 -2.718  1.00 57.56  ? 229 CYS D C   1 
ATOM   9374  O O   . CYS D 1 234 ? -13.575 -28.015 -2.385  1.00 59.42  ? 229 CYS D O   1 
ATOM   9375  C CB  . CYS D 1 234 ? -14.404 -30.796 -0.924  1.00 57.08  ? 229 CYS D CB  1 
ATOM   9376  S SG  . CYS D 1 234 ? -15.937 -31.555 -1.613  1.00 59.48  ? 229 CYS D SG  1 
ATOM   9377  N N   . GLU D 1 235 ? -14.699 -29.407 -3.730  1.00 59.32  ? 230 GLU D N   1 
ATOM   9378  C CA  . GLU D 1 235 ? -15.254 -28.329 -4.519  1.00 60.77  ? 230 GLU D CA  1 
ATOM   9379  C C   . GLU D 1 235 ? -16.462 -27.711 -3.833  1.00 59.74  ? 230 GLU D C   1 
ATOM   9380  O O   . GLU D 1 235 ? -16.499 -26.508 -3.589  1.00 57.99  ? 230 GLU D O   1 
ATOM   9381  C CB  . GLU D 1 235 ? -15.645 -28.856 -5.899  1.00 64.34  ? 230 GLU D CB  1 
ATOM   9382  C CG  . GLU D 1 235 ? -16.078 -27.777 -6.874  1.00 67.59  ? 230 GLU D CG  1 
ATOM   9383  C CD  . GLU D 1 235 ? -15.017 -26.711 -7.074  1.00 68.44  ? 230 GLU D CD  1 
ATOM   9384  O OE1 . GLU D 1 235 ? -15.258 -25.799 -7.891  1.00 69.01  ? 230 GLU D OE1 1 
ATOM   9385  O OE2 . GLU D 1 235 ? -13.952 -26.783 -6.418  1.00 69.03  ? 230 GLU D OE2 1 
ATOM   9386  N N   . SER D 1 236 ? -17.442 -28.549 -3.513  1.00 59.36  ? 231 SER D N   1 
ATOM   9387  C CA  . SER D 1 236 ? -18.675 -28.095 -2.877  1.00 61.35  ? 231 SER D CA  1 
ATOM   9388  C C   . SER D 1 236 ? -18.482 -27.582 -1.457  1.00 60.45  ? 231 SER D C   1 
ATOM   9389  O O   . SER D 1 236 ? -19.108 -26.596 -1.047  1.00 59.37  ? 231 SER D O   1 
ATOM   9390  C CB  . SER D 1 236 ? -19.696 -29.231 -2.854  1.00 63.58  ? 231 SER D CB  1 
ATOM   9391  O OG  . SER D 1 236 ? -19.223 -30.305 -2.059  1.00 67.36  ? 231 SER D OG  1 
ATOM   9392  N N   . LEU D 1 237 ? -17.628 -28.269 -0.706  1.00 58.10  ? 232 LEU D N   1 
ATOM   9393  C CA  . LEU D 1 237 ? -17.347 -27.900 0.675   1.00 54.40  ? 232 LEU D CA  1 
ATOM   9394  C C   . LEU D 1 237 ? -16.913 -26.433 0.709   1.00 54.60  ? 232 LEU D C   1 
ATOM   9395  O O   . LEU D 1 237 ? -17.383 -25.647 1.534   1.00 53.79  ? 232 LEU D O   1 
ATOM   9396  C CB  . LEU D 1 237 ? -16.244 -28.807 1.225   1.00 51.20  ? 232 LEU D CB  1 
ATOM   9397  C CG  . LEU D 1 237 ? -16.334 -29.165 2.706   1.00 49.35  ? 232 LEU D CG  1 
ATOM   9398  C CD1 . LEU D 1 237 ? -17.773 -29.518 3.064   1.00 46.34  ? 232 LEU D CD1 1 
ATOM   9399  C CD2 . LEU D 1 237 ? -15.400 -30.328 3.002   1.00 46.16  ? 232 LEU D CD2 1 
ATOM   9400  N N   . HIS D 1 238 ? -16.024 -26.079 -0.215  1.00 53.92  ? 233 HIS D N   1 
ATOM   9401  C CA  . HIS D 1 238 ? -15.510 -24.724 -0.332  1.00 52.04  ? 233 HIS D CA  1 
ATOM   9402  C C   . HIS D 1 238 ? -16.618 -23.761 -0.714  1.00 51.65  ? 233 HIS D C   1 
ATOM   9403  O O   . HIS D 1 238 ? -16.718 -22.671 -0.156  1.00 52.71  ? 233 HIS D O   1 
ATOM   9404  C CB  . HIS D 1 238 ? -14.409 -24.678 -1.391  1.00 51.84  ? 233 HIS D CB  1 
ATOM   9405  C CG  . HIS D 1 238 ? -14.068 -23.295 -1.854  1.00 52.28  ? 233 HIS D CG  1 
ATOM   9406  N ND1 . HIS D 1 238 ? -13.604 -22.313 -1.002  1.00 53.48  ? 233 HIS D ND1 1 
ATOM   9407  C CD2 . HIS D 1 238 ? -14.124 -22.727 -3.081  1.00 51.99  ? 233 HIS D CD2 1 
ATOM   9408  C CE1 . HIS D 1 238 ? -13.391 -21.204 -1.684  1.00 52.46  ? 233 HIS D CE1 1 
ATOM   9409  N NE2 . HIS D 1 238 ? -13.698 -21.428 -2.949  1.00 52.91  ? 233 HIS D NE2 1 
ATOM   9410  N N   . ASN D 1 239 ? -17.441 -24.169 -1.677  1.00 52.01  ? 234 ASN D N   1 
ATOM   9411  C CA  . ASN D 1 239 ? -18.547 -23.347 -2.160  1.00 50.48  ? 234 ASN D CA  1 
ATOM   9412  C C   . ASN D 1 239 ? -19.513 -23.036 -1.037  1.00 48.32  ? 234 ASN D C   1 
ATOM   9413  O O   . ASN D 1 239 ? -19.827 -21.877 -0.792  1.00 46.93  ? 234 ASN D O   1 
ATOM   9414  C CB  . ASN D 1 239 ? -19.291 -24.068 -3.285  1.00 53.02  ? 234 ASN D CB  1 
ATOM   9415  C CG  . ASN D 1 239 ? -18.480 -24.158 -4.566  1.00 56.09  ? 234 ASN D CG  1 
ATOM   9416  O OD1 . ASN D 1 239 ? -17.262 -23.956 -4.572  1.00 58.66  ? 234 ASN D OD1 1 
ATOM   9417  N ND2 . ASN D 1 239 ? -19.156 -24.477 -5.664  1.00 58.25  ? 234 ASN D ND2 1 
ATOM   9418  N N   . ARG D 1 240 ? -19.981 -24.079 -0.357  1.00 48.06  ? 235 ARG D N   1 
ATOM   9419  C CA  . ARG D 1 240 ? -20.920 -23.919 0.748   1.00 48.69  ? 235 ARG D CA  1 
ATOM   9420  C C   . ARG D 1 240 ? -20.328 -23.051 1.852   1.00 47.13  ? 235 ARG D C   1 
ATOM   9421  O O   . ARG D 1 240 ? -21.001 -22.183 2.409   1.00 47.87  ? 235 ARG D O   1 
ATOM   9422  C CB  . ARG D 1 240 ? -21.305 -25.289 1.313   1.00 50.45  ? 235 ARG D CB  1 
ATOM   9423  C CG  . ARG D 1 240 ? -22.201 -26.107 0.394   1.00 55.38  ? 235 ARG D CG  1 
ATOM   9424  C CD  . ARG D 1 240 ? -22.196 -27.583 0.787   1.00 59.68  ? 235 ARG D CD  1 
ATOM   9425  N NE  . ARG D 1 240 ? -22.783 -27.831 2.104   1.00 62.80  ? 235 ARG D NE  1 
ATOM   9426  C CZ  . ARG D 1 240 ? -22.627 -28.961 2.792   1.00 63.36  ? 235 ARG D CZ  1 
ATOM   9427  N NH1 . ARG D 1 240 ? -21.897 -29.953 2.291   1.00 63.18  ? 235 ARG D NH1 1 
ATOM   9428  N NH2 . ARG D 1 240 ? -23.204 -29.100 3.981   1.00 63.29  ? 235 ARG D NH2 1 
ATOM   9429  N N   . LEU D 1 241 ? -19.061 -23.288 2.160   1.00 44.97  ? 236 LEU D N   1 
ATOM   9430  C CA  . LEU D 1 241 ? -18.377 -22.542 3.201   1.00 44.66  ? 236 LEU D CA  1 
ATOM   9431  C C   . LEU D 1 241 ? -18.234 -21.075 2.820   1.00 45.99  ? 236 LEU D C   1 
ATOM   9432  O O   . LEU D 1 241 ? -18.410 -20.193 3.662   1.00 46.58  ? 236 LEU D O   1 
ATOM   9433  C CB  . LEU D 1 241 ? -17.013 -23.169 3.447   1.00 42.28  ? 236 LEU D CB  1 
ATOM   9434  C CG  . LEU D 1 241 ? -16.691 -23.763 4.821   1.00 42.21  ? 236 LEU D CG  1 
ATOM   9435  C CD1 . LEU D 1 241 ? -17.939 -24.196 5.570   1.00 39.52  ? 236 LEU D CD1 1 
ATOM   9436  C CD2 . LEU D 1 241 ? -15.752 -24.942 4.604   1.00 42.48  ? 236 LEU D CD2 1 
ATOM   9437  N N   . ARG D 1 242 ? -17.927 -20.818 1.549   1.00 47.92  ? 237 ARG D N   1 
ATOM   9438  C CA  . ARG D 1 242 ? -17.766 -19.453 1.052   1.00 49.46  ? 237 ARG D CA  1 
ATOM   9439  C C   . ARG D 1 242 ? -19.082 -18.718 1.231   1.00 48.46  ? 237 ARG D C   1 
ATOM   9440  O O   . ARG D 1 242 ? -19.120 -17.618 1.775   1.00 48.13  ? 237 ARG D O   1 
ATOM   9441  C CB  . ARG D 1 242 ? -17.375 -19.451 -0.437  1.00 52.93  ? 237 ARG D CB  1 
ATOM   9442  C CG  . ARG D 1 242 ? -16.875 -18.099 -0.963  1.00 57.53  ? 237 ARG D CG  1 
ATOM   9443  C CD  . ARG D 1 242 ? -15.532 -17.721 -0.318  1.00 65.67  ? 237 ARG D CD  1 
ATOM   9444  N NE  . ARG D 1 242 ? -15.148 -16.317 -0.517  1.00 69.81  ? 237 ARG D NE  1 
ATOM   9445  C CZ  . ARG D 1 242 ? -14.054 -15.752 -0.002  1.00 70.05  ? 237 ARG D CZ  1 
ATOM   9446  N NH1 . ARG D 1 242 ? -13.219 -16.464 0.750   1.00 68.51  ? 237 ARG D NH1 1 
ATOM   9447  N NH2 . ARG D 1 242 ? -13.796 -14.471 -0.238  1.00 70.35  ? 237 ARG D NH2 1 
ATOM   9448  N N   . PHE D 1 243 ? -20.164 -19.339 0.776   1.00 48.73  ? 238 PHE D N   1 
ATOM   9449  C CA  . PHE D 1 243 ? -21.483 -18.735 0.892   1.00 49.21  ? 238 PHE D CA  1 
ATOM   9450  C C   . PHE D 1 243 ? -21.726 -18.315 2.333   1.00 48.75  ? 238 PHE D C   1 
ATOM   9451  O O   . PHE D 1 243 ? -22.077 -17.167 2.594   1.00 49.69  ? 238 PHE D O   1 
ATOM   9452  C CB  . PHE D 1 243 ? -22.576 -19.717 0.462   1.00 50.14  ? 238 PHE D CB  1 
ATOM   9453  C CG  . PHE D 1 243 ? -23.960 -19.129 0.504   1.00 51.61  ? 238 PHE D CG  1 
ATOM   9454  C CD1 . PHE D 1 243 ? -24.354 -18.173 -0.434  1.00 51.66  ? 238 PHE D CD1 1 
ATOM   9455  C CD2 . PHE D 1 243 ? -24.850 -19.480 1.522   1.00 51.54  ? 238 PHE D CD2 1 
ATOM   9456  C CE1 . PHE D 1 243 ? -25.612 -17.571 -0.355  1.00 50.92  ? 238 PHE D CE1 1 
ATOM   9457  C CE2 . PHE D 1 243 ? -26.109 -18.885 1.612   1.00 50.28  ? 238 PHE D CE2 1 
ATOM   9458  C CZ  . PHE D 1 243 ? -26.491 -17.927 0.672   1.00 50.65  ? 238 PHE D CZ  1 
ATOM   9459  N N   . LEU D 1 244 ? -21.537 -19.247 3.264   1.00 47.29  ? 239 LEU D N   1 
ATOM   9460  C CA  . LEU D 1 244 ? -21.728 -18.966 4.682   1.00 46.48  ? 239 LEU D CA  1 
ATOM   9461  C C   . LEU D 1 244 ? -20.869 -17.795 5.118   1.00 46.99  ? 239 LEU D C   1 
ATOM   9462  O O   . LEU D 1 244 ? -21.351 -16.872 5.791   1.00 47.14  ? 239 LEU D O   1 
ATOM   9463  C CB  . LEU D 1 244 ? -21.366 -20.187 5.516   1.00 44.20  ? 239 LEU D CB  1 
ATOM   9464  C CG  . LEU D 1 244 ? -22.340 -21.341 5.309   1.00 45.03  ? 239 LEU D CG  1 
ATOM   9465  C CD1 . LEU D 1 244 ? -21.826 -22.595 6.007   1.00 45.20  ? 239 LEU D CD1 1 
ATOM   9466  C CD2 . LEU D 1 244 ? -23.713 -20.930 5.835   1.00 43.12  ? 239 LEU D CD2 1 
ATOM   9467  N N   . GLN D 1 245 ? -19.597 -17.838 4.732   1.00 46.96  ? 240 GLN D N   1 
ATOM   9468  C CA  . GLN D 1 245 ? -18.660 -16.778 5.075   1.00 46.86  ? 240 GLN D CA  1 
ATOM   9469  C C   . GLN D 1 245 ? -19.250 -15.426 4.708   1.00 47.33  ? 240 GLN D C   1 
ATOM   9470  O O   . GLN D 1 245 ? -19.384 -14.552 5.555   1.00 48.96  ? 240 GLN D O   1 
ATOM   9471  C CB  . GLN D 1 245 ? -17.335 -16.968 4.327   1.00 46.24  ? 240 GLN D CB  1 
ATOM   9472  C CG  . GLN D 1 245 ? -16.217 -16.026 4.776   1.00 44.76  ? 240 GLN D CG  1 
ATOM   9473  C CD  . GLN D 1 245 ? -15.026 -16.038 3.837   1.00 43.84  ? 240 GLN D CD  1 
ATOM   9474  O OE1 . GLN D 1 245 ? -13.925 -15.630 4.208   1.00 44.72  ? 240 GLN D OE1 1 
ATOM   9475  N NE2 . GLN D 1 245 ? -15.241 -16.499 2.608   1.00 43.14  ? 240 GLN D NE2 1 
ATOM   9476  N N   . ASN D 1 246 ? -19.622 -15.261 3.446   1.00 47.16  ? 241 ASN D N   1 
ATOM   9477  C CA  . ASN D 1 246 ? -20.165 -13.991 2.990   1.00 49.12  ? 241 ASN D CA  1 
ATOM   9478  C C   . ASN D 1 246 ? -21.609 -13.697 3.402   1.00 48.70  ? 241 ASN D C   1 
ATOM   9479  O O   . ASN D 1 246 ? -22.026 -12.542 3.395   1.00 48.80  ? 241 ASN D O   1 
ATOM   9480  C CB  . ASN D 1 246 ? -20.034 -13.888 1.462   1.00 52.06  ? 241 ASN D CB  1 
ATOM   9481  C CG  . ASN D 1 246 ? -18.580 -13.962 0.986   1.00 53.82  ? 241 ASN D CG  1 
ATOM   9482  O OD1 . ASN D 1 246 ? -17.694 -13.296 1.536   1.00 53.89  ? 241 ASN D OD1 1 
ATOM   9483  N ND2 . ASN D 1 246 ? -18.335 -14.764 -0.049  1.00 53.37  ? 241 ASN D ND2 1 
ATOM   9484  N N   . SER D 1 247 ? -22.361 -14.730 3.774   1.00 48.52  ? 242 SER D N   1 
ATOM   9485  C CA  . SER D 1 247 ? -23.767 -14.574 4.166   1.00 47.30  ? 242 SER D CA  1 
ATOM   9486  C C   . SER D 1 247 ? -23.963 -14.154 5.607   1.00 45.91  ? 242 SER D C   1 
ATOM   9487  O O   . SER D 1 247 ? -24.857 -13.368 5.913   1.00 43.95  ? 242 SER D O   1 
ATOM   9488  C CB  . SER D 1 247 ? -24.521 -15.887 3.968   1.00 48.72  ? 242 SER D CB  1 
ATOM   9489  O OG  . SER D 1 247 ? -24.415 -16.340 2.636   1.00 53.02  ? 242 SER D OG  1 
ATOM   9490  N N   . LEU D 1 248 ? -23.129 -14.702 6.484   1.00 44.83  ? 243 LEU D N   1 
ATOM   9491  C CA  . LEU D 1 248 ? -23.211 -14.429 7.915   1.00 44.06  ? 243 LEU D CA  1 
ATOM   9492  C C   . LEU D 1 248 ? -22.306 -13.287 8.446   1.00 43.33  ? 243 LEU D C   1 
ATOM   9493  O O   . LEU D 1 248 ? -22.624 -12.653 9.454   1.00 43.71  ? 243 LEU D O   1 
ATOM   9494  C CB  . LEU D 1 248 ? -22.961 -15.742 8.670   1.00 44.76  ? 243 LEU D CB  1 
ATOM   9495  C CG  . LEU D 1 248 ? -23.871 -16.894 8.203   1.00 42.48  ? 243 LEU D CG  1 
ATOM   9496  C CD1 . LEU D 1 248 ? -23.560 -18.147 8.997   1.00 41.75  ? 243 LEU D CD1 1 
ATOM   9497  C CD2 . LEU D 1 248 ? -25.335 -16.510 8.379   1.00 42.05  ? 243 LEU D CD2 1 
ATOM   9498  N N   . GLY D 1 249 ? -21.190 -13.027 7.776   1.00 40.74  ? 244 GLY D N   1 
ATOM   9499  C CA  . GLY D 1 249 ? -20.327 -11.935 8.187   1.00 39.22  ? 244 GLY D CA  1 
ATOM   9500  C C   . GLY D 1 249 ? -19.389 -12.126 9.367   1.00 39.47  ? 244 GLY D C   1 
ATOM   9501  O O   . GLY D 1 249 ? -18.967 -11.138 9.971   1.00 39.35  ? 244 GLY D O   1 
ATOM   9502  N N   . ALA D 1 250 ? -19.063 -13.374 9.704   1.00 38.48  ? 245 ALA D N   1 
ATOM   9503  C CA  . ALA D 1 250 ? -18.146 -13.670 10.811  1.00 36.69  ? 245 ALA D CA  1 
ATOM   9504  C C   . ALA D 1 250 ? -16.749 -13.584 10.208  1.00 35.48  ? 245 ALA D C   1 
ATOM   9505  O O   . ALA D 1 250 ? -15.940 -14.501 10.303  1.00 36.12  ? 245 ALA D O   1 
ATOM   9506  C CB  . ALA D 1 250 ? -18.407 -15.076 11.355  1.00 36.60  ? 245 ALA D CB  1 
ATOM   9507  N N   . VAL D 1 251 ? -16.479 -12.442 9.604   1.00 35.16  ? 246 VAL D N   1 
ATOM   9508  C CA  . VAL D 1 251 ? -15.238 -12.195 8.910   1.00 33.04  ? 246 VAL D CA  1 
ATOM   9509  C C   . VAL D 1 251 ? -14.221 -11.273 9.601   1.00 34.31  ? 246 VAL D C   1 
ATOM   9510  O O   . VAL D 1 251 ? -14.582 -10.457 10.442  1.00 34.54  ? 246 VAL D O   1 
ATOM   9511  C CB  . VAL D 1 251 ? -15.620 -11.663 7.522   1.00 32.37  ? 246 VAL D CB  1 
ATOM   9512  C CG1 . VAL D 1 251 ? -14.514 -10.834 6.923   1.00 32.31  ? 246 VAL D CG1 1 
ATOM   9513  C CG2 . VAL D 1 251 ? -15.977 -12.854 6.627   1.00 33.02  ? 246 VAL D CG2 1 
ATOM   9514  N N   . PRO D 1 252 ? -12.922 -11.419 9.260   1.00 36.38  ? 247 PRO D N   1 
ATOM   9515  C CA  . PRO D 1 252 ? -11.792 -10.641 9.789   1.00 35.77  ? 247 PRO D CA  1 
ATOM   9516  C C   . PRO D 1 252 ? -11.692 -9.279  9.103   1.00 35.97  ? 247 PRO D C   1 
ATOM   9517  O O   . PRO D 1 252 ? -12.144 -9.125  7.970   1.00 37.47  ? 247 PRO D O   1 
ATOM   9518  C CB  . PRO D 1 252 ? -10.576 -11.497 9.434   1.00 35.73  ? 247 PRO D CB  1 
ATOM   9519  C CG  . PRO D 1 252 ? -11.132 -12.857 9.191   1.00 36.59  ? 247 PRO D CG  1 
ATOM   9520  C CD  . PRO D 1 252 ? -12.423 -12.581 8.505   1.00 36.66  ? 247 PRO D CD  1 
ATOM   9521  N N   . SER D 1 253 ? -11.080 -8.301  9.766   1.00 36.35  ? 248 SER D N   1 
ATOM   9522  C CA  . SER D 1 253 ? -10.928 -6.980  9.157   1.00 37.83  ? 248 SER D CA  1 
ATOM   9523  C C   . SER D 1 253 ? -9.661  -6.943  8.303   1.00 37.58  ? 248 SER D C   1 
ATOM   9524  O O   . SER D 1 253 ? -8.741  -7.729  8.507   1.00 35.88  ? 248 SER D O   1 
ATOM   9525  C CB  . SER D 1 253 ? -10.815 -5.899  10.227  1.00 39.25  ? 248 SER D CB  1 
ATOM   9526  O OG  . SER D 1 253 ? -9.454  -5.655  10.555  1.00 41.74  ? 248 SER D OG  1 
ATOM   9527  N N   . PRO D 1 254 ? -9.596  -6.024  7.332   1.00 38.27  ? 249 PRO D N   1 
ATOM   9528  C CA  . PRO D 1 254 ? -8.399  -5.954  6.494   1.00 39.83  ? 249 PRO D CA  1 
ATOM   9529  C C   . PRO D 1 254 ? -7.110  -5.874  7.311   1.00 39.79  ? 249 PRO D C   1 
ATOM   9530  O O   . PRO D 1 254 ? -6.083  -6.411  6.903   1.00 39.88  ? 249 PRO D O   1 
ATOM   9531  C CB  . PRO D 1 254 ? -8.654  -4.712  5.650   1.00 40.33  ? 249 PRO D CB  1 
ATOM   9532  C CG  . PRO D 1 254 ? -10.134 -4.788  5.429   1.00 39.36  ? 249 PRO D CG  1 
ATOM   9533  C CD  . PRO D 1 254 ? -10.642 -5.120  6.820   1.00 40.10  ? 249 PRO D CD  1 
ATOM   9534  N N   . ILE D 1 255 ? -7.167  -5.212  8.462   1.00 40.24  ? 250 ILE D N   1 
ATOM   9535  C CA  . ILE D 1 255 ? -5.994  -5.106  9.323   1.00 40.24  ? 250 ILE D CA  1 
ATOM   9536  C C   . ILE D 1 255 ? -5.568  -6.495  9.824   1.00 39.77  ? 250 ILE D C   1 
ATOM   9537  O O   . ILE D 1 255 ? -4.406  -6.879  9.679   1.00 40.18  ? 250 ILE D O   1 
ATOM   9538  C CB  . ILE D 1 255 ? -6.272  -4.204  10.537  1.00 41.09  ? 250 ILE D CB  1 
ATOM   9539  C CG1 . ILE D 1 255 ? -6.536  -2.768  10.078  1.00 42.44  ? 250 ILE D CG1 1 
ATOM   9540  C CG2 . ILE D 1 255 ? -5.085  -4.235  11.494  1.00 42.51  ? 250 ILE D CG2 1 
ATOM   9541  C CD1 . ILE D 1 255 ? -5.308  -2.040  9.571   1.00 42.84  ? 250 ILE D CD1 1 
ATOM   9542  N N   . ASP D 1 256 ? -6.503  -7.237  10.416  1.00 38.34  ? 251 ASP D N   1 
ATOM   9543  C CA  . ASP D 1 256 ? -6.215  -8.574  10.918  1.00 38.18  ? 251 ASP D CA  1 
ATOM   9544  C C   . ASP D 1 256 ? -5.557  -9.415  9.846   1.00 36.06  ? 251 ASP D C   1 
ATOM   9545  O O   . ASP D 1 256 ? -4.515  -10.020 10.074  1.00 34.46  ? 251 ASP D O   1 
ATOM   9546  C CB  . ASP D 1 256 ? -7.496  -9.286  11.335  1.00 45.68  ? 251 ASP D CB  1 
ATOM   9547  C CG  . ASP D 1 256 ? -8.131  -8.678  12.548  1.00 52.18  ? 251 ASP D CG  1 
ATOM   9548  O OD1 . ASP D 1 256 ? -7.431  -8.604  13.581  1.00 56.68  ? 251 ASP D OD1 1 
ATOM   9549  O OD2 . ASP D 1 256 ? -9.323  -8.285  12.467  1.00 54.66  ? 251 ASP D OD2 1 
ATOM   9550  N N   . CYS D 1 257 ? -6.195  -9.468  8.679   1.00 33.42  ? 252 CYS D N   1 
ATOM   9551  C CA  . CYS D 1 257 ? -5.689  -10.251 7.562   1.00 30.59  ? 252 CYS D CA  1 
ATOM   9552  C C   . CYS D 1 257 ? -4.275  -9.860  7.214   1.00 30.12  ? 252 CYS D C   1 
ATOM   9553  O O   . CYS D 1 257 ? -3.422  -10.719 6.971   1.00 30.16  ? 252 CYS D O   1 
ATOM   9554  C CB  . CYS D 1 257 ? -6.569  -10.069 6.334   1.00 30.23  ? 252 CYS D CB  1 
ATOM   9555  S SG  . CYS D 1 257 ? -8.157  -10.845 6.504   1.00 30.89  ? 252 CYS D SG  1 
ATOM   9556  N N   . TYR D 1 258 ? -4.027  -8.559  7.188   1.00 28.02  ? 253 TYR D N   1 
ATOM   9557  C CA  . TYR D 1 258 ? -2.699  -8.084  6.867   1.00 28.48  ? 253 TYR D CA  1 
ATOM   9558  C C   . TYR D 1 258 ? -1.706  -8.522  7.937   1.00 26.52  ? 253 TYR D C   1 
ATOM   9559  O O   . TYR D 1 258 ? -0.663  -9.080  7.631   1.00 26.23  ? 253 TYR D O   1 
ATOM   9560  C CB  . TYR D 1 258 ? -2.677  -6.564  6.747   1.00 30.66  ? 253 TYR D CB  1 
ATOM   9561  C CG  . TYR D 1 258 ? -1.290  -6.063  6.485   1.00 33.99  ? 253 TYR D CG  1 
ATOM   9562  C CD1 . TYR D 1 258 ? -0.690  -6.248  5.241   1.00 35.69  ? 253 TYR D CD1 1 
ATOM   9563  C CD2 . TYR D 1 258 ? -0.530  -5.503  7.510   1.00 35.75  ? 253 TYR D CD2 1 
ATOM   9564  C CE1 . TYR D 1 258 ? 0.639   -5.896  5.023   1.00 38.43  ? 253 TYR D CE1 1 
ATOM   9565  C CE2 . TYR D 1 258 ? 0.798   -5.148  7.306   1.00 38.82  ? 253 TYR D CE2 1 
ATOM   9566  C CZ  . TYR D 1 258 ? 1.380   -5.351  6.062   1.00 40.07  ? 253 TYR D CZ  1 
ATOM   9567  O OH  . TYR D 1 258 ? 2.712   -5.037  5.876   1.00 43.47  ? 253 TYR D OH  1 
ATOM   9568  N N   . LEU D 1 259 ? -2.039  -8.264  9.193   1.00 26.76  ? 254 LEU D N   1 
ATOM   9569  C CA  . LEU D 1 259 ? -1.171  -8.633  10.295  1.00 29.20  ? 254 LEU D CA  1 
ATOM   9570  C C   . LEU D 1 259 ? -0.922  -10.128 10.345  1.00 29.89  ? 254 LEU D C   1 
ATOM   9571  O O   . LEU D 1 259 ? 0.217   -10.566 10.523  1.00 31.16  ? 254 LEU D O   1 
ATOM   9572  C CB  . LEU D 1 259 ? -1.774  -8.154  11.613  1.00 29.41  ? 254 LEU D CB  1 
ATOM   9573  C CG  . LEU D 1 259 ? -1.242  -6.819  12.159  1.00 32.84  ? 254 LEU D CG  1 
ATOM   9574  C CD1 . LEU D 1 259 ? -0.841  -5.878  11.030  1.00 32.61  ? 254 LEU D CD1 1 
ATOM   9575  C CD2 . LEU D 1 259 ? -2.305  -6.183  13.043  1.00 32.84  ? 254 LEU D CD2 1 
ATOM   9576  N N   . CYS D 1 260 ? -1.986  -10.908 10.185  1.00 29.59  ? 255 CYS D N   1 
ATOM   9577  C CA  . CYS D 1 260 ? -1.888  -12.361 10.206  1.00 31.84  ? 255 CYS D CA  1 
ATOM   9578  C C   . CYS D 1 260 ? -0.928  -12.843 9.110   1.00 33.66  ? 255 CYS D C   1 
ATOM   9579  O O   . CYS D 1 260 ? -0.009  -13.640 9.357   1.00 33.33  ? 255 CYS D O   1 
ATOM   9580  C CB  . CYS D 1 260 ? -3.274  -12.959 9.990   1.00 33.47  ? 255 CYS D CB  1 
ATOM   9581  S SG  . CYS D 1 260 ? -3.345  -14.758 10.033  1.00 33.79  ? 255 CYS D SG  1 
ATOM   9582  N N   . ASN D 1 261 ? -1.150  -12.348 7.898   1.00 33.82  ? 256 ASN D N   1 
ATOM   9583  C CA  . ASN D 1 261 ? -0.322  -12.700 6.754   1.00 35.82  ? 256 ASN D CA  1 
ATOM   9584  C C   . ASN D 1 261 ? 1.132   -12.299 7.038   1.00 36.22  ? 256 ASN D C   1 
ATOM   9585  O O   . ASN D 1 261 ? 2.072   -13.043 6.743   1.00 35.14  ? 256 ASN D O   1 
ATOM   9586  C CB  . ASN D 1 261 ? -0.858  -11.979 5.510   1.00 33.79  ? 256 ASN D CB  1 
ATOM   9587  C CG  . ASN D 1 261 ? -0.372  -12.594 4.209   1.00 33.35  ? 256 ASN D CG  1 
ATOM   9588  O OD1 . ASN D 1 261 ? -0.996  -12.418 3.159   1.00 34.95  ? 256 ASN D OD1 1 
ATOM   9589  N ND2 . ASN D 1 261 ? 0.746   -13.302 4.264   1.00 33.33  ? 256 ASN D ND2 1 
ATOM   9590  N N   . ARG D 1 262 ? 1.304   -11.120 7.623   1.00 38.10  ? 257 ARG D N   1 
ATOM   9591  C CA  . ARG D 1 262 ? 2.625   -10.603 7.954   1.00 40.01  ? 257 ARG D CA  1 
ATOM   9592  C C   . ARG D 1 262 ? 3.379   -11.572 8.859   1.00 39.01  ? 257 ARG D C   1 
ATOM   9593  O O   . ARG D 1 262 ? 4.567   -11.826 8.659   1.00 38.34  ? 257 ARG D O   1 
ATOM   9594  C CB  . ARG D 1 262 ? 2.488   -9.248  8.654   1.00 44.95  ? 257 ARG D CB  1 
ATOM   9595  C CG  . ARG D 1 262 ? 3.805   -8.631  9.110   1.00 51.64  ? 257 ARG D CG  1 
ATOM   9596  C CD  . ARG D 1 262 ? 4.515   -7.877  7.990   1.00 59.41  ? 257 ARG D CD  1 
ATOM   9597  N NE  . ARG D 1 262 ? 5.937   -7.670  8.277   1.00 63.71  ? 257 ARG D NE  1 
ATOM   9598  C CZ  . ARG D 1 262 ? 6.413   -7.072  9.365   1.00 65.32  ? 257 ARG D CZ  1 
ATOM   9599  N NH1 . ARG D 1 262 ? 5.592   -6.607  10.297  1.00 67.47  ? 257 ARG D NH1 1 
ATOM   9600  N NH2 . ARG D 1 262 ? 7.719   -6.946  9.526   1.00 66.42  ? 257 ARG D NH2 1 
ATOM   9601  N N   . GLY D 1 263 ? 2.679   -12.108 9.854   1.00 38.40  ? 258 GLY D N   1 
ATOM   9602  C CA  . GLY D 1 263 ? 3.293   -13.030 10.795  1.00 36.79  ? 258 GLY D CA  1 
ATOM   9603  C C   . GLY D 1 263 ? 3.636   -14.408 10.257  1.00 37.42  ? 258 GLY D C   1 
ATOM   9604  O O   . GLY D 1 263 ? 4.575   -15.045 10.733  1.00 38.10  ? 258 GLY D O   1 
ATOM   9605  N N   . LEU D 1 264 ? 2.871   -14.877 9.277   1.00 37.12  ? 259 LEU D N   1 
ATOM   9606  C CA  . LEU D 1 264 ? 3.095   -16.185 8.669   1.00 35.24  ? 259 LEU D CA  1 
ATOM   9607  C C   . LEU D 1 264 ? 4.504   -16.305 8.067   1.00 35.63  ? 259 LEU D C   1 
ATOM   9608  O O   . LEU D 1 264 ? 5.127   -17.364 8.138   1.00 35.48  ? 259 LEU D O   1 
ATOM   9609  C CB  . LEU D 1 264 ? 2.049   -16.420 7.576   1.00 35.50  ? 259 LEU D CB  1 
ATOM   9610  C CG  . LEU D 1 264 ? 0.856   -17.359 7.792   1.00 37.06  ? 259 LEU D CG  1 
ATOM   9611  C CD1 . LEU D 1 264 ? 0.275   -17.243 9.196   1.00 34.47  ? 259 LEU D CD1 1 
ATOM   9612  C CD2 . LEU D 1 264 ? -0.191  -17.031 6.722   1.00 36.32  ? 259 LEU D CD2 1 
ATOM   9613  N N   . LYS D 1 265 ? 4.998   -15.214 7.482   1.00 33.99  ? 260 LYS D N   1 
ATOM   9614  C CA  . LYS D 1 265 ? 6.317   -15.197 6.854   1.00 32.91  ? 260 LYS D CA  1 
ATOM   9615  C C   . LYS D 1 265 ? 7.404   -15.852 7.699   1.00 32.19  ? 260 LYS D C   1 
ATOM   9616  O O   . LYS D 1 265 ? 8.316   -16.468 7.164   1.00 30.62  ? 260 LYS D O   1 
ATOM   9617  C CB  . LYS D 1 265 ? 6.756   -13.758 6.550   1.00 34.96  ? 260 LYS D CB  1 
ATOM   9618  C CG  . LYS D 1 265 ? 5.738   -12.895 5.805   1.00 36.52  ? 260 LYS D CG  1 
ATOM   9619  C CD  . LYS D 1 265 ? 5.703   -13.178 4.323   1.00 37.94  ? 260 LYS D CD  1 
ATOM   9620  C CE  . LYS D 1 265 ? 4.793   -12.186 3.607   1.00 37.38  ? 260 LYS D CE  1 
ATOM   9621  N NZ  . LYS D 1 265 ? 5.241   -10.791 3.797   1.00 37.15  ? 260 LYS D NZ  1 
ATOM   9622  N N   . THR D 1 266 ? 7.309   -15.719 9.017   1.00 32.23  ? 261 THR D N   1 
ATOM   9623  C CA  . THR D 1 266 ? 8.321   -16.281 9.912   1.00 29.64  ? 261 THR D CA  1 
ATOM   9624  C C   . THR D 1 266 ? 7.867   -17.498 10.706  1.00 30.65  ? 261 THR D C   1 
ATOM   9625  O O   . THR D 1 266 ? 8.592   -17.967 11.587  1.00 30.77  ? 261 THR D O   1 
ATOM   9626  C CB  . THR D 1 266 ? 8.803   -15.228 10.931  1.00 30.77  ? 261 THR D CB  1 
ATOM   9627  O OG1 . THR D 1 266 ? 7.689   -14.778 11.716  1.00 30.85  ? 261 THR D OG1 1 
ATOM   9628  C CG2 . THR D 1 266 ? 9.434   -14.046 10.217  1.00 29.39  ? 261 THR D CG2 1 
ATOM   9629  N N   . LEU D 1 267 ? 6.681   -18.013 10.398  1.00 29.31  ? 262 LEU D N   1 
ATOM   9630  C CA  . LEU D 1 267 ? 6.156   -19.166 11.116  1.00 28.93  ? 262 LEU D CA  1 
ATOM   9631  C C   . LEU D 1 267 ? 7.136   -20.332 11.171  1.00 31.44  ? 262 LEU D C   1 
ATOM   9632  O O   . LEU D 1 267 ? 7.284   -20.982 12.207  1.00 32.49  ? 262 LEU D O   1 
ATOM   9633  C CB  . LEU D 1 267 ? 4.851   -19.625 10.479  1.00 27.38  ? 262 LEU D CB  1 
ATOM   9634  C CG  . LEU D 1 267 ? 4.148   -20.795 11.167  1.00 26.40  ? 262 LEU D CG  1 
ATOM   9635  C CD1 . LEU D 1 267 ? 3.874   -20.449 12.625  1.00 25.38  ? 262 LEU D CD1 1 
ATOM   9636  C CD2 . LEU D 1 267 ? 2.850   -21.118 10.425  1.00 25.63  ? 262 LEU D CD2 1 
ATOM   9637  N N   . HIS D 1 268 ? 7.811   -20.596 10.057  1.00 34.04  ? 263 HIS D N   1 
ATOM   9638  C CA  . HIS D 1 268 ? 8.760   -21.693 10.004  1.00 36.14  ? 263 HIS D CA  1 
ATOM   9639  C C   . HIS D 1 268 ? 9.937   -21.505 10.951  1.00 36.46  ? 263 HIS D C   1 
ATOM   9640  O O   . HIS D 1 268 ? 10.272  -22.434 11.682  1.00 36.44  ? 263 HIS D O   1 
ATOM   9641  C CB  . HIS D 1 268 ? 9.253   -21.910 8.566   1.00 40.14  ? 263 HIS D CB  1 
ATOM   9642  C CG  . HIS D 1 268 ? 9.926   -20.716 7.956   1.00 45.11  ? 263 HIS D CG  1 
ATOM   9643  N ND1 . HIS D 1 268 ? 11.297  -20.593 7.879   1.00 47.68  ? 263 HIS D ND1 1 
ATOM   9644  C CD2 . HIS D 1 268 ? 9.417   -19.604 7.374   1.00 46.02  ? 263 HIS D CD2 1 
ATOM   9645  C CE1 . HIS D 1 268 ? 11.602  -19.458 7.275   1.00 47.44  ? 263 HIS D CE1 1 
ATOM   9646  N NE2 . HIS D 1 268 ? 10.479  -18.840 6.959   1.00 46.78  ? 263 HIS D NE2 1 
ATOM   9647  N N   . VAL D 1 269 ? 10.557  -20.321 10.959  1.00 35.50  ? 264 VAL D N   1 
ATOM   9648  C CA  . VAL D 1 269 ? 11.696  -20.079 11.852  1.00 35.85  ? 264 VAL D CA  1 
ATOM   9649  C C   . VAL D 1 269 ? 11.285  -19.983 13.315  1.00 36.44  ? 264 VAL D C   1 
ATOM   9650  O O   . VAL D 1 269 ? 12.045  -20.371 14.208  1.00 37.04  ? 264 VAL D O   1 
ATOM   9651  C CB  . VAL D 1 269 ? 12.495  -18.795 11.495  1.00 35.32  ? 264 VAL D CB  1 
ATOM   9652  C CG1 . VAL D 1 269 ? 13.298  -19.017 10.229  1.00 35.99  ? 264 VAL D CG1 1 
ATOM   9653  C CG2 . VAL D 1 269 ? 11.563  -17.613 11.354  1.00 35.17  ? 264 VAL D CG2 1 
ATOM   9654  N N   . ARG D 1 270 ? 10.095  -19.457 13.570  1.00 36.30  ? 265 ARG D N   1 
ATOM   9655  C CA  . ARG D 1 270 ? 9.634   -19.377 14.940  1.00 36.40  ? 265 ARG D CA  1 
ATOM   9656  C C   . ARG D 1 270 ? 9.333   -20.776 15.457  1.00 38.01  ? 265 ARG D C   1 
ATOM   9657  O O   . ARG D 1 270 ? 9.851   -21.168 16.496  1.00 39.52  ? 265 ARG D O   1 
ATOM   9658  C CB  . ARG D 1 270 ? 8.398   -18.492 15.053  1.00 34.99  ? 265 ARG D CB  1 
ATOM   9659  C CG  . ARG D 1 270 ? 8.751   -17.025 15.168  1.00 32.33  ? 265 ARG D CG  1 
ATOM   9660  C CD  . ARG D 1 270 ? 7.539   -16.175 15.441  1.00 30.12  ? 265 ARG D CD  1 
ATOM   9661  N NE  . ARG D 1 270 ? 6.656   -16.133 14.285  1.00 32.68  ? 265 ARG D NE  1 
ATOM   9662  C CZ  . ARG D 1 270 ? 5.473   -16.726 14.230  1.00 30.92  ? 265 ARG D CZ  1 
ATOM   9663  N NH1 . ARG D 1 270 ? 5.030   -17.408 15.273  1.00 32.99  ? 265 ARG D NH1 1 
ATOM   9664  N NH2 . ARG D 1 270 ? 4.733   -16.628 13.137  1.00 31.10  ? 265 ARG D NH2 1 
ATOM   9665  N N   . MET D 1 271 ? 8.526   -21.540 14.725  1.00 38.69  ? 266 MET D N   1 
ATOM   9666  C CA  . MET D 1 271 ? 8.182   -22.891 15.155  1.00 39.36  ? 266 MET D CA  1 
ATOM   9667  C C   . MET D 1 271 ? 9.382   -23.834 15.309  1.00 40.64  ? 266 MET D C   1 
ATOM   9668  O O   . MET D 1 271 ? 9.376   -24.696 16.184  1.00 41.44  ? 266 MET D O   1 
ATOM   9669  C CB  . MET D 1 271 ? 7.144   -23.509 14.211  1.00 40.33  ? 266 MET D CB  1 
ATOM   9670  C CG  . MET D 1 271 ? 5.774   -22.839 14.273  1.00 40.05  ? 266 MET D CG  1 
ATOM   9671  S SD  . MET D 1 271 ? 5.138   -22.687 15.962  1.00 41.95  ? 266 MET D SD  1 
ATOM   9672  C CE  . MET D 1 271 ? 3.847   -23.934 15.997  1.00 43.15  ? 266 MET D CE  1 
ATOM   9673  N N   . GLU D 1 272 ? 10.411  -23.687 14.478  1.00 40.38  ? 267 GLU D N   1 
ATOM   9674  C CA  . GLU D 1 272 ? 11.581  -24.557 14.619  1.00 40.95  ? 267 GLU D CA  1 
ATOM   9675  C C   . GLU D 1 272 ? 12.270  -24.328 15.952  1.00 39.51  ? 267 GLU D C   1 
ATOM   9676  O O   . GLU D 1 272 ? 12.730  -25.274 16.580  1.00 40.74  ? 267 GLU D O   1 
ATOM   9677  C CB  . GLU D 1 272 ? 12.604  -24.345 13.491  1.00 43.41  ? 267 GLU D CB  1 
ATOM   9678  C CG  . GLU D 1 272 ? 12.337  -25.187 12.245  1.00 48.67  ? 267 GLU D CG  1 
ATOM   9679  C CD  . GLU D 1 272 ? 12.337  -26.694 12.519  1.00 51.93  ? 267 GLU D CD  1 
ATOM   9680  O OE1 . GLU D 1 272 ? 11.972  -27.468 11.604  1.00 52.92  ? 267 GLU D OE1 1 
ATOM   9681  O OE2 . GLU D 1 272 ? 12.704  -27.110 13.641  1.00 53.17  ? 267 GLU D OE2 1 
ATOM   9682  N N   . LYS D 1 273 ? 12.349  -23.075 16.384  1.00 38.16  ? 268 LYS D N   1 
ATOM   9683  C CA  . LYS D 1 273 ? 12.989  -22.771 17.654  1.00 37.61  ? 268 LYS D CA  1 
ATOM   9684  C C   . LYS D 1 273 ? 12.133  -23.223 18.835  1.00 37.47  ? 268 LYS D C   1 
ATOM   9685  O O   . LYS D 1 273 ? 12.659  -23.595 19.890  1.00 37.41  ? 268 LYS D O   1 
ATOM   9686  C CB  . LYS D 1 273 ? 13.268  -21.278 17.766  1.00 38.15  ? 268 LYS D CB  1 
ATOM   9687  C CG  . LYS D 1 273 ? 13.924  -20.882 19.077  1.00 40.15  ? 268 LYS D CG  1 
ATOM   9688  C CD  . LYS D 1 273 ? 15.294  -21.525 19.265  1.00 39.05  ? 268 LYS D CD  1 
ATOM   9689  C CE  . LYS D 1 273 ? 15.952  -20.954 20.513  1.00 40.19  ? 268 LYS D CE  1 
ATOM   9690  N NZ  . LYS D 1 273 ? 17.365  -21.363 20.657  1.00 41.84  ? 268 LYS D NZ  1 
ATOM   9691  N N   . HIS D 1 274 ? 10.816  -23.184 18.664  1.00 35.73  ? 269 HIS D N   1 
ATOM   9692  C CA  . HIS D 1 274 ? 9.924   -23.608 19.729  1.00 35.55  ? 269 HIS D CA  1 
ATOM   9693  C C   . HIS D 1 274 ? 10.195  -25.081 19.939  1.00 38.09  ? 269 HIS D C   1 
ATOM   9694  O O   . HIS D 1 274 ? 10.150  -25.585 21.066  1.00 39.93  ? 269 HIS D O   1 
ATOM   9695  C CB  . HIS D 1 274 ? 8.461   -23.427 19.329  1.00 32.98  ? 269 HIS D CB  1 
ATOM   9696  C CG  . HIS D 1 274 ? 7.914   -22.051 19.567  1.00 31.32  ? 269 HIS D CG  1 
ATOM   9697  N ND1 . HIS D 1 274 ? 7.868   -21.471 20.816  1.00 28.43  ? 269 HIS D ND1 1 
ATOM   9698  C CD2 . HIS D 1 274 ? 7.301   -21.180 18.728  1.00 32.10  ? 269 HIS D CD2 1 
ATOM   9699  C CE1 . HIS D 1 274 ? 7.246   -20.308 20.738  1.00 30.12  ? 269 HIS D CE1 1 
ATOM   9700  N NE2 . HIS D 1 274 ? 6.890   -20.107 19.481  1.00 30.80  ? 269 HIS D NE2 1 
ATOM   9701  N N   . PHE D 1 275 ? 10.484  -25.761 18.833  1.00 40.10  ? 270 PHE D N   1 
ATOM   9702  C CA  . PHE D 1 275 ? 10.757  -27.195 18.825  1.00 41.61  ? 270 PHE D CA  1 
ATOM   9703  C C   . PHE D 1 275 ? 12.127  -27.566 19.413  1.00 42.45  ? 270 PHE D C   1 
ATOM   9704  O O   . PHE D 1 275 ? 12.230  -28.518 20.191  1.00 41.62  ? 270 PHE D O   1 
ATOM   9705  C CB  . PHE D 1 275 ? 10.606  -27.719 17.389  1.00 43.20  ? 270 PHE D CB  1 
ATOM   9706  C CG  . PHE D 1 275 ? 10.794  -29.202 17.247  1.00 44.02  ? 270 PHE D CG  1 
ATOM   9707  C CD1 . PHE D 1 275 ? 10.442  -30.068 18.277  1.00 45.17  ? 270 PHE D CD1 1 
ATOM   9708  C CD2 . PHE D 1 275 ? 11.297  -29.734 16.065  1.00 43.49  ? 270 PHE D CD2 1 
ATOM   9709  C CE1 . PHE D 1 275 ? 10.590  -31.443 18.131  1.00 46.28  ? 270 PHE D CE1 1 
ATOM   9710  C CE2 . PHE D 1 275 ? 11.446  -31.101 15.906  1.00 43.61  ? 270 PHE D CE2 1 
ATOM   9711  C CZ  . PHE D 1 275 ? 11.092  -31.960 16.941  1.00 45.91  ? 270 PHE D CZ  1 
ATOM   9712  N N   . LYS D 1 276 ? 13.174  -26.827 19.050  1.00 43.83  ? 271 LYS D N   1 
ATOM   9713  C CA  . LYS D 1 276 ? 14.505  -27.105 19.593  1.00 46.37  ? 271 LYS D CA  1 
ATOM   9714  C C   . LYS D 1 276 ? 14.482  -26.879 21.098  1.00 44.65  ? 271 LYS D C   1 
ATOM   9715  O O   . LYS D 1 276 ? 15.044  -27.665 21.863  1.00 45.06  ? 271 LYS D O   1 
ATOM   9716  C CB  . LYS D 1 276 ? 15.567  -26.186 18.985  1.00 50.34  ? 271 LYS D CB  1 
ATOM   9717  C CG  . LYS D 1 276 ? 16.089  -26.608 17.630  1.00 56.95  ? 271 LYS D CG  1 
ATOM   9718  C CD  . LYS D 1 276 ? 17.255  -25.714 17.179  1.00 63.73  ? 271 LYS D CD  1 
ATOM   9719  C CE  . LYS D 1 276 ? 18.488  -25.811 18.103  1.00 66.02  ? 271 LYS D CE  1 
ATOM   9720  N NZ  . LYS D 1 276 ? 18.327  -25.127 19.423  1.00 67.33  ? 271 LYS D NZ  1 
ATOM   9721  N N   . ASN D 1 277 ? 13.840  -25.788 21.508  1.00 42.77  ? 272 ASN D N   1 
ATOM   9722  C CA  . ASN D 1 277 ? 13.729  -25.447 22.917  1.00 41.12  ? 272 ASN D CA  1 
ATOM   9723  C C   . ASN D 1 277 ? 12.796  -26.434 23.609  1.00 40.28  ? 272 ASN D C   1 
ATOM   9724  O O   . ASN D 1 277 ? 13.042  -26.838 24.738  1.00 39.94  ? 272 ASN D O   1 
ATOM   9725  C CB  . ASN D 1 277 ? 13.213  -24.009 23.079  1.00 39.08  ? 272 ASN D CB  1 
ATOM   9726  C CG  . ASN D 1 277 ? 14.315  -22.958 22.910  1.00 37.73  ? 272 ASN D CG  1 
ATOM   9727  O OD1 . ASN D 1 277 ? 15.469  -23.285 22.616  1.00 36.04  ? 272 ASN D OD1 1 
ATOM   9728  N ND2 . ASN D 1 277 ? 13.957  -21.691 23.101  1.00 35.27  ? 272 ASN D ND2 1 
ATOM   9729  N N   . GLY D 1 278 ? 11.729  -26.832 22.925  1.00 41.91  ? 273 GLY D N   1 
ATOM   9730  C CA  . GLY D 1 278 ? 10.799  -27.789 23.511  1.00 43.55  ? 273 GLY D CA  1 
ATOM   9731  C C   . GLY D 1 278 ? 11.483  -29.122 23.788  1.00 44.07  ? 273 GLY D C   1 
ATOM   9732  O O   . GLY D 1 278 ? 11.437  -29.653 24.903  1.00 42.59  ? 273 GLY D O   1 
ATOM   9733  N N   . MET D 1 279 ? 12.116  -29.660 22.750  1.00 44.39  ? 274 MET D N   1 
ATOM   9734  C CA  . MET D 1 279 ? 12.847  -30.913 22.836  1.00 44.55  ? 274 MET D CA  1 
ATOM   9735  C C   . MET D 1 279 ? 13.834  -30.852 24.019  1.00 44.06  ? 274 MET D C   1 
ATOM   9736  O O   . MET D 1 279 ? 13.808  -31.715 24.900  1.00 44.48  ? 274 MET D O   1 
ATOM   9737  C CB  . MET D 1 279 ? 13.610  -31.135 21.529  1.00 46.71  ? 274 MET D CB  1 
ATOM   9738  C CG  . MET D 1 279 ? 14.041  -32.562 21.271  1.00 48.26  ? 274 MET D CG  1 
ATOM   9739  S SD  . MET D 1 279 ? 12.631  -33.599 20.919  1.00 52.53  ? 274 MET D SD  1 
ATOM   9740  C CE  . MET D 1 279 ? 12.813  -34.882 22.168  1.00 51.14  ? 274 MET D CE  1 
ATOM   9741  N N   . ALA D 1 280 ? 14.691  -29.828 24.036  1.00 41.37  ? 275 ALA D N   1 
ATOM   9742  C CA  . ALA D 1 280 ? 15.676  -29.643 25.101  1.00 39.79  ? 275 ALA D CA  1 
ATOM   9743  C C   . ALA D 1 280 ? 15.040  -29.664 26.490  1.00 41.26  ? 275 ALA D C   1 
ATOM   9744  O O   . ALA D 1 280 ? 15.484  -30.392 27.379  1.00 41.85  ? 275 ALA D O   1 
ATOM   9745  C CB  . ALA D 1 280 ? 16.411  -28.340 24.903  1.00 36.12  ? 275 ALA D CB  1 
ATOM   9746  N N   . VAL D 1 281 ? 14.010  -28.848 26.676  1.00 42.18  ? 276 VAL D N   1 
ATOM   9747  C CA  . VAL D 1 281 ? 13.312  -28.781 27.946  1.00 41.99  ? 276 VAL D CA  1 
ATOM   9748  C C   . VAL D 1 281 ? 12.743  -30.149 28.286  1.00 44.27  ? 276 VAL D C   1 
ATOM   9749  O O   . VAL D 1 281 ? 12.886  -30.615 29.408  1.00 45.89  ? 276 VAL D O   1 
ATOM   9750  C CB  . VAL D 1 281 ? 12.134  -27.767 27.901  1.00 42.47  ? 276 VAL D CB  1 
ATOM   9751  C CG1 . VAL D 1 281 ? 11.222  -27.964 29.105  1.00 42.51  ? 276 VAL D CG1 1 
ATOM   9752  C CG2 . VAL D 1 281 ? 12.658  -26.346 27.890  1.00 39.76  ? 276 VAL D CG2 1 
ATOM   9753  N N   . ALA D 1 282 ? 12.096  -30.794 27.319  1.00 45.28  ? 277 ALA D N   1 
ATOM   9754  C CA  . ALA D 1 282 ? 11.492  -32.101 27.561  1.00 47.12  ? 277 ALA D CA  1 
ATOM   9755  C C   . ALA D 1 282 ? 12.498  -33.152 28.021  1.00 49.64  ? 277 ALA D C   1 
ATOM   9756  O O   . ALA D 1 282 ? 12.183  -33.989 28.870  1.00 50.67  ? 277 ALA D O   1 
ATOM   9757  C CB  . ALA D 1 282 ? 10.767  -32.582 26.314  1.00 46.13  ? 277 ALA D CB  1 
ATOM   9758  N N   . GLN D 1 283 ? 13.705  -33.109 27.460  1.00 51.94  ? 278 GLN D N   1 
ATOM   9759  C CA  . GLN D 1 283 ? 14.756  -34.060 27.819  1.00 54.31  ? 278 GLN D CA  1 
ATOM   9760  C C   . GLN D 1 283 ? 15.264  -33.797 29.223  1.00 52.26  ? 278 GLN D C   1 
ATOM   9761  O O   . GLN D 1 283 ? 15.251  -34.682 30.073  1.00 52.80  ? 278 GLN D O   1 
ATOM   9762  C CB  . GLN D 1 283 ? 15.915  -33.965 26.835  1.00 58.55  ? 278 GLN D CB  1 
ATOM   9763  C CG  . GLN D 1 283 ? 15.775  -34.857 25.623  1.00 66.05  ? 278 GLN D CG  1 
ATOM   9764  C CD  . GLN D 1 283 ? 16.690  -34.421 24.501  1.00 71.16  ? 278 GLN D CD  1 
ATOM   9765  O OE1 . GLN D 1 283 ? 17.816  -33.979 24.740  1.00 73.99  ? 278 GLN D OE1 1 
ATOM   9766  N NE2 . GLN D 1 283 ? 16.214  -34.544 23.268  1.00 73.85  ? 278 GLN D NE2 1 
ATOM   9767  N N   . PHE D 1 284 ? 15.727  -32.576 29.447  1.00 50.08  ? 279 PHE D N   1 
ATOM   9768  C CA  . PHE D 1 284 ? 16.223  -32.163 30.748  1.00 49.39  ? 279 PHE D CA  1 
ATOM   9769  C C   . PHE D 1 284 ? 15.278  -32.636 31.863  1.00 49.53  ? 279 PHE D C   1 
ATOM   9770  O O   . PHE D 1 284 ? 15.708  -33.215 32.863  1.00 47.66  ? 279 PHE D O   1 
ATOM   9771  C CB  . PHE D 1 284 ? 16.325  -30.637 30.785  1.00 49.49  ? 279 PHE D CB  1 
ATOM   9772  C CG  . PHE D 1 284 ? 16.671  -30.087 32.134  1.00 49.58  ? 279 PHE D CG  1 
ATOM   9773  C CD1 . PHE D 1 284 ? 18.000  -29.946 32.520  1.00 49.33  ? 279 PHE D CD1 1 
ATOM   9774  C CD2 . PHE D 1 284 ? 15.665  -29.725 33.029  1.00 49.06  ? 279 PHE D CD2 1 
ATOM   9775  C CE1 . PHE D 1 284 ? 18.327  -29.451 33.778  1.00 49.84  ? 279 PHE D CE1 1 
ATOM   9776  C CE2 . PHE D 1 284 ? 15.980  -29.229 34.291  1.00 49.91  ? 279 PHE D CE2 1 
ATOM   9777  C CZ  . PHE D 1 284 ? 17.313  -29.092 34.667  1.00 50.05  ? 279 PHE D CZ  1 
ATOM   9778  N N   . LEU D 1 285 ? 13.988  -32.379 31.677  1.00 49.47  ? 280 LEU D N   1 
ATOM   9779  C CA  . LEU D 1 285 ? 12.975  -32.749 32.657  1.00 50.60  ? 280 LEU D CA  1 
ATOM   9780  C C   . LEU D 1 285 ? 12.908  -34.242 32.922  1.00 52.17  ? 280 LEU D C   1 
ATOM   9781  O O   . LEU D 1 285 ? 13.021  -34.682 34.067  1.00 51.97  ? 280 LEU D O   1 
ATOM   9782  C CB  . LEU D 1 285 ? 11.598  -32.251 32.207  1.00 49.33  ? 280 LEU D CB  1 
ATOM   9783  C CG  . LEU D 1 285 ? 11.401  -30.737 32.273  1.00 48.45  ? 280 LEU D CG  1 
ATOM   9784  C CD1 . LEU D 1 285 ? 10.037  -30.397 31.711  1.00 49.12  ? 280 LEU D CD1 1 
ATOM   9785  C CD2 . LEU D 1 285 ? 11.538  -30.245 33.711  1.00 46.32  ? 280 LEU D CD2 1 
ATOM   9786  N N   . GLU D 1 286 ? 12.717  -35.015 31.861  1.00 54.26  ? 281 GLU D N   1 
ATOM   9787  C CA  . GLU D 1 286 ? 12.624  -36.467 31.972  1.00 56.47  ? 281 GLU D CA  1 
ATOM   9788  C C   . GLU D 1 286 ? 13.874  -37.096 32.579  1.00 57.74  ? 281 GLU D C   1 
ATOM   9789  O O   . GLU D 1 286 ? 13.827  -38.214 33.091  1.00 57.33  ? 281 GLU D O   1 
ATOM   9790  C CB  . GLU D 1 286 ? 12.349  -37.066 30.595  1.00 57.24  ? 281 GLU D CB  1 
ATOM   9791  C CG  . GLU D 1 286 ? 12.297  -38.568 30.564  1.00 57.42  ? 281 GLU D CG  1 
ATOM   9792  C CD  . GLU D 1 286 ? 11.578  -39.076 29.333  1.00 59.34  ? 281 GLU D CD  1 
ATOM   9793  O OE1 . GLU D 1 286 ? 10.328  -38.969 29.301  1.00 58.15  ? 281 GLU D OE1 1 
ATOM   9794  O OE2 . GLU D 1 286 ? 12.261  -39.565 28.400  1.00 59.53  ? 281 GLU D OE2 1 
ATOM   9795  N N   . SER D 1 287 ? 14.987  -36.371 32.527  1.00 58.63  ? 282 SER D N   1 
ATOM   9796  C CA  . SER D 1 287 ? 16.242  -36.859 33.081  1.00 60.57  ? 282 SER D CA  1 
ATOM   9797  C C   . SER D 1 287 ? 16.490  -36.261 34.464  1.00 63.12  ? 282 SER D C   1 
ATOM   9798  O O   . SER D 1 287 ? 17.522  -36.522 35.081  1.00 62.60  ? 282 SER D O   1 
ATOM   9799  C CB  . SER D 1 287 ? 17.408  -36.499 32.155  1.00 60.96  ? 282 SER D CB  1 
ATOM   9800  O OG  . SER D 1 287 ? 17.240  -37.054 30.860  1.00 61.70  ? 282 SER D OG  1 
ATOM   9801  N N   . ASN D 1 288 ? 15.542  -35.463 34.950  1.00 64.65  ? 283 ASN D N   1 
ATOM   9802  C CA  . ASN D 1 288 ? 15.678  -34.823 36.255  1.00 66.67  ? 283 ASN D CA  1 
ATOM   9803  C C   . ASN D 1 288 ? 15.085  -35.678 37.388  1.00 69.36  ? 283 ASN D C   1 
ATOM   9804  O O   . ASN D 1 288 ? 13.951  -36.165 37.299  1.00 69.39  ? 283 ASN D O   1 
ATOM   9805  C CB  . ASN D 1 288 ? 15.022  -33.437 36.216  1.00 66.91  ? 283 ASN D CB  1 
ATOM   9806  C CG  . ASN D 1 288 ? 15.312  -32.612 37.461  1.00 67.93  ? 283 ASN D CG  1 
ATOM   9807  O OD1 . ASN D 1 288 ? 14.705  -32.821 38.513  1.00 68.61  ? 283 ASN D OD1 1 
ATOM   9808  N ND2 . ASN D 1 288 ? 16.251  -31.674 37.349  1.00 67.05  ? 283 ASN D ND2 1 
ATOM   9809  N N   . PRO D 1 289 ? 15.857  -35.873 38.472  1.00 69.44  ? 284 PRO D N   1 
ATOM   9810  C CA  . PRO D 1 289 ? 15.471  -36.660 39.649  1.00 69.33  ? 284 PRO D CA  1 
ATOM   9811  C C   . PRO D 1 289 ? 14.166  -36.238 40.324  1.00 69.73  ? 284 PRO D C   1 
ATOM   9812  O O   . PRO D 1 289 ? 13.524  -37.040 41.007  1.00 69.94  ? 284 PRO D O   1 
ATOM   9813  C CB  . PRO D 1 289 ? 16.667  -36.485 40.582  1.00 69.70  ? 284 PRO D CB  1 
ATOM   9814  C CG  . PRO D 1 289 ? 17.808  -36.328 39.636  1.00 70.01  ? 284 PRO D CG  1 
ATOM   9815  C CD  . PRO D 1 289 ? 17.234  -35.370 38.623  1.00 69.96  ? 284 PRO D CD  1 
ATOM   9816  N N   . TRP D 1 290 ? 13.777  -34.982 40.129  1.00 68.54  ? 285 TRP D N   1 
ATOM   9817  C CA  . TRP D 1 290 ? 12.566  -34.447 40.746  1.00 66.13  ? 285 TRP D CA  1 
ATOM   9818  C C   . TRP D 1 290 ? 11.324  -34.463 39.848  1.00 64.46  ? 285 TRP D C   1 
ATOM   9819  O O   . TRP D 1 290 ? 10.292  -33.880 40.194  1.00 63.75  ? 285 TRP D O   1 
ATOM   9820  C CB  . TRP D 1 290 ? 12.844  -33.022 41.223  1.00 68.01  ? 285 TRP D CB  1 
ATOM   9821  C CG  . TRP D 1 290 ? 14.003  -32.932 42.172  1.00 70.20  ? 285 TRP D CG  1 
ATOM   9822  C CD1 . TRP D 1 290 ? 15.052  -32.059 42.108  1.00 70.78  ? 285 TRP D CD1 1 
ATOM   9823  C CD2 . TRP D 1 290 ? 14.215  -33.727 43.345  1.00 71.81  ? 285 TRP D CD2 1 
ATOM   9824  N NE1 . TRP D 1 290 ? 15.903  -32.258 43.170  1.00 71.27  ? 285 TRP D NE1 1 
ATOM   9825  C CE2 . TRP D 1 290 ? 15.412  -33.275 43.945  1.00 72.48  ? 285 TRP D CE2 1 
ATOM   9826  C CE3 . TRP D 1 290 ? 13.506  -34.775 43.951  1.00 72.51  ? 285 TRP D CE3 1 
ATOM   9827  C CZ2 . TRP D 1 290 ? 15.920  -33.841 45.120  1.00 73.69  ? 285 TRP D CZ2 1 
ATOM   9828  C CZ3 . TRP D 1 290 ? 14.012  -35.338 45.119  1.00 73.09  ? 285 TRP D CZ3 1 
ATOM   9829  C CH2 . TRP D 1 290 ? 15.207  -34.868 45.691  1.00 74.13  ? 285 TRP D CH2 1 
ATOM   9830  N N   . VAL D 1 291 ? 11.421  -35.139 38.705  1.00 61.73  ? 286 VAL D N   1 
ATOM   9831  C CA  . VAL D 1 291 ? 10.299  -35.219 37.771  1.00 58.44  ? 286 VAL D CA  1 
ATOM   9832  C C   . VAL D 1 291 ? 9.797   -36.654 37.604  1.00 60.85  ? 286 VAL D C   1 
ATOM   9833  O O   . VAL D 1 291 ? 10.512  -37.518 37.090  1.00 59.86  ? 286 VAL D O   1 
ATOM   9834  C CB  . VAL D 1 291 ? 10.694  -34.661 36.373  1.00 54.63  ? 286 VAL D CB  1 
ATOM   9835  C CG1 . VAL D 1 291 ? 9.480   -34.650 35.448  1.00 50.17  ? 286 VAL D CG1 1 
ATOM   9836  C CG2 . VAL D 1 291 ? 11.270  -33.262 36.514  1.00 49.93  ? 286 VAL D CG2 1 
ATOM   9837  N N   . GLU D 1 292 ? 8.564   -36.900 38.036  1.00 63.79  ? 287 GLU D N   1 
ATOM   9838  C CA  . GLU D 1 292 ? 7.971   -38.230 37.924  1.00 67.65  ? 287 GLU D CA  1 
ATOM   9839  C C   . GLU D 1 292 ? 7.844   -38.701 36.488  1.00 66.07  ? 287 GLU D C   1 
ATOM   9840  O O   . GLU D 1 292 ? 8.274   -39.804 36.153  1.00 67.02  ? 287 GLU D O   1 
ATOM   9841  C CB  . GLU D 1 292 ? 6.594   -38.276 38.591  1.00 73.52  ? 287 GLU D CB  1 
ATOM   9842  C CG  . GLU D 1 292 ? 6.630   -38.877 39.983  1.00 84.18  ? 287 GLU D CG  1 
ATOM   9843  C CD  . GLU D 1 292 ? 7.186   -40.292 39.986  1.00 89.59  ? 287 GLU D CD  1 
ATOM   9844  O OE1 . GLU D 1 292 ? 7.527   -40.791 41.080  1.00 93.14  ? 287 GLU D OE1 1 
ATOM   9845  O OE2 . GLU D 1 292 ? 7.276   -40.904 38.897  1.00 92.34  ? 287 GLU D OE2 1 
ATOM   9846  N N   . LYS D 1 293 ? 7.249   -37.869 35.640  1.00 63.30  ? 288 LYS D N   1 
ATOM   9847  C CA  . LYS D 1 293 ? 7.080   -38.232 34.241  1.00 59.48  ? 288 LYS D CA  1 
ATOM   9848  C C   . LYS D 1 293 ? 7.000   -37.026 33.321  1.00 56.64  ? 288 LYS D C   1 
ATOM   9849  O O   . LYS D 1 293 ? 6.668   -35.921 33.749  1.00 56.70  ? 288 LYS D O   1 
ATOM   9850  C CB  . LYS D 1 293 ? 5.821   -39.089 34.062  1.00 59.94  ? 288 LYS D CB  1 
ATOM   9851  C CG  . LYS D 1 293 ? 5.630   -39.598 32.649  1.00 58.75  ? 288 LYS D CG  1 
ATOM   9852  C CD  . LYS D 1 293 ? 4.619   -40.725 32.575  1.00 59.34  ? 288 LYS D CD  1 
ATOM   9853  C CE  . LYS D 1 293 ? 3.230   -40.272 32.969  1.00 60.34  ? 288 LYS D CE  1 
ATOM   9854  N NZ  . LYS D 1 293 ? 2.208   -41.305 32.618  1.00 61.93  ? 288 LYS D NZ  1 
ATOM   9855  N N   . VAL D 1 294 ? 7.332   -37.249 32.055  1.00 51.78  ? 289 VAL D N   1 
ATOM   9856  C CA  . VAL D 1 294 ? 7.263   -36.202 31.055  1.00 46.51  ? 289 VAL D CA  1 
ATOM   9857  C C   . VAL D 1 294 ? 6.408   -36.711 29.904  1.00 48.33  ? 289 VAL D C   1 
ATOM   9858  O O   . VAL D 1 294 ? 6.382   -37.907 29.603  1.00 48.11  ? 289 VAL D O   1 
ATOM   9859  C CB  . VAL D 1 294 ? 8.652   -35.808 30.506  1.00 44.25  ? 289 VAL D CB  1 
ATOM   9860  C CG1 . VAL D 1 294 ? 8.488   -34.883 29.309  1.00 41.30  ? 289 VAL D CG1 1 
ATOM   9861  C CG2 . VAL D 1 294 ? 9.457   -35.099 31.577  1.00 40.91  ? 289 VAL D CG2 1 
ATOM   9862  N N   . ILE D 1 295 ? 5.687   -35.794 29.280  1.00 47.35  ? 290 ILE D N   1 
ATOM   9863  C CA  . ILE D 1 295 ? 4.841   -36.135 28.158  1.00 45.97  ? 290 ILE D CA  1 
ATOM   9864  C C   . ILE D 1 295 ? 5.124   -35.082 27.100  1.00 47.74  ? 290 ILE D C   1 
ATOM   9865  O O   . ILE D 1 295 ? 4.719   -33.927 27.226  1.00 49.33  ? 290 ILE D O   1 
ATOM   9866  C CB  . ILE D 1 295 ? 3.365   -36.098 28.551  1.00 45.14  ? 290 ILE D CB  1 
ATOM   9867  C CG1 . ILE D 1 295 ? 3.154   -36.933 29.809  1.00 44.46  ? 290 ILE D CG1 1 
ATOM   9868  C CG2 . ILE D 1 295 ? 2.516   -36.637 27.422  1.00 43.88  ? 290 ILE D CG2 1 
ATOM   9869  C CD1 . ILE D 1 295 ? 1.884   -36.591 30.541  1.00 46.57  ? 290 ILE D CD1 1 
ATOM   9870  N N   . TYR D 1 296 ? 5.861   -35.480 26.074  1.00 47.22  ? 291 TYR D N   1 
ATOM   9871  C CA  . TYR D 1 296 ? 6.202   -34.584 24.994  1.00 45.76  ? 291 TYR D CA  1 
ATOM   9872  C C   . TYR D 1 296 ? 6.323   -35.435 23.754  1.00 46.78  ? 291 TYR D C   1 
ATOM   9873  O O   . TYR D 1 296 ? 7.234   -36.249 23.648  1.00 46.58  ? 291 TYR D O   1 
ATOM   9874  C CB  . TYR D 1 296 ? 7.529   -33.887 25.275  1.00 45.22  ? 291 TYR D CB  1 
ATOM   9875  C CG  . TYR D 1 296 ? 7.932   -32.933 24.177  1.00 45.78  ? 291 TYR D CG  1 
ATOM   9876  C CD1 . TYR D 1 296 ? 7.123   -31.848 23.836  1.00 46.11  ? 291 TYR D CD1 1 
ATOM   9877  C CD2 . TYR D 1 296 ? 9.121   -33.115 23.474  1.00 45.88  ? 291 TYR D CD2 1 
ATOM   9878  C CE1 . TYR D 1 296 ? 7.489   -30.968 22.825  1.00 45.67  ? 291 TYR D CE1 1 
ATOM   9879  C CE2 . TYR D 1 296 ? 9.499   -32.240 22.459  1.00 45.43  ? 291 TYR D CE2 1 
ATOM   9880  C CZ  . TYR D 1 296 ? 8.681   -31.171 22.143  1.00 46.32  ? 291 TYR D CZ  1 
ATOM   9881  O OH  . TYR D 1 296 ? 9.070   -30.289 21.164  1.00 48.87  ? 291 TYR D OH  1 
ATOM   9882  N N   . PRO D 1 297 ? 5.400   -35.261 22.798  1.00 46.48  ? 292 PRO D N   1 
ATOM   9883  C CA  . PRO D 1 297 ? 5.393   -36.023 21.544  1.00 47.65  ? 292 PRO D CA  1 
ATOM   9884  C C   . PRO D 1 297 ? 6.757   -36.144 20.865  1.00 48.58  ? 292 PRO D C   1 
ATOM   9885  O O   . PRO D 1 297 ? 6.957   -37.016 20.021  1.00 47.93  ? 292 PRO D O   1 
ATOM   9886  C CB  . PRO D 1 297 ? 4.391   -35.257 20.689  1.00 48.05  ? 292 PRO D CB  1 
ATOM   9887  C CG  . PRO D 1 297 ? 3.403   -34.774 21.709  1.00 46.89  ? 292 PRO D CG  1 
ATOM   9888  C CD  . PRO D 1 297 ? 4.303   -34.275 22.816  1.00 46.52  ? 292 PRO D CD  1 
ATOM   9889  N N   . GLY D 1 298 ? 7.688   -35.273 21.237  1.00 48.04  ? 293 GLY D N   1 
ATOM   9890  C CA  . GLY D 1 298 ? 9.006   -35.308 20.635  1.00 48.27  ? 293 GLY D CA  1 
ATOM   9891  C C   . GLY D 1 298 ? 9.941   -36.352 21.209  1.00 49.13  ? 293 GLY D C   1 
ATOM   9892  O O   . GLY D 1 298 ? 10.942  -36.692 20.586  1.00 49.64  ? 293 GLY D O   1 
ATOM   9893  N N   . LEU D 1 299 ? 9.628   -36.857 22.397  1.00 49.89  ? 294 LEU D N   1 
ATOM   9894  C CA  . LEU D 1 299 ? 10.466  -37.868 23.046  1.00 49.88  ? 294 LEU D CA  1 
ATOM   9895  C C   . LEU D 1 299 ? 9.983   -39.259 22.658  1.00 50.96  ? 294 LEU D C   1 
ATOM   9896  O O   . LEU D 1 299 ? 8.807   -39.444 22.342  1.00 50.48  ? 294 LEU D O   1 
ATOM   9897  C CB  . LEU D 1 299 ? 10.392  -37.734 24.573  1.00 47.61  ? 294 LEU D CB  1 
ATOM   9898  C CG  . LEU D 1 299 ? 10.909  -36.467 25.255  1.00 45.28  ? 294 LEU D CG  1 
ATOM   9899  C CD1 . LEU D 1 299 ? 10.566  -36.521 26.736  1.00 43.99  ? 294 LEU D CD1 1 
ATOM   9900  C CD2 . LEU D 1 299 ? 12.408  -36.342 25.051  1.00 42.63  ? 294 LEU D CD2 1 
ATOM   9901  N N   . PRO D 1 300 ? 10.890  -40.253 22.663  1.00 51.54  ? 295 PRO D N   1 
ATOM   9902  C CA  . PRO D 1 300 ? 10.522  -41.633 22.314  1.00 50.35  ? 295 PRO D CA  1 
ATOM   9903  C C   . PRO D 1 300 ? 9.708   -42.299 23.434  1.00 51.40  ? 295 PRO D C   1 
ATOM   9904  O O   . PRO D 1 300 ? 8.999   -43.286 23.207  1.00 50.27  ? 295 PRO D O   1 
ATOM   9905  C CB  . PRO D 1 300 ? 11.873  -42.300 22.092  1.00 49.48  ? 295 PRO D CB  1 
ATOM   9906  C CG  . PRO D 1 300 ? 12.760  -41.557 23.043  1.00 50.94  ? 295 PRO D CG  1 
ATOM   9907  C CD  . PRO D 1 300 ? 12.348  -40.124 22.833  1.00 49.86  ? 295 PRO D CD  1 
ATOM   9908  N N   . SER D 1 301 ? 9.814   -41.734 24.636  1.00 51.70  ? 296 SER D N   1 
ATOM   9909  C CA  . SER D 1 301 ? 9.105   -42.229 25.814  1.00 51.97  ? 296 SER D CA  1 
ATOM   9910  C C   . SER D 1 301 ? 7.595   -42.024 25.708  1.00 52.75  ? 296 SER D C   1 
ATOM   9911  O O   . SER D 1 301 ? 6.815   -42.673 26.413  1.00 53.71  ? 296 SER D O   1 
ATOM   9912  C CB  . SER D 1 301 ? 9.614   -41.518 27.066  1.00 51.09  ? 296 SER D CB  1 
ATOM   9913  O OG  . SER D 1 301 ? 9.264   -40.148 27.041  1.00 50.15  ? 296 SER D OG  1 
ATOM   9914  N N   . HIS D 1 302 ? 7.185   -41.108 24.837  1.00 52.48  ? 297 HIS D N   1 
ATOM   9915  C CA  . HIS D 1 302 ? 5.769   -40.829 24.638  1.00 52.53  ? 297 HIS D CA  1 
ATOM   9916  C C   . HIS D 1 302 ? 5.073   -42.099 24.146  1.00 54.30  ? 297 HIS D C   1 
ATOM   9917  O O   . HIS D 1 302 ? 5.612   -42.834 23.316  1.00 54.26  ? 297 HIS D O   1 
ATOM   9918  C CB  . HIS D 1 302 ? 5.595   -39.716 23.602  1.00 51.65  ? 297 HIS D CB  1 
ATOM   9919  C CG  . HIS D 1 302 ? 4.192   -39.208 23.492  1.00 52.27  ? 297 HIS D CG  1 
ATOM   9920  N ND1 . HIS D 1 302 ? 3.667   -38.276 24.363  1.00 52.49  ? 297 HIS D ND1 1 
ATOM   9921  C CD2 . HIS D 1 302 ? 3.192   -39.533 22.639  1.00 51.80  ? 297 HIS D CD2 1 
ATOM   9922  C CE1 . HIS D 1 302 ? 2.403   -38.050 24.050  1.00 52.14  ? 297 HIS D CE1 1 
ATOM   9923  N NE2 . HIS D 1 302 ? 2.091   -38.800 23.008  1.00 50.99  ? 297 HIS D NE2 1 
ATOM   9924  N N   . PRO D 1 303 ? 3.861   -42.374 24.648  1.00 54.61  ? 298 PRO D N   1 
ATOM   9925  C CA  . PRO D 1 303 ? 3.118   -43.568 24.238  1.00 55.44  ? 298 PRO D CA  1 
ATOM   9926  C C   . PRO D 1 303 ? 2.664   -43.563 22.786  1.00 56.95  ? 298 PRO D C   1 
ATOM   9927  O O   . PRO D 1 303 ? 2.052   -44.531 22.337  1.00 59.72  ? 298 PRO D O   1 
ATOM   9928  C CB  . PRO D 1 303 ? 1.938   -43.590 25.202  1.00 55.08  ? 298 PRO D CB  1 
ATOM   9929  C CG  . PRO D 1 303 ? 1.683   -42.142 25.432  1.00 55.04  ? 298 PRO D CG  1 
ATOM   9930  C CD  . PRO D 1 303 ? 3.090   -41.604 25.636  1.00 55.46  ? 298 PRO D CD  1 
ATOM   9931  N N   . GLN D 1 304 ? 2.942   -42.482 22.058  1.00 56.78  ? 299 GLN D N   1 
ATOM   9932  C CA  . GLN D 1 304 ? 2.561   -42.402 20.647  1.00 58.06  ? 299 GLN D CA  1 
ATOM   9933  C C   . GLN D 1 304 ? 3.679   -41.856 19.766  1.00 58.98  ? 299 GLN D C   1 
ATOM   9934  O O   . GLN D 1 304 ? 3.438   -41.491 18.615  1.00 58.24  ? 299 GLN D O   1 
ATOM   9935  C CB  . GLN D 1 304 ? 1.317   -41.528 20.459  1.00 57.21  ? 299 GLN D CB  1 
ATOM   9936  C CG  . GLN D 1 304 ? 0.008   -42.196 20.826  1.00 57.34  ? 299 GLN D CG  1 
ATOM   9937  C CD  . GLN D 1 304 ? -0.705  -41.473 21.949  1.00 57.96  ? 299 GLN D CD  1 
ATOM   9938  O OE1 . GLN D 1 304 ? -0.927  -40.269 21.880  1.00 58.87  ? 299 GLN D OE1 1 
ATOM   9939  N NE2 . GLN D 1 304 ? -1.070  -42.205 22.989  1.00 58.95  ? 299 GLN D NE2 1 
ATOM   9940  N N   . HIS D 1 305 ? 4.895   -41.812 20.305  1.00 61.59  ? 300 HIS D N   1 
ATOM   9941  C CA  . HIS D 1 305 ? 6.050   -41.298 19.574  1.00 65.11  ? 300 HIS D CA  1 
ATOM   9942  C C   . HIS D 1 305 ? 6.151   -41.821 18.140  1.00 63.51  ? 300 HIS D C   1 
ATOM   9943  O O   . HIS D 1 305 ? 6.620   -41.117 17.241  1.00 62.17  ? 300 HIS D O   1 
ATOM   9944  C CB  . HIS D 1 305 ? 7.341   -41.638 20.320  1.00 70.36  ? 300 HIS D CB  1 
ATOM   9945  C CG  . HIS D 1 305 ? 8.567   -41.038 19.703  1.00 77.42  ? 300 HIS D CG  1 
ATOM   9946  N ND1 . HIS D 1 305 ? 8.785   -39.678 19.654  1.00 80.43  ? 300 HIS D ND1 1 
ATOM   9947  C CD2 . HIS D 1 305 ? 9.638   -41.613 19.104  1.00 80.46  ? 300 HIS D CD2 1 
ATOM   9948  C CE1 . HIS D 1 305 ? 9.937   -39.440 19.053  1.00 82.34  ? 300 HIS D CE1 1 
ATOM   9949  N NE2 . HIS D 1 305 ? 10.475  -40.597 18.709  1.00 82.57  ? 300 HIS D NE2 1 
ATOM   9950  N N   . GLU D 1 306 ? 5.716   -43.055 17.923  1.00 62.46  ? 301 GLU D N   1 
ATOM   9951  C CA  . GLU D 1 306 ? 5.788   -43.624 16.590  1.00 62.35  ? 301 GLU D CA  1 
ATOM   9952  C C   . GLU D 1 306 ? 4.637   -43.160 15.700  1.00 60.07  ? 301 GLU D C   1 
ATOM   9953  O O   . GLU D 1 306 ? 4.775   -43.119 14.478  1.00 59.70  ? 301 GLU D O   1 
ATOM   9954  C CB  . GLU D 1 306 ? 5.863   -45.152 16.678  1.00 65.08  ? 301 GLU D CB  1 
ATOM   9955  C CG  . GLU D 1 306 ? 7.117   -45.636 17.424  1.00 69.54  ? 301 GLU D CG  1 
ATOM   9956  C CD  . GLU D 1 306 ? 8.427   -45.189 16.763  1.00 71.84  ? 301 GLU D CD  1 
ATOM   9957  O OE1 . GLU D 1 306 ? 9.468   -45.119 17.461  1.00 72.47  ? 301 GLU D OE1 1 
ATOM   9958  O OE2 . GLU D 1 306 ? 8.420   -44.917 15.541  1.00 73.63  ? 301 GLU D OE2 1 
ATOM   9959  N N   . LEU D 1 307 ? 3.506   -42.803 16.303  1.00 57.37  ? 302 LEU D N   1 
ATOM   9960  C CA  . LEU D 1 307 ? 2.376   -42.303 15.523  1.00 54.89  ? 302 LEU D CA  1 
ATOM   9961  C C   . LEU D 1 307 ? 2.770   -40.884 15.134  1.00 56.21  ? 302 LEU D C   1 
ATOM   9962  O O   . LEU D 1 307 ? 2.514   -40.436 14.017  1.00 55.68  ? 302 LEU D O   1 
ATOM   9963  C CB  . LEU D 1 307 ? 1.095   -42.247 16.364  1.00 52.53  ? 302 LEU D CB  1 
ATOM   9964  C CG  . LEU D 1 307 ? -0.238  -42.187 15.602  1.00 49.93  ? 302 LEU D CG  1 
ATOM   9965  C CD1 . LEU D 1 307 ? -1.359  -41.873 16.578  1.00 48.96  ? 302 LEU D CD1 1 
ATOM   9966  C CD2 . LEU D 1 307 ? -0.196  -41.143 14.509  1.00 48.92  ? 302 LEU D CD2 1 
ATOM   9967  N N   . VAL D 1 308 ? 3.402   -40.191 16.080  1.00 56.89  ? 303 VAL D N   1 
ATOM   9968  C CA  . VAL D 1 308 ? 3.862   -38.817 15.894  1.00 55.08  ? 303 VAL D CA  1 
ATOM   9969  C C   . VAL D 1 308 ? 4.866   -38.677 14.747  1.00 56.50  ? 303 VAL D C   1 
ATOM   9970  O O   . VAL D 1 308 ? 4.768   -37.747 13.955  1.00 57.29  ? 303 VAL D O   1 
ATOM   9971  C CB  . VAL D 1 308 ? 4.508   -38.263 17.197  1.00 54.82  ? 303 VAL D CB  1 
ATOM   9972  C CG1 . VAL D 1 308 ? 5.089   -36.880 16.949  1.00 53.23  ? 303 VAL D CG1 1 
ATOM   9973  C CG2 . VAL D 1 308 ? 3.473   -38.206 18.308  1.00 52.63  ? 303 VAL D CG2 1 
ATOM   9974  N N   . LYS D 1 309 ? 5.827   -39.589 14.648  1.00 56.42  ? 304 LYS D N   1 
ATOM   9975  C CA  . LYS D 1 309 ? 6.808   -39.495 13.579  1.00 57.48  ? 304 LYS D CA  1 
ATOM   9976  C C   . LYS D 1 309 ? 6.240   -39.743 12.184  1.00 57.56  ? 304 LYS D C   1 
ATOM   9977  O O   . LYS D 1 309 ? 6.846   -39.347 11.198  1.00 58.73  ? 304 LYS D O   1 
ATOM   9978  C CB  . LYS D 1 309 ? 7.980   -40.445 13.835  1.00 59.65  ? 304 LYS D CB  1 
ATOM   9979  C CG  . LYS D 1 309 ? 8.961   -39.943 14.896  1.00 63.40  ? 304 LYS D CG  1 
ATOM   9980  C CD  . LYS D 1 309 ? 10.212  -40.821 14.990  1.00 66.30  ? 304 LYS D CD  1 
ATOM   9981  C CE  . LYS D 1 309 ? 9.864   -42.262 15.366  1.00 68.70  ? 304 LYS D CE  1 
ATOM   9982  N NZ  . LYS D 1 309 ? 11.067  -43.137 15.496  1.00 70.22  ? 304 LYS D NZ  1 
ATOM   9983  N N   . ARG D 1 310 ? 5.080   -40.385 12.091  1.00 57.98  ? 305 ARG D N   1 
ATOM   9984  C CA  . ARG D 1 310 ? 4.471   -40.662 10.789  1.00 58.34  ? 305 ARG D CA  1 
ATOM   9985  C C   . ARG D 1 310 ? 3.265   -39.771 10.486  1.00 56.96  ? 305 ARG D C   1 
ATOM   9986  O O   . ARG D 1 310 ? 2.482   -40.053 9.580   1.00 57.12  ? 305 ARG D O   1 
ATOM   9987  C CB  . ARG D 1 310 ? 4.053   -42.139 10.706  1.00 61.16  ? 305 ARG D CB  1 
ATOM   9988  C CG  . ARG D 1 310 ? 3.334   -42.669 11.945  1.00 67.01  ? 305 ARG D CG  1 
ATOM   9989  C CD  . ARG D 1 310 ? 2.879   -44.122 11.773  1.00 70.16  ? 305 ARG D CD  1 
ATOM   9990  N NE  . ARG D 1 310 ? 1.657   -44.225 10.972  1.00 74.92  ? 305 ARG D NE  1 
ATOM   9991  C CZ  . ARG D 1 310 ? 0.420   -44.085 11.452  1.00 76.23  ? 305 ARG D CZ  1 
ATOM   9992  N NH1 . ARG D 1 310 ? 0.227   -43.839 12.741  1.00 77.41  ? 305 ARG D NH1 1 
ATOM   9993  N NH2 . ARG D 1 310 ? -0.628  -44.184 10.641  1.00 75.31  ? 305 ARG D NH2 1 
ATOM   9994  N N   . GLN D 1 311 ? 3.132   -38.683 11.234  1.00 55.70  ? 306 GLN D N   1 
ATOM   9995  C CA  . GLN D 1 311 ? 2.007   -37.764 11.068  1.00 53.23  ? 306 GLN D CA  1 
ATOM   9996  C C   . GLN D 1 311 ? 2.427   -36.287 11.153  1.00 51.79  ? 306 GLN D C   1 
ATOM   9997  O O   . GLN D 1 311 ? 1.806   -35.418 10.539  1.00 49.25  ? 306 GLN D O   1 
ATOM   9998  C CB  . GLN D 1 311 ? 0.952   -38.092 12.129  1.00 52.60  ? 306 GLN D CB  1 
ATOM   9999  C CG  . GLN D 1 311 ? -0.109  -37.048 12.342  1.00 53.46  ? 306 GLN D CG  1 
ATOM   10000 C CD  . GLN D 1 311 ? -1.193  -37.529 13.289  1.00 54.83  ? 306 GLN D CD  1 
ATOM   10001 O OE1 . GLN D 1 311 ? -1.990  -38.401 12.940  1.00 54.75  ? 306 GLN D OE1 1 
ATOM   10002 N NE2 . GLN D 1 311 ? -1.223  -36.970 14.496  1.00 55.15  ? 306 GLN D NE2 1 
ATOM   10003 N N   . CYS D 1 312 ? 3.494   -36.022 11.905  1.00 50.11  ? 307 CYS D N   1 
ATOM   10004 C CA  . CYS D 1 312 ? 4.009   -34.671 12.089  1.00 47.89  ? 307 CYS D CA  1 
ATOM   10005 C C   . CYS D 1 312 ? 5.430   -34.578 11.568  1.00 46.74  ? 307 CYS D C   1 
ATOM   10006 O O   . CYS D 1 312 ? 6.075   -35.593 11.319  1.00 46.45  ? 307 CYS D O   1 
ATOM   10007 C CB  . CYS D 1 312 ? 4.016   -34.299 13.569  1.00 48.32  ? 307 CYS D CB  1 
ATOM   10008 S SG  . CYS D 1 312 ? 2.569   -34.857 14.465  1.00 52.12  ? 307 CYS D SG  1 
ATOM   10009 N N   . THR D 1 313 ? 5.907   -33.347 11.405  1.00 45.69  ? 308 THR D N   1 
ATOM   10010 C CA  . THR D 1 313 ? 7.264   -33.096 10.941  1.00 43.19  ? 308 THR D CA  1 
ATOM   10011 C C   . THR D 1 313 ? 8.033   -32.473 12.097  1.00 41.63  ? 308 THR D C   1 
ATOM   10012 O O   . THR D 1 313 ? 9.163   -32.020 11.931  1.00 40.76  ? 308 THR D O   1 
ATOM   10013 C CB  . THR D 1 313 ? 7.287   -32.127 9.758   1.00 43.08  ? 308 THR D CB  1 
ATOM   10014 O OG1 . THR D 1 313 ? 6.933   -30.818 10.212  1.00 44.64  ? 308 THR D OG1 1 
ATOM   10015 C CG2 . THR D 1 313 ? 6.308   -32.578 8.688   1.00 43.03  ? 308 THR D CG2 1 
ATOM   10016 N N   . GLY D 1 314 ? 7.403   -32.454 13.270  1.00 41.08  ? 309 GLY D N   1 
ATOM   10017 C CA  . GLY D 1 314 ? 8.032   -31.897 14.453  1.00 41.47  ? 309 GLY D CA  1 
ATOM   10018 C C   . GLY D 1 314 ? 7.030   -31.641 15.557  1.00 42.43  ? 309 GLY D C   1 
ATOM   10019 O O   . GLY D 1 314 ? 5.885   -32.081 15.459  1.00 41.38  ? 309 GLY D O   1 
ATOM   10020 N N   . CYS D 1 315 ? 7.462   -30.928 16.600  1.00 45.24  ? 310 CYS D N   1 
ATOM   10021 C CA  . CYS D 1 315 ? 6.605   -30.603 17.744  1.00 48.01  ? 310 CYS D CA  1 
ATOM   10022 C C   . CYS D 1 315 ? 6.676   -29.153 18.225  1.00 48.37  ? 310 CYS D C   1 
ATOM   10023 O O   . CYS D 1 315 ? 7.654   -28.437 17.998  1.00 48.00  ? 310 CYS D O   1 
ATOM   10024 C CB  . CYS D 1 315 ? 6.927   -31.510 18.928  1.00 48.09  ? 310 CYS D CB  1 
ATOM   10025 S SG  . CYS D 1 315 ? 6.660   -33.237 18.598  1.00 52.72  ? 310 CYS D SG  1 
ATOM   10026 N N   . THR D 1 316 ? 5.613   -28.753 18.913  1.00 49.15  ? 311 THR D N   1 
ATOM   10027 C CA  . THR D 1 316 ? 5.461   -27.423 19.476  1.00 51.16  ? 311 THR D CA  1 
ATOM   10028 C C   . THR D 1 316 ? 6.353   -27.299 20.711  1.00 47.58  ? 311 THR D C   1 
ATOM   10029 O O   . THR D 1 316 ? 7.111   -28.202 21.038  1.00 47.40  ? 311 THR D O   1 
ATOM   10030 C CB  . THR D 1 316 ? 3.997   -27.199 19.905  1.00 54.13  ? 311 THR D CB  1 
ATOM   10031 O OG1 . THR D 1 316 ? 3.125   -27.786 18.934  1.00 59.18  ? 311 THR D OG1 1 
ATOM   10032 C CG2 . THR D 1 316 ? 3.681   -25.718 19.998  1.00 59.23  ? 311 THR D CG2 1 
ATOM   10033 N N   . GLY D 1 317 ? 6.262   -26.169 21.391  1.00 45.34  ? 312 GLY D N   1 
ATOM   10034 C CA  . GLY D 1 317 ? 7.051   -25.979 22.586  1.00 44.46  ? 312 GLY D CA  1 
ATOM   10035 C C   . GLY D 1 317 ? 6.220   -26.349 23.799  1.00 42.78  ? 312 GLY D C   1 
ATOM   10036 O O   . GLY D 1 317 ? 6.576   -26.002 24.925  1.00 39.50  ? 312 GLY D O   1 
ATOM   10037 N N   . MET D 1 318 ? 5.102   -27.041 23.564  1.00 43.69  ? 313 MET D N   1 
ATOM   10038 C CA  . MET D 1 318 ? 4.222   -27.469 24.653  1.00 44.61  ? 313 MET D CA  1 
ATOM   10039 C C   . MET D 1 318 ? 4.730   -28.757 25.283  1.00 43.93  ? 313 MET D C   1 
ATOM   10040 O O   . MET D 1 318 ? 4.623   -29.849 24.708  1.00 44.23  ? 313 MET D O   1 
ATOM   10041 C CB  . MET D 1 318 ? 2.774   -27.671 24.176  1.00 45.65  ? 313 MET D CB  1 
ATOM   10042 C CG  . MET D 1 318 ? 1.908   -28.422 25.211  1.00 48.08  ? 313 MET D CG  1 
ATOM   10043 S SD  . MET D 1 318 ? 0.097   -28.257 25.085  1.00 52.17  ? 313 MET D SD  1 
ATOM   10044 C CE  . MET D 1 318 ? -0.301  -29.360 23.621  1.00 50.46  ? 313 MET D CE  1 
ATOM   10045 N N   . VAL D 1 319 ? 5.287   -28.607 26.476  1.00 41.83  ? 314 VAL D N   1 
ATOM   10046 C CA  . VAL D 1 319 ? 5.827   -29.722 27.224  1.00 40.30  ? 314 VAL D CA  1 
ATOM   10047 C C   . VAL D 1 319 ? 5.060   -29.877 28.534  1.00 41.72  ? 314 VAL D C   1 
ATOM   10048 O O   . VAL D 1 319 ? 4.886   -28.920 29.287  1.00 41.62  ? 314 VAL D O   1 
ATOM   10049 C CB  . VAL D 1 319 ? 7.320   -29.498 27.541  1.00 38.91  ? 314 VAL D CB  1 
ATOM   10050 C CG1 . VAL D 1 319 ? 7.839   -30.615 28.419  1.00 37.78  ? 314 VAL D CG1 1 
ATOM   10051 C CG2 . VAL D 1 319 ? 8.113   -29.423 26.250  1.00 37.51  ? 314 VAL D CG2 1 
ATOM   10052 N N   . THR D 1 320 ? 4.589   -31.087 28.794  1.00 41.84  ? 315 THR D N   1 
ATOM   10053 C CA  . THR D 1 320 ? 3.870   -31.364 30.025  1.00 40.96  ? 315 THR D CA  1 
ATOM   10054 C C   . THR D 1 320 ? 4.750   -32.280 30.868  1.00 42.58  ? 315 THR D C   1 
ATOM   10055 O O   . THR D 1 320 ? 5.559   -33.033 30.329  1.00 43.26  ? 315 THR D O   1 
ATOM   10056 C CB  . THR D 1 320 ? 2.548   -32.064 29.736  1.00 39.66  ? 315 THR D CB  1 
ATOM   10057 O OG1 . THR D 1 320 ? 1.773   -31.257 28.843  1.00 37.28  ? 315 THR D OG1 1 
ATOM   10058 C CG2 . THR D 1 320 ? 1.780   -32.295 31.028  1.00 39.90  ? 315 THR D CG2 1 
ATOM   10059 N N   . PHE D 1 321 ? 4.613   -32.210 32.187  1.00 43.79  ? 316 PHE D N   1 
ATOM   10060 C CA  . PHE D 1 321 ? 5.421   -33.058 33.052  1.00 43.79  ? 316 PHE D CA  1 
ATOM   10061 C C   . PHE D 1 321 ? 4.891   -33.096 34.479  1.00 44.27  ? 316 PHE D C   1 
ATOM   10062 O O   . PHE D 1 321 ? 4.288   -32.136 34.949  1.00 45.48  ? 316 PHE D O   1 
ATOM   10063 C CB  . PHE D 1 321 ? 6.875   -32.571 33.040  1.00 42.25  ? 316 PHE D CB  1 
ATOM   10064 C CG  . PHE D 1 321 ? 7.161   -31.448 34.008  1.00 41.59  ? 316 PHE D CG  1 
ATOM   10065 C CD1 . PHE D 1 321 ? 7.432   -31.717 35.346  1.00 39.45  ? 316 PHE D CD1 1 
ATOM   10066 C CD2 . PHE D 1 321 ? 7.194   -30.126 33.572  1.00 41.03  ? 316 PHE D CD2 1 
ATOM   10067 C CE1 . PHE D 1 321 ? 7.736   -30.694 36.234  1.00 39.20  ? 316 PHE D CE1 1 
ATOM   10068 C CE2 . PHE D 1 321 ? 7.497   -29.092 34.452  1.00 40.49  ? 316 PHE D CE2 1 
ATOM   10069 C CZ  . PHE D 1 321 ? 7.769   -29.378 35.789  1.00 41.15  ? 316 PHE D CZ  1 
ATOM   10070 N N   . TYR D 1 322 ? 5.114   -34.212 35.163  1.00 45.32  ? 317 TYR D N   1 
ATOM   10071 C CA  . TYR D 1 322 ? 4.673   -34.352 36.543  1.00 45.60  ? 317 TYR D CA  1 
ATOM   10072 C C   . TYR D 1 322 ? 5.862   -34.129 37.452  1.00 46.77  ? 317 TYR D C   1 
ATOM   10073 O O   . TYR D 1 322 ? 6.931   -34.667 37.207  1.00 48.09  ? 317 TYR D O   1 
ATOM   10074 C CB  . TYR D 1 322 ? 4.098   -35.741 36.780  1.00 44.00  ? 317 TYR D CB  1 
ATOM   10075 C CG  . TYR D 1 322 ? 2.886   -36.027 35.928  1.00 45.19  ? 317 TYR D CG  1 
ATOM   10076 C CD1 . TYR D 1 322 ? 3.015   -36.330 34.573  1.00 44.92  ? 317 TYR D CD1 1 
ATOM   10077 C CD2 . TYR D 1 322 ? 1.599   -35.979 36.474  1.00 44.47  ? 317 TYR D CD2 1 
ATOM   10078 C CE1 . TYR D 1 322 ? 1.886   -36.583 33.781  1.00 44.69  ? 317 TYR D CE1 1 
ATOM   10079 C CE2 . TYR D 1 322 ? 0.472   -36.228 35.692  1.00 43.60  ? 317 TYR D CE2 1 
ATOM   10080 C CZ  . TYR D 1 322 ? 0.623   -36.532 34.351  1.00 43.65  ? 317 TYR D CZ  1 
ATOM   10081 O OH  . TYR D 1 322 ? -0.486  -36.810 33.592  1.00 44.38  ? 317 TYR D OH  1 
ATOM   10082 N N   . ILE D 1 323 ? 5.684   -33.322 38.491  1.00 48.87  ? 318 ILE D N   1 
ATOM   10083 C CA  . ILE D 1 323 ? 6.770   -33.051 39.422  1.00 50.75  ? 318 ILE D CA  1 
ATOM   10084 C C   . ILE D 1 323 ? 6.685   -34.024 40.591  1.00 53.88  ? 318 ILE D C   1 
ATOM   10085 O O   . ILE D 1 323 ? 5.617   -34.207 41.167  1.00 55.38  ? 318 ILE D O   1 
ATOM   10086 C CB  . ILE D 1 323 ? 6.690   -31.610 39.950  1.00 50.21  ? 318 ILE D CB  1 
ATOM   10087 C CG1 . ILE D 1 323 ? 7.827   -31.365 40.945  1.00 49.53  ? 318 ILE D CG1 1 
ATOM   10088 C CG2 . ILE D 1 323 ? 5.313   -31.358 40.563  1.00 48.29  ? 318 ILE D CG2 1 
ATOM   10089 C CD1 . ILE D 1 323 ? 8.218   -29.905 41.094  1.00 48.74  ? 318 ILE D CD1 1 
ATOM   10090 N N   . LYS D 1 324 ? 7.802   -34.660 40.932  1.00 56.67  ? 319 LYS D N   1 
ATOM   10091 C CA  . LYS D 1 324 ? 7.811   -35.617 42.041  1.00 58.98  ? 319 LYS D CA  1 
ATOM   10092 C C   . LYS D 1 324 ? 7.355   -34.963 43.343  1.00 59.06  ? 319 LYS D C   1 
ATOM   10093 O O   . LYS D 1 324 ? 7.951   -33.976 43.782  1.00 59.60  ? 319 LYS D O   1 
ATOM   10094 C CB  . LYS D 1 324 ? 9.217   -36.204 42.250  1.00 61.31  ? 319 LYS D CB  1 
ATOM   10095 C CG  . LYS D 1 324 ? 9.548   -37.458 41.435  1.00 64.51  ? 319 LYS D CG  1 
ATOM   10096 C CD  . LYS D 1 324 ? 10.840  -38.110 41.952  1.00 66.84  ? 319 LYS D CD  1 
ATOM   10097 C CE  . LYS D 1 324 ? 11.229  -39.372 41.177  1.00 67.83  ? 319 LYS D CE  1 
ATOM   10098 N NZ  . LYS D 1 324 ? 11.813  -39.086 39.832  1.00 68.43  ? 319 LYS D NZ  1 
ATOM   10099 N N   . GLY D 1 325 ? 6.309   -35.515 43.961  1.00 58.56  ? 320 GLY D N   1 
ATOM   10100 C CA  . GLY D 1 325 ? 5.823   -34.963 45.217  1.00 57.77  ? 320 GLY D CA  1 
ATOM   10101 C C   . GLY D 1 325 ? 4.330   -34.704 45.266  1.00 58.54  ? 320 GLY D C   1 
ATOM   10102 O O   . GLY D 1 325 ? 3.540   -35.495 44.744  1.00 57.10  ? 320 GLY D O   1 
ATOM   10103 N N   . THR D 1 326 ? 3.948   -33.595 45.900  1.00 59.92  ? 321 THR D N   1 
ATOM   10104 C CA  . THR D 1 326 ? 2.540   -33.207 46.032  1.00 63.18  ? 321 THR D CA  1 
ATOM   10105 C C   . THR D 1 326 ? 2.256   -31.819 45.483  1.00 64.26  ? 321 THR D C   1 
ATOM   10106 O O   . THR D 1 326 ? 3.169   -31.085 45.114  1.00 65.16  ? 321 THR D O   1 
ATOM   10107 C CB  . THR D 1 326 ? 2.095   -33.184 47.497  1.00 62.64  ? 321 THR D CB  1 
ATOM   10108 O OG1 . THR D 1 326 ? 3.247   -33.028 48.334  1.00 63.15  ? 321 THR D OG1 1 
ATOM   10109 C CG2 . THR D 1 326 ? 1.331   -34.448 47.852  1.00 64.04  ? 321 THR D CG2 1 
ATOM   10110 N N   . LEU D 1 327 ? 0.975   -31.462 45.458  1.00 66.21  ? 322 LEU D N   1 
ATOM   10111 C CA  . LEU D 1 327 ? 0.544   -30.154 44.980  1.00 68.18  ? 322 LEU D CA  1 
ATOM   10112 C C   . LEU D 1 327 ? 1.295   -29.044 45.702  1.00 71.45  ? 322 LEU D C   1 
ATOM   10113 O O   . LEU D 1 327 ? 1.331   -27.905 45.241  1.00 72.23  ? 322 LEU D O   1 
ATOM   10114 C CB  . LEU D 1 327 ? -0.956  -29.980 45.209  1.00 64.45  ? 322 LEU D CB  1 
ATOM   10115 C CG  . LEU D 1 327 ? -1.496  -28.555 45.096  1.00 61.51  ? 322 LEU D CG  1 
ATOM   10116 C CD1 . LEU D 1 327 ? -1.262  -27.995 43.706  1.00 60.24  ? 322 LEU D CD1 1 
ATOM   10117 C CD2 . LEU D 1 327 ? -2.966  -28.574 45.420  1.00 60.86  ? 322 LEU D CD2 1 
ATOM   10118 N N   . GLN D 1 328 ? 1.886   -29.381 46.841  1.00 76.43  ? 323 GLN D N   1 
ATOM   10119 C CA  . GLN D 1 328 ? 2.637   -28.412 47.619  1.00 81.63  ? 323 GLN D CA  1 
ATOM   10120 C C   . GLN D 1 328 ? 3.991   -28.191 46.955  1.00 79.22  ? 323 GLN D C   1 
ATOM   10121 O O   . GLN D 1 328 ? 4.611   -27.138 47.112  1.00 78.91  ? 323 GLN D O   1 
ATOM   10122 C CB  . GLN D 1 328 ? 2.841   -28.926 49.043  1.00 90.13  ? 323 GLN D CB  1 
ATOM   10123 C CG  . GLN D 1 328 ? 3.515   -27.924 49.968  1.00 102.87 ? 323 GLN D CG  1 
ATOM   10124 C CD  . GLN D 1 328 ? 3.976   -28.547 51.276  1.00 109.72 ? 323 GLN D CD  1 
ATOM   10125 O OE1 . GLN D 1 328 ? 4.487   -27.855 52.160  1.00 114.22 ? 323 GLN D OE1 1 
ATOM   10126 N NE2 . GLN D 1 328 ? 3.805   -29.860 51.402  1.00 113.82 ? 323 GLN D NE2 1 
ATOM   10127 N N   . HIS D 1 329 ? 4.442   -29.195 46.212  1.00 76.20  ? 324 HIS D N   1 
ATOM   10128 C CA  . HIS D 1 329 ? 5.721   -29.124 45.519  1.00 74.20  ? 324 HIS D CA  1 
ATOM   10129 C C   . HIS D 1 329 ? 5.588   -28.447 44.166  1.00 71.49  ? 324 HIS D C   1 
ATOM   10130 O O   . HIS D 1 329 ? 6.484   -27.721 43.734  1.00 71.19  ? 324 HIS D O   1 
ATOM   10131 C CB  . HIS D 1 329 ? 6.301   -30.525 45.362  1.00 75.98  ? 324 HIS D CB  1 
ATOM   10132 C CG  . HIS D 1 329 ? 6.778   -31.118 46.649  1.00 78.26  ? 324 HIS D CG  1 
ATOM   10133 N ND1 . HIS D 1 329 ? 7.103   -32.450 46.782  1.00 79.33  ? 324 HIS D ND1 1 
ATOM   10134 C CD2 . HIS D 1 329 ? 7.010   -30.552 47.857  1.00 79.16  ? 324 HIS D CD2 1 
ATOM   10135 C CE1 . HIS D 1 329 ? 7.516   -32.678 48.015  1.00 80.13  ? 324 HIS D CE1 1 
ATOM   10136 N NE2 . HIS D 1 329 ? 7.469   -31.542 48.688  1.00 79.53  ? 324 HIS D NE2 1 
ATOM   10137 N N   . ALA D 1 330 ? 4.474   -28.690 43.488  1.00 68.60  ? 325 ALA D N   1 
ATOM   10138 C CA  . ALA D 1 330 ? 4.246   -28.050 42.206  1.00 66.91  ? 325 ALA D CA  1 
ATOM   10139 C C   . ALA D 1 330 ? 4.204   -26.554 42.530  1.00 66.22  ? 325 ALA D C   1 
ATOM   10140 O O   . ALA D 1 330 ? 4.638   -25.717 41.740  1.00 65.79  ? 325 ALA D O   1 
ATOM   10141 C CB  . ALA D 1 330 ? 2.920   -28.515 41.616  1.00 65.42  ? 325 ALA D CB  1 
ATOM   10142 N N   . GLU D 1 331 ? 3.694   -26.239 43.718  1.00 66.72  ? 326 GLU D N   1 
ATOM   10143 C CA  . GLU D 1 331 ? 3.592   -24.867 44.200  1.00 68.29  ? 326 GLU D CA  1 
ATOM   10144 C C   . GLU D 1 331 ? 4.968   -24.228 44.322  1.00 67.37  ? 326 GLU D C   1 
ATOM   10145 O O   . GLU D 1 331 ? 5.252   -23.208 43.690  1.00 66.76  ? 326 GLU D O   1 
ATOM   10146 C CB  . GLU D 1 331 ? 2.918   -24.845 45.569  1.00 71.93  ? 326 GLU D CB  1 
ATOM   10147 C CG  . GLU D 1 331 ? 1.422   -24.990 45.525  1.00 78.67  ? 326 GLU D CG  1 
ATOM   10148 C CD  . GLU D 1 331 ? 0.765   -23.760 44.959  1.00 82.88  ? 326 GLU D CD  1 
ATOM   10149 O OE1 . GLU D 1 331 ? 0.925   -22.682 45.565  1.00 85.94  ? 326 GLU D OE1 1 
ATOM   10150 O OE2 . GLU D 1 331 ? 0.095   -23.865 43.912  1.00 86.07  ? 326 GLU D OE2 1 
ATOM   10151 N N   . ILE D 1 332 ? 5.816   -24.831 45.151  1.00 66.19  ? 327 ILE D N   1 
ATOM   10152 C CA  . ILE D 1 332 ? 7.163   -24.316 45.359  1.00 66.93  ? 327 ILE D CA  1 
ATOM   10153 C C   . ILE D 1 332 ? 7.836   -24.107 44.011  1.00 65.19  ? 327 ILE D C   1 
ATOM   10154 O O   . ILE D 1 332 ? 8.387   -23.042 43.731  1.00 64.16  ? 327 ILE D O   1 
ATOM   10155 C CB  . ILE D 1 332 ? 8.021   -25.293 46.189  1.00 67.22  ? 327 ILE D CB  1 
ATOM   10156 C CG1 . ILE D 1 332 ? 7.293   -25.656 47.483  1.00 68.95  ? 327 ILE D CG1 1 
ATOM   10157 C CG2 . ILE D 1 332 ? 9.364   -24.656 46.516  1.00 66.77  ? 327 ILE D CG2 1 
ATOM   10158 C CD1 . ILE D 1 332 ? 6.963   -24.461 48.356  1.00 71.66  ? 327 ILE D CD1 1 
ATOM   10159 N N   . PHE D 1 333 ? 7.778   -25.138 43.177  1.00 63.44  ? 328 PHE D N   1 
ATOM   10160 C CA  . PHE D 1 333 ? 8.372   -25.082 41.854  1.00 61.01  ? 328 PHE D CA  1 
ATOM   10161 C C   . PHE D 1 333 ? 7.933   -23.829 41.091  1.00 60.20  ? 328 PHE D C   1 
ATOM   10162 O O   . PHE D 1 333 ? 8.737   -22.923 40.864  1.00 59.01  ? 328 PHE D O   1 
ATOM   10163 C CB  . PHE D 1 333 ? 7.992   -26.337 41.064  1.00 61.22  ? 328 PHE D CB  1 
ATOM   10164 C CG  . PHE D 1 333 ? 8.365   -26.270 39.616  1.00 60.92  ? 328 PHE D CG  1 
ATOM   10165 C CD1 . PHE D 1 333 ? 9.693   -26.111 39.236  1.00 60.82  ? 328 PHE D CD1 1 
ATOM   10166 C CD2 . PHE D 1 333 ? 7.384   -26.334 38.631  1.00 60.59  ? 328 PHE D CD2 1 
ATOM   10167 C CE1 . PHE D 1 333 ? 10.041  -26.014 37.893  1.00 61.28  ? 328 PHE D CE1 1 
ATOM   10168 C CE2 . PHE D 1 333 ? 7.718   -26.239 37.285  1.00 60.89  ? 328 PHE D CE2 1 
ATOM   10169 C CZ  . PHE D 1 333 ? 9.048   -26.078 36.913  1.00 61.49  ? 328 PHE D CZ  1 
ATOM   10170 N N   . LEU D 1 334 ? 6.658   -23.783 40.706  1.00 58.41  ? 329 LEU D N   1 
ATOM   10171 C CA  . LEU D 1 334 ? 6.114   -22.656 39.955  1.00 56.62  ? 329 LEU D CA  1 
ATOM   10172 C C   . LEU D 1 334 ? 6.460   -21.301 40.519  1.00 55.72  ? 329 LEU D C   1 
ATOM   10173 O O   . LEU D 1 334 ? 6.754   -20.368 39.775  1.00 55.99  ? 329 LEU D O   1 
ATOM   10174 C CB  . LEU D 1 334 ? 4.594   -22.751 39.857  1.00 55.33  ? 329 LEU D CB  1 
ATOM   10175 C CG  . LEU D 1 334 ? 4.061   -23.780 38.865  1.00 57.57  ? 329 LEU D CG  1 
ATOM   10176 C CD1 . LEU D 1 334 ? 2.559   -23.618 38.745  1.00 58.54  ? 329 LEU D CD1 1 
ATOM   10177 C CD2 . LEU D 1 334 ? 4.718   -23.585 37.503  1.00 57.87  ? 329 LEU D CD2 1 
ATOM   10178 N N   . LYS D 1 335 ? 6.421   -21.192 41.838  1.00 55.96  ? 330 LYS D N   1 
ATOM   10179 C CA  . LYS D 1 335 ? 6.699   -19.924 42.481  1.00 56.44  ? 330 LYS D CA  1 
ATOM   10180 C C   . LYS D 1 335 ? 8.169   -19.516 42.422  1.00 54.72  ? 330 LYS D C   1 
ATOM   10181 O O   . LYS D 1 335 ? 8.495   -18.345 42.611  1.00 54.78  ? 330 LYS D O   1 
ATOM   10182 C CB  . LYS D 1 335 ? 6.211   -19.960 43.930  1.00 58.38  ? 330 LYS D CB  1 
ATOM   10183 C CG  . LYS D 1 335 ? 5.734   -18.612 44.411  1.00 63.23  ? 330 LYS D CG  1 
ATOM   10184 C CD  . LYS D 1 335 ? 5.218   -18.651 45.834  1.00 67.52  ? 330 LYS D CD  1 
ATOM   10185 C CE  . LYS D 1 335 ? 4.789   -17.249 46.281  1.00 70.54  ? 330 LYS D CE  1 
ATOM   10186 N NZ  . LYS D 1 335 ? 5.859   -16.217 46.093  1.00 69.73  ? 330 LYS D NZ  1 
ATOM   10187 N N   . ASN D 1 336 ? 9.048   -20.473 42.141  1.00 53.05  ? 331 ASN D N   1 
ATOM   10188 C CA  . ASN D 1 336 ? 10.487  -20.207 42.066  1.00 51.38  ? 331 ASN D CA  1 
ATOM   10189 C C   . ASN D 1 336 ? 11.017  -19.903 40.669  1.00 50.71  ? 331 ASN D C   1 
ATOM   10190 O O   . ASN D 1 336 ? 12.137  -19.410 40.531  1.00 50.38  ? 331 ASN D O   1 
ATOM   10191 C CB  . ASN D 1 336 ? 11.276  -21.383 42.650  1.00 52.84  ? 331 ASN D CB  1 
ATOM   10192 C CG  . ASN D 1 336 ? 11.424  -21.294 44.153  1.00 53.20  ? 331 ASN D CG  1 
ATOM   10193 O OD1 . ASN D 1 336 ? 12.145  -20.440 44.673  1.00 52.35  ? 331 ASN D OD1 1 
ATOM   10194 N ND2 . ASN D 1 336 ? 10.732  -22.173 44.862  1.00 54.79  ? 331 ASN D ND2 1 
ATOM   10195 N N   . LEU D 1 337 ? 10.231  -20.219 39.639  1.00 48.49  ? 332 LEU D N   1 
ATOM   10196 C CA  . LEU D 1 337 ? 10.630  -19.950 38.259  1.00 44.12  ? 332 LEU D CA  1 
ATOM   10197 C C   . LEU D 1 337 ? 10.899  -18.456 38.211  1.00 45.09  ? 332 LEU D C   1 
ATOM   10198 O O   . LEU D 1 337 ? 10.159  -17.678 38.813  1.00 46.22  ? 332 LEU D O   1 
ATOM   10199 C CB  . LEU D 1 337 ? 9.495   -20.308 37.299  1.00 39.63  ? 332 LEU D CB  1 
ATOM   10200 C CG  . LEU D 1 337 ? 9.099   -21.785 37.271  1.00 35.90  ? 332 LEU D CG  1 
ATOM   10201 C CD1 . LEU D 1 337 ? 7.730   -21.946 36.668  1.00 34.33  ? 332 LEU D CD1 1 
ATOM   10202 C CD2 . LEU D 1 337 ? 10.122  -22.562 36.491  1.00 32.87  ? 332 LEU D CD2 1 
ATOM   10203 N N   . LYS D 1 338 ? 11.960  -18.058 37.519  1.00 44.40  ? 333 LYS D N   1 
ATOM   10204 C CA  . LYS D 1 338 ? 12.317  -16.647 37.422  1.00 44.27  ? 333 LYS D CA  1 
ATOM   10205 C C   . LYS D 1 338 ? 12.330  -16.161 35.974  1.00 43.36  ? 333 LYS D C   1 
ATOM   10206 O O   . LYS D 1 338 ? 12.194  -14.965 35.711  1.00 44.06  ? 333 LYS D O   1 
ATOM   10207 C CB  . LYS D 1 338 ? 13.691  -16.416 38.052  1.00 45.92  ? 333 LYS D CB  1 
ATOM   10208 C CG  . LYS D 1 338 ? 13.779  -16.787 39.526  1.00 50.19  ? 333 LYS D CG  1 
ATOM   10209 C CD  . LYS D 1 338 ? 15.210  -16.666 40.028  1.00 53.12  ? 333 LYS D CD  1 
ATOM   10210 C CE  . LYS D 1 338 ? 15.288  -16.715 41.547  1.00 55.63  ? 333 LYS D CE  1 
ATOM   10211 N NZ  . LYS D 1 338 ? 16.679  -16.453 42.022  1.00 57.75  ? 333 LYS D NZ  1 
ATOM   10212 N N   . LEU D 1 339 ? 12.506  -17.094 35.039  1.00 42.35  ? 334 LEU D N   1 
ATOM   10213 C CA  . LEU D 1 339 ? 12.544  -16.764 33.619  1.00 40.02  ? 334 LEU D CA  1 
ATOM   10214 C C   . LEU D 1 339 ? 11.242  -17.185 32.962  1.00 37.56  ? 334 LEU D C   1 
ATOM   10215 O O   . LEU D 1 339 ? 10.777  -16.518 32.052  1.00 37.10  ? 334 LEU D O   1 
ATOM   10216 C CB  . LEU D 1 339 ? 13.749  -17.438 32.941  1.00 41.76  ? 334 LEU D CB  1 
ATOM   10217 C CG  . LEU D 1 339 ? 14.125  -17.087 31.492  1.00 42.00  ? 334 LEU D CG  1 
ATOM   10218 C CD1 . LEU D 1 339 ? 13.307  -17.922 30.545  1.00 45.75  ? 334 LEU D CD1 1 
ATOM   10219 C CD2 . LEU D 1 339 ? 13.910  -15.603 31.224  1.00 42.56  ? 334 LEU D CD2 1 
ATOM   10220 N N   . PHE D 1 340 ? 10.656  -18.291 33.417  1.00 37.02  ? 335 PHE D N   1 
ATOM   10221 C CA  . PHE D 1 340 ? 9.367   -18.733 32.873  1.00 36.77  ? 335 PHE D CA  1 
ATOM   10222 C C   . PHE D 1 340 ? 8.310   -17.813 33.480  1.00 38.14  ? 335 PHE D C   1 
ATOM   10223 O O   . PHE D 1 340 ? 8.489   -17.275 34.580  1.00 38.91  ? 335 PHE D O   1 
ATOM   10224 C CB  . PHE D 1 340 ? 9.026   -20.184 33.277  1.00 35.68  ? 335 PHE D CB  1 
ATOM   10225 C CG  . PHE D 1 340 ? 9.547   -21.235 32.333  1.00 31.34  ? 335 PHE D CG  1 
ATOM   10226 C CD1 . PHE D 1 340 ? 10.898  -21.581 32.320  1.00 30.80  ? 335 PHE D CD1 1 
ATOM   10227 C CD2 . PHE D 1 340 ? 8.686   -21.878 31.461  1.00 29.73  ? 335 PHE D CD2 1 
ATOM   10228 C CE1 . PHE D 1 340 ? 11.381  -22.558 31.445  1.00 30.22  ? 335 PHE D CE1 1 
ATOM   10229 C CE2 . PHE D 1 340 ? 9.158   -22.859 30.577  1.00 31.42  ? 335 PHE D CE2 1 
ATOM   10230 C CZ  . PHE D 1 340 ? 10.508  -23.198 30.571  1.00 30.00  ? 335 PHE D CZ  1 
ATOM   10231 N N   . THR D 1 341 ? 7.203   -17.643 32.775  1.00 39.31  ? 336 THR D N   1 
ATOM   10232 C CA  . THR D 1 341 ? 6.133   -16.791 33.264  1.00 40.63  ? 336 THR D CA  1 
ATOM   10233 C C   . THR D 1 341 ? 4.871   -17.589 33.571  1.00 39.71  ? 336 THR D C   1 
ATOM   10234 O O   . THR D 1 341 ? 4.440   -18.419 32.768  1.00 41.24  ? 336 THR D O   1 
ATOM   10235 C CB  . THR D 1 341 ? 5.815   -15.700 32.240  1.00 40.99  ? 336 THR D CB  1 
ATOM   10236 O OG1 . THR D 1 341 ? 6.891   -14.750 32.224  1.00 43.46  ? 336 THR D OG1 1 
ATOM   10237 C CG2 . THR D 1 341 ? 4.506   -15.002 32.584  1.00 41.96  ? 336 THR D CG2 1 
ATOM   10238 N N   . LEU D 1 342 ? 4.285   -17.334 34.739  1.00 38.73  ? 337 LEU D N   1 
ATOM   10239 C CA  . LEU D 1 342 ? 3.073   -18.026 35.149  1.00 37.93  ? 337 LEU D CA  1 
ATOM   10240 C C   . LEU D 1 342 ? 1.881   -17.475 34.381  1.00 38.24  ? 337 LEU D C   1 
ATOM   10241 O O   . LEU D 1 342 ? 1.356   -16.415 34.708  1.00 38.18  ? 337 LEU D O   1 
ATOM   10242 C CB  . LEU D 1 342 ? 2.846   -17.860 36.656  1.00 35.91  ? 337 LEU D CB  1 
ATOM   10243 C CG  . LEU D 1 342 ? 3.959   -18.336 37.598  1.00 35.25  ? 337 LEU D CG  1 
ATOM   10244 C CD1 . LEU D 1 342 ? 3.478   -18.250 39.031  1.00 35.23  ? 337 LEU D CD1 1 
ATOM   10245 C CD2 . LEU D 1 342 ? 4.351   -19.763 37.283  1.00 35.01  ? 337 LEU D CD2 1 
ATOM   10246 N N   . ALA D 1 343 ? 1.463   -18.192 33.347  1.00 40.65  ? 338 ALA D N   1 
ATOM   10247 C CA  . ALA D 1 343 ? 0.331   -17.761 32.537  1.00 43.34  ? 338 ALA D CA  1 
ATOM   10248 C C   . ALA D 1 343 ? -0.479  -18.967 32.092  1.00 45.47  ? 338 ALA D C   1 
ATOM   10249 O O   . ALA D 1 343 ? 0.048   -20.073 31.969  1.00 44.95  ? 338 ALA D O   1 
ATOM   10250 C CB  . ALA D 1 343 ? 0.818   -16.971 31.324  1.00 44.03  ? 338 ALA D CB  1 
ATOM   10251 N N   . GLU D 1 344 ? -1.759  -18.731 31.831  1.00 48.38  ? 339 GLU D N   1 
ATOM   10252 C CA  . GLU D 1 344 ? -2.687  -19.780 31.430  1.00 52.37  ? 339 GLU D CA  1 
ATOM   10253 C C   . GLU D 1 344 ? -2.816  -19.946 29.917  1.00 50.62  ? 339 GLU D C   1 
ATOM   10254 O O   . GLU D 1 344 ? -3.455  -20.884 29.440  1.00 50.94  ? 339 GLU D O   1 
ATOM   10255 C CB  . GLU D 1 344 ? -4.047  -19.471 32.044  1.00 57.58  ? 339 GLU D CB  1 
ATOM   10256 C CG  . GLU D 1 344 ? -5.000  -20.628 32.138  1.00 67.03  ? 339 GLU D CG  1 
ATOM   10257 C CD  . GLU D 1 344 ? -6.073  -20.362 33.173  1.00 72.98  ? 339 GLU D CD  1 
ATOM   10258 O OE1 . GLU D 1 344 ? -5.748  -20.372 34.381  1.00 75.60  ? 339 GLU D OE1 1 
ATOM   10259 O OE2 . GLU D 1 344 ? -7.236  -20.124 32.782  1.00 77.61  ? 339 GLU D OE2 1 
ATOM   10260 N N   . SER D 1 345 ? -2.205  -19.037 29.168  1.00 49.10  ? 340 SER D N   1 
ATOM   10261 C CA  . SER D 1 345 ? -2.253  -19.089 27.711  1.00 49.21  ? 340 SER D CA  1 
ATOM   10262 C C   . SER D 1 345 ? -1.049  -19.854 27.169  1.00 50.38  ? 340 SER D C   1 
ATOM   10263 O O   . SER D 1 345 ? -0.245  -20.388 27.934  1.00 50.26  ? 340 SER D O   1 
ATOM   10264 C CB  . SER D 1 345 ? -2.248  -17.676 27.128  1.00 47.75  ? 340 SER D CB  1 
ATOM   10265 O OG  . SER D 1 345 ? -1.019  -17.019 27.401  1.00 47.18  ? 340 SER D OG  1 
ATOM   10266 N N   . LEU D 1 346 ? -0.928  -19.906 25.847  1.00 50.33  ? 341 LEU D N   1 
ATOM   10267 C CA  . LEU D 1 346 ? 0.194   -20.592 25.214  1.00 50.80  ? 341 LEU D CA  1 
ATOM   10268 C C   . LEU D 1 346 ? 0.486   -20.007 23.832  1.00 50.96  ? 341 LEU D C   1 
ATOM   10269 O O   . LEU D 1 346 ? -0.440  -19.756 23.053  1.00 51.16  ? 341 LEU D O   1 
ATOM   10270 C CB  . LEU D 1 346 ? -0.086  -22.104 25.104  1.00 50.71  ? 341 LEU D CB  1 
ATOM   10271 C CG  . LEU D 1 346 ? -1.289  -22.602 24.294  1.00 50.04  ? 341 LEU D CG  1 
ATOM   10272 C CD1 . LEU D 1 346 ? -1.361  -24.125 24.355  1.00 48.91  ? 341 LEU D CD1 1 
ATOM   10273 C CD2 . LEU D 1 346 ? -2.570  -21.998 24.857  1.00 52.53  ? 341 LEU D CD2 1 
ATOM   10274 N N   . GLY D 1 347 ? 1.765   -19.753 23.546  1.00 49.60  ? 342 GLY D N   1 
ATOM   10275 C CA  . GLY D 1 347 ? 2.117   -19.234 22.238  1.00 48.64  ? 342 GLY D CA  1 
ATOM   10276 C C   . GLY D 1 347 ? 3.141   -18.129 22.055  1.00 47.94  ? 342 GLY D C   1 
ATOM   10277 O O   . GLY D 1 347 ? 3.788   -18.063 21.012  1.00 48.69  ? 342 GLY D O   1 
ATOM   10278 N N   . GLY D 1 348 ? 3.317   -17.262 23.039  1.00 47.70  ? 343 GLY D N   1 
ATOM   10279 C CA  . GLY D 1 348 ? 4.265   -16.164 22.857  1.00 47.30  ? 343 GLY D CA  1 
ATOM   10280 C C   . GLY D 1 348 ? 5.726   -16.484 22.576  1.00 44.76  ? 343 GLY D C   1 
ATOM   10281 O O   . GLY D 1 348 ? 6.095   -17.631 22.322  1.00 44.44  ? 343 GLY D O   1 
ATOM   10282 N N   . PHE D 1 349 ? 6.555   -15.443 22.595  1.00 42.33  ? 344 PHE D N   1 
ATOM   10283 C CA  . PHE D 1 349 ? 7.984   -15.607 22.402  1.00 39.73  ? 344 PHE D CA  1 
ATOM   10284 C C   . PHE D 1 349 ? 8.541   -15.914 23.782  1.00 39.77  ? 344 PHE D C   1 
ATOM   10285 O O   . PHE D 1 349 ? 9.721   -16.227 23.928  1.00 39.85  ? 344 PHE D O   1 
ATOM   10286 C CB  . PHE D 1 349 ? 8.647   -14.315 21.916  1.00 39.87  ? 344 PHE D CB  1 
ATOM   10287 C CG  . PHE D 1 349 ? 8.247   -13.886 20.529  1.00 40.20  ? 344 PHE D CG  1 
ATOM   10288 C CD1 . PHE D 1 349 ? 7.729   -14.796 19.613  1.00 39.67  ? 344 PHE D CD1 1 
ATOM   10289 C CD2 . PHE D 1 349 ? 8.440   -12.564 20.124  1.00 38.48  ? 344 PHE D CD2 1 
ATOM   10290 C CE1 . PHE D 1 349 ? 7.415   -14.392 18.315  1.00 38.74  ? 344 PHE D CE1 1 
ATOM   10291 C CE2 . PHE D 1 349 ? 8.130   -12.156 18.835  1.00 35.24  ? 344 PHE D CE2 1 
ATOM   10292 C CZ  . PHE D 1 349 ? 7.618   -13.067 17.929  1.00 36.26  ? 344 PHE D CZ  1 
ATOM   10293 N N   . GLU D 1 350 ? 7.686   -15.801 24.795  1.00 40.26  ? 345 GLU D N   1 
ATOM   10294 C CA  . GLU D 1 350 ? 8.087   -16.034 26.177  1.00 42.14  ? 345 GLU D CA  1 
ATOM   10295 C C   . GLU D 1 350 ? 7.631   -17.382 26.722  1.00 40.15  ? 345 GLU D C   1 
ATOM   10296 O O   . GLU D 1 350 ? 6.493   -17.814 26.491  1.00 39.06  ? 345 GLU D O   1 
ATOM   10297 C CB  . GLU D 1 350 ? 7.542   -14.919 27.055  1.00 45.83  ? 345 GLU D CB  1 
ATOM   10298 C CG  . GLU D 1 350 ? 7.916   -13.559 26.547  1.00 56.96  ? 345 GLU D CG  1 
ATOM   10299 C CD  . GLU D 1 350 ? 7.072   -12.463 27.153  1.00 64.75  ? 345 GLU D CD  1 
ATOM   10300 O OE1 . GLU D 1 350 ? 7.153   -12.264 28.392  1.00 69.09  ? 345 GLU D OE1 1 
ATOM   10301 O OE2 . GLU D 1 350 ? 6.324   -11.808 26.384  1.00 68.51  ? 345 GLU D OE2 1 
ATOM   10302 N N   . SER D 1 351 ? 8.534   -18.044 27.443  1.00 37.79  ? 346 SER D N   1 
ATOM   10303 C CA  . SER D 1 351 ? 8.244   -19.346 28.029  1.00 37.84  ? 346 SER D CA  1 
ATOM   10304 C C   . SER D 1 351 ? 7.276   -19.188 29.207  1.00 38.09  ? 346 SER D C   1 
ATOM   10305 O O   . SER D 1 351 ? 7.537   -18.436 30.163  1.00 37.49  ? 346 SER D O   1 
ATOM   10306 C CB  . SER D 1 351 ? 9.547   -20.018 28.472  1.00 37.65  ? 346 SER D CB  1 
ATOM   10307 O OG  . SER D 1 351 ? 10.412  -20.220 27.364  1.00 36.02  ? 346 SER D OG  1 
ATOM   10308 N N   . LEU D 1 352 ? 6.158   -19.907 29.124  1.00 37.33  ? 347 LEU D N   1 
ATOM   10309 C CA  . LEU D 1 352 ? 5.109   -19.853 30.137  1.00 36.57  ? 347 LEU D CA  1 
ATOM   10310 C C   . LEU D 1 352 ? 4.943   -21.170 30.904  1.00 36.34  ? 347 LEU D C   1 
ATOM   10311 O O   . LEU D 1 352 ? 5.169   -22.248 30.355  1.00 36.07  ? 347 LEU D O   1 
ATOM   10312 C CB  . LEU D 1 352 ? 3.790   -19.494 29.451  1.00 37.69  ? 347 LEU D CB  1 
ATOM   10313 C CG  . LEU D 1 352 ? 3.896   -18.399 28.381  1.00 36.94  ? 347 LEU D CG  1 
ATOM   10314 C CD1 . LEU D 1 352 ? 2.588   -18.273 27.612  1.00 35.21  ? 347 LEU D CD1 1 
ATOM   10315 C CD2 . LEU D 1 352 ? 4.277   -17.090 29.050  1.00 37.10  ? 347 LEU D CD2 1 
ATOM   10316 N N   . ALA D 1 353 ? 4.553   -21.067 32.175  1.00 37.24  ? 348 ALA D N   1 
ATOM   10317 C CA  . ALA D 1 353 ? 4.326   -22.229 33.035  1.00 38.57  ? 348 ALA D CA  1 
ATOM   10318 C C   . ALA D 1 353 ? 2.904   -22.172 33.556  1.00 42.02  ? 348 ALA D C   1 
ATOM   10319 O O   . ALA D 1 353 ? 2.284   -21.113 33.581  1.00 43.16  ? 348 ALA D O   1 
ATOM   10320 C CB  . ALA D 1 353 ? 5.285   -22.230 34.192  1.00 36.51  ? 348 ALA D CB  1 
ATOM   10321 N N   . GLU D 1 354 ? 2.390   -23.313 33.995  1.00 47.11  ? 349 GLU D N   1 
ATOM   10322 C CA  . GLU D 1 354 ? 1.027   -23.377 34.491  1.00 49.09  ? 349 GLU D CA  1 
ATOM   10323 C C   . GLU D 1 354 ? 0.758   -24.668 35.259  1.00 49.70  ? 349 GLU D C   1 
ATOM   10324 O O   . GLU D 1 354 ? 1.368   -25.701 34.982  1.00 50.59  ? 349 GLU D O   1 
ATOM   10325 C CB  . GLU D 1 354 ? 0.069   -23.296 33.309  1.00 50.65  ? 349 GLU D CB  1 
ATOM   10326 C CG  . GLU D 1 354 ? -1.378  -23.326 33.705  1.00 57.07  ? 349 GLU D CG  1 
ATOM   10327 C CD  . GLU D 1 354 ? -2.253  -23.911 32.626  1.00 60.89  ? 349 GLU D CD  1 
ATOM   10328 O OE1 . GLU D 1 354 ? -3.492  -23.777 32.730  1.00 64.99  ? 349 GLU D OE1 1 
ATOM   10329 O OE2 . GLU D 1 354 ? -1.702  -24.513 31.679  1.00 62.59  ? 349 GLU D OE2 1 
ATOM   10330 N N   . LEU D 1 355 ? -0.158  -24.601 36.225  1.00 49.52  ? 350 LEU D N   1 
ATOM   10331 C CA  . LEU D 1 355 ? -0.562  -25.767 37.021  1.00 47.05  ? 350 LEU D CA  1 
ATOM   10332 C C   . LEU D 1 355 ? -2.083  -25.873 36.872  1.00 44.95  ? 350 LEU D C   1 
ATOM   10333 O O   . LEU D 1 355 ? -2.835  -25.369 37.699  1.00 43.38  ? 350 LEU D O   1 
ATOM   10334 C CB  . LEU D 1 355 ? -0.185  -25.578 38.495  1.00 48.25  ? 350 LEU D CB  1 
ATOM   10335 C CG  . LEU D 1 355 ? -0.497  -26.723 39.473  1.00 48.72  ? 350 LEU D CG  1 
ATOM   10336 C CD1 . LEU D 1 355 ? 0.291   -27.957 39.102  1.00 47.06  ? 350 LEU D CD1 1 
ATOM   10337 C CD2 . LEU D 1 355 ? -0.148  -26.297 40.886  1.00 48.73  ? 350 LEU D CD2 1 
ATOM   10338 N N   . PRO D 1 356 ? -2.546  -26.531 35.798  1.00 44.55  ? 351 PRO D N   1 
ATOM   10339 C CA  . PRO D 1 356 ? -3.957  -26.735 35.470  1.00 42.44  ? 351 PRO D CA  1 
ATOM   10340 C C   . PRO D 1 356 ? -4.873  -27.055 36.637  1.00 43.71  ? 351 PRO D C   1 
ATOM   10341 O O   . PRO D 1 356 ? -6.034  -26.647 36.638  1.00 44.94  ? 351 PRO D O   1 
ATOM   10342 C CB  . PRO D 1 356 ? -3.906  -27.863 34.454  1.00 41.98  ? 351 PRO D CB  1 
ATOM   10343 C CG  . PRO D 1 356 ? -2.663  -27.550 33.710  1.00 42.17  ? 351 PRO D CG  1 
ATOM   10344 C CD  . PRO D 1 356 ? -1.692  -27.246 34.832  1.00 43.53  ? 351 PRO D CD  1 
ATOM   10345 N N   . ALA D 1 357 ? -4.364  -27.790 37.621  1.00 44.60  ? 352 ALA D N   1 
ATOM   10346 C CA  . ALA D 1 357 ? -5.163  -28.169 38.790  1.00 46.03  ? 352 ALA D CA  1 
ATOM   10347 C C   . ALA D 1 357 ? -5.796  -26.970 39.509  1.00 47.48  ? 352 ALA D C   1 
ATOM   10348 O O   . ALA D 1 357 ? -6.886  -27.084 40.064  1.00 46.10  ? 352 ALA D O   1 
ATOM   10349 C CB  . ALA D 1 357 ? -4.307  -28.974 39.765  1.00 44.09  ? 352 ALA D CB  1 
ATOM   10350 N N   . ILE D 1 358 ? -5.108  -25.830 39.498  1.00 51.00  ? 353 ILE D N   1 
ATOM   10351 C CA  . ILE D 1 358 ? -5.608  -24.615 40.135  1.00 55.52  ? 353 ILE D CA  1 
ATOM   10352 C C   . ILE D 1 358 ? -5.510  -23.407 39.212  1.00 58.97  ? 353 ILE D C   1 
ATOM   10353 O O   . ILE D 1 358 ? -5.131  -22.322 39.643  1.00 58.13  ? 353 ILE D O   1 
ATOM   10354 C CB  . ILE D 1 358 ? -4.837  -24.295 41.421  1.00 55.18  ? 353 ILE D CB  1 
ATOM   10355 C CG1 . ILE D 1 358 ? -3.331  -24.363 41.147  1.00 55.83  ? 353 ILE D CG1 1 
ATOM   10356 C CG2 . ILE D 1 358 ? -5.276  -25.237 42.536  1.00 55.66  ? 353 ILE D CG2 1 
ATOM   10357 C CD1 . ILE D 1 358 ? -2.467  -24.235 42.394  1.00 56.10  ? 353 ILE D CD1 1 
ATOM   10358 N N   . MET D 1 359 ? -5.868  -23.606 37.945  1.00 62.74  ? 354 MET D N   1 
ATOM   10359 C CA  . MET D 1 359 ? -5.831  -22.542 36.944  1.00 66.25  ? 354 MET D CA  1 
ATOM   10360 C C   . MET D 1 359 ? -6.788  -22.843 35.794  1.00 66.81  ? 354 MET D C   1 
ATOM   10361 O O   . MET D 1 359 ? -7.898  -23.335 36.007  1.00 67.85  ? 354 MET D O   1 
ATOM   10362 C CB  . MET D 1 359 ? -4.399  -22.359 36.407  1.00 67.95  ? 354 MET D CB  1 
ATOM   10363 C CG  . MET D 1 359 ? -3.419  -21.760 37.431  1.00 69.84  ? 354 MET D CG  1 
ATOM   10364 S SD  . MET D 1 359 ? -1.767  -21.296 36.804  1.00 72.05  ? 354 MET D SD  1 
ATOM   10365 C CE  . MET D 1 359 ? -0.707  -22.180 37.922  1.00 70.84  ? 354 MET D CE  1 
ATOM   10366 N N   . LEU D 1 372 ? -12.980 -36.750 39.118  1.00 81.06  ? 367 LEU D N   1 
ATOM   10367 C CA  . LEU D 1 372 ? -11.563 -36.584 39.425  1.00 80.87  ? 367 LEU D CA  1 
ATOM   10368 C C   . LEU D 1 372 ? -10.888 -35.577 38.502  1.00 79.49  ? 367 LEU D C   1 
ATOM   10369 O O   . LEU D 1 372 ? -10.868 -35.754 37.279  1.00 79.67  ? 367 LEU D O   1 
ATOM   10370 C CB  . LEU D 1 372 ? -10.827 -37.929 39.329  1.00 81.78  ? 367 LEU D CB  1 
ATOM   10371 C CG  . LEU D 1 372 ? -10.628 -38.752 40.607  1.00 81.79  ? 367 LEU D CG  1 
ATOM   10372 C CD1 . LEU D 1 372 ? -9.908  -40.044 40.258  1.00 81.27  ? 367 LEU D CD1 1 
ATOM   10373 C CD2 . LEU D 1 372 ? -9.817  -37.951 41.629  1.00 81.67  ? 367 LEU D CD2 1 
ATOM   10374 N N   . GLY D 1 373 ? -10.333 -34.527 39.103  1.00 77.15  ? 368 GLY D N   1 
ATOM   10375 C CA  . GLY D 1 373 ? -9.646  -33.499 38.336  1.00 73.93  ? 368 GLY D CA  1 
ATOM   10376 C C   . GLY D 1 373 ? -8.192  -33.837 38.042  1.00 70.70  ? 368 GLY D C   1 
ATOM   10377 O O   . GLY D 1 373 ? -7.598  -34.698 38.694  1.00 71.04  ? 368 GLY D O   1 
ATOM   10378 N N   . ILE D 1 374 ? -7.619  -33.147 37.058  1.00 67.38  ? 369 ILE D N   1 
ATOM   10379 C CA  . ILE D 1 374 ? -6.233  -33.358 36.645  1.00 63.25  ? 369 ILE D CA  1 
ATOM   10380 C C   . ILE D 1 374 ? -5.344  -33.526 37.864  1.00 61.70  ? 369 ILE D C   1 
ATOM   10381 O O   . ILE D 1 374 ? -5.545  -32.855 38.874  1.00 60.80  ? 369 ILE D O   1 
ATOM   10382 C CB  . ILE D 1 374 ? -5.692  -32.165 35.823  1.00 62.65  ? 369 ILE D CB  1 
ATOM   10383 C CG1 . ILE D 1 374 ? -6.842  -31.400 35.165  1.00 63.16  ? 369 ILE D CG1 1 
ATOM   10384 C CG2 . ILE D 1 374 ? -4.749  -32.667 34.741  1.00 60.13  ? 369 ILE D CG2 1 
ATOM   10385 C CD1 . ILE D 1 374 ? -7.700  -30.573 36.131  1.00 63.67  ? 369 ILE D CD1 1 
ATOM   10386 N N   . SER D 1 375 ? -4.362  -34.419 37.773  1.00 60.65  ? 370 SER D N   1 
ATOM   10387 C CA  . SER D 1 375 ? -3.464  -34.637 38.900  1.00 60.73  ? 370 SER D CA  1 
ATOM   10388 C C   . SER D 1 375 ? -2.858  -33.289 39.261  1.00 60.37  ? 370 SER D C   1 
ATOM   10389 O O   . SER D 1 375 ? -2.296  -32.606 38.404  1.00 61.05  ? 370 SER D O   1 
ATOM   10390 C CB  . SER D 1 375 ? -2.355  -35.635 38.542  1.00 59.72  ? 370 SER D CB  1 
ATOM   10391 O OG  . SER D 1 375 ? -1.328  -35.022 37.788  1.00 58.32  ? 370 SER D OG  1 
ATOM   10392 N N   . ASP D 1 376 ? -2.993  -32.898 40.524  1.00 59.92  ? 371 ASP D N   1 
ATOM   10393 C CA  . ASP D 1 376 ? -2.462  -31.621 40.978  1.00 59.56  ? 371 ASP D CA  1 
ATOM   10394 C C   . ASP D 1 376 ? -0.939  -31.631 41.033  1.00 57.02  ? 371 ASP D C   1 
ATOM   10395 O O   . ASP D 1 376 ? -0.319  -30.808 41.707  1.00 56.41  ? 371 ASP D O   1 
ATOM   10396 C CB  . ASP D 1 376 ? -3.044  -31.276 42.348  1.00 63.62  ? 371 ASP D CB  1 
ATOM   10397 C CG  . ASP D 1 376 ? -2.946  -32.422 43.324  1.00 67.75  ? 371 ASP D CG  1 
ATOM   10398 O OD1 . ASP D 1 376 ? -1.821  -32.744 43.765  1.00 69.91  ? 371 ASP D OD1 1 
ATOM   10399 O OD2 . ASP D 1 376 ? -4.002  -33.007 43.645  1.00 70.57  ? 371 ASP D OD2 1 
ATOM   10400 N N   . THR D 1 377 ? -0.342  -32.562 40.300  1.00 53.51  ? 372 THR D N   1 
ATOM   10401 C CA  . THR D 1 377 ? 1.102   -32.685 40.260  1.00 50.81  ? 372 THR D CA  1 
ATOM   10402 C C   . THR D 1 377 ? 1.591   -32.483 38.810  1.00 50.59  ? 372 THR D C   1 
ATOM   10403 O O   . THR D 1 377 ? 2.791   -32.542 38.526  1.00 50.50  ? 372 THR D O   1 
ATOM   10404 C CB  . THR D 1 377 ? 1.517   -34.076 40.812  1.00 50.37  ? 372 THR D CB  1 
ATOM   10405 O OG1 . THR D 1 377 ? 2.894   -34.055 41.198  1.00 49.31  ? 372 THR D OG1 1 
ATOM   10406 C CG2 . THR D 1 377 ? 1.295   -35.162 39.767  1.00 49.73  ? 372 THR D CG2 1 
ATOM   10407 N N   . LEU D 1 378 ? 0.643   -32.215 37.909  1.00 49.05  ? 373 LEU D N   1 
ATOM   10408 C CA  . LEU D 1 378 ? 0.911   -32.003 36.481  1.00 46.58  ? 373 LEU D CA  1 
ATOM   10409 C C   . LEU D 1 378 ? 1.169   -30.547 36.116  1.00 45.74  ? 373 LEU D C   1 
ATOM   10410 O O   . LEU D 1 378 ? 0.471   -29.647 36.576  1.00 47.48  ? 373 LEU D O   1 
ATOM   10411 C CB  . LEU D 1 378 ? -0.269  -32.516 35.646  1.00 45.74  ? 373 LEU D CB  1 
ATOM   10412 C CG  . LEU D 1 378 ? -0.260  -32.291 34.129  1.00 44.45  ? 373 LEU D CG  1 
ATOM   10413 C CD1 . LEU D 1 378 ? -1.330  -33.156 33.520  1.00 44.69  ? 373 LEU D CD1 1 
ATOM   10414 C CD2 . LEU D 1 378 ? -0.516  -30.839 33.777  1.00 42.65  ? 373 LEU D CD2 1 
ATOM   10415 N N   . ILE D 1 379 ? 2.150   -30.327 35.251  1.00 43.45  ? 374 ILE D N   1 
ATOM   10416 C CA  . ILE D 1 379 ? 2.498   -28.985 34.818  1.00 40.34  ? 374 ILE D CA  1 
ATOM   10417 C C   . ILE D 1 379 ? 2.660   -28.916 33.304  1.00 39.88  ? 374 ILE D C   1 
ATOM   10418 O O   . ILE D 1 379 ? 3.297   -29.771 32.696  1.00 39.87  ? 374 ILE D O   1 
ATOM   10419 C CB  . ILE D 1 379 ? 3.807   -28.535 35.480  1.00 40.02  ? 374 ILE D CB  1 
ATOM   10420 C CG1 . ILE D 1 379 ? 3.611   -28.479 36.991  1.00 40.32  ? 374 ILE D CG1 1 
ATOM   10421 C CG2 . ILE D 1 379 ? 4.245   -27.186 34.933  1.00 35.92  ? 374 ILE D CG2 1 
ATOM   10422 C CD1 . ILE D 1 379 ? 4.904   -28.362 37.766  1.00 43.34  ? 374 ILE D CD1 1 
ATOM   10423 N N   . ARG D 1 380 ? 2.058   -27.899 32.698  1.00 40.88  ? 375 ARG D N   1 
ATOM   10424 C CA  . ARG D 1 380 ? 2.166   -27.687 31.256  1.00 39.21  ? 375 ARG D CA  1 
ATOM   10425 C C   . ARG D 1 380 ? 3.042   -26.455 31.031  1.00 38.29  ? 375 ARG D C   1 
ATOM   10426 O O   . ARG D 1 380 ? 2.808   -25.393 31.610  1.00 39.61  ? 375 ARG D O   1 
ATOM   10427 C CB  . ARG D 1 380 ? 0.787   -27.467 30.618  1.00 36.31  ? 375 ARG D CB  1 
ATOM   10428 C CG  . ARG D 1 380 ? 0.864   -27.000 29.174  1.00 36.94  ? 375 ARG D CG  1 
ATOM   10429 C CD  . ARG D 1 380 ? -0.484  -27.031 28.454  1.00 38.92  ? 375 ARG D CD  1 
ATOM   10430 N NE  . ARG D 1 380 ? -1.442  -26.002 28.875  1.00 41.15  ? 375 ARG D NE  1 
ATOM   10431 C CZ  . ARG D 1 380 ? -1.301  -24.694 28.667  1.00 41.10  ? 375 ARG D CZ  1 
ATOM   10432 N NH1 . ARG D 1 380 ? -0.231  -24.226 28.045  1.00 43.42  ? 375 ARG D NH1 1 
ATOM   10433 N NH2 . ARG D 1 380 ? -2.246  -23.849 29.056  1.00 41.83  ? 375 ARG D NH2 1 
ATOM   10434 N N   . LEU D 1 381 ? 4.069   -26.612 30.207  1.00 37.01  ? 376 LEU D N   1 
ATOM   10435 C CA  . LEU D 1 381 ? 4.961   -25.510 29.893  1.00 36.21  ? 376 LEU D CA  1 
ATOM   10436 C C   . LEU D 1 381 ? 4.708   -25.099 28.466  1.00 35.71  ? 376 LEU D C   1 
ATOM   10437 O O   . LEU D 1 381 ? 4.280   -25.912 27.646  1.00 36.16  ? 376 LEU D O   1 
ATOM   10438 C CB  . LEU D 1 381 ? 6.426   -25.932 29.992  1.00 33.58  ? 376 LEU D CB  1 
ATOM   10439 C CG  . LEU D 1 381 ? 6.968   -26.410 31.328  1.00 31.99  ? 376 LEU D CG  1 
ATOM   10440 C CD1 . LEU D 1 381 ? 8.448   -26.717 31.147  1.00 30.54  ? 376 LEU D CD1 1 
ATOM   10441 C CD2 . LEU D 1 381 ? 6.729   -25.349 32.409  1.00 27.56  ? 376 LEU D CD2 1 
ATOM   10442 N N   . SER D 1 382 ? 4.963   -23.829 28.177  1.00 35.79  ? 377 SER D N   1 
ATOM   10443 C CA  . SER D 1 382 ? 4.830   -23.312 26.827  1.00 34.79  ? 377 SER D CA  1 
ATOM   10444 C C   . SER D 1 382 ? 6.209   -22.732 26.567  1.00 34.18  ? 377 SER D C   1 
ATOM   10445 O O   . SER D 1 382 ? 6.468   -21.573 26.892  1.00 34.04  ? 377 SER D O   1 
ATOM   10446 C CB  . SER D 1 382 ? 3.769   -22.220 26.759  1.00 34.68  ? 377 SER D CB  1 
ATOM   10447 O OG  . SER D 1 382 ? 3.542   -21.859 25.407  1.00 36.38  ? 377 SER D OG  1 
ATOM   10448 N N   . VAL D 1 383 ? 7.105   -23.548 26.014  1.00 32.77  ? 378 VAL D N   1 
ATOM   10449 C CA  . VAL D 1 383 ? 8.468   -23.094 25.768  1.00 30.82  ? 378 VAL D CA  1 
ATOM   10450 C C   . VAL D 1 383 ? 8.511   -22.085 24.639  1.00 31.36  ? 378 VAL D C   1 
ATOM   10451 O O   . VAL D 1 383 ? 8.013   -22.350 23.546  1.00 31.17  ? 378 VAL D O   1 
ATOM   10452 C CB  . VAL D 1 383 ? 9.418   -24.269 25.452  1.00 30.21  ? 378 VAL D CB  1 
ATOM   10453 C CG1 . VAL D 1 383 ? 10.834  -23.763 25.284  1.00 27.04  ? 378 VAL D CG1 1 
ATOM   10454 C CG2 . VAL D 1 383 ? 9.389   -25.263 26.584  1.00 29.58  ? 378 VAL D CG2 1 
ATOM   10455 N N   . GLY D 1 384 ? 9.110   -20.929 24.932  1.00 30.12  ? 379 GLY D N   1 
ATOM   10456 C CA  . GLY D 1 384 ? 9.213   -19.851 23.975  1.00 30.03  ? 379 GLY D CA  1 
ATOM   10457 C C   . GLY D 1 384 ? 10.506  -19.839 23.193  1.00 32.25  ? 379 GLY D C   1 
ATOM   10458 O O   . GLY D 1 384 ? 11.097  -20.893 22.955  1.00 33.51  ? 379 GLY D O   1 
ATOM   10459 N N   . LEU D 1 385 ? 10.960  -18.644 22.813  1.00 32.72  ? 380 LEU D N   1 
ATOM   10460 C CA  . LEU D 1 385 ? 12.173  -18.497 22.014  1.00 33.69  ? 380 LEU D CA  1 
ATOM   10461 C C   . LEU D 1 385 ? 13.418  -18.003 22.745  1.00 34.26  ? 380 LEU D C   1 
ATOM   10462 O O   . LEU D 1 385 ? 14.358  -17.517 22.113  1.00 33.41  ? 380 LEU D O   1 
ATOM   10463 C CB  . LEU D 1 385 ? 11.890  -17.580 20.817  1.00 33.99  ? 380 LEU D CB  1 
ATOM   10464 C CG  . LEU D 1 385 ? 10.658  -17.919 19.967  1.00 35.03  ? 380 LEU D CG  1 
ATOM   10465 C CD1 . LEU D 1 385 ? 10.615  -16.991 18.757  1.00 33.94  ? 380 LEU D CD1 1 
ATOM   10466 C CD2 . LEU D 1 385 ? 10.700  -19.378 19.515  1.00 35.08  ? 380 LEU D CD2 1 
ATOM   10467 N N   . GLU D 1 386 ? 13.432  -18.125 24.065  1.00 35.03  ? 381 GLU D N   1 
ATOM   10468 C CA  . GLU D 1 386 ? 14.590  -17.695 24.844  1.00 36.22  ? 381 GLU D CA  1 
ATOM   10469 C C   . GLU D 1 386 ? 15.768  -18.637 24.600  1.00 37.29  ? 381 GLU D C   1 
ATOM   10470 O O   . GLU D 1 386 ? 15.639  -19.620 23.869  1.00 37.78  ? 381 GLU D O   1 
ATOM   10471 C CB  . GLU D 1 386 ? 14.257  -17.686 26.336  1.00 34.81  ? 381 GLU D CB  1 
ATOM   10472 C CG  . GLU D 1 386 ? 13.121  -16.764 26.729  1.00 31.66  ? 381 GLU D CG  1 
ATOM   10473 C CD  . GLU D 1 386 ? 11.765  -17.429 26.682  1.00 30.25  ? 381 GLU D CD  1 
ATOM   10474 O OE1 . GLU D 1 386 ? 10.808  -16.839 27.225  1.00 33.23  ? 381 GLU D OE1 1 
ATOM   10475 O OE2 . GLU D 1 386 ? 11.643  -18.529 26.112  1.00 27.85  ? 381 GLU D OE2 1 
ATOM   10476 N N   . ASP D 1 387 ? 16.915  -18.329 25.203  1.00 39.72  ? 382 ASP D N   1 
ATOM   10477 C CA  . ASP D 1 387 ? 18.105  -19.169 25.063  1.00 43.01  ? 382 ASP D CA  1 
ATOM   10478 C C   . ASP D 1 387 ? 17.885  -20.496 25.784  1.00 43.73  ? 382 ASP D C   1 
ATOM   10479 O O   . ASP D 1 387 ? 17.564  -20.518 26.971  1.00 44.86  ? 382 ASP D O   1 
ATOM   10480 C CB  . ASP D 1 387 ? 19.338  -18.478 25.661  1.00 44.92  ? 382 ASP D CB  1 
ATOM   10481 C CG  . ASP D 1 387 ? 19.993  -17.505 24.697  1.00 48.40  ? 382 ASP D CG  1 
ATOM   10482 O OD1 . ASP D 1 387 ? 20.488  -17.947 23.635  1.00 51.28  ? 382 ASP D OD1 1 
ATOM   10483 O OD2 . ASP D 1 387 ? 20.017  -16.295 25.000  1.00 48.85  ? 382 ASP D OD2 1 
ATOM   10484 N N   . GLU D 1 388 ? 18.063  -21.599 25.071  1.00 44.66  ? 383 GLU D N   1 
ATOM   10485 C CA  . GLU D 1 388 ? 17.880  -22.918 25.659  1.00 48.41  ? 383 GLU D CA  1 
ATOM   10486 C C   . GLU D 1 388 ? 18.579  -23.082 27.014  1.00 49.07  ? 383 GLU D C   1 
ATOM   10487 O O   . GLU D 1 388 ? 17.997  -23.613 27.963  1.00 48.34  ? 383 GLU D O   1 
ATOM   10488 C CB  . GLU D 1 388 ? 18.388  -23.969 24.681  1.00 51.78  ? 383 GLU D CB  1 
ATOM   10489 C CG  . GLU D 1 388 ? 18.463  -25.369 25.226  1.00 55.97  ? 383 GLU D CG  1 
ATOM   10490 C CD  . GLU D 1 388 ? 18.967  -26.341 24.186  1.00 60.35  ? 383 GLU D CD  1 
ATOM   10491 O OE1 . GLU D 1 388 ? 19.256  -27.500 24.546  1.00 64.05  ? 383 GLU D OE1 1 
ATOM   10492 O OE2 . GLU D 1 388 ? 19.072  -25.944 23.004  1.00 62.73  ? 383 GLU D OE2 1 
ATOM   10493 N N   . GLU D 1 389 ? 19.826  -22.627 27.097  1.00 51.48  ? 384 GLU D N   1 
ATOM   10494 C CA  . GLU D 1 389 ? 20.607  -22.723 28.327  1.00 54.08  ? 384 GLU D CA  1 
ATOM   10495 C C   . GLU D 1 389 ? 19.866  -22.101 29.496  1.00 49.51  ? 384 GLU D C   1 
ATOM   10496 O O   . GLU D 1 389 ? 19.673  -22.732 30.538  1.00 48.83  ? 384 GLU D O   1 
ATOM   10497 C CB  . GLU D 1 389 ? 21.944  -22.009 28.155  1.00 63.19  ? 384 GLU D CB  1 
ATOM   10498 C CG  . GLU D 1 389 ? 22.749  -21.894 29.435  1.00 80.95  ? 384 GLU D CG  1 
ATOM   10499 C CD  . GLU D 1 389 ? 23.556  -20.599 29.516  1.00 91.56  ? 384 GLU D CD  1 
ATOM   10500 O OE1 . GLU D 1 389 ? 24.361  -20.454 30.465  1.00 98.38  ? 384 GLU D OE1 1 
ATOM   10501 O OE2 . GLU D 1 389 ? 23.382  -19.722 28.639  1.00 97.80  ? 384 GLU D OE2 1 
ATOM   10502 N N   . ASP D 1 390 ? 19.459  -20.850 29.317  1.00 45.93  ? 385 ASP D N   1 
ATOM   10503 C CA  . ASP D 1 390 ? 18.750  -20.123 30.358  1.00 43.08  ? 385 ASP D CA  1 
ATOM   10504 C C   . ASP D 1 390 ? 17.469  -20.814 30.777  1.00 41.20  ? 385 ASP D C   1 
ATOM   10505 O O   . ASP D 1 390 ? 17.146  -20.855 31.961  1.00 40.01  ? 385 ASP D O   1 
ATOM   10506 C CB  . ASP D 1 390 ? 18.428  -18.699 29.898  1.00 44.50  ? 385 ASP D CB  1 
ATOM   10507 C CG  . ASP D 1 390 ? 19.673  -17.868 29.653  1.00 44.31  ? 385 ASP D CG  1 
ATOM   10508 O OD1 . ASP D 1 390 ? 20.761  -18.278 30.104  1.00 46.07  ? 385 ASP D OD1 1 
ATOM   10509 O OD2 . ASP D 1 390 ? 19.561  -16.799 29.021  1.00 44.95  ? 385 ASP D OD2 1 
ATOM   10510 N N   . LEU D 1 391 ? 16.734  -21.347 29.809  1.00 39.88  ? 386 LEU D N   1 
ATOM   10511 C CA  . LEU D 1 391 ? 15.486  -22.027 30.118  1.00 40.17  ? 386 LEU D CA  1 
ATOM   10512 C C   . LEU D 1 391 ? 15.719  -23.197 31.064  1.00 41.48  ? 386 LEU D C   1 
ATOM   10513 O O   . LEU D 1 391 ? 15.021  -23.343 32.072  1.00 41.00  ? 386 LEU D O   1 
ATOM   10514 C CB  . LEU D 1 391 ? 14.804  -22.506 28.834  1.00 38.86  ? 386 LEU D CB  1 
ATOM   10515 C CG  . LEU D 1 391 ? 14.126  -21.402 28.012  1.00 39.14  ? 386 LEU D CG  1 
ATOM   10516 C CD1 . LEU D 1 391 ? 13.613  -21.982 26.698  1.00 37.01  ? 386 LEU D CD1 1 
ATOM   10517 C CD2 . LEU D 1 391 ? 12.984  -20.775 28.822  1.00 36.96  ? 386 LEU D CD2 1 
ATOM   10518 N N   . LEU D 1 392 ? 16.710  -24.023 30.739  1.00 43.39  ? 387 LEU D N   1 
ATOM   10519 C CA  . LEU D 1 392 ? 17.052  -25.187 31.554  1.00 43.99  ? 387 LEU D CA  1 
ATOM   10520 C C   . LEU D 1 392 ? 17.518  -24.787 32.945  1.00 46.11  ? 387 LEU D C   1 
ATOM   10521 O O   . LEU D 1 392 ? 17.101  -25.388 33.934  1.00 46.16  ? 387 LEU D O   1 
ATOM   10522 C CB  . LEU D 1 392 ? 18.143  -26.003 30.866  1.00 41.53  ? 387 LEU D CB  1 
ATOM   10523 C CG  . LEU D 1 392 ? 17.743  -27.093 29.872  1.00 39.77  ? 387 LEU D CG  1 
ATOM   10524 C CD1 . LEU D 1 392 ? 16.500  -26.702 29.071  1.00 40.67  ? 387 LEU D CD1 1 
ATOM   10525 C CD2 . LEU D 1 392 ? 18.924  -27.345 28.961  1.00 39.13  ? 387 LEU D CD2 1 
ATOM   10526 N N   . GLU D 1 393 ? 18.384  -23.781 33.022  1.00 49.37  ? 388 GLU D N   1 
ATOM   10527 C CA  . GLU D 1 393 ? 18.884  -23.321 34.312  1.00 55.11  ? 388 GLU D CA  1 
ATOM   10528 C C   . GLU D 1 393 ? 17.749  -22.845 35.201  1.00 53.83  ? 388 GLU D C   1 
ATOM   10529 O O   . GLU D 1 393 ? 17.755  -23.094 36.402  1.00 55.79  ? 388 GLU D O   1 
ATOM   10530 C CB  . GLU D 1 393 ? 19.911  -22.199 34.129  1.00 61.34  ? 388 GLU D CB  1 
ATOM   10531 C CG  . GLU D 1 393 ? 21.326  -22.706 33.854  1.00 72.35  ? 388 GLU D CG  1 
ATOM   10532 C CD  . GLU D 1 393 ? 22.296  -21.610 33.409  1.00 78.25  ? 388 GLU D CD  1 
ATOM   10533 O OE1 . GLU D 1 393 ? 22.345  -20.541 34.054  1.00 82.66  ? 388 GLU D OE1 1 
ATOM   10534 O OE2 . GLU D 1 393 ? 23.025  -21.825 32.415  1.00 81.71  ? 388 GLU D OE2 1 
ATOM   10535 N N   . ASP D 1 394 ? 16.769  -22.168 34.613  1.00 53.32  ? 389 ASP D N   1 
ATOM   10536 C CA  . ASP D 1 394 ? 15.627  -21.677 35.375  1.00 51.48  ? 389 ASP D CA  1 
ATOM   10537 C C   . ASP D 1 394 ? 14.762  -22.843 35.869  1.00 51.08  ? 389 ASP D C   1 
ATOM   10538 O O   . ASP D 1 394 ? 14.183  -22.786 36.956  1.00 51.48  ? 389 ASP D O   1 
ATOM   10539 C CB  . ASP D 1 394 ? 14.780  -20.734 34.521  1.00 51.63  ? 389 ASP D CB  1 
ATOM   10540 C CG  . ASP D 1 394 ? 13.673  -20.074 35.317  1.00 51.41  ? 389 ASP D CG  1 
ATOM   10541 O OD1 . ASP D 1 394 ? 14.005  -19.333 36.260  1.00 52.50  ? 389 ASP D OD1 1 
ATOM   10542 O OD2 . ASP D 1 394 ? 12.480  -20.294 35.012  1.00 49.44  ? 389 ASP D OD2 1 
ATOM   10543 N N   . LEU D 1 395 ? 14.664  -23.898 35.066  1.00 48.91  ? 390 LEU D N   1 
ATOM   10544 C CA  . LEU D 1 395 ? 13.879  -25.058 35.462  1.00 47.50  ? 390 LEU D CA  1 
ATOM   10545 C C   . LEU D 1 395 ? 14.609  -25.781 36.571  1.00 49.16  ? 390 LEU D C   1 
ATOM   10546 O O   . LEU D 1 395 ? 14.005  -26.206 37.551  1.00 50.87  ? 390 LEU D O   1 
ATOM   10547 C CB  . LEU D 1 395 ? 13.688  -26.019 34.293  1.00 42.66  ? 390 LEU D CB  1 
ATOM   10548 C CG  . LEU D 1 395 ? 12.729  -25.605 33.182  1.00 39.16  ? 390 LEU D CG  1 
ATOM   10549 C CD1 . LEU D 1 395 ? 12.722  -26.692 32.123  1.00 35.43  ? 390 LEU D CD1 1 
ATOM   10550 C CD2 . LEU D 1 395 ? 11.327  -25.391 33.746  1.00 35.62  ? 390 LEU D CD2 1 
ATOM   10551 N N   . ASP D 1 396 ? 15.919  -25.913 36.396  1.00 50.34  ? 391 ASP D N   1 
ATOM   10552 C CA  . ASP D 1 396 ? 16.788  -26.593 37.354  1.00 51.89  ? 391 ASP D CA  1 
ATOM   10553 C C   . ASP D 1 396 ? 16.743  -25.927 38.730  1.00 52.14  ? 391 ASP D C   1 
ATOM   10554 O O   . ASP D 1 396 ? 16.579  -26.586 39.764  1.00 51.81  ? 391 ASP D O   1 
ATOM   10555 C CB  . ASP D 1 396 ? 18.220  -26.572 36.820  1.00 53.04  ? 391 ASP D CB  1 
ATOM   10556 C CG  . ASP D 1 396 ? 19.127  -27.521 37.548  1.00 53.16  ? 391 ASP D CG  1 
ATOM   10557 O OD1 . ASP D 1 396 ? 18.858  -28.739 37.502  1.00 53.72  ? 391 ASP D OD1 1 
ATOM   10558 O OD2 . ASP D 1 396 ? 20.107  -27.044 38.159  1.00 54.40  ? 391 ASP D OD2 1 
ATOM   10559 N N   . GLN D 1 397 ? 16.894  -24.611 38.719  1.00 51.83  ? 392 GLN D N   1 
ATOM   10560 C CA  . GLN D 1 397 ? 16.890  -23.805 39.924  1.00 51.83  ? 392 GLN D CA  1 
ATOM   10561 C C   . GLN D 1 397 ? 15.594  -23.945 40.738  1.00 53.27  ? 392 GLN D C   1 
ATOM   10562 O O   . GLN D 1 397 ? 15.640  -24.131 41.954  1.00 54.99  ? 392 GLN D O   1 
ATOM   10563 C CB  . GLN D 1 397 ? 17.155  -22.349 39.523  1.00 51.01  ? 392 GLN D CB  1 
ATOM   10564 C CG  . GLN D 1 397 ? 16.913  -21.295 40.584  1.00 50.63  ? 392 GLN D CG  1 
ATOM   10565 C CD  . GLN D 1 397 ? 15.452  -20.889 40.678  1.00 50.57  ? 392 GLN D CD  1 
ATOM   10566 O OE1 . GLN D 1 397 ? 14.761  -20.776 39.658  1.00 46.64  ? 392 GLN D OE1 1 
ATOM   10567 N NE2 . GLN D 1 397 ? 14.976  -20.650 41.905  1.00 49.31  ? 392 GLN D NE2 1 
ATOM   10568 N N   . ALA D 1 398 ? 14.442  -23.873 40.076  1.00 53.19  ? 393 ALA D N   1 
ATOM   10569 C CA  . ALA D 1 398 ? 13.156  -23.985 40.770  1.00 52.99  ? 393 ALA D CA  1 
ATOM   10570 C C   . ALA D 1 398 ? 12.835  -25.413 41.229  1.00 53.76  ? 393 ALA D C   1 
ATOM   10571 O O   . ALA D 1 398 ? 12.071  -25.607 42.170  1.00 53.32  ? 393 ALA D O   1 
ATOM   10572 C CB  . ALA D 1 398 ? 12.036  -23.456 39.881  1.00 51.59  ? 393 ALA D CB  1 
ATOM   10573 N N   . LEU D 1 399 ? 13.401  -26.409 40.557  1.00 55.12  ? 394 LEU D N   1 
ATOM   10574 C CA  . LEU D 1 399 ? 13.175  -27.803 40.935  1.00 55.85  ? 394 LEU D CA  1 
ATOM   10575 C C   . LEU D 1 399 ? 13.967  -28.104 42.207  1.00 57.91  ? 394 LEU D C   1 
ATOM   10576 O O   . LEU D 1 399 ? 13.515  -28.854 43.076  1.00 57.60  ? 394 LEU D O   1 
ATOM   10577 C CB  . LEU D 1 399 ? 13.620  -28.752 39.814  1.00 52.14  ? 394 LEU D CB  1 
ATOM   10578 C CG  . LEU D 1 399 ? 12.634  -28.960 38.665  1.00 49.94  ? 394 LEU D CG  1 
ATOM   10579 C CD1 . LEU D 1 399 ? 13.265  -29.802 37.568  1.00 48.71  ? 394 LEU D CD1 1 
ATOM   10580 C CD2 . LEU D 1 399 ? 11.391  -29.640 39.201  1.00 48.81  ? 394 LEU D CD2 1 
ATOM   10581 N N   . LYS D 1 400 ? 15.154  -27.515 42.306  1.00 59.60  ? 395 LYS D N   1 
ATOM   10582 C CA  . LYS D 1 400 ? 15.995  -27.717 43.472  1.00 60.68  ? 395 LYS D CA  1 
ATOM   10583 C C   . LYS D 1 400 ? 15.382  -26.999 44.661  1.00 61.09  ? 395 LYS D C   1 
ATOM   10584 O O   . LYS D 1 400 ? 15.585  -27.399 45.805  1.00 62.75  ? 395 LYS D O   1 
ATOM   10585 C CB  . LYS D 1 400 ? 17.410  -27.185 43.223  1.00 61.63  ? 395 LYS D CB  1 
ATOM   10586 C CG  . LYS D 1 400 ? 18.235  -28.015 42.244  1.00 62.36  ? 395 LYS D CG  1 
ATOM   10587 C CD  . LYS D 1 400 ? 19.666  -27.501 42.146  1.00 61.79  ? 395 LYS D CD  1 
ATOM   10588 C CE  . LYS D 1 400 ? 20.526  -28.408 41.276  1.00 61.53  ? 395 LYS D CE  1 
ATOM   10589 N NZ  . LYS D 1 400 ? 21.912  -27.875 41.109  1.00 61.65  ? 395 LYS D NZ  1 
ATOM   10590 N N   . ALA D 1 401 ? 14.628  -25.939 44.390  1.00 61.04  ? 396 ALA D N   1 
ATOM   10591 C CA  . ALA D 1 401 ? 13.997  -25.176 45.460  1.00 61.17  ? 396 ALA D CA  1 
ATOM   10592 C C   . ALA D 1 401 ? 12.773  -25.924 45.989  1.00 61.06  ? 396 ALA D C   1 
ATOM   10593 O O   . ALA D 1 401 ? 12.468  -25.874 47.179  1.00 58.82  ? 396 ALA D O   1 
ATOM   10594 C CB  . ALA D 1 401 ? 13.604  -23.783 44.952  1.00 59.66  ? 396 ALA D CB  1 
ATOM   10595 N N   . ALA D 1 402 ? 12.086  -26.628 45.100  1.00 63.10  ? 397 ALA D N   1 
ATOM   10596 C CA  . ALA D 1 402 ? 10.904  -27.386 45.481  1.00 67.55  ? 397 ALA D CA  1 
ATOM   10597 C C   . ALA D 1 402 ? 11.286  -28.629 46.279  1.00 72.11  ? 397 ALA D C   1 
ATOM   10598 O O   . ALA D 1 402 ? 10.422  -29.316 46.825  1.00 71.58  ? 397 ALA D O   1 
ATOM   10599 C CB  . ALA D 1 402 ? 10.120  -27.781 44.242  1.00 67.41  ? 397 ALA D CB  1 
ATOM   10600 N N   . HIS D 1 403 ? 12.583  -28.918 46.331  1.00 77.56  ? 398 HIS D N   1 
ATOM   10601 C CA  . HIS D 1 403 ? 13.105  -30.068 47.072  1.00 82.69  ? 398 HIS D CA  1 
ATOM   10602 C C   . HIS D 1 403 ? 14.456  -29.703 47.693  1.00 87.84  ? 398 HIS D C   1 
ATOM   10603 O O   . HIS D 1 403 ? 15.512  -30.070 47.170  1.00 89.19  ? 398 HIS D O   1 
ATOM   10604 C CB  . HIS D 1 403 ? 13.261  -31.277 46.147  1.00 80.15  ? 398 HIS D CB  1 
ATOM   10605 C CG  . HIS D 1 403 ? 11.965  -31.771 45.580  1.00 78.52  ? 398 HIS D CG  1 
ATOM   10606 N ND1 . HIS D 1 403 ? 10.916  -32.180 46.372  1.00 78.05  ? 398 HIS D ND1 1 
ATOM   10607 C CD2 . HIS D 1 403 ? 11.555  -31.930 44.299  1.00 77.54  ? 398 HIS D CD2 1 
ATOM   10608 C CE1 . HIS D 1 403 ? 9.913   -32.572 45.604  1.00 76.83  ? 398 HIS D CE1 1 
ATOM   10609 N NE2 . HIS D 1 403 ? 10.276  -32.431 44.343  1.00 76.59  ? 398 HIS D NE2 1 
ATOM   10610 N N   . PRO D 1 404 ? 14.429  -28.968 48.823  1.00 94.07  ? 399 PRO D N   1 
ATOM   10611 C CA  . PRO D 1 404 ? 15.580  -28.488 49.602  1.00 95.42  ? 399 PRO D CA  1 
ATOM   10612 C C   . PRO D 1 404 ? 16.635  -29.543 49.944  1.00 96.66  ? 399 PRO D C   1 
ATOM   10613 O O   . PRO D 1 404 ? 16.818  -29.829 51.148  1.00 96.91  ? 399 PRO D O   1 
ATOM   10614 C CB  . PRO D 1 404 ? 14.926  -27.908 50.852  1.00 96.95  ? 399 PRO D CB  1 
ATOM   10615 C CG  . PRO D 1 404 ? 13.617  -27.406 50.335  1.00 96.62  ? 399 PRO D CG  1 
ATOM   10616 C CD  . PRO D 1 404 ? 13.168  -28.549 49.464  1.00 94.67  ? 399 PRO D CD  1 
HETATM 10617 O O   . HOH E 2 .   ? 44.804  -36.727 28.300  1.00 47.81  ? 447 HOH B O   1 
HETATM 10618 O O   . HOH E 2 .   ? 47.054  -36.724 27.024  1.00 52.02  ? 448 HOH B O   1 
HETATM 10619 O O   . HOH E 2 .   ? 64.366  -44.690 -1.332  1.00 64.49  ? 449 HOH B O   1 
HETATM 10620 O O   . HOH E 2 .   ? 78.037  -37.335 -12.839 1.00 22.57  ? 450 HOH B O   1 
HETATM 10621 O O   . HOH E 2 .   ? 68.326  -24.542 3.406   1.00 27.75  ? 451 HOH B O   1 
HETATM 10622 O O   . HOH E 2 .   ? 67.077  -51.607 -24.093 1.00 31.47  ? 452 HOH B O   1 
HETATM 10623 O O   . HOH E 2 .   ? 57.758  -26.534 1.542   1.00 24.31  ? 453 HOH B O   1 
HETATM 10624 O O   . HOH E 2 .   ? 54.294  -38.630 -6.495  1.00 46.10  ? 454 HOH B O   1 
HETATM 10625 O O   . HOH E 2 .   ? 47.525  -47.650 4.021   1.00 25.49  ? 455 HOH B O   1 
HETATM 10626 O O   . HOH E 2 .   ? 50.416  -51.181 -11.761 1.00 35.27  ? 456 HOH B O   1 
HETATM 10627 O O   . HOH E 2 .   ? 51.611  -46.590 -0.400  1.00 28.31  ? 457 HOH B O   1 
HETATM 10628 O O   . HOH E 2 .   ? 50.839  -21.445 -15.633 1.00 32.63  ? 458 HOH B O   1 
HETATM 10629 O O   . HOH E 2 .   ? 52.212  -38.332 3.496   1.00 31.58  ? 459 HOH B O   1 
HETATM 10630 O O   . HOH E 2 .   ? 63.543  -30.878 -7.479  1.00 44.15  ? 460 HOH B O   1 
HETATM 10631 O O   . HOH E 2 .   ? 67.895  -28.866 3.202   1.00 32.88  ? 461 HOH B O   1 
HETATM 10632 O O   . HOH E 2 .   ? 62.997  -27.704 -24.880 1.00 43.61  ? 462 HOH B O   1 
HETATM 10633 O O   . HOH E 2 .   ? 40.368  -24.603 5.066   1.00 26.17  ? 463 HOH B O   1 
HETATM 10634 O O   . HOH E 2 .   ? 61.884  -46.975 -30.369 1.00 31.31  ? 464 HOH B O   1 
HETATM 10635 O O   . HOH E 2 .   ? 53.836  -42.077 16.344  1.00 43.21  ? 465 HOH B O   1 
HETATM 10636 O O   . HOH E 2 .   ? 59.048  -28.034 -2.496  1.00 36.63  ? 466 HOH B O   1 
HETATM 10637 O O   . HOH E 2 .   ? 36.312  -50.206 -4.695  1.00 41.12  ? 467 HOH B O   1 
HETATM 10638 O O   . HOH E 2 .   ? 51.677  -49.715 -2.684  1.00 26.36  ? 468 HOH B O   1 
HETATM 10639 O O   . HOH E 2 .   ? 57.437  -34.583 -17.064 1.00 37.52  ? 469 HOH B O   1 
HETATM 10640 O O   . HOH E 2 .   ? 67.934  -54.345 -24.733 1.00 25.62  ? 470 HOH B O   1 
HETATM 10641 O O   . HOH E 2 .   ? 48.075  -44.086 -18.532 1.00 34.67  ? 471 HOH B O   1 
HETATM 10642 O O   . HOH E 2 .   ? 61.427  -33.708 1.154   1.00 51.73  ? 472 HOH B O   1 
HETATM 10643 O O   . HOH E 2 .   ? 56.863  -54.690 -4.155  1.00 29.90  ? 473 HOH B O   1 
HETATM 10644 O O   . HOH E 2 .   ? 34.858  -44.848 11.949  1.00 53.79  ? 474 HOH B O   1 
HETATM 10645 O O   . HOH E 2 .   ? 33.742  -30.139 2.414   1.00 38.94  ? 475 HOH B O   1 
HETATM 10646 O O   . HOH E 2 .   ? 45.243  -35.498 -18.497 1.00 36.52  ? 476 HOH B O   1 
HETATM 10647 O O   . HOH E 2 .   ? 32.040  -43.049 4.003   1.00 42.26  ? 477 HOH B O   1 
HETATM 10648 O O   . HOH E 2 .   ? 56.253  -46.527 -14.183 1.00 25.03  ? 478 HOH B O   1 
HETATM 10649 O O   . HOH E 2 .   ? 58.008  -24.111 -23.848 1.00 29.82  ? 479 HOH B O   1 
HETATM 10650 O O   . HOH E 2 .   ? 44.946  -37.180 -20.447 1.00 31.27  ? 480 HOH B O   1 
HETATM 10651 O O   . HOH E 2 .   ? 78.528  -28.185 -14.280 1.00 47.91  ? 481 HOH B O   1 
HETATM 10652 O O   . HOH E 2 .   ? 32.949  -26.973 -10.105 1.00 44.18  ? 482 HOH B O   1 
HETATM 10653 O O   . HOH E 2 .   ? 56.015  -12.541 -21.260 1.00 43.86  ? 483 HOH B O   1 
HETATM 10654 O O   . HOH E 2 .   ? 51.624  -39.220 -6.717  1.00 45.66  ? 484 HOH B O   1 
HETATM 10655 O O   . HOH E 2 .   ? 59.345  -48.154 -30.600 1.00 41.53  ? 485 HOH B O   1 
HETATM 10656 O O   . HOH E 2 .   ? 62.967  -38.296 -6.551  1.00 41.62  ? 486 HOH B O   1 
HETATM 10657 O O   . HOH E 2 .   ? 60.571  -50.247 -23.401 1.00 44.90  ? 487 HOH B O   1 
HETATM 10658 O O   . HOH E 2 .   ? 51.938  -41.534 -7.393  1.00 52.84  ? 488 HOH B O   1 
HETATM 10659 O O   . HOH E 2 .   ? 70.003  -47.881 -21.006 1.00 35.41  ? 489 HOH B O   1 
HETATM 10660 O O   . HOH E 2 .   ? 37.548  -46.053 -10.676 1.00 28.84  ? 490 HOH B O   1 
HETATM 10661 O O   . HOH E 2 .   ? 55.094  -43.715 19.949  1.00 35.27  ? 491 HOH B O   1 
HETATM 10662 O O   . HOH E 2 .   ? 63.693  -44.596 -5.274  1.00 34.21  ? 492 HOH B O   1 
HETATM 10663 O O   . HOH E 2 .   ? 31.971  -37.742 11.405  1.00 38.86  ? 493 HOH B O   1 
HETATM 10664 O O   . HOH E 2 .   ? 38.518  -26.807 8.083   1.00 45.56  ? 494 HOH B O   1 
HETATM 10665 O O   . HOH E 2 .   ? 64.189  -35.580 -8.329  1.00 30.60  ? 495 HOH B O   1 
HETATM 10666 O O   . HOH E 2 .   ? 40.600  -34.792 -23.891 1.00 40.55  ? 496 HOH B O   1 
HETATM 10667 O O   . HOH E 2 .   ? 52.585  -36.866 -5.456  1.00 45.53  ? 497 HOH B O   1 
HETATM 10668 O O   . HOH E 2 .   ? 39.791  -35.448 -13.432 1.00 28.75  ? 498 HOH B O   1 
HETATM 10669 O O   . HOH E 2 .   ? 74.242  -23.642 -26.062 1.00 37.39  ? 499 HOH B O   1 
HETATM 10670 O O   . HOH E 2 .   ? 56.637  -36.679 -28.947 1.00 43.90  ? 500 HOH B O   1 
HETATM 10671 O O   . HOH E 2 .   ? 70.382  -52.775 -30.310 1.00 50.03  ? 501 HOH B O   1 
HETATM 10672 O O   . HOH E 2 .   ? 65.894  -16.831 -21.922 1.00 43.42  ? 502 HOH B O   1 
HETATM 10673 O O   . HOH E 2 .   ? 58.656  -47.868 -9.728  1.00 28.13  ? 503 HOH B O   1 
HETATM 10674 O O   . HOH E 2 .   ? 36.525  -32.003 -10.637 1.00 45.48  ? 504 HOH B O   1 
HETATM 10675 O O   . HOH E 2 .   ? 78.447  -23.132 -4.768  1.00 49.64  ? 505 HOH B O   1 
HETATM 10676 O O   . HOH E 2 .   ? 67.754  -46.990 -12.571 1.00 60.70  ? 506 HOH B O   1 
HETATM 10677 O O   . HOH E 2 .   ? 57.482  -39.600 -29.138 1.00 46.98  ? 507 HOH B O   1 
HETATM 10678 O O   . HOH E 2 .   ? 54.247  -47.293 -24.047 1.00 36.40  ? 508 HOH B O   1 
HETATM 10679 O O   . HOH E 2 .   ? 38.927  -43.232 -11.161 1.00 37.01  ? 509 HOH B O   1 
HETATM 10680 O O   . HOH E 2 .   ? 56.436  -41.635 20.882  1.00 43.86  ? 510 HOH B O   1 
HETATM 10681 O O   . HOH E 2 .   ? 35.285  -46.629 -4.031  1.00 35.22  ? 511 HOH B O   1 
HETATM 10682 O O   . HOH E 2 .   ? 53.652  -45.111 -13.669 1.00 32.23  ? 512 HOH B O   1 
HETATM 10683 O O   . HOH E 2 .   ? 65.628  -46.631 -4.312  1.00 35.57  ? 513 HOH B O   1 
HETATM 10684 O O   . HOH E 2 .   ? 51.886  -35.901 -27.476 1.00 31.98  ? 514 HOH B O   1 
HETATM 10685 O O   . HOH E 2 .   ? 68.112  -52.519 -32.017 1.00 47.65  ? 515 HOH B O   1 
HETATM 10686 O O   . HOH E 2 .   ? 50.541  -38.415 26.817  1.00 54.94  ? 516 HOH B O   1 
HETATM 10687 O O   . HOH E 2 .   ? 38.056  -32.854 -13.517 1.00 43.99  ? 517 HOH B O   1 
HETATM 10688 O O   . HOH E 2 .   ? 52.157  -33.872 -19.768 1.00 45.88  ? 518 HOH B O   1 
HETATM 10689 O O   . HOH E 2 .   ? 36.986  -25.754 -9.026  1.00 56.21  ? 519 HOH B O   1 
HETATM 10690 O O   . HOH E 2 .   ? 73.503  -33.274 -4.009  1.00 60.65  ? 520 HOH B O   1 
HETATM 10691 O O   . HOH E 2 .   ? 54.185  -31.696 10.954  1.00 47.34  ? 521 HOH B O   1 
HETATM 10692 O O   . HOH E 2 .   ? 55.605  -31.177 -20.071 1.00 35.30  ? 522 HOH B O   1 
HETATM 10693 O O   . HOH E 2 .   ? 50.569  -52.144 -24.980 1.00 38.80  ? 523 HOH B O   1 
HETATM 10694 O O   . HOH E 2 .   ? 49.479  -28.519 -17.642 1.00 52.45  ? 524 HOH B O   1 
HETATM 10695 O O   . HOH E 2 .   ? 79.122  -31.071 -1.892  1.00 56.60  ? 525 HOH B O   1 
HETATM 10696 O O   . HOH E 2 .   ? 64.919  -42.129 -28.072 1.00 35.43  ? 526 HOH B O   1 
HETATM 10697 O O   . HOH E 2 .   ? 37.223  -25.395 -0.573  1.00 41.27  ? 527 HOH B O   1 
HETATM 10698 O O   . HOH E 2 .   ? 69.379  -26.912 3.441   1.00 50.47  ? 528 HOH B O   1 
HETATM 10699 O O   . HOH E 2 .   ? 64.297  -41.426 -9.168  1.00 32.22  ? 529 HOH B O   1 
HETATM 10700 O O   . HOH E 2 .   ? 68.566  -49.529 -22.876 1.00 57.62  ? 530 HOH B O   1 
HETATM 10701 O O   . HOH E 2 .   ? 51.496  -27.161 -9.930  1.00 45.81  ? 531 HOH B O   1 
HETATM 10702 O O   . HOH E 2 .   ? 68.179  -33.801 -31.892 1.00 39.46  ? 532 HOH B O   1 
HETATM 10703 O O   . HOH E 2 .   ? 69.416  -52.727 -23.924 1.00 43.53  ? 533 HOH B O   1 
HETATM 10704 O O   . HOH E 2 .   ? 35.474  -37.941 -5.276  1.00 33.07  ? 534 HOH B O   1 
HETATM 10705 O O   . HOH E 2 .   ? 32.241  -49.242 -1.986  1.00 43.96  ? 535 HOH B O   1 
HETATM 10706 O O   . HOH E 2 .   ? 54.144  -40.347 3.575   1.00 40.06  ? 536 HOH B O   1 
HETATM 10707 O O   . HOH E 2 .   ? 41.964  -22.866 4.275   1.00 47.52  ? 537 HOH B O   1 
HETATM 10708 O O   . HOH E 2 .   ? 57.811  -19.149 -22.653 1.00 43.99  ? 538 HOH B O   1 
HETATM 10709 O O   . HOH E 2 .   ? 47.916  -39.075 25.935  1.00 67.67  ? 539 HOH B O   1 
HETATM 10710 O O   . HOH E 2 .   ? 49.122  -39.930 -4.764  1.00 63.46  ? 540 HOH B O   1 
HETATM 10711 O O   . HOH E 2 .   ? 55.883  -31.516 -9.519  1.00 52.78  ? 541 HOH B O   1 
HETATM 10712 O O   . HOH E 2 .   ? 65.661  -33.256 -8.066  1.00 50.04  ? 542 HOH B O   1 
HETATM 10713 O O   . HOH E 2 .   ? 55.530  -41.251 18.123  1.00 53.54  ? 543 HOH B O   1 
HETATM 10714 O O   . HOH E 2 .   ? 55.073  -18.495 -22.085 1.00 57.77  ? 544 HOH B O   1 
HETATM 10715 O O   . HOH E 2 .   ? 34.074  -36.106 15.742  1.00 50.22  ? 545 HOH B O   1 
HETATM 10716 O O   . HOH E 2 .   ? 49.807  -43.272 -1.610  1.00 35.17  ? 546 HOH B O   1 
HETATM 10717 O O   . HOH E 2 .   ? 78.289  -16.040 -19.816 1.00 49.16  ? 547 HOH B O   1 
HETATM 10718 O O   . HOH E 2 .   ? 36.096  -43.998 -10.621 1.00 48.75  ? 548 HOH B O   1 
HETATM 10719 O O   . HOH E 2 .   ? 52.629  -15.578 -7.405  1.00 51.08  ? 549 HOH B O   1 
HETATM 10720 O O   . HOH E 2 .   ? 64.764  -41.766 -6.421  1.00 39.95  ? 550 HOH B O   1 
HETATM 10721 O O   . HOH E 2 .   ? 58.645  -28.269 -31.132 1.00 55.08  ? 551 HOH B O   1 
HETATM 10722 O O   . HOH E 2 .   ? 72.859  -23.279 -21.369 1.00 44.49  ? 552 HOH B O   1 
HETATM 10723 O O   . HOH E 2 .   ? 55.140  -45.113 -0.726  1.00 45.06  ? 553 HOH B O   1 
HETATM 10724 O O   . HOH E 2 .   ? 38.051  -46.458 -5.170  1.00 34.68  ? 554 HOH B O   1 
HETATM 10725 O O   . HOH E 2 .   ? 66.674  -39.575 -7.349  1.00 29.02  ? 555 HOH B O   1 
HETATM 10726 O O   . HOH E 2 .   ? 50.987  -37.731 -2.950  1.00 43.75  ? 556 HOH B O   1 
HETATM 10727 O O   . HOH E 2 .   ? 57.171  -46.087 -8.431  1.00 52.30  ? 557 HOH B O   1 
HETATM 10728 O O   . HOH E 2 .   ? 66.132  -22.629 3.354   1.00 52.81  ? 558 HOH B O   1 
HETATM 10729 O O   . HOH E 2 .   ? 34.384  -45.910 -8.675  1.00 47.64  ? 559 HOH B O   1 
HETATM 10730 O O   . HOH E 2 .   ? 50.024  -39.111 23.426  1.00 50.44  ? 560 HOH B O   1 
HETATM 10731 O O   . HOH E 2 .   ? 40.953  -19.334 -4.849  1.00 45.74  ? 561 HOH B O   1 
HETATM 10732 O O   . HOH E 2 .   ? 73.163  -34.661 2.382   1.00 53.08  ? 562 HOH B O   1 
HETATM 10733 O O   . HOH E 2 .   ? 59.623  -20.643 -24.282 1.00 50.58  ? 563 HOH B O   1 
HETATM 10734 O O   . HOH E 2 .   ? 59.421  -35.875 7.829   1.00 52.82  ? 564 HOH B O   1 
HETATM 10735 O O   . HOH E 2 .   ? 41.579  -41.870 -17.907 1.00 46.09  ? 565 HOH B O   1 
HETATM 10736 O O   . HOH E 2 .   ? 77.701  -40.313 -14.088 1.00 34.38  ? 566 HOH B O   1 
HETATM 10737 O O   . HOH E 2 .   ? 51.322  -13.458 -21.241 1.00 58.35  ? 567 HOH B O   1 
HETATM 10738 O O   . HOH E 2 .   ? 61.476  -33.879 9.095   1.00 47.73  ? 568 HOH B O   1 
HETATM 10739 O O   . HOH E 2 .   ? 80.479  -35.703 -21.511 1.00 52.42  ? 569 HOH B O   1 
HETATM 10740 O O   . HOH E 2 .   ? 70.663  -47.024 -29.255 1.00 39.97  ? 570 HOH B O   1 
HETATM 10741 O O   . HOH E 2 .   ? 69.185  -9.727  -22.906 1.00 46.33  ? 571 HOH B O   1 
HETATM 10742 O O   . HOH E 2 .   ? 61.971  -34.873 11.761  1.00 66.75  ? 572 HOH B O   1 
HETATM 10743 O O   . HOH F 2 .   ? 42.235  -72.589 -18.460 1.00 22.55  ? 406 HOH A O   1 
HETATM 10744 O O   . HOH F 2 .   ? 32.629  -60.285 -6.191  1.00 19.56  ? 407 HOH A O   1 
HETATM 10745 O O   . HOH F 2 .   ? 31.256  -64.447 -5.406  1.00 33.12  ? 408 HOH A O   1 
HETATM 10746 O O   . HOH F 2 .   ? 27.339  -68.638 -27.646 1.00 24.70  ? 409 HOH A O   1 
HETATM 10747 O O   . HOH F 2 .   ? 44.108  -56.265 -25.459 1.00 31.42  ? 410 HOH A O   1 
HETATM 10748 O O   . HOH F 2 .   ? 31.703  -77.183 -29.280 1.00 26.32  ? 411 HOH A O   1 
HETATM 10749 O O   . HOH F 2 .   ? 44.936  -79.941 -8.244  1.00 21.10  ? 412 HOH A O   1 
HETATM 10750 O O   . HOH F 2 .   ? 43.181  -69.744 -16.724 1.00 20.41  ? 413 HOH A O   1 
HETATM 10751 O O   . HOH F 2 .   ? 19.271  -47.596 -17.790 1.00 42.46  ? 414 HOH A O   1 
HETATM 10752 O O   . HOH F 2 .   ? 29.774  -60.602 -49.030 1.00 38.81  ? 415 HOH A O   1 
HETATM 10753 O O   . HOH F 2 .   ? 43.656  -39.599 -20.965 1.00 41.10  ? 416 HOH A O   1 
HETATM 10754 O O   . HOH F 2 .   ? 29.885  -89.695 -20.576 1.00 35.38  ? 417 HOH A O   1 
HETATM 10755 O O   . HOH F 2 .   ? 44.943  -51.868 -30.046 1.00 31.55  ? 418 HOH A O   1 
HETATM 10756 O O   . HOH F 2 .   ? 49.049  -53.807 -11.188 1.00 50.21  ? 419 HOH A O   1 
HETATM 10757 O O   . HOH F 2 .   ? 39.102  -38.652 -24.865 1.00 36.28  ? 420 HOH A O   1 
HETATM 10758 O O   . HOH F 2 .   ? 36.732  -69.042 -18.290 1.00 24.78  ? 421 HOH A O   1 
HETATM 10759 O O   . HOH F 2 .   ? 43.709  -58.568 -12.594 1.00 26.82  ? 422 HOH A O   1 
HETATM 10760 O O   . HOH F 2 .   ? 52.770  -70.184 -2.560  1.00 25.04  ? 423 HOH A O   1 
HETATM 10761 O O   . HOH F 2 .   ? 50.652  -53.663 -13.201 1.00 27.91  ? 424 HOH A O   1 
HETATM 10762 O O   . HOH F 2 .   ? 26.808  -66.116 -27.130 1.00 47.50  ? 425 HOH A O   1 
HETATM 10763 O O   . HOH F 2 .   ? 37.107  -48.023 -8.751  1.00 30.26  ? 426 HOH A O   1 
HETATM 10764 O O   . HOH F 2 .   ? 24.997  -75.055 -37.181 1.00 36.34  ? 427 HOH A O   1 
HETATM 10765 O O   . HOH F 2 .   ? 39.074  -60.181 -29.752 1.00 43.34  ? 428 HOH A O   1 
HETATM 10766 O O   . HOH F 2 .   ? 39.600  -57.240 -18.893 1.00 37.47  ? 429 HOH A O   1 
HETATM 10767 O O   . HOH F 2 .   ? 33.085  -67.327 -18.303 1.00 52.27  ? 430 HOH A O   1 
HETATM 10768 O O   . HOH F 2 .   ? 39.749  -45.791 -13.039 1.00 28.67  ? 431 HOH A O   1 
HETATM 10769 O O   . HOH F 2 .   ? 36.165  -70.191 -34.444 1.00 46.67  ? 432 HOH A O   1 
HETATM 10770 O O   . HOH F 2 .   ? 36.195  -58.491 -23.477 1.00 39.14  ? 433 HOH A O   1 
HETATM 10771 O O   . HOH F 2 .   ? 53.351  -54.007 -13.432 1.00 22.96  ? 434 HOH A O   1 
HETATM 10772 O O   . HOH F 2 .   ? 27.793  -92.001 -19.321 1.00 31.28  ? 435 HOH A O   1 
HETATM 10773 O O   . HOH F 2 .   ? 25.706  -77.855 -36.115 1.00 42.58  ? 436 HOH A O   1 
HETATM 10774 O O   . HOH F 2 .   ? 39.666  -39.901 -22.280 1.00 16.88  ? 437 HOH A O   1 
HETATM 10775 O O   . HOH F 2 .   ? 29.305  -74.650 -21.446 1.00 38.92  ? 438 HOH A O   1 
HETATM 10776 O O   . HOH F 2 .   ? 52.973  -61.999 -16.830 1.00 40.11  ? 439 HOH A O   1 
HETATM 10777 O O   . HOH F 2 .   ? 37.257  -40.811 -21.625 1.00 57.12  ? 440 HOH A O   1 
HETATM 10778 O O   . HOH F 2 .   ? 35.786  -48.602 -6.669  1.00 51.16  ? 441 HOH A O   1 
HETATM 10779 O O   . HOH F 2 .   ? 42.119  -41.529 -21.172 1.00 36.76  ? 442 HOH A O   1 
HETATM 10780 O O   . HOH F 2 .   ? 20.109  -48.469 -25.838 1.00 38.83  ? 443 HOH A O   1 
HETATM 10781 O O   . HOH F 2 .   ? 50.094  -52.022 -30.215 1.00 39.24  ? 444 HOH A O   1 
HETATM 10782 O O   . HOH F 2 .   ? 24.542  -65.495 -41.316 1.00 37.15  ? 445 HOH A O   1 
HETATM 10783 O O   . HOH F 2 .   ? 43.551  -73.912 -19.971 1.00 37.51  ? 446 HOH A O   1 
HETATM 10784 O O   . HOH F 2 .   ? 24.004  -67.664 -28.166 1.00 52.90  ? 448 HOH A O   1 
HETATM 10785 O O   . HOH F 2 .   ? 24.770  -88.285 -22.894 1.00 44.89  ? 449 HOH A O   1 
HETATM 10786 O O   . HOH F 2 .   ? 42.116  -37.662 -26.056 1.00 44.90  ? 450 HOH A O   1 
HETATM 10787 O O   . HOH F 2 .   ? 20.967  -84.782 -4.531  1.00 36.99  ? 451 HOH A O   1 
HETATM 10788 O O   . HOH F 2 .   ? 41.284  -63.609 -21.908 1.00 41.44  ? 452 HOH A O   1 
HETATM 10789 O O   . HOH F 2 .   ? 47.397  -55.591 -23.032 1.00 36.14  ? 453 HOH A O   1 
HETATM 10790 O O   . HOH F 2 .   ? 34.371  -56.428 -1.513  1.00 40.11  ? 454 HOH A O   1 
HETATM 10791 O O   . HOH F 2 .   ? 33.371  -72.786 -18.068 1.00 27.47  ? 455 HOH A O   1 
HETATM 10792 O O   . HOH F 2 .   ? 34.241  -59.442 1.309   1.00 40.87  ? 456 HOH A O   1 
HETATM 10793 O O   . HOH F 2 .   ? 49.843  -54.122 -0.871  1.00 49.52  ? 457 HOH A O   1 
HETATM 10794 O O   . HOH F 2 .   ? 26.045  -61.638 -16.357 1.00 37.46  ? 458 HOH A O   1 
HETATM 10795 O O   . HOH F 2 .   ? 36.687  -63.122 3.238   1.00 36.97  ? 459 HOH A O   1 
HETATM 10796 O O   . HOH F 2 .   ? 52.389  -57.353 6.261   1.00 38.95  ? 460 HOH A O   1 
HETATM 10797 O O   . HOH F 2 .   ? 14.016  -48.507 -16.058 1.00 51.72  ? 461 HOH A O   1 
HETATM 10798 O O   . HOH F 2 .   ? 37.213  -65.159 -27.393 1.00 36.45  ? 462 HOH A O   1 
HETATM 10799 O O   . HOH F 2 .   ? 39.640  -63.544 3.268   1.00 32.74  ? 463 HOH A O   1 
HETATM 10800 O O   . HOH F 2 .   ? 44.245  -70.147 -19.332 1.00 36.61  ? 464 HOH A O   1 
HETATM 10801 O O   . HOH F 2 .   ? 38.271  -41.983 -18.450 1.00 64.06  ? 465 HOH A O   1 
HETATM 10802 O O   . HOH F 2 .   ? 55.851  -69.837 -1.425  1.00 20.11  ? 466 HOH A O   1 
HETATM 10803 O O   . HOH F 2 .   ? 28.943  -78.189 -29.373 1.00 37.93  ? 467 HOH A O   1 
HETATM 10804 O O   . HOH F 2 .   ? 21.463  -46.359 -24.766 1.00 45.37  ? 468 HOH A O   1 
HETATM 10805 O O   . HOH F 2 .   ? 23.265  -44.386 -26.374 1.00 51.14  ? 469 HOH A O   1 
HETATM 10806 O O   . HOH F 2 .   ? 26.888  -42.173 -33.009 1.00 40.89  ? 470 HOH A O   1 
HETATM 10807 O O   . HOH F 2 .   ? 46.596  -58.930 -23.566 1.00 41.55  ? 471 HOH A O   1 
HETATM 10808 O O   . HOH F 2 .   ? 46.487  -68.757 -20.603 1.00 41.79  ? 472 HOH A O   1 
HETATM 10809 O O   . HOH F 2 .   ? 34.203  -51.554 -5.286  1.00 46.60  ? 473 HOH A O   1 
HETATM 10810 O O   . HOH F 2 .   ? 38.025  -69.213 -37.829 1.00 58.26  ? 474 HOH A O   1 
HETATM 10811 O O   . HOH F 2 .   ? 41.671  -72.316 0.903   1.00 50.46  ? 475 HOH A O   1 
HETATM 10812 O O   . HOH F 2 .   ? 37.706  -59.011 -19.324 1.00 45.77  ? 476 HOH A O   1 
HETATM 10813 O O   . HOH F 2 .   ? 40.778  -53.926 -7.150  1.00 34.31  ? 477 HOH A O   1 
HETATM 10814 O O   . HOH F 2 .   ? 41.604  -37.708 -23.026 1.00 55.80  ? 478 HOH A O   1 
HETATM 10815 O O   . HOH F 2 .   ? 37.381  -55.665 -20.263 1.00 50.61  ? 479 HOH A O   1 
HETATM 10816 O O   . HOH F 2 .   ? 11.956  -69.857 -19.918 1.00 44.22  ? 480 HOH A O   1 
HETATM 10817 O O   . HOH F 2 .   ? 30.786  -62.776 -37.111 1.00 44.08  ? 481 HOH A O   1 
HETATM 10818 O O   . HOH F 2 .   ? 26.924  -82.287 -26.768 1.00 45.69  ? 482 HOH A O   1 
HETATM 10819 O O   . HOH F 2 .   ? 32.749  -62.767 -7.359  1.00 45.86  ? 483 HOH A O   1 
HETATM 10820 O O   . HOH F 2 .   ? 16.208  -79.216 -2.366  1.00 44.50  ? 484 HOH A O   1 
HETATM 10821 O O   . HOH F 2 .   ? 50.963  -73.357 -4.888  1.00 50.47  ? 485 HOH A O   1 
HETATM 10822 O O   . HOH F 2 .   ? 52.755  -61.377 1.704   1.00 44.50  ? 486 HOH A O   1 
HETATM 10823 O O   . HOH F 2 .   ? 20.023  -62.935 -10.373 1.00 61.59  ? 487 HOH A O   1 
HETATM 10824 O O   . HOH F 2 .   ? 35.767  -85.146 -12.800 1.00 56.54  ? 488 HOH A O   1 
HETATM 10825 O O   . HOH F 2 .   ? 23.497  -64.295 -34.320 1.00 37.73  ? 489 HOH A O   1 
HETATM 10826 O O   . HOH F 2 .   ? 40.407  -58.448 -15.721 1.00 45.15  ? 490 HOH A O   1 
HETATM 10827 O O   . HOH F 2 .   ? 46.223  -58.281 -1.866  1.00 40.47  ? 491 HOH A O   1 
HETATM 10828 O O   . HOH F 2 .   ? 26.853  -62.278 -46.098 1.00 63.69  ? 492 HOH A O   1 
HETATM 10829 O O   . HOH F 2 .   ? 46.814  -56.826 -25.327 1.00 58.07  ? 493 HOH A O   1 
HETATM 10830 O O   . HOH F 2 .   ? 36.851  -59.061 -29.464 1.00 38.31  ? 494 HOH A O   1 
HETATM 10831 O O   . HOH F 2 .   ? 48.351  -64.611 4.252   1.00 39.13  ? 495 HOH A O   1 
HETATM 10832 O O   . HOH F 2 .   ? 19.220  -70.730 -4.082  1.00 47.07  ? 496 HOH A O   1 
HETATM 10833 O O   . HOH F 2 .   ? 51.649  -58.780 -4.760  1.00 49.59  ? 497 HOH A O   1 
HETATM 10834 O O   . HOH F 2 .   ? 15.400  -78.585 -20.887 1.00 65.78  ? 498 HOH A O   1 
HETATM 10835 O O   . HOH F 2 .   ? 31.487  -63.837 -16.103 1.00 53.91  ? 499 HOH A O   1 
HETATM 10836 O O   . HOH F 2 .   ? 48.579  -53.866 -30.898 1.00 51.51  ? 501 HOH A O   1 
HETATM 10837 O O   . HOH F 2 .   ? 56.565  -73.158 4.251   1.00 43.31  ? 502 HOH A O   1 
HETATM 10838 O O   . HOH F 2 .   ? 34.547  -61.881 1.996   1.00 67.32  ? 503 HOH A O   1 
HETATM 10839 O O   . HOH F 2 .   ? 36.047  -60.533 3.805   1.00 33.82  ? 504 HOH A O   1 
HETATM 10840 O O   . HOH F 2 .   ? 50.604  -52.005 -14.994 1.00 43.53  ? 505 HOH A O   1 
HETATM 10841 O O   . HOH F 2 .   ? 26.082  -46.068 -15.439 1.00 52.35  ? 506 HOH A O   1 
HETATM 10842 O O   . HOH F 2 .   ? 35.541  -90.514 -11.819 1.00 45.20  ? 507 HOH A O   1 
HETATM 10843 O O   . HOH F 2 .   ? 33.087  -87.290 -25.005 1.00 44.04  ? 508 HOH A O   1 
HETATM 10844 O O   . HOH F 2 .   ? 40.774  -68.798 1.641   1.00 36.87  ? 509 HOH A O   1 
HETATM 10845 O O   . HOH F 2 .   ? 14.918  -53.488 -26.830 1.00 47.82  ? 510 HOH A O   1 
HETATM 10846 O O   . HOH F 2 .   ? 42.887  -77.348 3.787   1.00 62.03  ? 511 HOH A O   1 
HETATM 10847 O O   . HOH F 2 .   ? 51.757  -61.869 4.082   1.00 44.53  ? 512 HOH A O   1 
HETATM 10848 O O   . HOH F 2 .   ? 21.715  -82.972 -23.687 1.00 57.03  ? 513 HOH A O   1 
HETATM 10849 O O   . HOH F 2 .   ? 19.251  -92.913 -14.842 1.00 41.83  ? 514 HOH A O   1 
HETATM 10850 O O   . HOH F 2 .   ? 34.591  -87.638 -11.347 1.00 49.30  ? 515 HOH A O   1 
HETATM 10851 O O   . HOH F 2 .   ? 49.215  -53.706 -23.421 1.00 56.76  ? 516 HOH A O   1 
HETATM 10852 O O   . HOH F 2 .   ? 37.139  -60.155 -16.884 1.00 46.25  ? 517 HOH A O   1 
HETATM 10853 O O   . HOH F 2 .   ? 40.380  -68.799 -36.060 1.00 61.01  ? 518 HOH A O   1 
HETATM 10854 O O   . HOH F 2 .   ? 54.539  -59.419 -15.792 1.00 40.75  ? 519 HOH A O   1 
HETATM 10855 O O   . HOH F 2 .   ? 45.139  -58.671 5.917   1.00 49.80  ? 520 HOH A O   1 
HETATM 10856 O O   . HOH F 2 .   ? 15.777  -54.041 -21.762 1.00 54.99  ? 521 HOH A O   1 
HETATM 10857 O O   . HOH F 2 .   ? 41.863  -42.883 -33.376 1.00 29.44  ? 522 HOH A O   1 
HETATM 10858 O O   . HOH F 2 .   ? 15.495  -84.523 -11.819 1.00 57.05  ? 523 HOH A O   1 
HETATM 10859 O O   . HOH F 2 .   ? 37.979  -57.438 4.622   1.00 44.76  ? 524 HOH A O   1 
HETATM 10860 O O   . HOH F 2 .   ? 39.350  -76.972 -28.944 1.00 49.71  ? 526 HOH A O   1 
HETATM 10861 O O   . HOH F 2 .   ? 30.936  -39.402 -23.054 1.00 39.50  ? 527 HOH A O   1 
HETATM 10862 O O   . HOH F 2 .   ? 34.804  -64.623 -9.262  1.00 40.41  ? 528 HOH A O   1 
HETATM 10863 O O   . HOH G 2 .   ? 35.369  7.715   -3.117  1.00 29.55  ? 406 HOH C O   1 
HETATM 10864 O O   . HOH G 2 .   ? 9.343   6.637   24.186  1.00 26.91  ? 407 HOH C O   1 
HETATM 10865 O O   . HOH G 2 .   ? 12.997  -12.991 -3.750  1.00 31.71  ? 408 HOH C O   1 
HETATM 10866 O O   . HOH G 2 .   ? 34.212  -2.928  -1.352  1.00 22.79  ? 409 HOH C O   1 
HETATM 10867 O O   . HOH G 2 .   ? 22.331  -8.465  -3.168  1.00 28.86  ? 410 HOH C O   1 
HETATM 10868 O O   . HOH G 2 .   ? 39.163  -9.829  15.955  1.00 30.19  ? 411 HOH C O   1 
HETATM 10869 O O   . HOH G 2 .   ? 12.985  -1.993  9.934   1.00 29.05  ? 412 HOH C O   1 
HETATM 10870 O O   . HOH G 2 .   ? 18.774  -6.541  -16.432 1.00 34.55  ? 413 HOH C O   1 
HETATM 10871 O O   . HOH G 2 .   ? 32.911  2.185   25.123  1.00 40.55  ? 414 HOH C O   1 
HETATM 10872 O O   . HOH G 2 .   ? 17.246  -5.541  -19.807 1.00 37.81  ? 415 HOH C O   1 
HETATM 10873 O O   . HOH G 2 .   ? 15.983  2.991   5.539   1.00 35.77  ? 416 HOH C O   1 
HETATM 10874 O O   . HOH G 2 .   ? 32.824  -1.528  2.776   1.00 39.72  ? 417 HOH C O   1 
HETATM 10875 O O   . HOH G 2 .   ? 14.195  -9.032  0.720   1.00 20.65  ? 418 HOH C O   1 
HETATM 10876 O O   . HOH G 2 .   ? 26.255  -3.301  17.259  1.00 30.00  ? 419 HOH C O   1 
HETATM 10877 O O   . HOH G 2 .   ? 15.544  -6.957  13.846  1.00 28.63  ? 420 HOH C O   1 
HETATM 10878 O O   . HOH G 2 .   ? 29.718  3.112   7.776   1.00 50.99  ? 421 HOH C O   1 
HETATM 10879 O O   . HOH G 2 .   ? 12.923  -21.311 -9.866  1.00 37.58  ? 422 HOH C O   1 
HETATM 10880 O O   . HOH G 2 .   ? 10.969  -8.989  2.983   1.00 27.05  ? 423 HOH C O   1 
HETATM 10881 O O   . HOH G 2 .   ? 24.817  -8.669  27.598  1.00 25.14  ? 424 HOH C O   1 
HETATM 10882 O O   . HOH G 2 .   ? 8.537   -10.081 24.952  1.00 34.01  ? 425 HOH C O   1 
HETATM 10883 O O   . HOH G 2 .   ? 23.038  -28.706 -11.130 1.00 33.60  ? 426 HOH C O   1 
HETATM 10884 O O   . HOH G 2 .   ? 32.374  17.862  14.502  1.00 37.62  ? 427 HOH C O   1 
HETATM 10885 O O   . HOH G 2 .   ? 33.857  -27.714 10.169  1.00 39.46  ? 428 HOH C O   1 
HETATM 10886 O O   . HOH G 2 .   ? 27.495  -17.951 32.213  1.00 53.06  ? 429 HOH C O   1 
HETATM 10887 O O   . HOH G 2 .   ? 6.976   6.972   25.361  1.00 29.50  ? 430 HOH C O   1 
HETATM 10888 O O   . HOH G 2 .   ? 16.561  -12.611 19.153  1.00 34.60  ? 431 HOH C O   1 
HETATM 10889 O O   . HOH G 2 .   ? 46.478  17.668  7.059   1.00 46.57  ? 432 HOH C O   1 
HETATM 10890 O O   . HOH G 2 .   ? 9.740   -10.287 12.012  1.00 31.67  ? 433 HOH C O   1 
HETATM 10891 O O   . HOH G 2 .   ? 17.397  -10.787 1.904   1.00 21.66  ? 434 HOH C O   1 
HETATM 10892 O O   . HOH G 2 .   ? 4.300   9.099   25.693  1.00 43.65  ? 435 HOH C O   1 
HETATM 10893 O O   . HOH G 2 .   ? 32.113  7.648   -3.078  1.00 34.31  ? 436 HOH C O   1 
HETATM 10894 O O   . HOH G 2 .   ? 43.513  -19.145 2.354   1.00 38.99  ? 437 HOH C O   1 
HETATM 10895 O O   . HOH G 2 .   ? 30.132  -27.068 -2.010  1.00 35.86  ? 438 HOH C O   1 
HETATM 10896 O O   . HOH G 2 .   ? 4.368   6.823   24.752  1.00 41.49  ? 439 HOH C O   1 
HETATM 10897 O O   . HOH G 2 .   ? 28.451  -22.572 13.528  1.00 39.37  ? 440 HOH C O   1 
HETATM 10898 O O   . HOH G 2 .   ? 10.440  -24.374 5.157   1.00 37.40  ? 441 HOH C O   1 
HETATM 10899 O O   . HOH G 2 .   ? 20.249  -6.587  -3.364  1.00 33.18  ? 442 HOH C O   1 
HETATM 10900 O O   . HOH G 2 .   ? 23.264  -11.546 24.785  1.00 44.40  ? 443 HOH C O   1 
HETATM 10901 O O   . HOH G 2 .   ? 22.546  2.861   -9.091  1.00 42.67  ? 444 HOH C O   1 
HETATM 10902 O O   . HOH G 2 .   ? 35.226  -23.560 0.745   1.00 32.59  ? 445 HOH C O   1 
HETATM 10903 O O   . HOH G 2 .   ? 36.630  -2.801  24.064  1.00 37.72  ? 446 HOH C O   1 
HETATM 10904 O O   . HOH G 2 .   ? 22.260  -9.836  -24.872 1.00 47.51  ? 447 HOH C O   1 
HETATM 10905 O O   . HOH G 2 .   ? 36.313  -24.846 7.951   1.00 54.98  ? 448 HOH C O   1 
HETATM 10906 O O   . HOH G 2 .   ? 6.127   -3.885  4.194   1.00 38.84  ? 449 HOH C O   1 
HETATM 10907 O O   . HOH G 2 .   ? 23.911  10.754  30.794  1.00 38.36  ? 450 HOH C O   1 
HETATM 10908 O O   . HOH G 2 .   ? 35.119  -3.490  -16.646 1.00 54.63  ? 451 HOH C O   1 
HETATM 10909 O O   . HOH G 2 .   ? 27.684  -6.152  18.775  1.00 38.95  ? 452 HOH C O   1 
HETATM 10910 O O   . HOH G 2 .   ? 6.600   -6.490  21.328  1.00 38.15  ? 453 HOH C O   1 
HETATM 10911 O O   . HOH G 2 .   ? 22.508  1.900   6.842   1.00 49.94  ? 454 HOH C O   1 
HETATM 10912 O O   . HOH G 2 .   ? 13.879  5.189   4.593   1.00 39.13  ? 455 HOH C O   1 
HETATM 10913 O O   . HOH G 2 .   ? 20.675  -3.043  29.736  1.00 39.66  ? 456 HOH C O   1 
HETATM 10914 O O   . HOH G 2 .   ? 26.860  -24.253 20.805  1.00 37.00  ? 457 HOH C O   1 
HETATM 10915 O O   . HOH G 2 .   ? 14.380  -23.039 11.198  1.00 39.88  ? 458 HOH C O   1 
HETATM 10916 O O   . HOH G 2 .   ? 29.600  -4.995  20.364  1.00 24.75  ? 459 HOH C O   1 
HETATM 10917 O O   . HOH G 2 .   ? 35.921  -20.423 -4.986  1.00 28.30  ? 460 HOH C O   1 
HETATM 10918 O O   . HOH G 2 .   ? 25.104  -15.428 18.997  1.00 43.68  ? 461 HOH C O   1 
HETATM 10919 O O   . HOH G 2 .   ? 24.927  -1.192  18.198  1.00 34.74  ? 462 HOH C O   1 
HETATM 10920 O O   . HOH G 2 .   ? 35.167  5.295   31.573  1.00 42.38  ? 463 HOH C O   1 
HETATM 10921 O O   . HOH G 2 .   ? 25.278  -20.863 13.722  1.00 31.59  ? 464 HOH C O   1 
HETATM 10922 O O   . HOH G 2 .   ? 27.279  -21.554 20.346  1.00 32.42  ? 465 HOH C O   1 
HETATM 10923 O O   . HOH G 2 .   ? 37.391  12.374  21.959  1.00 43.65  ? 466 HOH C O   1 
HETATM 10924 O O   . HOH G 2 .   ? 16.348  3.264   2.587   1.00 52.52  ? 467 HOH C O   1 
HETATM 10925 O O   . HOH G 2 .   ? 23.755  -3.760  29.342  1.00 36.46  ? 468 HOH C O   1 
HETATM 10926 O O   . HOH G 2 .   ? 20.519  -11.305 3.711   1.00 38.44  ? 469 HOH C O   1 
HETATM 10927 O O   . HOH G 2 .   ? 22.746  -15.824 20.776  1.00 31.01  ? 470 HOH C O   1 
HETATM 10928 O O   . HOH G 2 .   ? 19.785  -2.984  4.381   1.00 33.41  ? 471 HOH C O   1 
HETATM 10929 O O   . HOH G 2 .   ? 26.868  -8.559  20.084  1.00 40.17  ? 472 HOH C O   1 
HETATM 10930 O O   . HOH G 2 .   ? 25.208  3.448   8.549   1.00 36.97  ? 473 HOH C O   1 
HETATM 10931 O O   . HOH G 2 .   ? 14.126  -22.692 5.367   1.00 39.22  ? 474 HOH C O   1 
HETATM 10932 O O   . HOH G 2 .   ? 42.054  -5.522  22.255  1.00 62.19  ? 475 HOH C O   1 
HETATM 10933 O O   . HOH G 2 .   ? 29.064  -6.552  -10.571 1.00 46.33  ? 476 HOH C O   1 
HETATM 10934 O O   . HOH G 2 .   ? 9.363   10.977  23.856  1.00 53.26  ? 477 HOH C O   1 
HETATM 10935 O O   . HOH G 2 .   ? 18.697  3.974   6.683   1.00 41.33  ? 478 HOH C O   1 
HETATM 10936 O O   . HOH G 2 .   ? 14.121  -25.424 4.277   1.00 30.47  ? 479 HOH C O   1 
HETATM 10937 O O   . HOH G 2 .   ? 34.706  -23.262 9.556   1.00 58.06  ? 480 HOH C O   1 
HETATM 10938 O O   . HOH G 2 .   ? 22.970  -9.673  3.134   1.00 49.43  ? 481 HOH C O   1 
HETATM 10939 O O   . HOH G 2 .   ? 15.636  -5.856  0.990   1.00 47.07  ? 482 HOH C O   1 
HETATM 10940 O O   . HOH G 2 .   ? 19.143  3.517   9.407   1.00 36.58  ? 483 HOH C O   1 
HETATM 10941 O O   . HOH G 2 .   ? 16.920  -23.024 10.701  1.00 65.50  ? 484 HOH C O   1 
HETATM 10942 O O   . HOH G 2 .   ? 29.118  -4.857  9.637   1.00 63.70  ? 485 HOH C O   1 
HETATM 10943 O O   . HOH G 2 .   ? 37.165  -3.969  -1.970  1.00 59.33  ? 486 HOH C O   1 
HETATM 10944 O O   . HOH G 2 .   ? 32.127  -10.942 17.918  1.00 56.32  ? 487 HOH C O   1 
HETATM 10945 O O   . HOH G 2 .   ? 29.489  18.388  2.298   1.00 61.50  ? 488 HOH C O   1 
HETATM 10946 O O   . HOH G 2 .   ? 12.757  9.659   21.535  1.00 39.73  ? 489 HOH C O   1 
HETATM 10947 O O   . HOH G 2 .   ? 33.448  -9.128  9.965   1.00 36.70  ? 490 HOH C O   1 
HETATM 10948 O O   . HOH G 2 .   ? 37.594  -18.903 -3.992  1.00 40.75  ? 491 HOH C O   1 
HETATM 10949 O O   . HOH G 2 .   ? 17.181  -28.670 -3.826  1.00 42.53  ? 492 HOH C O   1 
HETATM 10950 O O   . HOH G 2 .   ? 48.570  -4.742  21.129  1.00 51.27  ? 493 HOH C O   1 
HETATM 10951 O O   . HOH G 2 .   ? 30.721  -22.996 15.356  1.00 53.14  ? 494 HOH C O   1 
HETATM 10952 O O   . HOH G 2 .   ? 41.287  16.201  21.580  1.00 62.87  ? 495 HOH C O   1 
HETATM 10953 O O   . HOH G 2 .   ? 48.121  4.635   17.967  1.00 54.17  ? 496 HOH C O   1 
HETATM 10954 O O   . HOH G 2 .   ? 34.617  4.244   5.275   1.00 55.32  ? 497 HOH C O   1 
HETATM 10955 O O   . HOH G 2 .   ? 24.938  -1.201  -7.609  1.00 54.76  ? 498 HOH C O   1 
HETATM 10956 O O   . HOH G 2 .   ? 14.721  -12.279 -12.439 1.00 53.61  ? 499 HOH C O   1 
HETATM 10957 O O   . HOH G 2 .   ? 11.749  -7.795  0.527   1.00 57.33  ? 500 HOH C O   1 
HETATM 10958 O O   . HOH G 2 .   ? 41.205  -19.724 4.070   1.00 59.10  ? 501 HOH C O   1 
HETATM 10959 O O   . HOH G 2 .   ? 46.985  -9.419  21.819  1.00 54.63  ? 502 HOH C O   1 
HETATM 10960 O O   . HOH G 2 .   ? 46.685  8.786   7.530   1.00 51.04  ? 503 HOH C O   1 
HETATM 10961 O O   . HOH G 2 .   ? 55.800  3.830   18.453  1.00 64.05  ? 504 HOH C O   1 
HETATM 10962 O O   . HOH G 2 .   ? 26.077  -26.736 16.159  1.00 49.82  ? 505 HOH C O   1 
HETATM 10963 O O   . HOH G 2 .   ? 29.649  -16.570 23.635  1.00 34.34  ? 506 HOH C O   1 
HETATM 10964 O O   . HOH G 2 .   ? 19.857  -1.684  2.019   1.00 47.66  ? 507 HOH C O   1 
HETATM 10965 O O   . HOH G 2 .   ? 7.248   -4.794  32.262  1.00 47.36  ? 508 HOH C O   1 
HETATM 10966 O O   . HOH G 2 .   ? 41.814  -2.863  22.743  1.00 41.69  ? 509 HOH C O   1 
HETATM 10967 O O   . HOH G 2 .   ? 20.967  5.977   7.659   1.00 30.45  ? 510 HOH C O   1 
HETATM 10968 O O   . HOH G 2 .   ? 27.530  5.258   7.978   1.00 55.13  ? 511 HOH C O   1 
HETATM 10969 O O   . HOH G 2 .   ? 7.558   8.633   23.963  1.00 48.63  ? 512 HOH C O   1 
HETATM 10970 O O   . HOH G 2 .   ? 9.642   -13.319 -6.875  1.00 42.44  ? 513 HOH C O   1 
HETATM 10971 O O   . HOH G 2 .   ? 14.380  -4.511  14.461  1.00 31.97  ? 514 HOH C O   1 
HETATM 10972 O O   . HOH G 2 .   ? 45.114  -0.783  -0.305  1.00 40.02  ? 515 HOH C O   1 
HETATM 10973 O O   . HOH G 2 .   ? 36.970  -4.016  -14.965 1.00 52.85  ? 516 HOH C O   1 
HETATM 10974 O O   . HOH G 2 .   ? 13.713  9.752   29.215  1.00 45.18  ? 517 HOH C O   1 
HETATM 10975 O O   . HOH G 2 .   ? 51.443  6.012   12.782  1.00 55.00  ? 518 HOH C O   1 
HETATM 10976 O O   . HOH G 2 .   ? 51.704  -6.360  4.218   1.00 48.70  ? 519 HOH C O   1 
HETATM 10977 O O   . HOH G 2 .   ? 16.954  0.117   12.357  1.00 51.23  ? 520 HOH C O   1 
HETATM 10978 O O   . HOH G 2 .   ? 26.939  -27.698 5.461   1.00 36.87  ? 521 HOH C O   1 
HETATM 10979 O O   . HOH H 2 .   ? -12.084 -18.387 18.773  1.00 24.64  ? 406 HOH D O   1 
HETATM 10980 O O   . HOH H 2 .   ? 0.532   -28.105 6.403   1.00 21.36  ? 407 HOH D O   1 
HETATM 10981 O O   . HOH H 2 .   ? -16.885 -28.141 28.752  1.00 35.50  ? 408 HOH D O   1 
HETATM 10982 O O   . HOH H 2 .   ? -19.352 -15.640 8.449   1.00 21.32  ? 409 HOH D O   1 
HETATM 10983 O O   . HOH H 2 .   ? 4.455   -16.571 25.652  1.00 29.97  ? 410 HOH D O   1 
HETATM 10984 O O   . HOH H 2 .   ? -3.779  -29.339 5.714   1.00 29.75  ? 411 HOH D O   1 
HETATM 10985 O O   . HOH H 2 .   ? -8.655  -23.925 18.614  1.00 27.89  ? 412 HOH D O   1 
HETATM 10986 O O   . HOH H 2 .   ? 13.003  -41.843 17.990  1.00 47.81  ? 413 HOH D O   1 
HETATM 10987 O O   . HOH H 2 .   ? 0.068   -30.876 49.221  1.00 29.23  ? 414 HOH D O   1 
HETATM 10988 O O   . HOH H 2 .   ? -9.073  -17.450 17.029  1.00 26.88  ? 415 HOH D O   1 
HETATM 10989 O O   . HOH H 2 .   ? 12.596  -12.887 37.656  1.00 48.49  ? 416 HOH D O   1 
HETATM 10990 O O   . HOH H 2 .   ? 19.414  -22.429 18.937  1.00 61.88  ? 417 HOH D O   1 
HETATM 10991 O O   . HOH H 2 .   ? -4.295  -35.665 42.055  1.00 56.28  ? 418 HOH D O   1 
HETATM 10992 O O   . HOH H 2 .   ? 3.442   -8.465  -6.231  1.00 49.60  ? 419 HOH D O   1 
HETATM 10993 O O   . HOH H 2 .   ? -3.752  -12.450 -3.800  1.00 29.63  ? 420 HOH D O   1 
HETATM 10994 O O   . HOH H 2 .   ? -14.098 -35.614 36.955  1.00 36.28  ? 421 HOH D O   1 
HETATM 10995 O O   . HOH H 2 .   ? -9.817  -7.916  2.977   1.00 30.55  ? 422 HOH D O   1 
HETATM 10996 O O   . HOH H 2 .   ? 19.967  -17.791 21.072  1.00 40.92  ? 423 HOH D O   1 
HETATM 10997 O O   . HOH H 2 .   ? -17.563 -31.782 29.650  1.00 39.87  ? 424 HOH D O   1 
HETATM 10998 O O   . HOH H 2 .   ? 2.101   -17.068 12.890  1.00 33.88  ? 425 HOH D O   1 
HETATM 10999 O O   . HOH H 2 .   ? -1.312  -7.673  17.184  1.00 37.27  ? 426 HOH D O   1 
HETATM 11000 O O   . HOH H 2 .   ? -14.359 -30.809 23.015  1.00 47.07  ? 427 HOH D O   1 
HETATM 11001 O O   . HOH H 2 .   ? 20.651  -23.621 22.163  1.00 45.03  ? 428 HOH D O   1 
HETATM 11002 O O   . HOH H 2 .   ? 14.852  -20.890 13.267  1.00 27.51  ? 429 HOH D O   1 
HETATM 11003 O O   . HOH H 2 .   ? 3.547   -20.936 19.334  1.00 37.63  ? 430 HOH D O   1 
HETATM 11004 O O   . HOH H 2 .   ? 5.116   -13.232 23.412  1.00 37.86  ? 431 HOH D O   1 
HETATM 11005 O O   . HOH H 2 .   ? -28.371 -25.860 8.632   1.00 57.46  ? 432 HOH D O   1 
HETATM 11006 O O   . HOH H 2 .   ? -2.030  -29.935 37.243  1.00 34.59  ? 433 HOH D O   1 
HETATM 11007 O O   . HOH H 2 .   ? -9.280  -3.822  1.741   1.00 25.74  ? 434 HOH D O   1 
HETATM 11008 O O   . HOH H 2 .   ? -24.114 -39.586 4.896   1.00 38.87  ? 435 HOH D O   1 
HETATM 11009 O O   . HOH H 2 .   ? 20.479  -20.912 22.387  1.00 26.59  ? 436 HOH D O   1 
HETATM 11010 O O   . HOH H 2 .   ? 8.156   -10.715 30.622  1.00 47.03  ? 437 HOH D O   1 
HETATM 11011 O O   . HOH H 2 .   ? -2.307  -24.023 -2.860  1.00 40.41  ? 438 HOH D O   1 
HETATM 11012 O O   . HOH H 2 .   ? 0.990   -6.365  15.917  1.00 32.72  ? 439 HOH D O   1 
HETATM 11013 O O   . HOH H 2 .   ? -16.568 -15.747 -2.931  1.00 45.89  ? 440 HOH D O   1 
HETATM 11014 O O   . HOH H 2 .   ? 0.828   -33.969 8.342   1.00 51.91  ? 441 HOH D O   1 
HETATM 11015 O O   . HOH H 2 .   ? -2.806  -20.950 -3.051  1.00 30.09  ? 442 HOH D O   1 
HETATM 11016 O O   . HOH H 2 .   ? -1.092  -33.642 46.125  1.00 64.06  ? 443 HOH D O   1 
HETATM 11017 O O   . HOH H 2 .   ? 20.186  -30.567 49.160  1.00 54.92  ? 444 HOH D O   1 
HETATM 11018 O O   . HOH H 2 .   ? -32.387 -41.370 14.578  1.00 51.42  ? 445 HOH D O   1 
HETATM 11019 O O   . HOH H 2 .   ? 6.590   -45.489 26.884  1.00 47.13  ? 446 HOH D O   1 
HETATM 11020 O O   . HOH H 2 .   ? 23.608  -26.305 39.989  1.00 38.54  ? 447 HOH D O   1 
HETATM 11021 O O   . HOH H 2 .   ? -24.667 -25.619 3.417   1.00 40.60  ? 448 HOH D O   1 
HETATM 11022 O O   . HOH H 2 .   ? 1.491   -8.861  13.206  1.00 42.88  ? 449 HOH D O   1 
HETATM 11023 O O   . HOH H 2 .   ? -16.311 -29.695 30.309  1.00 42.36  ? 450 HOH D O   1 
HETATM 11024 O O   . HOH H 2 .   ? -21.929 -33.806 26.717  1.00 50.81  ? 451 HOH D O   1 
HETATM 11025 O O   . HOH H 2 .   ? 3.796   -26.274 1.659   1.00 43.32  ? 452 HOH D O   1 
HETATM 11026 O O   . HOH H 2 .   ? 4.814   -15.368 36.455  1.00 41.56  ? 453 HOH D O   1 
HETATM 11027 O O   . HOH H 2 .   ? 0.173   -24.636 -3.854  1.00 29.61  ? 454 HOH D O   1 
HETATM 11028 O O   . HOH H 2 .   ? 7.527   -28.101 7.478   1.00 36.68  ? 455 HOH D O   1 
HETATM 11029 O O   . HOH H 2 .   ? -20.592 -23.436 22.131  1.00 47.19  ? 456 HOH D O   1 
HETATM 11030 O O   . HOH H 2 .   ? 5.243   -23.512 20.554  1.00 44.41  ? 457 HOH D O   1 
HETATM 11031 O O   . HOH H 2 .   ? 1.664   -23.792 29.521  1.00 24.53  ? 458 HOH D O   1 
HETATM 11032 O O   . HOH H 2 .   ? 6.715   -19.951 7.345   1.00 35.00  ? 459 HOH D O   1 
HETATM 11033 O O   . HOH H 2 .   ? 2.928   -4.674  15.095  1.00 41.42  ? 460 HOH D O   1 
HETATM 11034 O O   . HOH H 2 .   ? 20.594  -31.053 37.378  1.00 45.72  ? 461 HOH D O   1 
HETATM 11035 O O   . HOH H 2 .   ? -0.375  -12.944 0.396   1.00 58.00  ? 462 HOH D O   1 
HETATM 11036 O O   . HOH H 2 .   ? 22.707  -18.384 26.674  1.00 43.14  ? 463 HOH D O   1 
HETATM 11037 O O   . HOH H 2 .   ? -13.960 -31.710 20.859  1.00 47.61  ? 464 HOH D O   1 
HETATM 11038 O O   . HOH H 2 .   ? 3.618   -13.765 26.019  1.00 44.17  ? 465 HOH D O   1 
HETATM 11039 O O   . HOH H 2 .   ? -24.554 -24.740 12.886  1.00 63.40  ? 466 HOH D O   1 
HETATM 11040 O O   . HOH H 2 .   ? 8.827   -15.845 30.275  1.00 32.63  ? 467 HOH D O   1 
HETATM 11041 O O   . HOH H 2 .   ? -9.659  -48.670 20.239  1.00 60.90  ? 468 HOH D O   1 
HETATM 11042 O O   . HOH H 2 .   ? -2.029  -28.008 7.364   1.00 42.28  ? 469 HOH D O   1 
HETATM 11043 O O   . HOH H 2 .   ? -26.418 -24.338 5.062   1.00 51.31  ? 470 HOH D O   1 
HETATM 11044 O O   . HOH H 2 .   ? 2.510   -14.446 2.152   1.00 41.83  ? 471 HOH D O   1 
HETATM 11045 O O   . HOH H 2 .   ? 2.262   -20.148 15.976  1.00 50.22  ? 472 HOH D O   1 
HETATM 11046 O O   . HOH H 2 .   ? -2.721  -40.378 10.894  1.00 59.65  ? 473 HOH D O   1 
HETATM 11047 O O   . HOH H 2 .   ? -17.379 -45.247 21.293  1.00 66.71  ? 474 HOH D O   1 
HETATM 11048 O O   . HOH H 2 .   ? -11.793 -19.036 -0.573  1.00 52.03  ? 475 HOH D O   1 
HETATM 11049 O O   . HOH H 2 .   ? -8.677  -5.837  0.839   1.00 52.13  ? 476 HOH D O   1 
HETATM 11050 O O   . HOH H 2 .   ? -18.771 -44.613 2.540   1.00 49.96  ? 477 HOH D O   1 
HETATM 11051 O O   . HOH H 2 .   ? 1.903   -22.735 18.990  1.00 46.30  ? 478 HOH D O   1 
HETATM 11052 O O   . HOH H 2 .   ? -21.318 -34.902 6.300   1.00 51.41  ? 479 HOH D O   1 
HETATM 11053 O O   . HOH H 2 .   ? -12.210 -27.142 18.246  1.00 39.23  ? 480 HOH D O   1 
HETATM 11054 O O   . HOH H 2 .   ? 14.073  -18.699 43.223  1.00 54.47  ? 481 HOH D O   1 
HETATM 11055 O O   . HOH H 2 .   ? 17.661  -24.250 21.626  1.00 49.96  ? 482 HOH D O   1 
HETATM 11056 O O   . HOH H 2 .   ? -12.630 -9.749  4.982   1.00 50.59  ? 483 HOH D O   1 
HETATM 11057 O O   . HOH H 2 .   ? -10.043 -41.450 4.280   1.00 42.66  ? 484 HOH D O   1 
HETATM 11058 O O   . HOH H 2 .   ? 2.760   -22.497 -4.539  1.00 42.11  ? 485 HOH D O   1 
HETATM 11059 O O   . HOH H 2 .   ? -15.320 -35.768 39.325  1.00 52.74  ? 486 HOH D O   1 
HETATM 11060 O O   . HOH H 2 .   ? 12.049  -40.485 25.994  1.00 47.29  ? 487 HOH D O   1 
HETATM 11061 O O   . HOH H 2 .   ? 12.984  -39.722 36.946  1.00 52.78  ? 488 HOH D O   1 
HETATM 11062 O O   . HOH H 2 .   ? -9.329  -16.411 19.598  1.00 41.26  ? 489 HOH D O   1 
HETATM 11063 O O   . HOH H 2 .   ? -3.932  -26.148 9.467   1.00 38.48  ? 490 HOH D O   1 
HETATM 11064 O O   . HOH H 2 .   ? 17.981  -18.690 33.557  1.00 27.66  ? 491 HOH D O   1 
HETATM 11065 O O   . HOH H 2 .   ? 8.012   -43.494 12.935  1.00 50.62  ? 492 HOH D O   1 
HETATM 11066 O O   . HOH H 2 .   ? -6.360  -24.825 34.059  1.00 54.74  ? 493 HOH D O   1 
HETATM 11067 O O   . HOH H 2 .   ? -6.947  -42.567 27.443  1.00 58.64  ? 494 HOH D O   1 
HETATM 11068 O O   . HOH H 2 .   ? 8.887   -26.593 5.599   1.00 47.12  ? 495 HOH D O   1 
HETATM 11069 O O   . HOH H 2 .   ? 0.484   -21.519 29.872  1.00 33.91  ? 496 HOH D O   1 
HETATM 11070 O O   . HOH H 2 .   ? -4.892  -23.451 28.612  1.00 51.59  ? 497 HOH D O   1 
HETATM 11071 O O   . HOH H 2 .   ? 21.841  -21.363 25.297  1.00 48.26  ? 498 HOH D O   1 
HETATM 11072 O O   . HOH H 2 .   ? 0.654   -20.598 35.689  1.00 67.04  ? 499 HOH D O   1 
HETATM 11073 O O   . HOH H 2 .   ? -6.930  -37.515 28.809  1.00 55.28  ? 500 HOH D O   1 
HETATM 11074 O O   . HOH H 2 .   ? 1.717   -14.164 24.211  1.00 43.48  ? 501 HOH D O   1 
HETATM 11075 O O   . HOH H 2 .   ? -0.563  -36.548 47.409  1.00 59.83  ? 502 HOH D O   1 
HETATM 11076 O O   . HOH H 2 .   ? 18.363  -33.826 33.240  1.00 40.76  ? 503 HOH D O   1 
HETATM 11077 O O   . HOH H 2 .   ? 14.842  -40.793 28.846  1.00 49.98  ? 504 HOH D O   1 
HETATM 11078 O O   . HOH H 2 .   ? -22.980 -39.414 23.815  1.00 46.58  ? 505 HOH D O   1 
HETATM 11079 O O   . HOH H 2 .   ? -29.424 -25.267 11.940  1.00 48.52  ? 506 HOH D O   1 
HETATM 11080 O O   . HOH H 2 .   ? -4.924  -14.445 -8.044  1.00 42.30  ? 507 HOH D O   1 
HETATM 11081 O O   . HOH H 2 .   ? -26.530 -28.131 25.265  1.00 45.46  ? 508 HOH D O   1 
HETATM 11082 O O   . HOH H 2 .   ? -24.113 -45.422 12.064  1.00 67.15  ? 509 HOH D O   1 
HETATM 11083 O O   . HOH H 2 .   ? 10.097  -41.763 38.168  1.00 47.57  ? 510 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  ?   ?   ?   B . n 
A 1 2   SER 2   -3  ?   ?   ?   B . n 
A 1 3   PRO 3   -2  ?   ?   ?   B . n 
A 1 4   ASN 4   -1  ?   ?   ?   B . n 
A 1 5   SER 5   0   ?   ?   ?   B . n 
A 1 6   MET 6   1   ?   ?   ?   B . n 
A 1 7   GLN 7   2   ?   ?   ?   B . n 
A 1 8   GLU 8   3   ?   ?   ?   B . n 
A 1 9   LYS 9   4   ?   ?   ?   B . n 
A 1 10  ASP 10  5   ?   ?   ?   B . n 
A 1 11  ALA 11  6   ?   ?   ?   B . n 
A 1 12  SER 12  7   ?   ?   ?   B . n 
A 1 13  SER 13  8   ?   ?   ?   B . n 
A 1 14  GLN 14  9   9   GLN GLN B . n 
A 1 15  GLY 15  10  10  GLY GLY B . n 
A 1 16  PHE 16  11  11  PHE PHE B . n 
A 1 17  LEU 17  12  12  LEU LEU B . n 
A 1 18  PRO 18  13  13  PRO PRO B . n 
A 1 19  HIS 19  14  14  HIS HIS B . n 
A 1 20  PHE 20  15  15  PHE PHE B . n 
A 1 21  GLN 21  16  16  GLN GLN B . n 
A 1 22  HIS 22  17  17  HIS HIS B . n 
A 1 23  PHE 23  18  18  PHE PHE B . n 
A 1 24  ALA 24  19  19  ALA ALA B . n 
A 1 25  THR 25  20  20  THR THR B . n 
A 1 26  GLN 26  21  21  GLN GLN B . n 
A 1 27  ALA 27  22  22  ALA ALA B . n 
A 1 28  ILE 28  23  23  ILE ILE B . n 
A 1 29  HIS 29  24  24  HIS HIS B . n 
A 1 30  VAL 30  25  25  VAL VAL B . n 
A 1 31  GLY 31  26  26  GLY GLY B . n 
A 1 32  GLN 32  27  27  GLN GLN B . n 
A 1 33  ASP 33  28  ?   ?   ?   B . n 
A 1 34  PRO 34  29  ?   ?   ?   B . n 
A 1 35  GLU 35  30  ?   ?   ?   B . n 
A 1 36  GLN 36  31  ?   ?   ?   B . n 
A 1 37  TRP 37  32  ?   ?   ?   B . n 
A 1 38  THR 38  33  ?   ?   ?   B . n 
A 1 39  SER 39  34  ?   ?   ?   B . n 
A 1 40  ARG 40  35  ?   ?   ?   B . n 
A 1 41  ALA 41  36  ?   ?   ?   B . n 
A 1 42  VAL 42  37  ?   ?   ?   B . n 
A 1 43  VAL 43  38  ?   ?   ?   B . n 
A 1 44  PRO 44  39  ?   ?   ?   B . n 
A 1 45  PRO 45  40  ?   ?   ?   B . n 
A 1 46  ILE 46  41  ?   ?   ?   B . n 
A 1 47  SER 47  42  ?   ?   ?   B . n 
A 1 48  LEU 48  43  ?   ?   ?   B . n 
A 1 49  SER 49  44  ?   ?   ?   B . n 
A 1 50  THR 50  45  ?   ?   ?   B . n 
A 1 51  THR 51  46  ?   ?   ?   B . n 
A 1 52  PHE 52  47  ?   ?   ?   B . n 
A 1 53  LYS 53  48  ?   ?   ?   B . n 
A 1 54  GLN 54  49  ?   ?   ?   B . n 
A 1 55  GLY 55  50  ?   ?   ?   B . n 
A 1 56  ALA 56  51  ?   ?   ?   B . n 
A 1 57  PRO 57  52  ?   ?   ?   B . n 
A 1 58  GLY 58  53  ?   ?   ?   B . n 
A 1 59  GLN 59  54  ?   ?   ?   B . n 
A 1 60  HIS 60  55  ?   ?   ?   B . n 
A 1 61  SER 61  56  ?   ?   ?   B . n 
A 1 62  GLY 62  57  ?   ?   ?   B . n 
A 1 63  PHE 63  58  ?   ?   ?   B . n 
A 1 64  GLU 64  59  ?   ?   ?   B . n 
A 1 65  TYR 65  60  ?   ?   ?   B . n 
A 1 66  SER 66  61  ?   ?   ?   B . n 
A 1 67  ARG 67  62  ?   ?   ?   B . n 
A 1 68  SER 68  63  ?   ?   ?   B . n 
A 1 69  GLY 69  64  64  GLY GLY B . n 
A 1 70  ASN 70  65  65  ASN ASN B . n 
A 1 71  PRO 71  66  66  PRO PRO B . n 
A 1 72  THR 72  67  67  THR THR B . n 
A 1 73  ARG 73  68  68  ARG ARG B . n 
A 1 74  ASN 74  69  69  ASN ASN B . n 
A 1 75  CYS 75  70  70  CYS CYS B . n 
A 1 76  LEU 76  71  71  LEU LEU B . n 
A 1 77  GLU 77  72  72  GLU GLU B . n 
A 1 78  LYS 78  73  73  LYS LYS B . n 
A 1 79  ALA 79  74  74  ALA ALA B . n 
A 1 80  VAL 80  75  75  VAL VAL B . n 
A 1 81  ALA 81  76  76  ALA ALA B . n 
A 1 82  ALA 82  77  77  ALA ALA B . n 
A 1 83  LEU 83  78  78  LEU LEU B . n 
A 1 84  ASP 84  79  79  ASP ASP B . n 
A 1 85  GLY 85  80  80  GLY GLY B . n 
A 1 86  ALA 86  81  81  ALA ALA B . n 
A 1 87  LYS 87  82  82  LYS LYS B . n 
A 1 88  TYR 88  83  83  TYR TYR B . n 
A 1 89  CYS 89  84  84  CYS CYS B . n 
A 1 90  LEU 90  85  85  LEU LEU B . n 
A 1 91  ALA 91  86  86  ALA ALA B . n 
A 1 92  PHE 92  87  87  PHE PHE B . n 
A 1 93  ALA 93  88  88  ALA ALA B . n 
A 1 94  SER 94  89  89  SER SER B . n 
A 1 95  GLY 95  90  90  GLY GLY B . n 
A 1 96  LEU 96  91  91  LEU LEU B . n 
A 1 97  ALA 97  92  92  ALA ALA B . n 
A 1 98  ALA 98  93  93  ALA ALA B . n 
A 1 99  THR 99  94  94  THR THR B . n 
A 1 100 VAL 100 95  95  VAL VAL B . n 
A 1 101 THR 101 96  96  THR THR B . n 
A 1 102 ILE 102 97  97  ILE ILE B . n 
A 1 103 THR 103 98  98  THR THR B . n 
A 1 104 HIS 104 99  99  HIS HIS B . n 
A 1 105 LEU 105 100 100 LEU LEU B . n 
A 1 106 LEU 106 101 101 LEU LEU B . n 
A 1 107 LYS 107 102 102 LYS LYS B . n 
A 1 108 ALA 108 103 103 ALA ALA B . n 
A 1 109 GLY 109 104 104 GLY GLY B . n 
A 1 110 ASP 110 105 105 ASP ASP B . n 
A 1 111 GLN 111 106 106 GLN GLN B . n 
A 1 112 ILE 112 107 107 ILE ILE B . n 
A 1 113 ILE 113 108 108 ILE ILE B . n 
A 1 114 CYS 114 109 109 CYS CYS B . n 
A 1 115 MET 115 110 110 MET MET B . n 
A 1 116 ASP 116 111 111 ASP ASP B . n 
A 1 117 ASP 117 112 112 ASP ASP B . n 
A 1 118 VAL 118 113 113 VAL VAL B . n 
A 1 119 TYR 119 114 114 TYR TYR B . n 
A 1 120 GLY 120 115 115 GLY GLY B . n 
A 1 121 GLY 121 116 116 GLY GLY B . n 
A 1 122 THR 122 117 117 THR THR B . n 
A 1 123 ASN 123 118 118 ASN ASN B . n 
A 1 124 ARG 124 119 119 ARG ARG B . n 
A 1 125 TYR 125 120 120 TYR TYR B . n 
A 1 126 PHE 126 121 121 PHE PHE B . n 
A 1 127 ARG 127 122 122 ARG ARG B . n 
A 1 128 GLN 128 123 123 GLN GLN B . n 
A 1 129 VAL 129 124 124 VAL VAL B . n 
A 1 130 ALA 130 125 125 ALA ALA B . n 
A 1 131 SER 131 126 126 SER SER B . n 
A 1 132 GLU 132 127 127 GLU GLU B . n 
A 1 133 PHE 133 128 128 PHE PHE B . n 
A 1 134 GLY 134 129 129 GLY GLY B . n 
A 1 135 LEU 135 130 130 LEU LEU B . n 
A 1 136 LYS 136 131 131 LYS LYS B . n 
A 1 137 ILE 137 132 132 ILE ILE B . n 
A 1 138 SER 138 133 133 SER SER B . n 
A 1 139 PHE 139 134 134 PHE PHE B . n 
A 1 140 VAL 140 135 135 VAL VAL B . n 
A 1 141 ASP 141 136 136 ASP ASP B . n 
A 1 142 CYS 142 137 137 CYS CYS B . n 
A 1 143 SER 143 138 138 SER SER B . n 
A 1 144 LYS 144 139 139 LYS LYS B . n 
A 1 145 ILE 145 140 140 ILE ILE B . n 
A 1 146 LYS 146 141 141 LYS LYS B . n 
A 1 147 LEU 147 142 142 LEU LEU B . n 
A 1 148 LEU 148 143 143 LEU LEU B . n 
A 1 149 GLU 149 144 144 GLU GLU B . n 
A 1 150 ALA 150 145 145 ALA ALA B . n 
A 1 151 ALA 151 146 146 ALA ALA B . n 
A 1 152 ILE 152 147 147 ILE ILE B . n 
A 1 153 THR 153 148 148 THR THR B . n 
A 1 154 PRO 154 149 149 PRO PRO B . n 
A 1 155 GLU 155 150 150 GLU GLU B . n 
A 1 156 THR 156 151 151 THR THR B . n 
A 1 157 LYS 157 152 152 LYS LYS B . n 
A 1 158 LEU 158 153 153 LEU LEU B . n