data_3F9C
# 
_entry.id   3F9C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3F9C         
RCSB  RCSB050309   
WWPDB D_1000050309 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3D59 'THE SAME WILD TYPE PROTEIN'               unspecified 
PDB 3D5E 'THE SAME PROTEIN COMPLEXED WITH PARAOXON' unspecified 
PDB 3F96 'THE SAME PROTEIN COMPLEXED WITH SARIN'    unspecified 
PDB 3F97 'THE SAME PROTEIN COMPLEXED WITH SOMAN'    unspecified 
PDB 3F98 'THE SAME PROTEIN COMPLEXED WITH TABUN'    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3F9C 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Samanta, U.'   1 
'Bahnson, B.J.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of human group-VIIA phospholipase A2 inhibited by organophosphorus nerve agents exhibit non-aged complexes.' 
_citation.journal_abbrev            'Biochem Pharmacol' 
_citation.journal_volume            78 
_citation.page_first                420 
_citation.page_last                 429 
_citation.year                      2009 
_citation.journal_id_ASTM           BCPCA6 
_citation.country                   UK 
_citation.journal_id_ISSN           0006-2952 
_citation.journal_id_CSD            0725 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19394314 
_citation.pdbx_database_id_DOI      10.1016/j.bcp.2009.04.018 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Samanta, U.'    1 
primary 'Kirby, S.D.'    2 
primary 'Srinivasan, P.' 3 
primary 'Cerasoli, D.M.' 4 
primary 'Bahnson, B.J.'  5 
# 
_cell.entry_id           3F9C 
_cell.length_a           116.375 
_cell.length_b           82.400 
_cell.length_c           96.511 
_cell.angle_alpha        90.00 
_cell.angle_beta         115.64 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3F9C 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Platelet-activating factor acetylhydrolase' 43494.367 2   3.1.1.47 ? 'UNP RESIDUES 47-429' ? 
2 non-polymer syn 'DIISOPROPYL PHOSPHONATE'                    166.155   2   ?        ? ?                     ? 
3 water       nat water                                        18.015    170 ?        ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;PAF acetylhydrolase, PAF 2-acylhydrolase, LDL-associated phospholipase A2, LDL-PLA(2), 2-acetyl-1-alkylglycerophosphocholine esterase, 1-alkyl-2-acetylglycerophosphocholine esterase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFG
SMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYL
RTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSED
QRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIG
HMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGTNINTTNQHI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFG
SMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYL
RTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSED
QRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIG
HMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGTNINTTNQHI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   ALA n 
1 4   SER n 
1 5   PHE n 
1 6   GLY n 
1 7   GLN n 
1 8   THR n 
1 9   LYS n 
1 10  ILE n 
1 11  PRO n 
1 12  ARG n 
1 13  GLY n 
1 14  ASN n 
1 15  GLY n 
1 16  PRO n 
1 17  TYR n 
1 18  SER n 
1 19  VAL n 
1 20  GLY n 
1 21  CYS n 
1 22  THR n 
1 23  ASP n 
1 24  LEU n 
1 25  MET n 
1 26  PHE n 
1 27  ASP n 
1 28  HIS n 
1 29  THR n 
1 30  ASN n 
1 31  LYS n 
1 32  GLY n 
1 33  THR n 
1 34  PHE n 
1 35  LEU n 
1 36  ARG n 
1 37  LEU n 
1 38  TYR n 
1 39  TYR n 
1 40  PRO n 
1 41  SER n 
1 42  GLN n 
1 43  ASP n 
1 44  ASN n 
1 45  ASP n 
1 46  ARG n 
1 47  LEU n 
1 48  ASP n 
1 49  THR n 
1 50  LEU n 
1 51  TRP n 
1 52  ILE n 
1 53  PRO n 
1 54  ASN n 
1 55  LYS n 
1 56  GLU n 
1 57  TYR n 
1 58  PHE n 
1 59  TRP n 
1 60  GLY n 
1 61  LEU n 
1 62  SER n 
1 63  LYS n 
1 64  PHE n 
1 65  LEU n 
1 66  GLY n 
1 67  THR n 
1 68  HIS n 
1 69  TRP n 
1 70  LEU n 
1 71  MET n 
1 72  GLY n 
1 73  ASN n 
1 74  ILE n 
1 75  LEU n 
1 76  ARG n 
1 77  LEU n 
1 78  LEU n 
1 79  PHE n 
1 80  GLY n 
1 81  SER n 
1 82  MET n 
1 83  THR n 
1 84  THR n 
1 85  PRO n 
1 86  ALA n 
1 87  ASN n 
1 88  TRP n 
1 89  ASN n 
1 90  SER n 
1 91  PRO n 
1 92  LEU n 
1 93  ARG n 
1 94  PRO n 
1 95  GLY n 
1 96  GLU n 
1 97  LYS n 
1 98  TYR n 
1 99  PRO n 
1 100 LEU n 
1 101 VAL n 
1 102 VAL n 
1 103 PHE n 
1 104 SER n 
1 105 HIS n 
1 106 GLY n 
1 107 LEU n 
1 108 GLY n 
1 109 ALA n 
1 110 PHE n 
1 111 ARG n 
1 112 THR n 
1 113 LEU n 
1 114 TYR n 
1 115 SER n 
1 116 ALA n 
1 117 ILE n 
1 118 GLY n 
1 119 ILE n 
1 120 ASP n 
1 121 LEU n 
1 122 ALA n 
1 123 SER n 
1 124 HIS n 
1 125 GLY n 
1 126 PHE n 
1 127 ILE n 
1 128 VAL n 
1 129 ALA n 
1 130 ALA n 
1 131 VAL n 
1 132 GLU n 
1 133 HIS n 
1 134 ARG n 
1 135 ASP n 
1 136 ARG n 
1 137 SER n 
1 138 ALA n 
1 139 SER n 
1 140 ALA n 
1 141 THR n 
1 142 TYR n 
1 143 TYR n 
1 144 PHE n 
1 145 LYS n 
1 146 ASP n 
1 147 GLN n 
1 148 SER n 
1 149 ALA n 
1 150 ALA n 
1 151 GLU n 
1 152 ILE n 
1 153 GLY n 
1 154 ASP n 
1 155 LYS n 
1 156 SER n 
1 157 TRP n 
1 158 LEU n 
1 159 TYR n 
1 160 LEU n 
1 161 ARG n 
1 162 THR n 
1 163 LEU n 
1 164 LYS n 
1 165 GLN n 
1 166 GLU n 
1 167 GLU n 
1 168 GLU n 
1 169 THR n 
1 170 HIS n 
1 171 ILE n 
1 172 ARG n 
1 173 ASN n 
1 174 GLU n 
1 175 GLN n 
1 176 VAL n 
1 177 ARG n 
1 178 GLN n 
1 179 ARG n 
1 180 ALA n 
1 181 LYS n 
1 182 GLU n 
1 183 CYS n 
1 184 SER n 
1 185 GLN n 
1 186 ALA n 
1 187 LEU n 
1 188 SER n 
1 189 LEU n 
1 190 ILE n 
1 191 LEU n 
1 192 ASP n 
1 193 ILE n 
1 194 ASP n 
1 195 HIS n 
1 196 GLY n 
1 197 LYS n 
1 198 PRO n 
1 199 VAL n 
1 200 LYS n 
1 201 ASN n 
1 202 ALA n 
1 203 LEU n 
1 204 ASP n 
1 205 LEU n 
1 206 LYS n 
1 207 PHE n 
1 208 ASP n 
1 209 MET n 
1 210 GLU n 
1 211 GLN n 
1 212 LEU n 
1 213 LYS n 
1 214 ASP n 
1 215 SER n 
1 216 ILE n 
1 217 ASP n 
1 218 ARG n 
1 219 GLU n 
1 220 LYS n 
1 221 ILE n 
1 222 ALA n 
1 223 VAL n 
1 224 ILE n 
1 225 GLY n 
1 226 HIS n 
1 227 SER n 
1 228 PHE n 
1 229 GLY n 
1 230 GLY n 
1 231 ALA n 
1 232 THR n 
1 233 VAL n 
1 234 ILE n 
1 235 GLN n 
1 236 THR n 
1 237 LEU n 
1 238 SER n 
1 239 GLU n 
1 240 ASP n 
1 241 GLN n 
1 242 ARG n 
1 243 PHE n 
1 244 ARG n 
1 245 CYS n 
1 246 GLY n 
1 247 ILE n 
1 248 ALA n 
1 249 LEU n 
1 250 ASP n 
1 251 ALA n 
1 252 TRP n 
1 253 MET n 
1 254 PHE n 
1 255 PRO n 
1 256 LEU n 
1 257 GLY n 
1 258 ASP n 
1 259 GLU n 
1 260 VAL n 
1 261 TYR n 
1 262 SER n 
1 263 ARG n 
1 264 ILE n 
1 265 PRO n 
1 266 GLN n 
1 267 PRO n 
1 268 LEU n 
1 269 PHE n 
1 270 PHE n 
1 271 ILE n 
1 272 ASN n 
1 273 SER n 
1 274 GLU n 
1 275 TYR n 
1 276 PHE n 
1 277 GLN n 
1 278 TYR n 
1 279 PRO n 
1 280 ALA n 
1 281 ASN n 
1 282 ILE n 
1 283 ILE n 
1 284 LYS n 
1 285 MET n 
1 286 LYS n 
1 287 LYS n 
1 288 CYS n 
1 289 TYR n 
1 290 SER n 
1 291 PRO n 
1 292 ASP n 
1 293 LYS n 
1 294 GLU n 
1 295 ARG n 
1 296 LYS n 
1 297 MET n 
1 298 ILE n 
1 299 THR n 
1 300 ILE n 
1 301 ARG n 
1 302 GLY n 
1 303 SER n 
1 304 VAL n 
1 305 HIS n 
1 306 GLN n 
1 307 ASN n 
1 308 PHE n 
1 309 ALA n 
1 310 ASP n 
1 311 PHE n 
1 312 THR n 
1 313 PHE n 
1 314 ALA n 
1 315 THR n 
1 316 GLY n 
1 317 LYS n 
1 318 ILE n 
1 319 ILE n 
1 320 GLY n 
1 321 HIS n 
1 322 MET n 
1 323 LEU n 
1 324 LYS n 
1 325 LEU n 
1 326 LYS n 
1 327 GLY n 
1 328 ASP n 
1 329 ILE n 
1 330 ASP n 
1 331 SER n 
1 332 ASN n 
1 333 VAL n 
1 334 ALA n 
1 335 ILE n 
1 336 ASP n 
1 337 LEU n 
1 338 SER n 
1 339 ASN n 
1 340 LYS n 
1 341 ALA n 
1 342 SER n 
1 343 LEU n 
1 344 ALA n 
1 345 PHE n 
1 346 LEU n 
1 347 GLN n 
1 348 LYS n 
1 349 HIS n 
1 350 LEU n 
1 351 GLY n 
1 352 LEU n 
1 353 HIS n 
1 354 LYS n 
1 355 ASP n 
1 356 PHE n 
1 357 ASP n 
1 358 GLN n 
1 359 TRP n 
1 360 ASP n 
1 361 CYS n 
1 362 LEU n 
1 363 ILE n 
1 364 GLU n 
1 365 GLY n 
1 366 ASP n 
1 367 ASP n 
1 368 GLU n 
1 369 ASN n 
1 370 LEU n 
1 371 ILE n 
1 372 PRO n 
1 373 GLY n 
1 374 THR n 
1 375 ASN n 
1 376 ILE n 
1 377 ASN n 
1 378 THR n 
1 379 THR n 
1 380 ASN n 
1 381 GLN n 
1 382 HIS n 
1 383 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PLA2G7, PAFAH' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PAFA_HUMAN 
_struct_ref.pdbx_db_accession          Q13093 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFG
SMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYL
RTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSED
QRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIG
HMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGTNINTTNQHI
;
_struct_ref.pdbx_align_begin           47 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3F9C A 1 ? 383 ? Q13093 47 ? 429 ? 47 429 
2 1 3F9C B 1 ? 383 ? Q13093 47 ? 429 ? 47 429 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'   121.158 
DFP non-polymer         . 'DIISOPROPYL PHOSPHONATE' ? 'C6 H15 O3 P'    166.155 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                     ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3F9C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   48.70 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.6 
_exptl_crystal_grow.pdbx_details    
'PH 6.6. NATIVE PROTEIN CRYSTAL SOAKED IN MOTHER LIQUOR CONTAINING DFP, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   2008-05-15 
_diffrn_detector.details                'OSMIC BLUE' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.54 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     3F9C 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   36675 
_reflns.number_all                   36675 
_reflns.percent_possible_obs         100.00 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.71 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   100.00 
_reflns_shell.Rmerge_I_obs           0.44 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.23 
_reflns_shell.pdbx_redundancy        4.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3F9C 
_refine.ls_number_reflns_obs                     34789 
_refine.ls_number_reflns_all                     36675 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.94 
_refine.ls_R_factor_obs                          0.19919 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19595 
_refine.ls_R_factor_R_free                       0.26109 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1826 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               36.908 
_refine.aniso_B[1][1]                            -1.48 
_refine.aniso_B[2][2]                            0.56 
_refine.aniso_B[3][3]                            1.30 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.46 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'NATIVE STRUCTURE, PDB ENTRY 3D59' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.358 
_refine.pdbx_overall_ESU_R_Free                  0.257 
_refine.overall_SU_ML                            0.190 
_refine.overall_SU_B                             7.754 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5978 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               6168 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.020  0.022  ? 6142 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.813  1.953  ? 8301 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.823  5.000  ? 739  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   37.302 23.966 ? 295  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.355 15.000 ? 1061 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20.355 15.000 ? 36   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.119  0.200  ? 891  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.008  0.020  ? 4654 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.231  0.200  ? 2823 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.309  0.200  ? 4082 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.167  0.200  ? 312  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.352  0.200  ? 54   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.291  0.200  ? 7    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.058  1.500  ? 3816 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.752  2.000  ? 5944 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.590  3.000  ? 2693 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.825  4.500  ? 2357 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             2542 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               99.78 
_refine_ls_shell.R_factor_R_free                  0.300 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             121 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3F9C 
_struct.title                     
'Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by diisopropylfluorophosphate' 
_struct.pdbx_descriptor           'Platelet-activating factor acetylhydrolase (E.C.3.1.1.47)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3F9C 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;PLASMA PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE, SECRETED PROTEIN, ALPHA/BETA-HYDROLASE-FOLD, LDL-BOUND; LIPOPROTEIN ASSOCIATED PHOSPHOLIPASE A2, LP-PLA2, GROUP VIIA PLA2, GLYCOPROTEIN, HYDROLASE, LIPID DEGRADATION, POLYMORPHISM, DIISOPROPYLFLUOROPHOSPHATE, DFP, Disease mutation, Secreted
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 54  ? LEU A 65  ? ASN A 100 LEU A 111 1 ? 12 
HELX_P HELX_P2  2  HIS A 68  ? GLY A 80  ? HIS A 114 GLY A 126 1 ? 13 
HELX_P HELX_P3  3  TYR A 114 ? SER A 123 ? TYR A 160 SER A 169 1 ? 10 
HELX_P HELX_P4  4  ASP A 146 ? GLY A 153 ? ASP A 192 GLY A 199 1 ? 8  
HELX_P HELX_P5  5  LYS A 164 ? GLU A 166 ? LYS A 210 GLU A 212 5 ? 3  
HELX_P HELX_P6  6  GLU A 167 ? HIS A 195 ? GLU A 213 HIS A 241 1 ? 29 
HELX_P HELX_P7  7  ASP A 208 ? LYS A 213 ? ASP A 254 LYS A 259 5 ? 6  
HELX_P HELX_P8  8  SER A 227 ? SER A 227 ? SER A 273 SER A 273 1 ? 1  
HELX_P HELX_P9  9  PHE A 228 ? ASP A 240 ? PHE A 274 ASP A 286 1 ? 13 
HELX_P HELX_P10 10 GLY A 257 ? ILE A 264 ? GLY A 303 ILE A 310 5 ? 8  
HELX_P HELX_P11 11 TYR A 278 ? LYS A 287 ? TYR A 324 LYS A 333 1 ? 10 
HELX_P HELX_P12 12 VAL A 304 ? ALA A 314 ? VAL A 350 ALA A 360 5 ? 11 
HELX_P HELX_P13 13 GLY A 316 ? LYS A 324 ? GLY A 362 LYS A 370 1 ? 9  
HELX_P HELX_P14 14 ASP A 330 ? GLY A 351 ? ASP A 376 GLY A 397 1 ? 22 
HELX_P HELX_P15 15 ASP A 355 ? ILE A 363 ? ASP A 401 ILE A 409 5 ? 9  
HELX_P HELX_P16 16 ASN B 54  ? GLY B 66  ? ASN B 100 GLY B 112 1 ? 13 
HELX_P HELX_P17 17 HIS B 68  ? GLY B 80  ? HIS B 114 GLY B 126 1 ? 13 
HELX_P HELX_P18 18 TYR B 114 ? HIS B 124 ? TYR B 160 HIS B 170 1 ? 11 
HELX_P HELX_P19 19 ASP B 146 ? GLY B 153 ? ASP B 192 GLY B 199 1 ? 8  
HELX_P HELX_P20 20 LYS B 164 ? GLU B 166 ? LYS B 210 GLU B 212 5 ? 3  
HELX_P HELX_P21 21 GLU B 167 ? HIS B 195 ? GLU B 213 HIS B 241 1 ? 29 
HELX_P HELX_P22 22 ASP B 208 ? LYS B 213 ? ASP B 254 LYS B 259 5 ? 6  
HELX_P HELX_P23 23 SER B 227 ? SER B 227 ? SER B 273 SER B 273 1 ? 1  
HELX_P HELX_P24 24 PHE B 228 ? ASP B 240 ? PHE B 274 ASP B 286 1 ? 13 
HELX_P HELX_P25 25 GLU B 259 ? ARG B 263 ? GLU B 305 ARG B 309 5 ? 5  
HELX_P HELX_P26 26 TYR B 278 ? LYS B 287 ? TYR B 324 LYS B 333 1 ? 10 
HELX_P HELX_P27 27 VAL B 304 ? ALA B 314 ? VAL B 350 ALA B 360 5 ? 11 
HELX_P HELX_P28 28 GLY B 316 ? LEU B 323 ? GLY B 362 LEU B 369 1 ? 8  
HELX_P HELX_P29 29 ASP B 330 ? GLY B 351 ? ASP B 376 GLY B 397 1 ? 22 
HELX_P HELX_P30 30 ASP B 355 ? GLN B 358 ? ASP B 401 GLN B 404 5 ? 4  
HELX_P HELX_P31 31 TRP B 359 ? GLY B 365 ? TRP B 405 GLY B 411 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A HIS 226 C  ? ? ? 1_555 A SER 227 N ? ? A HIS 272 A SER 273 1_555 ? ? ? ? ? ? ? 1.619 ? 
covale2 covale ? ? A SER 227 C  ? ? ? 1_555 A PHE 228 N ? ? A SER 273 A PHE 274 1_555 ? ? ? ? ? ? ? 1.619 ? 
covale3 covale ? ? B HIS 226 C  ? ? ? 1_555 B SER 227 N ? ? B HIS 272 B SER 273 1_555 ? ? ? ? ? ? ? 1.637 ? 
covale4 covale ? ? B SER 227 C  ? ? ? 1_555 B PHE 228 N ? ? B SER 273 B PHE 274 1_555 ? ? ? ? ? ? ? 1.635 ? 
covale5 covale ? ? A SER 227 OG ? ? ? 1_555 C DFP .   P ? ? A SER 273 A DFP 473 1_555 ? ? ? ? ? ? ? 1.633 ? 
covale6 covale ? ? B SER 227 OG ? ? ? 1_555 D DFP .   P ? ? B SER 273 B DFP 473 1_555 ? ? ? ? ? ? ? 1.617 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 26 A . ? PHE 72 A ASP 27 A ? ASP 73 A 1 -2.76 
2 PHE 26 B . ? PHE 72 B ASP 27 B ? ASP 73 B 1 -5.91 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 2  ? 
C ? 2  ? 
D ? 10 ? 
E ? 2  ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? parallel      
A 2 3  ? anti-parallel 
A 3 4  ? anti-parallel 
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? parallel      
A 8 9  ? parallel      
A 9 10 ? anti-parallel 
B 1 2  ? anti-parallel 
C 1 2  ? anti-parallel 
D 1 2  ? parallel      
D 2 3  ? anti-parallel 
D 3 4  ? anti-parallel 
D 4 5  ? parallel      
D 5 6  ? parallel      
D 6 7  ? parallel      
D 7 8  ? parallel      
D 8 9  ? parallel      
D 9 10 ? anti-parallel 
E 1 2  ? anti-parallel 
F 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ASN A 87  ? TRP A 88  ? ASN A 133 TRP A 134 
A 2  SER A 18  ? PHE A 26  ? SER A 64  PHE A 72  
A 3  THR A 33  ? SER A 41  ? THR A 79  SER A 87  
A 4  ILE A 127 ? VAL A 131 ? ILE A 173 VAL A 177 
A 5  TYR A 98  ? SER A 104 ? TYR A 144 SER A 150 
A 6  ILE A 216 ? GLY A 225 ? ILE A 262 GLY A 271 
A 7  CYS A 245 ? LEU A 249 ? CYS A 291 LEU A 295 
A 8  LEU A 268 ? SER A 273 ? LEU A 314 SER A 319 
A 9  ARG A 295 ? ILE A 300 ? ARG A 341 ILE A 346 
A 10 LEU A 370 ? PRO A 372 ? LEU A 416 PRO A 418 
B 1  THR A 49  ? LEU A 50  ? THR A 95  LEU A 96  
B 2  THR A 83  ? THR A 84  ? THR A 129 THR A 130 
C 1  ALA A 140 ? TYR A 143 ? ALA A 186 TYR A 189 
C 2  SER A 156 ? TYR A 159 ? SER A 202 TYR A 205 
D 1  ASN B 87  ? TRP B 88  ? ASN B 133 TRP B 134 
D 2  SER B 18  ? PHE B 26  ? SER B 64  PHE B 72  
D 3  THR B 33  ? SER B 41  ? THR B 79  SER B 87  
D 4  ILE B 127 ? VAL B 131 ? ILE B 173 VAL B 177 
D 5  TYR B 98  ? SER B 104 ? TYR B 144 SER B 150 
D 6  ILE B 216 ? GLY B 225 ? ILE B 262 GLY B 271 
D 7  CYS B 245 ? LEU B 249 ? CYS B 291 LEU B 295 
D 8  LEU B 268 ? SER B 273 ? LEU B 314 SER B 319 
D 9  ARG B 295 ? ILE B 300 ? ARG B 341 ILE B 346 
D 10 LEU B 370 ? PRO B 372 ? LEU B 416 PRO B 418 
E 1  THR B 49  ? LEU B 50  ? THR B 95  LEU B 96  
E 2  THR B 83  ? THR B 84  ? THR B 129 THR B 130 
F 1  ALA B 140 ? TYR B 143 ? ALA B 186 TYR B 189 
F 2  SER B 156 ? TYR B 159 ? SER B 202 TYR B 205 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O ASN A 87  ? O ASN A 133 N VAL A 19  ? N VAL A 65  
A 2 3  N GLY A 20  ? N GLY A 66  O TYR A 39  ? O TYR A 85  
A 3 4  N ARG A 36  ? N ARG A 82  O ALA A 130 ? O ALA A 176 
A 4 5  O ALA A 129 ? O ALA A 175 N PHE A 103 ? N PHE A 149 
A 5 6  N VAL A 102 ? N VAL A 148 O ILE A 224 ? O ILE A 270 
A 6 7  N GLY A 225 ? N GLY A 271 O LEU A 249 ? O LEU A 295 
A 7 8  N ALA A 248 ? N ALA A 294 O PHE A 269 ? O PHE A 315 
A 8 9  N PHE A 270 ? N PHE A 316 O LYS A 296 ? O LYS A 342 
A 9 10 N THR A 299 ? N THR A 345 O ILE A 371 ? O ILE A 417 
B 1 2  N THR A 49  ? N THR A 95  O THR A 84  ? O THR A 130 
C 1 2  N TYR A 143 ? N TYR A 189 O SER A 156 ? O SER A 202 
D 1 2  O ASN B 87  ? O ASN B 133 N VAL B 19  ? N VAL B 65  
D 2 3  N SER B 18  ? N SER B 64  O SER B 41  ? O SER B 87  
D 3 4  N TYR B 38  ? N TYR B 84  O VAL B 128 ? O VAL B 174 
D 4 5  O ALA B 129 ? O ALA B 175 N VAL B 101 ? N VAL B 147 
D 5 6  N LEU B 100 ? N LEU B 146 O LYS B 220 ? O LYS B 266 
D 6 7  N GLY B 225 ? N GLY B 271 O LEU B 249 ? O LEU B 295 
D 7 8  N ALA B 248 ? N ALA B 294 O ILE B 271 ? O ILE B 317 
D 8 9  N ASN B 272 ? N ASN B 318 O ILE B 298 ? O ILE B 344 
D 9 10 N THR B 299 ? N THR B 345 O ILE B 371 ? O ILE B 417 
E 1 2  N THR B 49  ? N THR B 95  O THR B 84  ? O THR B 130 
F 1 2  N TYR B 143 ? N TYR B 189 O SER B 156 ? O SER B 202 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE DFP A 473' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE DFP B 473' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 GLY A 106 ? GLY A 152 . ? 1_555 ? 
2  AC1 7 LEU A 107 ? LEU A 153 . ? 1_555 ? 
3  AC1 7 HIS A 226 ? HIS A 272 . ? 1_555 ? 
4  AC1 7 SER A 227 ? SER A 273 . ? 1_555 ? 
5  AC1 7 PHE A 228 ? PHE A 274 . ? 1_555 ? 
6  AC1 7 HIS A 305 ? HIS A 351 . ? 1_555 ? 
7  AC1 7 GLN A 306 ? GLN A 352 . ? 1_555 ? 
8  AC2 6 GLY B 106 ? GLY B 152 . ? 1_555 ? 
9  AC2 6 LEU B 107 ? LEU B 153 . ? 1_555 ? 
10 AC2 6 SER B 227 ? SER B 273 . ? 1_555 ? 
11 AC2 6 PHE B 228 ? PHE B 274 . ? 1_555 ? 
12 AC2 6 HIS B 305 ? HIS B 351 . ? 1_555 ? 
13 AC2 6 GLN B 306 ? GLN B 352 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3F9C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3F9C 
_atom_sites.fract_transf_matrix[1][1]   0.008593 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004125 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012136 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011493 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . THR A 1 8   ? -18.945 11.837  -31.134 1.00 46.46 ? 54  THR A N     1 
ATOM   2    C CA    . THR A 1 8   ? -18.676 10.451  -30.613 1.00 45.97 ? 54  THR A CA    1 
ATOM   3    C C     . THR A 1 8   ? -18.749 10.309  -29.065 1.00 44.93 ? 54  THR A C     1 
ATOM   4    O O     . THR A 1 8   ? -18.895 11.319  -28.335 1.00 45.31 ? 54  THR A O     1 
ATOM   5    C CB    . THR A 1 8   ? -17.391 9.805   -31.255 1.00 46.23 ? 54  THR A CB    1 
ATOM   6    O OG1   . THR A 1 8   ? -16.258 9.779   -30.342 1.00 45.84 ? 54  THR A OG1   1 
ATOM   7    C CG2   . THR A 1 8   ? -17.080 10.476  -32.668 1.00 48.18 ? 54  THR A CG2   1 
ATOM   8    N N     . LYS A 1 9   ? -18.691 9.071   -28.566 1.00 42.96 ? 55  LYS A N     1 
ATOM   9    C CA    . LYS A 1 9   ? -18.944 8.883   -27.139 1.00 41.14 ? 55  LYS A CA    1 
ATOM   10   C C     . LYS A 1 9   ? -17.754 8.402   -26.321 1.00 38.81 ? 55  LYS A C     1 
ATOM   11   O O     . LYS A 1 9   ? -17.888 8.244   -25.087 1.00 37.73 ? 55  LYS A O     1 
ATOM   12   C CB    . LYS A 1 9   ? -20.235 8.083   -26.841 1.00 42.58 ? 55  LYS A CB    1 
ATOM   13   C CG    . LYS A 1 9   ? -21.591 8.766   -27.240 1.00 43.75 ? 55  LYS A CG    1 
ATOM   14   C CD    . LYS A 1 9   ? -22.134 9.671   -26.136 1.00 47.91 ? 55  LYS A CD    1 
ATOM   15   C CE    . LYS A 1 9   ? -23.585 10.093  -26.393 1.00 47.23 ? 55  LYS A CE    1 
ATOM   16   N NZ    . LYS A 1 9   ? -23.657 11.057  -27.542 1.00 52.38 ? 55  LYS A NZ    1 
ATOM   17   N N     . ILE A 1 10  ? -16.594 8.249   -26.967 1.00 35.62 ? 56  ILE A N     1 
ATOM   18   C CA    . ILE A 1 10  ? -15.347 8.130   -26.205 1.00 33.82 ? 56  ILE A CA    1 
ATOM   19   C C     . ILE A 1 10  ? -15.164 9.395   -25.388 1.00 33.54 ? 56  ILE A C     1 
ATOM   20   O O     . ILE A 1 10  ? -15.199 10.493  -25.937 1.00 34.22 ? 56  ILE A O     1 
ATOM   21   C CB    . ILE A 1 10  ? -14.108 7.808   -27.067 1.00 33.35 ? 56  ILE A CB    1 
ATOM   22   C CG1   . ILE A 1 10  ? -14.277 6.447   -27.733 1.00 29.64 ? 56  ILE A CG1   1 
ATOM   23   C CG2   . ILE A 1 10  ? -12.795 7.812   -26.192 1.00 34.12 ? 56  ILE A CG2   1 
ATOM   24   C CD1   . ILE A 1 10  ? -13.430 6.260   -29.009 1.00 24.79 ? 56  ILE A CD1   1 
ATOM   25   N N     . PRO A 1 11  ? -15.001 9.253   -24.060 1.00 32.92 ? 57  PRO A N     1 
ATOM   26   C CA    . PRO A 1 11  ? -14.993 10.397  -23.194 1.00 33.34 ? 57  PRO A CA    1 
ATOM   27   C C     . PRO A 1 11  ? -13.724 11.235  -23.329 1.00 33.00 ? 57  PRO A C     1 
ATOM   28   O O     . PRO A 1 11  ? -12.676 10.677  -23.498 1.00 33.92 ? 57  PRO A O     1 
ATOM   29   C CB    . PRO A 1 11  ? -15.043 9.764   -21.789 1.00 33.45 ? 57  PRO A CB    1 
ATOM   30   C CG    . PRO A 1 11  ? -14.455 8.484   -21.921 1.00 31.61 ? 57  PRO A CG    1 
ATOM   31   C CD    . PRO A 1 11  ? -14.835 8.008   -23.295 1.00 33.55 ? 57  PRO A CD    1 
ATOM   32   N N     . ARG A 1 12  ? -13.831 12.554  -23.236 1.00 32.12 ? 58  ARG A N     1 
ATOM   33   C CA    . ARG A 1 12  ? -12.664 13.402  -23.081 1.00 33.07 ? 58  ARG A CA    1 
ATOM   34   C C     . ARG A 1 12  ? -11.989 13.107  -21.746 1.00 32.46 ? 58  ARG A C     1 
ATOM   35   O O     . ARG A 1 12  ? -12.624 12.601  -20.831 1.00 32.41 ? 58  ARG A O     1 
ATOM   36   C CB    . ARG A 1 12  ? -13.061 14.872  -23.060 1.00 33.11 ? 58  ARG A CB    1 
ATOM   37   C CG    . ARG A 1 12  ? -13.742 15.394  -24.280 1.00 37.49 ? 58  ARG A CG    1 
ATOM   38   C CD    . ARG A 1 12  ? -14.255 16.795  -23.937 1.00 44.86 ? 58  ARG A CD    1 
ATOM   39   N NE    . ARG A 1 12  ? -15.498 16.753  -23.168 1.00 52.09 ? 58  ARG A NE    1 
ATOM   40   C CZ    . ARG A 1 12  ? -16.686 16.462  -23.708 1.00 57.28 ? 58  ARG A CZ    1 
ATOM   41   N NH1   . ARG A 1 12  ? -16.769 16.189  -25.021 1.00 61.24 ? 58  ARG A NH1   1 
ATOM   42   N NH2   . ARG A 1 12  ? -17.788 16.439  -22.955 1.00 57.08 ? 58  ARG A NH2   1 
ATOM   43   N N     . GLY A 1 13  ? -10.719 13.474  -21.615 1.00 31.23 ? 59  GLY A N     1 
ATOM   44   C CA    . GLY A 1 13  ? -10.021 13.257  -20.380 1.00 30.89 ? 59  GLY A CA    1 
ATOM   45   C C     . GLY A 1 13  ? -10.488 14.273  -19.367 1.00 31.09 ? 59  GLY A C     1 
ATOM   46   O O     . GLY A 1 13  ? -10.885 15.382  -19.762 1.00 30.35 ? 59  GLY A O     1 
ATOM   47   N N     . ASN A 1 14  ? -10.404 13.907  -18.080 1.00 29.85 ? 60  ASN A N     1 
ATOM   48   C CA    . ASN A 1 14  ? -10.864 14.765  -16.981 1.00 31.11 ? 60  ASN A CA    1 
ATOM   49   C C     . ASN A 1 14  ? -9.818  15.681  -16.377 1.00 30.74 ? 60  ASN A C     1 
ATOM   50   O O     . ASN A 1 14  ? -10.149 16.551  -15.587 1.00 30.25 ? 60  ASN A O     1 
ATOM   51   C CB    . ASN A 1 14  ? -11.450 13.932  -15.828 1.00 31.28 ? 60  ASN A CB    1 
ATOM   52   C CG    . ASN A 1 14  ? -12.565 12.966  -16.264 1.00 33.48 ? 60  ASN A CG    1 
ATOM   53   O OD1   . ASN A 1 14  ? -12.663 11.899  -15.692 1.00 41.95 ? 60  ASN A OD1   1 
ATOM   54   N ND2   . ASN A 1 14  ? -13.392 13.329  -17.247 1.00 32.91 ? 60  ASN A ND2   1 
ATOM   55   N N     . GLY A 1 15  ? -8.554  15.489  -16.738 1.00 30.66 ? 61  GLY A N     1 
ATOM   56   C CA    . GLY A 1 15  ? -7.471  16.320  -16.203 1.00 30.34 ? 61  GLY A CA    1 
ATOM   57   C C     . GLY A 1 15  ? -7.441  17.680  -16.864 1.00 30.43 ? 61  GLY A C     1 
ATOM   58   O O     . GLY A 1 15  ? -8.151  17.916  -17.858 1.00 29.85 ? 61  GLY A O     1 
ATOM   59   N N     . PRO A 1 16  ? -6.631  18.583  -16.313 1.00 30.93 ? 62  PRO A N     1 
ATOM   60   C CA    . PRO A 1 16  ? -6.477  20.007  -16.712 1.00 32.06 ? 62  PRO A CA    1 
ATOM   61   C C     . PRO A 1 16  ? -5.803  20.289  -18.081 1.00 33.84 ? 62  PRO A C     1 
ATOM   62   O O     . PRO A 1 16  ? -6.018  21.374  -18.691 1.00 33.14 ? 62  PRO A O     1 
ATOM   63   C CB    . PRO A 1 16  ? -5.573  20.577  -15.604 1.00 32.50 ? 62  PRO A CB    1 
ATOM   64   C CG    . PRO A 1 16  ? -4.791  19.406  -15.114 1.00 31.47 ? 62  PRO A CG    1 
ATOM   65   C CD    . PRO A 1 16  ? -5.803  18.246  -15.147 1.00 29.95 ? 62  PRO A CD    1 
ATOM   66   N N     . TYR A 1 17  ? -4.959  19.362  -18.539 1.00 33.70 ? 63  TYR A N     1 
ATOM   67   C CA    . TYR A 1 17  ? -4.271  19.555  -19.818 1.00 34.30 ? 63  TYR A CA    1 
ATOM   68   C C     . TYR A 1 17  ? -5.150  19.185  -20.998 1.00 33.82 ? 63  TYR A C     1 
ATOM   69   O O     . TYR A 1 17  ? -5.982  18.265  -20.932 1.00 34.25 ? 63  TYR A O     1 
ATOM   70   C CB    . TYR A 1 17  ? -3.017  18.697  -19.888 1.00 36.00 ? 63  TYR A CB    1 
ATOM   71   C CG    . TYR A 1 17  ? -2.041  18.883  -18.770 1.00 36.68 ? 63  TYR A CG    1 
ATOM   72   C CD1   . TYR A 1 17  ? -1.012  19.784  -18.893 1.00 41.78 ? 63  TYR A CD1   1 
ATOM   73   C CD2   . TYR A 1 17  ? -2.116  18.117  -17.611 1.00 37.44 ? 63  TYR A CD2   1 
ATOM   74   C CE1   . TYR A 1 17  ? -0.081  19.949  -17.891 1.00 42.96 ? 63  TYR A CE1   1 
ATOM   75   C CE2   . TYR A 1 17  ? -1.208  18.269  -16.597 1.00 39.37 ? 63  TYR A CE2   1 
ATOM   76   C CZ    . TYR A 1 17  ? -0.184  19.203  -16.738 1.00 41.68 ? 63  TYR A CZ    1 
ATOM   77   O OH    . TYR A 1 17  ? 0.747   19.411  -15.744 1.00 41.56 ? 63  TYR A OH    1 
ATOM   78   N N     . SER A 1 18  ? -4.938  19.869  -22.105 1.00 33.36 ? 64  SER A N     1 
ATOM   79   C CA    . SER A 1 18  ? -5.524  19.427  -23.358 1.00 33.03 ? 64  SER A CA    1 
ATOM   80   C C     . SER A 1 18  ? -4.641  18.325  -23.936 1.00 31.08 ? 64  SER A C     1 
ATOM   81   O O     . SER A 1 18  ? -3.488  18.171  -23.532 1.00 31.15 ? 64  SER A O     1 
ATOM   82   C CB    . SER A 1 18  ? -5.743  20.591  -24.346 1.00 33.43 ? 64  SER A CB    1 
ATOM   83   O OG    . SER A 1 18  ? -4.623  21.449  -24.388 1.00 38.10 ? 64  SER A OG    1 
ATOM   84   N N     . VAL A 1 19  ? -5.193  17.556  -24.861 1.00 29.38 ? 65  VAL A N     1 
ATOM   85   C CA    . VAL A 1 19  ? -4.591  16.280  -25.242 1.00 28.27 ? 65  VAL A CA    1 
ATOM   86   C C     . VAL A 1 19  ? -4.394  16.215  -26.748 1.00 27.42 ? 65  VAL A C     1 
ATOM   87   O O     . VAL A 1 19  ? -5.334  16.414  -27.501 1.00 26.67 ? 65  VAL A O     1 
ATOM   88   C CB    . VAL A 1 19  ? -5.466  15.084  -24.764 1.00 28.31 ? 65  VAL A CB    1 
ATOM   89   C CG1   . VAL A 1 19  ? -4.940  13.730  -25.342 1.00 26.70 ? 65  VAL A CG1   1 
ATOM   90   C CG2   . VAL A 1 19  ? -5.507  15.085  -23.276 1.00 26.63 ? 65  VAL A CG2   1 
ATOM   91   N N     . GLY A 1 20  ? -3.156  15.933  -27.160 1.00 27.99 ? 66  GLY A N     1 
ATOM   92   C CA    . GLY A 1 20  ? -2.803  15.796  -28.573 1.00 27.32 ? 66  GLY A CA    1 
ATOM   93   C C     . GLY A 1 20  ? -2.593  14.345  -28.896 1.00 27.10 ? 66  GLY A C     1 
ATOM   94   O O     . GLY A 1 20  ? -2.478  13.543  -28.012 1.00 27.45 ? 66  GLY A O     1 
ATOM   95   N N     . CYS A 1 21  ? -2.519  14.011  -30.182 1.00 27.67 ? 67  CYS A N     1 
ATOM   96   C CA    . CYS A 1 21  ? -2.310  12.642  -30.609 1.00 27.40 ? 67  CYS A CA    1 
ATOM   97   C C     . CYS A 1 21  ? -1.607  12.587  -31.963 1.00 27.28 ? 67  CYS A C     1 
ATOM   98   O O     . CYS A 1 21  ? -1.904  13.341  -32.870 1.00 26.59 ? 67  CYS A O     1 
ATOM   99   C CB    . CYS A 1 21  ? -3.637  11.886  -30.667 1.00 27.00 ? 67  CYS A CB    1 
ATOM   100  S SG    . CYS A 1 21  ? -3.533  10.111  -31.083 1.00 26.29 ? 67  CYS A SG    1 
ATOM   101  N N     . THR A 1 22  ? -0.645  11.681  -32.065 1.00 27.04 ? 68  THR A N     1 
ATOM   102  C CA    . THR A 1 22  ? 0.054   11.437  -33.310 1.00 26.34 ? 68  THR A CA    1 
ATOM   103  C C     . THR A 1 22  ? 0.534   9.985   -33.315 1.00 25.45 ? 68  THR A C     1 
ATOM   104  O O     . THR A 1 22  ? 0.418   9.309   -32.310 1.00 25.68 ? 68  THR A O     1 
ATOM   105  C CB    . THR A 1 22  ? 1.243   12.423  -33.487 1.00 26.41 ? 68  THR A CB    1 
ATOM   106  O OG1   . THR A 1 22  ? 1.716   12.297  -34.823 1.00 27.22 ? 68  THR A OG1   1 
ATOM   107  C CG2   . THR A 1 22  ? 2.398   12.099  -32.521 1.00 25.37 ? 68  THR A CG2   1 
ATOM   108  N N     . ASP A 1 23  ? 1.065   9.511   -34.443 1.00 26.07 ? 69  ASP A N     1 
ATOM   109  C CA    . ASP A 1 23  ? 1.627   8.171   -34.572 1.00 25.93 ? 69  ASP A CA    1 
ATOM   110  C C     . ASP A 1 23  ? 3.127   8.223   -34.892 1.00 25.46 ? 69  ASP A C     1 
ATOM   111  O O     . ASP A 1 23  ? 3.595   9.067   -35.650 1.00 23.96 ? 69  ASP A O     1 
ATOM   112  C CB    . ASP A 1 23  ? 0.924   7.401   -35.670 1.00 26.13 ? 69  ASP A CB    1 
ATOM   113  C CG    . ASP A 1 23  ? -0.486  6.968   -35.291 1.00 29.70 ? 69  ASP A CG    1 
ATOM   114  O OD1   . ASP A 1 23  ? -0.710  6.541   -34.131 1.00 30.94 ? 69  ASP A OD1   1 
ATOM   115  O OD2   . ASP A 1 23  ? -1.376  7.009   -36.176 1.00 29.84 ? 69  ASP A OD2   1 
ATOM   116  N N     . LEU A 1 24  ? 3.874   7.283   -34.322 1.00 25.26 ? 70  LEU A N     1 
ATOM   117  C CA    . LEU A 1 24  ? 5.305   7.183   -34.558 1.00 23.83 ? 70  LEU A CA    1 
ATOM   118  C C     . LEU A 1 24  ? 5.604   5.737   -34.909 1.00 24.59 ? 70  LEU A C     1 
ATOM   119  O O     . LEU A 1 24  ? 5.231   4.847   -34.161 1.00 24.19 ? 70  LEU A O     1 
ATOM   120  C CB    . LEU A 1 24  ? 6.113   7.689   -33.345 1.00 23.51 ? 70  LEU A CB    1 
ATOM   121  C CG    . LEU A 1 24  ? 7.651   7.376   -33.276 1.00 25.33 ? 70  LEU A CG    1 
ATOM   122  C CD1   . LEU A 1 24  ? 8.422   8.093   -34.403 1.00 23.91 ? 70  LEU A CD1   1 
ATOM   123  C CD2   . LEU A 1 24  ? 8.278   7.726   -31.897 1.00 21.66 ? 70  LEU A CD2   1 
ATOM   124  N N     . MET A 1 25  ? 6.205   5.517   -36.089 1.00 24.30 ? 71  MET A N     1 
ATOM   125  C CA    . MET A 1 25  ? 6.817   4.238   -36.430 1.00 24.43 ? 71  MET A CA    1 
ATOM   126  C C     . MET A 1 25  ? 8.317   4.440   -36.735 1.00 24.68 ? 71  MET A C     1 
ATOM   127  O O     . MET A 1 25  ? 8.635   5.219   -37.606 1.00 22.95 ? 71  MET A O     1 
ATOM   128  C CB    . MET A 1 25  ? 6.141   3.616   -37.659 1.00 23.84 ? 71  MET A CB    1 
ATOM   129  C CG    . MET A 1 25  ? 6.571   2.213   -37.928 1.00 22.25 ? 71  MET A CG    1 
ATOM   130  S SD    . MET A 1 25  ? 5.951   1.653   -39.510 1.00 25.61 ? 71  MET A SD    1 
ATOM   131  C CE    . MET A 1 25  ? 4.193   1.671   -39.228 1.00 22.18 ? 71  MET A CE    1 
ATOM   132  N N     . PHE A 1 26  ? 9.201   3.688   -36.051 1.00 25.16 ? 72  PHE A N     1 
ATOM   133  C CA    . PHE A 1 26  ? 10.642  3.753   -36.289 1.00 26.63 ? 72  PHE A CA    1 
ATOM   134  C C     . PHE A 1 26  ? 11.341  2.529   -35.686 1.00 27.22 ? 72  PHE A C     1 
ATOM   135  O O     . PHE A 1 26  ? 11.135  2.259   -34.508 1.00 28.14 ? 72  PHE A O     1 
ATOM   136  C CB    . PHE A 1 26  ? 11.277  5.056   -35.736 1.00 27.58 ? 72  PHE A CB    1 
ATOM   137  C CG    . PHE A 1 26  ? 12.712  5.232   -36.143 1.00 29.31 ? 72  PHE A CG    1 
ATOM   138  C CD1   . PHE A 1 26  ? 13.740  4.656   -35.378 1.00 32.07 ? 72  PHE A CD1   1 
ATOM   139  C CD2   . PHE A 1 26  ? 13.030  5.877   -37.347 1.00 28.42 ? 72  PHE A CD2   1 
ATOM   140  C CE1   . PHE A 1 26  ? 15.087  4.741   -35.787 1.00 33.63 ? 72  PHE A CE1   1 
ATOM   141  C CE2   . PHE A 1 26  ? 14.364  5.994   -37.771 1.00 31.18 ? 72  PHE A CE2   1 
ATOM   142  C CZ    . PHE A 1 26  ? 15.409  5.427   -36.981 1.00 32.71 ? 72  PHE A CZ    1 
ATOM   143  N N     . ASP A 1 27  ? 12.145  1.773   -36.452 1.00 27.66 ? 73  ASP A N     1 
ATOM   144  C CA    . ASP A 1 27  ? 12.400  1.971   -37.903 1.00 28.63 ? 73  ASP A CA    1 
ATOM   145  C C     . ASP A 1 27  ? 11.142  1.570   -38.705 1.00 29.31 ? 73  ASP A C     1 
ATOM   146  O O     . ASP A 1 27  ? 10.144  1.203   -38.093 1.00 30.02 ? 73  ASP A O     1 
ATOM   147  C CB    . ASP A 1 27  ? 13.727  1.272   -38.377 1.00 27.31 ? 73  ASP A CB    1 
ATOM   148  C CG    . ASP A 1 27  ? 13.698  -0.284  -38.317 1.00 29.74 ? 73  ASP A CG    1 
ATOM   149  O OD1   . ASP A 1 27  ? 12.659  -0.961  -38.178 1.00 29.91 ? 73  ASP A OD1   1 
ATOM   150  O OD2   . ASP A 1 27  ? 14.785  -0.887  -38.418 1.00 35.36 ? 73  ASP A OD2   1 
ATOM   151  N N     . HIS A 1 28  ? 11.171  1.654   -40.038 1.00 29.30 ? 74  HIS A N     1 
ATOM   152  C CA    . HIS A 1 28  ? 9.998   1.334   -40.861 1.00 29.58 ? 74  HIS A CA    1 
ATOM   153  C C     . HIS A 1 28  ? 9.676   -0.166  -40.899 1.00 29.63 ? 74  HIS A C     1 
ATOM   154  O O     . HIS A 1 28  ? 8.632   -0.545  -41.394 1.00 30.10 ? 74  HIS A O     1 
ATOM   155  C CB    . HIS A 1 28  ? 10.198  1.842   -42.291 1.00 29.17 ? 74  HIS A CB    1 
ATOM   156  C CG    . HIS A 1 28  ? 11.399  1.258   -42.954 1.00 30.02 ? 74  HIS A CG    1 
ATOM   157  N ND1   . HIS A 1 28  ? 12.604  1.914   -43.001 1.00 32.62 ? 74  HIS A ND1   1 
ATOM   158  C CD2   . HIS A 1 28  ? 11.601  0.053   -43.543 1.00 30.71 ? 74  HIS A CD2   1 
ATOM   159  C CE1   . HIS A 1 28  ? 13.499  1.146   -43.598 1.00 32.16 ? 74  HIS A CE1   1 
ATOM   160  N NE2   . HIS A 1 28  ? 12.914  0.014   -43.939 1.00 34.61 ? 74  HIS A NE2   1 
ATOM   161  N N     . THR A 1 29  ? 10.554  -1.020  -40.372 1.00 30.03 ? 75  THR A N     1 
ATOM   162  C CA    . THR A 1 29  ? 10.439  -2.483  -40.645 1.00 30.31 ? 75  THR A CA    1 
ATOM   163  C C     . THR A 1 29  ? 9.494   -3.233  -39.695 1.00 30.38 ? 75  THR A C     1 
ATOM   164  O O     . THR A 1 29  ? 9.006   -2.680  -38.694 1.00 30.03 ? 75  THR A O     1 
ATOM   165  C CB    . THR A 1 29  ? 11.835  -3.211  -40.621 1.00 30.15 ? 75  THR A CB    1 
ATOM   166  O OG1   . THR A 1 29  ? 12.286  -3.352  -39.268 1.00 31.65 ? 75  THR A OG1   1 
ATOM   167  C CG2   . THR A 1 29  ? 12.893  -2.465  -41.434 1.00 27.47 ? 75  THR A CG2   1 
ATOM   168  N N     . ASN A 1 30  ? 9.295   -4.507  -39.986 1.00 30.45 ? 76  ASN A N     1 
ATOM   169  C CA    . ASN A 1 30  ? 8.471   -5.380  -39.155 1.00 32.01 ? 76  ASN A CA    1 
ATOM   170  C C     . ASN A 1 30  ? 9.071   -5.621  -37.748 1.00 31.96 ? 76  ASN A C     1 
ATOM   171  O O     . ASN A 1 30  ? 8.400   -6.125  -36.828 1.00 31.51 ? 76  ASN A O     1 
ATOM   172  C CB    . ASN A 1 30  ? 8.253   -6.703  -39.898 1.00 32.36 ? 76  ASN A CB    1 
ATOM   173  C CG    . ASN A 1 30  ? 9.501   -7.536  -39.951 1.00 35.92 ? 76  ASN A CG    1 
ATOM   174  O OD1   . ASN A 1 30  ? 10.562  -7.112  -40.465 1.00 36.59 ? 76  ASN A OD1   1 
ATOM   175  N ND2   . ASN A 1 30  ? 9.420   -8.705  -39.341 1.00 38.14 ? 76  ASN A ND2   1 
ATOM   176  N N     . LYS A 1 31  ? 10.330  -5.221  -37.597 1.00 32.07 ? 77  LYS A N     1 
ATOM   177  C CA    . LYS A 1 31  ? 11.060  -5.295  -36.337 1.00 32.84 ? 77  LYS A CA    1 
ATOM   178  C C     . LYS A 1 31  ? 11.261  -3.930  -35.647 1.00 30.70 ? 77  LYS A C     1 
ATOM   179  O O     . LYS A 1 31  ? 11.720  -3.883  -34.510 1.00 30.80 ? 77  LYS A O     1 
ATOM   180  C CB    . LYS A 1 31  ? 12.395  -6.029  -36.550 1.00 33.76 ? 77  LYS A CB    1 
ATOM   181  C CG    . LYS A 1 31  ? 12.212  -7.508  -36.881 1.00 35.71 ? 77  LYS A CG    1 
ATOM   182  C CD    . LYS A 1 31  ? 13.523  -8.203  -37.251 1.00 37.82 ? 77  LYS A CD    1 
ATOM   183  C CE    . LYS A 1 31  ? 13.462  -9.788  -37.011 1.00 41.80 ? 77  LYS A CE    1 
ATOM   184  N NZ    . LYS A 1 31  ? 14.840  -10.455 -37.156 1.00 43.04 ? 77  LYS A NZ    1 
ATOM   185  N N     . GLY A 1 32  ? 10.893  -2.842  -36.324 1.00 28.31 ? 78  GLY A N     1 
ATOM   186  C CA    . GLY A 1 32  ? 10.855  -1.519  -35.737 1.00 25.47 ? 78  GLY A CA    1 
ATOM   187  C C     . GLY A 1 32  ? 9.705   -1.326  -34.757 1.00 24.73 ? 78  GLY A C     1 
ATOM   188  O O     . GLY A 1 32  ? 8.940   -2.230  -34.490 1.00 22.07 ? 78  GLY A O     1 
ATOM   189  N N     . THR A 1 33  ? 9.589   -0.119  -34.206 1.00 24.49 ? 79  THR A N     1 
ATOM   190  C CA    . THR A 1 33  ? 8.552   0.177   -33.195 1.00 22.88 ? 79  THR A CA    1 
ATOM   191  C C     . THR A 1 33  ? 7.419   0.917   -33.867 1.00 22.44 ? 79  THR A C     1 
ATOM   192  O O     . THR A 1 33  ? 7.654   1.712   -34.774 1.00 22.72 ? 79  THR A O     1 
ATOM   193  C CB    . THR A 1 33  ? 9.143   1.028   -32.003 1.00 23.70 ? 79  THR A CB    1 
ATOM   194  O OG1   . THR A 1 33  ? 10.074  0.242   -31.234 1.00 21.80 ? 79  THR A OG1   1 
ATOM   195  C CG2   . THR A 1 33  ? 8.072   1.585   -31.108 1.00 22.98 ? 79  THR A CG2   1 
ATOM   196  N N     . PHE A 1 34  ? 6.184   0.594   -33.465 1.00 22.27 ? 80  PHE A N     1 
ATOM   197  C CA    . PHE A 1 34  ? 5.006   1.276   -33.913 1.00 21.43 ? 80  PHE A CA    1 
ATOM   198  C C     . PHE A 1 34  ? 4.155   1.589   -32.698 1.00 21.82 ? 80  PHE A C     1 
ATOM   199  O O     . PHE A 1 34  ? 3.760   0.696   -31.943 1.00 21.47 ? 80  PHE A O     1 
ATOM   200  C CB    . PHE A 1 34  ? 4.212   0.384   -34.884 1.00 22.08 ? 80  PHE A CB    1 
ATOM   201  C CG    . PHE A 1 34  ? 3.142   1.110   -35.683 1.00 19.52 ? 80  PHE A CG    1 
ATOM   202  C CD1   . PHE A 1 34  ? 3.158   2.482   -35.845 1.00 20.72 ? 80  PHE A CD1   1 
ATOM   203  C CD2   . PHE A 1 34  ? 2.112   0.376   -36.295 1.00 19.54 ? 80  PHE A CD2   1 
ATOM   204  C CE1   . PHE A 1 34  ? 2.127   3.116   -36.611 1.00 21.87 ? 80  PHE A CE1   1 
ATOM   205  C CE2   . PHE A 1 34  ? 1.140   0.983   -37.067 1.00 13.57 ? 80  PHE A CE2   1 
ATOM   206  C CZ    . PHE A 1 34  ? 1.147   2.353   -37.226 1.00 17.15 ? 80  PHE A CZ    1 
ATOM   207  N N     . LEU A 1 35  ? 3.869   2.873   -32.529 1.00 21.87 ? 81  LEU A N     1 
ATOM   208  C CA    . LEU A 1 35  ? 3.119   3.356   -31.404 1.00 22.92 ? 81  LEU A CA    1 
ATOM   209  C C     . LEU A 1 35  ? 2.226   4.565   -31.794 1.00 23.47 ? 81  LEU A C     1 
ATOM   210  O O     . LEU A 1 35  ? 2.549   5.301   -32.711 1.00 24.53 ? 81  LEU A O     1 
ATOM   211  C CB    . LEU A 1 35  ? 4.078   3.669   -30.230 1.00 22.11 ? 81  LEU A CB    1 
ATOM   212  C CG    . LEU A 1 35  ? 5.120   4.801   -30.359 1.00 24.17 ? 81  LEU A CG    1 
ATOM   213  C CD1   . LEU A 1 35  ? 4.464   6.206   -30.157 1.00 18.58 ? 81  LEU A CD1   1 
ATOM   214  C CD2   . LEU A 1 35  ? 6.306   4.593   -29.359 1.00 21.63 ? 81  LEU A CD2   1 
ATOM   215  N N     . ARG A 1 36  ? 1.086   4.721   -31.124 1.00 24.23 ? 82  ARG A N     1 
ATOM   216  C CA    . ARG A 1 36  ? 0.297   5.960   -31.104 1.00 24.17 ? 82  ARG A CA    1 
ATOM   217  C C     . ARG A 1 36  ? 0.624   6.668   -29.824 1.00 24.81 ? 82  ARG A C     1 
ATOM   218  O O     . ARG A 1 36  ? 0.596   6.021   -28.775 1.00 26.89 ? 82  ARG A O     1 
ATOM   219  C CB    . ARG A 1 36  ? -1.195  5.614   -31.030 1.00 24.30 ? 82  ARG A CB    1 
ATOM   220  C CG    . ARG A 1 36  ? -2.059  6.820   -30.869 1.00 21.15 ? 82  ARG A CG    1 
ATOM   221  C CD    . ARG A 1 36  ? -3.408  6.627   -31.505 1.00 22.43 ? 82  ARG A CD    1 
ATOM   222  N NE    . ARG A 1 36  ? -3.308  6.786   -32.959 1.00 24.91 ? 82  ARG A NE    1 
ATOM   223  C CZ    . ARG A 1 36  ? -4.327  6.981   -33.788 1.00 24.73 ? 82  ARG A CZ    1 
ATOM   224  N NH1   . ARG A 1 36  ? -5.558  7.039   -33.335 1.00 25.32 ? 82  ARG A NH1   1 
ATOM   225  N NH2   . ARG A 1 36  ? -4.103  7.104   -35.083 1.00 26.00 ? 82  ARG A NH2   1 
ATOM   226  N N     . LEU A 1 37  ? 0.905   7.966   -29.898 1.00 24.82 ? 83  LEU A N     1 
ATOM   227  C CA    . LEU A 1 37  ? 1.241   8.808   -28.747 1.00 25.46 ? 83  LEU A CA    1 
ATOM   228  C C     . LEU A 1 37  ? 0.066   9.677   -28.334 1.00 25.03 ? 83  LEU A C     1 
ATOM   229  O O     . LEU A 1 37  ? -0.561  10.252  -29.188 1.00 24.27 ? 83  LEU A O     1 
ATOM   230  C CB    . LEU A 1 37  ? 2.364   9.798   -29.088 1.00 25.04 ? 83  LEU A CB    1 
ATOM   231  C CG    . LEU A 1 37  ? 3.863   9.645   -28.812 1.00 29.68 ? 83  LEU A CG    1 
ATOM   232  C CD1   . LEU A 1 37  ? 4.569   11.020  -29.054 1.00 29.69 ? 83  LEU A CD1   1 
ATOM   233  C CD2   . LEU A 1 37  ? 4.268   9.091   -27.427 1.00 26.36 ? 83  LEU A CD2   1 
ATOM   234  N N     . TYR A 1 38  ? -0.171  9.802   -27.023 1.00 24.33 ? 84  TYR A N     1 
ATOM   235  C CA    . TYR A 1 38  ? -1.129  10.768  -26.485 1.00 24.68 ? 84  TYR A CA    1 
ATOM   236  C C     . TYR A 1 38  ? -0.308  11.631  -25.572 1.00 24.82 ? 84  TYR A C     1 
ATOM   237  O O     . TYR A 1 38  ? 0.542   11.118  -24.908 1.00 25.33 ? 84  TYR A O     1 
ATOM   238  C CB    . TYR A 1 38  ? -2.206  10.072  -25.664 1.00 23.73 ? 84  TYR A CB    1 
ATOM   239  C CG    . TYR A 1 38  ? -2.928  8.978   -26.397 1.00 22.48 ? 84  TYR A CG    1 
ATOM   240  C CD1   . TYR A 1 38  ? -4.016  9.272   -27.250 1.00 21.58 ? 84  TYR A CD1   1 
ATOM   241  C CD2   . TYR A 1 38  ? -2.564  7.642   -26.229 1.00 22.04 ? 84  TYR A CD2   1 
ATOM   242  C CE1   . TYR A 1 38  ? -4.685  8.261   -27.928 1.00 22.42 ? 84  TYR A CE1   1 
ATOM   243  C CE2   . TYR A 1 38  ? -3.250  6.605   -26.874 1.00 19.55 ? 84  TYR A CE2   1 
ATOM   244  C CZ    . TYR A 1 38  ? -4.316  6.926   -27.704 1.00 23.95 ? 84  TYR A CZ    1 
ATOM   245  O OH    . TYR A 1 38  ? -4.993  5.929   -28.382 1.00 28.10 ? 84  TYR A OH    1 
ATOM   246  N N     . TYR A 1 39  ? -0.512  12.942  -25.565 1.00 25.18 ? 85  TYR A N     1 
ATOM   247  C CA    . TYR A 1 39  ? 0.408   13.822  -24.842 1.00 25.34 ? 85  TYR A CA    1 
ATOM   248  C C     . TYR A 1 39  ? -0.328  15.115  -24.470 1.00 26.63 ? 85  TYR A C     1 
ATOM   249  O O     . TYR A 1 39  ? -1.350  15.429  -25.089 1.00 26.02 ? 85  TYR A O     1 
ATOM   250  C CB    . TYR A 1 39  ? 1.670   14.084  -25.708 1.00 24.44 ? 85  TYR A CB    1 
ATOM   251  C CG    . TYR A 1 39  ? 1.312   14.535  -27.093 1.00 23.88 ? 85  TYR A CG    1 
ATOM   252  C CD1   . TYR A 1 39  ? 1.137   15.870  -27.377 1.00 22.51 ? 85  TYR A CD1   1 
ATOM   253  C CD2   . TYR A 1 39  ? 1.134   13.618  -28.128 1.00 22.29 ? 85  TYR A CD2   1 
ATOM   254  C CE1   . TYR A 1 39  ? 0.753   16.294  -28.633 1.00 22.33 ? 85  TYR A CE1   1 
ATOM   255  C CE2   . TYR A 1 39  ? 0.772   14.042  -29.370 1.00 19.87 ? 85  TYR A CE2   1 
ATOM   256  C CZ    . TYR A 1 39  ? 0.582   15.392  -29.619 1.00 22.59 ? 85  TYR A CZ    1 
ATOM   257  O OH    . TYR A 1 39  ? 0.199   15.838  -30.881 1.00 23.05 ? 85  TYR A OH    1 
ATOM   258  N N     . PRO A 1 40  ? 0.123   15.829  -23.403 1.00 28.49 ? 86  PRO A N     1 
ATOM   259  C CA    . PRO A 1 40  ? -0.460  17.174  -23.173 1.00 30.09 ? 86  PRO A CA    1 
ATOM   260  C C     . PRO A 1 40  ? -0.132  18.042  -24.342 1.00 31.81 ? 86  PRO A C     1 
ATOM   261  O O     . PRO A 1 40  ? 1.026   18.148  -24.673 1.00 32.74 ? 86  PRO A O     1 
ATOM   262  C CB    . PRO A 1 40  ? 0.298   17.699  -21.935 1.00 28.90 ? 86  PRO A CB    1 
ATOM   263  C CG    . PRO A 1 40  ? 0.780   16.530  -21.252 1.00 29.36 ? 86  PRO A CG    1 
ATOM   264  C CD    . PRO A 1 40  ? 1.063   15.458  -22.332 1.00 27.69 ? 86  PRO A CD    1 
ATOM   265  N N     . SER A 1 41  ? -1.118  18.643  -24.976 1.00 34.24 ? 87  SER A N     1 
ATOM   266  C CA    . SER A 1 41  ? -0.826  19.588  -26.039 1.00 37.29 ? 87  SER A CA    1 
ATOM   267  C C     . SER A 1 41  ? -0.835  21.032  -25.561 1.00 39.66 ? 87  SER A C     1 
ATOM   268  O O     . SER A 1 41  ? -1.474  21.380  -24.552 1.00 39.95 ? 87  SER A O     1 
ATOM   269  C CB    . SER A 1 41  ? -1.756  19.433  -27.234 1.00 35.75 ? 87  SER A CB    1 
ATOM   270  O OG    . SER A 1 41  ? -3.054  19.514  -26.803 1.00 37.07 ? 87  SER A OG    1 
ATOM   271  N N     . GLN A 1 42  ? -0.122  21.855  -26.324 1.00 43.13 ? 88  GLN A N     1 
ATOM   272  C CA    . GLN A 1 42  ? 0.040   23.281  -26.056 1.00 45.36 ? 88  GLN A CA    1 
ATOM   273  C C     . GLN A 1 42  ? -1.359  23.859  -26.108 1.00 46.81 ? 88  GLN A C     1 
ATOM   274  O O     . GLN A 1 42  ? -1.838  24.421  -25.105 1.00 46.92 ? 88  GLN A O     1 
ATOM   275  C CB    . GLN A 1 42  ? 1.019   23.906  -27.095 1.00 45.45 ? 88  GLN A CB    1 
ATOM   276  C CG    . GLN A 1 42  ? 1.295   25.439  -27.046 1.00 45.78 ? 88  GLN A CG    1 
ATOM   277  C CD    . GLN A 1 42  ? 1.797   25.955  -25.681 1.00 49.95 ? 88  GLN A CD    1 
ATOM   278  O OE1   . GLN A 1 42  ? 1.346   25.495  -24.627 1.00 48.86 ? 88  GLN A OE1   1 
ATOM   279  N NE2   . GLN A 1 42  ? 2.734   26.926  -25.707 1.00 50.50 ? 88  GLN A NE2   1 
ATOM   280  N N     . ASP A 1 43  ? -2.015  23.591  -27.246 1.00 48.69 ? 89  ASP A N     1 
ATOM   281  C CA    . ASP A 1 43  ? -3.340  24.080  -27.651 1.00 50.62 ? 89  ASP A CA    1 
ATOM   282  C C     . ASP A 1 43  ? -4.452  23.020  -27.692 1.00 51.34 ? 89  ASP A C     1 
ATOM   283  O O     . ASP A 1 43  ? -4.178  21.810  -27.692 1.00 51.83 ? 89  ASP A O     1 
ATOM   284  C CB    . ASP A 1 43  ? -3.232  24.685  -29.057 1.00 51.46 ? 89  ASP A CB    1 
ATOM   285  C CG    . ASP A 1 43  ? -2.166  25.781  -29.150 1.00 53.84 ? 89  ASP A CG    1 
ATOM   286  O OD1   . ASP A 1 43  ? -1.859  26.205  -30.301 1.00 55.97 ? 89  ASP A OD1   1 
ATOM   287  O OD2   . ASP A 1 43  ? -1.657  26.217  -28.074 1.00 54.14 ? 89  ASP A OD2   1 
ATOM   288  N N     . ASN A 1 44  ? -5.704  23.500  -27.767 1.00 51.89 ? 90  ASN A N     1 
ATOM   289  C CA    . ASN A 1 44  ? -6.924  22.665  -27.777 1.00 52.27 ? 90  ASN A CA    1 
ATOM   290  C C     . ASN A 1 44  ? -7.917  23.143  -28.853 1.00 52.14 ? 90  ASN A C     1 
ATOM   291  O O     . ASN A 1 44  ? -8.936  23.770  -28.547 1.00 52.61 ? 90  ASN A O     1 
ATOM   292  C CB    . ASN A 1 44  ? -7.576  22.693  -26.379 1.00 52.34 ? 90  ASN A CB    1 
ATOM   293  C CG    . ASN A 1 44  ? -8.648  21.619  -26.187 1.00 53.95 ? 90  ASN A CG    1 
ATOM   294  O OD1   . ASN A 1 44  ? -9.564  21.802  -25.397 1.00 54.04 ? 90  ASN A OD1   1 
ATOM   295  N ND2   . ASN A 1 44  ? -8.521  20.489  -26.885 1.00 55.84 ? 90  ASN A ND2   1 
ATOM   296  N N     . ASP A 1 45  ? -7.616  22.837  -30.112 1.00 51.84 ? 91  ASP A N     1 
ATOM   297  C CA    . ASP A 1 45  ? -8.277  23.467  -31.246 1.00 51.36 ? 91  ASP A CA    1 
ATOM   298  C C     . ASP A 1 45  ? -9.435  22.707  -31.870 1.00 50.60 ? 91  ASP A C     1 
ATOM   299  O O     . ASP A 1 45  ? -10.379 23.324  -32.407 1.00 51.07 ? 91  ASP A O     1 
ATOM   300  C CB    . ASP A 1 45  ? -7.248  23.808  -32.312 1.00 52.44 ? 91  ASP A CB    1 
ATOM   301  C CG    . ASP A 1 45  ? -6.416  25.023  -31.942 1.00 54.61 ? 91  ASP A CG    1 
ATOM   302  O OD1   . ASP A 1 45  ? -7.006  26.070  -31.586 1.00 54.51 ? 91  ASP A OD1   1 
ATOM   303  O OD2   . ASP A 1 45  ? -5.170  24.922  -32.008 1.00 58.48 ? 91  ASP A OD2   1 
ATOM   304  N N     . ARG A 1 46  ? -9.350  21.383  -31.826 1.00 48.56 ? 92  ARG A N     1 
ATOM   305  C CA    . ARG A 1 46  ? -10.420 20.499  -32.277 1.00 47.44 ? 92  ARG A CA    1 
ATOM   306  C C     . ARG A 1 46  ? -10.069 19.052  -31.885 1.00 45.57 ? 92  ARG A C     1 
ATOM   307  O O     . ARG A 1 46  ? -8.901  18.624  -31.936 1.00 45.58 ? 92  ARG A O     1 
ATOM   308  C CB    . ARG A 1 46  ? -10.672 20.617  -33.790 1.00 46.92 ? 92  ARG A CB    1 
ATOM   309  C CG    . ARG A 1 46  ? -9.399  20.563  -34.622 1.00 49.20 ? 92  ARG A CG    1 
ATOM   310  C CD    . ARG A 1 46  ? -9.620  20.690  -36.139 1.00 49.68 ? 92  ARG A CD    1 
ATOM   311  N NE    . ARG A 1 46  ? -10.325 21.917  -36.534 1.00 55.04 ? 92  ARG A NE    1 
ATOM   312  C CZ    . ARG A 1 46  ? -9.801  23.156  -36.583 1.00 58.19 ? 92  ARG A CZ    1 
ATOM   313  N NH1   . ARG A 1 46  ? -8.526  23.404  -36.231 1.00 59.28 ? 92  ARG A NH1   1 
ATOM   314  N NH2   . ARG A 1 46  ? -10.568 24.168  -36.988 1.00 56.03 ? 92  ARG A NH2   1 
ATOM   315  N N     . LEU A 1 47  ? -11.099 18.309  -31.501 1.00 43.09 ? 93  LEU A N     1 
ATOM   316  C CA    . LEU A 1 47  ? -10.982 16.932  -31.052 1.00 40.53 ? 93  LEU A CA    1 
ATOM   317  C C     . LEU A 1 47  ? -11.248 16.045  -32.267 1.00 38.42 ? 93  LEU A C     1 
ATOM   318  O O     . LEU A 1 47  ? -12.310 15.493  -32.409 1.00 38.32 ? 93  LEU A O     1 
ATOM   319  C CB    . LEU A 1 47  ? -11.966 16.690  -29.903 1.00 40.18 ? 93  LEU A CB    1 
ATOM   320  C CG    . LEU A 1 47  ? -11.801 17.646  -28.715 1.00 42.09 ? 93  LEU A CG    1 
ATOM   321  C CD1   . LEU A 1 47  ? -12.755 17.285  -27.566 1.00 45.15 ? 93  LEU A CD1   1 
ATOM   322  C CD2   . LEU A 1 47  ? -10.347 17.679  -28.195 1.00 42.42 ? 93  LEU A CD2   1 
ATOM   323  N N     . ASP A 1 48  ? -10.246 15.926  -33.139 1.00 36.76 ? 94  ASP A N     1 
ATOM   324  C CA    . ASP A 1 48  ? -10.425 15.452  -34.516 1.00 34.13 ? 94  ASP A CA    1 
ATOM   325  C C     . ASP A 1 48  ? -9.712  14.129  -34.927 1.00 32.50 ? 94  ASP A C     1 
ATOM   326  O O     . ASP A 1 48  ? -9.762  13.723  -36.085 1.00 31.77 ? 94  ASP A O     1 
ATOM   327  C CB    . ASP A 1 48  ? -10.062 16.595  -35.468 1.00 33.99 ? 94  ASP A CB    1 
ATOM   328  C CG    . ASP A 1 48  ? -8.555  16.997  -35.416 1.00 36.03 ? 94  ASP A CG    1 
ATOM   329  O OD1   . ASP A 1 48  ? -7.845  16.718  -34.413 1.00 33.12 ? 94  ASP A OD1   1 
ATOM   330  O OD2   . ASP A 1 48  ? -8.082  17.615  -36.415 1.00 34.98 ? 94  ASP A OD2   1 
ATOM   331  N N     . THR A 1 49  ? -9.084  13.453  -33.969 1.00 30.80 ? 95  THR A N     1 
ATOM   332  C CA    . THR A 1 49  ? -8.319  12.244  -34.241 1.00 28.76 ? 95  THR A CA    1 
ATOM   333  C C     . THR A 1 49  ? -9.229  11.085  -34.690 1.00 29.46 ? 95  THR A C     1 
ATOM   334  O O     . THR A 1 49  ? -10.240 10.766  -34.058 1.00 28.84 ? 95  THR A O     1 
ATOM   335  C CB    . THR A 1 49  ? -7.429  11.847  -33.006 1.00 28.73 ? 95  THR A CB    1 
ATOM   336  O OG1   . THR A 1 49  ? -6.438  12.860  -32.778 1.00 26.39 ? 95  THR A OG1   1 
ATOM   337  C CG2   . THR A 1 49  ? -6.753  10.477  -33.177 1.00 26.81 ? 95  THR A CG2   1 
ATOM   338  N N     . LEU A 1 50  ? -8.867  10.462  -35.802 1.00 29.28 ? 96  LEU A N     1 
ATOM   339  C CA    . LEU A 1 50  ? -9.604  9.345   -36.288 1.00 30.33 ? 96  LEU A CA    1 
ATOM   340  C C     . LEU A 1 50  ? -9.264  8.077   -35.506 1.00 30.14 ? 96  LEU A C     1 
ATOM   341  O O     . LEU A 1 50  ? -8.081  7.660   -35.401 1.00 29.85 ? 96  LEU A O     1 
ATOM   342  C CB    . LEU A 1 50  ? -9.314  9.184   -37.785 1.00 31.25 ? 96  LEU A CB    1 
ATOM   343  C CG    . LEU A 1 50  ? -10.304 8.335   -38.554 1.00 33.24 ? 96  LEU A CG    1 
ATOM   344  C CD1   . LEU A 1 50  ? -11.566 9.154   -38.843 1.00 34.03 ? 96  LEU A CD1   1 
ATOM   345  C CD2   . LEU A 1 50  ? -9.599  7.901   -39.833 1.00 37.79 ? 96  LEU A CD2   1 
ATOM   346  N N     . TRP A 1 51  ? -10.318 7.455   -34.989 1.00 29.59 ? 97  TRP A N     1 
ATOM   347  C CA    . TRP A 1 51  ? -10.217 6.378   -34.019 1.00 29.44 ? 97  TRP A CA    1 
ATOM   348  C C     . TRP A 1 51  ? -9.584  5.082   -34.585 1.00 30.03 ? 97  TRP A C     1 
ATOM   349  O O     . TRP A 1 51  ? -8.610  4.559   -34.021 1.00 30.87 ? 97  TRP A O     1 
ATOM   350  C CB    . TRP A 1 51  ? -11.618 6.132   -33.386 1.00 28.32 ? 97  TRP A CB    1 
ATOM   351  C CG    . TRP A 1 51  ? -11.655 5.034   -32.369 1.00 28.04 ? 97  TRP A CG    1 
ATOM   352  C CD1   . TRP A 1 51  ? -10.769 4.828   -31.340 1.00 26.34 ? 97  TRP A CD1   1 
ATOM   353  C CD2   . TRP A 1 51  ? -12.617 3.974   -32.284 1.00 27.68 ? 97  TRP A CD2   1 
ATOM   354  N NE1   . TRP A 1 51  ? -11.117 3.714   -30.629 1.00 24.44 ? 97  TRP A NE1   1 
ATOM   355  C CE2   . TRP A 1 51  ? -12.263 3.179   -31.167 1.00 26.45 ? 97  TRP A CE2   1 
ATOM   356  C CE3   . TRP A 1 51  ? -13.769 3.638   -33.017 1.00 28.17 ? 97  TRP A CE3   1 
ATOM   357  C CZ2   . TRP A 1 51  ? -13.009 2.049   -30.783 1.00 23.33 ? 97  TRP A CZ2   1 
ATOM   358  C CZ3   . TRP A 1 51  ? -14.503 2.501   -32.635 1.00 26.97 ? 97  TRP A CZ3   1 
ATOM   359  C CH2   . TRP A 1 51  ? -14.113 1.734   -31.527 1.00 27.52 ? 97  TRP A CH2   1 
ATOM   360  N N     . ILE A 1 52  ? -10.146 4.564   -35.683 1.00 30.26 ? 98  ILE A N     1 
ATOM   361  C CA    . ILE A 1 52  ? -9.639  3.380   -36.346 1.00 30.08 ? 98  ILE A CA    1 
ATOM   362  C C     . ILE A 1 52  ? -9.230  3.839   -37.742 1.00 32.37 ? 98  ILE A C     1 
ATOM   363  O O     . ILE A 1 52  ? -10.051 3.878   -38.671 1.00 33.77 ? 98  ILE A O     1 
ATOM   364  C CB    . ILE A 1 52  ? -10.661 2.209   -36.364 1.00 29.72 ? 98  ILE A CB    1 
ATOM   365  C CG1   . ILE A 1 52  ? -10.954 1.747   -34.910 1.00 30.24 ? 98  ILE A CG1   1 
ATOM   366  C CG2   . ILE A 1 52  ? -10.142 1.065   -37.250 1.00 26.33 ? 98  ILE A CG2   1 
ATOM   367  C CD1   . ILE A 1 52  ? -12.007 0.664   -34.702 1.00 27.71 ? 98  ILE A CD1   1 
ATOM   368  N N     . PRO A 1 53  ? -7.952  4.192   -37.898 1.00 32.58 ? 99  PRO A N     1 
ATOM   369  C CA    . PRO A 1 53  ? -7.598  5.037   -39.020 1.00 32.75 ? 99  PRO A CA    1 
ATOM   370  C C     . PRO A 1 53  ? -7.421  4.353   -40.398 1.00 33.08 ? 99  PRO A C     1 
ATOM   371  O O     . PRO A 1 53  ? -7.132  5.061   -41.360 1.00 33.52 ? 99  PRO A O     1 
ATOM   372  C CB    . PRO A 1 53  ? -6.307  5.694   -38.532 1.00 32.01 ? 99  PRO A CB    1 
ATOM   373  C CG    . PRO A 1 53  ? -5.658  4.598   -37.785 1.00 31.92 ? 99  PRO A CG    1 
ATOM   374  C CD    . PRO A 1 53  ? -6.779  3.878   -37.055 1.00 32.56 ? 99  PRO A CD    1 
ATOM   375  N N     . ASN A 1 54  ? -7.629  3.031   -40.500 1.00 32.72 ? 100 ASN A N     1 
ATOM   376  C CA    . ASN A 1 54  ? -7.430  2.274   -41.758 1.00 32.54 ? 100 ASN A CA    1 
ATOM   377  C C     . ASN A 1 54  ? -8.420  1.114   -41.912 1.00 33.34 ? 100 ASN A C     1 
ATOM   378  O O     . ASN A 1 54  ? -8.806  0.492   -40.921 1.00 34.21 ? 100 ASN A O     1 
ATOM   379  C CB    . ASN A 1 54  ? -6.019  1.679   -41.856 1.00 32.35 ? 100 ASN A CB    1 
ATOM   380  C CG    . ASN A 1 54  ? -4.915  2.734   -41.823 1.00 30.77 ? 100 ASN A CG    1 
ATOM   381  O OD1   . ASN A 1 54  ? -4.528  3.262   -42.857 1.00 31.07 ? 100 ASN A OD1   1 
ATOM   382  N ND2   . ASN A 1 54  ? -4.383  3.010   -40.632 1.00 25.07 ? 100 ASN A ND2   1 
ATOM   383  N N     . LYS A 1 55  ? -8.786  0.793   -43.151 1.00 33.50 ? 101 LYS A N     1 
ATOM   384  C CA    . LYS A 1 55  ? -9.873  -0.161  -43.436 1.00 33.61 ? 101 LYS A CA    1 
ATOM   385  C C     . LYS A 1 55  ? -9.465  -1.588  -43.142 1.00 33.25 ? 101 LYS A C     1 
ATOM   386  O O     . LYS A 1 55  ? -10.281 -2.411  -42.758 1.00 34.36 ? 101 LYS A O     1 
ATOM   387  C CB    . LYS A 1 55  ? -10.375 -0.026  -44.891 1.00 33.83 ? 101 LYS A CB    1 
ATOM   388  C CG    . LYS A 1 55  ? -9.515  -0.770  -45.978 1.00 34.14 ? 101 LYS A CG    1 
ATOM   389  C CD    . LYS A 1 55  ? -9.962  -0.420  -47.398 1.00 35.79 ? 101 LYS A CD    1 
ATOM   390  C CE    . LYS A 1 55  ? -9.016  -0.978  -48.444 1.00 38.42 ? 101 LYS A CE    1 
ATOM   391  N NZ    . LYS A 1 55  ? -7.722  -0.201  -48.539 1.00 43.34 ? 101 LYS A NZ    1 
ATOM   392  N N     . GLU A 1 56  ? -8.189  -1.880  -43.311 1.00 33.48 ? 102 GLU A N     1 
ATOM   393  C CA    . GLU A 1 56  ? -7.628  -3.179  -42.967 1.00 32.91 ? 102 GLU A CA    1 
ATOM   394  C C     . GLU A 1 56  ? -7.798  -3.615  -41.487 1.00 33.09 ? 102 GLU A C     1 
ATOM   395  O O     . GLU A 1 56  ? -7.729  -4.828  -41.221 1.00 32.92 ? 102 GLU A O     1 
ATOM   396  C CB    . GLU A 1 56  ? -6.154  -3.226  -43.386 1.00 33.04 ? 102 GLU A CB    1 
ATOM   397  C CG    . GLU A 1 56  ? -5.938  -3.310  -44.905 1.00 32.10 ? 102 GLU A CG    1 
ATOM   398  C CD    . GLU A 1 56  ? -5.761  -1.957  -45.594 1.00 30.30 ? 102 GLU A CD    1 
ATOM   399  O OE1   . GLU A 1 56  ? -5.976  -0.918  -44.969 1.00 27.08 ? 102 GLU A OE1   1 
ATOM   400  O OE2   . GLU A 1 56  ? -5.379  -1.934  -46.793 1.00 35.57 ? 102 GLU A OE2   1 
ATOM   401  N N     . TYR A 1 57  ? -8.013  -2.663  -40.554 1.00 32.29 ? 103 TYR A N     1 
ATOM   402  C CA    . TYR A 1 57  ? -8.294  -3.003  -39.106 1.00 32.77 ? 103 TYR A CA    1 
ATOM   403  C C     . TYR A 1 57  ? -9.643  -3.687  -38.918 1.00 32.59 ? 103 TYR A C     1 
ATOM   404  O O     . TYR A 1 57  ? -9.777  -4.648  -38.121 1.00 31.80 ? 103 TYR A O     1 
ATOM   405  C CB    . TYR A 1 57  ? -8.172  -1.784  -38.145 1.00 31.92 ? 103 TYR A CB    1 
ATOM   406  C CG    . TYR A 1 57  ? -6.761  -1.276  -38.002 1.00 32.24 ? 103 TYR A CG    1 
ATOM   407  C CD1   . TYR A 1 57  ? -5.756  -2.115  -37.484 1.00 33.70 ? 103 TYR A CD1   1 
ATOM   408  C CD2   . TYR A 1 57  ? -6.408  0.034   -38.381 1.00 31.64 ? 103 TYR A CD2   1 
ATOM   409  C CE1   . TYR A 1 57  ? -4.438  -1.686  -37.358 1.00 33.06 ? 103 TYR A CE1   1 
ATOM   410  C CE2   . TYR A 1 57  ? -5.071  0.477   -38.265 1.00 30.82 ? 103 TYR A CE2   1 
ATOM   411  C CZ    . TYR A 1 57  ? -4.093  -0.402  -37.765 1.00 32.83 ? 103 TYR A CZ    1 
ATOM   412  O OH    . TYR A 1 57  ? -2.769  -0.024  -37.644 1.00 30.95 ? 103 TYR A OH    1 
ATOM   413  N N     . PHE A 1 58  ? -10.636 -3.192  -39.671 1.00 32.75 ? 104 PHE A N     1 
ATOM   414  C CA    . PHE A 1 58  ? -11.978 -3.794  -39.763 1.00 32.25 ? 104 PHE A CA    1 
ATOM   415  C C     . PHE A 1 58  ? -11.964 -5.193  -40.374 1.00 32.85 ? 104 PHE A C     1 
ATOM   416  O O     . PHE A 1 58  ? -12.658 -6.108  -39.898 1.00 33.06 ? 104 PHE A O     1 
ATOM   417  C CB    . PHE A 1 58  ? -12.922 -2.857  -40.490 1.00 31.69 ? 104 PHE A CB    1 
ATOM   418  C CG    . PHE A 1 58  ? -13.034 -1.486  -39.846 1.00 31.26 ? 104 PHE A CG    1 
ATOM   419  C CD1   . PHE A 1 58  ? -13.730 -1.309  -38.645 1.00 31.78 ? 104 PHE A CD1   1 
ATOM   420  C CD2   . PHE A 1 58  ? -12.435 -0.396  -40.421 1.00 28.13 ? 104 PHE A CD2   1 
ATOM   421  C CE1   . PHE A 1 58  ? -13.856 -0.069  -38.065 1.00 28.41 ? 104 PHE A CE1   1 
ATOM   422  C CE2   . PHE A 1 58  ? -12.528 0.857   -39.836 1.00 28.65 ? 104 PHE A CE2   1 
ATOM   423  C CZ    . PHE A 1 58  ? -13.254 1.026   -38.667 1.00 30.24 ? 104 PHE A CZ    1 
ATOM   424  N N     . TRP A 1 59  ? -11.146 -5.391  -41.390 1.00 34.31 ? 105 TRP A N     1 
ATOM   425  C CA    . TRP A 1 59  ? -10.960 -6.745  -41.916 1.00 35.92 ? 105 TRP A CA    1 
ATOM   426  C C     . TRP A 1 59  ? -10.286 -7.605  -40.866 1.00 34.63 ? 105 TRP A C     1 
ATOM   427  O O     . TRP A 1 59  ? -10.620 -8.769  -40.704 1.00 34.19 ? 105 TRP A O     1 
ATOM   428  C CB    . TRP A 1 59  ? -10.126 -6.791  -43.219 1.00 38.18 ? 105 TRP A CB    1 
ATOM   429  C CG    . TRP A 1 59  ? -10.590 -5.879  -44.346 1.00 42.12 ? 105 TRP A CG    1 
ATOM   430  C CD1   . TRP A 1 59  ? -11.814 -5.254  -44.481 1.00 44.40 ? 105 TRP A CD1   1 
ATOM   431  C CD2   . TRP A 1 59  ? -9.827  -5.518  -45.509 1.00 42.48 ? 105 TRP A CD2   1 
ATOM   432  N NE1   . TRP A 1 59  ? -11.836 -4.514  -45.642 1.00 44.51 ? 105 TRP A NE1   1 
ATOM   433  C CE2   . TRP A 1 59  ? -10.633 -4.660  -46.289 1.00 43.88 ? 105 TRP A CE2   1 
ATOM   434  C CE3   . TRP A 1 59  ? -8.530  -5.826  -45.950 1.00 43.74 ? 105 TRP A CE3   1 
ATOM   435  C CZ2   . TRP A 1 59  ? -10.189 -4.104  -47.509 1.00 44.85 ? 105 TRP A CZ2   1 
ATOM   436  C CZ3   . TRP A 1 59  ? -8.071  -5.274  -47.180 1.00 45.37 ? 105 TRP A CZ3   1 
ATOM   437  C CH2   . TRP A 1 59  ? -8.905  -4.413  -47.936 1.00 44.83 ? 105 TRP A CH2   1 
ATOM   438  N N     . GLY A 1 60  ? -9.286  -7.043  -40.191 1.00 34.18 ? 106 GLY A N     1 
ATOM   439  C CA    . GLY A 1 60  ? -8.632  -7.741  -39.104 1.00 32.92 ? 106 GLY A CA    1 
ATOM   440  C C     . GLY A 1 60  ? -9.594  -8.089  -37.981 1.00 32.42 ? 106 GLY A C     1 
ATOM   441  O O     . GLY A 1 60  ? -9.593  -9.206  -37.491 1.00 31.58 ? 106 GLY A O     1 
ATOM   442  N N     . LEU A 1 61  ? -10.387 -7.108  -37.569 1.00 33.56 ? 107 LEU A N     1 
ATOM   443  C CA    . LEU A 1 61  ? -11.311 -7.240  -36.450 1.00 34.92 ? 107 LEU A CA    1 
ATOM   444  C C     . LEU A 1 61  ? -12.353 -8.295  -36.759 1.00 37.11 ? 107 LEU A C     1 
ATOM   445  O O     . LEU A 1 61  ? -12.669 -9.116  -35.922 1.00 38.54 ? 107 LEU A O     1 
ATOM   446  C CB    . LEU A 1 61  ? -12.004 -5.907  -36.164 1.00 33.64 ? 107 LEU A CB    1 
ATOM   447  C CG    . LEU A 1 61  ? -11.345 -4.876  -35.255 1.00 33.10 ? 107 LEU A CG    1 
ATOM   448  C CD1   . LEU A 1 61  ? -12.099 -3.526  -35.281 1.00 27.88 ? 107 LEU A CD1   1 
ATOM   449  C CD2   . LEU A 1 61  ? -11.111 -5.383  -33.794 1.00 31.70 ? 107 LEU A CD2   1 
ATOM   450  N N     . SER A 1 62  ? -12.884 -8.274  -37.975 1.00 39.85 ? 108 SER A N     1 
ATOM   451  C CA    . SER A 1 62  ? -13.777 -9.324  -38.468 1.00 41.34 ? 108 SER A CA    1 
ATOM   452  C C     . SER A 1 62  ? -13.128 -10.722 -38.459 1.00 42.56 ? 108 SER A C     1 
ATOM   453  O O     . SER A 1 62  ? -13.768 -11.686 -38.014 1.00 43.66 ? 108 SER A O     1 
ATOM   454  C CB    . SER A 1 62  ? -14.278 -8.954  -39.863 1.00 41.31 ? 108 SER A CB    1 
ATOM   455  O OG    . SER A 1 62  ? -14.766 -10.105 -40.515 1.00 43.56 ? 108 SER A OG    1 
ATOM   456  N N     . LYS A 1 63  ? -11.883 -10.848 -38.933 1.00 42.83 ? 109 LYS A N     1 
ATOM   457  C CA    . LYS A 1 63  ? -11.126 -12.105 -38.838 1.00 43.37 ? 109 LYS A CA    1 
ATOM   458  C C     . LYS A 1 63  ? -11.037 -12.588 -37.378 1.00 43.54 ? 109 LYS A C     1 
ATOM   459  O O     . LYS A 1 63  ? -11.065 -13.802 -37.107 1.00 44.17 ? 109 LYS A O     1 
ATOM   460  C CB    . LYS A 1 63  ? -9.717  -11.990 -39.475 1.00 44.29 ? 109 LYS A CB    1 
ATOM   461  C CG    . LYS A 1 63  ? -9.682  -11.828 -41.086 1.00 45.95 ? 109 LYS A CG    1 
ATOM   462  C CD    . LYS A 1 63  ? -8.242  -11.572 -41.744 1.00 44.77 ? 109 LYS A CD    1 
ATOM   463  C CE    . LYS A 1 63  ? -8.070  -12.020 -43.272 1.00 46.00 ? 109 LYS A CE    1 
ATOM   464  N NZ    . LYS A 1 63  ? -6.731  -12.785 -43.585 1.00 44.06 ? 109 LYS A NZ    1 
ATOM   465  N N     . PHE A 1 64  ? -10.961 -11.642 -36.433 1.00 42.68 ? 110 PHE A N     1 
ATOM   466  C CA    . PHE A 1 64  ? -10.908 -11.961 -35.009 1.00 40.93 ? 110 PHE A CA    1 
ATOM   467  C C     . PHE A 1 64  ? -12.266 -12.464 -34.482 1.00 41.09 ? 110 PHE A C     1 
ATOM   468  O O     . PHE A 1 64  ? -12.326 -13.426 -33.727 1.00 40.18 ? 110 PHE A O     1 
ATOM   469  C CB    . PHE A 1 64  ? -10.407 -10.744 -34.217 1.00 39.62 ? 110 PHE A CB    1 
ATOM   470  C CG    . PHE A 1 64  ? -10.423 -10.913 -32.702 1.00 36.68 ? 110 PHE A CG    1 
ATOM   471  C CD1   . PHE A 1 64  ? -9.578  -11.814 -32.065 1.00 35.73 ? 110 PHE A CD1   1 
ATOM   472  C CD2   . PHE A 1 64  ? -11.240 -10.116 -31.916 1.00 36.68 ? 110 PHE A CD2   1 
ATOM   473  C CE1   . PHE A 1 64  ? -9.577  -11.950 -30.634 1.00 36.67 ? 110 PHE A CE1   1 
ATOM   474  C CE2   . PHE A 1 64  ? -11.223 -10.240 -30.495 1.00 36.68 ? 110 PHE A CE2   1 
ATOM   475  C CZ    . PHE A 1 64  ? -10.396 -11.155 -29.870 1.00 33.94 ? 110 PHE A CZ    1 
ATOM   476  N N     . LEU A 1 65  ? -13.347 -11.810 -34.867 1.00 41.69 ? 111 LEU A N     1 
ATOM   477  C CA    . LEU A 1 65  ? -14.668 -12.256 -34.448 1.00 43.65 ? 111 LEU A CA    1 
ATOM   478  C C     . LEU A 1 65  ? -15.104 -13.510 -35.192 1.00 44.49 ? 111 LEU A C     1 
ATOM   479  O O     . LEU A 1 65  ? -16.244 -13.903 -35.091 1.00 46.10 ? 111 LEU A O     1 
ATOM   480  C CB    . LEU A 1 65  ? -15.722 -11.151 -34.615 1.00 43.47 ? 111 LEU A CB    1 
ATOM   481  C CG    . LEU A 1 65  ? -15.469 -9.807  -33.912 1.00 44.36 ? 111 LEU A CG    1 
ATOM   482  C CD1   . LEU A 1 65  ? -16.480 -8.736  -34.384 1.00 43.40 ? 111 LEU A CD1   1 
ATOM   483  C CD2   . LEU A 1 65  ? -15.461 -9.893  -32.376 1.00 43.66 ? 111 LEU A CD2   1 
ATOM   484  N N     . GLY A 1 66  ? -14.197 -14.144 -35.927 1.00 45.61 ? 112 GLY A N     1 
ATOM   485  C CA    . GLY A 1 66  ? -14.482 -15.402 -36.601 1.00 46.97 ? 112 GLY A CA    1 
ATOM   486  C C     . GLY A 1 66  ? -15.550 -15.293 -37.684 1.00 48.88 ? 112 GLY A C     1 
ATOM   487  O O     . GLY A 1 66  ? -16.241 -16.285 -37.980 1.00 50.10 ? 112 GLY A O     1 
ATOM   488  N N     . THR A 1 67  ? -15.705 -14.097 -38.258 1.00 49.18 ? 113 THR A N     1 
ATOM   489  C CA    . THR A 1 67  ? -16.600 -13.869 -39.376 1.00 49.62 ? 113 THR A CA    1 
ATOM   490  C C     . THR A 1 67  ? -15.845 -13.559 -40.672 1.00 50.96 ? 113 THR A C     1 
ATOM   491  O O     . THR A 1 67  ? -14.702 -13.995 -40.853 1.00 50.76 ? 113 THR A O     1 
ATOM   492  C CB    . THR A 1 67  ? -17.616 -12.737 -39.103 1.00 48.69 ? 113 THR A CB    1 
ATOM   493  O OG1   . THR A 1 67  ? -16.921 -11.539 -38.779 1.00 47.76 ? 113 THR A OG1   1 
ATOM   494  C CG2   . THR A 1 67  ? -18.554 -13.102 -37.976 1.00 48.51 ? 113 THR A CG2   1 
ATOM   495  N N     . HIS A 1 68  ? -16.478 -12.733 -41.511 1.00 52.61 ? 114 HIS A N     1 
ATOM   496  C CA    . HIS A 1 68  ? -16.253 -12.676 -42.960 1.00 54.50 ? 114 HIS A CA    1 
ATOM   497  C C     . HIS A 1 68  ? -15.926 -11.270 -43.506 1.00 55.66 ? 114 HIS A C     1 
ATOM   498  O O     . HIS A 1 68  ? -15.846 -10.283 -42.741 1.00 55.39 ? 114 HIS A O     1 
ATOM   499  C CB    . HIS A 1 68  ? -17.505 -13.255 -43.692 1.00 54.95 ? 114 HIS A CB    1 
ATOM   500  C CG    . HIS A 1 68  ? -18.822 -12.961 -43.007 1.00 54.16 ? 114 HIS A CG    1 
ATOM   501  N ND1   . HIS A 1 68  ? -19.448 -11.737 -43.086 1.00 53.17 ? 114 HIS A ND1   1 
ATOM   502  C CD2   . HIS A 1 68  ? -19.613 -13.732 -42.217 1.00 53.55 ? 114 HIS A CD2   1 
ATOM   503  C CE1   . HIS A 1 68  ? -20.567 -11.766 -42.378 1.00 53.49 ? 114 HIS A CE1   1 
ATOM   504  N NE2   . HIS A 1 68  ? -20.687 -12.960 -41.834 1.00 52.57 ? 114 HIS A NE2   1 
ATOM   505  N N     . TRP A 1 69  ? -15.757 -11.195 -44.834 1.00 56.97 ? 115 TRP A N     1 
ATOM   506  C CA    . TRP A 1 69  ? -15.640 -9.932  -45.586 1.00 58.01 ? 115 TRP A CA    1 
ATOM   507  C C     . TRP A 1 69  ? -16.808 -8.966  -45.330 1.00 57.47 ? 115 TRP A C     1 
ATOM   508  O O     . TRP A 1 69  ? -16.620 -7.747  -45.311 1.00 57.74 ? 115 TRP A O     1 
ATOM   509  C CB    . TRP A 1 69  ? -15.524 -10.222 -47.096 1.00 59.89 ? 115 TRP A CB    1 
ATOM   510  C CG    . TRP A 1 69  ? -16.727 -11.015 -47.647 1.00 62.67 ? 115 TRP A CG    1 
ATOM   511  C CD1   . TRP A 1 69  ? -16.836 -12.392 -47.754 1.00 63.68 ? 115 TRP A CD1   1 
ATOM   512  C CD2   . TRP A 1 69  ? -17.996 -10.478 -48.108 1.00 64.59 ? 115 TRP A CD2   1 
ATOM   513  N NE1   . TRP A 1 69  ? -18.080 -12.731 -48.259 1.00 65.12 ? 115 TRP A NE1   1 
ATOM   514  C CE2   . TRP A 1 69  ? -18.810 -11.587 -48.483 1.00 64.79 ? 115 TRP A CE2   1 
ATOM   515  C CE3   . TRP A 1 69  ? -18.519 -9.172  -48.244 1.00 64.45 ? 115 TRP A CE3   1 
ATOM   516  C CZ2   . TRP A 1 69  ? -20.121 -11.428 -48.985 1.00 63.70 ? 115 TRP A CZ2   1 
ATOM   517  C CZ3   . TRP A 1 69  ? -19.830 -9.016  -48.744 1.00 63.69 ? 115 TRP A CZ3   1 
ATOM   518  C CH2   . TRP A 1 69  ? -20.609 -10.143 -49.109 1.00 63.24 ? 115 TRP A CH2   1 
ATOM   519  N N     . LEU A 1 70  ? -18.011 -9.501  -45.122 1.00 56.69 ? 116 LEU A N     1 
ATOM   520  C CA    . LEU A 1 70  ? -19.220 -8.661  -44.994 1.00 56.42 ? 116 LEU A CA    1 
ATOM   521  C C     . LEU A 1 70  ? -19.331 -7.927  -43.654 1.00 55.28 ? 116 LEU A C     1 
ATOM   522  O O     . LEU A 1 70  ? -19.759 -6.771  -43.594 1.00 54.79 ? 116 LEU A O     1 
ATOM   523  C CB    . LEU A 1 70  ? -20.489 -9.500  -45.251 1.00 56.28 ? 116 LEU A CB    1 
ATOM   524  C CG    . LEU A 1 70  ? -21.837 -8.933  -44.764 1.00 57.37 ? 116 LEU A CG    1 
ATOM   525  C CD1   . LEU A 1 70  ? -22.326 -7.711  -45.578 1.00 55.39 ? 116 LEU A CD1   1 
ATOM   526  C CD2   . LEU A 1 70  ? -22.895 -10.056 -44.726 1.00 57.40 ? 116 LEU A CD2   1 
ATOM   527  N N     . MET A 1 71  ? -18.971 -8.624  -42.578 1.00 54.66 ? 117 MET A N     1 
ATOM   528  C CA    . MET A 1 71  ? -18.914 -8.010  -41.247 1.00 53.95 ? 117 MET A CA    1 
ATOM   529  C C     . MET A 1 71  ? -17.851 -6.911  -41.229 1.00 52.64 ? 117 MET A C     1 
ATOM   530  O O     . MET A 1 71  ? -18.090 -5.835  -40.690 1.00 53.12 ? 117 MET A O     1 
ATOM   531  C CB    . MET A 1 71  ? -18.685 -9.080  -40.168 1.00 54.49 ? 117 MET A CB    1 
ATOM   532  C CG    . MET A 1 71  ? -18.707 -8.599  -38.715 1.00 56.05 ? 117 MET A CG    1 
ATOM   533  S SD    . MET A 1 71  ? -20.198 -7.690  -38.226 1.00 59.67 ? 117 MET A SD    1 
ATOM   534  C CE    . MET A 1 71  ? -19.819 -7.317  -36.512 1.00 59.15 ? 117 MET A CE    1 
ATOM   535  N N     . GLY A 1 72  ? -16.704 -7.172  -41.853 1.00 51.24 ? 118 GLY A N     1 
ATOM   536  C CA    . GLY A 1 72  ? -15.643 -6.177  -42.017 1.00 50.07 ? 118 GLY A CA    1 
ATOM   537  C C     . GLY A 1 72  ? -16.140 -4.901  -42.654 1.00 49.41 ? 118 GLY A C     1 
ATOM   538  O O     . GLY A 1 72  ? -15.838 -3.799  -42.178 1.00 49.78 ? 118 GLY A O     1 
ATOM   539  N N     . ASN A 1 73  ? -16.933 -5.037  -43.715 1.00 48.15 ? 119 ASN A N     1 
ATOM   540  C CA    . ASN A 1 73  ? -17.531 -3.857  -44.361 1.00 47.44 ? 119 ASN A CA    1 
ATOM   541  C C     . ASN A 1 73  ? -18.620 -3.175  -43.544 1.00 45.88 ? 119 ASN A C     1 
ATOM   542  O O     . ASN A 1 73  ? -18.716 -1.953  -43.544 1.00 46.12 ? 119 ASN A O     1 
ATOM   543  C CB    . ASN A 1 73  ? -17.955 -4.136  -45.827 1.00 47.82 ? 119 ASN A CB    1 
ATOM   544  C CG    . ASN A 1 73  ? -16.751 -4.247  -46.755 1.00 49.22 ? 119 ASN A CG    1 
ATOM   545  O OD1   . ASN A 1 73  ? -16.034 -3.259  -46.961 1.00 53.27 ? 119 ASN A OD1   1 
ATOM   546  N ND2   . ASN A 1 73  ? -16.483 -5.451  -47.269 1.00 47.74 ? 119 ASN A ND2   1 
ATOM   547  N N     . ILE A 1 74  ? -19.412 -3.958  -42.823 1.00 44.39 ? 120 ILE A N     1 
ATOM   548  C CA    . ILE A 1 74  ? -20.340 -3.399  -41.820 1.00 43.36 ? 120 ILE A CA    1 
ATOM   549  C C     . ILE A 1 74  ? -19.662 -2.572  -40.694 1.00 42.83 ? 120 ILE A C     1 
ATOM   550  O O     . ILE A 1 74  ? -20.083 -1.439  -40.443 1.00 43.55 ? 120 ILE A O     1 
ATOM   551  C CB    . ILE A 1 74  ? -21.333 -4.486  -41.258 1.00 43.66 ? 120 ILE A CB    1 
ATOM   552  C CG1   . ILE A 1 74  ? -22.274 -4.974  -42.371 1.00 43.29 ? 120 ILE A CG1   1 
ATOM   553  C CG2   . ILE A 1 74  ? -22.133 -3.949  -40.090 1.00 43.72 ? 120 ILE A CG2   1 
ATOM   554  C CD1   . ILE A 1 74  ? -23.036 -6.208  -42.040 1.00 46.73 ? 120 ILE A CD1   1 
ATOM   555  N N     . LEU A 1 75  ? -18.635 -3.120  -40.034 1.00 42.09 ? 121 LEU A N     1 
ATOM   556  C CA    . LEU A 1 75  ? -17.832 -2.374  -39.009 1.00 41.97 ? 121 LEU A CA    1 
ATOM   557  C C     . LEU A 1 75  ? -17.270 -1.060  -39.522 1.00 41.06 ? 121 LEU A C     1 
ATOM   558  O O     . LEU A 1 75  ? -17.318 -0.038  -38.847 1.00 40.18 ? 121 LEU A O     1 
ATOM   559  C CB    . LEU A 1 75  ? -16.666 -3.225  -38.458 1.00 41.19 ? 121 LEU A CB    1 
ATOM   560  C CG    . LEU A 1 75  ? -17.149 -4.436  -37.648 1.00 39.84 ? 121 LEU A CG    1 
ATOM   561  C CD1   . LEU A 1 75  ? -15.995 -5.284  -37.205 1.00 39.25 ? 121 LEU A CD1   1 
ATOM   562  C CD2   . LEU A 1 75  ? -17.995 -3.973  -36.441 1.00 40.41 ? 121 LEU A CD2   1 
ATOM   563  N N     . ARG A 1 76  ? -16.760 -1.104  -40.747 1.00 41.74 ? 122 ARG A N     1 
ATOM   564  C CA    . ARG A 1 76  ? -16.164 0.056   -41.377 1.00 41.52 ? 122 ARG A CA    1 
ATOM   565  C C     . ARG A 1 76  ? -17.212 1.135   -41.570 1.00 41.82 ? 122 ARG A C     1 
ATOM   566  O O     . ARG A 1 76  ? -16.914 2.338   -41.402 1.00 41.77 ? 122 ARG A O     1 
ATOM   567  C CB    . ARG A 1 76  ? -15.529 -0.382  -42.680 1.00 41.55 ? 122 ARG A CB    1 
ATOM   568  C CG    . ARG A 1 76  ? -14.798 0.681   -43.378 1.00 44.22 ? 122 ARG A CG    1 
ATOM   569  C CD    . ARG A 1 76  ? -14.567 0.293   -44.828 1.00 49.32 ? 122 ARG A CD    1 
ATOM   570  N NE    . ARG A 1 76  ? -13.579 1.218   -45.353 1.00 53.52 ? 122 ARG A NE    1 
ATOM   571  C CZ    . ARG A 1 76  ? -13.429 1.567   -46.627 1.00 56.73 ? 122 ARG A CZ    1 
ATOM   572  N NH1   . ARG A 1 76  ? -14.220 1.068   -47.575 1.00 56.98 ? 122 ARG A NH1   1 
ATOM   573  N NH2   . ARG A 1 76  ? -12.464 2.432   -46.944 1.00 57.45 ? 122 ARG A NH2   1 
ATOM   574  N N     . LEU A 1 77  ? -18.446 0.726   -41.903 1.00 41.99 ? 123 LEU A N     1 
ATOM   575  C CA    . LEU A 1 77  ? -19.549 1.693   -42.080 1.00 42.47 ? 123 LEU A CA    1 
ATOM   576  C C     . LEU A 1 77  ? -19.999 2.309   -40.767 1.00 42.36 ? 123 LEU A C     1 
ATOM   577  O O     . LEU A 1 77  ? -20.109 3.528   -40.636 1.00 42.29 ? 123 LEU A O     1 
ATOM   578  C CB    . LEU A 1 77  ? -20.747 1.054   -42.776 1.00 43.52 ? 123 LEU A CB    1 
ATOM   579  C CG    . LEU A 1 77  ? -20.975 1.606   -44.182 1.00 45.05 ? 123 LEU A CG    1 
ATOM   580  C CD1   . LEU A 1 77  ? -21.403 0.485   -45.176 1.00 47.78 ? 123 LEU A CD1   1 
ATOM   581  C CD2   . LEU A 1 77  ? -21.993 2.744   -44.116 1.00 47.80 ? 123 LEU A CD2   1 
ATOM   582  N N     . LEU A 1 78  ? -20.257 1.448   -39.795 1.00 42.07 ? 124 LEU A N     1 
ATOM   583  C CA    . LEU A 1 78  ? -20.477 1.889   -38.438 1.00 41.82 ? 124 LEU A CA    1 
ATOM   584  C C     . LEU A 1 78  ? -19.377 2.798   -37.859 1.00 41.00 ? 124 LEU A C     1 
ATOM   585  O O     . LEU A 1 78  ? -19.709 3.785   -37.219 1.00 40.63 ? 124 LEU A O     1 
ATOM   586  C CB    . LEU A 1 78  ? -20.696 0.676   -37.544 1.00 42.14 ? 124 LEU A CB    1 
ATOM   587  C CG    . LEU A 1 78  ? -22.121 0.152   -37.527 1.00 42.64 ? 124 LEU A CG    1 
ATOM   588  C CD1   . LEU A 1 78  ? -22.104 -1.321  -37.246 1.00 44.52 ? 124 LEU A CD1   1 
ATOM   589  C CD2   . LEU A 1 78  ? -22.876 0.891   -36.452 1.00 46.63 ? 124 LEU A CD2   1 
ATOM   590  N N     . PHE A 1 79  ? -18.088 2.497   -38.089 1.00 40.21 ? 125 PHE A N     1 
ATOM   591  C CA    . PHE A 1 79  ? -17.042 3.149   -37.285 1.00 39.70 ? 125 PHE A CA    1 
ATOM   592  C C     . PHE A 1 79  ? -15.923 3.905   -38.026 1.00 39.72 ? 125 PHE A C     1 
ATOM   593  O O     . PHE A 1 79  ? -15.130 4.619   -37.390 1.00 39.14 ? 125 PHE A O     1 
ATOM   594  C CB    . PHE A 1 79  ? -16.446 2.133   -36.290 1.00 40.45 ? 125 PHE A CB    1 
ATOM   595  C CG    . PHE A 1 79  ? -17.487 1.424   -35.423 1.00 38.68 ? 125 PHE A CG    1 
ATOM   596  C CD1   . PHE A 1 79  ? -18.237 2.137   -34.491 1.00 38.44 ? 125 PHE A CD1   1 
ATOM   597  C CD2   . PHE A 1 79  ? -17.694 0.049   -35.547 1.00 37.59 ? 125 PHE A CD2   1 
ATOM   598  C CE1   . PHE A 1 79  ? -19.221 1.484   -33.701 1.00 39.22 ? 125 PHE A CE1   1 
ATOM   599  C CE2   . PHE A 1 79  ? -18.641 -0.610  -34.759 1.00 39.94 ? 125 PHE A CE2   1 
ATOM   600  C CZ    . PHE A 1 79  ? -19.410 0.113   -33.823 1.00 39.14 ? 125 PHE A CZ    1 
ATOM   601  N N     . GLY A 1 80  ? -15.906 3.792   -39.363 1.00 38.98 ? 126 GLY A N     1 
ATOM   602  C CA    . GLY A 1 80  ? -14.787 4.245   -40.204 1.00 37.47 ? 126 GLY A CA    1 
ATOM   603  C C     . GLY A 1 80  ? -14.464 5.716   -40.078 1.00 36.89 ? 126 GLY A C     1 
ATOM   604  O O     . GLY A 1 80  ? -13.363 6.136   -40.455 1.00 36.26 ? 126 GLY A O     1 
ATOM   605  N N     . SER A 1 81  ? -15.387 6.470   -39.479 1.00 36.32 ? 127 SER A N     1 
ATOM   606  C CA    . SER A 1 81  ? -15.309 7.926   -39.399 1.00 37.17 ? 127 SER A CA    1 
ATOM   607  C C     . SER A 1 81  ? -15.419 8.464   -37.985 1.00 37.10 ? 127 SER A C     1 
ATOM   608  O O     . SER A 1 81  ? -15.399 9.697   -37.752 1.00 37.03 ? 127 SER A O     1 
ATOM   609  C CB    . SER A 1 81  ? -16.406 8.550   -40.280 1.00 37.83 ? 127 SER A CB    1 
ATOM   610  O OG    . SER A 1 81  ? -17.634 7.827   -40.118 1.00 40.93 ? 127 SER A OG    1 
ATOM   611  N N     . MET A 1 82  ? -15.547 7.535   -37.032 1.00 37.56 ? 128 MET A N     1 
ATOM   612  C CA    . MET A 1 82  ? -15.635 7.878   -35.630 1.00 37.09 ? 128 MET A CA    1 
ATOM   613  C C     . MET A 1 82  ? -14.316 8.509   -35.261 1.00 35.57 ? 128 MET A C     1 
ATOM   614  O O     . MET A 1 82  ? -13.290 8.048   -35.688 1.00 35.24 ? 128 MET A O     1 
ATOM   615  C CB    . MET A 1 82  ? -15.852 6.617   -34.788 1.00 37.00 ? 128 MET A CB    1 
ATOM   616  C CG    . MET A 1 82  ? -16.121 6.923   -33.312 1.00 38.31 ? 128 MET A CG    1 
ATOM   617  S SD    . MET A 1 82  ? -17.112 5.649   -32.492 1.00 40.96 ? 128 MET A SD    1 
ATOM   618  C CE    . MET A 1 82  ? -18.764 6.022   -33.150 1.00 45.38 ? 128 MET A CE    1 
ATOM   619  N N     . THR A 1 83  ? -14.361 9.582   -34.492 1.00 35.02 ? 129 THR A N     1 
ATOM   620  C CA    . THR A 1 83  ? -13.184 10.195  -33.935 1.00 33.34 ? 129 THR A CA    1 
ATOM   621  C C     . THR A 1 83  ? -12.998 9.809   -32.449 1.00 32.13 ? 129 THR A C     1 
ATOM   622  O O     . THR A 1 83  ? -13.832 9.129   -31.841 1.00 32.15 ? 129 THR A O     1 
ATOM   623  C CB    . THR A 1 83  ? -13.226 11.753  -34.062 1.00 33.55 ? 129 THR A CB    1 
ATOM   624  O OG1   . THR A 1 83  ? -14.287 12.273  -33.243 1.00 35.70 ? 129 THR A OG1   1 
ATOM   625  C CG2   . THR A 1 83  ? -13.366 12.211  -35.512 1.00 31.67 ? 129 THR A CG2   1 
ATOM   626  N N     . THR A 1 84  ? -11.905 10.281  -31.872 1.00 29.88 ? 130 THR A N     1 
ATOM   627  C CA    . THR A 1 84  ? -11.645 10.121  -30.477 1.00 29.04 ? 130 THR A CA    1 
ATOM   628  C C     . THR A 1 84  ? -11.096 11.456  -29.955 1.00 28.30 ? 130 THR A C     1 
ATOM   629  O O     . THR A 1 84  ? -10.342 12.131  -30.635 1.00 28.29 ? 130 THR A O     1 
ATOM   630  C CB    . THR A 1 84  ? -10.718 8.854   -30.167 1.00 28.85 ? 130 THR A CB    1 
ATOM   631  O OG1   . THR A 1 84  ? -10.459 8.787   -28.765 1.00 29.61 ? 130 THR A OG1   1 
ATOM   632  C CG2   . THR A 1 84  ? -9.364  8.911   -30.863 1.00 28.80 ? 130 THR A CG2   1 
ATOM   633  N N     . PRO A 1 85  ? -11.506 11.864  -28.760 1.00 28.31 ? 131 PRO A N     1 
ATOM   634  C CA    . PRO A 1 85  ? -11.235 13.261  -28.346 1.00 29.09 ? 131 PRO A CA    1 
ATOM   635  C C     . PRO A 1 85  ? -9.781  13.661  -28.070 1.00 29.02 ? 131 PRO A C     1 
ATOM   636  O O     . PRO A 1 85  ? -9.423  13.916  -26.920 1.00 29.42 ? 131 PRO A O     1 
ATOM   637  C CB    . PRO A 1 85  ? -12.133 13.439  -27.109 1.00 29.23 ? 131 PRO A CB    1 
ATOM   638  C CG    . PRO A 1 85  ? -12.318 12.026  -26.597 1.00 27.60 ? 131 PRO A CG    1 
ATOM   639  C CD    . PRO A 1 85  ? -12.332 11.135  -27.783 1.00 27.50 ? 131 PRO A CD    1 
ATOM   640  N N     . ALA A 1 86  ? -8.961  13.744  -29.125 1.00 28.99 ? 132 ALA A N     1 
ATOM   641  C CA    . ALA A 1 86  ? -7.600  14.252  -28.990 1.00 28.95 ? 132 ALA A CA    1 
ATOM   642  C C     . ALA A 1 86  ? -7.335  15.139  -30.170 1.00 29.40 ? 132 ALA A C     1 
ATOM   643  O O     . ALA A 1 86  ? -7.804  14.834  -31.266 1.00 29.84 ? 132 ALA A O     1 
ATOM   644  C CB    . ALA A 1 86  ? -6.598  13.090  -28.967 1.00 28.63 ? 132 ALA A CB    1 
ATOM   645  N N     . ASN A 1 87  ? -6.607  16.241  -29.951 1.00 30.19 ? 133 ASN A N     1 
ATOM   646  C CA    . ASN A 1 87  ? -6.130  17.126  -31.052 1.00 30.24 ? 133 ASN A CA    1 
ATOM   647  C C     . ASN A 1 87  ? -5.035  16.426  -31.894 1.00 29.54 ? 133 ASN A C     1 
ATOM   648  O O     . ASN A 1 87  ? -3.885  16.308  -31.467 1.00 28.91 ? 133 ASN A O     1 
ATOM   649  C CB    . ASN A 1 87  ? -5.551  18.412  -30.482 1.00 30.85 ? 133 ASN A CB    1 
ATOM   650  C CG    . ASN A 1 87  ? -6.575  19.243  -29.658 1.00 35.57 ? 133 ASN A CG    1 
ATOM   651  O OD1   . ASN A 1 87  ? -7.119  20.218  -30.156 1.00 38.55 ? 133 ASN A OD1   1 
ATOM   652  N ND2   . ASN A 1 87  ? -6.807  18.865  -28.406 1.00 35.31 ? 133 ASN A ND2   1 
ATOM   653  N N     . TRP A 1 88  ? -5.400  15.956  -33.077 1.00 29.16 ? 134 TRP A N     1 
ATOM   654  C CA    . TRP A 1 88  ? -4.457  15.306  -33.999 1.00 28.99 ? 134 TRP A CA    1 
ATOM   655  C C     . TRP A 1 88  ? -3.296  16.203  -34.453 1.00 30.10 ? 134 TRP A C     1 
ATOM   656  O O     . TRP A 1 88  ? -3.535  17.209  -35.129 1.00 28.86 ? 134 TRP A O     1 
ATOM   657  C CB    . TRP A 1 88  ? -5.207  14.821  -35.231 1.00 27.32 ? 134 TRP A CB    1 
ATOM   658  C CG    . TRP A 1 88  ? -4.399  14.006  -36.236 1.00 27.38 ? 134 TRP A CG    1 
ATOM   659  C CD1   . TRP A 1 88  ? -4.158  14.319  -37.571 1.00 25.43 ? 134 TRP A CD1   1 
ATOM   660  C CD2   . TRP A 1 88  ? -3.784  12.716  -36.012 1.00 26.52 ? 134 TRP A CD2   1 
ATOM   661  N NE1   . TRP A 1 88  ? -3.457  13.280  -38.175 1.00 27.75 ? 134 TRP A NE1   1 
ATOM   662  C CE2   . TRP A 1 88  ? -3.222  12.292  -37.254 1.00 26.12 ? 134 TRP A CE2   1 
ATOM   663  C CE3   . TRP A 1 88  ? -3.708  11.844  -34.898 1.00 25.45 ? 134 TRP A CE3   1 
ATOM   664  C CZ2   . TRP A 1 88  ? -2.553  11.066  -37.392 1.00 25.99 ? 134 TRP A CZ2   1 
ATOM   665  C CZ3   . TRP A 1 88  ? -3.061  10.606  -35.051 1.00 24.46 ? 134 TRP A CZ3   1 
ATOM   666  C CH2   . TRP A 1 88  ? -2.480  10.245  -36.283 1.00 24.70 ? 134 TRP A CH2   1 
ATOM   667  N N     . ASN A 1 89  ? -2.061  15.779  -34.098 1.00 30.90 ? 135 ASN A N     1 
ATOM   668  C CA    . ASN A 1 89  ? -0.782  16.389  -34.485 1.00 31.22 ? 135 ASN A CA    1 
ATOM   669  C C     . ASN A 1 89  ? -0.555  17.737  -33.835 1.00 32.51 ? 135 ASN A C     1 
ATOM   670  O O     . ASN A 1 89  ? 0.246   18.562  -34.290 1.00 33.28 ? 135 ASN A O     1 
ATOM   671  C CB    . ASN A 1 89  ? -0.639  16.501  -35.997 1.00 31.43 ? 135 ASN A CB    1 
ATOM   672  C CG    . ASN A 1 89  ? -0.310  15.182  -36.672 1.00 31.14 ? 135 ASN A CG    1 
ATOM   673  O OD1   . ASN A 1 89  ? -0.645  15.007  -37.848 1.00 33.54 ? 135 ASN A OD1   1 
ATOM   674  N ND2   . ASN A 1 89  ? 0.374   14.270  -35.971 1.00 23.81 ? 135 ASN A ND2   1 
ATOM   675  N N     . SER A 1 90  ? -1.235  17.953  -32.729 1.00 33.00 ? 136 SER A N     1 
ATOM   676  C CA    . SER A 1 90  ? -1.130  19.207  -32.016 1.00 34.05 ? 136 SER A CA    1 
ATOM   677  C C     . SER A 1 90  ? 0.254   19.356  -31.381 1.00 34.18 ? 136 SER A C     1 
ATOM   678  O O     . SER A 1 90  ? 0.875   18.362  -31.029 1.00 34.86 ? 136 SER A O     1 
ATOM   679  C CB    . SER A 1 90  ? -2.192  19.228  -30.934 1.00 33.35 ? 136 SER A CB    1 
ATOM   680  O OG    . SER A 1 90  ? -2.447  20.537  -30.548 1.00 37.44 ? 136 SER A OG    1 
ATOM   681  N N     . PRO A 1 91  ? 0.785   20.596  -31.295 1.00 34.48 ? 137 PRO A N     1 
ATOM   682  C CA    . PRO A 1 91  ? 2.040   20.788  -30.538 1.00 33.65 ? 137 PRO A CA    1 
ATOM   683  C C     . PRO A 1 91  ? 2.058   20.267  -29.081 1.00 33.06 ? 137 PRO A C     1 
ATOM   684  O O     . PRO A 1 91  ? 1.067   20.334  -28.367 1.00 31.85 ? 137 PRO A O     1 
ATOM   685  C CB    . PRO A 1 91  ? 2.283   22.300  -30.628 1.00 33.68 ? 137 PRO A CB    1 
ATOM   686  C CG    . PRO A 1 91  ? 1.694   22.657  -31.974 1.00 34.70 ? 137 PRO A CG    1 
ATOM   687  C CD    . PRO A 1 91  ? 0.395   21.826  -32.019 1.00 34.12 ? 137 PRO A CD    1 
ATOM   688  N N     . LEU A 1 92  ? 3.197   19.700  -28.705 1.00 32.00 ? 138 LEU A N     1 
ATOM   689  C CA    . LEU A 1 92  ? 3.461   19.244  -27.383 1.00 31.96 ? 138 LEU A CA    1 
ATOM   690  C C     . LEU A 1 92  ? 3.570   20.494  -26.492 1.00 33.07 ? 138 LEU A C     1 
ATOM   691  O O     . LEU A 1 92  ? 4.166   21.482  -26.892 1.00 32.50 ? 138 LEU A O     1 
ATOM   692  C CB    . LEU A 1 92  ? 4.752   18.389  -27.345 1.00 30.57 ? 138 LEU A CB    1 
ATOM   693  C CG    . LEU A 1 92  ? 5.103   17.933  -25.914 1.00 30.82 ? 138 LEU A CG    1 
ATOM   694  C CD1   . LEU A 1 92  ? 4.095   16.875  -25.378 1.00 23.22 ? 138 LEU A CD1   1 
ATOM   695  C CD2   . LEU A 1 92  ? 6.565   17.440  -25.808 1.00 30.89 ? 138 LEU A CD2   1 
ATOM   696  N N     . ARG A 1 93  ? 2.945   20.431  -25.319 1.00 34.32 ? 139 ARG A N     1 
ATOM   697  C CA    . ARG A 1 93  ? 2.958   21.494  -24.356 1.00 37.03 ? 139 ARG A CA    1 
ATOM   698  C C     . ARG A 1 93  ? 4.369   21.570  -23.795 1.00 38.58 ? 139 ARG A C     1 
ATOM   699  O O     . ARG A 1 93  ? 4.921   20.572  -23.325 1.00 38.77 ? 139 ARG A O     1 
ATOM   700  C CB    . ARG A 1 93  ? 1.927   21.232  -23.258 1.00 37.21 ? 139 ARG A CB    1 
ATOM   701  C CG    . ARG A 1 93  ? 1.834   22.290  -22.150 1.00 39.01 ? 139 ARG A CG    1 
ATOM   702  C CD    . ARG A 1 93  ? 1.109   21.690  -20.958 1.00 41.79 ? 139 ARG A CD    1 
ATOM   703  N NE    . ARG A 1 93  ? 1.050   22.599  -19.827 1.00 45.15 ? 139 ARG A NE    1 
ATOM   704  C CZ    . ARG A 1 93  ? 1.884   22.563  -18.786 1.00 47.89 ? 139 ARG A CZ    1 
ATOM   705  N NH1   . ARG A 1 93  ? 2.865   21.652  -18.714 1.00 48.04 ? 139 ARG A NH1   1 
ATOM   706  N NH2   . ARG A 1 93  ? 1.738   23.445  -17.803 1.00 46.76 ? 139 ARG A NH2   1 
ATOM   707  N N     . PRO A 1 94  ? 4.972   22.763  -23.867 1.00 40.10 ? 140 PRO A N     1 
ATOM   708  C CA    . PRO A 1 94  ? 6.361   22.840  -23.513 1.00 40.92 ? 140 PRO A CA    1 
ATOM   709  C C     . PRO A 1 94  ? 6.641   23.080  -22.025 1.00 41.99 ? 140 PRO A C     1 
ATOM   710  O O     . PRO A 1 94  ? 5.727   23.071  -21.174 1.00 41.26 ? 140 PRO A O     1 
ATOM   711  C CB    . PRO A 1 94  ? 6.874   24.000  -24.389 1.00 41.16 ? 140 PRO A CB    1 
ATOM   712  C CG    . PRO A 1 94  ? 5.708   24.865  -24.613 1.00 40.69 ? 140 PRO A CG    1 
ATOM   713  C CD    . PRO A 1 94  ? 4.443   24.061  -24.325 1.00 40.07 ? 140 PRO A CD    1 
ATOM   714  N N     . GLY A 1 95  ? 7.929   23.241  -21.745 1.00 43.01 ? 141 GLY A N     1 
ATOM   715  C CA    . GLY A 1 95  ? 8.414   23.680  -20.440 1.00 45.07 ? 141 GLY A CA    1 
ATOM   716  C C     . GLY A 1 95  ? 8.379   22.647  -19.337 1.00 45.63 ? 141 GLY A C     1 
ATOM   717  O O     . GLY A 1 95  ? 8.645   22.987  -18.180 1.00 46.09 ? 141 GLY A O     1 
ATOM   718  N N     . GLU A 1 96  ? 8.053   21.397  -19.675 1.00 45.53 ? 142 GLU A N     1 
ATOM   719  C CA    . GLU A 1 96  ? 7.956   20.374  -18.644 1.00 45.47 ? 142 GLU A CA    1 
ATOM   720  C C     . GLU A 1 96  ? 8.323   18.991  -19.131 1.00 44.39 ? 142 GLU A C     1 
ATOM   721  O O     . GLU A 1 96  ? 8.219   18.670  -20.335 1.00 45.12 ? 142 GLU A O     1 
ATOM   722  C CB    . GLU A 1 96  ? 6.567   20.352  -18.043 1.00 46.50 ? 142 GLU A CB    1 
ATOM   723  C CG    . GLU A 1 96  ? 6.477   19.908  -16.600 1.00 49.23 ? 142 GLU A CG    1 
ATOM   724  C CD    . GLU A 1 96  ? 5.066   19.430  -16.267 1.00 53.07 ? 142 GLU A CD    1 
ATOM   725  O OE1   . GLU A 1 96  ? 4.087   20.094  -16.704 1.00 56.04 ? 142 GLU A OE1   1 
ATOM   726  O OE2   . GLU A 1 96  ? 4.932   18.390  -15.578 1.00 53.24 ? 142 GLU A OE2   1 
ATOM   727  N N     . LYS A 1 97  ? 8.796   18.197  -18.166 1.00 42.18 ? 143 LYS A N     1 
ATOM   728  C CA    . LYS A 1 97  ? 9.102   16.793  -18.357 1.00 39.16 ? 143 LYS A CA    1 
ATOM   729  C C     . LYS A 1 97  ? 7.950   15.996  -17.771 1.00 36.36 ? 143 LYS A C     1 
ATOM   730  O O     . LYS A 1 97  ? 7.657   16.070  -16.587 1.00 34.99 ? 143 LYS A O     1 
ATOM   731  C CB    . LYS A 1 97  ? 10.410  16.405  -17.668 1.00 38.79 ? 143 LYS A CB    1 
ATOM   732  C CG    . LYS A 1 97  ? 11.681  16.895  -18.330 1.00 38.47 ? 143 LYS A CG    1 
ATOM   733  C CD    . LYS A 1 97  ? 12.872  16.697  -17.346 1.00 40.26 ? 143 LYS A CD    1 
ATOM   734  C CE    . LYS A 1 97  ? 14.202  17.128  -17.971 1.00 44.76 ? 143 LYS A CE    1 
ATOM   735  N NZ    . LYS A 1 97  ? 15.292  17.077  -16.955 1.00 46.15 ? 143 LYS A NZ    1 
ATOM   736  N N     . TYR A 1 98  ? 7.317   15.241  -18.651 1.00 33.96 ? 144 TYR A N     1 
ATOM   737  C CA    . TYR A 1 98  ? 6.218   14.364  -18.328 1.00 32.34 ? 144 TYR A CA    1 
ATOM   738  C C     . TYR A 1 98  ? 6.679   12.958  -17.992 1.00 30.65 ? 144 TYR A C     1 
ATOM   739  O O     . TYR A 1 98  ? 7.598   12.441  -18.596 1.00 30.54 ? 144 TYR A O     1 
ATOM   740  C CB    . TYR A 1 98  ? 5.237   14.346  -19.518 1.00 31.85 ? 144 TYR A CB    1 
ATOM   741  C CG    . TYR A 1 98  ? 4.906   15.745  -19.985 1.00 31.40 ? 144 TYR A CG    1 
ATOM   742  C CD1   . TYR A 1 98  ? 4.167   16.616  -19.163 1.00 31.92 ? 144 TYR A CD1   1 
ATOM   743  C CD2   . TYR A 1 98  ? 5.380   16.226  -21.211 1.00 29.55 ? 144 TYR A CD2   1 
ATOM   744  C CE1   . TYR A 1 98  ? 3.861   17.936  -19.572 1.00 32.22 ? 144 TYR A CE1   1 
ATOM   745  C CE2   . TYR A 1 98  ? 5.091   17.519  -21.631 1.00 32.40 ? 144 TYR A CE2   1 
ATOM   746  C CZ    . TYR A 1 98  ? 4.324   18.381  -20.803 1.00 32.99 ? 144 TYR A CZ    1 
ATOM   747  O OH    . TYR A 1 98  ? 4.026   19.677  -21.209 1.00 31.86 ? 144 TYR A OH    1 
ATOM   748  N N     . PRO A 1 99  ? 6.029   12.341  -16.998 1.00 29.84 ? 145 PRO A N     1 
ATOM   749  C CA    . PRO A 1 99  ? 6.127   10.915  -16.717 1.00 27.46 ? 145 PRO A CA    1 
ATOM   750  C C     . PRO A 1 99  ? 5.600   10.185  -17.923 1.00 25.97 ? 145 PRO A C     1 
ATOM   751  O O     . PRO A 1 99  ? 4.802   10.733  -18.688 1.00 24.83 ? 145 PRO A O     1 
ATOM   752  C CB    . PRO A 1 99  ? 5.198   10.724  -15.527 1.00 28.52 ? 145 PRO A CB    1 
ATOM   753  C CG    . PRO A 1 99  ? 4.255   11.957  -15.577 1.00 29.45 ? 145 PRO A CG    1 
ATOM   754  C CD    . PRO A 1 99  ? 5.116   13.046  -16.076 1.00 29.59 ? 145 PRO A CD    1 
ATOM   755  N N     . LEU A 1 100 ? 6.081   8.970   -18.130 1.00 24.71 ? 146 LEU A N     1 
ATOM   756  C CA    . LEU A 1 100 ? 5.763   8.302   -19.370 1.00 23.62 ? 146 LEU A CA    1 
ATOM   757  C C     . LEU A 1 100 ? 5.158   6.921   -19.099 1.00 22.45 ? 146 LEU A C     1 
ATOM   758  O O     . LEU A 1 100 ? 5.685   6.210   -18.269 1.00 20.76 ? 146 LEU A O     1 
ATOM   759  C CB    . LEU A 1 100 ? 7.005   8.192   -20.273 1.00 23.40 ? 146 LEU A CB    1 
ATOM   760  C CG    . LEU A 1 100 ? 6.972   7.207   -21.447 1.00 23.07 ? 146 LEU A CG    1 
ATOM   761  C CD1   . LEU A 1 100 ? 6.032   7.756   -22.546 1.00 24.99 ? 146 LEU A CD1   1 
ATOM   762  C CD2   . LEU A 1 100 ? 8.380   7.017   -21.993 1.00 23.10 ? 146 LEU A CD2   1 
ATOM   763  N N     . VAL A 1 101 ? 4.041   6.617   -19.799 1.00 21.15 ? 147 VAL A N     1 
ATOM   764  C CA    . VAL A 1 101 ? 3.385   5.314   -19.791 1.00 20.17 ? 147 VAL A CA    1 
ATOM   765  C C     . VAL A 1 101 ? 3.576   4.601   -21.111 1.00 20.95 ? 147 VAL A C     1 
ATOM   766  O O     . VAL A 1 101 ? 3.369   5.198   -22.151 1.00 21.49 ? 147 VAL A O     1 
ATOM   767  C CB    . VAL A 1 101 ? 1.916   5.401   -19.359 1.00 20.46 ? 147 VAL A CB    1 
ATOM   768  C CG1   . VAL A 1 101 ? 1.126   4.051   -19.710 1.00 19.67 ? 147 VAL A CG1   1 
ATOM   769  C CG2   . VAL A 1 101 ? 1.845   5.693   -17.824 1.00 16.13 ? 147 VAL A CG2   1 
ATOM   770  N N     . VAL A 1 102 ? 4.069   3.351   -21.064 1.00 21.06 ? 148 VAL A N     1 
ATOM   771  C CA    . VAL A 1 102 ? 3.983   2.411   -22.215 1.00 20.65 ? 148 VAL A CA    1 
ATOM   772  C C     . VAL A 1 102 ? 2.748   1.519   -22.103 1.00 19.64 ? 148 VAL A C     1 
ATOM   773  O O     . VAL A 1 102 ? 2.533   0.839   -21.100 1.00 19.31 ? 148 VAL A O     1 
ATOM   774  C CB    . VAL A 1 102 ? 5.313   1.592   -22.468 1.00 20.32 ? 148 VAL A CB    1 
ATOM   775  C CG1   . VAL A 1 102 ? 5.123   0.580   -23.514 1.00 20.64 ? 148 VAL A CG1   1 
ATOM   776  C CG2   . VAL A 1 102 ? 6.422   2.522   -22.953 1.00 21.32 ? 148 VAL A CG2   1 
ATOM   777  N N     . PHE A 1 103 ? 1.916   1.528   -23.132 1.00 20.21 ? 149 PHE A N     1 
ATOM   778  C CA    . PHE A 1 103 ? 0.679   0.762   -23.085 1.00 20.74 ? 149 PHE A CA    1 
ATOM   779  C C     . PHE A 1 103 ? 0.629   -0.405  -24.059 1.00 21.53 ? 149 PHE A C     1 
ATOM   780  O O     . PHE A 1 103 ? 0.897   -0.261  -25.262 1.00 21.40 ? 149 PHE A O     1 
ATOM   781  C CB    . PHE A 1 103 ? -0.530  1.702   -23.289 1.00 22.06 ? 149 PHE A CB    1 
ATOM   782  C CG    . PHE A 1 103 ? -1.855  1.075   -22.928 1.00 19.93 ? 149 PHE A CG    1 
ATOM   783  C CD1   . PHE A 1 103 ? -2.448  1.338   -21.694 1.00 24.04 ? 149 PHE A CD1   1 
ATOM   784  C CD2   . PHE A 1 103 ? -2.520  0.256   -23.829 1.00 20.57 ? 149 PHE A CD2   1 
ATOM   785  C CE1   . PHE A 1 103 ? -3.667  0.758   -21.347 1.00 20.68 ? 149 PHE A CE1   1 
ATOM   786  C CE2   . PHE A 1 103 ? -3.700  -0.354  -23.485 1.00 19.47 ? 149 PHE A CE2   1 
ATOM   787  C CZ    . PHE A 1 103 ? -4.280  -0.078  -22.245 1.00 22.16 ? 149 PHE A CZ    1 
ATOM   788  N N     . SER A 1 104 ? 0.246   -1.572  -23.542 1.00 21.47 ? 150 SER A N     1 
ATOM   789  C CA    . SER A 1 104 ? 0.148   -2.763  -24.352 1.00 21.22 ? 150 SER A CA    1 
ATOM   790  C C     . SER A 1 104 ? -1.312  -3.219  -24.540 1.00 21.32 ? 150 SER A C     1 
ATOM   791  O O     . SER A 1 104 ? -2.012  -3.506  -23.580 1.00 23.54 ? 150 SER A O     1 
ATOM   792  C CB    . SER A 1 104 ? 0.940   -3.890  -23.699 1.00 21.07 ? 150 SER A CB    1 
ATOM   793  O OG    . SER A 1 104 ? 0.787   -5.080  -24.486 1.00 23.90 ? 150 SER A OG    1 
ATOM   794  N N     . HIS A 1 105 ? -1.746  -3.310  -25.790 1.00 20.61 ? 151 HIS A N     1 
ATOM   795  C CA    . HIS A 1 105 ? -3.049  -3.838  -26.188 1.00 19.01 ? 151 HIS A CA    1 
ATOM   796  C C     . HIS A 1 105 ? -3.262  -5.381  -26.024 1.00 19.27 ? 151 HIS A C     1 
ATOM   797  O O     . HIS A 1 105 ? -2.316  -6.158  -26.003 1.00 19.06 ? 151 HIS A O     1 
ATOM   798  C CB    . HIS A 1 105 ? -3.388  -3.367  -27.627 1.00 17.71 ? 151 HIS A CB    1 
ATOM   799  C CG    . HIS A 1 105 ? -2.578  -4.033  -28.681 1.00 14.97 ? 151 HIS A CG    1 
ATOM   800  N ND1   . HIS A 1 105 ? -2.800  -5.324  -29.065 1.00 14.71 ? 151 HIS A ND1   1 
ATOM   801  C CD2   . HIS A 1 105 ? -1.555  -3.588  -29.446 1.00 11.19 ? 151 HIS A CD2   1 
ATOM   802  C CE1   . HIS A 1 105 ? -1.945  -5.669  -29.998 1.00 13.63 ? 151 HIS A CE1   1 
ATOM   803  N NE2   . HIS A 1 105 ? -1.170  -4.634  -30.238 1.00 17.08 ? 151 HIS A NE2   1 
ATOM   804  N N     . GLY A 1 106 ? -4.537  -5.788  -25.920 1.00 20.35 ? 152 GLY A N     1 
ATOM   805  C CA    . GLY A 1 106 ? -4.927  -7.161  -25.845 1.00 21.10 ? 152 GLY A CA    1 
ATOM   806  C C     . GLY A 1 106 ? -4.983  -7.865  -27.187 1.00 23.34 ? 152 GLY A C     1 
ATOM   807  O O     . GLY A 1 106 ? -4.738  -7.278  -28.246 1.00 24.38 ? 152 GLY A O     1 
ATOM   808  N N     . LEU A 1 107 ? -5.289  -9.140  -27.124 1.00 24.17 ? 153 LEU A N     1 
ATOM   809  C CA    . LEU A 1 107 ? -5.422  -10.011 -28.260 1.00 26.37 ? 153 LEU A CA    1 
ATOM   810  C C     . LEU A 1 107 ? -6.596  -9.497  -29.082 1.00 26.61 ? 153 LEU A C     1 
ATOM   811  O O     . LEU A 1 107 ? -7.665  -9.222  -28.537 1.00 27.42 ? 153 LEU A O     1 
ATOM   812  C CB    . LEU A 1 107 ? -5.677  -11.461 -27.766 1.00 25.69 ? 153 LEU A CB    1 
ATOM   813  C CG    . LEU A 1 107 ? -5.776  -12.551 -28.834 1.00 28.61 ? 153 LEU A CG    1 
ATOM   814  C CD1   . LEU A 1 107 ? -4.454  -12.717 -29.658 1.00 24.75 ? 153 LEU A CD1   1 
ATOM   815  C CD2   . LEU A 1 107 ? -6.300  -13.921 -28.241 1.00 26.21 ? 153 LEU A CD2   1 
ATOM   816  N N     . GLY A 1 108 ? -6.368  -9.321  -30.386 1.00 26.62 ? 154 GLY A N     1 
ATOM   817  C CA    . GLY A 1 108 ? -7.405  -8.873  -31.318 1.00 24.11 ? 154 GLY A CA    1 
ATOM   818  C C     . GLY A 1 108 ? -7.591  -7.373  -31.350 1.00 23.76 ? 154 GLY A C     1 
ATOM   819  O O     . GLY A 1 108 ? -8.498  -6.881  -32.017 1.00 23.50 ? 154 GLY A O     1 
ATOM   820  N N     . ALA A 1 109 ? -6.785  -6.642  -30.573 1.00 22.70 ? 155 ALA A N     1 
ATOM   821  C CA    . ALA A 1 109 ? -6.845  -5.187  -30.585 1.00 22.10 ? 155 ALA A CA    1 
ATOM   822  C C     . ALA A 1 109 ? -5.684  -4.646  -31.425 1.00 22.11 ? 155 ALA A C     1 
ATOM   823  O O     . ALA A 1 109 ? -5.080  -5.396  -32.208 1.00 23.78 ? 155 ALA A O     1 
ATOM   824  C CB    . ALA A 1 109 ? -6.854  -4.609  -29.155 1.00 21.37 ? 155 ALA A CB    1 
ATOM   825  N N     . PHE A 1 110 ? -5.388  -3.356  -31.279 1.00 21.46 ? 156 PHE A N     1 
ATOM   826  C CA    . PHE A 1 110 ? -4.277  -2.696  -31.922 1.00 20.93 ? 156 PHE A CA    1 
ATOM   827  C C     . PHE A 1 110 ? -4.154  -1.356  -31.174 1.00 21.92 ? 156 PHE A C     1 
ATOM   828  O O     . PHE A 1 110 ? -4.917  -1.084  -30.237 1.00 22.69 ? 156 PHE A O     1 
ATOM   829  C CB    . PHE A 1 110 ? -4.435  -2.569  -33.464 1.00 21.09 ? 156 PHE A CB    1 
ATOM   830  C CG    . PHE A 1 110 ? -5.822  -2.203  -33.911 1.00 22.06 ? 156 PHE A CG    1 
ATOM   831  C CD1   . PHE A 1 110 ? -6.196  -0.876  -34.044 1.00 20.69 ? 156 PHE A CD1   1 
ATOM   832  C CD2   . PHE A 1 110 ? -6.768  -3.212  -34.175 1.00 22.22 ? 156 PHE A CD2   1 
ATOM   833  C CE1   . PHE A 1 110 ? -7.497  -0.527  -34.431 1.00 22.12 ? 156 PHE A CE1   1 
ATOM   834  C CE2   . PHE A 1 110 ? -8.073  -2.896  -34.526 1.00 22.98 ? 156 PHE A CE2   1 
ATOM   835  C CZ    . PHE A 1 110 ? -8.450  -1.543  -34.657 1.00 22.78 ? 156 PHE A CZ    1 
ATOM   836  N N     . ARG A 1 111 ? -3.196  -0.532  -31.565 1.00 21.20 ? 157 ARG A N     1 
ATOM   837  C CA    . ARG A 1 111 ? -2.758  0.584   -30.751 1.00 21.47 ? 157 ARG A CA    1 
ATOM   838  C C     . ARG A 1 111 ? -3.796  1.670   -30.448 1.00 21.69 ? 157 ARG A C     1 
ATOM   839  O O     . ARG A 1 111 ? -3.558  2.489   -29.550 1.00 21.29 ? 157 ARG A O     1 
ATOM   840  C CB    . ARG A 1 111 ? -1.528  1.280   -31.419 1.00 21.48 ? 157 ARG A CB    1 
ATOM   841  C CG    . ARG A 1 111 ? -1.909  2.140   -32.623 1.00 21.71 ? 157 ARG A CG    1 
ATOM   842  C CD    . ARG A 1 111 ? -0.716  2.699   -33.486 1.00 21.33 ? 157 ARG A CD    1 
ATOM   843  N NE    . ARG A 1 111 ? -1.220  3.656   -34.512 1.00 21.27 ? 157 ARG A NE    1 
ATOM   844  C CZ    . ARG A 1 111 ? -1.874  3.274   -35.616 1.00 20.15 ? 157 ARG A CZ    1 
ATOM   845  N NH1   . ARG A 1 111 ? -2.136  2.005   -35.781 1.00 23.84 ? 157 ARG A NH1   1 
ATOM   846  N NH2   . ARG A 1 111 ? -2.299  4.130   -36.518 1.00 21.30 ? 157 ARG A NH2   1 
ATOM   847  N N     . THR A 1 112 ? -4.901  1.717   -31.203 1.00 22.32 ? 158 THR A N     1 
ATOM   848  C CA    . THR A 1 112 ? -5.834  2.876   -31.165 1.00 22.16 ? 158 THR A CA    1 
ATOM   849  C C     . THR A 1 112 ? -7.052  2.702   -30.245 1.00 22.69 ? 158 THR A C     1 
ATOM   850  O O     . THR A 1 112 ? -7.782  3.666   -30.003 1.00 23.15 ? 158 THR A O     1 
ATOM   851  C CB    . THR A 1 112 ? -6.342  3.269   -32.563 1.00 22.51 ? 158 THR A CB    1 
ATOM   852  O OG1   . THR A 1 112 ? -7.205  2.243   -33.077 1.00 21.40 ? 158 THR A OG1   1 
ATOM   853  C CG2   . THR A 1 112 ? -5.139  3.481   -33.532 1.00 21.81 ? 158 THR A CG2   1 
ATOM   854  N N     . LEU A 1 113 ? -7.188  1.501   -29.681 1.00 22.84 ? 159 LEU A N     1 
ATOM   855  C CA    . LEU A 1 113 ? -8.420  0.973   -29.070 1.00 22.12 ? 159 LEU A CA    1 
ATOM   856  C C     . LEU A 1 113 ? -8.489  1.209   -27.578 1.00 21.81 ? 159 LEU A C     1 
ATOM   857  O O     . LEU A 1 113 ? -9.413  0.776   -26.897 1.00 21.56 ? 159 LEU A O     1 
ATOM   858  C CB    . LEU A 1 113 ? -8.594  -0.516  -29.393 1.00 20.16 ? 159 LEU A CB    1 
ATOM   859  C CG    . LEU A 1 113 ? -8.929  -0.820  -30.888 1.00 23.01 ? 159 LEU A CG    1 
ATOM   860  C CD1   . LEU A 1 113 ? -9.406  -2.255  -31.096 1.00 21.33 ? 159 LEU A CD1   1 
ATOM   861  C CD2   . LEU A 1 113 ? -9.924  0.116   -31.563 1.00 17.65 ? 159 LEU A CD2   1 
ATOM   862  N N     . TYR A 1 114 ? -7.509  1.912   -27.054 1.00 21.56 ? 160 TYR A N     1 
ATOM   863  C CA    . TYR A 1 114 ? -7.568  2.246   -25.638 1.00 20.34 ? 160 TYR A CA    1 
ATOM   864  C C     . TYR A 1 114 ? -7.327  3.707   -25.470 1.00 20.77 ? 160 TYR A C     1 
ATOM   865  O O     . TYR A 1 114 ? -6.609  4.119   -24.556 1.00 20.34 ? 160 TYR A O     1 
ATOM   866  C CB    . TYR A 1 114 ? -6.531  1.432   -24.890 1.00 20.43 ? 160 TYR A CB    1 
ATOM   867  C CG    . TYR A 1 114 ? -6.722  -0.066  -25.044 1.00 19.54 ? 160 TYR A CG    1 
ATOM   868  C CD1   . TYR A 1 114 ? -7.422  -0.773  -24.096 1.00 19.40 ? 160 TYR A CD1   1 
ATOM   869  C CD2   . TYR A 1 114 ? -6.196  -0.761  -26.138 1.00 15.71 ? 160 TYR A CD2   1 
ATOM   870  C CE1   . TYR A 1 114 ? -7.555  -2.155  -24.213 1.00 19.12 ? 160 TYR A CE1   1 
ATOM   871  C CE2   . TYR A 1 114 ? -6.331  -2.149  -26.272 1.00 15.68 ? 160 TYR A CE2   1 
ATOM   872  C CZ    . TYR A 1 114 ? -7.050  -2.837  -25.292 1.00 18.37 ? 160 TYR A CZ    1 
ATOM   873  O OH    . TYR A 1 114 ? -7.234  -4.216  -25.337 1.00 18.65 ? 160 TYR A OH    1 
ATOM   874  N N     . SER A 1 115 ? -7.936  4.502   -26.371 1.00 21.88 ? 161 SER A N     1 
ATOM   875  C CA    . SER A 1 115 ? -7.797  5.961   -26.324 1.00 23.37 ? 161 SER A CA    1 
ATOM   876  C C     . SER A 1 115 ? -8.429  6.624   -25.100 1.00 23.60 ? 161 SER A C     1 
ATOM   877  O O     . SER A 1 115 ? -7.980  7.680   -24.679 1.00 24.73 ? 161 SER A O     1 
ATOM   878  C CB    . SER A 1 115 ? -8.291  6.630   -27.650 1.00 24.07 ? 161 SER A CB    1 
ATOM   879  O OG    . SER A 1 115 ? -9.714  6.508   -27.835 1.00 25.90 ? 161 SER A OG    1 
ATOM   880  N N     . ALA A 1 116 ? -9.482  6.035   -24.530 1.00 24.72 ? 162 ALA A N     1 
ATOM   881  C CA    . ALA A 1 116 ? -10.106 6.613   -23.318 1.00 24.22 ? 162 ALA A CA    1 
ATOM   882  C C     . ALA A 1 116 ? -9.135  6.577   -22.153 1.00 24.74 ? 162 ALA A C     1 
ATOM   883  O O     . ALA A 1 116 ? -9.045  7.516   -21.364 1.00 24.12 ? 162 ALA A O     1 
ATOM   884  C CB    . ALA A 1 116 ? -11.413 5.859   -22.966 1.00 24.48 ? 162 ALA A CB    1 
ATOM   885  N N     . ILE A 1 117 ? -8.386  5.472   -22.045 1.00 25.24 ? 163 ILE A N     1 
ATOM   886  C CA    . ILE A 1 117 ? -7.301  5.381   -21.040 1.00 24.59 ? 163 ILE A CA    1 
ATOM   887  C C     . ILE A 1 117 ? -6.198  6.401   -21.382 1.00 24.69 ? 163 ILE A C     1 
ATOM   888  O O     . ILE A 1 117 ? -5.898  7.289   -20.576 1.00 25.04 ? 163 ILE A O     1 
ATOM   889  C CB    . ILE A 1 117 ? -6.736  3.930   -20.938 1.00 24.75 ? 163 ILE A CB    1 
ATOM   890  C CG1   . ILE A 1 117 ? -7.806  3.030   -20.285 1.00 24.33 ? 163 ILE A CG1   1 
ATOM   891  C CG2   . ILE A 1 117 ? -5.404  3.918   -20.191 1.00 23.27 ? 163 ILE A CG2   1 
ATOM   892  C CD1   . ILE A 1 117 ? -7.546  1.572   -20.383 1.00 21.79 ? 163 ILE A CD1   1 
ATOM   893  N N     . GLY A 1 118 ? -5.646  6.296   -22.599 1.00 23.58 ? 164 GLY A N     1 
ATOM   894  C CA    . GLY A 1 118 ? -4.564  7.144   -23.041 1.00 23.27 ? 164 GLY A CA    1 
ATOM   895  C C     . GLY A 1 118 ? -4.862  8.621   -22.982 1.00 23.88 ? 164 GLY A C     1 
ATOM   896  O O     . GLY A 1 118 ? -4.059  9.399   -22.406 1.00 23.61 ? 164 GLY A O     1 
ATOM   897  N N     . ILE A 1 119 ? -5.979  9.029   -23.602 1.00 24.05 ? 165 ILE A N     1 
ATOM   898  C CA    . ILE A 1 119 ? -6.421  10.432  -23.516 1.00 25.17 ? 165 ILE A CA    1 
ATOM   899  C C     . ILE A 1 119 ? -6.620  10.923  -22.061 1.00 26.15 ? 165 ILE A C     1 
ATOM   900  O O     . ILE A 1 119 ? -6.208  12.055  -21.737 1.00 27.13 ? 165 ILE A O     1 
ATOM   901  C CB    . ILE A 1 119 ? -7.713  10.713  -24.320 1.00 25.37 ? 165 ILE A CB    1 
ATOM   902  C CG1   . ILE A 1 119 ? -7.478  10.628  -25.838 1.00 24.96 ? 165 ILE A CG1   1 
ATOM   903  C CG2   . ILE A 1 119 ? -8.265  12.044  -23.968 1.00 23.80 ? 165 ILE A CG2   1 
ATOM   904  C CD1   . ILE A 1 119 ? -8.813  10.323  -26.584 1.00 25.21 ? 165 ILE A CD1   1 
ATOM   905  N N     . ASP A 1 120 ? -7.242  10.110  -21.194 1.00 26.21 ? 166 ASP A N     1 
ATOM   906  C CA    . ASP A 1 120 ? -7.364  10.507  -19.770 1.00 26.93 ? 166 ASP A CA    1 
ATOM   907  C C     . ASP A 1 120 ? -6.019  10.714  -19.071 1.00 27.32 ? 166 ASP A C     1 
ATOM   908  O O     . ASP A 1 120 ? -5.851  11.709  -18.356 1.00 28.30 ? 166 ASP A O     1 
ATOM   909  C CB    . ASP A 1 120 ? -8.216  9.544   -18.904 1.00 25.80 ? 166 ASP A CB    1 
ATOM   910  C CG    . ASP A 1 120 ? -8.651  10.203  -17.597 1.00 27.78 ? 166 ASP A CG    1 
ATOM   911  O OD1   . ASP A 1 120 ? -9.317  11.254  -17.669 1.00 26.24 ? 166 ASP A OD1   1 
ATOM   912  O OD2   . ASP A 1 120 ? -8.290  9.734   -16.478 1.00 32.67 ? 166 ASP A OD2   1 
ATOM   913  N N     . LEU A 1 121 ? -5.089  9.761   -19.228 1.00 27.00 ? 167 LEU A N     1 
ATOM   914  C CA    . LEU A 1 121 ? -3.785  9.883   -18.611 1.00 26.34 ? 167 LEU A CA    1 
ATOM   915  C C     . LEU A 1 121 ? -3.062  11.138  -19.119 1.00 25.40 ? 167 LEU A C     1 
ATOM   916  O O     . LEU A 1 121 ? -2.414  11.852  -18.359 1.00 24.66 ? 167 LEU A O     1 
ATOM   917  C CB    . LEU A 1 121 ? -2.946  8.642   -18.921 1.00 27.25 ? 167 LEU A CB    1 
ATOM   918  C CG    . LEU A 1 121 ? -3.255  7.370   -18.156 1.00 27.84 ? 167 LEU A CG    1 
ATOM   919  C CD1   . LEU A 1 121 ? -2.618  6.198   -18.855 1.00 25.89 ? 167 LEU A CD1   1 
ATOM   920  C CD2   . LEU A 1 121 ? -2.739  7.495   -16.715 1.00 29.04 ? 167 LEU A CD2   1 
ATOM   921  N N     . ALA A 1 122 ? -3.155  11.374  -20.418 1.00 25.50 ? 168 ALA A N     1 
ATOM   922  C CA    . ALA A 1 122 ? -2.516  12.517  -21.050 1.00 26.39 ? 168 ALA A CA    1 
ATOM   923  C C     . ALA A 1 122 ? -3.086  13.816  -20.497 1.00 26.82 ? 168 ALA A C     1 
ATOM   924  O O     . ALA A 1 122 ? -2.347  14.771  -20.323 1.00 28.01 ? 168 ALA A O     1 
ATOM   925  C CB    . ALA A 1 122 ? -2.665  12.479  -22.593 1.00 26.18 ? 168 ALA A CB    1 
ATOM   926  N N     . SER A 1 123 ? -4.387  13.864  -20.233 1.00 27.11 ? 169 SER A N     1 
ATOM   927  C CA    . SER A 1 123 ? -4.976  15.093  -19.646 1.00 27.22 ? 169 SER A CA    1 
ATOM   928  C C     . SER A 1 123 ? -4.504  15.309  -18.234 1.00 27.36 ? 169 SER A C     1 
ATOM   929  O O     . SER A 1 123 ? -4.718  16.356  -17.681 1.00 28.77 ? 169 SER A O     1 
ATOM   930  C CB    . SER A 1 123 ? -6.501  15.089  -19.732 1.00 25.92 ? 169 SER A CB    1 
ATOM   931  O OG    . SER A 1 123 ? -7.047  14.091  -18.897 1.00 27.09 ? 169 SER A OG    1 
ATOM   932  N N     . HIS A 1 124 ? -3.844  14.324  -17.643 1.00 27.78 ? 170 HIS A N     1 
ATOM   933  C CA    . HIS A 1 124 ? -3.264  14.505  -16.298 1.00 27.80 ? 170 HIS A CA    1 
ATOM   934  C C     . HIS A 1 124 ? -1.737  14.678  -16.333 1.00 27.02 ? 170 HIS A C     1 
ATOM   935  O O     . HIS A 1 124 ? -1.076  14.758  -15.301 1.00 26.93 ? 170 HIS A O     1 
ATOM   936  C CB    . HIS A 1 124 ? -3.711  13.390  -15.329 1.00 27.59 ? 170 HIS A CB    1 
ATOM   937  C CG    . HIS A 1 124 ? -5.183  13.432  -14.993 1.00 28.87 ? 170 HIS A CG    1 
ATOM   938  N ND1   . HIS A 1 124 ? -6.130  12.723  -15.699 1.00 28.59 ? 170 HIS A ND1   1 
ATOM   939  C CD2   . HIS A 1 124 ? -5.861  14.080  -14.005 1.00 28.38 ? 170 HIS A CD2   1 
ATOM   940  C CE1   . HIS A 1 124 ? -7.327  12.943  -15.179 1.00 28.79 ? 170 HIS A CE1   1 
ATOM   941  N NE2   . HIS A 1 124 ? -7.186  13.737  -14.130 1.00 26.46 ? 170 HIS A NE2   1 
ATOM   942  N N     . GLY A 1 125 ? -1.181  14.788  -17.529 1.00 26.26 ? 171 GLY A N     1 
ATOM   943  C CA    . GLY A 1 125 ? 0.208   15.237  -17.648 1.00 26.48 ? 171 GLY A CA    1 
ATOM   944  C C     . GLY A 1 125 ? 1.171   14.147  -18.087 1.00 26.33 ? 171 GLY A C     1 
ATOM   945  O O     . GLY A 1 125 ? 2.367   14.354  -18.048 1.00 27.49 ? 171 GLY A O     1 
ATOM   946  N N     . PHE A 1 126 ? 0.641   13.000  -18.498 1.00 24.64 ? 172 PHE A N     1 
ATOM   947  C CA    . PHE A 1 126 ? 1.446   11.894  -18.962 1.00 24.09 ? 172 PHE A CA    1 
ATOM   948  C C     . PHE A 1 126 ? 1.579   11.977  -20.476 1.00 23.28 ? 172 PHE A C     1 
ATOM   949  O O     . PHE A 1 126 ? 0.676   12.455  -21.161 1.00 21.67 ? 172 PHE A O     1 
ATOM   950  C CB    . PHE A 1 126 ? 0.802   10.544  -18.628 1.00 23.49 ? 172 PHE A CB    1 
ATOM   951  C CG    . PHE A 1 126 ? 0.887   10.167  -17.169 1.00 24.76 ? 172 PHE A CG    1 
ATOM   952  C CD1   . PHE A 1 126 ? 1.927   9.376   -16.715 1.00 23.59 ? 172 PHE A CD1   1 
ATOM   953  C CD2   . PHE A 1 126 ? -0.080  10.636  -16.238 1.00 23.15 ? 172 PHE A CD2   1 
ATOM   954  C CE1   . PHE A 1 126 ? 1.988   8.997   -15.347 1.00 24.89 ? 172 PHE A CE1   1 
ATOM   955  C CE2   . PHE A 1 126 ? -0.025  10.268  -14.903 1.00 22.14 ? 172 PHE A CE2   1 
ATOM   956  C CZ    . PHE A 1 126 ? 1.030   9.446   -14.450 1.00 23.18 ? 172 PHE A CZ    1 
ATOM   957  N N     . ILE A 1 127 ? 2.718   11.489  -20.964 1.00 21.87 ? 173 ILE A N     1 
ATOM   958  C CA    . ILE A 1 127 ? 2.819   11.063  -22.351 1.00 21.38 ? 173 ILE A CA    1 
ATOM   959  C C     . ILE A 1 127 ? 2.520   9.554   -22.311 1.00 21.29 ? 173 ILE A C     1 
ATOM   960  O O     . ILE A 1 127 ? 3.015   8.814   -21.434 1.00 19.40 ? 173 ILE A O     1 
ATOM   961  C CB    . ILE A 1 127 ? 4.220   11.428  -22.974 1.00 21.79 ? 173 ILE A CB    1 
ATOM   962  C CG1   . ILE A 1 127 ? 4.375   12.967  -23.037 1.00 21.22 ? 173 ILE A CG1   1 
ATOM   963  C CG2   . ILE A 1 127 ? 4.408   10.804  -24.317 1.00 21.77 ? 173 ILE A CG2   1 
ATOM   964  C CD1   . ILE A 1 127 ? 5.708   13.468  -23.504 1.00 20.11 ? 173 ILE A CD1   1 
ATOM   965  N N     . VAL A 1 128 ? 1.685   9.124   -23.249 1.00 20.62 ? 174 VAL A N     1 
ATOM   966  C CA    . VAL A 1 128 ? 1.353   7.709   -23.420 1.00 20.81 ? 174 VAL A CA    1 
ATOM   967  C C     . VAL A 1 128 ? 1.778   7.225   -24.804 1.00 20.35 ? 174 VAL A C     1 
ATOM   968  O O     . VAL A 1 128 ? 1.423   7.792   -25.828 1.00 20.17 ? 174 VAL A O     1 
ATOM   969  C CB    . VAL A 1 128 ? -0.204  7.410   -23.117 1.00 21.28 ? 174 VAL A CB    1 
ATOM   970  C CG1   . VAL A 1 128 ? -0.551  5.882   -23.228 1.00 19.98 ? 174 VAL A CG1   1 
ATOM   971  C CG2   . VAL A 1 128 ? -0.612  7.972   -21.723 1.00 20.20 ? 174 VAL A CG2   1 
ATOM   972  N N     . ALA A 1 129 ? 2.526   6.136   -24.796 1.00 20.76 ? 175 ALA A N     1 
ATOM   973  C CA    . ALA A 1 129 ? 2.957   5.432   -25.997 1.00 20.92 ? 175 ALA A CA    1 
ATOM   974  C C     . ALA A 1 129 ? 2.191   4.106   -26.035 1.00 20.85 ? 175 ALA A C     1 
ATOM   975  O O     . ALA A 1 129 ? 2.538   3.143   -25.338 1.00 20.31 ? 175 ALA A O     1 
ATOM   976  C CB    . ALA A 1 129 ? 4.514   5.174   -25.930 1.00 20.34 ? 175 ALA A CB    1 
ATOM   977  N N     . ALA A 1 130 ? 1.135   4.060   -26.837 1.00 21.67 ? 176 ALA A N     1 
ATOM   978  C CA    . ALA A 1 130 ? 0.392   2.819   -27.007 1.00 21.54 ? 176 ALA A CA    1 
ATOM   979  C C     . ALA A 1 130 ? 0.983   2.075   -28.188 1.00 22.19 ? 176 ALA A C     1 
ATOM   980  O O     . ALA A 1 130 ? 0.931   2.525   -29.350 1.00 23.05 ? 176 ALA A O     1 
ATOM   981  C CB    . ALA A 1 130 ? -1.097  3.091   -27.182 1.00 19.72 ? 176 ALA A CB    1 
ATOM   982  N N     . VAL A 1 131 ? 1.574   0.930   -27.883 1.00 23.55 ? 177 VAL A N     1 
ATOM   983  C CA    . VAL A 1 131 ? 2.356   0.153   -28.838 1.00 24.36 ? 177 VAL A CA    1 
ATOM   984  C C     . VAL A 1 131 ? 1.449   -0.704  -29.752 1.00 24.72 ? 177 VAL A C     1 
ATOM   985  O O     . VAL A 1 131 ? 0.373   -1.103  -29.333 1.00 23.94 ? 177 VAL A O     1 
ATOM   986  C CB    . VAL A 1 131 ? 3.378   -0.753  -28.047 1.00 24.72 ? 177 VAL A CB    1 
ATOM   987  C CG1   . VAL A 1 131 ? 4.059   -1.708  -28.966 1.00 26.21 ? 177 VAL A CG1   1 
ATOM   988  C CG2   . VAL A 1 131 ? 4.425   0.111   -27.378 1.00 24.56 ? 177 VAL A CG2   1 
ATOM   989  N N     . GLU A 1 132 ? 1.868   -0.954  -31.010 1.00 24.46 ? 178 GLU A N     1 
ATOM   990  C CA    . GLU A 1 132 ? 1.167   -1.936  -31.827 1.00 23.75 ? 178 GLU A CA    1 
ATOM   991  C C     . GLU A 1 132 ? 2.108   -3.129  -31.964 1.00 23.15 ? 178 GLU A C     1 
ATOM   992  O O     . GLU A 1 132 ? 3.242   -3.049  -32.484 1.00 22.14 ? 178 GLU A O     1 
ATOM   993  C CB    . GLU A 1 132 ? 0.734   -1.366  -33.188 1.00 23.85 ? 178 GLU A CB    1 
ATOM   994  C CG    . GLU A 1 132 ? -0.375  -2.164  -33.924 1.00 24.64 ? 178 GLU A CG    1 
ATOM   995  C CD    . GLU A 1 132 ? -1.260  -1.256  -34.789 1.00 24.43 ? 178 GLU A CD    1 
ATOM   996  O OE1   . GLU A 1 132 ? -1.138  -1.244  -36.033 1.00 24.17 ? 178 GLU A OE1   1 
ATOM   997  O OE2   . GLU A 1 132 ? -2.066  -0.507  -34.211 1.00 26.79 ? 178 GLU A OE2   1 
ATOM   998  N N     . HIS A 1 133 ? 1.634   -4.241  -31.462 1.00 22.31 ? 179 HIS A N     1 
ATOM   999  C CA    . HIS A 1 133 ? 2.430   -5.437  -31.469 1.00 22.86 ? 179 HIS A CA    1 
ATOM   1000 C C     . HIS A 1 133 ? 2.437   -6.073  -32.835 1.00 22.63 ? 179 HIS A C     1 
ATOM   1001 O O     . HIS A 1 133 ? 1.472   -5.982  -33.574 1.00 22.73 ? 179 HIS A O     1 
ATOM   1002 C CB    . HIS A 1 133 ? 1.914   -6.396  -30.412 1.00 21.81 ? 179 HIS A CB    1 
ATOM   1003 C CG    . HIS A 1 133 ? 2.090   -5.877  -29.021 1.00 22.18 ? 179 HIS A CG    1 
ATOM   1004 N ND1   . HIS A 1 133 ? 3.328   -5.597  -28.492 1.00 22.54 ? 179 HIS A ND1   1 
ATOM   1005 C CD2   . HIS A 1 133 ? 1.185   -5.548  -28.064 1.00 21.26 ? 179 HIS A CD2   1 
ATOM   1006 C CE1   . HIS A 1 133 ? 3.180   -5.167  -27.244 1.00 24.34 ? 179 HIS A CE1   1 
ATOM   1007 N NE2   . HIS A 1 133 ? 1.886   -5.115  -26.966 1.00 20.07 ? 179 HIS A NE2   1 
ATOM   1008 N N     . ARG A 1 134 ? 3.558   -6.691  -33.162 1.00 23.23 ? 180 ARG A N     1 
ATOM   1009 C CA    . ARG A 1 134 ? 3.777   -7.313  -34.443 1.00 24.21 ? 180 ARG A CA    1 
ATOM   1010 C C     . ARG A 1 134 ? 4.005   -8.804  -34.152 1.00 25.23 ? 180 ARG A C     1 
ATOM   1011 O O     . ARG A 1 134 ? 4.724   -9.483  -34.875 1.00 27.17 ? 180 ARG A O     1 
ATOM   1012 C CB    . ARG A 1 134 ? 4.999   -6.691  -35.119 1.00 24.23 ? 180 ARG A CB    1 
ATOM   1013 C CG    . ARG A 1 134 ? 4.718   -5.507  -36.071 1.00 25.28 ? 180 ARG A CG    1 
ATOM   1014 C CD    . ARG A 1 134 ? 4.209   -4.205  -35.399 1.00 24.25 ? 180 ARG A CD    1 
ATOM   1015 N NE    . ARG A 1 134 ? 4.251   -3.118  -36.393 1.00 25.33 ? 180 ARG A NE    1 
ATOM   1016 C CZ    . ARG A 1 134 ? 5.336   -2.372  -36.660 1.00 27.21 ? 180 ARG A CZ    1 
ATOM   1017 N NH1   . ARG A 1 134 ? 6.471   -2.509  -35.952 1.00 19.73 ? 180 ARG A NH1   1 
ATOM   1018 N NH2   . ARG A 1 134 ? 5.262   -1.434  -37.602 1.00 25.73 ? 180 ARG A NH2   1 
ATOM   1019 N N     . ASP A 1 135 ? 3.431   -9.303  -33.058 1.00 25.60 ? 181 ASP A N     1 
ATOM   1020 C CA    . ASP A 1 135 ? 3.553   -10.702 -32.690 1.00 26.38 ? 181 ASP A CA    1 
ATOM   1021 C C     . ASP A 1 135 ? 2.427   -11.549 -33.338 1.00 26.98 ? 181 ASP A C     1 
ATOM   1022 O O     . ASP A 1 135 ? 2.302   -12.714 -33.030 1.00 26.58 ? 181 ASP A O     1 
ATOM   1023 C CB    . ASP A 1 135 ? 3.497   -10.835 -31.153 1.00 26.15 ? 181 ASP A CB    1 
ATOM   1024 C CG    . ASP A 1 135 ? 2.156   -10.434 -30.588 1.00 27.71 ? 181 ASP A CG    1 
ATOM   1025 O OD1   . ASP A 1 135 ? 1.458   -9.594  -31.203 1.00 27.01 ? 181 ASP A OD1   1 
ATOM   1026 O OD2   . ASP A 1 135 ? 1.772   -10.946 -29.511 1.00 28.85 ? 181 ASP A OD2   1 
ATOM   1027 N N     . ARG A 1 136 ? 1.597   -10.915 -34.183 1.00 28.00 ? 182 ARG A N     1 
ATOM   1028 C CA    . ARG A 1 136 ? 0.383   -11.479 -34.792 1.00 29.70 ? 182 ARG A CA    1 
ATOM   1029 C C     . ARG A 1 136 ? -0.767  -11.659 -33.813 1.00 30.18 ? 182 ARG A C     1 
ATOM   1030 O O     . ARG A 1 136 ? -1.728  -12.375 -34.123 1.00 30.20 ? 182 ARG A O     1 
ATOM   1031 C CB    . ARG A 1 136 ? 0.652   -12.760 -35.627 1.00 30.33 ? 182 ARG A CB    1 
ATOM   1032 C CG    . ARG A 1 136 ? 1.733   -12.524 -36.719 1.00 30.97 ? 182 ARG A CG    1 
ATOM   1033 C CD    . ARG A 1 136 ? 1.655   -13.537 -37.830 1.00 36.93 ? 182 ARG A CD    1 
ATOM   1034 N NE    . ARG A 1 136 ? 0.306   -13.612 -38.424 1.00 37.32 ? 182 ARG A NE    1 
ATOM   1035 C CZ    . ARG A 1 136 ? -0.184  -14.698 -39.017 1.00 37.33 ? 182 ARG A CZ    1 
ATOM   1036 N NH1   . ARG A 1 136 ? 0.547   -15.807 -39.113 1.00 36.32 ? 182 ARG A NH1   1 
ATOM   1037 N NH2   . ARG A 1 136 ? -1.419  -14.682 -39.488 1.00 36.89 ? 182 ARG A NH2   1 
ATOM   1038 N N     . SER A 1 137 ? -0.670  -11.008 -32.641 1.00 30.06 ? 183 SER A N     1 
ATOM   1039 C CA    . SER A 1 137 ? -1.784  -10.938 -31.678 1.00 29.50 ? 183 SER A CA    1 
ATOM   1040 C C     . SER A 1 137 ? -2.704  -9.787  -32.010 1.00 29.06 ? 183 SER A C     1 
ATOM   1041 O O     . SER A 1 137 ? -3.846  -9.777  -31.574 1.00 30.29 ? 183 SER A O     1 
ATOM   1042 C CB    . SER A 1 137 ? -1.307  -10.797 -30.217 1.00 30.41 ? 183 SER A CB    1 
ATOM   1043 O OG    . SER A 1 137 ? -0.915  -9.463  -29.911 1.00 29.59 ? 183 SER A OG    1 
ATOM   1044 N N     . ALA A 1 138 ? -2.228  -8.786  -32.739 1.00 28.18 ? 184 ALA A N     1 
ATOM   1045 C CA    . ALA A 1 138 ? -3.134  -7.719  -33.123 1.00 27.60 ? 184 ALA A CA    1 
ATOM   1046 C C     . ALA A 1 138 ? -4.035  -8.237  -34.228 1.00 27.52 ? 184 ALA A C     1 
ATOM   1047 O O     . ALA A 1 138 ? -3.615  -9.065  -35.036 1.00 27.32 ? 184 ALA A O     1 
ATOM   1048 C CB    . ALA A 1 138 ? -2.366  -6.473  -33.573 1.00 26.68 ? 184 ALA A CB    1 
ATOM   1049 N N     . SER A 1 139 ? -5.268  -7.751  -34.271 1.00 28.38 ? 185 SER A N     1 
ATOM   1050 C CA    . SER A 1 139 ? -6.176  -8.045  -35.385 1.00 30.06 ? 185 SER A CA    1 
ATOM   1051 C C     . SER A 1 139 ? -5.404  -7.771  -36.672 1.00 29.64 ? 185 SER A C     1 
ATOM   1052 O O     . SER A 1 139 ? -5.155  -8.686  -37.458 1.00 30.95 ? 185 SER A O     1 
ATOM   1053 C CB    . SER A 1 139 ? -7.444  -7.177  -35.298 1.00 29.54 ? 185 SER A CB    1 
ATOM   1054 O OG    . SER A 1 139 ? -8.374  -7.871  -34.525 1.00 32.91 ? 185 SER A OG    1 
ATOM   1055 N N     . ALA A 1 140 ? -4.967  -6.532  -36.838 1.00 28.94 ? 186 ALA A N     1 
ATOM   1056 C CA    . ALA A 1 140 ? -4.022  -6.190  -37.898 1.00 29.22 ? 186 ALA A CA    1 
ATOM   1057 C C     . ALA A 1 140 ? -3.003  -5.172  -37.418 1.00 28.79 ? 186 ALA A C     1 
ATOM   1058 O O     . ALA A 1 140 ? -3.218  -4.490  -36.440 1.00 27.94 ? 186 ALA A O     1 
ATOM   1059 C CB    . ALA A 1 140 ? -4.763  -5.639  -39.150 1.00 28.92 ? 186 ALA A CB    1 
ATOM   1060 N N     . THR A 1 141 ? -1.902  -5.081  -38.145 1.00 27.98 ? 187 THR A N     1 
ATOM   1061 C CA    . THR A 1 141 ? -0.977  -4.017  -37.990 1.00 27.87 ? 187 THR A CA    1 
ATOM   1062 C C     . THR A 1 141 ? -0.208  -3.899  -39.307 1.00 28.93 ? 187 THR A C     1 
ATOM   1063 O O     . THR A 1 141 ? -0.294  -4.776  -40.161 1.00 30.30 ? 187 THR A O     1 
ATOM   1064 C CB    . THR A 1 141 ? 0.019   -4.223  -36.811 1.00 27.95 ? 187 THR A CB    1 
ATOM   1065 O OG1   . THR A 1 141 ? 0.846   -3.046  -36.735 1.00 28.15 ? 187 THR A OG1   1 
ATOM   1066 C CG2   . THR A 1 141 ? 0.909   -5.517  -37.008 1.00 24.08 ? 187 THR A CG2   1 
ATOM   1067 N N     . TYR A 1 142 ? 0.581   -2.845  -39.467 1.00 28.41 ? 188 TYR A N     1 
ATOM   1068 C CA    . TYR A 1 142 ? 1.454   -2.802  -40.648 1.00 27.70 ? 188 TYR A CA    1 
ATOM   1069 C C     . TYR A 1 142 ? 2.886   -2.296  -40.368 1.00 28.23 ? 188 TYR A C     1 
ATOM   1070 O O     . TYR A 1 142 ? 3.203   -1.818  -39.265 1.00 27.66 ? 188 TYR A O     1 
ATOM   1071 C CB    . TYR A 1 142 ? 0.792   -1.975  -41.736 1.00 25.86 ? 188 TYR A CB    1 
ATOM   1072 C CG    . TYR A 1 142 ? 0.578   -0.509  -41.401 1.00 25.50 ? 188 TYR A CG    1 
ATOM   1073 C CD1   . TYR A 1 142 ? 1.481   0.489   -41.830 1.00 23.42 ? 188 TYR A CD1   1 
ATOM   1074 C CD2   . TYR A 1 142 ? -0.538  -0.107  -40.665 1.00 25.60 ? 188 TYR A CD2   1 
ATOM   1075 C CE1   . TYR A 1 142 ? 1.264   1.854   -41.533 1.00 23.21 ? 188 TYR A CE1   1 
ATOM   1076 C CE2   . TYR A 1 142 ? -0.763  1.254   -40.373 1.00 25.93 ? 188 TYR A CE2   1 
ATOM   1077 C CZ    . TYR A 1 142 ? 0.132   2.215   -40.799 1.00 25.19 ? 188 TYR A CZ    1 
ATOM   1078 O OH    . TYR A 1 142 ? -0.151  3.522   -40.494 1.00 23.83 ? 188 TYR A OH    1 
ATOM   1079 N N     . TYR A 1 143 ? 3.700   -2.365  -41.424 1.00 28.71 ? 189 TYR A N     1 
ATOM   1080 C CA    . TYR A 1 143 ? 5.093   -2.033  -41.450 1.00 29.27 ? 189 TYR A CA    1 
ATOM   1081 C C     . TYR A 1 143 ? 5.418   -1.817  -42.923 1.00 29.78 ? 189 TYR A C     1 
ATOM   1082 O O     . TYR A 1 143 ? 4.557   -1.947  -43.790 1.00 29.36 ? 189 TYR A O     1 
ATOM   1083 C CB    . TYR A 1 143 ? 5.961   -3.168  -40.863 1.00 29.81 ? 189 TYR A CB    1 
ATOM   1084 C CG    . TYR A 1 143 ? 5.933   -4.475  -41.644 1.00 29.65 ? 189 TYR A CG    1 
ATOM   1085 C CD1   . TYR A 1 143 ? 6.904   -4.755  -42.624 1.00 29.22 ? 189 TYR A CD1   1 
ATOM   1086 C CD2   . TYR A 1 143 ? 4.956   -5.447  -41.393 1.00 31.04 ? 189 TYR A CD2   1 
ATOM   1087 C CE1   . TYR A 1 143 ? 6.888   -5.980  -43.368 1.00 30.43 ? 189 TYR A CE1   1 
ATOM   1088 C CE2   . TYR A 1 143 ? 4.926   -6.675  -42.137 1.00 32.86 ? 189 TYR A CE2   1 
ATOM   1089 C CZ    . TYR A 1 143 ? 5.896   -6.915  -43.127 1.00 32.35 ? 189 TYR A CZ    1 
ATOM   1090 O OH    . TYR A 1 143 ? 5.881   -8.077  -43.861 1.00 34.44 ? 189 TYR A OH    1 
ATOM   1091 N N     . PHE A 1 144 ? 6.675   -1.489  -43.213 1.00 30.36 ? 190 PHE A N     1 
ATOM   1092 C CA    . PHE A 1 144 ? 7.089   -1.156  -44.583 1.00 29.24 ? 190 PHE A CA    1 
ATOM   1093 C C     . PHE A 1 144 ? 8.250   -2.021  -44.944 1.00 29.30 ? 190 PHE A C     1 
ATOM   1094 O O     . PHE A 1 144 ? 9.113   -2.268  -44.113 1.00 29.73 ? 190 PHE A O     1 
ATOM   1095 C CB    . PHE A 1 144 ? 7.445   0.319   -44.689 1.00 28.49 ? 190 PHE A CB    1 
ATOM   1096 C CG    . PHE A 1 144 ? 6.257   1.235   -44.464 1.00 29.09 ? 190 PHE A CG    1 
ATOM   1097 C CD1   . PHE A 1 144 ? 5.288   1.387   -45.438 1.00 26.41 ? 190 PHE A CD1   1 
ATOM   1098 C CD2   . PHE A 1 144 ? 6.099   1.905   -43.261 1.00 26.62 ? 190 PHE A CD2   1 
ATOM   1099 C CE1   . PHE A 1 144 ? 4.223   2.196   -45.236 1.00 26.00 ? 190 PHE A CE1   1 
ATOM   1100 C CE2   . PHE A 1 144 ? 5.032   2.735   -43.049 1.00 25.39 ? 190 PHE A CE2   1 
ATOM   1101 C CZ    . PHE A 1 144 ? 4.089   2.899   -44.034 1.00 26.75 ? 190 PHE A CZ    1 
ATOM   1102 N N     . LYS A 1 145 ? 8.291   -2.481  -46.190 1.00 30.18 ? 191 LYS A N     1 
ATOM   1103 C CA    . LYS A 1 145 ? 9.354   -3.408  -46.623 1.00 30.39 ? 191 LYS A CA    1 
ATOM   1104 C C     . LYS A 1 145 ? 10.692  -2.704  -46.930 1.00 30.59 ? 191 LYS A C     1 
ATOM   1105 O O     . LYS A 1 145 ? 11.747  -3.329  -46.908 1.00 30.65 ? 191 LYS A O     1 
ATOM   1106 C CB    . LYS A 1 145 ? 8.878   -4.243  -47.800 1.00 30.00 ? 191 LYS A CB    1 
ATOM   1107 C CG    . LYS A 1 145 ? 8.101   -5.448  -47.358 1.00 29.53 ? 191 LYS A CG    1 
ATOM   1108 C CD    . LYS A 1 145 ? 7.299   -6.062  -48.540 1.00 30.72 ? 191 LYS A CD    1 
ATOM   1109 C CE    . LYS A 1 145 ? 6.854   -7.478  -48.174 1.00 30.91 ? 191 LYS A CE    1 
ATOM   1110 N NZ    . LYS A 1 145 ? 5.911   -8.097  -49.144 1.00 33.75 ? 191 LYS A NZ    1 
ATOM   1111 N N     . ASP A 1 146 ? 10.644  -1.406  -47.197 1.00 30.53 ? 192 ASP A N     1 
ATOM   1112 C CA    . ASP A 1 146 ? 11.844  -0.660  -47.441 1.00 31.74 ? 192 ASP A CA    1 
ATOM   1113 C C     . ASP A 1 146 ? 11.499  0.781   -47.353 1.00 32.24 ? 192 ASP A C     1 
ATOM   1114 O O     . ASP A 1 146 ? 10.328  1.128   -47.291 1.00 33.03 ? 192 ASP A O     1 
ATOM   1115 C CB    . ASP A 1 146 ? 12.502  -1.008  -48.786 1.00 31.83 ? 192 ASP A CB    1 
ATOM   1116 C CG    . ASP A 1 146 ? 11.533  -1.008  -49.943 1.00 34.55 ? 192 ASP A CG    1 
ATOM   1117 O OD1   . ASP A 1 146 ? 10.765  -0.040  -50.150 1.00 37.56 ? 192 ASP A OD1   1 
ATOM   1118 O OD2   . ASP A 1 146 ? 11.575  -1.992  -50.690 1.00 37.96 ? 192 ASP A OD2   1 
ATOM   1119 N N     . GLN A 1 147 ? 12.518  1.627   -47.330 1.00 33.66 ? 193 GLN A N     1 
ATOM   1120 C CA    . GLN A 1 147 ? 12.322  3.043   -47.112 1.00 35.07 ? 193 GLN A CA    1 
ATOM   1121 C C     . GLN A 1 147 ? 11.482  3.696   -48.227 1.00 35.33 ? 193 GLN A C     1 
ATOM   1122 O O     . GLN A 1 147 ? 10.704  4.624   -47.964 1.00 35.98 ? 193 GLN A O     1 
ATOM   1123 C CB    . GLN A 1 147 ? 13.673  3.759   -46.887 1.00 35.68 ? 193 GLN A CB    1 
ATOM   1124 C CG    . GLN A 1 147 ? 13.487  5.235   -46.462 1.00 39.77 ? 193 GLN A CG    1 
ATOM   1125 C CD    . GLN A 1 147 ? 12.987  5.371   -45.024 1.00 43.66 ? 193 GLN A CD    1 
ATOM   1126 O OE1   . GLN A 1 147 ? 13.618  4.801   -44.106 1.00 48.90 ? 193 GLN A OE1   1 
ATOM   1127 N NE2   . GLN A 1 147 ? 11.895  6.141   -44.801 1.00 38.27 ? 193 GLN A NE2   1 
ATOM   1128 N N     . SER A 1 148 ? 11.609  3.203   -49.464 1.00 35.67 ? 194 SER A N     1 
ATOM   1129 C CA    . SER A 1 148 ? 10.795  3.742   -50.572 1.00 35.29 ? 194 SER A CA    1 
ATOM   1130 C C     . SER A 1 148 ? 9.307   3.436   -50.398 1.00 33.59 ? 194 SER A C     1 
ATOM   1131 O O     . SER A 1 148 ? 8.460   4.273   -50.744 1.00 33.57 ? 194 SER A O     1 
ATOM   1132 C CB    . SER A 1 148 ? 11.252  3.223   -51.931 1.00 36.35 ? 194 SER A CB    1 
ATOM   1133 O OG    . SER A 1 148 ? 10.116  3.068   -52.808 1.00 42.09 ? 194 SER A OG    1 
ATOM   1134 N N     . ALA A 1 149 ? 8.992   2.255   -49.860 1.00 30.81 ? 195 ALA A N     1 
ATOM   1135 C CA    . ALA A 1 149 ? 7.601   1.895   -49.614 1.00 29.58 ? 195 ALA A CA    1 
ATOM   1136 C C     . ALA A 1 149 ? 6.972   2.833   -48.546 1.00 28.63 ? 195 ALA A C     1 
ATOM   1137 O O     . ALA A 1 149 ? 5.801   3.194   -48.620 1.00 28.07 ? 195 ALA A O     1 
ATOM   1138 C CB    . ALA A 1 149 ? 7.505   0.411   -49.214 1.00 27.53 ? 195 ALA A CB    1 
ATOM   1139 N N     . ALA A 1 150 ? 7.780   3.232   -47.571 1.00 29.11 ? 196 ALA A N     1 
ATOM   1140 C CA    . ALA A 1 150 ? 7.342   4.109   -46.486 1.00 30.41 ? 196 ALA A CA    1 
ATOM   1141 C C     . ALA A 1 150 ? 7.063   5.521   -47.018 1.00 31.35 ? 196 ALA A C     1 
ATOM   1142 O O     . ALA A 1 150 ? 6.067   6.139   -46.657 1.00 32.04 ? 196 ALA A O     1 
ATOM   1143 C CB    . ALA A 1 150 ? 8.367   4.098   -45.307 1.00 29.69 ? 196 ALA A CB    1 
ATOM   1144 N N     . GLU A 1 151 ? 7.899   5.987   -47.948 1.00 32.89 ? 197 GLU A N     1 
ATOM   1145 C CA    . GLU A 1 151 ? 7.662   7.244   -48.678 1.00 33.80 ? 197 GLU A CA    1 
ATOM   1146 C C     . GLU A 1 151 ? 6.400   7.229   -49.544 1.00 34.57 ? 197 GLU A C     1 
ATOM   1147 O O     . GLU A 1 151 ? 5.680   8.243   -49.638 1.00 35.52 ? 197 GLU A O     1 
ATOM   1148 C CB    . GLU A 1 151 ? 8.878   7.581   -49.529 1.00 34.17 ? 197 GLU A CB    1 
ATOM   1149 C CG    . GLU A 1 151 ? 10.169  7.574   -48.739 1.00 37.40 ? 197 GLU A CG    1 
ATOM   1150 C CD    . GLU A 1 151 ? 10.464  8.929   -48.103 1.00 43.89 ? 197 GLU A CD    1 
ATOM   1151 O OE1   . GLU A 1 151 ? 9.640   9.866   -48.272 1.00 43.25 ? 197 GLU A OE1   1 
ATOM   1152 O OE2   . GLU A 1 151 ? 11.527  9.048   -47.435 1.00 47.38 ? 197 GLU A OE2   1 
ATOM   1153 N N     . ILE A 1 152 ? 6.106   6.079   -50.147 1.00 33.94 ? 198 ILE A N     1 
ATOM   1154 C CA    . ILE A 1 152 ? 4.911   5.912   -51.024 1.00 33.75 ? 198 ILE A CA    1 
ATOM   1155 C C     . ILE A 1 152 ? 3.633   5.684   -50.173 1.00 33.45 ? 198 ILE A C     1 
ATOM   1156 O O     . ILE A 1 152 ? 2.524   5.883   -50.664 1.00 34.47 ? 198 ILE A O     1 
ATOM   1157 C CB    . ILE A 1 152 ? 5.213   4.785   -52.164 1.00 32.76 ? 198 ILE A CB    1 
ATOM   1158 C CG1   . ILE A 1 152 ? 6.180   5.370   -53.200 1.00 34.42 ? 198 ILE A CG1   1 
ATOM   1159 C CG2   . ILE A 1 152 ? 3.991   4.314   -52.927 1.00 33.58 ? 198 ILE A CG2   1 
ATOM   1160 C CD1   . ILE A 1 152 ? 7.223   4.352   -53.883 1.00 34.05 ? 198 ILE A CD1   1 
ATOM   1161 N N     . GLY A 1 153 ? 3.801   5.296   -48.897 1.00 32.63 ? 199 GLY A N     1 
ATOM   1162 C CA    . GLY A 1 153 ? 2.708   4.873   -48.024 1.00 30.83 ? 199 GLY A CA    1 
ATOM   1163 C C     . GLY A 1 153 ? 2.221   3.473   -48.385 1.00 30.71 ? 199 GLY A C     1 
ATOM   1164 O O     . GLY A 1 153 ? 1.056   3.128   -48.128 1.00 30.55 ? 199 GLY A O     1 
ATOM   1165 N N     . ASP A 1 154 ? 3.116   2.677   -48.984 1.00 29.82 ? 200 ASP A N     1 
ATOM   1166 C CA    . ASP A 1 154 ? 2.848   1.316   -49.461 1.00 29.38 ? 200 ASP A CA    1 
ATOM   1167 C C     . ASP A 1 154 ? 3.020   0.296   -48.347 1.00 29.51 ? 200 ASP A C     1 
ATOM   1168 O O     . ASP A 1 154 ? 4.079   -0.294  -48.190 1.00 29.35 ? 200 ASP A O     1 
ATOM   1169 C CB    . ASP A 1 154 ? 3.762   0.992   -50.677 1.00 29.68 ? 200 ASP A CB    1 
ATOM   1170 C CG    . ASP A 1 154 ? 3.735   -0.492  -51.096 1.00 30.82 ? 200 ASP A CG    1 
ATOM   1171 O OD1   . ASP A 1 154 ? 2.670   -1.152  -51.094 1.00 31.06 ? 200 ASP A OD1   1 
ATOM   1172 O OD2   . ASP A 1 154 ? 4.811   -1.016  -51.446 1.00 35.56 ? 200 ASP A OD2   1 
ATOM   1173 N N     . LYS A 1 155 ? 1.931   0.064   -47.614 1.00 30.23 ? 201 LYS A N     1 
ATOM   1174 C CA    . LYS A 1 155 ? 1.924   -0.682  -46.365 1.00 30.49 ? 201 LYS A CA    1 
ATOM   1175 C C     . LYS A 1 155 ? 1.933   -2.179  -46.601 1.00 30.81 ? 201 LYS A C     1 
ATOM   1176 O O     . LYS A 1 155 ? 1.213   -2.683  -47.480 1.00 31.35 ? 201 LYS A O     1 
ATOM   1177 C CB    . LYS A 1 155 ? 0.651   -0.336  -45.588 1.00 30.50 ? 201 LYS A CB    1 
ATOM   1178 C CG    . LYS A 1 155 ? 0.448   1.147   -45.308 1.00 31.11 ? 201 LYS A CG    1 
ATOM   1179 C CD    . LYS A 1 155 ? -0.965  1.393   -44.708 1.00 30.44 ? 201 LYS A CD    1 
ATOM   1180 C CE    . LYS A 1 155 ? -1.175  2.847   -44.442 1.00 31.83 ? 201 LYS A CE    1 
ATOM   1181 N NZ    . LYS A 1 155 ? -1.086  3.656   -45.706 1.00 34.08 ? 201 LYS A NZ    1 
ATOM   1182 N N     . SER A 1 156 ? 2.723   -2.906  -45.824 1.00 30.26 ? 202 SER A N     1 
ATOM   1183 C CA    . SER A 1 156 ? 2.546   -4.354  -45.757 1.00 29.73 ? 202 SER A CA    1 
ATOM   1184 C C     . SER A 1 156 ? 1.744   -4.706  -44.505 1.00 29.77 ? 202 SER A C     1 
ATOM   1185 O O     . SER A 1 156 ? 2.132   -4.310  -43.414 1.00 28.09 ? 202 SER A O     1 
ATOM   1186 C CB    . SER A 1 156 ? 3.882   -5.064  -45.731 1.00 29.76 ? 202 SER A CB    1 
ATOM   1187 O OG    . SER A 1 156 ? 4.579   -4.755  -46.903 1.00 31.43 ? 202 SER A OG    1 
ATOM   1188 N N     . TRP A 1 157 ? 0.642   -5.456  -44.679 1.00 29.81 ? 203 TRP A N     1 
ATOM   1189 C CA    . TRP A 1 157 ? -0.246  -5.820  -43.572 1.00 29.70 ? 203 TRP A CA    1 
ATOM   1190 C C     . TRP A 1 157 ? 0.013   -7.179  -42.963 1.00 30.45 ? 203 TRP A C     1 
ATOM   1191 O O     . TRP A 1 157 ? 0.294   -8.152  -43.673 1.00 30.54 ? 203 TRP A O     1 
ATOM   1192 C CB    . TRP A 1 157 ? -1.734  -5.653  -43.935 1.00 29.04 ? 203 TRP A CB    1 
ATOM   1193 C CG    . TRP A 1 157 ? -2.116  -4.211  -44.005 1.00 27.05 ? 203 TRP A CG    1 
ATOM   1194 C CD1   . TRP A 1 157 ? -1.957  -3.395  -45.080 1.00 26.95 ? 203 TRP A CD1   1 
ATOM   1195 C CD2   . TRP A 1 157 ? -2.644  -3.391  -42.957 1.00 27.40 ? 203 TRP A CD2   1 
ATOM   1196 N NE1   . TRP A 1 157 ? -2.382  -2.129  -44.792 1.00 27.50 ? 203 TRP A NE1   1 
ATOM   1197 C CE2   . TRP A 1 157 ? -2.795  -2.087  -43.488 1.00 25.49 ? 203 TRP A CE2   1 
ATOM   1198 C CE3   . TRP A 1 157 ? -2.997  -3.620  -41.620 1.00 27.67 ? 203 TRP A CE3   1 
ATOM   1199 C CZ2   . TRP A 1 157 ? -3.304  -1.012  -42.740 1.00 26.28 ? 203 TRP A CZ2   1 
ATOM   1200 C CZ3   . TRP A 1 157 ? -3.513  -2.533  -40.877 1.00 28.43 ? 203 TRP A CZ3   1 
ATOM   1201 C CH2   . TRP A 1 157 ? -3.646  -1.242  -41.449 1.00 26.14 ? 203 TRP A CH2   1 
ATOM   1202 N N     . LEU A 1 158 ? -0.138  -7.232  -41.631 1.00 30.78 ? 204 LEU A N     1 
ATOM   1203 C CA    . LEU A 1 158 ? 0.049   -8.427  -40.837 1.00 30.33 ? 204 LEU A CA    1 
ATOM   1204 C C     . LEU A 1 158 ? -1.223  -8.643  -40.033 1.00 29.98 ? 204 LEU A C     1 
ATOM   1205 O O     . LEU A 1 158 ? -1.680  -7.738  -39.373 1.00 30.40 ? 204 LEU A O     1 
ATOM   1206 C CB    . LEU A 1 158 ? 1.237   -8.190  -39.921 1.00 31.31 ? 204 LEU A CB    1 
ATOM   1207 C CG    . LEU A 1 158 ? 2.030   -9.354  -39.321 1.00 33.47 ? 204 LEU A CG    1 
ATOM   1208 C CD1   . LEU A 1 158 ? 2.321   -10.428 -40.393 1.00 34.33 ? 204 LEU A CD1   1 
ATOM   1209 C CD2   . LEU A 1 158 ? 3.308   -8.847  -38.729 1.00 31.51 ? 204 LEU A CD2   1 
ATOM   1210 N N     . TYR A 1 159 ? -1.815  -9.831  -40.115 1.00 29.78 ? 205 TYR A N     1 
ATOM   1211 C CA    . TYR A 1 159 ? -3.136  -10.095 -39.544 1.00 29.57 ? 205 TYR A CA    1 
ATOM   1212 C C     . TYR A 1 159 ? -2.969  -11.104 -38.452 1.00 29.74 ? 205 TYR A C     1 
ATOM   1213 O O     . TYR A 1 159 ? -1.987  -11.848 -38.437 1.00 29.17 ? 205 TYR A O     1 
ATOM   1214 C CB    . TYR A 1 159 ? -4.163  -10.602 -40.606 1.00 29.62 ? 205 TYR A CB    1 
ATOM   1215 C CG    . TYR A 1 159 ? -4.497  -9.565  -41.650 1.00 29.64 ? 205 TYR A CG    1 
ATOM   1216 C CD1   . TYR A 1 159 ? -5.315  -8.481  -41.341 1.00 29.68 ? 205 TYR A CD1   1 
ATOM   1217 C CD2   . TYR A 1 159 ? -3.923  -9.606  -42.928 1.00 32.32 ? 205 TYR A CD2   1 
ATOM   1218 C CE1   . TYR A 1 159 ? -5.585  -7.466  -42.298 1.00 28.60 ? 205 TYR A CE1   1 
ATOM   1219 C CE2   . TYR A 1 159 ? -4.225  -8.601  -43.909 1.00 29.91 ? 205 TYR A CE2   1 
ATOM   1220 C CZ    . TYR A 1 159 ? -5.054  -7.539  -43.571 1.00 28.04 ? 205 TYR A CZ    1 
ATOM   1221 O OH    . TYR A 1 159 ? -5.368  -6.546  -44.505 1.00 28.65 ? 205 TYR A OH    1 
ATOM   1222 N N     . LEU A 1 160 ? -3.938  -11.100 -37.542 1.00 31.68 ? 206 LEU A N     1 
ATOM   1223 C CA    . LEU A 1 160 ? -3.984  -12.018 -36.420 1.00 32.77 ? 206 LEU A CA    1 
ATOM   1224 C C     . LEU A 1 160 ? -3.764  -13.441 -36.869 1.00 33.75 ? 206 LEU A C     1 
ATOM   1225 O O     . LEU A 1 160 ? -4.340  -13.887 -37.875 1.00 33.07 ? 206 LEU A O     1 
ATOM   1226 C CB    . LEU A 1 160 ? -5.320  -11.897 -35.688 1.00 32.99 ? 206 LEU A CB    1 
ATOM   1227 C CG    . LEU A 1 160 ? -5.677  -12.767 -34.461 1.00 32.97 ? 206 LEU A CG    1 
ATOM   1228 C CD1   . LEU A 1 160 ? -5.345  -12.085 -33.162 1.00 33.62 ? 206 LEU A CD1   1 
ATOM   1229 C CD2   . LEU A 1 160 ? -7.179  -12.993 -34.515 1.00 34.65 ? 206 LEU A CD2   1 
ATOM   1230 N N     . ARG A 1 161 ? -2.917  -14.150 -36.116 1.00 35.09 ? 207 ARG A N     1 
ATOM   1231 C CA    . ARG A 1 161 ? -2.735  -15.578 -36.311 1.00 36.50 ? 207 ARG A CA    1 
ATOM   1232 C C     . ARG A 1 161 ? -3.766  -16.329 -35.448 1.00 38.12 ? 207 ARG A C     1 
ATOM   1233 O O     . ARG A 1 161 ? -3.872  -16.116 -34.210 1.00 38.31 ? 207 ARG A O     1 
ATOM   1234 C CB    . ARG A 1 161 ? -1.295  -15.956 -35.975 1.00 36.04 ? 207 ARG A CB    1 
ATOM   1235 C CG    . ARG A 1 161 ? -0.971  -17.429 -36.092 1.00 36.78 ? 207 ARG A CG    1 
ATOM   1236 C CD    . ARG A 1 161 ? 0.494   -17.700 -35.799 1.00 38.01 ? 207 ARG A CD    1 
ATOM   1237 N NE    . ARG A 1 161 ? 0.780   -19.130 -35.691 1.00 42.03 ? 207 ARG A NE    1 
ATOM   1238 C CZ    . ARG A 1 161 ? 1.993   -19.663 -35.512 1.00 42.80 ? 207 ARG A CZ    1 
ATOM   1239 N NH1   . ARG A 1 161 ? 3.066   -18.890 -35.447 1.00 41.96 ? 207 ARG A NH1   1 
ATOM   1240 N NH2   . ARG A 1 161 ? 2.132   -20.985 -35.377 1.00 42.28 ? 207 ARG A NH2   1 
ATOM   1241 N N     . THR A 1 162 ? -4.579  -17.178 -36.076 1.00 39.64 ? 208 THR A N     1 
ATOM   1242 C CA    . THR A 1 162 ? -5.354  -18.123 -35.250 1.00 39.82 ? 208 THR A CA    1 
ATOM   1243 C C     . THR A 1 162 ? -4.553  -19.392 -34.913 1.00 40.41 ? 208 THR A C     1 
ATOM   1244 O O     . THR A 1 162 ? -3.754  -19.878 -35.718 1.00 40.12 ? 208 THR A O     1 
ATOM   1245 C CB    . THR A 1 162 ? -6.720  -18.421 -35.813 1.00 39.59 ? 208 THR A CB    1 
ATOM   1246 O OG1   . THR A 1 162 ? -6.563  -19.211 -36.983 1.00 41.50 ? 208 THR A OG1   1 
ATOM   1247 C CG2   . THR A 1 162 ? -7.449  -17.129 -36.143 1.00 38.58 ? 208 THR A CG2   1 
ATOM   1248 N N     . LEU A 1 163 ? -4.760  -19.910 -33.706 1.00 41.91 ? 209 LEU A N     1 
ATOM   1249 C CA    . LEU A 1 163 ? -3.930  -20.981 -33.182 1.00 44.11 ? 209 LEU A CA    1 
ATOM   1250 C C     . LEU A 1 163 ? -4.737  -22.267 -33.004 1.00 46.80 ? 209 LEU A C     1 
ATOM   1251 O O     . LEU A 1 163 ? -5.955  -22.228 -32.727 1.00 48.05 ? 209 LEU A O     1 
ATOM   1252 C CB    . LEU A 1 163 ? -3.305  -20.591 -31.816 1.00 42.61 ? 209 LEU A CB    1 
ATOM   1253 C CG    . LEU A 1 163 ? -2.469  -19.330 -31.559 1.00 40.35 ? 209 LEU A CG    1 
ATOM   1254 C CD1   . LEU A 1 163 ? -1.716  -19.521 -30.259 1.00 42.33 ? 209 LEU A CD1   1 
ATOM   1255 C CD2   . LEU A 1 163 ? -1.509  -19.053 -32.630 1.00 36.14 ? 209 LEU A CD2   1 
ATOM   1256 N N     . LYS A 1 164 ? -4.061  -23.405 -33.148 1.00 49.00 ? 210 LYS A N     1 
ATOM   1257 C CA    . LYS A 1 164 ? -4.646  -24.684 -32.748 1.00 51.05 ? 210 LYS A CA    1 
ATOM   1258 C C     . LYS A 1 164 ? -4.417  -24.838 -31.243 1.00 51.62 ? 210 LYS A C     1 
ATOM   1259 O O     . LYS A 1 164 ? -3.395  -24.379 -30.723 1.00 51.90 ? 210 LYS A O     1 
ATOM   1260 C CB    . LYS A 1 164 ? -3.993  -25.841 -33.534 1.00 51.50 ? 210 LYS A CB    1 
ATOM   1261 C CG    . LYS A 1 164 ? -4.309  -25.858 -35.055 1.00 53.00 ? 210 LYS A CG    1 
ATOM   1262 C CD    . LYS A 1 164 ? -3.154  -26.497 -35.847 1.00 55.29 ? 210 LYS A CD    1 
ATOM   1263 C CE    . LYS A 1 164 ? -3.536  -26.788 -37.304 1.00 55.11 ? 210 LYS A CE    1 
ATOM   1264 N NZ    . LYS A 1 164 ? -2.455  -27.545 -38.056 1.00 55.88 ? 210 LYS A NZ    1 
ATOM   1265 N N     . GLN A 1 165 ? -5.342  -25.484 -30.535 1.00 52.47 ? 211 GLN A N     1 
ATOM   1266 C CA    . GLN A 1 165 ? -5.128  -25.732 -29.102 1.00 52.65 ? 211 GLN A CA    1 
ATOM   1267 C C     . GLN A 1 165 ? -3.705  -26.223 -28.772 1.00 52.12 ? 211 GLN A C     1 
ATOM   1268 O O     . GLN A 1 165 ? -3.077  -25.712 -27.846 1.00 52.19 ? 211 GLN A O     1 
ATOM   1269 C CB    . GLN A 1 165 ? -6.211  -26.649 -28.491 1.00 53.22 ? 211 GLN A CB    1 
ATOM   1270 C CG    . GLN A 1 165 ? -5.987  -27.011 -26.989 1.00 54.18 ? 211 GLN A CG    1 
ATOM   1271 C CD    . GLN A 1 165 ? -5.586  -25.810 -26.102 1.00 59.86 ? 211 GLN A CD    1 
ATOM   1272 O OE1   . GLN A 1 165 ? -5.519  -24.656 -26.582 1.00 60.86 ? 211 GLN A OE1   1 
ATOM   1273 N NE2   . GLN A 1 165 ? -5.298  -26.081 -24.798 1.00 57.79 ? 211 GLN A NE2   1 
ATOM   1274 N N     . GLU A 1 166 ? -3.195  -27.184 -29.540 1.00 51.52 ? 212 GLU A N     1 
ATOM   1275 C CA    . GLU A 1 166 ? -1.829  -27.694 -29.345 1.00 50.96 ? 212 GLU A CA    1 
ATOM   1276 C C     . GLU A 1 166 ? -0.698  -26.646 -29.522 1.00 50.12 ? 212 GLU A C     1 
ATOM   1277 O O     . GLU A 1 166 ? 0.468   -26.913 -29.195 1.00 49.65 ? 212 GLU A O     1 
ATOM   1278 C CB    . GLU A 1 166 ? -1.580  -28.868 -30.287 1.00 51.38 ? 212 GLU A CB    1 
ATOM   1279 C CG    . GLU A 1 166 ? -1.557  -28.481 -31.775 1.00 54.41 ? 212 GLU A CG    1 
ATOM   1280 C CD    . GLU A 1 166 ? -2.795  -28.944 -32.588 1.00 58.64 ? 212 GLU A CD    1 
ATOM   1281 O OE1   . GLU A 1 166 ? -3.921  -29.149 -32.026 1.00 56.82 ? 212 GLU A OE1   1 
ATOM   1282 O OE2   . GLU A 1 166 ? -2.611  -29.088 -33.825 1.00 60.75 ? 212 GLU A OE2   1 
ATOM   1283 N N     . GLU A 1 167 ? -1.036  -25.483 -30.075 1.00 48.80 ? 213 GLU A N     1 
ATOM   1284 C CA    . GLU A 1 167 ? -0.075  -24.396 -30.267 1.00 48.08 ? 213 GLU A CA    1 
ATOM   1285 C C     . GLU A 1 167 ? -0.066  -23.375 -29.120 1.00 47.08 ? 213 GLU A C     1 
ATOM   1286 O O     . GLU A 1 167 ? 0.960   -22.756 -28.842 1.00 45.76 ? 213 GLU A O     1 
ATOM   1287 C CB    . GLU A 1 167 ? -0.399  -23.655 -31.548 1.00 48.23 ? 213 GLU A CB    1 
ATOM   1288 C CG    . GLU A 1 167 ? 0.116   -24.339 -32.753 1.00 48.76 ? 213 GLU A CG    1 
ATOM   1289 C CD    . GLU A 1 167 ? -0.136  -23.531 -33.978 1.00 48.92 ? 213 GLU A CD    1 
ATOM   1290 O OE1   . GLU A 1 167 ? -1.327  -23.225 -34.257 1.00 47.20 ? 213 GLU A OE1   1 
ATOM   1291 O OE2   . GLU A 1 167 ? 0.878   -23.205 -34.641 1.00 51.98 ? 213 GLU A OE2   1 
ATOM   1292 N N     . GLU A 1 168 ? -1.225  -23.257 -28.471 1.00 46.27 ? 214 GLU A N     1 
ATOM   1293 C CA    . GLU A 1 168 ? -1.547  -22.219 -27.518 1.00 45.84 ? 214 GLU A CA    1 
ATOM   1294 C C     . GLU A 1 168 ? -0.468  -21.907 -26.476 1.00 45.18 ? 214 GLU A C     1 
ATOM   1295 O O     . GLU A 1 168 ? -0.148  -20.732 -26.272 1.00 44.32 ? 214 GLU A O     1 
ATOM   1296 C CB    . GLU A 1 168 ? -2.926  -22.460 -26.869 1.00 46.52 ? 214 GLU A CB    1 
ATOM   1297 C CG    . GLU A 1 168 ? -4.149  -22.082 -27.772 1.00 47.76 ? 214 GLU A CG    1 
ATOM   1298 C CD    . GLU A 1 168 ? -4.591  -20.610 -27.667 1.00 50.36 ? 214 GLU A CD    1 
ATOM   1299 O OE1   . GLU A 1 168 ? -5.408  -20.179 -28.519 1.00 48.57 ? 214 GLU A OE1   1 
ATOM   1300 O OE2   . GLU A 1 168 ? -4.134  -19.879 -26.743 1.00 50.58 ? 214 GLU A OE2   1 
ATOM   1301 N N     . THR A 1 169 ? 0.111   -22.939 -25.866 1.00 43.46 ? 215 THR A N     1 
ATOM   1302 C CA    . THR A 1 169 ? 1.020   -22.727 -24.764 1.00 43.09 ? 215 THR A CA    1 
ATOM   1303 C C     . THR A 1 169 ? 2.363   -22.117 -25.231 1.00 42.18 ? 215 THR A C     1 
ATOM   1304 O O     . THR A 1 169 ? 2.820   -21.101 -24.696 1.00 41.62 ? 215 THR A O     1 
ATOM   1305 C CB    . THR A 1 169 ? 1.222   -24.026 -23.928 1.00 43.19 ? 215 THR A CB    1 
ATOM   1306 O OG1   . THR A 1 169 ? -0.028  -24.403 -23.348 1.00 44.16 ? 215 THR A OG1   1 
ATOM   1307 C CG2   . THR A 1 169 ? 2.259   -23.814 -22.779 1.00 43.20 ? 215 THR A CG2   1 
ATOM   1308 N N     . HIS A 1 170 ? 2.954   -22.729 -26.246 1.00 40.87 ? 216 HIS A N     1 
ATOM   1309 C CA    . HIS A 1 170 ? 4.236   -22.307 -26.761 1.00 40.03 ? 216 HIS A CA    1 
ATOM   1310 C C     . HIS A 1 170 ? 4.145   -20.947 -27.447 1.00 38.47 ? 216 HIS A C     1 
ATOM   1311 O O     . HIS A 1 170 ? 5.034   -20.110 -27.291 1.00 38.26 ? 216 HIS A O     1 
ATOM   1312 C CB    . HIS A 1 170 ? 4.794   -23.380 -27.709 1.00 39.76 ? 216 HIS A CB    1 
ATOM   1313 C CG    . HIS A 1 170 ? 5.991   -22.938 -28.492 1.00 43.95 ? 216 HIS A CG    1 
ATOM   1314 N ND1   . HIS A 1 170 ? 7.180   -22.564 -27.891 1.00 48.22 ? 216 HIS A ND1   1 
ATOM   1315 C CD2   . HIS A 1 170 ? 6.193   -22.827 -29.827 1.00 45.98 ? 216 HIS A CD2   1 
ATOM   1316 C CE1   . HIS A 1 170 ? 8.055   -22.221 -28.825 1.00 49.07 ? 216 HIS A CE1   1 
ATOM   1317 N NE2   . HIS A 1 170 ? 7.484   -22.377 -30.007 1.00 47.88 ? 216 HIS A NE2   1 
ATOM   1318 N N     . ILE A 1 171 ? 3.078   -20.734 -28.208 1.00 37.28 ? 217 ILE A N     1 
ATOM   1319 C CA    . ILE A 1 171 ? 2.965   -19.555 -29.063 1.00 35.97 ? 217 ILE A CA    1 
ATOM   1320 C C     . ILE A 1 171 ? 2.571   -18.338 -28.247 1.00 35.33 ? 217 ILE A C     1 
ATOM   1321 O O     . ILE A 1 171 ? 3.158   -17.272 -28.424 1.00 36.54 ? 217 ILE A O     1 
ATOM   1322 C CB    . ILE A 1 171 ? 2.031   -19.799 -30.290 1.00 36.45 ? 217 ILE A CB    1 
ATOM   1323 C CG1   . ILE A 1 171 ? 2.553   -20.976 -31.117 1.00 37.08 ? 217 ILE A CG1   1 
ATOM   1324 C CG2   . ILE A 1 171 ? 1.845   -18.529 -31.176 1.00 36.15 ? 217 ILE A CG2   1 
ATOM   1325 C CD1   . ILE A 1 171 ? 3.791   -20.645 -31.978 1.00 40.52 ? 217 ILE A CD1   1 
ATOM   1326 N N     . ARG A 1 172 ? 1.634   -18.487 -27.319 1.00 34.08 ? 218 ARG A N     1 
ATOM   1327 C CA    . ARG A 1 172 ? 1.294   -17.378 -26.428 1.00 33.57 ? 218 ARG A CA    1 
ATOM   1328 C C     . ARG A 1 172 ? 2.487   -16.939 -25.607 1.00 33.82 ? 218 ARG A C     1 
ATOM   1329 O O     . ARG A 1 172 ? 2.697   -15.744 -25.396 1.00 33.90 ? 218 ARG A O     1 
ATOM   1330 C CB    . ARG A 1 172 ? 0.109   -17.715 -25.526 1.00 33.56 ? 218 ARG A CB    1 
ATOM   1331 C CG    . ARG A 1 172 ? -1.160  -18.023 -26.308 1.00 32.59 ? 218 ARG A CG    1 
ATOM   1332 C CD    . ARG A 1 172 ? -1.574  -16.874 -27.160 1.00 32.11 ? 218 ARG A CD    1 
ATOM   1333 N NE    . ARG A 1 172 ? -2.890  -17.085 -27.743 1.00 34.26 ? 218 ARG A NE    1 
ATOM   1334 C CZ    . ARG A 1 172 ? -3.334  -16.472 -28.841 1.00 34.97 ? 218 ARG A CZ    1 
ATOM   1335 N NH1   . ARG A 1 172 ? -2.562  -15.598 -29.483 1.00 35.04 ? 218 ARG A NH1   1 
ATOM   1336 N NH2   . ARG A 1 172 ? -4.559  -16.738 -29.311 1.00 35.00 ? 218 ARG A NH2   1 
ATOM   1337 N N     . ASN A 1 173 ? 3.292   -17.910 -25.177 1.00 33.52 ? 219 ASN A N     1 
ATOM   1338 C CA    . ASN A 1 173 ? 4.509   -17.572 -24.503 1.00 33.47 ? 219 ASN A CA    1 
ATOM   1339 C C     . ASN A 1 173 ? 5.537   -16.811 -25.334 1.00 33.28 ? 219 ASN A C     1 
ATOM   1340 O O     . ASN A 1 173 ? 6.115   -15.857 -24.821 1.00 34.53 ? 219 ASN A O     1 
ATOM   1341 C CB    . ASN A 1 173 ? 5.159   -18.744 -23.794 1.00 32.60 ? 219 ASN A CB    1 
ATOM   1342 C CG    . ASN A 1 173 ? 6.225   -18.281 -22.828 1.00 33.25 ? 219 ASN A CG    1 
ATOM   1343 O OD1   . ASN A 1 173 ? 7.402   -18.254 -23.169 1.00 34.95 ? 219 ASN A OD1   1 
ATOM   1344 N ND2   . ASN A 1 173 ? 5.816   -17.848 -21.636 1.00 30.26 ? 219 ASN A ND2   1 
ATOM   1345 N N     . GLU A 1 174 ? 5.750   -17.211 -26.586 1.00 32.90 ? 220 GLU A N     1 
ATOM   1346 C CA    . GLU A 1 174 ? 6.682   -16.552 -27.511 1.00 32.34 ? 220 GLU A CA    1 
ATOM   1347 C C     . GLU A 1 174 ? 6.238   -15.151 -27.829 1.00 29.85 ? 220 GLU A C     1 
ATOM   1348 O O     . GLU A 1 174 ? 7.053   -14.278 -28.053 1.00 30.87 ? 220 GLU A O     1 
ATOM   1349 C CB    . GLU A 1 174 ? 6.681   -17.246 -28.865 1.00 33.76 ? 220 GLU A CB    1 
ATOM   1350 C CG    . GLU A 1 174 ? 7.361   -18.569 -28.946 1.00 39.30 ? 220 GLU A CG    1 
ATOM   1351 C CD    . GLU A 1 174 ? 7.512   -18.979 -30.424 1.00 49.04 ? 220 GLU A CD    1 
ATOM   1352 O OE1   . GLU A 1 174 ? 6.536   -18.797 -31.214 1.00 52.27 ? 220 GLU A OE1   1 
ATOM   1353 O OE2   . GLU A 1 174 ? 8.607   -19.467 -30.801 1.00 52.48 ? 220 GLU A OE2   1 
ATOM   1354 N N     . GLN A 1 175 ? 4.933   -14.983 -27.924 1.00 27.18 ? 221 GLN A N     1 
ATOM   1355 C CA    . GLN A 1 175 ? 4.287   -13.697 -28.131 1.00 25.36 ? 221 GLN A CA    1 
ATOM   1356 C C     . GLN A 1 175 ? 4.386   -12.750 -26.925 1.00 25.08 ? 221 GLN A C     1 
ATOM   1357 O O     . GLN A 1 175 ? 4.590   -11.596 -27.106 1.00 26.53 ? 221 GLN A O     1 
ATOM   1358 C CB    . GLN A 1 175 ? 2.807   -13.915 -28.476 1.00 25.75 ? 221 GLN A CB    1 
ATOM   1359 C CG    . GLN A 1 175 ? 2.539   -14.591 -29.831 1.00 24.41 ? 221 GLN A CG    1 
ATOM   1360 C CD    . GLN A 1 175 ? 1.081   -14.803 -30.068 1.00 24.26 ? 221 GLN A CD    1 
ATOM   1361 O OE1   . GLN A 1 175 ? 0.356   -15.306 -29.211 1.00 23.53 ? 221 GLN A OE1   1 
ATOM   1362 N NE2   . GLN A 1 175 ? 0.635   -14.437 -31.230 1.00 22.46 ? 221 GLN A NE2   1 
ATOM   1363 N N     . VAL A 1 176 ? 4.245   -13.240 -25.697 1.00 24.31 ? 222 VAL A N     1 
ATOM   1364 C CA    . VAL A 1 176 ? 4.418   -12.393 -24.549 1.00 23.83 ? 222 VAL A CA    1 
ATOM   1365 C C     . VAL A 1 176 ? 5.881   -11.938 -24.451 1.00 25.50 ? 222 VAL A C     1 
ATOM   1366 O O     . VAL A 1 176 ? 6.143   -10.800 -24.090 1.00 27.35 ? 222 VAL A O     1 
ATOM   1367 C CB    . VAL A 1 176 ? 3.799   -13.019 -23.216 1.00 22.41 ? 222 VAL A CB    1 
ATOM   1368 C CG1   . VAL A 1 176 ? 4.725   -14.061 -22.562 1.00 19.22 ? 222 VAL A CG1   1 
ATOM   1369 C CG2   . VAL A 1 176 ? 3.402   -11.931 -22.269 1.00 20.35 ? 222 VAL A CG2   1 
ATOM   1370 N N     . ARG A 1 177 ? 6.822   -12.808 -24.802 1.00 26.21 ? 223 ARG A N     1 
ATOM   1371 C CA    . ARG A 1 177 ? 8.229   -12.435 -24.837 1.00 27.09 ? 223 ARG A CA    1 
ATOM   1372 C C     . ARG A 1 177 ? 8.531   -11.333 -25.856 1.00 26.74 ? 223 ARG A C     1 
ATOM   1373 O O     . ARG A 1 177 ? 9.229   -10.375 -25.549 1.00 27.98 ? 223 ARG A O     1 
ATOM   1374 C CB    . ARG A 1 177 ? 9.082   -13.664 -25.113 1.00 26.33 ? 223 ARG A CB    1 
ATOM   1375 C CG    . ARG A 1 177 ? 9.325   -14.448 -23.923 1.00 29.50 ? 223 ARG A CG    1 
ATOM   1376 C CD    . ARG A 1 177 ? 9.955   -15.781 -24.290 1.00 37.42 ? 223 ARG A CD    1 
ATOM   1377 N NE    . ARG A 1 177 ? 9.598   -16.776 -23.302 1.00 38.44 ? 223 ARG A NE    1 
ATOM   1378 C CZ    . ARG A 1 177 ? 10.257  -16.949 -22.171 1.00 43.67 ? 223 ARG A CZ    1 
ATOM   1379 N NH1   . ARG A 1 177 ? 11.315  -16.186 -21.909 1.00 45.44 ? 223 ARG A NH1   1 
ATOM   1380 N NH2   . ARG A 1 177 ? 9.849   -17.873 -21.299 1.00 45.86 ? 223 ARG A NH2   1 
ATOM   1381 N N     . GLN A 1 178 ? 8.007   -11.478 -27.066 1.00 26.51 ? 224 GLN A N     1 
ATOM   1382 C CA    . GLN A 1 178 ? 8.180   -10.472 -28.115 1.00 25.53 ? 224 GLN A CA    1 
ATOM   1383 C C     . GLN A 1 178 ? 7.526   -9.197  -27.671 1.00 24.70 ? 224 GLN A C     1 
ATOM   1384 O O     . GLN A 1 178 ? 8.074   -8.126  -27.887 1.00 25.04 ? 224 GLN A O     1 
ATOM   1385 C CB    . GLN A 1 178 ? 7.484   -10.940 -29.412 1.00 25.83 ? 224 GLN A CB    1 
ATOM   1386 C CG    . GLN A 1 178 ? 7.263   -9.811  -30.422 1.00 28.37 ? 224 GLN A CG    1 
ATOM   1387 C CD    . GLN A 1 178 ? 7.198   -10.307 -31.855 1.00 30.79 ? 224 GLN A CD    1 
ATOM   1388 O OE1   . GLN A 1 178 ? 7.402   -11.487 -32.110 1.00 35.16 ? 224 GLN A OE1   1 
ATOM   1389 N NE2   . GLN A 1 178 ? 6.895   -9.407  -32.797 1.00 29.42 ? 224 GLN A NE2   1 
ATOM   1390 N N     . ARG A 1 179 ? 6.312   -9.319  -27.104 1.00 23.85 ? 225 ARG A N     1 
ATOM   1391 C CA    . ARG A 1 179 ? 5.542   -8.177  -26.625 1.00 22.60 ? 225 ARG A CA    1 
ATOM   1392 C C     . ARG A 1 179 ? 6.291   -7.313  -25.607 1.00 22.49 ? 225 ARG A C     1 
ATOM   1393 O O     . ARG A 1 179 ? 6.325   -6.089  -25.751 1.00 22.21 ? 225 ARG A O     1 
ATOM   1394 C CB    . ARG A 1 179 ? 4.181   -8.638  -26.086 1.00 22.91 ? 225 ARG A CB    1 
ATOM   1395 C CG    . ARG A 1 179 ? 3.116   -8.821  -27.128 1.00 20.03 ? 225 ARG A CG    1 
ATOM   1396 C CD    . ARG A 1 179 ? 1.892   -9.579  -26.525 1.00 22.96 ? 225 ARG A CD    1 
ATOM   1397 N NE    . ARG A 1 179 ? 0.629   -9.268  -27.214 1.00 20.00 ? 225 ARG A NE    1 
ATOM   1398 C CZ    . ARG A 1 179 ? -0.314  -8.409  -26.793 1.00 23.52 ? 225 ARG A CZ    1 
ATOM   1399 N NH1   . ARG A 1 179 ? -0.221  -7.757  -25.622 1.00 18.37 ? 225 ARG A NH1   1 
ATOM   1400 N NH2   . ARG A 1 179 ? -1.390  -8.194  -27.555 1.00 22.03 ? 225 ARG A NH2   1 
ATOM   1401 N N     . ALA A 1 180 ? 6.848   -7.962  -24.576 1.00 22.53 ? 226 ALA A N     1 
ATOM   1402 C CA    . ALA A 1 180 ? 7.792   -7.380  -23.584 1.00 21.63 ? 226 ALA A CA    1 
ATOM   1403 C C     . ALA A 1 180 ? 8.954   -6.666  -24.292 1.00 22.16 ? 226 ALA A C     1 
ATOM   1404 O O     . ALA A 1 180 ? 9.280   -5.520  -23.964 1.00 21.74 ? 226 ALA A O     1 
ATOM   1405 C CB    . ALA A 1 180 ? 8.361   -8.491  -22.667 1.00 20.33 ? 226 ALA A CB    1 
ATOM   1406 N N     . LYS A 1 181 ? 9.582   -7.351  -25.244 1.00 22.72 ? 227 LYS A N     1 
ATOM   1407 C CA    . LYS A 1 181 ? 10.644  -6.740  -26.045 1.00 25.64 ? 227 LYS A CA    1 
ATOM   1408 C C     . LYS A 1 181 ? 10.194  -5.501  -26.838 1.00 23.51 ? 227 LYS A C     1 
ATOM   1409 O O     . LYS A 1 181 ? 10.886  -4.524  -26.868 1.00 23.22 ? 227 LYS A O     1 
ATOM   1410 C CB    . LYS A 1 181 ? 11.396  -7.773  -26.893 1.00 26.70 ? 227 LYS A CB    1 
ATOM   1411 C CG    . LYS A 1 181 ? 11.918  -7.234  -28.297 1.00 31.36 ? 227 LYS A CG    1 
ATOM   1412 C CD    . LYS A 1 181 ? 12.610  -8.403  -29.136 1.00 31.52 ? 227 LYS A CD    1 
ATOM   1413 C CE    . LYS A 1 181 ? 12.205  -8.380  -30.650 1.00 38.63 ? 227 LYS A CE    1 
ATOM   1414 N NZ    . LYS A 1 181 ? 10.726  -8.154  -30.855 1.00 38.06 ? 227 LYS A NZ    1 
ATOM   1415 N N     . GLU A 1 182 ? 8.989   -5.526  -27.388 1.00 23.97 ? 228 GLU A N     1 
ATOM   1416 C CA    . GLU A 1 182 ? 8.371   -4.351  -28.034 1.00 22.38 ? 228 GLU A CA    1 
ATOM   1417 C C     . GLU A 1 182 ? 8.096   -3.208  -27.073 1.00 22.43 ? 228 GLU A C     1 
ATOM   1418 O O     . GLU A 1 182 ? 8.338   -2.041  -27.401 1.00 21.96 ? 228 GLU A O     1 
ATOM   1419 C CB    . GLU A 1 182 ? 7.102   -4.758  -28.792 1.00 22.01 ? 228 GLU A CB    1 
ATOM   1420 C CG    . GLU A 1 182 ? 7.468   -5.560  -30.022 1.00 23.63 ? 228 GLU A CG    1 
ATOM   1421 C CD    . GLU A 1 182 ? 6.316   -6.180  -30.740 1.00 24.55 ? 228 GLU A CD    1 
ATOM   1422 O OE1   . GLU A 1 182 ? 5.270   -6.436  -30.130 1.00 30.15 ? 228 GLU A OE1   1 
ATOM   1423 O OE2   . GLU A 1 182 ? 6.489   -6.510  -31.906 1.00 26.34 ? 228 GLU A OE2   1 
ATOM   1424 N N     . CYS A 1 183 ? 7.687   -3.533  -25.852 1.00 22.13 ? 229 CYS A N     1 
ATOM   1425 C CA    . CYS A 1 183 ? 7.486   -2.481  -24.860 1.00 21.74 ? 229 CYS A CA    1 
ATOM   1426 C C     . CYS A 1 183 ? 8.808   -1.840  -24.494 1.00 21.66 ? 229 CYS A C     1 
ATOM   1427 O O     . CYS A 1 183 ? 8.906   -0.639  -24.446 1.00 21.18 ? 229 CYS A O     1 
ATOM   1428 C CB    . CYS A 1 183 ? 6.743   -2.997  -23.620 1.00 21.69 ? 229 CYS A CB    1 
ATOM   1429 S SG    . CYS A 1 183 ? 5.029   -3.393  -24.010 1.00 20.99 ? 229 CYS A SG    1 
ATOM   1430 N N     . SER A 1 184 ? 9.816   -2.669  -24.276 1.00 22.30 ? 230 SER A N     1 
ATOM   1431 C CA    . SER A 1 184 ? 11.131  -2.226  -23.929 1.00 22.99 ? 230 SER A CA    1 
ATOM   1432 C C     . SER A 1 184 ? 11.745  -1.383  -25.020 1.00 23.47 ? 230 SER A C     1 
ATOM   1433 O O     . SER A 1 184 ? 12.391  -0.380  -24.707 1.00 23.74 ? 230 SER A O     1 
ATOM   1434 C CB    . SER A 1 184 ? 12.068  -3.420  -23.639 1.00 22.89 ? 230 SER A CB    1 
ATOM   1435 O OG    . SER A 1 184 ? 11.866  -3.920  -22.348 1.00 23.50 ? 230 SER A OG    1 
ATOM   1436 N N     . GLN A 1 185 ? 11.569  -1.816  -26.274 1.00 23.46 ? 231 GLN A N     1 
ATOM   1437 C CA    . GLN A 1 185 ? 12.119  -1.152  -27.457 1.00 25.28 ? 231 GLN A CA    1 
ATOM   1438 C C     . GLN A 1 185 ? 11.415  0.180   -27.729 1.00 24.72 ? 231 GLN A C     1 
ATOM   1439 O O     . GLN A 1 185 ? 12.049  1.153   -28.102 1.00 26.17 ? 231 GLN A O     1 
ATOM   1440 C CB    . GLN A 1 185 ? 11.971  -2.072  -28.717 1.00 24.94 ? 231 GLN A CB    1 
ATOM   1441 C CG    . GLN A 1 185 ? 12.618  -1.512  -29.978 1.00 26.95 ? 231 GLN A CG    1 
ATOM   1442 C CD    . GLN A 1 185 ? 12.593  -2.510  -31.160 1.00 29.07 ? 231 GLN A CD    1 
ATOM   1443 O OE1   . GLN A 1 185 ? 13.148  -3.621  -31.070 1.00 32.18 ? 231 GLN A OE1   1 
ATOM   1444 N NE2   . GLN A 1 185 ? 11.931  -2.122  -32.256 1.00 29.41 ? 231 GLN A NE2   1 
ATOM   1445 N N     . ALA A 1 186 ? 10.089  0.202   -27.632 1.00 24.14 ? 232 ALA A N     1 
ATOM   1446 C CA    . ALA A 1 186 ? 9.331   1.466   -27.725 1.00 23.33 ? 232 ALA A CA    1 
ATOM   1447 C C     . ALA A 1 186 ? 9.841   2.397   -26.625 1.00 22.50 ? 232 ALA A C     1 
ATOM   1448 O O     . ALA A 1 186 ? 10.034  3.569   -26.844 1.00 23.62 ? 232 ALA A O     1 
ATOM   1449 C CB    . ALA A 1 186 ? 7.829   1.227   -27.579 1.00 21.39 ? 232 ALA A CB    1 
ATOM   1450 N N     . LEU A 1 187 ? 10.043  1.885   -25.423 1.00 22.28 ? 233 LEU A N     1 
ATOM   1451 C CA    . LEU A 1 187 ? 10.613  2.753   -24.373 1.00 22.09 ? 233 LEU A CA    1 
ATOM   1452 C C     . LEU A 1 187 ? 11.981  3.358   -24.841 1.00 22.79 ? 233 LEU A C     1 
ATOM   1453 O O     . LEU A 1 187 ? 12.201  4.573   -24.760 1.00 22.26 ? 233 LEU A O     1 
ATOM   1454 C CB    . LEU A 1 187 ? 10.750  2.043   -23.027 1.00 18.84 ? 233 LEU A CB    1 
ATOM   1455 C CG    . LEU A 1 187 ? 11.406  2.826   -21.875 1.00 20.68 ? 233 LEU A CG    1 
ATOM   1456 C CD1   . LEU A 1 187 ? 10.796  4.208   -21.656 1.00 20.44 ? 233 LEU A CD1   1 
ATOM   1457 C CD2   . LEU A 1 187 ? 11.413  2.053   -20.551 1.00 19.82 ? 233 LEU A CD2   1 
ATOM   1458 N N     . SER A 1 188 ? 12.859  2.499   -25.363 1.00 23.43 ? 234 SER A N     1 
ATOM   1459 C CA    . SER A 1 188 ? 14.173  2.940   -25.827 1.00 24.55 ? 234 SER A CA    1 
ATOM   1460 C C     . SER A 1 188 ? 14.081  4.026   -26.892 1.00 25.16 ? 234 SER A C     1 
ATOM   1461 O O     . SER A 1 188 ? 14.852  4.987   -26.881 1.00 25.91 ? 234 SER A O     1 
ATOM   1462 C CB    . SER A 1 188 ? 14.993  1.734   -26.349 1.00 22.94 ? 234 SER A CB    1 
ATOM   1463 O OG    . SER A 1 188 ? 15.326  0.924   -25.252 1.00 21.82 ? 234 SER A OG    1 
ATOM   1464 N N     . LEU A 1 189 ? 13.146  3.854   -27.827 1.00 25.20 ? 235 LEU A N     1 
ATOM   1465 C CA    . LEU A 1 189 ? 12.911  4.836   -28.866 1.00 25.48 ? 235 LEU A CA    1 
ATOM   1466 C C     . LEU A 1 189 ? 12.618  6.209   -28.314 1.00 26.41 ? 235 LEU A C     1 
ATOM   1467 O O     . LEU A 1 189 ? 13.216  7.175   -28.738 1.00 27.04 ? 235 LEU A O     1 
ATOM   1468 C CB    . LEU A 1 189 ? 11.758  4.392   -29.792 1.00 25.90 ? 235 LEU A CB    1 
ATOM   1469 C CG    . LEU A 1 189 ? 11.321  5.293   -30.977 1.00 23.92 ? 235 LEU A CG    1 
ATOM   1470 C CD1   . LEU A 1 189 ? 12.489  5.653   -31.838 1.00 23.03 ? 235 LEU A CD1   1 
ATOM   1471 C CD2   . LEU A 1 189 ? 10.263  4.606   -31.834 1.00 24.84 ? 235 LEU A CD2   1 
ATOM   1472 N N     . ILE A 1 190 ? 11.637  6.302   -27.415 1.00 27.15 ? 236 ILE A N     1 
ATOM   1473 C CA    . ILE A 1 190 ? 11.233  7.575   -26.846 1.00 26.26 ? 236 ILE A CA    1 
ATOM   1474 C C     . ILE A 1 190 ? 12.401  8.164   -26.025 1.00 25.74 ? 236 ILE A C     1 
ATOM   1475 O O     . ILE A 1 190 ? 12.661  9.375   -26.104 1.00 25.53 ? 236 ILE A O     1 
ATOM   1476 C CB    . ILE A 1 190 ? 9.924   7.444   -25.953 1.00 26.46 ? 236 ILE A CB    1 
ATOM   1477 C CG1   . ILE A 1 190 ? 8.678   7.229   -26.806 1.00 27.71 ? 236 ILE A CG1   1 
ATOM   1478 C CG2   . ILE A 1 190 ? 9.703   8.675   -25.127 1.00 22.28 ? 236 ILE A CG2   1 
ATOM   1479 C CD1   . ILE A 1 190 ? 8.169   5.867   -26.679 1.00 30.97 ? 236 ILE A CD1   1 
ATOM   1480 N N     . LEU A 1 191 ? 13.053  7.316   -25.218 1.00 25.23 ? 237 LEU A N     1 
ATOM   1481 C CA    . LEU A 1 191 ? 14.194  7.724   -24.377 1.00 25.33 ? 237 LEU A CA    1 
ATOM   1482 C C     . LEU A 1 191 ? 15.328  8.300   -25.264 1.00 26.44 ? 237 LEU A C     1 
ATOM   1483 O O     . LEU A 1 191 ? 15.938  9.339   -24.922 1.00 27.50 ? 237 LEU A O     1 
ATOM   1484 C CB    . LEU A 1 191 ? 14.709  6.566   -23.505 1.00 23.79 ? 237 LEU A CB    1 
ATOM   1485 C CG    . LEU A 1 191 ? 13.840  6.232   -22.272 1.00 24.89 ? 237 LEU A CG    1 
ATOM   1486 C CD1   . LEU A 1 191 ? 14.397  5.123   -21.361 1.00 18.69 ? 237 LEU A CD1   1 
ATOM   1487 C CD2   . LEU A 1 191 ? 13.486  7.459   -21.415 1.00 24.17 ? 237 LEU A CD2   1 
ATOM   1488 N N     . ASP A 1 192 ? 15.590  7.619   -26.380 1.00 25.93 ? 238 ASP A N     1 
ATOM   1489 C CA    . ASP A 1 192 ? 16.532  8.072   -27.412 1.00 27.95 ? 238 ASP A CA    1 
ATOM   1490 C C     . ASP A 1 192 ? 16.176  9.421   -28.065 1.00 27.60 ? 238 ASP A C     1 
ATOM   1491 O O     . ASP A 1 192 ? 17.031  10.299  -28.150 1.00 28.32 ? 238 ASP A O     1 
ATOM   1492 C CB    . ASP A 1 192 ? 16.781  6.973   -28.472 1.00 28.07 ? 238 ASP A CB    1 
ATOM   1493 C CG    . ASP A 1 192 ? 17.529  5.736   -27.899 1.00 30.76 ? 238 ASP A CG    1 
ATOM   1494 O OD1   . ASP A 1 192 ? 18.073  5.775   -26.746 1.00 32.06 ? 238 ASP A OD1   1 
ATOM   1495 O OD2   . ASP A 1 192 ? 17.584  4.721   -28.621 1.00 31.66 ? 238 ASP A OD2   1 
ATOM   1496 N N     . ILE A 1 193 ? 14.934  9.600   -28.514 1.00 27.17 ? 239 ILE A N     1 
ATOM   1497 C CA    . ILE A 1 193 ? 14.476  10.909  -28.975 1.00 25.83 ? 239 ILE A CA    1 
ATOM   1498 C C     . ILE A 1 193 ? 14.546  11.942  -27.825 1.00 27.09 ? 239 ILE A C     1 
ATOM   1499 O O     . ILE A 1 193 ? 14.981  13.109  -28.031 1.00 27.15 ? 239 ILE A O     1 
ATOM   1500 C CB    . ILE A 1 193 ? 13.027  10.810  -29.609 1.00 27.66 ? 239 ILE A CB    1 
ATOM   1501 C CG1   . ILE A 1 193 ? 12.982  9.720   -30.717 1.00 25.32 ? 239 ILE A CG1   1 
ATOM   1502 C CG2   . ILE A 1 193 ? 12.480  12.189  -30.071 1.00 23.52 ? 239 ILE A CG2   1 
ATOM   1503 C CD1   . ILE A 1 193 ? 11.561  9.376   -31.253 1.00 23.69 ? 239 ILE A CD1   1 
ATOM   1504 N N     . ASP A 1 194 ? 14.170  11.532  -26.605 1.00 26.62 ? 240 ASP A N     1 
ATOM   1505 C CA    . ASP A 1 194 ? 14.283  12.444  -25.486 1.00 26.87 ? 240 ASP A CA    1 
ATOM   1506 C C     . ASP A 1 194 ? 15.707  13.078  -25.431 1.00 28.27 ? 240 ASP A C     1 
ATOM   1507 O O     . ASP A 1 194 ? 15.880  14.238  -25.044 1.00 27.76 ? 240 ASP A O     1 
ATOM   1508 C CB    . ASP A 1 194 ? 13.918  11.752  -24.176 1.00 26.48 ? 240 ASP A CB    1 
ATOM   1509 C CG    . ASP A 1 194 ? 14.104  12.651  -22.971 1.00 26.96 ? 240 ASP A CG    1 
ATOM   1510 O OD1   . ASP A 1 194 ? 13.487  13.740  -22.961 1.00 26.86 ? 240 ASP A OD1   1 
ATOM   1511 O OD2   . ASP A 1 194 ? 14.859  12.290  -22.033 1.00 23.46 ? 240 ASP A OD2   1 
ATOM   1512 N N     . HIS A 1 195 ? 16.705  12.318  -25.880 1.00 29.52 ? 241 HIS A N     1 
ATOM   1513 C CA    . HIS A 1 195 ? 18.123  12.690  -25.703 1.00 31.04 ? 241 HIS A CA    1 
ATOM   1514 C C     . HIS A 1 195 ? 18.850  13.030  -26.999 1.00 31.99 ? 241 HIS A C     1 
ATOM   1515 O O     . HIS A 1 195 ? 20.044  12.837  -27.127 1.00 34.37 ? 241 HIS A O     1 
ATOM   1516 C CB    . HIS A 1 195 ? 18.866  11.631  -24.831 1.00 29.47 ? 241 HIS A CB    1 
ATOM   1517 C CG    . HIS A 1 195 ? 18.775  11.907  -23.354 1.00 26.03 ? 241 HIS A CG    1 
ATOM   1518 N ND1   . HIS A 1 195 ? 19.424  11.147  -22.396 1.00 23.15 ? 241 HIS A ND1   1 
ATOM   1519 C CD2   . HIS A 1 195 ? 18.146  12.897  -22.681 1.00 23.79 ? 241 HIS A CD2   1 
ATOM   1520 C CE1   . HIS A 1 195 ? 19.186  11.653  -21.198 1.00 22.77 ? 241 HIS A CE1   1 
ATOM   1521 N NE2   . HIS A 1 195 ? 18.402  12.709  -21.342 1.00 22.28 ? 241 HIS A NE2   1 
ATOM   1522 N N     . GLY A 1 196 ? 18.104  13.526  -27.959 1.00 33.62 ? 242 GLY A N     1 
ATOM   1523 C CA    . GLY A 1 196 ? 18.671  14.071  -29.166 1.00 35.00 ? 242 GLY A CA    1 
ATOM   1524 C C     . GLY A 1 196 ? 18.809  13.130  -30.357 1.00 36.00 ? 242 GLY A C     1 
ATOM   1525 O O     . GLY A 1 196 ? 19.323  13.533  -31.384 1.00 35.88 ? 242 GLY A O     1 
ATOM   1526 N N     . LYS A 1 197 ? 18.408  11.869  -30.234 1.00 37.46 ? 243 LYS A N     1 
ATOM   1527 C CA    . LYS A 1 197 ? 18.598  10.946  -31.341 1.00 38.77 ? 243 LYS A CA    1 
ATOM   1528 C C     . LYS A 1 197 ? 17.775  11.439  -32.529 1.00 40.09 ? 243 LYS A C     1 
ATOM   1529 O O     . LYS A 1 197 ? 16.564  11.645  -32.387 1.00 40.13 ? 243 LYS A O     1 
ATOM   1530 C CB    . LYS A 1 197 ? 18.177  9.540   -30.955 1.00 39.19 ? 243 LYS A CB    1 
ATOM   1531 C CG    . LYS A 1 197 ? 18.596  8.458   -31.960 1.00 40.72 ? 243 LYS A CG    1 
ATOM   1532 C CD    . LYS A 1 197 ? 17.598  7.300   -31.986 1.00 41.84 ? 243 LYS A CD    1 
ATOM   1533 C CE    . LYS A 1 197 ? 17.892  6.329   -33.186 1.00 43.36 ? 243 LYS A CE    1 
ATOM   1534 N NZ    . LYS A 1 197 ? 19.070  5.437   -32.945 1.00 45.11 ? 243 LYS A NZ    1 
ATOM   1535 N N     . PRO A 1 198 ? 18.418  11.636  -33.708 1.00 40.89 ? 244 PRO A N     1 
ATOM   1536 C CA    . PRO A 1 198 ? 17.627  12.148  -34.824 1.00 41.50 ? 244 PRO A CA    1 
ATOM   1537 C C     . PRO A 1 198 ? 16.835  10.965  -35.344 1.00 41.89 ? 244 PRO A C     1 
ATOM   1538 O O     . PRO A 1 198 ? 17.332  9.816   -35.366 1.00 42.73 ? 244 PRO A O     1 
ATOM   1539 C CB    . PRO A 1 198 ? 18.677  12.559  -35.842 1.00 41.42 ? 244 PRO A CB    1 
ATOM   1540 C CG    . PRO A 1 198 ? 19.779  11.548  -35.640 1.00 41.69 ? 244 PRO A CG    1 
ATOM   1541 C CD    . PRO A 1 198 ? 19.802  11.328  -34.120 1.00 41.40 ? 244 PRO A CD    1 
ATOM   1542 N N     . VAL A 1 199 ? 15.600  11.203  -35.729 1.00 41.71 ? 245 VAL A N     1 
ATOM   1543 C CA    . VAL A 1 199 ? 14.753  10.054  -36.033 1.00 41.09 ? 245 VAL A CA    1 
ATOM   1544 C C     . VAL A 1 199 ? 13.887  10.437  -37.184 1.00 40.54 ? 245 VAL A C     1 
ATOM   1545 O O     . VAL A 1 199 ? 13.369  11.558  -37.225 1.00 41.98 ? 245 VAL A O     1 
ATOM   1546 C CB    . VAL A 1 199 ? 13.954  9.615   -34.760 1.00 41.22 ? 245 VAL A CB    1 
ATOM   1547 C CG1   . VAL A 1 199 ? 12.480  9.447   -35.018 1.00 40.60 ? 245 VAL A CG1   1 
ATOM   1548 C CG2   . VAL A 1 199 ? 14.621  8.389   -34.093 1.00 40.70 ? 245 VAL A CG2   1 
ATOM   1549 N N     . LYS A 1 200 ? 13.747  9.542   -38.140 1.00 38.96 ? 246 LYS A N     1 
ATOM   1550 C CA    . LYS A 1 200 ? 12.839  9.820   -39.236 1.00 38.35 ? 246 LYS A CA    1 
ATOM   1551 C C     . LYS A 1 200 ? 11.587  8.950   -39.091 1.00 36.76 ? 246 LYS A C     1 
ATOM   1552 O O     . LYS A 1 200 ? 11.627  7.745   -39.363 1.00 37.80 ? 246 LYS A O     1 
ATOM   1553 C CB    . LYS A 1 200 ? 13.551  9.559   -40.568 1.00 38.87 ? 246 LYS A CB    1 
ATOM   1554 C CG    . LYS A 1 200 ? 13.052  10.365  -41.706 1.00 41.77 ? 246 LYS A CG    1 
ATOM   1555 C CD    . LYS A 1 200 ? 13.867  10.050  -42.953 1.00 48.24 ? 246 LYS A CD    1 
ATOM   1556 C CE    . LYS A 1 200 ? 12.965  10.036  -44.196 1.00 51.34 ? 246 LYS A CE    1 
ATOM   1557 N NZ    . LYS A 1 200 ? 12.114  11.301  -44.249 1.00 54.86 ? 246 LYS A NZ    1 
ATOM   1558 N N     . ASN A 1 201 ? 10.482  9.564   -38.671 1.00 34.37 ? 247 ASN A N     1 
ATOM   1559 C CA    . ASN A 1 201 ? 9.194   8.906   -38.619 1.00 32.11 ? 247 ASN A CA    1 
ATOM   1560 C C     . ASN A 1 201 ? 8.908   8.246   -39.964 1.00 32.21 ? 247 ASN A C     1 
ATOM   1561 O O     . ASN A 1 201 ? 8.893   8.961   -40.973 1.00 32.46 ? 247 ASN A O     1 
ATOM   1562 C CB    . ASN A 1 201 ? 8.095   9.942   -38.250 1.00 30.29 ? 247 ASN A CB    1 
ATOM   1563 C CG    . ASN A 1 201 ? 6.774   9.284   -37.793 1.00 28.47 ? 247 ASN A CG    1 
ATOM   1564 O OD1   . ASN A 1 201 ? 6.584   8.077   -37.929 1.00 25.09 ? 247 ASN A OD1   1 
ATOM   1565 N ND2   . ASN A 1 201 ? 5.870   10.078  -37.245 1.00 25.29 ? 247 ASN A ND2   1 
ATOM   1566 N N     . ALA A 1 202 ? 8.654   6.927   -40.006 1.00 31.45 ? 248 ALA A N     1 
ATOM   1567 C CA    . ALA A 1 202 ? 8.266   6.259   -41.311 1.00 32.44 ? 248 ALA A CA    1 
ATOM   1568 C C     . ALA A 1 202 ? 6.925   6.755   -41.849 1.00 33.12 ? 248 ALA A C     1 
ATOM   1569 O O     . ALA A 1 202 ? 6.634   6.642   -43.060 1.00 33.46 ? 248 ALA A O     1 
ATOM   1570 C CB    . ALA A 1 202 ? 8.278   4.682   -41.225 1.00 31.86 ? 248 ALA A CB    1 
ATOM   1571 N N     . LEU A 1 203 ? 6.114   7.311   -40.940 1.00 33.24 ? 249 LEU A N     1 
ATOM   1572 C CA    . LEU A 1 203 ? 4.850   8.002   -41.300 1.00 33.49 ? 249 LEU A CA    1 
ATOM   1573 C C     . LEU A 1 203 ? 5.078   9.499   -41.461 1.00 34.91 ? 249 LEU A C     1 
ATOM   1574 O O     . LEU A 1 203 ? 5.740   10.127  -40.649 1.00 34.57 ? 249 LEU A O     1 
ATOM   1575 C CB    . LEU A 1 203 ? 3.760   7.751   -40.250 1.00 32.20 ? 249 LEU A CB    1 
ATOM   1576 C CG    . LEU A 1 203 ? 3.554   6.320   -39.752 1.00 30.83 ? 249 LEU A CG    1 
ATOM   1577 C CD1   . LEU A 1 203 ? 2.366   6.296   -38.822 1.00 30.31 ? 249 LEU A CD1   1 
ATOM   1578 C CD2   . LEU A 1 203 ? 3.434   5.276   -40.936 1.00 25.11 ? 249 LEU A CD2   1 
ATOM   1579 N N     . ASP A 1 204 ? 4.560   10.065  -42.542 1.00 37.19 ? 250 ASP A N     1 
ATOM   1580 C CA    . ASP A 1 204 ? 4.771   11.474  -42.811 1.00 39.68 ? 250 ASP A CA    1 
ATOM   1581 C C     . ASP A 1 204 ? 3.667   12.283  -42.144 1.00 39.29 ? 250 ASP A C     1 
ATOM   1582 O O     . ASP A 1 204 ? 2.604   12.469  -42.709 1.00 40.94 ? 250 ASP A O     1 
ATOM   1583 C CB    . ASP A 1 204 ? 4.820   11.749  -44.326 1.00 40.77 ? 250 ASP A CB    1 
ATOM   1584 C CG    . ASP A 1 204 ? 5.024   13.246  -44.650 1.00 46.15 ? 250 ASP A CG    1 
ATOM   1585 O OD1   . ASP A 1 204 ? 5.519   13.982  -43.746 1.00 50.03 ? 250 ASP A OD1   1 
ATOM   1586 O OD2   . ASP A 1 204 ? 4.688   13.692  -45.804 1.00 51.97 ? 250 ASP A OD2   1 
ATOM   1587 N N     . LEU A 1 205 ? 3.930   12.782  -40.949 1.00 39.49 ? 251 LEU A N     1 
ATOM   1588 C CA    . LEU A 1 205 ? 2.885   13.427  -40.144 1.00 38.88 ? 251 LEU A CA    1 
ATOM   1589 C C     . LEU A 1 205 ? 3.356   14.802  -39.758 1.00 38.64 ? 251 LEU A C     1 
ATOM   1590 O O     . LEU A 1 205 ? 4.564   15.042  -39.700 1.00 38.98 ? 251 LEU A O     1 
ATOM   1591 C CB    . LEU A 1 205 ? 2.511   12.559  -38.915 1.00 38.30 ? 251 LEU A CB    1 
ATOM   1592 C CG    . LEU A 1 205 ? 1.810   11.245  -39.323 1.00 39.95 ? 251 LEU A CG    1 
ATOM   1593 C CD1   . LEU A 1 205 ? 1.371   10.431  -38.132 1.00 38.73 ? 251 LEU A CD1   1 
ATOM   1594 C CD2   . LEU A 1 205 ? 0.590   11.528  -40.233 1.00 41.63 ? 251 LEU A CD2   1 
ATOM   1595 N N     . LYS A 1 206 ? 2.429   15.711  -39.497 1.00 38.34 ? 252 LYS A N     1 
ATOM   1596 C CA    . LYS A 1 206 ? 2.801   17.083  -39.207 1.00 38.58 ? 252 LYS A CA    1 
ATOM   1597 C C     . LYS A 1 206 ? 3.559   17.269  -37.880 1.00 37.66 ? 252 LYS A C     1 
ATOM   1598 O O     . LYS A 1 206 ? 4.311   18.256  -37.697 1.00 39.60 ? 252 LYS A O     1 
ATOM   1599 C CB    . LYS A 1 206 ? 1.571   18.001  -39.290 1.00 39.15 ? 252 LYS A CB    1 
ATOM   1600 C CG    . LYS A 1 206 ? 1.831   19.283  -40.063 1.00 43.74 ? 252 LYS A CG    1 
ATOM   1601 C CD    . LYS A 1 206 ? 2.226   19.037  -41.553 1.00 48.15 ? 252 LYS A CD    1 
ATOM   1602 C CE    . LYS A 1 206 ? 1.050   18.513  -42.405 1.00 51.10 ? 252 LYS A CE    1 
ATOM   1603 N NZ    . LYS A 1 206 ? 0.017   19.559  -42.732 1.00 50.36 ? 252 LYS A NZ    1 
ATOM   1604 N N     . PHE A 1 207 ? 3.432   16.329  -36.966 1.00 35.84 ? 253 PHE A N     1 
ATOM   1605 C CA    . PHE A 1 207 ? 4.012   16.522  -35.627 1.00 34.18 ? 253 PHE A CA    1 
ATOM   1606 C C     . PHE A 1 207 ? 5.539   16.360  -35.726 1.00 34.55 ? 253 PHE A C     1 
ATOM   1607 O O     . PHE A 1 207 ? 6.024   15.370  -36.243 1.00 34.03 ? 253 PHE A O     1 
ATOM   1608 C CB    . PHE A 1 207 ? 3.409   15.500  -34.671 1.00 32.76 ? 253 PHE A CB    1 
ATOM   1609 C CG    . PHE A 1 207 ? 3.858   15.628  -33.245 1.00 30.94 ? 253 PHE A CG    1 
ATOM   1610 C CD1   . PHE A 1 207 ? 3.113   16.349  -32.344 1.00 24.29 ? 253 PHE A CD1   1 
ATOM   1611 C CD2   . PHE A 1 207 ? 5.001   14.968  -32.798 1.00 27.92 ? 253 PHE A CD2   1 
ATOM   1612 C CE1   . PHE A 1 207 ? 3.513   16.416  -31.021 1.00 28.62 ? 253 PHE A CE1   1 
ATOM   1613 C CE2   . PHE A 1 207 ? 5.414   15.051  -31.483 1.00 27.80 ? 253 PHE A CE2   1 
ATOM   1614 C CZ    . PHE A 1 207 ? 4.663   15.752  -30.586 1.00 27.32 ? 253 PHE A CZ    1 
ATOM   1615 N N     . ASP A 1 208 ? 6.302   17.341  -35.260 1.00 34.02 ? 254 ASP A N     1 
ATOM   1616 C CA    . ASP A 1 208 ? 7.748   17.215  -35.369 1.00 33.89 ? 254 ASP A CA    1 
ATOM   1617 C C     . ASP A 1 208 ? 8.268   16.488  -34.149 1.00 32.92 ? 254 ASP A C     1 
ATOM   1618 O O     . ASP A 1 208 ? 8.222   17.006  -33.041 1.00 31.54 ? 254 ASP A O     1 
ATOM   1619 C CB    . ASP A 1 208 ? 8.419   18.603  -35.559 1.00 34.20 ? 254 ASP A CB    1 
ATOM   1620 C CG    . ASP A 1 208 ? 9.956   18.529  -35.645 1.00 36.44 ? 254 ASP A CG    1 
ATOM   1621 O OD1   . ASP A 1 208 ? 10.539  17.430  -35.842 1.00 34.31 ? 254 ASP A OD1   1 
ATOM   1622 O OD2   . ASP A 1 208 ? 10.597  19.615  -35.540 1.00 41.44 ? 254 ASP A OD2   1 
ATOM   1623 N N     . MET A 1 209 ? 8.784   15.282  -34.373 1.00 33.38 ? 255 MET A N     1 
ATOM   1624 C CA    . MET A 1 209 ? 9.294   14.449  -33.299 1.00 34.16 ? 255 MET A CA    1 
ATOM   1625 C C     . MET A 1 209 ? 10.411  15.081  -32.492 1.00 35.73 ? 255 MET A C     1 
ATOM   1626 O O     . MET A 1 209 ? 10.679  14.642  -31.399 1.00 36.31 ? 255 MET A O     1 
ATOM   1627 C CB    . MET A 1 209 ? 9.715   13.096  -33.849 1.00 34.61 ? 255 MET A CB    1 
ATOM   1628 C CG    . MET A 1 209 ? 8.542   12.219  -34.275 1.00 33.17 ? 255 MET A CG    1 
ATOM   1629 S SD    . MET A 1 209 ? 7.428   11.862  -32.876 1.00 33.40 ? 255 MET A SD    1 
ATOM   1630 C CE    . MET A 1 209 ? 5.902   11.474  -33.757 1.00 32.32 ? 255 MET A CE    1 
ATOM   1631 N N     . GLU A 1 210 ? 11.044  16.136  -33.014 1.00 37.18 ? 256 GLU A N     1 
ATOM   1632 C CA    . GLU A 1 210 ? 11.981  16.951  -32.228 1.00 38.97 ? 256 GLU A CA    1 
ATOM   1633 C C     . GLU A 1 210 ? 11.389  17.566  -30.971 1.00 37.08 ? 256 GLU A C     1 
ATOM   1634 O O     . GLU A 1 210 ? 12.116  17.864  -30.012 1.00 36.46 ? 256 GLU A O     1 
ATOM   1635 C CB    . GLU A 1 210 ? 12.631  18.051  -33.098 1.00 39.64 ? 256 GLU A CB    1 
ATOM   1636 C CG    . GLU A 1 210 ? 13.778  17.521  -34.042 1.00 44.14 ? 256 GLU A CG    1 
ATOM   1637 C CD    . GLU A 1 210 ? 14.954  18.549  -34.262 1.00 44.24 ? 256 GLU A CD    1 
ATOM   1638 O OE1   . GLU A 1 210 ? 14.705  19.776  -34.483 1.00 49.18 ? 256 GLU A OE1   1 
ATOM   1639 O OE2   . GLU A 1 210 ? 16.125  18.100  -34.206 1.00 49.25 ? 256 GLU A OE2   1 
ATOM   1640 N N     . GLN A 1 211 ? 10.067  17.751  -30.953 1.00 37.24 ? 257 GLN A N     1 
ATOM   1641 C CA    . GLN A 1 211 ? 9.380   18.331  -29.759 1.00 36.28 ? 257 GLN A CA    1 
ATOM   1642 C C     . GLN A 1 211 ? 9.586   17.454  -28.531 1.00 35.32 ? 257 GLN A C     1 
ATOM   1643 O O     . GLN A 1 211 ? 9.602   17.951  -27.397 1.00 34.82 ? 257 GLN A O     1 
ATOM   1644 C CB    . GLN A 1 211 ? 7.892   18.526  -29.985 1.00 36.02 ? 257 GLN A CB    1 
ATOM   1645 C CG    . GLN A 1 211 ? 7.560   19.338  -31.233 1.00 38.12 ? 257 GLN A CG    1 
ATOM   1646 C CD    . GLN A 1 211 ? 6.068   19.429  -31.451 1.00 35.68 ? 257 GLN A CD    1 
ATOM   1647 O OE1   . GLN A 1 211 ? 5.382   20.173  -30.763 1.00 33.84 ? 257 GLN A OE1   1 
ATOM   1648 N NE2   . GLN A 1 211 ? 5.563   18.668  -32.394 1.00 36.74 ? 257 GLN A NE2   1 
ATOM   1649 N N     . LEU A 1 212 ? 9.779   16.159  -28.777 1.00 34.13 ? 258 LEU A N     1 
ATOM   1650 C CA    . LEU A 1 212 ? 9.966   15.192  -27.700 1.00 34.15 ? 258 LEU A CA    1 
ATOM   1651 C C     . LEU A 1 212 ? 11.352  15.253  -27.046 1.00 34.15 ? 258 LEU A C     1 
ATOM   1652 O O     . LEU A 1 212 ? 11.577  14.625  -26.000 1.00 32.58 ? 258 LEU A O     1 
ATOM   1653 C CB    . LEU A 1 212 ? 9.664   13.777  -28.210 1.00 34.01 ? 258 LEU A CB    1 
ATOM   1654 C CG    . LEU A 1 212 ? 8.219   13.525  -28.657 1.00 35.20 ? 258 LEU A CG    1 
ATOM   1655 C CD1   . LEU A 1 212 ? 8.085   12.104  -29.247 1.00 33.52 ? 258 LEU A CD1   1 
ATOM   1656 C CD2   . LEU A 1 212 ? 7.253   13.752  -27.472 1.00 34.38 ? 258 LEU A CD2   1 
ATOM   1657 N N     . LYS A 1 213 ? 12.281  15.997  -27.667 1.00 34.36 ? 259 LYS A N     1 
ATOM   1658 C CA    . LYS A 1 213 ? 13.627  16.167  -27.109 1.00 35.09 ? 259 LYS A CA    1 
ATOM   1659 C C     . LYS A 1 213 ? 13.469  16.808  -25.744 1.00 34.42 ? 259 LYS A C     1 
ATOM   1660 O O     . LYS A 1 213 ? 12.776  17.811  -25.604 1.00 34.47 ? 259 LYS A O     1 
ATOM   1661 C CB    . LYS A 1 213 ? 14.443  17.029  -28.053 1.00 35.15 ? 259 LYS A CB    1 
ATOM   1662 C CG    . LYS A 1 213 ? 15.958  16.929  -27.999 1.00 37.08 ? 259 LYS A CG    1 
ATOM   1663 C CD    . LYS A 1 213 ? 16.573  17.451  -29.345 1.00 38.47 ? 259 LYS A CD    1 
ATOM   1664 C CE    . LYS A 1 213 ? 16.161  16.499  -30.545 1.00 43.27 ? 259 LYS A CE    1 
ATOM   1665 N NZ    . LYS A 1 213 ? 16.795  16.728  -31.892 1.00 39.83 ? 259 LYS A NZ    1 
ATOM   1666 N N     . ASP A 1 214 ? 14.091  16.219  -24.731 1.00 34.55 ? 260 ASP A N     1 
ATOM   1667 C CA    . ASP A 1 214 ? 14.057  16.750  -23.375 1.00 34.81 ? 260 ASP A CA    1 
ATOM   1668 C C     . ASP A 1 214 ? 12.636  16.967  -22.816 1.00 34.59 ? 260 ASP A C     1 
ATOM   1669 O O     . ASP A 1 214 ? 12.400  17.954  -22.122 1.00 35.83 ? 260 ASP A O     1 
ATOM   1670 C CB    . ASP A 1 214 ? 14.853  18.064  -23.269 1.00 35.71 ? 260 ASP A CB    1 
ATOM   1671 C CG    . ASP A 1 214 ? 16.269  17.956  -23.843 1.00 36.81 ? 260 ASP A CG    1 
ATOM   1672 O OD1   . ASP A 1 214 ? 17.111  17.188  -23.309 1.00 38.54 ? 260 ASP A OD1   1 
ATOM   1673 O OD2   . ASP A 1 214 ? 16.541  18.660  -24.834 1.00 39.71 ? 260 ASP A OD2   1 
ATOM   1674 N N     . SER A 1 215 ? 11.722  16.032  -23.089 1.00 32.86 ? 261 SER A N     1 
ATOM   1675 C CA    . SER A 1 215 ? 10.318  16.123  -22.638 1.00 31.66 ? 261 SER A CA    1 
ATOM   1676 C C     . SER A 1 215 ? 9.920   15.056  -21.640 1.00 29.98 ? 261 SER A C     1 
ATOM   1677 O O     . SER A 1 215 ? 8.829   15.101  -21.121 1.00 29.42 ? 261 SER A O     1 
ATOM   1678 C CB    . SER A 1 215 ? 9.344   16.044  -23.815 1.00 31.75 ? 261 SER A CB    1 
ATOM   1679 O OG    . SER A 1 215 ? 9.423   14.765  -24.454 1.00 32.39 ? 261 SER A OG    1 
ATOM   1680 N N     . ILE A 1 216 ? 10.805  14.088  -21.409 1.00 29.28 ? 262 ILE A N     1 
ATOM   1681 C CA    . ILE A 1 216 ? 10.525  12.919  -20.558 1.00 28.53 ? 262 ILE A CA    1 
ATOM   1682 C C     . ILE A 1 216 ? 11.153  13.030  -19.176 1.00 27.99 ? 262 ILE A C     1 
ATOM   1683 O O     . ILE A 1 216 ? 12.349  13.338  -19.034 1.00 27.82 ? 262 ILE A O     1 
ATOM   1684 C CB    . ILE A 1 216 ? 11.008  11.581  -21.215 1.00 27.55 ? 262 ILE A CB    1 
ATOM   1685 C CG1   . ILE A 1 216 ? 10.474  11.428  -22.660 1.00 27.96 ? 262 ILE A CG1   1 
ATOM   1686 C CG2   . ILE A 1 216 ? 10.680  10.359  -20.323 1.00 24.85 ? 262 ILE A CG2   1 
ATOM   1687 C CD1   . ILE A 1 216 ? 8.970   11.417  -22.850 1.00 25.83 ? 262 ILE A CD1   1 
ATOM   1688 N N     . ASP A 1 217 ? 10.343  12.783  -18.160 1.00 26.35 ? 263 ASP A N     1 
ATOM   1689 C CA    . ASP A 1 217 ? 10.915  12.528  -16.871 1.00 26.63 ? 263 ASP A CA    1 
ATOM   1690 C C     . ASP A 1 217 ? 11.318  11.046  -16.823 1.00 27.28 ? 263 ASP A C     1 
ATOM   1691 O O     . ASP A 1 217 ? 10.465  10.126  -16.634 1.00 27.28 ? 263 ASP A O     1 
ATOM   1692 C CB    . ASP A 1 217 ? 9.940   12.871  -15.765 1.00 26.25 ? 263 ASP A CB    1 
ATOM   1693 C CG    . ASP A 1 217 ? 10.575  12.778  -14.439 1.00 30.68 ? 263 ASP A CG    1 
ATOM   1694 O OD1   . ASP A 1 217 ? 11.585  12.028  -14.338 1.00 33.98 ? 263 ASP A OD1   1 
ATOM   1695 O OD2   . ASP A 1 217 ? 10.102  13.438  -13.487 1.00 34.06 ? 263 ASP A OD2   1 
ATOM   1696 N N     . ARG A 1 218 ? 12.619  10.819  -17.000 1.00 26.64 ? 264 ARG A N     1 
ATOM   1697 C CA    . ARG A 1 218 ? 13.167  9.495   -17.271 1.00 26.22 ? 264 ARG A CA    1 
ATOM   1698 C C     . ARG A 1 218 ? 13.120  8.546   -16.106 1.00 26.09 ? 264 ARG A C     1 
ATOM   1699 O O     . ARG A 1 218 ? 13.355  7.336   -16.284 1.00 25.92 ? 264 ARG A O     1 
ATOM   1700 C CB    . ARG A 1 218 ? 14.615  9.631   -17.774 1.00 25.71 ? 264 ARG A CB    1 
ATOM   1701 C CG    . ARG A 1 218 ? 14.693  10.447  -19.056 1.00 25.19 ? 264 ARG A CG    1 
ATOM   1702 C CD    . ARG A 1 218 ? 16.110  10.792  -19.416 1.00 24.82 ? 264 ARG A CD    1 
ATOM   1703 N NE    . ARG A 1 218 ? 16.827  9.615   -19.880 1.00 26.24 ? 264 ARG A NE    1 
ATOM   1704 C CZ    . ARG A 1 218 ? 16.873  9.217   -21.138 1.00 26.18 ? 264 ARG A CZ    1 
ATOM   1705 N NH1   . ARG A 1 218 ? 16.246  9.891   -22.103 1.00 25.86 ? 264 ARG A NH1   1 
ATOM   1706 N NH2   . ARG A 1 218 ? 17.561  8.120   -21.432 1.00 30.96 ? 264 ARG A NH2   1 
ATOM   1707 N N     . GLU A 1 219 ? 12.895  9.079   -14.903 1.00 25.69 ? 265 GLU A N     1 
ATOM   1708 C CA    . GLU A 1 219 ? 12.794  8.212   -13.729 1.00 26.75 ? 265 GLU A CA    1 
ATOM   1709 C C     . GLU A 1 219 ? 11.370  7.751   -13.522 1.00 25.41 ? 265 GLU A C     1 
ATOM   1710 O O     . GLU A 1 219 ? 11.132  6.916   -12.674 1.00 26.23 ? 265 GLU A O     1 
ATOM   1711 C CB    . GLU A 1 219 ? 13.266  8.919   -12.459 1.00 26.15 ? 265 GLU A CB    1 
ATOM   1712 C CG    . GLU A 1 219 ? 14.755  9.308   -12.481 1.00 29.63 ? 265 GLU A CG    1 
ATOM   1713 C CD    . GLU A 1 219 ? 15.178  10.074  -11.223 1.00 32.33 ? 265 GLU A CD    1 
ATOM   1714 O OE1   . GLU A 1 219 ? 14.321  10.749  -10.559 1.00 36.44 ? 265 GLU A OE1   1 
ATOM   1715 O OE2   . GLU A 1 219 ? 16.386  9.963   -10.879 1.00 41.22 ? 265 GLU A OE2   1 
ATOM   1716 N N     . LYS A 1 220 ? 10.431  8.325   -14.286 1.00 24.47 ? 266 LYS A N     1 
ATOM   1717 C CA    . LYS A 1 220 ? 9.008   8.131   -14.039 1.00 23.53 ? 266 LYS A CA    1 
ATOM   1718 C C     . LYS A 1 220 ? 8.320   7.364   -15.165 1.00 22.39 ? 266 LYS A C     1 
ATOM   1719 O O     . LYS A 1 220 ? 7.561   7.921   -15.950 1.00 21.31 ? 266 LYS A O     1 
ATOM   1720 C CB    . LYS A 1 220 ? 8.294   9.427   -13.641 1.00 23.44 ? 266 LYS A CB    1 
ATOM   1721 C CG    . LYS A 1 220 ? 8.799   9.988   -12.291 1.00 23.60 ? 266 LYS A CG    1 
ATOM   1722 C CD    . LYS A 1 220 ? 8.025   11.255  -11.976 1.00 30.32 ? 266 LYS A CD    1 
ATOM   1723 C CE    . LYS A 1 220 ? 8.603   12.022  -10.761 1.00 33.08 ? 266 LYS A CE    1 
ATOM   1724 N NZ    . LYS A 1 220 ? 9.919   12.647  -11.060 1.00 34.27 ? 266 LYS A NZ    1 
ATOM   1725 N N     . ILE A 1 221 ? 8.576   6.051   -15.167 1.00 20.75 ? 267 ILE A N     1 
ATOM   1726 C CA    . ILE A 1 221 ? 8.217   5.227   -16.290 1.00 21.12 ? 267 ILE A CA    1 
ATOM   1727 C C     . ILE A 1 221 ? 7.382   4.090   -15.801 1.00 20.67 ? 267 ILE A C     1 
ATOM   1728 O O     . ILE A 1 221 ? 7.751   3.415   -14.849 1.00 20.27 ? 267 ILE A O     1 
ATOM   1729 C CB    . ILE A 1 221 ? 9.448   4.788   -17.143 1.00 21.87 ? 267 ILE A CB    1 
ATOM   1730 C CG1   . ILE A 1 221 ? 10.187  6.033   -17.667 1.00 23.60 ? 267 ILE A CG1   1 
ATOM   1731 C CG2   . ILE A 1 221 ? 8.962   3.935   -18.339 1.00 21.64 ? 267 ILE A CG2   1 
ATOM   1732 C CD1   . ILE A 1 221 ? 11.455  5.727   -18.370 1.00 27.70 ? 267 ILE A CD1   1 
ATOM   1733 N N     . ALA A 1 222 ? 6.198   3.945   -16.406 1.00 21.00 ? 268 ALA A N     1 
ATOM   1734 C CA    . ALA A 1 222 ? 5.313   2.850   -16.079 1.00 21.33 ? 268 ALA A CA    1 
ATOM   1735 C C     . ALA A 1 222 ? 4.900   2.094   -17.314 1.00 20.91 ? 268 ALA A C     1 
ATOM   1736 O O     . ALA A 1 222 ? 4.808   2.675   -18.412 1.00 22.53 ? 268 ALA A O     1 
ATOM   1737 C CB    . ALA A 1 222 ? 4.065   3.397   -15.323 1.00 21.27 ? 268 ALA A CB    1 
ATOM   1738 N N     . VAL A 1 223 ? 4.583   0.816   -17.130 1.00 21.16 ? 269 VAL A N     1 
ATOM   1739 C CA    . VAL A 1 223 ? 3.967   0.016   -18.167 1.00 19.99 ? 269 VAL A CA    1 
ATOM   1740 C C     . VAL A 1 223 ? 2.537   -0.383  -17.725 1.00 21.57 ? 269 VAL A C     1 
ATOM   1741 O O     . VAL A 1 223 ? 2.290   -0.715  -16.541 1.00 23.06 ? 269 VAL A O     1 
ATOM   1742 C CB    . VAL A 1 223 ? 4.865   -1.189  -18.571 1.00 20.12 ? 269 VAL A CB    1 
ATOM   1743 C CG1   . VAL A 1 223 ? 5.076   -2.198  -17.426 1.00 18.72 ? 269 VAL A CG1   1 
ATOM   1744 C CG2   . VAL A 1 223 ? 4.364   -1.896  -19.904 1.00 17.39 ? 269 VAL A CG2   1 
ATOM   1745 N N     . ILE A 1 224 ? 1.599   -0.317  -18.670 1.00 21.30 ? 270 ILE A N     1 
ATOM   1746 C CA    . ILE A 1 224 ? 0.161   -0.544  -18.426 1.00 20.99 ? 270 ILE A CA    1 
ATOM   1747 C C     . ILE A 1 224 ? -0.325  -1.349  -19.643 1.00 20.86 ? 270 ILE A C     1 
ATOM   1748 O O     . ILE A 1 224 ? 0.308   -1.325  -20.684 1.00 21.45 ? 270 ILE A O     1 
ATOM   1749 C CB    . ILE A 1 224 ? -0.678  0.767   -18.234 1.00 20.54 ? 270 ILE A CB    1 
ATOM   1750 C CG1   . ILE A 1 224 ? -0.118  1.621   -17.100 1.00 20.23 ? 270 ILE A CG1   1 
ATOM   1751 C CG2   . ILE A 1 224 ? -2.208  0.445   -17.907 1.00 20.54 ? 270 ILE A CG2   1 
ATOM   1752 C CD1   . ILE A 1 224 ? -0.975  2.747   -16.752 1.00 16.25 ? 270 ILE A CD1   1 
ATOM   1753 N N     . GLY A 1 225 ? -1.405  -2.099  -19.493 1.00 21.12 ? 271 GLY A N     1 
ATOM   1754 C CA    . GLY A 1 225 ? -1.889  -2.918  -20.570 1.00 21.74 ? 271 GLY A CA    1 
ATOM   1755 C C     . GLY A 1 225 ? -3.109  -3.672  -20.197 1.00 21.42 ? 271 GLY A C     1 
ATOM   1756 O O     . GLY A 1 225 ? -3.342  -3.905  -19.022 1.00 21.77 ? 271 GLY A O     1 
ATOM   1757 N N     . HIS A 1 226 ? -3.887  -4.053  -21.208 1.00 22.24 ? 272 HIS A N     1 
ATOM   1758 C CA    . HIS A 1 226 ? -5.179  -4.720  -20.994 1.00 22.14 ? 272 HIS A CA    1 
ATOM   1759 C C     . HIS A 1 226 ? -5.083  -6.133  -21.490 1.00 22.50 ? 272 HIS A C     1 
ATOM   1760 O O     . HIS A 1 226 ? -4.645  -6.395  -22.621 1.00 23.78 ? 272 HIS A O     1 
ATOM   1761 C CB    . HIS A 1 226 ? -6.294  -4.017  -21.744 1.00 21.90 ? 272 HIS A CB    1 
ATOM   1762 C CG    . HIS A 1 226 ? -7.617  -4.726  -21.688 1.00 23.97 ? 272 HIS A CG    1 
ATOM   1763 N ND1   . HIS A 1 226 ? -8.256  -5.221  -22.813 1.00 25.75 ? 272 HIS A ND1   1 
ATOM   1764 C CD2   . HIS A 1 226 ? -8.418  -5.033  -20.638 1.00 24.03 ? 272 HIS A CD2   1 
ATOM   1765 C CE1   . HIS A 1 226 ? -9.389  -5.797  -22.454 1.00 23.53 ? 272 HIS A CE1   1 
ATOM   1766 N NE2   . HIS A 1 226 ? -9.503  -5.703  -21.137 1.00 25.32 ? 272 HIS A NE2   1 
ATOM   1767 N N     . SER A 1 227 ? -5.500  -7.312  -20.461 1.00 30.70 ? 273 SER A N     1 
ATOM   1768 C CA    . SER A 1 227 ? -5.885  -8.663  -20.863 1.00 32.21 ? 273 SER A CA    1 
ATOM   1769 C C     . SER A 1 227 ? -4.701  -9.401  -21.427 1.00 29.89 ? 273 SER A C     1 
ATOM   1770 O O     . SER A 1 227 ? -3.702  -9.622  -20.798 1.00 28.13 ? 273 SER A O     1 
ATOM   1771 C CB    . SER A 1 227 ? -6.961  -8.647  -21.935 1.00 32.62 ? 273 SER A CB    1 
ATOM   1772 O OG    . SER A 1 227 ? -7.128  -9.993  -22.386 1.00 41.69 ? 273 SER A OG    1 
ATOM   1773 N N     . PHE A 1 228 ? -4.097  -9.898  -22.845 1.00 24.46 ? 274 PHE A N     1 
ATOM   1774 C CA    . PHE A 1 228 ? -2.726  -10.185 -23.331 1.00 24.66 ? 274 PHE A CA    1 
ATOM   1775 C C     . PHE A 1 228 ? -1.740  -9.095  -22.861 1.00 24.31 ? 274 PHE A C     1 
ATOM   1776 O O     . PHE A 1 228 ? -0.604  -9.409  -22.548 1.00 25.75 ? 274 PHE A O     1 
ATOM   1777 C CB    . PHE A 1 228 ? -2.746  -10.353 -24.865 1.00 23.58 ? 274 PHE A CB    1 
ATOM   1778 C CG    . PHE A 1 228 ? -1.758  -11.394 -25.359 1.00 24.00 ? 274 PHE A CG    1 
ATOM   1779 C CD1   . PHE A 1 228 ? -1.881  -11.950 -26.605 1.00 23.74 ? 274 PHE A CD1   1 
ATOM   1780 C CD2   . PHE A 1 228 ? -0.682  -11.805 -24.524 1.00 20.58 ? 274 PHE A CD2   1 
ATOM   1781 C CE1   . PHE A 1 228 ? -0.929  -12.890 -27.060 1.00 26.19 ? 274 PHE A CE1   1 
ATOM   1782 C CE2   . PHE A 1 228 ? 0.244   -12.695 -24.942 1.00 18.99 ? 274 PHE A CE2   1 
ATOM   1783 C CZ    . PHE A 1 228 ? 0.154   -13.253 -26.216 1.00 22.79 ? 274 PHE A CZ    1 
ATOM   1784 N N     . GLY A 1 229 ? -2.204  -7.835  -22.816 1.00 23.10 ? 275 GLY A N     1 
ATOM   1785 C CA    . GLY A 1 229 ? -1.436  -6.687  -22.404 1.00 22.57 ? 275 GLY A CA    1 
ATOM   1786 C C     . GLY A 1 229 ? -1.156  -6.620  -20.919 1.00 22.95 ? 275 GLY A C     1 
ATOM   1787 O O     . GLY A 1 229 ? -0.135  -6.108  -20.515 1.00 23.63 ? 275 GLY A O     1 
ATOM   1788 N N     . GLY A 1 230 ? -2.049  -7.180  -20.114 1.00 22.93 ? 276 GLY A N     1 
ATOM   1789 C CA    . GLY A 1 230 ? -1.803  -7.474  -18.707 1.00 22.93 ? 276 GLY A CA    1 
ATOM   1790 C C     . GLY A 1 230 ? -0.664  -8.446  -18.455 1.00 22.52 ? 276 GLY A C     1 
ATOM   1791 O O     . GLY A 1 230 ? 0.255   -8.138  -17.698 1.00 24.89 ? 276 GLY A O     1 
ATOM   1792 N N     . ALA A 1 231 ? -0.691  -9.614  -19.085 1.00 22.10 ? 277 ALA A N     1 
ATOM   1793 C CA    . ALA A 1 231 ? 0.459   -10.518 -19.089 1.00 21.57 ? 277 ALA A CA    1 
ATOM   1794 C C     . ALA A 1 231 ? 1.736   -9.790  -19.512 1.00 21.85 ? 277 ALA A C     1 
ATOM   1795 O O     . ALA A 1 231 ? 2.795   -10.070 -19.003 1.00 21.72 ? 277 ALA A O     1 
ATOM   1796 C CB    . ALA A 1 231 ? 0.200   -11.703 -20.051 1.00 20.33 ? 277 ALA A CB    1 
ATOM   1797 N N     . THR A 1 232 ? 1.630   -8.909  -20.520 1.00 23.39 ? 278 THR A N     1 
ATOM   1798 C CA    . THR A 1 232 ? 2.781   -8.142  -21.085 1.00 22.63 ? 278 THR A CA    1 
ATOM   1799 C C     . THR A 1 232 ? 3.364   -7.156  -20.028 1.00 21.90 ? 278 THR A C     1 
ATOM   1800 O O     . THR A 1 232 ? 4.573   -7.070  -19.867 1.00 22.27 ? 278 THR A O     1 
ATOM   1801 C CB    . THR A 1 232 ? 2.351   -7.494  -22.431 1.00 23.59 ? 278 THR A CB    1 
ATOM   1802 O OG1   . THR A 1 232 ? 1.945   -8.515  -23.342 1.00 24.68 ? 278 THR A OG1   1 
ATOM   1803 C CG2   . THR A 1 232 ? 3.445   -6.705  -23.117 1.00 23.95 ? 278 THR A CG2   1 
ATOM   1804 N N     . VAL A 1 233 ? 2.508   -6.455  -19.280 1.00 20.27 ? 279 VAL A N     1 
ATOM   1805 C CA    . VAL A 1 233 ? 2.979   -5.733  -18.107 1.00 19.26 ? 279 VAL A CA    1 
ATOM   1806 C C     . VAL A 1 233 ? 3.949   -6.578  -17.259 1.00 19.40 ? 279 VAL A C     1 
ATOM   1807 O O     . VAL A 1 233 ? 5.024   -6.151  -17.000 1.00 20.56 ? 279 VAL A O     1 
ATOM   1808 C CB    . VAL A 1 233 ? 1.790   -5.205  -17.262 1.00 18.54 ? 279 VAL A CB    1 
ATOM   1809 C CG1   . VAL A 1 233 ? 2.207   -4.836  -15.790 1.00 14.46 ? 279 VAL A CG1   1 
ATOM   1810 C CG2   . VAL A 1 233 ? 1.091   -4.038  -17.981 1.00 18.02 ? 279 VAL A CG2   1 
ATOM   1811 N N     . ILE A 1 234 ? 3.587   -7.813  -16.912 1.00 19.94 ? 280 ILE A N     1 
ATOM   1812 C CA    . ILE A 1 234 ? 4.322   -8.603  -15.949 1.00 19.64 ? 280 ILE A CA    1 
ATOM   1813 C C     . ILE A 1 234 ? 5.653   -9.067  -16.496 1.00 20.58 ? 280 ILE A C     1 
ATOM   1814 O O     . ILE A 1 234 ? 6.687   -8.929  -15.841 1.00 22.97 ? 280 ILE A O     1 
ATOM   1815 C CB    . ILE A 1 234 ? 3.425   -9.783  -15.368 1.00 19.71 ? 280 ILE A CB    1 
ATOM   1816 C CG1   . ILE A 1 234 ? 2.349   -9.212  -14.446 1.00 19.52 ? 280 ILE A CG1   1 
ATOM   1817 C CG2   . ILE A 1 234 ? 4.235   -10.755 -14.504 1.00 17.94 ? 280 ILE A CG2   1 
ATOM   1818 C CD1   . ILE A 1 234 ? 1.060   -10.010 -14.466 1.00 20.66 ? 280 ILE A CD1   1 
ATOM   1819 N N     . GLN A 1 235 ? 5.621   -9.568  -17.718 1.00 20.31 ? 281 GLN A N     1 
ATOM   1820 C CA    . GLN A 1 235 ? 6.782   -9.948  -18.484 1.00 19.51 ? 281 GLN A CA    1 
ATOM   1821 C C     . GLN A 1 235 ? 7.741   -8.765  -18.645 1.00 19.17 ? 281 GLN A C     1 
ATOM   1822 O O     . GLN A 1 235 ? 8.923   -8.907  -18.399 1.00 18.41 ? 281 GLN A O     1 
ATOM   1823 C CB    . GLN A 1 235 ? 6.339   -10.506 -19.864 1.00 18.62 ? 281 GLN A CB    1 
ATOM   1824 C CG    . GLN A 1 235 ? 7.485   -11.158 -20.693 1.00 20.21 ? 281 GLN A CG    1 
ATOM   1825 C CD    . GLN A 1 235 ? 7.941   -12.435 -20.073 1.00 20.85 ? 281 GLN A CD    1 
ATOM   1826 O OE1   . GLN A 1 235 ? 7.128   -13.212 -19.566 1.00 24.20 ? 281 GLN A OE1   1 
ATOM   1827 N NE2   . GLN A 1 235 ? 9.248   -12.655 -20.045 1.00 23.89 ? 281 GLN A NE2   1 
ATOM   1828 N N     . THR A 1 236 ? 7.218   -7.612  -19.077 1.00 20.07 ? 282 THR A N     1 
ATOM   1829 C CA    . THR A 1 236 ? 8.048   -6.433  -19.320 1.00 20.13 ? 282 THR A CA    1 
ATOM   1830 C C     . THR A 1 236 ? 8.718   -6.014  -18.019 1.00 20.22 ? 282 THR A C     1 
ATOM   1831 O O     . THR A 1 236 ? 9.882   -5.761  -18.021 1.00 20.58 ? 282 THR A O     1 
ATOM   1832 C CB    . THR A 1 236 ? 7.234   -5.221  -19.841 1.00 21.25 ? 282 THR A CB    1 
ATOM   1833 O OG1   . THR A 1 236 ? 6.410   -5.621  -20.925 1.00 19.31 ? 282 THR A OG1   1 
ATOM   1834 C CG2   . THR A 1 236 ? 8.164   -4.075  -20.302 1.00 20.25 ? 282 THR A CG2   1 
ATOM   1835 N N     . LEU A 1 237 ? 7.965   -5.915  -16.925 1.00 20.30 ? 283 LEU A N     1 
ATOM   1836 C CA    . LEU A 1 237 ? 8.525   -5.610  -15.597 1.00 20.98 ? 283 LEU A CA    1 
ATOM   1837 C C     . LEU A 1 237 ? 9.702   -6.530  -15.204 1.00 21.62 ? 283 LEU A C     1 
ATOM   1838 O O     . LEU A 1 237 ? 10.722  -6.062  -14.742 1.00 21.92 ? 283 LEU A O     1 
ATOM   1839 C CB    . LEU A 1 237 ? 7.428   -5.696  -14.516 1.00 19.65 ? 283 LEU A CB    1 
ATOM   1840 C CG    . LEU A 1 237 ? 6.381   -4.582  -14.407 1.00 22.16 ? 283 LEU A CG    1 
ATOM   1841 C CD1   . LEU A 1 237 ? 5.378   -4.811  -13.242 1.00 19.31 ? 283 LEU A CD1   1 
ATOM   1842 C CD2   . LEU A 1 237 ? 7.074   -3.168  -14.285 1.00 19.63 ? 283 LEU A CD2   1 
ATOM   1843 N N     . SER A 1 238 ? 9.547   -7.832  -15.432 1.00 23.35 ? 284 SER A N     1 
ATOM   1844 C CA    . SER A 1 238 ? 10.546  -8.855  -15.052 1.00 24.46 ? 284 SER A CA    1 
ATOM   1845 C C     . SER A 1 238 ? 11.872  -8.700  -15.795 1.00 24.29 ? 284 SER A C     1 
ATOM   1846 O O     . SER A 1 238 ? 12.927  -9.084  -15.289 1.00 24.29 ? 284 SER A O     1 
ATOM   1847 C CB    . SER A 1 238 ? 9.967   -10.286 -15.240 1.00 23.85 ? 284 SER A CB    1 
ATOM   1848 O OG    . SER A 1 238 ? 9.998   -10.677 -16.621 1.00 27.67 ? 284 SER A OG    1 
ATOM   1849 N N     . GLU A 1 239 ? 11.804  -8.133  -16.992 1.00 25.41 ? 285 GLU A N     1 
ATOM   1850 C CA    . GLU A 1 239 ? 12.940  -7.962  -17.886 1.00 26.64 ? 285 GLU A CA    1 
ATOM   1851 C C     . GLU A 1 239 ? 13.552  -6.550  -17.851 1.00 26.05 ? 285 GLU A C     1 
ATOM   1852 O O     . GLU A 1 239 ? 14.705  -6.360  -18.184 1.00 24.13 ? 285 GLU A O     1 
ATOM   1853 C CB    . GLU A 1 239 ? 12.420  -8.153  -19.296 1.00 27.78 ? 285 GLU A CB    1 
ATOM   1854 C CG    . GLU A 1 239 ? 11.948  -9.632  -19.645 1.00 30.45 ? 285 GLU A CG    1 
ATOM   1855 C CD    . GLU A 1 239 ? 11.623  -9.787  -21.124 1.00 32.21 ? 285 GLU A CD    1 
ATOM   1856 O OE1   . GLU A 1 239 ? 11.974  -8.830  -21.924 1.00 38.42 ? 285 GLU A OE1   1 
ATOM   1857 O OE2   . GLU A 1 239 ? 11.024  -10.847 -21.498 1.00 38.11 ? 285 GLU A OE2   1 
ATOM   1858 N N     . ASP A 1 240 ? 12.762  -5.560  -17.462 1.00 25.55 ? 286 ASP A N     1 
ATOM   1859 C CA    . ASP A 1 240 ? 13.122  -4.170  -17.746 1.00 24.82 ? 286 ASP A CA    1 
ATOM   1860 C C     . ASP A 1 240 ? 12.831  -3.318  -16.523 1.00 23.56 ? 286 ASP A C     1 
ATOM   1861 O O     . ASP A 1 240 ? 11.699  -2.952  -16.249 1.00 22.09 ? 286 ASP A O     1 
ATOM   1862 C CB    . ASP A 1 240 ? 12.422  -3.624  -19.024 1.00 24.77 ? 286 ASP A CB    1 
ATOM   1863 C CG    . ASP A 1 240 ? 13.073  -2.333  -19.558 1.00 24.58 ? 286 ASP A CG    1 
ATOM   1864 O OD1   . ASP A 1 240 ? 13.845  -1.697  -18.861 1.00 27.09 ? 286 ASP A OD1   1 
ATOM   1865 O OD2   . ASP A 1 240 ? 12.898  -1.964  -20.712 1.00 26.90 ? 286 ASP A OD2   1 
ATOM   1866 N N     . GLN A 1 241 ? 13.912  -3.030  -15.798 1.00 23.99 ? 287 GLN A N     1 
ATOM   1867 C CA    . GLN A 1 241 ? 13.919  -2.187  -14.617 1.00 24.59 ? 287 GLN A CA    1 
ATOM   1868 C C     . GLN A 1 241 ? 13.750  -0.711  -14.895 1.00 23.25 ? 287 GLN A C     1 
ATOM   1869 O O     . GLN A 1 241 ? 13.540  0.016   -13.947 1.00 24.25 ? 287 GLN A O     1 
ATOM   1870 C CB    . GLN A 1 241 ? 15.166  -2.402  -13.712 1.00 24.73 ? 287 GLN A CB    1 
ATOM   1871 C CG    . GLN A 1 241 ? 15.384  -3.798  -13.291 1.00 28.66 ? 287 GLN A CG    1 
ATOM   1872 C CD    . GLN A 1 241 ? 14.139  -4.520  -12.824 1.00 38.58 ? 287 GLN A CD    1 
ATOM   1873 O OE1   . GLN A 1 241 ? 13.561  -4.149  -11.782 1.00 42.05 ? 287 GLN A OE1   1 
ATOM   1874 N NE2   . GLN A 1 241 ? 13.735  -5.614  -13.563 1.00 37.55 ? 287 GLN A NE2   1 
ATOM   1875 N N     . ARG A 1 242 ? 13.779  -0.262  -16.153 1.00 22.62 ? 288 ARG A N     1 
ATOM   1876 C CA    . ARG A 1 242 ? 13.498  1.151   -16.426 1.00 21.90 ? 288 ARG A CA    1 
ATOM   1877 C C     . ARG A 1 242 ? 12.024  1.462   -16.109 1.00 22.27 ? 288 ARG A C     1 
ATOM   1878 O O     . ARG A 1 242 ? 11.659  2.603   -15.729 1.00 22.77 ? 288 ARG A O     1 
ATOM   1879 C CB    . ARG A 1 242 ? 13.858  1.555   -17.881 1.00 21.92 ? 288 ARG A CB    1 
ATOM   1880 C CG    . ARG A 1 242 ? 15.324  1.321   -18.223 1.00 20.55 ? 288 ARG A CG    1 
ATOM   1881 C CD    . ARG A 1 242 ? 15.641  1.551   -19.686 1.00 19.78 ? 288 ARG A CD    1 
ATOM   1882 N NE    . ARG A 1 242 ? 14.958  0.585   -20.537 1.00 16.80 ? 288 ARG A NE    1 
ATOM   1883 C CZ    . ARG A 1 242 ? 14.849  0.654   -21.870 1.00 17.85 ? 288 ARG A CZ    1 
ATOM   1884 N NH1   . ARG A 1 242 ? 15.391  1.630   -22.566 1.00 15.52 ? 288 ARG A NH1   1 
ATOM   1885 N NH2   . ARG A 1 242 ? 14.133  -0.247  -22.510 1.00 18.64 ? 288 ARG A NH2   1 
ATOM   1886 N N     . PHE A 1 243 ? 11.204  0.421   -16.219 1.00 21.38 ? 289 PHE A N     1 
ATOM   1887 C CA    . PHE A 1 243 ? 9.770   0.471   -15.859 1.00 21.41 ? 289 PHE A CA    1 
ATOM   1888 C C     . PHE A 1 243 ? 9.689   0.344   -14.373 1.00 20.63 ? 289 PHE A C     1 
ATOM   1889 O O     . PHE A 1 243 ? 10.143  -0.645  -13.812 1.00 21.11 ? 289 PHE A O     1 
ATOM   1890 C CB    . PHE A 1 243 ? 9.014   -0.672  -16.569 1.00 19.22 ? 289 PHE A CB    1 
ATOM   1891 C CG    . PHE A 1 243 ? 8.876   -0.474  -18.050 1.00 20.01 ? 289 PHE A CG    1 
ATOM   1892 C CD1   . PHE A 1 243 ? 8.001   0.492   -18.568 1.00 18.59 ? 289 PHE A CD1   1 
ATOM   1893 C CD2   . PHE A 1 243 ? 9.612   -1.228  -18.939 1.00 19.55 ? 289 PHE A CD2   1 
ATOM   1894 C CE1   . PHE A 1 243 ? 7.846   0.646   -19.908 1.00 16.10 ? 289 PHE A CE1   1 
ATOM   1895 C CE2   . PHE A 1 243 ? 9.479   -1.061  -20.289 1.00 17.08 ? 289 PHE A CE2   1 
ATOM   1896 C CZ    . PHE A 1 243 ? 8.615   -0.140  -20.786 1.00 16.57 ? 289 PHE A CZ    1 
ATOM   1897 N N     . ARG A 1 244 ? 9.122   1.349   -13.720 1.00 22.83 ? 290 ARG A N     1 
ATOM   1898 C CA    . ARG A 1 244 ? 9.230   1.461   -12.262 1.00 23.06 ? 290 ARG A CA    1 
ATOM   1899 C C     . ARG A 1 244 ? 8.016   0.890   -11.540 1.00 23.80 ? 290 ARG A C     1 
ATOM   1900 O O     . ARG A 1 244 ? 8.040   0.637   -10.341 1.00 23.59 ? 290 ARG A O     1 
ATOM   1901 C CB    . ARG A 1 244 ? 9.466   2.891   -11.927 1.00 24.61 ? 290 ARG A CB    1 
ATOM   1902 C CG    . ARG A 1 244 ? 10.790  3.407   -12.310 1.00 25.82 ? 290 ARG A CG    1 
ATOM   1903 C CD    . ARG A 1 244 ? 11.861  2.385   -12.201 1.00 29.21 ? 290 ARG A CD    1 
ATOM   1904 N NE    . ARG A 1 244 ? 12.197  2.132   -10.820 1.00 34.14 ? 290 ARG A NE    1 
ATOM   1905 C CZ    . ARG A 1 244 ? 12.488  0.957   -10.306 1.00 33.28 ? 290 ARG A CZ    1 
ATOM   1906 N NH1   . ARG A 1 244 ? 12.508  -0.115  -11.028 1.00 30.40 ? 290 ARG A NH1   1 
ATOM   1907 N NH2   . ARG A 1 244 ? 12.763  0.866   -9.043  1.00 34.93 ? 290 ARG A NH2   1 
ATOM   1908 N N     . CYS A 1 245 ? 6.948   0.665   -12.294 1.00 24.35 ? 291 CYS A N     1 
ATOM   1909 C CA    . CYS A 1 245 ? 5.782   -0.006  -11.749 1.00 25.06 ? 291 CYS A CA    1 
ATOM   1910 C C     . CYS A 1 245 ? 4.886   -0.449  -12.912 1.00 24.62 ? 291 CYS A C     1 
ATOM   1911 O O     . CYS A 1 245 ? 5.099   -0.038  -14.060 1.00 24.10 ? 291 CYS A O     1 
ATOM   1912 C CB    . CYS A 1 245 ? 5.050   0.909   -10.736 1.00 24.89 ? 291 CYS A CB    1 
ATOM   1913 S SG    . CYS A 1 245 ? 4.117   2.310   -11.473 1.00 27.54 ? 291 CYS A SG    1 
ATOM   1914 N N     . GLY A 1 246 ? 3.917   -1.306  -12.593 1.00 24.00 ? 292 GLY A N     1 
ATOM   1915 C CA    . GLY A 1 246 ? 3.023   -1.894  -13.565 1.00 23.35 ? 292 GLY A CA    1 
ATOM   1916 C C     . GLY A 1 246 ? 1.571   -1.804  -13.153 1.00 23.26 ? 292 GLY A C     1 
ATOM   1917 O O     . GLY A 1 246 ? 1.236   -1.806  -11.940 1.00 23.08 ? 292 GLY A O     1 
ATOM   1918 N N     . ILE A 1 247 ? 0.715   -1.638  -14.162 1.00 22.16 ? 293 ILE A N     1 
ATOM   1919 C CA    . ILE A 1 247 ? -0.717  -1.732  -13.967 1.00 22.34 ? 293 ILE A CA    1 
ATOM   1920 C C     . ILE A 1 247 ? -1.336  -2.657  -14.996 1.00 21.71 ? 293 ILE A C     1 
ATOM   1921 O O     . ILE A 1 247 ? -1.392  -2.330  -16.141 1.00 21.62 ? 293 ILE A O     1 
ATOM   1922 C CB    . ILE A 1 247 ? -1.462  -0.357  -13.969 1.00 22.72 ? 293 ILE A CB    1 
ATOM   1923 C CG1   . ILE A 1 247 ? -0.872  0.574   -12.892 1.00 21.99 ? 293 ILE A CG1   1 
ATOM   1924 C CG2   . ILE A 1 247 ? -2.934  -0.596  -13.706 1.00 23.72 ? 293 ILE A CG2   1 
ATOM   1925 C CD1   . ILE A 1 247 ? -1.465  2.013   -12.813 1.00 20.26 ? 293 ILE A CD1   1 
ATOM   1926 N N     . ALA A 1 248 ? -1.777  -3.828  -14.536 1.00 21.75 ? 294 ALA A N     1 
ATOM   1927 C CA    . ALA A 1 248 ? -2.378  -4.881  -15.365 1.00 21.42 ? 294 ALA A CA    1 
ATOM   1928 C C     . ALA A 1 248 ? -3.903  -4.789  -15.306 1.00 21.57 ? 294 ALA A C     1 
ATOM   1929 O O     . ALA A 1 248 ? -4.527  -5.004  -14.269 1.00 22.72 ? 294 ALA A O     1 
ATOM   1930 C CB    . ALA A 1 248 ? -1.864  -6.293  -14.921 1.00 19.73 ? 294 ALA A CB    1 
ATOM   1931 N N     . LEU A 1 249 ? -4.491  -4.441  -16.433 1.00 22.73 ? 295 LEU A N     1 
ATOM   1932 C CA    . LEU A 1 249 ? -5.910  -4.209  -16.564 1.00 23.49 ? 295 LEU A CA    1 
ATOM   1933 C C     . LEU A 1 249 ? -6.544  -5.497  -17.031 1.00 24.52 ? 295 LEU A C     1 
ATOM   1934 O O     . LEU A 1 249 ? -6.326  -5.944  -18.172 1.00 24.85 ? 295 LEU A O     1 
ATOM   1935 C CB    . LEU A 1 249 ? -6.192  -3.056  -17.544 1.00 23.09 ? 295 LEU A CB    1 
ATOM   1936 C CG    . LEU A 1 249 ? -5.664  -1.668  -17.283 1.00 21.89 ? 295 LEU A CG    1 
ATOM   1937 C CD1   . LEU A 1 249 ? -6.048  -0.736  -18.398 1.00 19.09 ? 295 LEU A CD1   1 
ATOM   1938 C CD2   . LEU A 1 249 ? -6.059  -1.073  -15.847 1.00 20.14 ? 295 LEU A CD2   1 
ATOM   1939 N N     . ASP A 1 250 ? -7.270  -6.138  -16.101 1.00 26.41 ? 296 ASP A N     1 
ATOM   1940 C CA    . ASP A 1 250 ? -7.885  -7.431  -16.323 1.00 27.38 ? 296 ASP A CA    1 
ATOM   1941 C C     . ASP A 1 250 ? -6.946  -8.409  -17.078 1.00 27.56 ? 296 ASP A C     1 
ATOM   1942 O O     . ASP A 1 250 ? -7.316  -8.932  -18.151 1.00 27.97 ? 296 ASP A O     1 
ATOM   1943 C CB    . ASP A 1 250 ? -9.149  -7.197  -17.141 1.00 28.89 ? 296 ASP A CB    1 
ATOM   1944 C CG    . ASP A 1 250 ? -10.310 -8.026  -16.675 1.00 31.90 ? 296 ASP A CG    1 
ATOM   1945 O OD1   . ASP A 1 250 ? -10.307 -8.533  -15.524 1.00 28.98 ? 296 ASP A OD1   1 
ATOM   1946 O OD2   . ASP A 1 250 ? -11.234 -8.147  -17.484 1.00 32.94 ? 296 ASP A OD2   1 
ATOM   1947 N N     . ALA A 1 251 ? -5.754  -8.643  -16.532 1.00 25.61 ? 297 ALA A N     1 
ATOM   1948 C CA    . ALA A 1 251 ? -4.749  -9.493  -17.164 1.00 26.26 ? 297 ALA A CA    1 
ATOM   1949 C C     . ALA A 1 251 ? -5.253  -10.890 -17.471 1.00 26.59 ? 297 ALA A C     1 
ATOM   1950 O O     . ALA A 1 251 ? -6.096  -11.443 -16.757 1.00 26.70 ? 297 ALA A O     1 
ATOM   1951 C CB    . ALA A 1 251 ? -3.466  -9.578  -16.298 1.00 25.90 ? 297 ALA A CB    1 
ATOM   1952 N N     . TRP A 1 252 ? -4.724  -11.432 -18.565 1.00 27.25 ? 298 TRP A N     1 
ATOM   1953 C CA    . TRP A 1 252 ? -4.909  -12.809 -18.989 1.00 26.53 ? 298 TRP A CA    1 
ATOM   1954 C C     . TRP A 1 252 ? -3.559  -13.452 -18.774 1.00 26.41 ? 298 TRP A C     1 
ATOM   1955 O O     . TRP A 1 252 ? -2.617  -13.166 -19.485 1.00 27.03 ? 298 TRP A O     1 
ATOM   1956 C CB    . TRP A 1 252 ? -5.328  -12.854 -20.457 1.00 26.76 ? 298 TRP A CB    1 
ATOM   1957 C CG    . TRP A 1 252 ? -5.418  -14.212 -21.009 1.00 27.58 ? 298 TRP A CG    1 
ATOM   1958 C CD1   . TRP A 1 252 ? -6.012  -15.333 -20.419 1.00 26.17 ? 298 TRP A CD1   1 
ATOM   1959 C CD2   . TRP A 1 252 ? -4.894  -14.652 -22.280 1.00 27.18 ? 298 TRP A CD2   1 
ATOM   1960 N NE1   . TRP A 1 252 ? -5.848  -16.430 -21.266 1.00 27.16 ? 298 TRP A NE1   1 
ATOM   1961 C CE2   . TRP A 1 252 ? -5.166  -16.048 -22.394 1.00 25.40 ? 298 TRP A CE2   1 
ATOM   1962 C CE3   . TRP A 1 252 ? -4.229  -14.002 -23.333 1.00 28.85 ? 298 TRP A CE3   1 
ATOM   1963 C CZ2   . TRP A 1 252 ? -4.809  -16.792 -23.516 1.00 28.01 ? 298 TRP A CZ2   1 
ATOM   1964 C CZ3   . TRP A 1 252 ? -3.871  -14.750 -24.462 1.00 28.46 ? 298 TRP A CZ3   1 
ATOM   1965 C CH2   . TRP A 1 252 ? -4.167  -16.132 -24.544 1.00 27.90 ? 298 TRP A CH2   1 
ATOM   1966 N N     . MET A 1 253 ? -3.475  -14.281 -17.746 1.00 26.02 ? 299 MET A N     1 
ATOM   1967 C CA    . MET A 1 253 ? -2.227  -14.757 -17.209 1.00 26.72 ? 299 MET A CA    1 
ATOM   1968 C C     . MET A 1 253 ? -1.627  -15.934 -17.909 1.00 27.79 ? 299 MET A C     1 
ATOM   1969 O O     . MET A 1 253 ? -0.434  -16.165 -17.763 1.00 28.68 ? 299 MET A O     1 
ATOM   1970 C CB    . MET A 1 253 ? -2.352  -15.052 -15.693 1.00 25.95 ? 299 MET A CB    1 
ATOM   1971 C CG    . MET A 1 253 ? -2.874  -13.851 -14.835 1.00 23.62 ? 299 MET A CG    1 
ATOM   1972 S SD    . MET A 1 253 ? -1.714  -12.440 -14.845 1.00 25.49 ? 299 MET A SD    1 
ATOM   1973 C CE    . MET A 1 253 ? -0.416  -13.158 -13.808 1.00 24.57 ? 299 MET A CE    1 
ATOM   1974 N N     . PHE A 1 254 ? -2.443  -16.676 -18.673 1.00 29.77 ? 300 PHE A N     1 
ATOM   1975 C CA    . PHE A 1 254 ? -2.049  -17.928 -19.343 1.00 29.58 ? 300 PHE A CA    1 
ATOM   1976 C C     . PHE A 1 254 ? -0.692  -17.895 -20.137 1.00 29.34 ? 300 PHE A C     1 
ATOM   1977 O O     . PHE A 1 254 ? 0.083   -18.862 -20.057 1.00 28.67 ? 300 PHE A O     1 
ATOM   1978 C CB    . PHE A 1 254 ? -3.228  -18.475 -20.221 1.00 30.24 ? 300 PHE A CB    1 
ATOM   1979 C CG    . PHE A 1 254 ? -2.817  -19.659 -21.128 1.00 32.20 ? 300 PHE A CG    1 
ATOM   1980 C CD1   . PHE A 1 254 ? -2.839  -20.975 -20.649 1.00 33.99 ? 300 PHE A CD1   1 
ATOM   1981 C CD2   . PHE A 1 254 ? -2.328  -19.433 -22.418 1.00 33.05 ? 300 PHE A CD2   1 
ATOM   1982 C CE1   . PHE A 1 254 ? -2.403  -22.038 -21.454 1.00 34.18 ? 300 PHE A CE1   1 
ATOM   1983 C CE2   . PHE A 1 254 ? -1.891  -20.467 -23.225 1.00 31.34 ? 300 PHE A CE2   1 
ATOM   1984 C CZ    . PHE A 1 254 ? -1.941  -21.780 -22.758 1.00 34.07 ? 300 PHE A CZ    1 
ATOM   1985 N N     . PRO A 1 255 ? -0.403  -16.800 -20.910 1.00 29.14 ? 301 PRO A N     1 
ATOM   1986 C CA    . PRO A 1 255 ? 0.882   -16.745 -21.679 1.00 29.51 ? 301 PRO A CA    1 
ATOM   1987 C C     . PRO A 1 255 ? 2.212   -16.796 -20.880 1.00 30.35 ? 301 PRO A C     1 
ATOM   1988 O O     . PRO A 1 255 ? 3.268   -17.091 -21.453 1.00 30.52 ? 301 PRO A O     1 
ATOM   1989 C CB    . PRO A 1 255 ? 0.790   -15.391 -22.431 1.00 28.80 ? 301 PRO A CB    1 
ATOM   1990 C CG    . PRO A 1 255 ? -0.657  -15.044 -22.423 1.00 28.01 ? 301 PRO A CG    1 
ATOM   1991 C CD    . PRO A 1 255 ? -1.206  -15.584 -21.141 1.00 27.77 ? 301 PRO A CD    1 
ATOM   1992 N N     . LEU A 1 256 ? 2.176   -16.465 -19.592 1.00 30.84 ? 302 LEU A N     1 
ATOM   1993 C CA    . LEU A 1 256 ? 3.426   -16.280 -18.796 1.00 30.87 ? 302 LEU A CA    1 
ATOM   1994 C C     . LEU A 1 256 ? 4.016   -17.622 -18.343 1.00 31.17 ? 302 LEU A C     1 
ATOM   1995 O O     . LEU A 1 256 ? 3.275   -18.501 -17.930 1.00 31.68 ? 302 LEU A O     1 
ATOM   1996 C CB    . LEU A 1 256 ? 3.156   -15.395 -17.543 1.00 29.12 ? 302 LEU A CB    1 
ATOM   1997 C CG    . LEU A 1 256 ? 2.738   -13.939 -17.719 1.00 27.85 ? 302 LEU A CG    1 
ATOM   1998 C CD1   . LEU A 1 256 ? 2.030   -13.423 -16.495 1.00 26.00 ? 302 LEU A CD1   1 
ATOM   1999 C CD2   . LEU A 1 256 ? 3.956   -13.020 -18.059 1.00 25.13 ? 302 LEU A CD2   1 
ATOM   2000 N N     . GLY A 1 257 ? 5.330   -17.777 -18.430 1.00 31.44 ? 303 GLY A N     1 
ATOM   2001 C CA    . GLY A 1 257 ? 5.998   -18.898 -17.783 1.00 32.58 ? 303 GLY A CA    1 
ATOM   2002 C C     . GLY A 1 257 ? 6.096   -18.720 -16.271 1.00 33.59 ? 303 GLY A C     1 
ATOM   2003 O O     . GLY A 1 257 ? 6.074   -17.599 -15.770 1.00 33.64 ? 303 GLY A O     1 
ATOM   2004 N N     . ASP A 1 258 ? 6.235   -19.834 -15.555 1.00 35.21 ? 304 ASP A N     1 
ATOM   2005 C CA    . ASP A 1 258 ? 6.388   -19.892 -14.089 1.00 37.32 ? 304 ASP A CA    1 
ATOM   2006 C C     . ASP A 1 258 ? 7.529   -19.072 -13.540 1.00 36.32 ? 304 ASP A C     1 
ATOM   2007 O O     . ASP A 1 258 ? 7.479   -18.648 -12.389 1.00 34.70 ? 304 ASP A O     1 
ATOM   2008 C CB    . ASP A 1 258 ? 6.643   -21.364 -13.660 1.00 39.98 ? 304 ASP A CB    1 
ATOM   2009 C CG    . ASP A 1 258 ? 5.409   -22.278 -13.858 1.00 45.06 ? 304 ASP A CG    1 
ATOM   2010 O OD1   . ASP A 1 258 ? 4.261   -21.800 -13.580 1.00 49.44 ? 304 ASP A OD1   1 
ATOM   2011 O OD2   . ASP A 1 258 ? 5.613   -23.464 -14.261 1.00 50.12 ? 304 ASP A OD2   1 
ATOM   2012 N N     . GLU A 1 259 ? 8.579   -18.918 -14.360 1.00 35.82 ? 305 GLU A N     1 
ATOM   2013 C CA    . GLU A 1 259 ? 9.769   -18.148 -14.003 1.00 35.72 ? 305 GLU A CA    1 
ATOM   2014 C C     . GLU A 1 259 ? 9.531   -16.679 -13.649 1.00 35.92 ? 305 GLU A C     1 
ATOM   2015 O O     . GLU A 1 259 ? 10.308  -16.096 -12.890 1.00 34.60 ? 305 GLU A O     1 
ATOM   2016 C CB    . GLU A 1 259 ? 10.834  -18.265 -15.113 1.00 36.49 ? 305 GLU A CB    1 
ATOM   2017 C CG    . GLU A 1 259 ? 10.633  -17.358 -16.341 1.00 38.36 ? 305 GLU A CG    1 
ATOM   2018 C CD    . GLU A 1 259 ? 9.691   -17.929 -17.374 1.00 40.60 ? 305 GLU A CD    1 
ATOM   2019 O OE1   . GLU A 1 259 ? 9.248   -19.095 -17.213 1.00 39.79 ? 305 GLU A OE1   1 
ATOM   2020 O OE2   . GLU A 1 259 ? 9.390   -17.188 -18.346 1.00 41.57 ? 305 GLU A OE2   1 
ATOM   2021 N N     . VAL A 1 260 ? 8.464   -16.083 -14.192 1.00 36.01 ? 306 VAL A N     1 
ATOM   2022 C CA    . VAL A 1 260 ? 8.304   -14.626 -14.123 1.00 36.78 ? 306 VAL A CA    1 
ATOM   2023 C C     . VAL A 1 260 ? 7.998   -14.178 -12.681 1.00 36.64 ? 306 VAL A C     1 
ATOM   2024 O O     . VAL A 1 260 ? 8.442   -13.119 -12.227 1.00 36.10 ? 306 VAL A O     1 
ATOM   2025 C CB    . VAL A 1 260 ? 7.190   -14.070 -15.101 1.00 36.46 ? 306 VAL A CB    1 
ATOM   2026 C CG1   . VAL A 1 260 ? 7.358   -12.580 -15.281 1.00 37.06 ? 306 VAL A CG1   1 
ATOM   2027 C CG2   . VAL A 1 260 ? 7.304   -14.677 -16.469 1.00 38.53 ? 306 VAL A CG2   1 
ATOM   2028 N N     . TYR A 1 261 ? 7.235   -15.003 -11.988 1.00 36.48 ? 307 TYR A N     1 
ATOM   2029 C CA    . TYR A 1 261 ? 6.590   -14.626 -10.734 1.00 37.60 ? 307 TYR A CA    1 
ATOM   2030 C C     . TYR A 1 261 ? 7.542   -14.180 -9.656  1.00 37.42 ? 307 TYR A C     1 
ATOM   2031 O O     . TYR A 1 261 ? 7.248   -13.252 -8.957  1.00 38.47 ? 307 TYR A O     1 
ATOM   2032 C CB    . TYR A 1 261 ? 5.681   -15.769 -10.240 1.00 37.50 ? 307 TYR A CB    1 
ATOM   2033 C CG    . TYR A 1 261 ? 4.631   -16.060 -11.247 1.00 36.89 ? 307 TYR A CG    1 
ATOM   2034 C CD1   . TYR A 1 261 ? 3.506   -15.251 -11.359 1.00 37.38 ? 307 TYR A CD1   1 
ATOM   2035 C CD2   . TYR A 1 261 ? 4.802   -17.074 -12.172 1.00 38.12 ? 307 TYR A CD2   1 
ATOM   2036 C CE1   . TYR A 1 261 ? 2.541   -15.494 -12.343 1.00 36.35 ? 307 TYR A CE1   1 
ATOM   2037 C CE2   . TYR A 1 261 ? 3.852   -17.307 -13.176 1.00 39.88 ? 307 TYR A CE2   1 
ATOM   2038 C CZ    . TYR A 1 261 ? 2.713   -16.518 -13.237 1.00 38.05 ? 307 TYR A CZ    1 
ATOM   2039 O OH    . TYR A 1 261 ? 1.770   -16.757 -14.225 1.00 39.48 ? 307 TYR A OH    1 
ATOM   2040 N N     . SER A 1 262 ? 8.705   -14.811 -9.572  1.00 37.99 ? 308 SER A N     1 
ATOM   2041 C CA    . SER A 1 262 ? 9.704   -14.504 -8.558  1.00 37.88 ? 308 SER A CA    1 
ATOM   2042 C C     . SER A 1 262 ? 10.586  -13.370 -8.947  1.00 36.88 ? 308 SER A C     1 
ATOM   2043 O O     . SER A 1 262 ? 11.321  -12.867 -8.114  1.00 38.26 ? 308 SER A O     1 
ATOM   2044 C CB    . SER A 1 262 ? 10.550  -15.741 -8.243  1.00 38.41 ? 308 SER A CB    1 
ATOM   2045 O OG    . SER A 1 262 ? 11.334  -16.154 -9.336  1.00 41.55 ? 308 SER A OG    1 
ATOM   2046 N N     . ARG A 1 263 ? 10.444  -12.908 -10.189 1.00 36.35 ? 309 ARG A N     1 
ATOM   2047 C CA    . ARG A 1 263 ? 11.331  -11.925 -10.814 1.00 34.93 ? 309 ARG A CA    1 
ATOM   2048 C C     . ARG A 1 263 ? 10.819  -10.513 -10.971 1.00 35.22 ? 309 ARG A C     1 
ATOM   2049 O O     . ARG A 1 263 ? 11.463  -9.722  -11.709 1.00 36.95 ? 309 ARG A O     1 
ATOM   2050 C CB    . ARG A 1 263 ? 11.699  -12.371 -12.216 1.00 34.31 ? 309 ARG A CB    1 
ATOM   2051 C CG    . ARG A 1 263 ? 12.569  -13.587 -12.305 1.00 32.79 ? 309 ARG A CG    1 
ATOM   2052 C CD    . ARG A 1 263 ? 12.786  -13.876 -13.721 1.00 29.62 ? 309 ARG A CD    1 
ATOM   2053 N NE    . ARG A 1 263 ? 13.752  -14.951 -13.909 1.00 34.01 ? 309 ARG A NE    1 
ATOM   2054 C CZ    . ARG A 1 263 ? 13.958  -15.572 -15.073 1.00 32.26 ? 309 ARG A CZ    1 
ATOM   2055 N NH1   . ARG A 1 263 ? 13.247  -15.213 -16.146 1.00 28.04 ? 309 ARG A NH1   1 
ATOM   2056 N NH2   . ARG A 1 263 ? 14.863  -16.544 -15.155 1.00 31.19 ? 309 ARG A NH2   1 
ATOM   2057 N N     . ILE A 1 264 ? 9.699   -10.164 -10.330 1.00 33.64 ? 310 ILE A N     1 
ATOM   2058 C CA    . ILE A 1 264 ? 9.152   -8.787  -10.442 1.00 32.50 ? 310 ILE A CA    1 
ATOM   2059 C C     . ILE A 1 264 ? 9.327   -7.946  -9.154  1.00 31.46 ? 310 ILE A C     1 
ATOM   2060 O O     . ILE A 1 264 ? 8.497   -7.955  -8.257  1.00 29.98 ? 310 ILE A O     1 
ATOM   2061 C CB    . ILE A 1 264 ? 7.673   -8.792  -10.939 1.00 32.65 ? 310 ILE A CB    1 
ATOM   2062 C CG1   . ILE A 1 264 ? 7.519   -9.655  -12.182 1.00 33.00 ? 310 ILE A CG1   1 
ATOM   2063 C CG2   . ILE A 1 264 ? 7.133   -7.344  -11.192 1.00 33.16 ? 310 ILE A CG2   1 
ATOM   2064 C CD1   . ILE A 1 264 ? 6.171   -10.380 -12.184 1.00 33.23 ? 310 ILE A CD1   1 
ATOM   2065 N N     . PRO A 1 265 ? 10.419  -7.179  -9.078  1.00 31.05 ? 311 PRO A N     1 
ATOM   2066 C CA    . PRO A 1 265 ? 10.596  -6.282  -7.903  1.00 29.63 ? 311 PRO A CA    1 
ATOM   2067 C C     . PRO A 1 265 ? 9.678   -5.048  -7.844  1.00 28.96 ? 311 PRO A C     1 
ATOM   2068 O O     . PRO A 1 265 ? 9.371   -4.532  -6.731  1.00 29.14 ? 311 PRO A O     1 
ATOM   2069 C CB    . PRO A 1 265 ? 12.090  -5.883  -7.955  1.00 29.52 ? 311 PRO A CB    1 
ATOM   2070 C CG    . PRO A 1 265 ? 12.547  -6.197  -9.372  1.00 31.07 ? 311 PRO A CG    1 
ATOM   2071 C CD    . PRO A 1 265 ? 11.528  -7.132  -10.050 1.00 30.79 ? 311 PRO A CD    1 
ATOM   2072 N N     . GLN A 1 266 ? 9.254   -4.548  -9.013  1.00 28.38 ? 312 GLN A N     1 
ATOM   2073 C CA    . GLN A 1 266 ? 8.466   -3.308  -9.067  1.00 27.57 ? 312 GLN A CA    1 
ATOM   2074 C C     . GLN A 1 266 ? 7.034   -3.438  -8.560  1.00 26.73 ? 312 GLN A C     1 
ATOM   2075 O O     . GLN A 1 266 ? 6.447   -4.486  -8.693  1.00 28.27 ? 312 GLN A O     1 
ATOM   2076 C CB    . GLN A 1 266 ? 8.416   -2.756  -10.488 1.00 27.84 ? 312 GLN A CB    1 
ATOM   2077 C CG    . GLN A 1 266 ? 9.776   -2.563  -11.171 1.00 24.53 ? 312 GLN A CG    1 
ATOM   2078 C CD    . GLN A 1 266 ? 10.088  -3.741  -12.031 1.00 25.52 ? 312 GLN A CD    1 
ATOM   2079 O OE1   . GLN A 1 266 ? 9.981   -4.902  -11.579 1.00 26.12 ? 312 GLN A OE1   1 
ATOM   2080 N NE2   . GLN A 1 266 ? 10.449  -3.481  -13.272 1.00 19.30 ? 312 GLN A NE2   1 
ATOM   2081 N N     . PRO A 1 267 ? 6.461   -2.363  -7.995  1.00 25.01 ? 313 PRO A N     1 
ATOM   2082 C CA    . PRO A 1 267 ? 5.020   -2.353  -7.678  1.00 23.59 ? 313 PRO A CA    1 
ATOM   2083 C C     . PRO A 1 267 ? 4.029   -2.694  -8.862  1.00 23.50 ? 313 PRO A C     1 
ATOM   2084 O O     . PRO A 1 267 ? 4.268   -2.325  -10.026 1.00 21.47 ? 313 PRO A O     1 
ATOM   2085 C CB    . PRO A 1 267 ? 4.803   -0.963  -7.091  1.00 24.81 ? 313 PRO A CB    1 
ATOM   2086 C CG    . PRO A 1 267 ? 6.234   -0.548  -6.556  1.00 25.21 ? 313 PRO A CG    1 
ATOM   2087 C CD    . PRO A 1 267 ? 7.146   -1.119  -7.584  1.00 24.56 ? 313 PRO A CD    1 
ATOM   2088 N N     . LEU A 1 268 ? 2.980   -3.466  -8.547  1.00 22.43 ? 314 LEU A N     1 
ATOM   2089 C CA    . LEU A 1 268 ? 2.114   -4.093  -9.556  1.00 22.55 ? 314 LEU A CA    1 
ATOM   2090 C C     . LEU A 1 268 ? 0.704   -3.936  -9.070  1.00 23.11 ? 314 LEU A C     1 
ATOM   2091 O O     . LEU A 1 268 ? 0.413   -4.313  -7.931  1.00 23.27 ? 314 LEU A O     1 
ATOM   2092 C CB    . LEU A 1 268 ? 2.448   -5.593  -9.763  1.00 21.79 ? 314 LEU A CB    1 
ATOM   2093 C CG    . LEU A 1 268 ? 1.756   -6.386  -10.930 1.00 22.73 ? 314 LEU A CG    1 
ATOM   2094 C CD1   . LEU A 1 268 ? 1.647   -5.672  -12.336 1.00 15.32 ? 314 LEU A CD1   1 
ATOM   2095 C CD2   . LEU A 1 268 ? 2.385   -7.763  -11.052 1.00 20.85 ? 314 LEU A CD2   1 
ATOM   2096 N N     . PHE A 1 269 ? -0.145  -3.371  -9.924  1.00 22.28 ? 315 PHE A N     1 
ATOM   2097 C CA    . PHE A 1 269 ? -1.582  -3.154  -9.650  1.00 22.57 ? 315 PHE A CA    1 
ATOM   2098 C C     . PHE A 1 269 ? -2.426  -3.952  -10.657 1.00 23.32 ? 315 PHE A C     1 
ATOM   2099 O O     . PHE A 1 269 ? -2.241  -3.861  -11.899 1.00 23.43 ? 315 PHE A O     1 
ATOM   2100 C CB    . PHE A 1 269 ? -1.827  -1.653  -9.730  1.00 22.32 ? 315 PHE A CB    1 
ATOM   2101 C CG    . PHE A 1 269 ? -3.177  -1.157  -9.227  1.00 23.01 ? 315 PHE A CG    1 
ATOM   2102 C CD1   . PHE A 1 269 ? -4.042  -1.944  -8.487  1.00 23.23 ? 315 PHE A CD1   1 
ATOM   2103 C CD2   . PHE A 1 269 ? -3.553  0.172   -9.529  1.00 21.76 ? 315 PHE A CD2   1 
ATOM   2104 C CE1   . PHE A 1 269 ? -5.275  -1.410  -8.069  1.00 22.93 ? 315 PHE A CE1   1 
ATOM   2105 C CE2   . PHE A 1 269 ? -4.706  0.700   -9.098  1.00 22.68 ? 315 PHE A CE2   1 
ATOM   2106 C CZ    . PHE A 1 269 ? -5.609  -0.098  -8.390  1.00 22.96 ? 315 PHE A CZ    1 
ATOM   2107 N N     . PHE A 1 270 ? -3.295  -4.803  -10.101 1.00 24.48 ? 316 PHE A N     1 
ATOM   2108 C CA    . PHE A 1 270 ? -4.277  -5.612  -10.835 1.00 22.69 ? 316 PHE A CA    1 
ATOM   2109 C C     . PHE A 1 270 ? -5.636  -4.924  -10.734 1.00 23.38 ? 316 PHE A C     1 
ATOM   2110 O O     . PHE A 1 270 ? -6.212  -4.789  -9.640  1.00 23.15 ? 316 PHE A O     1 
ATOM   2111 C CB    . PHE A 1 270 ? -4.379  -7.033  -10.274 1.00 23.33 ? 316 PHE A CB    1 
ATOM   2112 C CG    . PHE A 1 270 ? -3.096  -7.889  -10.375 1.00 22.67 ? 316 PHE A CG    1 
ATOM   2113 C CD1   . PHE A 1 270 ? -2.752  -8.528  -11.568 1.00 20.86 ? 316 PHE A CD1   1 
ATOM   2114 C CD2   . PHE A 1 270 ? -2.265  -8.064  -9.249  1.00 21.92 ? 316 PHE A CD2   1 
ATOM   2115 C CE1   . PHE A 1 270 ? -1.584  -9.370  -11.675 1.00 21.41 ? 316 PHE A CE1   1 
ATOM   2116 C CE2   . PHE A 1 270 ? -1.105  -8.899  -9.292  1.00 19.57 ? 316 PHE A CE2   1 
ATOM   2117 C CZ    . PHE A 1 270 ? -0.752  -9.563  -10.496 1.00 21.94 ? 316 PHE A CZ    1 
ATOM   2118 N N     . ILE A 1 271 ? -6.128  -4.429  -11.870 1.00 22.79 ? 317 ILE A N     1 
ATOM   2119 C CA    . ILE A 1 271 ? -7.482  -3.876  -11.948 1.00 22.97 ? 317 ILE A CA    1 
ATOM   2120 C C     . ILE A 1 271 ? -8.289  -4.793  -12.844 1.00 24.70 ? 317 ILE A C     1 
ATOM   2121 O O     . ILE A 1 271 ? -8.037  -4.914  -14.075 1.00 23.57 ? 317 ILE A O     1 
ATOM   2122 C CB    . ILE A 1 271 ? -7.553  -2.393  -12.445 1.00 23.70 ? 317 ILE A CB    1 
ATOM   2123 C CG1   . ILE A 1 271 ? -6.455  -1.531  -11.780 1.00 20.52 ? 317 ILE A CG1   1 
ATOM   2124 C CG2   . ILE A 1 271 ? -8.979  -1.823  -12.209 1.00 23.21 ? 317 ILE A CG2   1 
ATOM   2125 C CD1   . ILE A 1 271 ? -6.544  -0.052  -12.028 1.00 20.65 ? 317 ILE A CD1   1 
ATOM   2126 N N     . ASN A 1 272 ? -9.238  -5.463  -12.187 1.00 24.94 ? 318 ASN A N     1 
ATOM   2127 C CA    . ASN A 1 272 ? -9.960  -6.571  -12.770 1.00 25.78 ? 318 ASN A CA    1 
ATOM   2128 C C     . ASN A 1 272 ? -11.395 -6.215  -13.069 1.00 25.81 ? 318 ASN A C     1 
ATOM   2129 O O     . ASN A 1 272 ? -11.952 -5.332  -12.435 1.00 25.64 ? 318 ASN A O     1 
ATOM   2130 C CB    . ASN A 1 272 ? -9.939  -7.737  -11.799 1.00 25.07 ? 318 ASN A CB    1 
ATOM   2131 C CG    . ASN A 1 272 ? -8.604  -8.429  -11.728 1.00 25.95 ? 318 ASN A CG    1 
ATOM   2132 O OD1   . ASN A 1 272 ? -7.682  -8.168  -12.529 1.00 28.24 ? 318 ASN A OD1   1 
ATOM   2133 N ND2   . ASN A 1 272 ? -8.483  -9.346  -10.764 1.00 19.05 ? 318 ASN A ND2   1 
ATOM   2134 N N     . SER A 1 273 ? -12.000 -6.896  -14.033 1.00 27.41 ? 319 SER A N     1 
ATOM   2135 C CA    . SER A 1 273 ? -13.442 -6.717  -14.223 1.00 29.23 ? 319 SER A CA    1 
ATOM   2136 C C     . SER A 1 273 ? -14.076 -7.824  -13.392 1.00 31.46 ? 319 SER A C     1 
ATOM   2137 O O     . SER A 1 273 ? -13.461 -8.902  -13.222 1.00 31.02 ? 319 SER A O     1 
ATOM   2138 C CB    . SER A 1 273 ? -13.898 -6.826  -15.682 1.00 28.03 ? 319 SER A CB    1 
ATOM   2139 O OG    . SER A 1 273 ? -13.851 -8.176  -16.150 1.00 24.02 ? 319 SER A OG    1 
ATOM   2140 N N     . GLU A 1 274 ? -15.281 -7.532  -12.871 1.00 33.86 ? 320 GLU A N     1 
ATOM   2141 C CA    . GLU A 1 274 ? -16.043 -8.479  -12.064 1.00 35.46 ? 320 GLU A CA    1 
ATOM   2142 C C     . GLU A 1 274 ? -16.394 -9.679  -12.924 1.00 35.66 ? 320 GLU A C     1 
ATOM   2143 O O     . GLU A 1 274 ? -16.182 -10.845 -12.535 1.00 36.10 ? 320 GLU A O     1 
ATOM   2144 C CB    . GLU A 1 274 ? -17.288 -7.815  -11.425 1.00 35.84 ? 320 GLU A CB    1 
ATOM   2145 C CG    . GLU A 1 274 ? -18.329 -8.816  -10.829 1.00 38.74 ? 320 GLU A CG    1 
ATOM   2146 C CD    . GLU A 1 274 ? -19.270 -8.205  -9.805  1.00 36.90 ? 320 GLU A CD    1 
ATOM   2147 O OE1   . GLU A 1 274 ? -19.834 -7.145  -10.050 1.00 43.83 ? 320 GLU A OE1   1 
ATOM   2148 O OE2   . GLU A 1 274 ? -19.445 -8.774  -8.715  1.00 44.85 ? 320 GLU A OE2   1 
ATOM   2149 N N     . TYR A 1 275 ? -16.835 -9.399  -14.145 1.00 36.05 ? 321 TYR A N     1 
ATOM   2150 C CA    . TYR A 1 275 ? -17.426 -10.460 -14.960 1.00 34.97 ? 321 TYR A CA    1 
ATOM   2151 C C     . TYR A 1 275 ? -16.490 -11.368 -15.756 1.00 33.71 ? 321 TYR A C     1 
ATOM   2152 O O     . TYR A 1 275 ? -16.941 -12.334 -16.316 1.00 35.15 ? 321 TYR A O     1 
ATOM   2153 C CB    . TYR A 1 275 ? -18.653 -9.940  -15.791 1.00 35.43 ? 321 TYR A CB    1 
ATOM   2154 C CG    . TYR A 1 275 ? -19.774 -9.342  -14.935 1.00 33.48 ? 321 TYR A CG    1 
ATOM   2155 C CD1   . TYR A 1 275 ? -19.971 -9.766  -13.618 1.00 37.23 ? 321 TYR A CD1   1 
ATOM   2156 C CD2   . TYR A 1 275 ? -20.613 -8.367  -15.430 1.00 34.44 ? 321 TYR A CD2   1 
ATOM   2157 C CE1   . TYR A 1 275 ? -20.979 -9.255  -12.814 1.00 36.42 ? 321 TYR A CE1   1 
ATOM   2158 C CE2   . TYR A 1 275 ? -21.635 -7.818  -14.647 1.00 36.79 ? 321 TYR A CE2   1 
ATOM   2159 C CZ    . TYR A 1 275 ? -21.822 -8.264  -13.325 1.00 37.54 ? 321 TYR A CZ    1 
ATOM   2160 O OH    . TYR A 1 275 ? -22.832 -7.736  -12.506 1.00 34.52 ? 321 TYR A OH    1 
ATOM   2161 N N     . PHE A 1 276 ? -15.194 -11.115 -15.767 1.00 33.03 ? 322 PHE A N     1 
ATOM   2162 C CA    . PHE A 1 276 ? -14.216 -11.876 -16.629 1.00 31.28 ? 322 PHE A CA    1 
ATOM   2163 C C     . PHE A 1 276 ? -13.354 -12.883 -15.883 1.00 31.65 ? 322 PHE A C     1 
ATOM   2164 O O     . PHE A 1 276 ? -12.886 -13.847 -16.463 1.00 32.70 ? 322 PHE A O     1 
ATOM   2165 C CB    . PHE A 1 276 ? -13.249 -10.879 -17.334 1.00 31.43 ? 322 PHE A CB    1 
ATOM   2166 C CG    . PHE A 1 276 ? -12.017 -11.542 -18.023 1.00 31.62 ? 322 PHE A CG    1 
ATOM   2167 C CD1   . PHE A 1 276 ? -12.113 -12.076 -19.322 1.00 24.40 ? 322 PHE A CD1   1 
ATOM   2168 C CD2   . PHE A 1 276 ? -10.779 -11.603 -17.364 1.00 29.09 ? 322 PHE A CD2   1 
ATOM   2169 C CE1   . PHE A 1 276 ? -11.011 -12.680 -19.948 1.00 28.59 ? 322 PHE A CE1   1 
ATOM   2170 C CE2   . PHE A 1 276 ? -9.641  -12.205 -17.979 1.00 27.83 ? 322 PHE A CE2   1 
ATOM   2171 C CZ    . PHE A 1 276 ? -9.761  -12.744 -19.275 1.00 30.60 ? 322 PHE A CZ    1 
ATOM   2172 N N     . GLN A 1 277 ? -13.096 -12.672 -14.603 1.00 31.07 ? 323 GLN A N     1 
ATOM   2173 C CA    . GLN A 1 277 ? -12.017 -13.430 -13.972 1.00 30.99 ? 323 GLN A CA    1 
ATOM   2174 C C     . GLN A 1 277 ? -12.443 -14.842 -13.604 1.00 31.98 ? 323 GLN A C     1 
ATOM   2175 O O     . GLN A 1 277 ? -13.623 -15.105 -13.374 1.00 31.33 ? 323 GLN A O     1 
ATOM   2176 C CB    . GLN A 1 277 ? -11.493 -12.707 -12.725 1.00 31.08 ? 323 GLN A CB    1 
ATOM   2177 C CG    . GLN A 1 277 ? -10.586 -11.518 -13.027 1.00 30.06 ? 323 GLN A CG    1 
ATOM   2178 C CD    . GLN A 1 277 ? -9.364  -11.873 -13.840 1.00 26.62 ? 323 GLN A CD    1 
ATOM   2179 O OE1   . GLN A 1 277 ? -8.693  -12.907 -13.634 1.00 29.61 ? 323 GLN A OE1   1 
ATOM   2180 N NE2   . GLN A 1 277 ? -9.053  -11.009 -14.773 1.00 27.45 ? 323 GLN A NE2   1 
ATOM   2181 N N     . TYR A 1 278 ? -11.459 -15.740 -13.556 1.00 31.85 ? 324 TYR A N     1 
ATOM   2182 C CA    . TYR A 1 278 ? -11.691 -17.113 -13.179 1.00 31.53 ? 324 TYR A CA    1 
ATOM   2183 C C     . TYR A 1 278 ? -10.551 -17.618 -12.323 1.00 31.77 ? 324 TYR A C     1 
ATOM   2184 O O     . TYR A 1 278 ? -9.436  -17.075 -12.391 1.00 31.42 ? 324 TYR A O     1 
ATOM   2185 C CB    . TYR A 1 278 ? -11.883 -17.994 -14.392 1.00 31.05 ? 324 TYR A CB    1 
ATOM   2186 C CG    . TYR A 1 278 ? -10.851 -17.862 -15.453 1.00 29.73 ? 324 TYR A CG    1 
ATOM   2187 C CD1   . TYR A 1 278 ? -9.903  -18.874 -15.649 1.00 26.31 ? 324 TYR A CD1   1 
ATOM   2188 C CD2   . TYR A 1 278 ? -10.869 -16.754 -16.326 1.00 28.99 ? 324 TYR A CD2   1 
ATOM   2189 C CE1   . TYR A 1 278 ? -8.948  -18.753 -16.635 1.00 29.14 ? 324 TYR A CE1   1 
ATOM   2190 C CE2   . TYR A 1 278 ? -9.927  -16.635 -17.334 1.00 29.54 ? 324 TYR A CE2   1 
ATOM   2191 C CZ    . TYR A 1 278 ? -8.977  -17.618 -17.490 1.00 30.75 ? 324 TYR A CZ    1 
ATOM   2192 O OH    . TYR A 1 278 ? -8.031  -17.489 -18.513 1.00 32.82 ? 324 TYR A OH    1 
ATOM   2193 N N     . PRO A 1 279 ? -10.830 -18.644 -11.496 1.00 31.70 ? 325 PRO A N     1 
ATOM   2194 C CA    . PRO A 1 279 ? -9.843  -19.080 -10.455 1.00 30.54 ? 325 PRO A CA    1 
ATOM   2195 C C     . PRO A 1 279 ? -8.464  -19.405 -11.014 1.00 30.20 ? 325 PRO A C     1 
ATOM   2196 O O     . PRO A 1 279 ? -7.452  -19.093 -10.365 1.00 30.04 ? 325 PRO A O     1 
ATOM   2197 C CB    . PRO A 1 279 ? -10.498 -20.325 -9.803  1.00 29.62 ? 325 PRO A CB    1 
ATOM   2198 C CG    . PRO A 1 279 ? -12.048 -20.080 -9.998  1.00 30.77 ? 325 PRO A CG    1 
ATOM   2199 C CD    . PRO A 1 279 ? -12.098 -19.423 -11.437 1.00 31.98 ? 325 PRO A CD    1 
ATOM   2200 N N     . ALA A 1 280 ? -8.401  -20.022 -12.190 1.00 29.13 ? 326 ALA A N     1 
ATOM   2201 C CA    . ALA A 1 280 ? -7.122  -20.505 -12.693 1.00 28.67 ? 326 ALA A CA    1 
ATOM   2202 C C     . ALA A 1 280 ? -6.247  -19.318 -13.124 1.00 28.40 ? 326 ALA A C     1 
ATOM   2203 O O     . ALA A 1 280 ? -5.018  -19.394 -13.146 1.00 29.10 ? 326 ALA A O     1 
ATOM   2204 C CB    . ALA A 1 280 ? -7.344  -21.432 -13.823 1.00 29.76 ? 326 ALA A CB    1 
ATOM   2205 N N     . ASN A 1 281 ? -6.913  -18.214 -13.425 1.00 27.03 ? 327 ASN A N     1 
ATOM   2206 C CA    . ASN A 1 281 ? -6.277  -16.972 -13.762 1.00 26.38 ? 327 ASN A CA    1 
ATOM   2207 C C     . ASN A 1 281 ? -5.868  -16.137 -12.521 1.00 26.57 ? 327 ASN A C     1 
ATOM   2208 O O     . ASN A 1 281 ? -4.755  -15.633 -12.477 1.00 26.19 ? 327 ASN A O     1 
ATOM   2209 C CB    . ASN A 1 281 ? -7.199  -16.186 -14.691 1.00 25.40 ? 327 ASN A CB    1 
ATOM   2210 C CG    . ASN A 1 281 ? -6.441  -15.255 -15.596 1.00 25.42 ? 327 ASN A CG    1 
ATOM   2211 O OD1   . ASN A 1 281 ? -6.692  -14.062 -15.612 1.00 24.27 ? 327 ASN A OD1   1 
ATOM   2212 N ND2   . ASN A 1 281 ? -5.495  -15.793 -16.326 1.00 23.93 ? 327 ASN A ND2   1 
ATOM   2213 N N     . ILE A 1 282 ? -6.778  -16.022 -11.549 1.00 26.31 ? 328 ILE A N     1 
ATOM   2214 C CA    . ILE A 1 282 ? -6.579  -15.365 -10.267 1.00 26.23 ? 328 ILE A CA    1 
ATOM   2215 C C     . ILE A 1 282 ? -5.452  -15.995 -9.461  1.00 27.58 ? 328 ILE A C     1 
ATOM   2216 O O     . ILE A 1 282 ? -4.674  -15.306 -8.791  1.00 28.32 ? 328 ILE A O     1 
ATOM   2217 C CB    . ILE A 1 282 ? -7.935  -15.324 -9.475  1.00 26.17 ? 328 ILE A CB    1 
ATOM   2218 C CG1   . ILE A 1 282 ? -8.927  -14.393 -10.204 1.00 24.75 ? 328 ILE A CG1   1 
ATOM   2219 C CG2   . ILE A 1 282 ? -7.787  -14.932 -7.961  1.00 24.39 ? 328 ILE A CG2   1 
ATOM   2220 C CD1   . ILE A 1 282 ? -8.550  -12.947 -10.119 1.00 23.02 ? 328 ILE A CD1   1 
ATOM   2221 N N     . ILE A 1 283 ? -5.321  -17.298 -9.583  1.00 27.54 ? 329 ILE A N     1 
ATOM   2222 C CA    . ILE A 1 283 ? -4.289  -18.016 -8.903  1.00 28.19 ? 329 ILE A CA    1 
ATOM   2223 C C     . ILE A 1 283 ? -2.839  -17.636 -9.379  1.00 28.69 ? 329 ILE A C     1 
ATOM   2224 O O     . ILE A 1 283 ? -1.893  -17.629 -8.576  1.00 28.23 ? 329 ILE A O     1 
ATOM   2225 C CB    . ILE A 1 283 ? -4.577  -19.527 -8.901  1.00 26.73 ? 329 ILE A CB    1 
ATOM   2226 C CG1   . ILE A 1 283 ? -3.854  -20.181 -7.764  1.00 27.72 ? 329 ILE A CG1   1 
ATOM   2227 C CG2   . ILE A 1 283 ? -4.105  -20.150 -10.113 1.00 29.47 ? 329 ILE A CG2   1 
ATOM   2228 C CD1   . ILE A 1 283 ? -4.383  -19.657 -6.420  1.00 29.58 ? 329 ILE A CD1   1 
ATOM   2229 N N     . LYS A 1 284 ? -2.682  -17.352 -10.670 1.00 28.60 ? 330 LYS A N     1 
ATOM   2230 C CA    . LYS A 1 284 ? -1.439  -16.789 -11.197 1.00 28.48 ? 330 LYS A CA    1 
ATOM   2231 C C     . LYS A 1 284 ? -1.182  -15.393 -10.639 1.00 26.69 ? 330 LYS A C     1 
ATOM   2232 O O     . LYS A 1 284 ? -0.053  -15.077 -10.279 1.00 26.87 ? 330 LYS A O     1 
ATOM   2233 C CB    . LYS A 1 284 ? -1.461  -16.727 -12.717 1.00 28.31 ? 330 LYS A CB    1 
ATOM   2234 C CG    . LYS A 1 284 ? -1.644  -18.060 -13.394 1.00 32.82 ? 330 LYS A CG    1 
ATOM   2235 C CD    . LYS A 1 284 ? -0.613  -19.074 -12.946 1.00 38.60 ? 330 LYS A CD    1 
ATOM   2236 C CE    . LYS A 1 284 ? -0.542  -20.247 -13.932 1.00 43.31 ? 330 LYS A CE    1 
ATOM   2237 N NZ    . LYS A 1 284 ? 0.737   -21.045 -13.746 1.00 46.17 ? 330 LYS A NZ    1 
ATOM   2238 N N     . MET A 1 285 ? -2.205  -14.548 -10.609 1.00 25.80 ? 331 MET A N     1 
ATOM   2239 C CA    . MET A 1 285 ? -2.087  -13.236 -9.947  1.00 26.12 ? 331 MET A CA    1 
ATOM   2240 C C     . MET A 1 285 ? -1.648  -13.328 -8.478  1.00 26.52 ? 331 MET A C     1 
ATOM   2241 O O     . MET A 1 285 ? -0.796  -12.574 -8.032  1.00 28.66 ? 331 MET A O     1 
ATOM   2242 C CB    . MET A 1 285 ? -3.395  -12.449 -10.034 1.00 25.36 ? 331 MET A CB    1 
ATOM   2243 C CG    . MET A 1 285 ? -3.887  -12.131 -11.445 1.00 24.81 ? 331 MET A CG    1 
ATOM   2244 S SD    . MET A 1 285 ? -5.378  -11.157 -11.341 1.00 26.82 ? 331 MET A SD    1 
ATOM   2245 C CE    . MET A 1 285 ? -5.732  -10.942 -13.084 1.00 24.21 ? 331 MET A CE    1 
ATOM   2246 N N     . LYS A 1 286 ? -2.229  -14.235 -7.717  1.00 27.31 ? 332 LYS A N     1 
ATOM   2247 C CA    . LYS A 1 286 ? -1.862  -14.419 -6.305  1.00 29.31 ? 332 LYS A CA    1 
ATOM   2248 C C     . LYS A 1 286 ? -0.412  -14.876 -6.114  1.00 28.23 ? 332 LYS A C     1 
ATOM   2249 O O     . LYS A 1 286 ? 0.176   -14.595 -5.098  1.00 28.00 ? 332 LYS A O     1 
ATOM   2250 C CB    . LYS A 1 286 ? -2.837  -15.355 -5.591  1.00 28.60 ? 332 LYS A CB    1 
ATOM   2251 C CG    . LYS A 1 286 ? -4.234  -14.750 -5.285  1.00 31.39 ? 332 LYS A CG    1 
ATOM   2252 C CD    . LYS A 1 286 ? -5.102  -15.832 -4.613  1.00 32.30 ? 332 LYS A CD    1 
ATOM   2253 C CE    . LYS A 1 286 ? -6.119  -15.321 -3.590  1.00 40.46 ? 332 LYS A CE    1 
ATOM   2254 N NZ    . LYS A 1 286 ? -7.515  -15.089 -4.151  1.00 44.65 ? 332 LYS A NZ    1 
ATOM   2255 N N     . LYS A 1 287 ? 0.151   -15.571 -7.104  1.00 28.24 ? 333 LYS A N     1 
ATOM   2256 C CA    . LYS A 1 287 ? 1.581   -15.968 -7.120  1.00 28.26 ? 333 LYS A CA    1 
ATOM   2257 C C     . LYS A 1 287 ? 2.602   -14.787 -7.175  1.00 27.53 ? 333 LYS A C     1 
ATOM   2258 O O     . LYS A 1 287 ? 3.792   -14.961 -6.898  1.00 27.13 ? 333 LYS A O     1 
ATOM   2259 C CB    . LYS A 1 287 ? 1.843   -16.851 -8.317  1.00 27.93 ? 333 LYS A CB    1 
ATOM   2260 C CG    . LYS A 1 287 ? 1.818   -18.275 -8.033  1.00 33.15 ? 333 LYS A CG    1 
ATOM   2261 C CD    . LYS A 1 287 ? 1.873   -19.068 -9.361  1.00 38.88 ? 333 LYS A CD    1 
ATOM   2262 C CE    . LYS A 1 287 ? 3.223   -19.651 -9.635  1.00 41.81 ? 333 LYS A CE    1 
ATOM   2263 N NZ    . LYS A 1 287 ? 3.252   -20.085 -11.071 1.00 48.63 ? 333 LYS A NZ    1 
ATOM   2264 N N     . CYS A 1 288 ? 2.135   -13.608 -7.540  1.00 26.75 ? 334 CYS A N     1 
ATOM   2265 C CA    . CYS A 1 288 ? 2.995   -12.400 -7.583  1.00 26.98 ? 334 CYS A CA    1 
ATOM   2266 C C     . CYS A 1 288 ? 3.167   -11.748 -6.198  1.00 26.43 ? 334 CYS A C     1 
ATOM   2267 O O     . CYS A 1 288 ? 4.033   -10.907 -6.002  1.00 27.80 ? 334 CYS A O     1 
ATOM   2268 C CB    . CYS A 1 288 ? 2.387   -11.377 -8.568  1.00 26.21 ? 334 CYS A CB    1 
ATOM   2269 S SG    . CYS A 1 288 ? 2.307   -11.948 -10.280 1.00 26.43 ? 334 CYS A SG    1 
ATOM   2270 N N     . TYR A 1 289 ? 2.328   -12.138 -5.248  1.00 25.96 ? 335 TYR A N     1 
ATOM   2271 C CA    . TYR A 1 289 ? 2.285   -11.573 -3.923  1.00 25.21 ? 335 TYR A CA    1 
ATOM   2272 C C     . TYR A 1 289 ? 3.429   -12.156 -3.042  1.00 26.99 ? 335 TYR A C     1 
ATOM   2273 O O     . TYR A 1 289 ? 3.760   -13.346 -3.128  1.00 28.09 ? 335 TYR A O     1 
ATOM   2274 C CB    . TYR A 1 289 ? 0.933   -11.900 -3.331  1.00 23.29 ? 335 TYR A CB    1 
ATOM   2275 C CG    . TYR A 1 289 ? -0.169  -10.928 -3.701  1.00 23.23 ? 335 TYR A CG    1 
ATOM   2276 C CD1   . TYR A 1 289 ? -0.779  -10.949 -4.976  1.00 20.73 ? 335 TYR A CD1   1 
ATOM   2277 C CD2   . TYR A 1 289 ? -0.600  -9.979  -2.789  1.00 22.07 ? 335 TYR A CD2   1 
ATOM   2278 C CE1   . TYR A 1 289 ? -1.830  -10.029 -5.306  1.00 21.03 ? 335 TYR A CE1   1 
ATOM   2279 C CE2   . TYR A 1 289 ? -1.627  -9.061  -3.108  1.00 23.20 ? 335 TYR A CE2   1 
ATOM   2280 C CZ    . TYR A 1 289 ? -2.240  -9.108  -4.357  1.00 22.07 ? 335 TYR A CZ    1 
ATOM   2281 O OH    . TYR A 1 289 ? -3.217  -8.190  -4.646  1.00 22.63 ? 335 TYR A OH    1 
ATOM   2282 N N     . SER A 1 290 ? 4.009   -11.318 -2.183  1.00 28.28 ? 336 SER A N     1 
ATOM   2283 C CA    . SER A 1 290 ? 5.230   -11.620 -1.401  1.00 28.23 ? 336 SER A CA    1 
ATOM   2284 C C     . SER A 1 290 ? 5.277   -10.431 -0.451  1.00 27.87 ? 336 SER A C     1 
ATOM   2285 O O     . SER A 1 290 ? 5.072   -9.286  -0.904  1.00 27.52 ? 336 SER A O     1 
ATOM   2286 C CB    . SER A 1 290 ? 6.449   -11.563 -2.322  1.00 28.05 ? 336 SER A CB    1 
ATOM   2287 O OG    . SER A 1 290 ? 7.521   -12.352 -1.852  1.00 34.94 ? 336 SER A OG    1 
ATOM   2288 N N     . PRO A 1 291 ? 5.528   -10.676 0.864   1.00 27.75 ? 337 PRO A N     1 
ATOM   2289 C CA    . PRO A 1 291 ? 5.609   -9.597  1.866   1.00 26.60 ? 337 PRO A CA    1 
ATOM   2290 C C     . PRO A 1 291 ? 6.577   -8.491  1.476   1.00 26.00 ? 337 PRO A C     1 
ATOM   2291 O O     . PRO A 1 291 ? 6.343   -7.315  1.809   1.00 24.26 ? 337 PRO A O     1 
ATOM   2292 C CB    . PRO A 1 291 ? 6.094   -10.327 3.143   1.00 25.63 ? 337 PRO A CB    1 
ATOM   2293 C CG    . PRO A 1 291 ? 5.570   -11.695 2.981   1.00 27.15 ? 337 PRO A CG    1 
ATOM   2294 C CD    . PRO A 1 291 ? 5.771   -11.999 1.496   1.00 27.87 ? 337 PRO A CD    1 
ATOM   2295 N N     . ASP A 1 292 ? 7.638   -8.879  0.757   1.00 25.79 ? 338 ASP A N     1 
ATOM   2296 C CA    . ASP A 1 292 ? 8.664   -7.940  0.292   1.00 27.30 ? 338 ASP A CA    1 
ATOM   2297 C C     . ASP A 1 292 ? 8.294   -7.197  -0.995  1.00 26.73 ? 338 ASP A C     1 
ATOM   2298 O O     . ASP A 1 292 ? 9.087   -6.391  -1.471  1.00 27.39 ? 338 ASP A O     1 
ATOM   2299 C CB    . ASP A 1 292 ? 9.980   -8.653  0.059   1.00 27.24 ? 338 ASP A CB    1 
ATOM   2300 C CG    . ASP A 1 292 ? 9.835   -9.767  -0.916  1.00 31.25 ? 338 ASP A CG    1 
ATOM   2301 O OD1   . ASP A 1 292 ? 8.816   -10.465 -0.873  1.00 40.63 ? 338 ASP A OD1   1 
ATOM   2302 O OD2   . ASP A 1 292 ? 10.714  -9.974  -1.740  1.00 37.62 ? 338 ASP A OD2   1 
ATOM   2303 N N     . LYS A 1 293 ? 7.094   -7.417  -1.532  1.00 26.30 ? 339 LYS A N     1 
ATOM   2304 C CA    . LYS A 1 293 ? 6.690   -6.698  -2.738  1.00 26.39 ? 339 LYS A CA    1 
ATOM   2305 C C     . LYS A 1 293 ? 5.363   -6.003  -2.570  1.00 26.60 ? 339 LYS A C     1 
ATOM   2306 O O     . LYS A 1 293 ? 4.532   -6.450  -1.772  1.00 26.56 ? 339 LYS A O     1 
ATOM   2307 C CB    . LYS A 1 293 ? 6.609   -7.646  -3.908  1.00 25.17 ? 339 LYS A CB    1 
ATOM   2308 C CG    . LYS A 1 293 ? 7.933   -7.988  -4.436  1.00 26.84 ? 339 LYS A CG    1 
ATOM   2309 C CD    . LYS A 1 293 ? 7.815   -9.208  -5.264  1.00 25.46 ? 339 LYS A CD    1 
ATOM   2310 C CE    . LYS A 1 293 ? 9.226   -9.801  -5.473  1.00 33.29 ? 339 LYS A CE    1 
ATOM   2311 N NZ    . LYS A 1 293 ? 9.605   -10.902 -4.519  1.00 32.54 ? 339 LYS A NZ    1 
ATOM   2312 N N     . GLU A 1 294 ? 5.167   -4.914  -3.329  1.00 26.78 ? 340 GLU A N     1 
ATOM   2313 C CA    . GLU A 1 294 ? 3.891   -4.236  -3.340  1.00 27.01 ? 340 GLU A CA    1 
ATOM   2314 C C     . GLU A 1 294 ? 2.966   -4.728  -4.480  1.00 26.68 ? 340 GLU A C     1 
ATOM   2315 O O     . GLU A 1 294 ? 3.264   -4.535  -5.654  1.00 26.89 ? 340 GLU A O     1 
ATOM   2316 C CB    . GLU A 1 294 ? 4.079   -2.712  -3.314  1.00 26.33 ? 340 GLU A CB    1 
ATOM   2317 C CG    . GLU A 1 294 ? 2.773   -1.915  -3.539  1.00 29.52 ? 340 GLU A CG    1 
ATOM   2318 C CD    . GLU A 1 294 ? 1.720   -2.017  -2.445  1.00 32.33 ? 340 GLU A CD    1 
ATOM   2319 O OE1   . GLU A 1 294 ? 1.612   -3.037  -1.731  1.00 36.19 ? 340 GLU A OE1   1 
ATOM   2320 O OE2   . GLU A 1 294 ? 0.924   -1.064  -2.328  1.00 35.38 ? 340 GLU A OE2   1 
ATOM   2321 N N     . ARG A 1 295 ? 1.872   -5.402  -4.105  1.00 26.16 ? 341 ARG A N     1 
ATOM   2322 C CA    . ARG A 1 295 ? 0.797   -5.771  -5.025  1.00 26.10 ? 341 ARG A CA    1 
ATOM   2323 C C     . ARG A 1 295 ? -0.564  -5.340  -4.506  1.00 26.27 ? 341 ARG A C     1 
ATOM   2324 O O     . ARG A 1 295 ? -0.896  -5.565  -3.348  1.00 26.03 ? 341 ARG A O     1 
ATOM   2325 C CB    . ARG A 1 295 ? 0.783   -7.265  -5.307  1.00 25.38 ? 341 ARG A CB    1 
ATOM   2326 C CG    . ARG A 1 295 ? 1.794   -7.686  -6.309  1.00 26.99 ? 341 ARG A CG    1 
ATOM   2327 C CD    . ARG A 1 295 ? 3.177   -7.893  -5.648  1.00 29.02 ? 341 ARG A CD    1 
ATOM   2328 N NE    . ARG A 1 295 ? 4.150   -8.447  -6.582  1.00 22.29 ? 341 ARG A NE    1 
ATOM   2329 C CZ    . ARG A 1 295 ? 4.990   -7.720  -7.333  1.00 22.20 ? 341 ARG A CZ    1 
ATOM   2330 N NH1   . ARG A 1 295 ? 5.012   -6.413  -7.260  1.00 18.85 ? 341 ARG A NH1   1 
ATOM   2331 N NH2   . ARG A 1 295 ? 5.837   -8.318  -8.140  1.00 20.97 ? 341 ARG A NH2   1 
ATOM   2332 N N     . LYS A 1 296 ? -1.323  -4.662  -5.364  1.00 26.50 ? 342 LYS A N     1 
ATOM   2333 C CA    . LYS A 1 296 ? -2.715  -4.313  -5.081  1.00 26.60 ? 342 LYS A CA    1 
ATOM   2334 C C     . LYS A 1 296 ? -3.621  -4.922  -6.148  1.00 25.85 ? 342 LYS A C     1 
ATOM   2335 O O     . LYS A 1 296 ? -3.176  -5.151  -7.245  1.00 24.66 ? 342 LYS A O     1 
ATOM   2336 C CB    . LYS A 1 296 ? -2.924  -2.811  -5.002  1.00 25.63 ? 342 LYS A CB    1 
ATOM   2337 C CG    . LYS A 1 296 ? -1.997  -2.121  -4.061  1.00 29.43 ? 342 LYS A CG    1 
ATOM   2338 C CD    . LYS A 1 296 ? -2.151  -2.555  -2.594  1.00 32.61 ? 342 LYS A CD    1 
ATOM   2339 C CE    . LYS A 1 296 ? -3.318  -1.926  -1.890  1.00 34.12 ? 342 LYS A CE    1 
ATOM   2340 N NZ    . LYS A 1 296 ? -3.545  -2.604  -0.553  1.00 39.99 ? 342 LYS A NZ    1 
ATOM   2341 N N     . MET A 1 297 ? -4.863  -5.198  -5.754  1.00 25.79 ? 343 MET A N     1 
ATOM   2342 C CA    . MET A 1 297 ? -5.895  -5.716  -6.589  1.00 26.66 ? 343 MET A CA    1 
ATOM   2343 C C     . MET A 1 297 ? -7.236  -5.105  -6.186  1.00 27.49 ? 343 MET A C     1 
ATOM   2344 O O     . MET A 1 297 ? -7.611  -5.032  -4.973  1.00 28.92 ? 343 MET A O     1 
ATOM   2345 C CB    . MET A 1 297 ? -5.948  -7.224  -6.474  1.00 26.95 ? 343 MET A CB    1 
ATOM   2346 C CG    . MET A 1 297 ? -6.753  -7.878  -7.551  1.00 27.82 ? 343 MET A CG    1 
ATOM   2347 S SD    . MET A 1 297 ? -7.076  -9.595  -7.217  1.00 29.30 ? 343 MET A SD    1 
ATOM   2348 C CE    . MET A 1 297 ? -5.486  -10.376 -7.556  1.00 24.83 ? 343 MET A CE    1 
ATOM   2349 N N     . ILE A 1 298 ? -7.949  -4.614  -7.187  1.00 27.43 ? 344 ILE A N     1 
ATOM   2350 C CA    . ILE A 1 298 ? -9.354  -4.173  -7.021  1.00 26.57 ? 344 ILE A CA    1 
ATOM   2351 C C     . ILE A 1 298 ? -10.225 -4.810  -8.109  1.00 28.07 ? 344 ILE A C     1 
ATOM   2352 O O     . ILE A 1 298 ? -9.726  -5.243  -9.161  1.00 28.73 ? 344 ILE A O     1 
ATOM   2353 C CB    . ILE A 1 298 ? -9.527  -2.636  -7.021  1.00 26.70 ? 344 ILE A CB    1 
ATOM   2354 C CG1   . ILE A 1 298 ? -9.158  -2.037  -8.414  1.00 24.15 ? 344 ILE A CG1   1 
ATOM   2355 C CG2   . ILE A 1 298 ? -8.848  -2.024  -5.800  1.00 24.14 ? 344 ILE A CG2   1 
ATOM   2356 C CD1   . ILE A 1 298 ? -9.631  -0.596  -8.606  1.00 23.74 ? 344 ILE A CD1   1 
ATOM   2357 N N     . THR A 1 299 ? -11.518 -4.910  -7.855  1.00 28.06 ? 345 THR A N     1 
ATOM   2358 C CA    . THR A 1 299 ? -12.390 -5.444  -8.889  1.00 28.71 ? 345 THR A CA    1 
ATOM   2359 C C     . THR A 1 299 ? -13.496 -4.436  -9.126  1.00 29.28 ? 345 THR A C     1 
ATOM   2360 O O     . THR A 1 299 ? -14.008 -3.866  -8.160  1.00 29.86 ? 345 THR A O     1 
ATOM   2361 C CB    . THR A 1 299 ? -12.918 -6.839  -8.522  1.00 28.04 ? 345 THR A CB    1 
ATOM   2362 O OG1   . THR A 1 299 ? -11.798 -7.721  -8.403  1.00 31.78 ? 345 THR A OG1   1 
ATOM   2363 C CG2   . THR A 1 299 ? -13.891 -7.385  -9.580  1.00 25.24 ? 345 THR A CG2   1 
ATOM   2364 N N     . ILE A 1 300 ? -13.808 -4.167  -10.397 1.00 29.04 ? 346 ILE A N     1 
ATOM   2365 C CA    . ILE A 1 300 ? -14.871 -3.208  -10.716 1.00 29.33 ? 346 ILE A CA    1 
ATOM   2366 C C     . ILE A 1 300 ? -16.202 -3.960  -10.806 1.00 29.51 ? 346 ILE A C     1 
ATOM   2367 O O     . ILE A 1 300 ? -16.359 -4.943  -11.524 1.00 27.49 ? 346 ILE A O     1 
ATOM   2368 C CB    . ILE A 1 300 ? -14.609 -2.346  -11.982 1.00 30.03 ? 346 ILE A CB    1 
ATOM   2369 C CG1   . ILE A 1 300 ? -13.283 -1.592  -11.862 1.00 29.64 ? 346 ILE A CG1   1 
ATOM   2370 C CG2   . ILE A 1 300 ? -15.743 -1.305  -12.172 1.00 27.25 ? 346 ILE A CG2   1 
ATOM   2371 C CD1   . ILE A 1 300 ? -12.773 -1.057  -13.151 1.00 25.82 ? 346 ILE A CD1   1 
ATOM   2372 N N     . ARG A 1 301 ? -17.126 -3.503  -9.977  1.00 31.89 ? 347 ARG A N     1 
ATOM   2373 C CA    . ARG A 1 301 ? -18.440 -4.133  -9.844  1.00 34.85 ? 347 ARG A CA    1 
ATOM   2374 C C     . ARG A 1 301 ? -19.237 -3.878  -11.123 1.00 33.74 ? 347 ARG A C     1 
ATOM   2375 O O     . ARG A 1 301 ? -19.346 -2.720  -11.546 1.00 33.13 ? 347 ARG A O     1 
ATOM   2376 C CB    . ARG A 1 301 ? -19.178 -3.480  -8.680  1.00 34.53 ? 347 ARG A CB    1 
ATOM   2377 C CG    . ARG A 1 301 ? -19.381 -4.336  -7.480  1.00 38.77 ? 347 ARG A CG    1 
ATOM   2378 C CD    . ARG A 1 301 ? -20.551 -3.794  -6.553  1.00 38.79 ? 347 ARG A CD    1 
ATOM   2379 N NE    . ARG A 1 301 ? -21.893 -3.961  -7.125  1.00 43.90 ? 347 ARG A NE    1 
ATOM   2380 C CZ    . ARG A 1 301 ? -22.759 -2.972  -7.372  1.00 47.11 ? 347 ARG A CZ    1 
ATOM   2381 N NH1   . ARG A 1 301 ? -22.447 -1.694  -7.105  1.00 45.48 ? 347 ARG A NH1   1 
ATOM   2382 N NH2   . ARG A 1 301 ? -23.962 -3.274  -7.871  1.00 47.88 ? 347 ARG A NH2   1 
ATOM   2383 N N     . GLY A 1 302 ? -19.744 -4.956  -11.716 1.00 33.70 ? 348 GLY A N     1 
ATOM   2384 C CA    . GLY A 1 302 ? -20.673 -4.909  -12.858 1.00 34.34 ? 348 GLY A CA    1 
ATOM   2385 C C     . GLY A 1 302 ? -19.986 -4.800  -14.214 1.00 35.15 ? 348 GLY A C     1 
ATOM   2386 O O     . GLY A 1 302 ? -20.638 -4.609  -15.254 1.00 35.09 ? 348 GLY A O     1 
ATOM   2387 N N     . SER A 1 303 ? -18.657 -4.938  -14.196 1.00 34.61 ? 349 SER A N     1 
ATOM   2388 C CA    . SER A 1 303 ? -17.842 -4.738  -15.354 1.00 32.37 ? 349 SER A CA    1 
ATOM   2389 C C     . SER A 1 303 ? -17.516 -6.046  -15.996 1.00 31.62 ? 349 SER A C     1 
ATOM   2390 O O     . SER A 1 303 ? -17.501 -7.106  -15.361 1.00 32.12 ? 349 SER A O     1 
ATOM   2391 C CB    . SER A 1 303 ? -16.586 -3.945  -15.002 1.00 33.10 ? 349 SER A CB    1 
ATOM   2392 O OG    . SER A 1 303 ? -15.714 -4.726  -14.209 1.00 35.35 ? 349 SER A OG    1 
ATOM   2393 N N     . VAL A 1 304 ? -17.326 -5.950  -17.307 1.00 30.51 ? 350 VAL A N     1 
ATOM   2394 C CA    . VAL A 1 304 ? -16.998 -7.025  -18.211 1.00 28.88 ? 350 VAL A CA    1 
ATOM   2395 C C     . VAL A 1 304 ? -15.602 -6.629  -18.739 1.00 28.08 ? 350 VAL A C     1 
ATOM   2396 O O     . VAL A 1 304 ? -15.201 -5.470  -18.669 1.00 28.50 ? 350 VAL A O     1 
ATOM   2397 C CB    . VAL A 1 304 ? -18.014 -7.030  -19.413 1.00 29.71 ? 350 VAL A CB    1 
ATOM   2398 C CG1   . VAL A 1 304 ? -19.461 -7.366  -18.925 1.00 30.33 ? 350 VAL A CG1   1 
ATOM   2399 C CG2   . VAL A 1 304 ? -18.017 -5.613  -20.170 1.00 26.40 ? 350 VAL A CG2   1 
ATOM   2400 N N     . HIS A 1 305 ? -14.905 -7.601  -19.287 1.00 26.88 ? 351 HIS A N     1 
ATOM   2401 C CA    . HIS A 1 305 ? -13.621 -7.476  -19.857 1.00 25.91 ? 351 HIS A CA    1 
ATOM   2402 C C     . HIS A 1 305 ? -13.425 -6.252  -20.795 1.00 26.97 ? 351 HIS A C     1 
ATOM   2403 O O     . HIS A 1 305 ? -12.333 -5.649  -20.842 1.00 26.07 ? 351 HIS A O     1 
ATOM   2404 C CB    . HIS A 1 305 ? -13.377 -8.763  -20.614 1.00 24.70 ? 351 HIS A CB    1 
ATOM   2405 C CG    . HIS A 1 305 ? -11.927 -9.016  -20.919 1.00 26.93 ? 351 HIS A CG    1 
ATOM   2406 N ND1   . HIS A 1 305 ? -10.915 -8.746  -20.017 1.00 23.22 ? 351 HIS A ND1   1 
ATOM   2407 C CD2   . HIS A 1 305 ? -11.327 -9.577  -21.996 1.00 25.40 ? 351 HIS A CD2   1 
ATOM   2408 C CE1   . HIS A 1 305 ? -9.758  -9.128  -20.531 1.00 24.21 ? 351 HIS A CE1   1 
ATOM   2409 N NE2   . HIS A 1 305 ? -9.976  -9.626  -21.733 1.00 25.49 ? 351 HIS A NE2   1 
ATOM   2410 N N     . GLN A 1 306 ? -14.490 -5.911  -21.522 1.00 27.64 ? 352 GLN A N     1 
ATOM   2411 C CA    . GLN A 1 306 ? -14.462 -4.934  -22.639 1.00 28.51 ? 352 GLN A CA    1 
ATOM   2412 C C     . GLN A 1 306 ? -14.623 -3.551  -22.084 1.00 27.90 ? 352 GLN A C     1 
ATOM   2413 O O     . GLN A 1 306 ? -14.444 -2.593  -22.764 1.00 28.89 ? 352 GLN A O     1 
ATOM   2414 C CB    . GLN A 1 306 ? -15.540 -5.232  -23.685 1.00 27.95 ? 352 GLN A CB    1 
ATOM   2415 C CG    . GLN A 1 306 ? -15.187 -6.370  -24.643 1.00 29.76 ? 352 GLN A CG    1 
ATOM   2416 C CD    . GLN A 1 306 ? -13.883 -6.088  -25.454 1.00 33.92 ? 352 GLN A CD    1 
ATOM   2417 O OE1   . GLN A 1 306 ? -13.691 -4.989  -25.970 1.00 31.30 ? 352 GLN A OE1   1 
ATOM   2418 N NE2   . GLN A 1 306 ? -12.998 -7.085  -25.540 1.00 33.85 ? 352 GLN A NE2   1 
ATOM   2419 N N     . ASN A 1 307 ? -14.903 -3.454  -20.795 1.00 28.34 ? 353 ASN A N     1 
ATOM   2420 C CA    . ASN A 1 307 ? -15.032 -2.172  -20.152 1.00 27.28 ? 353 ASN A CA    1 
ATOM   2421 C C     . ASN A 1 307 ? -13.718 -1.351  -20.234 1.00 27.52 ? 353 ASN A C     1 
ATOM   2422 O O     . ASN A 1 307 ? -13.729 -0.097  -20.113 1.00 27.33 ? 353 ASN A O     1 
ATOM   2423 C CB    . ASN A 1 307 ? -15.506 -2.398  -18.701 1.00 27.65 ? 353 ASN A CB    1 
ATOM   2424 C CG    . ASN A 1 307 ? -17.072 -2.290  -18.536 1.00 29.99 ? 353 ASN A CG    1 
ATOM   2425 O OD1   . ASN A 1 307 ? -17.729 -3.266  -18.164 1.00 26.42 ? 353 ASN A OD1   1 
ATOM   2426 N ND2   . ASN A 1 307 ? -17.643 -1.095  -18.815 1.00 28.09 ? 353 ASN A ND2   1 
ATOM   2427 N N     . PHE A 1 308 ? -12.583 -2.042  -20.409 1.00 26.38 ? 354 PHE A N     1 
ATOM   2428 C CA    . PHE A 1 308 ? -11.296 -1.334  -20.415 1.00 26.87 ? 354 PHE A CA    1 
ATOM   2429 C C     . PHE A 1 308 ? -10.942 -0.729  -21.756 1.00 26.78 ? 354 PHE A C     1 
ATOM   2430 O O     . PHE A 1 308 ? -10.212 0.240   -21.807 1.00 27.62 ? 354 PHE A O     1 
ATOM   2431 C CB    . PHE A 1 308 ? -10.123 -2.161  -19.821 1.00 27.04 ? 354 PHE A CB    1 
ATOM   2432 C CG    . PHE A 1 308 ? -10.330 -2.557  -18.367 1.00 24.20 ? 354 PHE A CG    1 
ATOM   2433 C CD1   . PHE A 1 308 ? -9.981  -1.695  -17.347 1.00 22.74 ? 354 PHE A CD1   1 
ATOM   2434 C CD2   . PHE A 1 308 ? -10.924 -3.802  -18.050 1.00 25.11 ? 354 PHE A CD2   1 
ATOM   2435 C CE1   . PHE A 1 308 ? -10.198 -2.055  -16.006 1.00 23.91 ? 354 PHE A CE1   1 
ATOM   2436 C CE2   . PHE A 1 308 ? -11.156 -4.192  -16.746 1.00 25.52 ? 354 PHE A CE2   1 
ATOM   2437 C CZ    . PHE A 1 308 ? -10.797 -3.327  -15.711 1.00 27.75 ? 354 PHE A CZ    1 
ATOM   2438 N N     . ALA A 1 309 ? -11.487 -1.283  -22.828 1.00 27.57 ? 355 ALA A N     1 
ATOM   2439 C CA    . ALA A 1 309 ? -11.217 -0.845  -24.208 1.00 27.56 ? 355 ALA A CA    1 
ATOM   2440 C C     . ALA A 1 309 ? -12.365 0.006   -24.736 1.00 28.68 ? 355 ALA A C     1 
ATOM   2441 O O     . ALA A 1 309 ? -13.464 -0.032  -24.198 1.00 29.07 ? 355 ALA A O     1 
ATOM   2442 C CB    . ALA A 1 309 ? -11.046 -2.040  -25.074 1.00 26.41 ? 355 ALA A CB    1 
ATOM   2443 N N     . ASP A 1 310 ? -12.092 0.732   -25.824 1.00 29.42 ? 356 ASP A N     1 
ATOM   2444 C CA    . ASP A 1 310 ? -12.950 1.772   -26.415 1.00 28.79 ? 356 ASP A CA    1 
ATOM   2445 C C     . ASP A 1 310 ? -14.295 1.337   -27.032 1.00 29.14 ? 356 ASP A C     1 
ATOM   2446 O O     . ASP A 1 310 ? -15.168 2.199   -27.260 1.00 27.33 ? 356 ASP A O     1 
ATOM   2447 C CB    . ASP A 1 310 ? -12.176 2.557   -27.519 1.00 27.73 ? 356 ASP A CB    1 
ATOM   2448 C CG    . ASP A 1 310 ? -11.098 3.451   -26.983 1.00 25.90 ? 356 ASP A CG    1 
ATOM   2449 O OD1   . ASP A 1 310 ? -11.063 3.705   -25.773 1.00 21.84 ? 356 ASP A OD1   1 
ATOM   2450 O OD2   . ASP A 1 310 ? -10.261 3.935   -27.785 1.00 27.96 ? 356 ASP A OD2   1 
ATOM   2451 N N     . PHE A 1 311 ? -14.419 0.055   -27.398 1.00 30.82 ? 357 PHE A N     1 
ATOM   2452 C CA    . PHE A 1 311 ? -15.675 -0.477  -28.014 1.00 32.08 ? 357 PHE A CA    1 
ATOM   2453 C C     . PHE A 1 311 ? -16.830 -0.425  -26.980 1.00 33.01 ? 357 PHE A C     1 
ATOM   2454 O O     . PHE A 1 311 ? -17.988 -0.405  -27.327 1.00 33.13 ? 357 PHE A O     1 
ATOM   2455 C CB    . PHE A 1 311 ? -15.484 -1.880  -28.624 1.00 31.84 ? 357 PHE A CB    1 
ATOM   2456 C CG    . PHE A 1 311 ? -15.043 -1.865  -30.090 1.00 33.59 ? 357 PHE A CG    1 
ATOM   2457 C CD1   . PHE A 1 311 ? -15.961 -1.576  -31.113 1.00 36.22 ? 357 PHE A CD1   1 
ATOM   2458 C CD2   . PHE A 1 311 ? -13.713 -2.082  -30.444 1.00 33.19 ? 357 PHE A CD2   1 
ATOM   2459 C CE1   . PHE A 1 311 ? -15.564 -1.529  -32.456 1.00 33.89 ? 357 PHE A CE1   1 
ATOM   2460 C CE2   . PHE A 1 311 ? -13.301 -2.041  -31.779 1.00 31.87 ? 357 PHE A CE2   1 
ATOM   2461 C CZ    . PHE A 1 311 ? -14.228 -1.766  -32.787 1.00 34.33 ? 357 PHE A CZ    1 
ATOM   2462 N N     . THR A 1 312 ? -16.480 -0.321  -25.705 1.00 33.86 ? 358 THR A N     1 
ATOM   2463 C CA    . THR A 1 312 ? -17.443 -0.085  -24.645 1.00 35.04 ? 358 THR A CA    1 
ATOM   2464 C C     . THR A 1 312 ? -18.182 1.271   -24.778 1.00 35.97 ? 358 THR A C     1 
ATOM   2465 O O     . THR A 1 312 ? -19.191 1.513   -24.097 1.00 36.82 ? 358 THR A O     1 
ATOM   2466 C CB    . THR A 1 312 ? -16.740 -0.181  -23.244 1.00 34.14 ? 358 THR A CB    1 
ATOM   2467 O OG1   . THR A 1 312 ? -17.733 -0.396  -22.249 1.00 36.59 ? 358 THR A OG1   1 
ATOM   2468 C CG2   . THR A 1 312 ? -16.042 1.054   -22.901 1.00 31.44 ? 358 THR A CG2   1 
ATOM   2469 N N     . PHE A 1 313 ? -17.631 2.163   -25.597 1.00 36.07 ? 359 PHE A N     1 
ATOM   2470 C CA    . PHE A 1 313 ? -18.184 3.495   -25.830 1.00 37.50 ? 359 PHE A CA    1 
ATOM   2471 C C     . PHE A 1 313 ? -18.792 3.643   -27.252 1.00 38.08 ? 359 PHE A C     1 
ATOM   2472 O O     . PHE A 1 313 ? -19.312 4.692   -27.607 1.00 37.94 ? 359 PHE A O     1 
ATOM   2473 C CB    . PHE A 1 313 ? -17.103 4.557   -25.615 1.00 36.34 ? 359 PHE A CB    1 
ATOM   2474 C CG    . PHE A 1 313 ? -16.609 4.638   -24.205 1.00 37.01 ? 359 PHE A CG    1 
ATOM   2475 C CD1   . PHE A 1 313 ? -17.423 5.142   -23.200 1.00 36.58 ? 359 PHE A CD1   1 
ATOM   2476 C CD2   . PHE A 1 313 ? -15.303 4.231   -23.872 1.00 37.62 ? 359 PHE A CD2   1 
ATOM   2477 C CE1   . PHE A 1 313 ? -16.963 5.222   -21.862 1.00 39.35 ? 359 PHE A CE1   1 
ATOM   2478 C CE2   . PHE A 1 313 ? -14.843 4.324   -22.532 1.00 37.08 ? 359 PHE A CE2   1 
ATOM   2479 C CZ    . PHE A 1 313 ? -15.682 4.806   -21.534 1.00 35.41 ? 359 PHE A CZ    1 
ATOM   2480 N N     . ALA A 1 314 ? -18.741 2.562   -28.021 1.00 39.34 ? 360 ALA A N     1 
ATOM   2481 C CA    . ALA A 1 314 ? -18.998 2.589   -29.444 1.00 41.03 ? 360 ALA A CA    1 
ATOM   2482 C C     . ALA A 1 314 ? -20.470 2.370   -29.821 1.00 42.14 ? 360 ALA A C     1 
ATOM   2483 O O     . ALA A 1 314 ? -20.875 2.792   -30.908 1.00 42.80 ? 360 ALA A O     1 
ATOM   2484 C CB    . ALA A 1 314 ? -18.097 1.564   -30.162 1.00 40.58 ? 360 ALA A CB    1 
ATOM   2485 N N     . THR A 1 315 ? -21.247 1.704   -28.953 1.00 42.82 ? 361 THR A N     1 
ATOM   2486 C CA    . THR A 1 315 ? -22.673 1.437   -29.203 1.00 43.73 ? 361 THR A CA    1 
ATOM   2487 C C     . THR A 1 315 ? -23.559 2.004   -28.117 1.00 44.54 ? 361 THR A C     1 
ATOM   2488 O O     . THR A 1 315 ? -23.099 2.772   -27.269 1.00 44.11 ? 361 THR A O     1 
ATOM   2489 C CB    . THR A 1 315 ? -23.009 -0.054  -29.375 1.00 43.47 ? 361 THR A CB    1 
ATOM   2490 O OG1   . THR A 1 315 ? -23.004 -0.698  -28.097 1.00 44.04 ? 361 THR A OG1   1 
ATOM   2491 C CG2   . THR A 1 315 ? -22.026 -0.759  -30.295 1.00 44.78 ? 361 THR A CG2   1 
ATOM   2492 N N     . GLY A 1 316 ? -24.845 1.646   -28.170 1.00 45.96 ? 362 GLY A N     1 
ATOM   2493 C CA    . GLY A 1 316 ? -25.810 2.016   -27.119 1.00 47.13 ? 362 GLY A CA    1 
ATOM   2494 C C     . GLY A 1 316 ? -25.887 0.999   -25.981 1.00 47.56 ? 362 GLY A C     1 
ATOM   2495 O O     . GLY A 1 316 ? -25.461 -0.153  -26.137 1.00 47.29 ? 362 GLY A O     1 
ATOM   2496 N N     . LYS A 1 317 ? -26.443 1.424   -24.843 1.00 48.49 ? 363 LYS A N     1 
ATOM   2497 C CA    . LYS A 1 317 ? -26.631 0.543   -23.681 1.00 50.00 ? 363 LYS A CA    1 
ATOM   2498 C C     . LYS A 1 317 ? -27.053 -0.884  -24.055 1.00 49.61 ? 363 LYS A C     1 
ATOM   2499 O O     . LYS A 1 317 ? -26.387 -1.841  -23.672 1.00 50.42 ? 363 LYS A O     1 
ATOM   2500 C CB    . LYS A 1 317 ? -27.666 1.118   -22.702 1.00 49.67 ? 363 LYS A CB    1 
ATOM   2501 C CG    . LYS A 1 317 ? -27.162 2.049   -21.591 1.00 52.60 ? 363 LYS A CG    1 
ATOM   2502 C CD    . LYS A 1 317 ? -28.317 2.394   -20.581 1.00 52.86 ? 363 LYS A CD    1 
ATOM   2503 C CE    . LYS A 1 317 ? -28.477 1.315   -19.441 1.00 57.80 ? 363 LYS A CE    1 
ATOM   2504 N NZ    . LYS A 1 317 ? -29.919 0.980   -18.973 1.00 55.93 ? 363 LYS A NZ    1 
ATOM   2505 N N     . ILE A 1 318 ? -28.171 -1.013  -24.783 1.00 49.40 ? 364 ILE A N     1 
ATOM   2506 C CA    . ILE A 1 318 ? -28.845 -2.286  -25.029 1.00 48.28 ? 364 ILE A CA    1 
ATOM   2507 C C     . ILE A 1 318 ? -27.989 -3.194  -25.869 1.00 47.64 ? 364 ILE A C     1 
ATOM   2508 O O     . ILE A 1 318 ? -27.805 -4.361  -25.543 1.00 48.32 ? 364 ILE A O     1 
ATOM   2509 C CB    . ILE A 1 318 ? -30.197 -2.102  -25.813 1.00 49.00 ? 364 ILE A CB    1 
ATOM   2510 C CG1   . ILE A 1 318 ? -31.072 -0.908  -25.300 1.00 50.25 ? 364 ILE A CG1   1 
ATOM   2511 C CG2   . ILE A 1 318 ? -30.936 -3.426  -25.917 1.00 49.24 ? 364 ILE A CG2   1 
ATOM   2512 C CD1   . ILE A 1 318 ? -31.581 -0.945  -23.827 1.00 51.13 ? 364 ILE A CD1   1 
ATOM   2513 N N     . ILE A 1 319 ? -27.514 -2.667  -26.994 1.00 46.98 ? 365 ILE A N     1 
ATOM   2514 C CA    . ILE A 1 319 ? -26.642 -3.383  -27.926 1.00 45.86 ? 365 ILE A CA    1 
ATOM   2515 C C     . ILE A 1 319 ? -25.313 -3.774  -27.255 1.00 44.59 ? 365 ILE A C     1 
ATOM   2516 O O     . ILE A 1 319 ? -24.798 -4.869  -27.467 1.00 41.60 ? 365 ILE A O     1 
ATOM   2517 C CB    . ILE A 1 319 ? -26.276 -2.449  -29.110 1.00 47.06 ? 365 ILE A CB    1 
ATOM   2518 C CG1   . ILE A 1 319 ? -27.441 -1.493  -29.430 1.00 48.20 ? 365 ILE A CG1   1 
ATOM   2519 C CG2   . ILE A 1 319 ? -25.717 -3.258  -30.337 1.00 45.99 ? 365 ILE A CG2   1 
ATOM   2520 C CD1   . ILE A 1 319 ? -28.722 -2.193  -29.888 1.00 51.44 ? 365 ILE A CD1   1 
ATOM   2521 N N     . GLY A 1 320 ? -24.778 -2.848  -26.454 1.00 44.06 ? 366 GLY A N     1 
ATOM   2522 C CA    . GLY A 1 320 ? -23.476 -3.025  -25.825 1.00 44.90 ? 366 GLY A CA    1 
ATOM   2523 C C     . GLY A 1 320 ? -23.579 -4.160  -24.860 1.00 45.71 ? 366 GLY A C     1 
ATOM   2524 O O     . GLY A 1 320 ? -22.779 -5.099  -24.918 1.00 44.93 ? 366 GLY A O     1 
ATOM   2525 N N     . HIS A 1 321 ? -24.620 -4.088  -24.018 1.00 46.80 ? 367 HIS A N     1 
ATOM   2526 C CA    . HIS A 1 321 ? -24.928 -5.125  -23.027 1.00 48.26 ? 367 HIS A CA    1 
ATOM   2527 C C     . HIS A 1 321 ? -25.084 -6.513  -23.643 1.00 48.94 ? 367 HIS A C     1 
ATOM   2528 O O     . HIS A 1 321 ? -24.578 -7.509  -23.102 1.00 49.52 ? 367 HIS A O     1 
ATOM   2529 C CB    . HIS A 1 321 ? -26.151 -4.745  -22.188 1.00 48.04 ? 367 HIS A CB    1 
ATOM   2530 C CG    . HIS A 1 321 ? -26.125 -5.313  -20.802 1.00 51.49 ? 367 HIS A CG    1 
ATOM   2531 N ND1   . HIS A 1 321 ? -26.411 -6.640  -20.525 1.00 54.59 ? 367 HIS A ND1   1 
ATOM   2532 C CD2   . HIS A 1 321 ? -25.827 -4.742  -19.609 1.00 55.13 ? 367 HIS A CD2   1 
ATOM   2533 C CE1   . HIS A 1 321 ? -26.298 -6.857  -19.225 1.00 56.09 ? 367 HIS A CE1   1 
ATOM   2534 N NE2   . HIS A 1 321 ? -25.944 -5.721  -18.644 1.00 56.40 ? 367 HIS A NE2   1 
ATOM   2535 N N     . MET A 1 322 ? -25.763 -6.577  -24.785 1.00 50.15 ? 368 MET A N     1 
ATOM   2536 C CA    . MET A 1 322 ? -26.001 -7.832  -25.509 1.00 51.58 ? 368 MET A CA    1 
ATOM   2537 C C     . MET A 1 322 ? -24.781 -8.341  -26.238 1.00 49.63 ? 368 MET A C     1 
ATOM   2538 O O     . MET A 1 322 ? -24.674 -9.515  -26.533 1.00 50.37 ? 368 MET A O     1 
ATOM   2539 C CB    . MET A 1 322 ? -27.123 -7.632  -26.528 1.00 51.63 ? 368 MET A CB    1 
ATOM   2540 C CG    . MET A 1 322 ? -28.463 -7.203  -25.915 1.00 54.61 ? 368 MET A CG    1 
ATOM   2541 S SD    . MET A 1 322 ? -29.629 -6.538  -27.147 1.00 57.48 ? 368 MET A SD    1 
ATOM   2542 C CE    . MET A 1 322 ? -29.163 -7.484  -28.633 1.00 56.98 ? 368 MET A CE    1 
ATOM   2543 N N     . LEU A 1 323 ? -23.872 -7.447  -26.574 1.00 48.87 ? 369 LEU A N     1 
ATOM   2544 C CA    . LEU A 1 323 ? -22.643 -7.829  -27.290 1.00 47.66 ? 369 LEU A CA    1 
ATOM   2545 C C     . LEU A 1 323 ? -21.479 -8.035  -26.283 1.00 46.39 ? 369 LEU A C     1 
ATOM   2546 O O     . LEU A 1 323 ? -20.398 -8.548  -26.632 1.00 45.31 ? 369 LEU A O     1 
ATOM   2547 C CB    . LEU A 1 323 ? -22.288 -6.762  -28.350 1.00 47.64 ? 369 LEU A CB    1 
ATOM   2548 C CG    . LEU A 1 323 ? -23.086 -6.683  -29.663 1.00 47.49 ? 369 LEU A CG    1 
ATOM   2549 C CD1   . LEU A 1 323 ? -22.551 -5.577  -30.535 1.00 44.98 ? 369 LEU A CD1   1 
ATOM   2550 C CD2   . LEU A 1 323 ? -23.029 -8.043  -30.418 1.00 50.17 ? 369 LEU A CD2   1 
ATOM   2551 N N     . LYS A 1 324 ? -21.747 -7.633  -25.039 1.00 44.44 ? 370 LYS A N     1 
ATOM   2552 C CA    . LYS A 1 324 ? -20.794 -7.687  -23.939 1.00 43.42 ? 370 LYS A CA    1 
ATOM   2553 C C     . LYS A 1 324 ? -19.651 -6.708  -24.143 1.00 41.76 ? 370 LYS A C     1 
ATOM   2554 O O     . LYS A 1 324 ? -18.501 -7.034  -23.903 1.00 41.12 ? 370 LYS A O     1 
ATOM   2555 C CB    . LYS A 1 324 ? -20.237 -9.092  -23.719 1.00 43.93 ? 370 LYS A CB    1 
ATOM   2556 C CG    . LYS A 1 324 ? -21.245 -10.225 -23.584 1.00 48.04 ? 370 LYS A CG    1 
ATOM   2557 C CD    . LYS A 1 324 ? -20.412 -11.507 -23.692 1.00 55.05 ? 370 LYS A CD    1 
ATOM   2558 C CE    . LYS A 1 324 ? -21.166 -12.733 -24.213 1.00 56.94 ? 370 LYS A CE    1 
ATOM   2559 N NZ    . LYS A 1 324 ? -20.098 -13.672 -24.726 1.00 56.05 ? 370 LYS A NZ    1 
ATOM   2560 N N     . LEU A 1 325 ? -19.994 -5.502  -24.577 1.00 39.52 ? 371 LEU A N     1 
ATOM   2561 C CA    . LEU A 1 325 ? -19.056 -4.431  -24.699 1.00 38.31 ? 371 LEU A CA    1 
ATOM   2562 C C     . LEU A 1 325 ? -19.191 -3.572  -23.451 1.00 38.16 ? 371 LEU A C     1 
ATOM   2563 O O     . LEU A 1 325 ? -18.292 -2.782  -23.097 1.00 37.50 ? 371 LEU A O     1 
ATOM   2564 C CB    . LEU A 1 325 ? -19.390 -3.642  -25.970 1.00 38.38 ? 371 LEU A CB    1 
ATOM   2565 C CG    . LEU A 1 325 ? -19.225 -4.416  -27.310 1.00 37.22 ? 371 LEU A CG    1 
ATOM   2566 C CD1   . LEU A 1 325 ? -19.620 -3.564  -28.516 1.00 33.48 ? 371 LEU A CD1   1 
ATOM   2567 C CD2   . LEU A 1 325 ? -17.827 -5.026  -27.488 1.00 33.57 ? 371 LEU A CD2   1 
ATOM   2568 N N     . LYS A 1 326 ? -20.355 -3.734  -22.811 1.00 37.41 ? 372 LYS A N     1 
ATOM   2569 C CA    . LYS A 1 326 ? -20.760 -3.023  -21.617 1.00 36.63 ? 372 LYS A CA    1 
ATOM   2570 C C     . LYS A 1 326 ? -21.244 -4.027  -20.543 1.00 37.32 ? 372 LYS A C     1 
ATOM   2571 O O     . LYS A 1 326 ? -21.820 -5.084  -20.851 1.00 36.86 ? 372 LYS A O     1 
ATOM   2572 C CB    . LYS A 1 326 ? -21.909 -2.074  -21.954 1.00 36.83 ? 372 LYS A CB    1 
ATOM   2573 C CG    . LYS A 1 326 ? -21.606 -1.014  -23.027 1.00 36.67 ? 372 LYS A CG    1 
ATOM   2574 C CD    . LYS A 1 326 ? -22.745 -0.024  -23.181 1.00 34.27 ? 372 LYS A CD    1 
ATOM   2575 C CE    . LYS A 1 326 ? -22.334 1.252   -23.934 1.00 29.70 ? 372 LYS A CE    1 
ATOM   2576 N NZ    . LYS A 1 326 ? -21.921 2.290   -22.999 1.00 26.17 ? 372 LYS A NZ    1 
ATOM   2577 N N     . GLY A 1 327 ? -21.036 -3.682  -19.276 1.00 37.10 ? 373 GLY A N     1 
ATOM   2578 C CA    . GLY A 1 327 ? -21.685 -4.428  -18.198 1.00 37.07 ? 373 GLY A CA    1 
ATOM   2579 C C     . GLY A 1 327 ? -22.829 -3.651  -17.567 1.00 37.18 ? 373 GLY A C     1 
ATOM   2580 O O     . GLY A 1 327 ? -23.433 -2.800  -18.229 1.00 37.23 ? 373 GLY A O     1 
ATOM   2581 N N     . ASP A 1 328 ? -23.131 -3.940  -16.297 1.00 36.65 ? 374 ASP A N     1 
ATOM   2582 C CA    . ASP A 1 328 ? -24.264 -3.328  -15.605 1.00 36.84 ? 374 ASP A CA    1 
ATOM   2583 C C     . ASP A 1 328 ? -23.863 -1.961  -15.077 1.00 37.07 ? 374 ASP A C     1 
ATOM   2584 O O     . ASP A 1 328 ? -24.716 -1.105  -14.822 1.00 37.89 ? 374 ASP A O     1 
ATOM   2585 C CB    . ASP A 1 328 ? -24.714 -4.176  -14.395 1.00 37.93 ? 374 ASP A CB    1 
ATOM   2586 C CG    . ASP A 1 328 ? -24.949 -5.625  -14.735 1.00 38.13 ? 374 ASP A CG    1 
ATOM   2587 O OD1   . ASP A 1 328 ? -25.364 -5.963  -15.862 1.00 42.34 ? 374 ASP A OD1   1 
ATOM   2588 O OD2   . ASP A 1 328 ? -24.709 -6.449  -13.855 1.00 42.43 ? 374 ASP A OD2   1 
ATOM   2589 N N     . ILE A 1 329 ? -22.568 -1.757  -14.871 1.00 35.91 ? 375 ILE A N     1 
ATOM   2590 C CA    . ILE A 1 329 ? -22.047 -0.441  -14.526 1.00 34.89 ? 375 ILE A CA    1 
ATOM   2591 C C     . ILE A 1 329 ? -22.028 0.438   -15.794 1.00 34.93 ? 375 ILE A C     1 
ATOM   2592 O O     . ILE A 1 329 ? -21.894 -0.091  -16.878 1.00 34.37 ? 375 ILE A O     1 
ATOM   2593 C CB    . ILE A 1 329 ? -20.598 -0.592  -13.943 1.00 34.86 ? 375 ILE A CB    1 
ATOM   2594 C CG1   . ILE A 1 329 ? -20.143 0.651   -13.196 1.00 34.60 ? 375 ILE A CG1   1 
ATOM   2595 C CG2   . ILE A 1 329 ? -19.571 -0.952  -15.053 1.00 31.99 ? 375 ILE A CG2   1 
ATOM   2596 C CD1   . ILE A 1 329 ? -18.783 0.402   -12.471 1.00 34.85 ? 375 ILE A CD1   1 
ATOM   2597 N N     . ASP A 1 330 ? -22.169 1.756   -15.629 1.00 35.32 ? 376 ASP A N     1 
ATOM   2598 C CA    . ASP A 1 330 ? -21.903 2.764   -16.652 1.00 36.46 ? 376 ASP A CA    1 
ATOM   2599 C C     . ASP A 1 330 ? -20.419 2.731   -17.098 1.00 35.81 ? 376 ASP A C     1 
ATOM   2600 O O     . ASP A 1 330 ? -19.507 2.618   -16.265 1.00 36.36 ? 376 ASP A O     1 
ATOM   2601 C CB    . ASP A 1 330 ? -22.273 4.137   -16.075 1.00 36.83 ? 376 ASP A CB    1 
ATOM   2602 C CG    . ASP A 1 330 ? -22.135 5.311   -17.096 1.00 40.92 ? 376 ASP A CG    1 
ATOM   2603 O OD1   . ASP A 1 330 ? -22.856 5.352   -18.107 1.00 42.52 ? 376 ASP A OD1   1 
ATOM   2604 O OD2   . ASP A 1 330 ? -21.358 6.266   -16.837 1.00 44.28 ? 376 ASP A OD2   1 
ATOM   2605 N N     . SER A 1 331 ? -20.191 2.795   -18.415 1.00 35.00 ? 377 SER A N     1 
ATOM   2606 C CA    . SER A 1 331 ? -18.840 2.714   -19.016 1.00 32.70 ? 377 SER A CA    1 
ATOM   2607 C C     . SER A 1 331 ? -17.961 3.883   -18.582 1.00 33.30 ? 377 SER A C     1 
ATOM   2608 O O     . SER A 1 331 ? -16.723 3.755   -18.415 1.00 34.02 ? 377 SER A O     1 
ATOM   2609 C CB    . SER A 1 331 ? -18.943 2.612   -20.530 1.00 31.48 ? 377 SER A CB    1 
ATOM   2610 O OG    . SER A 1 331 ? -19.411 1.310   -20.934 1.00 31.21 ? 377 SER A OG    1 
ATOM   2611 N N     . ASN A 1 332 ? -18.604 5.030   -18.396 1.00 32.65 ? 378 ASN A N     1 
ATOM   2612 C CA    . ASN A 1 332 ? -17.928 6.182   -17.892 1.00 33.15 ? 378 ASN A CA    1 
ATOM   2613 C C     . ASN A 1 332 ? -17.608 6.051   -16.449 1.00 33.09 ? 378 ASN A C     1 
ATOM   2614 O O     . ASN A 1 332 ? -16.546 6.503   -16.027 1.00 34.71 ? 378 ASN A O     1 
ATOM   2615 C CB    . ASN A 1 332 ? -18.719 7.461   -18.146 1.00 33.24 ? 378 ASN A CB    1 
ATOM   2616 C CG    . ASN A 1 332 ? -18.389 8.063   -19.513 1.00 35.05 ? 378 ASN A CG    1 
ATOM   2617 O OD1   . ASN A 1 332 ? -17.598 9.007   -19.595 1.00 38.46 ? 378 ASN A OD1   1 
ATOM   2618 N ND2   . ASN A 1 332 ? -18.899 7.455   -20.581 1.00 31.17 ? 378 ASN A ND2   1 
ATOM   2619 N N     . VAL A 1 333 ? -18.524 5.457   -15.684 1.00 31.88 ? 379 VAL A N     1 
ATOM   2620 C CA    . VAL A 1 333 ? -18.272 5.225   -14.278 1.00 31.50 ? 379 VAL A CA    1 
ATOM   2621 C C     . VAL A 1 333 ? -17.099 4.249   -14.109 1.00 30.07 ? 379 VAL A C     1 
ATOM   2622 O O     . VAL A 1 333 ? -16.189 4.559   -13.345 1.00 30.41 ? 379 VAL A O     1 
ATOM   2623 C CB    . VAL A 1 333 ? -19.563 4.828   -13.465 1.00 31.35 ? 379 VAL A CB    1 
ATOM   2624 C CG1   . VAL A 1 333 ? -19.223 4.532   -12.006 1.00 30.46 ? 379 VAL A CG1   1 
ATOM   2625 C CG2   . VAL A 1 333 ? -20.619 5.987   -13.555 1.00 31.08 ? 379 VAL A CG2   1 
ATOM   2626 N N     . ALA A 1 334 ? -17.124 3.128   -14.838 1.00 28.52 ? 380 ALA A N     1 
ATOM   2627 C CA    . ALA A 1 334 ? -16.054 2.127   -14.814 1.00 29.16 ? 380 ALA A CA    1 
ATOM   2628 C C     . ALA A 1 334 ? -14.684 2.707   -15.199 1.00 29.38 ? 380 ALA A C     1 
ATOM   2629 O O     . ALA A 1 334 ? -13.690 2.518   -14.490 1.00 29.26 ? 380 ALA A O     1 
ATOM   2630 C CB    . ALA A 1 334 ? -16.396 0.947   -15.715 1.00 28.08 ? 380 ALA A CB    1 
ATOM   2631 N N     . ILE A 1 335 ? -14.640 3.471   -16.289 1.00 29.64 ? 381 ILE A N     1 
ATOM   2632 C CA    . ILE A 1 335 ? -13.353 3.935   -16.811 1.00 29.01 ? 381 ILE A CA    1 
ATOM   2633 C C     . ILE A 1 335 ? -12.811 5.041   -15.965 1.00 29.53 ? 381 ILE A C     1 
ATOM   2634 O O     . ILE A 1 335 ? -11.606 5.225   -15.939 1.00 30.22 ? 381 ILE A O     1 
ATOM   2635 C CB    . ILE A 1 335 ? -13.384 4.305   -18.353 1.00 28.77 ? 381 ILE A CB    1 
ATOM   2636 C CG1   . ILE A 1 335 ? -12.018 4.025   -19.034 1.00 26.45 ? 381 ILE A CG1   1 
ATOM   2637 C CG2   . ILE A 1 335 ? -13.876 5.768   -18.561 1.00 27.84 ? 381 ILE A CG2   1 
ATOM   2638 C CD1   . ILE A 1 335 ? -11.523 2.561   -18.939 1.00 22.45 ? 381 ILE A CD1   1 
ATOM   2639 N N     . ASP A 1 336 ? -13.674 5.783   -15.252 1.00 30.63 ? 382 ASP A N     1 
ATOM   2640 C CA    . ASP A 1 336 ? -13.181 6.786   -14.289 1.00 30.27 ? 382 ASP A CA    1 
ATOM   2641 C C     . ASP A 1 336 ? -12.610 6.079   -13.048 1.00 29.45 ? 382 ASP A C     1 
ATOM   2642 O O     . ASP A 1 336 ? -11.645 6.526   -12.469 1.00 28.61 ? 382 ASP A O     1 
ATOM   2643 C CB    . ASP A 1 336 ? -14.310 7.708   -13.810 1.00 31.63 ? 382 ASP A CB    1 
ATOM   2644 C CG    . ASP A 1 336 ? -14.775 8.656   -14.852 1.00 33.53 ? 382 ASP A CG    1 
ATOM   2645 O OD1   . ASP A 1 336 ? -14.244 8.600   -15.953 1.00 37.84 ? 382 ASP A OD1   1 
ATOM   2646 O OD2   . ASP A 1 336 ? -15.697 9.453   -14.588 1.00 36.54 ? 382 ASP A OD2   1 
ATOM   2647 N N     . LEU A 1 337 ? -13.241 4.986   -12.623 1.00 29.18 ? 383 LEU A N     1 
ATOM   2648 C CA    . LEU A 1 337 ? -12.738 4.235   -11.468 1.00 28.60 ? 383 LEU A CA    1 
ATOM   2649 C C     . LEU A 1 337 ? -11.343 3.633   -11.772 1.00 28.16 ? 383 LEU A C     1 
ATOM   2650 O O     . LEU A 1 337 ? -10.428 3.778   -10.991 1.00 29.37 ? 383 LEU A O     1 
ATOM   2651 C CB    . LEU A 1 337 ? -13.759 3.182   -11.012 1.00 27.24 ? 383 LEU A CB    1 
ATOM   2652 C CG    . LEU A 1 337 ? -14.976 3.716   -10.243 1.00 28.49 ? 383 LEU A CG    1 
ATOM   2653 C CD1   . LEU A 1 337 ? -16.033 2.654   -10.125 1.00 29.20 ? 383 LEU A CD1   1 
ATOM   2654 C CD2   . LEU A 1 337 ? -14.672 4.331   -8.875  1.00 25.31 ? 383 LEU A CD2   1 
ATOM   2655 N N     . SER A 1 338 ? -11.190 3.016   -12.933 1.00 27.39 ? 384 SER A N     1 
ATOM   2656 C CA    . SER A 1 338 ? -9.922  2.438   -13.409 1.00 25.68 ? 384 SER A CA    1 
ATOM   2657 C C     . SER A 1 338 ? -8.884  3.539   -13.544 1.00 24.95 ? 384 SER A C     1 
ATOM   2658 O O     . SER A 1 338 ? -7.812  3.467   -12.927 1.00 25.05 ? 384 SER A O     1 
ATOM   2659 C CB    . SER A 1 338 ? -10.169 1.759   -14.754 1.00 24.34 ? 384 SER A CB    1 
ATOM   2660 O OG    . SER A 1 338 ? -9.007  1.085   -15.202 1.00 27.45 ? 384 SER A OG    1 
ATOM   2661 N N     . ASN A 1 339 ? -9.223  4.605   -14.274 1.00 24.21 ? 385 ASN A N     1 
ATOM   2662 C CA    . ASN A 1 339 ? -8.270  5.730   -14.507 1.00 23.55 ? 385 ASN A CA    1 
ATOM   2663 C C     . ASN A 1 339 ? -7.796  6.452   -13.259 1.00 24.36 ? 385 ASN A C     1 
ATOM   2664 O O     . ASN A 1 339 ? -6.604  6.761   -13.111 1.00 25.92 ? 385 ASN A O     1 
ATOM   2665 C CB    . ASN A 1 339 ? -8.841  6.724   -15.521 1.00 22.91 ? 385 ASN A CB    1 
ATOM   2666 C CG    . ASN A 1 339 ? -8.941  6.134   -16.928 1.00 21.63 ? 385 ASN A CG    1 
ATOM   2667 O OD1   . ASN A 1 339 ? -8.314  5.116   -17.248 1.00 23.74 ? 385 ASN A OD1   1 
ATOM   2668 N ND2   . ASN A 1 339 ? -9.725  6.770   -17.774 1.00 23.98 ? 385 ASN A ND2   1 
ATOM   2669 N N     . LYS A 1 340 ? -8.727  6.707   -12.349 1.00 24.35 ? 386 LYS A N     1 
ATOM   2670 C CA    . LYS A 1 340 ? -8.447  7.356   -11.081 1.00 24.03 ? 386 LYS A CA    1 
ATOM   2671 C C     . LYS A 1 340 ? -7.609  6.522   -10.115 1.00 23.35 ? 386 LYS A C     1 
ATOM   2672 O O     . LYS A 1 340 ? -6.676  7.015   -9.519  1.00 23.91 ? 386 LYS A O     1 
ATOM   2673 C CB    . LYS A 1 340 ? -9.768  7.734   -10.419 1.00 23.96 ? 386 LYS A CB    1 
ATOM   2674 C CG    . LYS A 1 340 ? -10.357 9.091   -10.868 1.00 26.88 ? 386 LYS A CG    1 
ATOM   2675 C CD    . LYS A 1 340 ? -11.819 9.129   -10.337 1.00 28.11 ? 386 LYS A CD    1 
ATOM   2676 C CE    . LYS A 1 340 ? -12.677 10.277  -10.894 1.00 30.62 ? 386 LYS A CE    1 
ATOM   2677 N NZ    . LYS A 1 340 ? -14.075 10.169  -10.276 1.00 31.03 ? 386 LYS A NZ    1 
ATOM   2678 N N     . ALA A 1 341 ? -7.982  5.257   -9.931  1.00 23.59 ? 387 ALA A N     1 
ATOM   2679 C CA    . ALA A 1 341 ? -7.158  4.292   -9.238  1.00 22.46 ? 387 ALA A CA    1 
ATOM   2680 C C     . ALA A 1 341 ? -5.745  4.239   -9.803  1.00 22.07 ? 387 ALA A C     1 
ATOM   2681 O O     . ALA A 1 341 ? -4.753  4.141   -9.035  1.00 23.90 ? 387 ALA A O     1 
ATOM   2682 C CB    . ALA A 1 341 ? -7.818  2.948   -9.362  1.00 21.98 ? 387 ALA A CB    1 
ATOM   2683 N N     . SER A 1 342 ? -5.658  4.208   -11.138 1.00 21.43 ? 388 SER A N     1 
ATOM   2684 C CA    . SER A 1 342 ? -4.387  4.155   -11.868 1.00 21.70 ? 388 SER A CA    1 
ATOM   2685 C C     . SER A 1 342 ? -3.546  5.380   -11.537 1.00 22.39 ? 388 SER A C     1 
ATOM   2686 O O     . SER A 1 342 ? -2.358  5.251   -11.151 1.00 23.75 ? 388 SER A O     1 
ATOM   2687 C CB    . SER A 1 342 ? -4.603  4.022   -13.390 1.00 19.94 ? 388 SER A CB    1 
ATOM   2688 O OG    . SER A 1 342 ? -5.064  2.703   -13.681 1.00 19.60 ? 388 SER A OG    1 
ATOM   2689 N N     . LEU A 1 343 ? -4.169  6.546   -11.625 1.00 22.35 ? 389 LEU A N     1 
ATOM   2690 C CA    . LEU A 1 343 ? -3.478  7.836   -11.364 1.00 23.96 ? 389 LEU A CA    1 
ATOM   2691 C C     . LEU A 1 343 ? -2.911  7.864   -9.949  1.00 24.88 ? 389 LEU A C     1 
ATOM   2692 O O     . LEU A 1 343 ? -1.720  8.181   -9.775  1.00 25.33 ? 389 LEU A O     1 
ATOM   2693 C CB    . LEU A 1 343 ? -4.390  9.029   -11.614 1.00 22.14 ? 389 LEU A CB    1 
ATOM   2694 C CG    . LEU A 1 343 ? -4.646  9.264   -13.098 1.00 24.25 ? 389 LEU A CG    1 
ATOM   2695 C CD1   . LEU A 1 343 ? -6.080  9.907   -13.338 1.00 22.35 ? 389 LEU A CD1   1 
ATOM   2696 C CD2   . LEU A 1 343 ? -3.488  10.075  -13.804 1.00 18.73 ? 389 LEU A CD2   1 
ATOM   2697 N N     . ALA A 1 344 ? -3.741  7.489   -8.966  1.00 24.23 ? 390 ALA A N     1 
ATOM   2698 C CA    . ALA A 1 344 ? -3.298  7.345   -7.579  1.00 23.77 ? 390 ALA A CA    1 
ATOM   2699 C C     . ALA A 1 344 ? -2.122  6.345   -7.475  1.00 24.45 ? 390 ALA A C     1 
ATOM   2700 O O     . ALA A 1 344 ? -1.113  6.616   -6.816  1.00 24.37 ? 390 ALA A O     1 
ATOM   2701 C CB    . ALA A 1 344 ? -4.505  6.881   -6.689  1.00 22.92 ? 390 ALA A CB    1 
ATOM   2702 N N     . PHE A 1 345 ? -2.257  5.165   -8.087  1.00 24.33 ? 391 PHE A N     1 
ATOM   2703 C CA    . PHE A 1 345 ? -1.135  4.203   -8.058  1.00 24.54 ? 391 PHE A CA    1 
ATOM   2704 C C     . PHE A 1 345 ? 0.221   4.765   -8.649  1.00 24.98 ? 391 PHE A C     1 
ATOM   2705 O O     . PHE A 1 345 ? 1.288   4.583   -8.055  1.00 25.12 ? 391 PHE A O     1 
ATOM   2706 C CB    . PHE A 1 345 ? -1.586  2.883   -8.732  1.00 23.94 ? 391 PHE A CB    1 
ATOM   2707 C CG    . PHE A 1 345 ? -0.657  1.754   -8.512  1.00 24.66 ? 391 PHE A CG    1 
ATOM   2708 C CD1   . PHE A 1 345 ? -0.801  0.927   -7.388  1.00 24.20 ? 391 PHE A CD1   1 
ATOM   2709 C CD2   . PHE A 1 345 ? 0.390   1.502   -9.424  1.00 22.62 ? 391 PHE A CD2   1 
ATOM   2710 C CE1   . PHE A 1 345 ? 0.095   -0.115  -7.159  1.00 23.84 ? 391 PHE A CE1   1 
ATOM   2711 C CE2   . PHE A 1 345 ? 1.261   0.451   -9.196  1.00 22.05 ? 391 PHE A CE2   1 
ATOM   2712 C CZ    . PHE A 1 345 ? 1.111   -0.348  -8.060  1.00 22.34 ? 391 PHE A CZ    1 
ATOM   2713 N N     . LEU A 1 346 ? 0.133   5.404   -9.822  1.00 24.78 ? 392 LEU A N     1 
ATOM   2714 C CA    . LEU A 1 346 ? 1.212   6.087   -10.493 1.00 26.20 ? 392 LEU A CA    1 
ATOM   2715 C C     . LEU A 1 346 ? 1.821   7.170   -9.610  1.00 27.16 ? 392 LEU A C     1 
ATOM   2716 O O     . LEU A 1 346 ? 3.047   7.196   -9.393  1.00 27.99 ? 392 LEU A O     1 
ATOM   2717 C CB    . LEU A 1 346 ? 0.752   6.668   -11.857 1.00 24.74 ? 392 LEU A CB    1 
ATOM   2718 C CG    . LEU A 1 346 ? 0.274   5.583   -12.801 1.00 23.95 ? 392 LEU A CG    1 
ATOM   2719 C CD1   . LEU A 1 346 ? -0.408  6.084   -14.100 1.00 24.18 ? 392 LEU A CD1   1 
ATOM   2720 C CD2   . LEU A 1 346 ? 1.400   4.670   -13.130 1.00 21.84 ? 392 LEU A CD2   1 
ATOM   2721 N N     . GLN A 1 347 ? 0.994   8.050   -9.072  1.00 27.65 ? 393 GLN A N     1 
ATOM   2722 C CA    . GLN A 1 347 ? 1.544   9.077   -8.209  1.00 28.32 ? 393 GLN A CA    1 
ATOM   2723 C C     . GLN A 1 347 ? 2.383   8.491   -7.072  1.00 29.40 ? 393 GLN A C     1 
ATOM   2724 O O     . GLN A 1 347 ? 3.442   9.013   -6.789  1.00 30.47 ? 393 GLN A O     1 
ATOM   2725 C CB    . GLN A 1 347 ? 0.447   10.000  -7.655  1.00 28.23 ? 393 GLN A CB    1 
ATOM   2726 C CG    . GLN A 1 347 ? 0.960   10.906  -6.541  1.00 24.45 ? 393 GLN A CG    1 
ATOM   2727 C CD    . GLN A 1 347 ? 0.228   12.186  -6.483  1.00 23.33 ? 393 GLN A CD    1 
ATOM   2728 O OE1   . GLN A 1 347 ? -0.249  12.666  -7.481  1.00 29.64 ? 393 GLN A OE1   1 
ATOM   2729 N NE2   . GLN A 1 347 ? 0.138   12.768  -5.315  1.00 25.72 ? 393 GLN A NE2   1 
ATOM   2730 N N     . LYS A 1 348 ? 1.912   7.405   -6.436  1.00 30.42 ? 394 LYS A N     1 
ATOM   2731 C CA    . LYS A 1 348 ? 2.598   6.771   -5.284  1.00 30.84 ? 394 LYS A CA    1 
ATOM   2732 C C     . LYS A 1 348 ? 3.920   6.116   -5.641  1.00 29.78 ? 394 LYS A C     1 
ATOM   2733 O O     . LYS A 1 348 ? 4.948   6.291   -4.959  1.00 30.37 ? 394 LYS A O     1 
ATOM   2734 C CB    . LYS A 1 348 ? 1.705   5.737   -4.606  1.00 31.15 ? 394 LYS A CB    1 
ATOM   2735 C CG    . LYS A 1 348 ? 2.379   5.094   -3.352  1.00 34.20 ? 394 LYS A CG    1 
ATOM   2736 C CD    . LYS A 1 348 ? 1.435   4.148   -2.543  1.00 35.12 ? 394 LYS A CD    1 
ATOM   2737 C CE    . LYS A 1 348 ? 2.218   3.146   -1.565  1.00 40.07 ? 394 LYS A CE    1 
ATOM   2738 N NZ    . LYS A 1 348 ? 3.405   3.763   -0.798  1.00 47.15 ? 394 LYS A NZ    1 
ATOM   2739 N N     . HIS A 1 349 ? 3.915   5.377   -6.736  1.00 29.31 ? 395 HIS A N     1 
ATOM   2740 C CA    . HIS A 1 349 ? 5.075   4.597   -7.092  1.00 28.41 ? 395 HIS A CA    1 
ATOM   2741 C C     . HIS A 1 349 ? 5.990   5.270   -8.111  1.00 28.17 ? 395 HIS A C     1 
ATOM   2742 O O     . HIS A 1 349 ? 7.095   4.785   -8.340  1.00 28.45 ? 395 HIS A O     1 
ATOM   2743 C CB    . HIS A 1 349 ? 4.633   3.186   -7.499  1.00 28.55 ? 395 HIS A CB    1 
ATOM   2744 C CG    . HIS A 1 349 ? 3.931   2.484   -6.391  1.00 27.33 ? 395 HIS A CG    1 
ATOM   2745 N ND1   . HIS A 1 349 ? 4.576   2.103   -5.232  1.00 30.38 ? 395 HIS A ND1   1 
ATOM   2746 C CD2   . HIS A 1 349 ? 2.631   2.188   -6.213  1.00 26.61 ? 395 HIS A CD2   1 
ATOM   2747 C CE1   . HIS A 1 349 ? 3.703   1.570   -4.404  1.00 28.27 ? 395 HIS A CE1   1 
ATOM   2748 N NE2   . HIS A 1 349 ? 2.513   1.609   -4.977  1.00 28.55 ? 395 HIS A NE2   1 
ATOM   2749 N N     . LEU A 1 350 ? 5.536   6.364   -8.727  1.00 27.87 ? 396 LEU A N     1 
ATOM   2750 C CA    . LEU A 1 350 ? 6.432   7.205   -9.533  1.00 27.22 ? 396 LEU A CA    1 
ATOM   2751 C C     . LEU A 1 350 ? 6.925   8.451   -8.779  1.00 28.22 ? 396 LEU A C     1 
ATOM   2752 O O     . LEU A 1 350 ? 7.786   9.178   -9.258  1.00 28.16 ? 396 LEU A O     1 
ATOM   2753 C CB    . LEU A 1 350 ? 5.803   7.569   -10.883 1.00 26.32 ? 396 LEU A CB    1 
ATOM   2754 C CG    . LEU A 1 350 ? 5.495   6.370   -11.801 1.00 24.57 ? 396 LEU A CG    1 
ATOM   2755 C CD1   . LEU A 1 350 ? 4.803   6.824   -13.013 1.00 21.55 ? 396 LEU A CD1   1 
ATOM   2756 C CD2   . LEU A 1 350 ? 6.753   5.535   -12.112 1.00 22.39 ? 396 LEU A CD2   1 
ATOM   2757 N N     . GLY A 1 351 ? 6.363   8.699   -7.604  1.00 29.39 ? 397 GLY A N     1 
ATOM   2758 C CA    . GLY A 1 351 ? 6.698   9.874   -6.820  1.00 30.47 ? 397 GLY A CA    1 
ATOM   2759 C C     . GLY A 1 351 ? 6.285   11.160  -7.523  1.00 31.23 ? 397 GLY A C     1 
ATOM   2760 O O     . GLY A 1 351 ? 7.079   12.114  -7.613  1.00 31.74 ? 397 GLY A O     1 
ATOM   2761 N N     . LEU A 1 352 ? 5.052   11.212  -8.011  1.00 31.54 ? 398 LEU A N     1 
ATOM   2762 C CA    . LEU A 1 352 ? 4.555   12.452  -8.623  1.00 32.35 ? 398 LEU A CA    1 
ATOM   2763 C C     . LEU A 1 352 ? 4.070   13.453  -7.563  1.00 33.97 ? 398 LEU A C     1 
ATOM   2764 O O     . LEU A 1 352 ? 3.777   13.070  -6.445  1.00 34.18 ? 398 LEU A O     1 
ATOM   2765 C CB    . LEU A 1 352 ? 3.445   12.149  -9.620  1.00 32.20 ? 398 LEU A CB    1 
ATOM   2766 C CG    . LEU A 1 352 ? 3.699   11.178  -10.781 1.00 30.75 ? 398 LEU A CG    1 
ATOM   2767 C CD1   . LEU A 1 352 ? 2.430   11.076  -11.586 1.00 29.34 ? 398 LEU A CD1   1 
ATOM   2768 C CD2   . LEU A 1 352 ? 4.755   11.747  -11.658 1.00 31.82 ? 398 LEU A CD2   1 
ATOM   2769 N N     . HIS A 1 353 ? 4.023   14.732  -7.909  1.00 35.98 ? 399 HIS A N     1 
ATOM   2770 C CA    . HIS A 1 353 ? 3.639   15.788  -6.960  1.00 38.25 ? 399 HIS A CA    1 
ATOM   2771 C C     . HIS A 1 353 ? 2.400   16.464  -7.474  1.00 38.80 ? 399 HIS A C     1 
ATOM   2772 O O     . HIS A 1 353 ? 2.390   17.656  -7.765  1.00 38.41 ? 399 HIS A O     1 
ATOM   2773 C CB    . HIS A 1 353 ? 4.771   16.823  -6.781  1.00 39.30 ? 399 HIS A CB    1 
ATOM   2774 C CG    . HIS A 1 353 ? 6.069   16.214  -6.342  1.00 43.02 ? 399 HIS A CG    1 
ATOM   2775 N ND1   . HIS A 1 353 ? 6.211   15.544  -5.143  1.00 45.10 ? 399 HIS A ND1   1 
ATOM   2776 C CD2   . HIS A 1 353 ? 7.269   16.132  -6.962  1.00 46.56 ? 399 HIS A CD2   1 
ATOM   2777 C CE1   . HIS A 1 353 ? 7.449   15.095  -5.035  1.00 47.54 ? 399 HIS A CE1   1 
ATOM   2778 N NE2   . HIS A 1 353 ? 8.110   15.434  -6.131  1.00 48.55 ? 399 HIS A NE2   1 
ATOM   2779 N N     . LYS A 1 354 ? 1.368   15.657  -7.628  1.00 39.14 ? 400 LYS A N     1 
ATOM   2780 C CA    . LYS A 1 354 ? 0.107   16.100  -8.106  1.00 39.53 ? 400 LYS A CA    1 
ATOM   2781 C C     . LYS A 1 354 ? -0.891  15.751  -6.992  1.00 39.77 ? 400 LYS A C     1 
ATOM   2782 O O     . LYS A 1 354 ? -0.497  15.402  -5.871  1.00 39.27 ? 400 LYS A O     1 
ATOM   2783 C CB    . LYS A 1 354 ? -0.233  15.384  -9.424  1.00 40.71 ? 400 LYS A CB    1 
ATOM   2784 C CG    . LYS A 1 354 ? 0.775   15.548  -10.589 1.00 41.43 ? 400 LYS A CG    1 
ATOM   2785 C CD    . LYS A 1 354 ? 0.794   16.977  -11.186 1.00 45.41 ? 400 LYS A CD    1 
ATOM   2786 C CE    . LYS A 1 354 ? 2.056   17.183  -12.084 1.00 46.95 ? 400 LYS A CE    1 
ATOM   2787 N NZ    . LYS A 1 354 ? 2.541   18.613  -12.116 1.00 48.28 ? 400 LYS A NZ    1 
ATOM   2788 N N     . ASP A 1 355 ? -2.170  15.822  -7.323  1.00 39.94 ? 401 ASP A N     1 
ATOM   2789 C CA    . ASP A 1 355 ? -3.248  15.658  -6.376  1.00 40.48 ? 401 ASP A CA    1 
ATOM   2790 C C     . ASP A 1 355 ? -3.944  14.285  -6.552  1.00 39.10 ? 401 ASP A C     1 
ATOM   2791 O O     . ASP A 1 355 ? -5.099  14.109  -6.123  1.00 39.30 ? 401 ASP A O     1 
ATOM   2792 C CB    . ASP A 1 355 ? -4.232  16.840  -6.539  1.00 41.58 ? 401 ASP A CB    1 
ATOM   2793 C CG    . ASP A 1 355 ? -5.094  16.779  -7.860  1.00 46.38 ? 401 ASP A CG    1 
ATOM   2794 O OD1   . ASP A 1 355 ? -4.974  15.830  -8.680  1.00 50.29 ? 401 ASP A OD1   1 
ATOM   2795 O OD2   . ASP A 1 355 ? -5.943  17.706  -8.071  1.00 52.67 ? 401 ASP A OD2   1 
ATOM   2796 N N     . PHE A 1 356 ? -3.244  13.331  -7.183  1.00 36.98 ? 402 PHE A N     1 
ATOM   2797 C CA    . PHE A 1 356 ? -3.830  12.011  -7.508  1.00 35.63 ? 402 PHE A CA    1 
ATOM   2798 C C     . PHE A 1 356 ? -4.085  11.166  -6.300  1.00 34.47 ? 402 PHE A C     1 
ATOM   2799 O O     . PHE A 1 356 ? -4.855  10.215  -6.377  1.00 33.72 ? 402 PHE A O     1 
ATOM   2800 C CB    . PHE A 1 356 ? -2.985  11.179  -8.507  1.00 34.61 ? 402 PHE A CB    1 
ATOM   2801 C CG    . PHE A 1 356 ? -2.634  11.905  -9.743  1.00 33.36 ? 402 PHE A CG    1 
ATOM   2802 C CD1   . PHE A 1 356 ? -3.395  13.005  -10.168 1.00 31.78 ? 402 PHE A CD1   1 
ATOM   2803 C CD2   . PHE A 1 356 ? -1.527  11.516  -10.487 1.00 31.17 ? 402 PHE A CD2   1 
ATOM   2804 C CE1   . PHE A 1 356 ? -3.026  13.719  -11.313 1.00 31.47 ? 402 PHE A CE1   1 
ATOM   2805 C CE2   . PHE A 1 356 ? -1.162  12.225  -11.657 1.00 29.85 ? 402 PHE A CE2   1 
ATOM   2806 C CZ    . PHE A 1 356 ? -1.903  13.317  -12.060 1.00 29.87 ? 402 PHE A CZ    1 
ATOM   2807 N N     . ASP A 1 357 ? -3.426  11.517  -5.203  1.00 34.74 ? 403 ASP A N     1 
ATOM   2808 C CA    . ASP A 1 357 ? -3.549  10.784  -3.951  1.00 35.82 ? 403 ASP A CA    1 
ATOM   2809 C C     . ASP A 1 357 ? -4.927  10.988  -3.298  1.00 35.63 ? 403 ASP A C     1 
ATOM   2810 O O     . ASP A 1 357 ? -5.210  10.396  -2.253  1.00 36.21 ? 403 ASP A O     1 
ATOM   2811 C CB    . ASP A 1 357 ? -2.372  11.074  -2.969  1.00 35.77 ? 403 ASP A CB    1 
ATOM   2812 C CG    . ASP A 1 357 ? -2.195  12.569  -2.645  1.00 38.60 ? 403 ASP A CG    1 
ATOM   2813 O OD1   . ASP A 1 357 ? -2.780  13.433  -3.313  1.00 39.28 ? 403 ASP A OD1   1 
ATOM   2814 O OD2   . ASP A 1 357 ? -1.429  12.894  -1.712  1.00 41.70 ? 403 ASP A OD2   1 
ATOM   2815 N N     . GLN A 1 358 ? -5.770  11.811  -3.918  1.00 35.21 ? 404 GLN A N     1 
ATOM   2816 C CA    . GLN A 1 358 ? -7.165  11.938  -3.501  1.00 35.14 ? 404 GLN A CA    1 
ATOM   2817 C C     . GLN A 1 358 ? -8.005  10.732  -3.810  1.00 33.96 ? 404 GLN A C     1 
ATOM   2818 O O     . GLN A 1 358 ? -9.144  10.666  -3.389  1.00 33.12 ? 404 GLN A O     1 
ATOM   2819 C CB    . GLN A 1 358 ? -7.828  13.136  -4.175  1.00 35.48 ? 404 GLN A CB    1 
ATOM   2820 C CG    . GLN A 1 358 ? -8.119  12.921  -5.631  1.00 36.26 ? 404 GLN A CG    1 
ATOM   2821 C CD    . GLN A 1 358 ? -8.657  14.169  -6.294  1.00 37.49 ? 404 GLN A CD    1 
ATOM   2822 O OE1   . GLN A 1 358 ? -9.847  14.476  -6.192  1.00 36.50 ? 404 GLN A OE1   1 
ATOM   2823 N NE2   . GLN A 1 358 ? -7.781  14.893  -6.980  1.00 38.37 ? 404 GLN A NE2   1 
ATOM   2824 N N     . TRP A 1 359 ? -7.462  9.823   -4.619  1.00 33.61 ? 405 TRP A N     1 
ATOM   2825 C CA    . TRP A 1 359 ? -8.178  8.606   -5.055  1.00 32.48 ? 405 TRP A CA    1 
ATOM   2826 C C     . TRP A 1 359 ? -7.435  7.389   -4.524  1.00 32.45 ? 405 TRP A C     1 
ATOM   2827 O O     . TRP A 1 359 ? -7.701  6.267   -4.937  1.00 32.30 ? 405 TRP A O     1 
ATOM   2828 C CB    . TRP A 1 359 ? -8.321  8.529   -6.569  1.00 31.64 ? 405 TRP A CB    1 
ATOM   2829 C CG    . TRP A 1 359 ? -8.942  9.743   -7.183  1.00 32.00 ? 405 TRP A CG    1 
ATOM   2830 C CD1   . TRP A 1 359 ? -10.190 10.249  -6.918  1.00 30.52 ? 405 TRP A CD1   1 
ATOM   2831 C CD2   . TRP A 1 359 ? -8.384  10.581  -8.217  1.00 32.60 ? 405 TRP A CD2   1 
ATOM   2832 N NE1   . TRP A 1 359 ? -10.420 11.354  -7.687  1.00 30.45 ? 405 TRP A NE1   1 
ATOM   2833 C CE2   . TRP A 1 359 ? -9.339  11.585  -8.496  1.00 31.34 ? 405 TRP A CE2   1 
ATOM   2834 C CE3   . TRP A 1 359 ? -7.163  10.583  -8.935  1.00 31.96 ? 405 TRP A CE3   1 
ATOM   2835 C CZ2   . TRP A 1 359 ? -9.125  12.584  -9.464  1.00 31.50 ? 405 TRP A CZ2   1 
ATOM   2836 C CZ3   . TRP A 1 359 ? -6.941  11.601  -9.876  1.00 31.19 ? 405 TRP A CZ3   1 
ATOM   2837 C CH2   . TRP A 1 359 ? -7.914  12.594  -10.117 1.00 29.94 ? 405 TRP A CH2   1 
ATOM   2838 N N     . ASP A 1 360 ? -6.548  7.625   -3.555  1.00 32.62 ? 406 ASP A N     1 
ATOM   2839 C CA    . ASP A 1 360 ? -5.846  6.558   -2.862  1.00 33.87 ? 406 ASP A CA    1 
ATOM   2840 C C     . ASP A 1 360 ? -6.754  5.462   -2.335  1.00 34.09 ? 406 ASP A C     1 
ATOM   2841 O O     . ASP A 1 360 ? -6.364  4.306   -2.316  1.00 35.67 ? 406 ASP A O     1 
ATOM   2842 C CB    . ASP A 1 360 ? -5.021  7.108   -1.693  1.00 34.49 ? 406 ASP A CB    1 
ATOM   2843 C CG    . ASP A 1 360 ? -3.626  7.563   -2.100  1.00 35.71 ? 406 ASP A CG    1 
ATOM   2844 O OD1   . ASP A 1 360 ? -3.216  7.415   -3.265  1.00 36.72 ? 406 ASP A OD1   1 
ATOM   2845 O OD2   . ASP A 1 360 ? -2.930  8.086   -1.218  1.00 38.11 ? 406 ASP A OD2   1 
ATOM   2846 N N     . CYS A 1 361 ? -7.938  5.835   -1.861  1.00 33.73 ? 407 CYS A N     1 
ATOM   2847 C CA    . CYS A 1 361 ? -8.906  4.880   -1.335  1.00 33.55 ? 407 CYS A CA    1 
ATOM   2848 C C     . CYS A 1 361 ? -9.416  3.990   -2.433  1.00 30.30 ? 407 CYS A C     1 
ATOM   2849 O O     . CYS A 1 361 ? -9.921  2.929   -2.165  1.00 29.60 ? 407 CYS A O     1 
ATOM   2850 C CB    . CYS A 1 361 ? -10.102 5.597   -0.658  1.00 33.98 ? 407 CYS A CB    1 
ATOM   2851 S SG    . CYS A 1 361 ? -11.174 6.496   -1.901  1.00 41.47 ? 407 CYS A SG    1 
ATOM   2852 N N     . LEU A 1 362 ? -9.288  4.419   -3.676  1.00 29.78 ? 408 LEU A N     1 
ATOM   2853 C CA    . LEU A 1 362 ? -9.703  3.563   -4.814  1.00 29.14 ? 408 LEU A CA    1 
ATOM   2854 C C     . LEU A 1 362 ? -8.718  2.395   -5.057  1.00 28.55 ? 408 LEU A C     1 
ATOM   2855 O O     . LEU A 1 362 ? -9.129  1.340   -5.527  1.00 28.99 ? 408 LEU A O     1 
ATOM   2856 C CB    . LEU A 1 362 ? -9.920  4.378   -6.101  1.00 29.22 ? 408 LEU A CB    1 
ATOM   2857 C CG    . LEU A 1 362 ? -10.836 5.616   -6.186  1.00 30.47 ? 408 LEU A CG    1 
ATOM   2858 C CD1   . LEU A 1 362 ? -11.147 5.932   -7.669  1.00 25.30 ? 408 LEU A CD1   1 
ATOM   2859 C CD2   . LEU A 1 362 ? -12.158 5.441   -5.392  1.00 32.86 ? 408 LEU A CD2   1 
ATOM   2860 N N     . ILE A 1 363 ? -7.443  2.565   -4.687  1.00 28.27 ? 409 ILE A N     1 
ATOM   2861 C CA    . ILE A 1 363 ? -6.467  1.460   -4.695  1.00 28.12 ? 409 ILE A CA    1 
ATOM   2862 C C     . ILE A 1 363 ? -6.841  0.321   -3.714  1.00 28.89 ? 409 ILE A C     1 
ATOM   2863 O O     . ILE A 1 363 ? -6.444  -0.835  -3.891  1.00 27.74 ? 409 ILE A O     1 
ATOM   2864 C CB    . ILE A 1 363 ? -5.016  1.930   -4.389  1.00 27.22 ? 409 ILE A CB    1 
ATOM   2865 C CG1   . ILE A 1 363 ? -4.584  3.061   -5.304  1.00 25.71 ? 409 ILE A CG1   1 
ATOM   2866 C CG2   . ILE A 1 363 ? -4.016  0.773   -4.597  1.00 27.96 ? 409 ILE A CG2   1 
ATOM   2867 C CD1   . ILE A 1 363 ? -3.345  3.865   -4.801  1.00 27.70 ? 409 ILE A CD1   1 
ATOM   2868 N N     . GLU A 1 364 ? -7.606  0.675   -2.684  1.00 30.27 ? 410 GLU A N     1 
ATOM   2869 C CA    . GLU A 1 364 ? -7.977  -0.226  -1.606  1.00 31.71 ? 410 GLU A CA    1 
ATOM   2870 C C     . GLU A 1 364 ? -9.373  -0.824  -1.847  1.00 32.73 ? 410 GLU A C     1 
ATOM   2871 O O     . GLU A 1 364 ? -9.842  -1.667  -1.074  1.00 34.62 ? 410 GLU A O     1 
ATOM   2872 C CB    . GLU A 1 364 ? -7.985  0.544   -0.293  1.00 31.76 ? 410 GLU A CB    1 
ATOM   2873 C CG    . GLU A 1 364 ? -6.707  1.280   -0.026  1.00 34.02 ? 410 GLU A CG    1 
ATOM   2874 C CD    . GLU A 1 364 ? -5.541  0.352   0.288   1.00 34.74 ? 410 GLU A CD    1 
ATOM   2875 O OE1   . GLU A 1 364 ? -5.760  -0.691  0.903   1.00 34.70 ? 410 GLU A OE1   1 
ATOM   2876 O OE2   . GLU A 1 364 ? -4.405  0.694   -0.071  1.00 39.87 ? 410 GLU A OE2   1 
ATOM   2877 N N     . GLY A 1 365 ? -10.012 -0.396  -2.927  1.00 32.85 ? 411 GLY A N     1 
ATOM   2878 C CA    . GLY A 1 365 ? -11.329 -0.888  -3.340  1.00 33.56 ? 411 GLY A CA    1 
ATOM   2879 C C     . GLY A 1 365 ? -12.463 -0.150  -2.642  1.00 33.54 ? 411 GLY A C     1 
ATOM   2880 O O     . GLY A 1 365 ? -13.583 -0.597  -2.679  1.00 33.68 ? 411 GLY A O     1 
ATOM   2881 N N     . ASP A 1 366 ? -12.154 0.977   -2.014  1.00 34.38 ? 412 ASP A N     1 
ATOM   2882 C CA    . ASP A 1 366 ? -13.073 1.692   -1.124  1.00 35.99 ? 412 ASP A CA    1 
ATOM   2883 C C     . ASP A 1 366 ? -14.051 2.547   -1.907  1.00 36.54 ? 412 ASP A C     1 
ATOM   2884 O O     . ASP A 1 366 ? -13.922 3.781   -1.896  1.00 37.04 ? 412 ASP A O     1 
ATOM   2885 C CB    . ASP A 1 366 ? -12.262 2.586   -0.170  1.00 36.84 ? 412 ASP A CB    1 
ATOM   2886 C CG    . ASP A 1 366 ? -13.087 3.126   1.033   1.00 40.19 ? 412 ASP A CG    1 
ATOM   2887 O OD1   . ASP A 1 366 ? -14.160 2.562   1.348   1.00 42.46 ? 412 ASP A OD1   1 
ATOM   2888 O OD2   . ASP A 1 366 ? -12.628 4.103   1.689   1.00 40.29 ? 412 ASP A OD2   1 
ATOM   2889 N N     . ASP A 1 367 ? -14.994 1.897   -2.599  1.00 36.11 ? 413 ASP A N     1 
ATOM   2890 C CA    . ASP A 1 367 ? -16.031 2.558   -3.404  1.00 36.52 ? 413 ASP A CA    1 
ATOM   2891 C C     . ASP A 1 367 ? -17.209 1.615   -3.533  1.00 37.23 ? 413 ASP A C     1 
ATOM   2892 O O     . ASP A 1 367 ? -17.032 0.383   -3.473  1.00 36.42 ? 413 ASP A O     1 
ATOM   2893 C CB    . ASP A 1 367 ? -15.537 2.813   -4.820  1.00 37.02 ? 413 ASP A CB    1 
ATOM   2894 C CG    . ASP A 1 367 ? -16.445 3.750   -5.615  1.00 36.15 ? 413 ASP A CG    1 
ATOM   2895 O OD1   . ASP A 1 367 ? -16.347 4.955   -5.394  1.00 37.06 ? 413 ASP A OD1   1 
ATOM   2896 O OD2   . ASP A 1 367 ? -17.241 3.294   -6.461  1.00 36.50 ? 413 ASP A OD2   1 
ATOM   2897 N N     . GLU A 1 368 ? -18.397 2.173   -3.782  1.00 37.65 ? 414 GLU A N     1 
ATOM   2898 C CA    . GLU A 1 368 ? -19.588 1.357   -3.861  1.00 38.71 ? 414 GLU A CA    1 
ATOM   2899 C C     . GLU A 1 368 ? -19.519 0.460   -5.069  1.00 36.93 ? 414 GLU A C     1 
ATOM   2900 O O     . GLU A 1 368 ? -20.196 -0.564  -5.109  1.00 35.61 ? 414 GLU A O     1 
ATOM   2901 C CB    . GLU A 1 368 ? -20.914 2.190   -3.799  1.00 39.66 ? 414 GLU A CB    1 
ATOM   2902 C CG    . GLU A 1 368 ? -20.832 3.739   -3.933  1.00 43.54 ? 414 GLU A CG    1 
ATOM   2903 C CD    . GLU A 1 368 ? -22.097 4.493   -3.356  1.00 42.85 ? 414 GLU A CD    1 
ATOM   2904 O OE1   . GLU A 1 368 ? -21.958 5.280   -2.358  1.00 46.15 ? 414 GLU A OE1   1 
ATOM   2905 O OE2   . GLU A 1 368 ? -23.220 4.305   -3.913  1.00 45.65 ? 414 GLU A OE2   1 
ATOM   2906 N N     . ASN A 1 369 ? -18.709 0.886   -6.067  1.00 37.13 ? 415 ASN A N     1 
ATOM   2907 C CA    . ASN A 1 369 ? -18.521 0.184   -7.365  1.00 35.51 ? 415 ASN A CA    1 
ATOM   2908 C C     . ASN A 1 369 ? -17.219 -0.624  -7.477  1.00 34.48 ? 415 ASN A C     1 
ATOM   2909 O O     . ASN A 1 369 ? -16.924 -1.223  -8.545  1.00 33.65 ? 415 ASN A O     1 
ATOM   2910 C CB    . ASN A 1 369 ? -18.640 1.147   -8.545  1.00 35.72 ? 415 ASN A CB    1 
ATOM   2911 C CG    . ASN A 1 369 ? -20.063 1.626   -8.785  1.00 36.80 ? 415 ASN A CG    1 
ATOM   2912 O OD1   . ASN A 1 369 ? -20.368 2.818   -8.584  1.00 37.11 ? 415 ASN A OD1   1 
ATOM   2913 N ND2   . ASN A 1 369 ? -20.922 0.727   -9.262  1.00 32.94 ? 415 ASN A ND2   1 
ATOM   2914 N N     . LEU A 1 370 ? -16.484 -0.687  -6.363  1.00 33.61 ? 416 LEU A N     1 
ATOM   2915 C CA    . LEU A 1 370 ? -15.300 -1.595  -6.221  1.00 34.01 ? 416 LEU A CA    1 
ATOM   2916 C C     . LEU A 1 370 ? -15.392 -2.686  -5.134  1.00 34.60 ? 416 LEU A C     1 
ATOM   2917 O O     . LEU A 1 370 ? -15.988 -2.493  -4.091  1.00 34.57 ? 416 LEU A O     1 
ATOM   2918 C CB    . LEU A 1 370 ? -13.995 -0.806  -5.987  1.00 32.55 ? 416 LEU A CB    1 
ATOM   2919 C CG    . LEU A 1 370 ? -13.696 0.369   -6.906  1.00 31.29 ? 416 LEU A CG    1 
ATOM   2920 C CD1   . LEU A 1 370 ? -12.478 1.223   -6.455  1.00 26.32 ? 416 LEU A CD1   1 
ATOM   2921 C CD2   . LEU A 1 370 ? -13.573 -0.128  -8.319  1.00 25.46 ? 416 LEU A CD2   1 
ATOM   2922 N N     . ILE A 1 371 ? -14.749 -3.807  -5.412  1.00 34.80 ? 417 ILE A N     1 
ATOM   2923 C CA    . ILE A 1 371 ? -14.429 -4.851  -4.460  1.00 35.72 ? 417 ILE A CA    1 
ATOM   2924 C C     . ILE A 1 371 ? -12.877 -4.782  -4.216  1.00 35.04 ? 417 ILE A C     1 
ATOM   2925 O O     . ILE A 1 371 ? -12.092 -4.780  -5.171  1.00 34.10 ? 417 ILE A O     1 
ATOM   2926 C CB    . ILE A 1 371 ? -14.834 -6.201  -5.101  1.00 35.84 ? 417 ILE A CB    1 
ATOM   2927 C CG1   . ILE A 1 371 ? -16.341 -6.182  -5.395  1.00 38.14 ? 417 ILE A CG1   1 
ATOM   2928 C CG2   . ILE A 1 371 ? -14.496 -7.378  -4.228  1.00 36.71 ? 417 ILE A CG2   1 
ATOM   2929 C CD1   . ILE A 1 371 ? -16.855 -7.175  -6.530  1.00 36.99 ? 417 ILE A CD1   1 
ATOM   2930 N N     . PRO A 1 372 ? -12.440 -4.678  -2.933  1.00 34.86 ? 418 PRO A N     1 
ATOM   2931 C CA    . PRO A 1 372 ? -11.063 -4.926  -2.579  1.00 33.58 ? 418 PRO A CA    1 
ATOM   2932 C C     . PRO A 1 372 ? -10.745 -6.332  -3.027  1.00 32.80 ? 418 PRO A C     1 
ATOM   2933 O O     . PRO A 1 372 ? -11.546 -7.253  -2.796  1.00 31.67 ? 418 PRO A O     1 
ATOM   2934 C CB    . PRO A 1 372 ? -11.108 -4.891  -1.040  1.00 34.08 ? 418 PRO A CB    1 
ATOM   2935 C CG    . PRO A 1 372 ? -12.231 -4.045  -0.712  1.00 33.54 ? 418 PRO A CG    1 
ATOM   2936 C CD    . PRO A 1 372 ? -13.244 -4.341  -1.732  1.00 34.59 ? 418 PRO A CD    1 
ATOM   2937 N N     . GLY A 1 373 ? -9.629  -6.512  -3.711  1.00 31.67 ? 419 GLY A N     1 
ATOM   2938 C CA    . GLY A 1 373 ? -9.291  -7.844  -4.144  1.00 31.79 ? 419 GLY A CA    1 
ATOM   2939 C C     . GLY A 1 373 ? -10.145 -8.377  -5.271  1.00 32.19 ? 419 GLY A C     1 
ATOM   2940 O O     . GLY A 1 373 ? -10.348 -7.699  -6.275  1.00 32.45 ? 419 GLY A O     1 
ATOM   2941 N N     . THR A 1 374 ? -10.591 -9.619  -5.125  1.00 32.53 ? 420 THR A N     1 
ATOM   2942 C CA    . THR A 1 374 ? -11.266 -10.342 -6.181  1.00 33.89 ? 420 THR A CA    1 
ATOM   2943 C C     . THR A 1 374 ? -12.481 -11.042 -5.577  1.00 35.58 ? 420 THR A C     1 
ATOM   2944 O O     . THR A 1 374 ? -12.444 -11.475 -4.422  1.00 36.05 ? 420 THR A O     1 
ATOM   2945 C CB    . THR A 1 374 ? -10.337 -11.393 -6.882  1.00 33.23 ? 420 THR A CB    1 
ATOM   2946 O OG1   . THR A 1 374 ? -11.055 -12.093 -7.912  1.00 33.25 ? 420 THR A OG1   1 
ATOM   2947 C CG2   . THR A 1 374 ? -9.823  -12.438 -5.883  1.00 33.97 ? 420 THR A CG2   1 
ATOM   2948 N N     . ASN A 1 375 ? -13.551 -11.118 -6.358  1.00 37.50 ? 421 ASN A N     1 
ATOM   2949 C CA    . ASN A 1 375 ? -14.734 -11.899 -6.032  1.00 39.39 ? 421 ASN A CA    1 
ATOM   2950 C C     . ASN A 1 375 ? -14.420 -13.399 -6.090  1.00 42.29 ? 421 ASN A C     1 
ATOM   2951 O O     . ASN A 1 375 ? -15.035 -14.165 -5.357  1.00 43.84 ? 421 ASN A O     1 
ATOM   2952 C CB    . ASN A 1 375 ? -15.909 -11.567 -6.979  1.00 37.90 ? 421 ASN A CB    1 
ATOM   2953 C CG    . ASN A 1 375 ? -15.508 -11.543 -8.459  1.00 34.40 ? 421 ASN A CG    1 
ATOM   2954 O OD1   . ASN A 1 375 ? -14.710 -10.717 -8.869  1.00 34.53 ? 421 ASN A OD1   1 
ATOM   2955 N ND2   . ASN A 1 375 ? -16.083 -12.433 -9.267  1.00 30.50 ? 421 ASN A ND2   1 
ATOM   2956 N N     . ILE A 1 376 ? -13.476 -13.813 -6.941  1.00 44.36 ? 422 ILE A N     1 
ATOM   2957 C CA    . ILE A 1 376 ? -13.032 -15.221 -7.039  1.00 47.96 ? 422 ILE A CA    1 
ATOM   2958 C C     . ILE A 1 376 ? -12.169 -15.623 -5.836  1.00 49.68 ? 422 ILE A C     1 
ATOM   2959 O O     . ILE A 1 376 ? -10.942 -15.607 -5.966  1.00 50.88 ? 422 ILE A O     1 
ATOM   2960 C CB    . ILE A 1 376 ? -12.137 -15.454 -8.317  1.00 46.16 ? 422 ILE A CB    1 
ATOM   2961 C CG1   . ILE A 1 376 ? -12.679 -14.758 -9.573  1.00 42.78 ? 422 ILE A CG1   1 
ATOM   2962 C CG2   . ILE A 1 376 ? -11.911 -16.907 -8.584  1.00 47.27 ? 422 ILE A CG2   1 
ATOM   2963 C CD1   . ILE A 1 376 ? -13.825 -15.378 -10.182 1.00 33.25 ? 422 ILE A CD1   1 
ATOM   2964 N N     . ASN A 1 377 ? -12.787 -16.026 -4.711  1.00 52.47 ? 423 ASN A N     1 
ATOM   2965 C CA    . ASN A 1 377 ? -12.115 -16.199 -3.372  1.00 55.12 ? 423 ASN A CA    1 
ATOM   2966 C C     . ASN A 1 377 ? -11.009 -17.306 -3.159  1.00 57.03 ? 423 ASN A C     1 
ATOM   2967 O O     . ASN A 1 377 ? -10.399 -17.385 -2.059  1.00 57.09 ? 423 ASN A O     1 
ATOM   2968 C CB    . ASN A 1 377 ? -13.159 -16.223 -2.218  1.00 56.10 ? 423 ASN A CB    1 
ATOM   2969 C CG    . ASN A 1 377 ? -13.938 -14.873 -2.070  1.00 58.77 ? 423 ASN A CG    1 
ATOM   2970 O OD1   . ASN A 1 377 ? -13.684 -13.905 -2.795  1.00 61.69 ? 423 ASN A OD1   1 
ATOM   2971 N ND2   . ASN A 1 377 ? -14.893 -14.828 -1.133  1.00 60.67 ? 423 ASN A ND2   1 
ATOM   2972 N N     . THR A 1 378 ? -10.776 -18.130 -4.197  1.00 58.12 ? 424 THR A N     1 
ATOM   2973 C CA    . THR A 1 378 ? -9.663  -19.097 -4.309  1.00 59.23 ? 424 THR A CA    1 
ATOM   2974 C C     . THR A 1 378 ? -8.353  -18.683 -3.627  1.00 61.93 ? 424 THR A C     1 
ATOM   2975 O O     . THR A 1 378 ? -7.724  -17.706 -4.076  1.00 63.25 ? 424 THR A O     1 
ATOM   2976 C CB    . THR A 1 378 ? -9.360  -19.453 -5.837  1.00 59.45 ? 424 THR A CB    1 
ATOM   2977 O OG1   . THR A 1 378 ? -8.035  -19.967 -5.990  1.00 59.50 ? 424 THR A OG1   1 
ATOM   2978 C CG2   . THR A 1 378 ? -9.461  -18.258 -6.729  1.00 59.44 ? 424 THR A CG2   1 
ATOM   2979 N N     . THR A 1 379 ? -7.933  -19.410 -2.570  1.00 63.10 ? 425 THR A N     1 
ATOM   2980 C CA    . THR A 1 379 ? -6.596  -19.187 -1.930  1.00 64.37 ? 425 THR A CA    1 
ATOM   2981 C C     . THR A 1 379 ? -5.736  -20.463 -1.893  1.00 64.62 ? 425 THR A C     1 
ATOM   2982 O O     . THR A 1 379 ? -6.216  -21.553 -1.551  1.00 64.51 ? 425 THR A O     1 
ATOM   2983 C CB    . THR A 1 379 ? -6.664  -18.481 -0.484  1.00 64.78 ? 425 THR A CB    1 
ATOM   2984 O OG1   . THR A 1 379 ? -5.657  -17.443 -0.360  1.00 65.71 ? 425 THR A OG1   1 
ATOM   2985 C CG2   . THR A 1 379 ? -6.542  -19.497 0.677   1.00 64.40 ? 425 THR A CG2   1 
ATOM   2986 N N     . THR B 1 8   ? 52.421  -10.693 -5.136  1.00 49.89 ? 54  THR B N     1 
ATOM   2987 C CA    . THR B 1 8   ? 52.630  -9.346  -5.787  1.00 50.23 ? 54  THR B CA    1 
ATOM   2988 C C     . THR B 1 8   ? 52.064  -8.096  -5.025  1.00 48.57 ? 54  THR B C     1 
ATOM   2989 O O     . THR B 1 8   ? 51.629  -8.193  -3.861  1.00 49.58 ? 54  THR B O     1 
ATOM   2990 C CB    . THR B 1 8   ? 52.213  -9.315  -7.321  1.00 50.95 ? 54  THR B CB    1 
ATOM   2991 O OG1   . THR B 1 8   ? 50.793  -8.996  -7.458  1.00 53.51 ? 54  THR B OG1   1 
ATOM   2992 C CG2   . THR B 1 8   ? 52.668  -10.625 -8.091  1.00 49.54 ? 54  THR B CG2   1 
ATOM   2993 N N     . LYS B 1 9   ? 52.070  -6.938  -5.706  1.00 45.87 ? 55  LYS B N     1 
ATOM   2994 C CA    . LYS B 1 9   ? 51.951  -5.622  -5.053  1.00 43.12 ? 55  LYS B CA    1 
ATOM   2995 C C     . LYS B 1 9   ? 50.562  -4.944  -5.096  1.00 39.84 ? 55  LYS B C     1 
ATOM   2996 O O     . LYS B 1 9   ? 50.385  -3.865  -4.552  1.00 39.43 ? 55  LYS B O     1 
ATOM   2997 C CB    . LYS B 1 9   ? 53.023  -4.688  -5.644  1.00 43.40 ? 55  LYS B CB    1 
ATOM   2998 C CG    . LYS B 1 9   ? 54.460  -5.270  -5.648  1.00 45.56 ? 55  LYS B CG    1 
ATOM   2999 C CD    . LYS B 1 9   ? 55.564  -4.170  -5.663  1.00 45.83 ? 55  LYS B CD    1 
ATOM   3000 C CE    . LYS B 1 9   ? 55.985  -3.755  -4.261  1.00 50.34 ? 55  LYS B CE    1 
ATOM   3001 N NZ    . LYS B 1 9   ? 56.479  -4.885  -3.383  1.00 51.05 ? 55  LYS B NZ    1 
ATOM   3002 N N     . ILE B 1 10  ? 49.595  -5.573  -5.765  1.00 36.42 ? 56  ILE B N     1 
ATOM   3003 C CA    . ILE B 1 10  ? 48.240  -5.049  -5.895  1.00 32.70 ? 56  ILE B CA    1 
ATOM   3004 C C     . ILE B 1 10  ? 47.478  -5.563  -4.668  1.00 32.15 ? 56  ILE B C     1 
ATOM   3005 O O     . ILE B 1 10  ? 47.514  -6.759  -4.377  1.00 30.95 ? 56  ILE B O     1 
ATOM   3006 C CB    . ILE B 1 10  ? 47.574  -5.525  -7.222  1.00 31.46 ? 56  ILE B CB    1 
ATOM   3007 C CG1   . ILE B 1 10  ? 48.225  -4.840  -8.396  1.00 28.95 ? 56  ILE B CG1   1 
ATOM   3008 C CG2   . ILE B 1 10  ? 46.067  -5.260  -7.209  1.00 30.57 ? 56  ILE B CG2   1 
ATOM   3009 C CD1   . ILE B 1 10  ? 47.930  -5.481  -9.715  1.00 30.43 ? 56  ILE B CD1   1 
ATOM   3010 N N     . PRO B 1 11  ? 46.874  -4.646  -3.895  1.00 31.87 ? 57  PRO B N     1 
ATOM   3011 C CA    . PRO B 1 11  ? 46.306  -5.026  -2.595  1.00 32.43 ? 57  PRO B CA    1 
ATOM   3012 C C     . PRO B 1 11  ? 45.099  -5.958  -2.678  1.00 33.54 ? 57  PRO B C     1 
ATOM   3013 O O     . PRO B 1 11  ? 44.216  -5.784  -3.515  1.00 35.32 ? 57  PRO B O     1 
ATOM   3014 C CB    . PRO B 1 11  ? 45.903  -3.676  -2.000  1.00 32.53 ? 57  PRO B CB    1 
ATOM   3015 C CG    . PRO B 1 11  ? 45.702  -2.769  -3.213  1.00 30.89 ? 57  PRO B CG    1 
ATOM   3016 C CD    . PRO B 1 11  ? 46.758  -3.196  -4.145  1.00 31.11 ? 57  PRO B CD    1 
ATOM   3017 N N     . ARG B 1 12  ? 45.078  -6.955  -1.819  1.00 34.81 ? 58  ARG B N     1 
ATOM   3018 C CA    . ARG B 1 12  ? 43.896  -7.779  -1.585  1.00 36.51 ? 58  ARG B CA    1 
ATOM   3019 C C     . ARG B 1 12  ? 42.685  -6.886  -1.254  1.00 36.69 ? 58  ARG B C     1 
ATOM   3020 O O     . ARG B 1 12  ? 42.837  -5.715  -0.801  1.00 36.97 ? 58  ARG B O     1 
ATOM   3021 C CB    . ARG B 1 12  ? 44.172  -8.803  -0.472  1.00 36.52 ? 58  ARG B CB    1 
ATOM   3022 C CG    . ARG B 1 12  ? 45.547  -9.466  -0.551  1.00 39.50 ? 58  ARG B CG    1 
ATOM   3023 C CD    . ARG B 1 12  ? 46.534  -8.863  0.499   1.00 47.93 ? 58  ARG B CD    1 
ATOM   3024 N NE    . ARG B 1 12  ? 47.359  -7.730  0.019   1.00 49.61 ? 58  ARG B NE    1 
ATOM   3025 C CZ    . ARG B 1 12  ? 47.626  -6.619  0.717   1.00 49.67 ? 58  ARG B CZ    1 
ATOM   3026 N NH1   . ARG B 1 12  ? 47.104  -6.433  1.922   1.00 50.77 ? 58  ARG B NH1   1 
ATOM   3027 N NH2   . ARG B 1 12  ? 48.398  -5.672  0.192   1.00 50.20 ? 58  ARG B NH2   1 
ATOM   3028 N N     . GLY B 1 13  ? 41.501  -7.413  -1.538  1.00 36.97 ? 59  GLY B N     1 
ATOM   3029 C CA    . GLY B 1 13  ? 40.254  -6.718  -1.233  1.00 38.45 ? 59  GLY B CA    1 
ATOM   3030 C C     . GLY B 1 13  ? 40.190  -6.453  0.265   1.00 39.74 ? 59  GLY B C     1 
ATOM   3031 O O     . GLY B 1 13  ? 40.805  -7.184  1.045   1.00 39.66 ? 59  GLY B O     1 
ATOM   3032 N N     . ASN B 1 14  ? 39.486  -5.407  0.678   1.00 40.52 ? 60  ASN B N     1 
ATOM   3033 C CA    . ASN B 1 14  ? 39.440  -5.098  2.108   1.00 42.12 ? 60  ASN B CA    1 
ATOM   3034 C C     . ASN B 1 14  ? 38.197  -5.656  2.791   1.00 43.08 ? 60  ASN B C     1 
ATOM   3035 O O     . ASN B 1 14  ? 38.138  -5.737  4.017   1.00 43.96 ? 60  ASN B O     1 
ATOM   3036 C CB    . ASN B 1 14  ? 39.606  -3.606  2.366   1.00 41.84 ? 60  ASN B CB    1 
ATOM   3037 C CG    . ASN B 1 14  ? 41.071  -3.147  2.237   1.00 43.30 ? 60  ASN B CG    1 
ATOM   3038 O OD1   . ASN B 1 14  ? 41.348  -2.042  1.767   1.00 48.43 ? 60  ASN B OD1   1 
ATOM   3039 N ND2   . ASN B 1 14  ? 41.999  -3.994  2.642   1.00 41.94 ? 60  ASN B ND2   1 
ATOM   3040 N N     . GLY B 1 15  ? 37.235  -6.087  1.983   1.00 42.77 ? 61  GLY B N     1 
ATOM   3041 C CA    . GLY B 1 15  ? 36.042  -6.706  2.482   1.00 42.37 ? 61  GLY B CA    1 
ATOM   3042 C C     . GLY B 1 15  ? 36.184  -8.153  2.872   1.00 42.18 ? 61  GLY B C     1 
ATOM   3043 O O     . GLY B 1 15  ? 37.253  -8.754  2.702   1.00 42.33 ? 61  GLY B O     1 
ATOM   3044 N N     . PRO B 1 16  ? 35.096  -8.709  3.438   1.00 42.22 ? 62  PRO B N     1 
ATOM   3045 C CA    . PRO B 1 16  ? 34.972  -10.054 3.982   1.00 41.99 ? 62  PRO B CA    1 
ATOM   3046 C C     . PRO B 1 16  ? 34.786  -11.152 2.949   1.00 42.17 ? 62  PRO B C     1 
ATOM   3047 O O     . PRO B 1 16  ? 34.865  -12.317 3.291   1.00 41.22 ? 62  PRO B O     1 
ATOM   3048 C CB    . PRO B 1 16  ? 33.704  -9.953  4.837   1.00 42.75 ? 62  PRO B CB    1 
ATOM   3049 C CG    . PRO B 1 16  ? 32.875  -8.883  4.156   1.00 42.31 ? 62  PRO B CG    1 
ATOM   3050 C CD    . PRO B 1 16  ? 33.868  -7.906  3.641   1.00 41.65 ? 62  PRO B CD    1 
ATOM   3051 N N     . TYR B 1 17  ? 34.506  -10.794 1.698   1.00 42.38 ? 63  TYR B N     1 
ATOM   3052 C CA    . TYR B 1 17  ? 34.370  -11.815 0.675   1.00 42.19 ? 63  TYR B CA    1 
ATOM   3053 C C     . TYR B 1 17  ? 35.696  -12.186 0.014   1.00 41.55 ? 63  TYR B C     1 
ATOM   3054 O O     . TYR B 1 17  ? 36.581  -11.343 -0.224  1.00 40.84 ? 63  TYR B O     1 
ATOM   3055 C CB    . TYR B 1 17  ? 33.429  -11.368 -0.419  1.00 43.35 ? 63  TYR B CB    1 
ATOM   3056 C CG    . TYR B 1 17  ? 31.991  -11.236 -0.059  1.00 44.24 ? 63  TYR B CG    1 
ATOM   3057 C CD1   . TYR B 1 17  ? 31.114  -12.315 -0.217  1.00 46.19 ? 63  TYR B CD1   1 
ATOM   3058 C CD2   . TYR B 1 17  ? 31.475  -10.022 0.357   1.00 44.95 ? 63  TYR B CD2   1 
ATOM   3059 C CE1   . TYR B 1 17  ? 29.760  -12.190 0.057   1.00 45.52 ? 63  TYR B CE1   1 
ATOM   3060 C CE2   . TYR B 1 17  ? 30.118  -9.886  0.634   1.00 47.20 ? 63  TYR B CE2   1 
ATOM   3061 C CZ    . TYR B 1 17  ? 29.270  -10.980 0.495   1.00 46.41 ? 63  TYR B CZ    1 
ATOM   3062 O OH    . TYR B 1 17  ? 27.921  -10.848 0.774   1.00 47.27 ? 63  TYR B OH    1 
ATOM   3063 N N     . SER B 1 18  ? 35.809  -13.475 -0.269  1.00 40.43 ? 64  SER B N     1 
ATOM   3064 C CA    . SER B 1 18  ? 36.784  -13.980 -1.197  1.00 39.54 ? 64  SER B CA    1 
ATOM   3065 C C     . SER B 1 18  ? 36.436  -13.500 -2.612  1.00 37.62 ? 64  SER B C     1 
ATOM   3066 O O     . SER B 1 18  ? 35.261  -13.466 -2.986  1.00 36.76 ? 64  SER B O     1 
ATOM   3067 C CB    . SER B 1 18  ? 36.758  -15.501 -1.129  1.00 39.51 ? 64  SER B CB    1 
ATOM   3068 O OG    . SER B 1 18  ? 37.447  -15.871 0.035   1.00 42.37 ? 64  SER B OG    1 
ATOM   3069 N N     . VAL B 1 19  ? 37.463  -13.131 -3.374  1.00 35.65 ? 65  VAL B N     1 
ATOM   3070 C CA    . VAL B 1 19  ? 37.304  -12.666 -4.754  1.00 33.57 ? 65  VAL B CA    1 
ATOM   3071 C C     . VAL B 1 19  ? 37.767  -13.710 -5.786  1.00 32.74 ? 65  VAL B C     1 
ATOM   3072 O O     . VAL B 1 19  ? 38.885  -14.200 -5.716  1.00 32.87 ? 65  VAL B O     1 
ATOM   3073 C CB    . VAL B 1 19  ? 38.029  -11.326 -4.938  1.00 33.87 ? 65  VAL B CB    1 
ATOM   3074 C CG1   . VAL B 1 19  ? 37.758  -10.686 -6.345  1.00 30.55 ? 65  VAL B CG1   1 
ATOM   3075 C CG2   . VAL B 1 19  ? 37.611  -10.393 -3.794  1.00 33.10 ? 65  VAL B CG2   1 
ATOM   3076 N N     . GLY B 1 20  ? 36.871  -14.082 -6.703  1.00 31.86 ? 66  GLY B N     1 
ATOM   3077 C CA    . GLY B 1 20  ? 37.214  -14.864 -7.877  1.00 29.77 ? 66  GLY B CA    1 
ATOM   3078 C C     . GLY B 1 20  ? 37.349  -13.947 -9.092  1.00 29.69 ? 66  GLY B C     1 
ATOM   3079 O O     . GLY B 1 20  ? 36.901  -12.796 -9.054  1.00 28.92 ? 66  GLY B O     1 
ATOM   3080 N N     . CYS B 1 21  ? 37.962  -14.462 -10.171 1.00 29.12 ? 67  CYS B N     1 
ATOM   3081 C CA    . CYS B 1 21  ? 38.136  -13.712 -11.421 1.00 28.00 ? 67  CYS B CA    1 
ATOM   3082 C C     . CYS B 1 21  ? 38.055  -14.632 -12.632 1.00 27.41 ? 67  CYS B C     1 
ATOM   3083 O O     . CYS B 1 21  ? 38.596  -15.717 -12.639 1.00 26.42 ? 67  CYS B O     1 
ATOM   3084 C CB    . CYS B 1 21  ? 39.459  -12.935 -11.417 1.00 27.95 ? 67  CYS B CB    1 
ATOM   3085 S SG    . CYS B 1 21  ? 39.763  -11.911 -12.846 1.00 30.37 ? 67  CYS B SG    1 
ATOM   3086 N N     . THR B 1 22  ? 37.335  -14.195 -13.655 1.00 27.24 ? 68  THR B N     1 
ATOM   3087 C CA    . THR B 1 22  ? 37.297  -14.913 -14.903 1.00 26.27 ? 68  THR B CA    1 
ATOM   3088 C C     . THR B 1 22  ? 37.223  -13.874 -16.023 1.00 27.04 ? 68  THR B C     1 
ATOM   3089 O O     . THR B 1 22  ? 37.183  -12.662 -15.743 1.00 27.18 ? 68  THR B O     1 
ATOM   3090 C CB    . THR B 1 22  ? 36.219  -16.046 -14.943 1.00 26.60 ? 68  THR B CB    1 
ATOM   3091 O OG1   . THR B 1 22  ? 36.488  -16.916 -16.053 1.00 27.61 ? 68  THR B OG1   1 
ATOM   3092 C CG2   . THR B 1 22  ? 34.764  -15.522 -15.025 1.00 24.48 ? 68  THR B CG2   1 
ATOM   3093 N N     . ASP B 1 23  ? 37.226  -14.353 -17.268 1.00 27.13 ? 69  ASP B N     1 
ATOM   3094 C CA    . ASP B 1 23  ? 37.171  -13.536 -18.473 1.00 27.16 ? 69  ASP B CA    1 
ATOM   3095 C C     . ASP B 1 23  ? 36.070  -14.144 -19.278 1.00 27.11 ? 69  ASP B C     1 
ATOM   3096 O O     . ASP B 1 23  ? 35.944  -15.382 -19.277 1.00 27.74 ? 69  ASP B O     1 
ATOM   3097 C CB    . ASP B 1 23  ? 38.465  -13.660 -19.283 1.00 26.50 ? 69  ASP B CB    1 
ATOM   3098 C CG    . ASP B 1 23  ? 39.515  -12.675 -18.874 1.00 27.50 ? 69  ASP B CG    1 
ATOM   3099 O OD1   . ASP B 1 23  ? 39.191  -11.647 -18.239 1.00 28.33 ? 69  ASP B OD1   1 
ATOM   3100 O OD2   . ASP B 1 23  ? 40.698  -12.929 -19.160 1.00 26.26 ? 69  ASP B OD2   1 
ATOM   3101 N N     . LEU B 1 24  ? 35.270  -13.291 -19.930 1.00 25.83 ? 70  LEU B N     1 
ATOM   3102 C CA    . LEU B 1 24  ? 34.186  -13.712 -20.807 1.00 25.22 ? 70  LEU B CA    1 
ATOM   3103 C C     . LEU B 1 24  ? 34.207  -12.916 -22.145 1.00 25.96 ? 70  LEU B C     1 
ATOM   3104 O O     . LEU B 1 24  ? 34.205  -11.681 -22.133 1.00 24.25 ? 70  LEU B O     1 
ATOM   3105 C CB    . LEU B 1 24  ? 32.859  -13.467 -20.094 1.00 25.65 ? 70  LEU B CB    1 
ATOM   3106 C CG    . LEU B 1 24  ? 31.540  -13.557 -20.873 1.00 26.05 ? 70  LEU B CG    1 
ATOM   3107 C CD1   . LEU B 1 24  ? 31.393  -15.036 -21.311 1.00 26.82 ? 70  LEU B CD1   1 
ATOM   3108 C CD2   . LEU B 1 24  ? 30.311  -13.042 -20.057 1.00 25.40 ? 70  LEU B CD2   1 
ATOM   3109 N N     . MET B 1 25  ? 34.269  -13.646 -23.274 1.00 26.17 ? 71  MET B N     1 
ATOM   3110 C CA    . MET B 1 25  ? 34.094  -13.079 -24.607 1.00 26.52 ? 71  MET B CA    1 
ATOM   3111 C C     . MET B 1 25  ? 32.899  -13.716 -25.309 1.00 27.39 ? 71  MET B C     1 
ATOM   3112 O O     . MET B 1 25  ? 32.888  -14.900 -25.610 1.00 27.64 ? 71  MET B O     1 
ATOM   3113 C CB    . MET B 1 25  ? 35.366  -13.186 -25.440 1.00 25.84 ? 71  MET B CB    1 
ATOM   3114 C CG    . MET B 1 25  ? 35.314  -12.332 -26.707 1.00 26.17 ? 71  MET B CG    1 
ATOM   3115 S SD    . MET B 1 25  ? 36.689  -12.608 -27.834 1.00 27.03 ? 71  MET B SD    1 
ATOM   3116 C CE    . MET B 1 25  ? 38.056  -11.897 -26.917 1.00 25.96 ? 71  MET B CE    1 
ATOM   3117 N N     . PHE B 1 26  ? 31.872  -12.904 -25.549 1.00 28.93 ? 72  PHE B N     1 
ATOM   3118 C CA    . PHE B 1 26  ? 30.678  -13.354 -26.209 1.00 29.25 ? 72  PHE B CA    1 
ATOM   3119 C C     . PHE B 1 26  ? 30.016  -12.214 -26.952 1.00 29.28 ? 72  PHE B C     1 
ATOM   3120 O O     . PHE B 1 26  ? 29.631  -11.210 -26.355 1.00 29.91 ? 72  PHE B O     1 
ATOM   3121 C CB    . PHE B 1 26  ? 29.685  -14.028 -25.222 1.00 30.20 ? 72  PHE B CB    1 
ATOM   3122 C CG    . PHE B 1 26  ? 28.500  -14.608 -25.914 1.00 30.24 ? 72  PHE B CG    1 
ATOM   3123 C CD1   . PHE B 1 26  ? 27.266  -13.998 -25.842 1.00 33.41 ? 72  PHE B CD1   1 
ATOM   3124 C CD2   . PHE B 1 26  ? 28.650  -15.723 -26.735 1.00 35.23 ? 72  PHE B CD2   1 
ATOM   3125 C CE1   . PHE B 1 26  ? 26.164  -14.517 -26.541 1.00 38.06 ? 72  PHE B CE1   1 
ATOM   3126 C CE2   . PHE B 1 26  ? 27.557  -16.241 -27.457 1.00 36.51 ? 72  PHE B CE2   1 
ATOM   3127 C CZ    . PHE B 1 26  ? 26.312  -15.656 -27.333 1.00 34.00 ? 72  PHE B CZ    1 
ATOM   3128 N N     . ASP B 1 27  ? 29.880  -12.334 -28.266 1.00 29.90 ? 73  ASP B N     1 
ATOM   3129 C CA    . ASP B 1 27  ? 30.422  -13.410 -29.048 1.00 29.38 ? 73  ASP B CA    1 
ATOM   3130 C C     . ASP B 1 27  ? 31.897  -13.187 -29.367 1.00 29.48 ? 73  ASP B C     1 
ATOM   3131 O O     . ASP B 1 27  ? 32.514  -12.207 -28.885 1.00 28.78 ? 73  ASP B O     1 
ATOM   3132 C CB    . ASP B 1 27  ? 29.617  -13.541 -30.343 1.00 30.37 ? 73  ASP B CB    1 
ATOM   3133 C CG    . ASP B 1 27  ? 29.574  -12.249 -31.169 1.00 32.15 ? 73  ASP B CG    1 
ATOM   3134 O OD1   . ASP B 1 27  ? 30.417  -11.314 -31.003 1.00 33.30 ? 73  ASP B OD1   1 
ATOM   3135 O OD2   . ASP B 1 27  ? 28.696  -12.207 -32.045 1.00 34.32 ? 73  ASP B OD2   1 
ATOM   3136 N N     . HIS B 1 28  ? 32.441  -14.071 -30.206 1.00 28.96 ? 74  HIS B N     1 
ATOM   3137 C CA    . HIS B 1 28  ? 33.871  -14.074 -30.565 1.00 29.34 ? 74  HIS B CA    1 
ATOM   3138 C C     . HIS B 1 28  ? 34.303  -12.877 -31.450 1.00 28.77 ? 74  HIS B C     1 
ATOM   3139 O O     . HIS B 1 28  ? 35.503  -12.748 -31.781 1.00 28.43 ? 74  HIS B O     1 
ATOM   3140 C CB    . HIS B 1 28  ? 34.233  -15.399 -31.264 1.00 28.82 ? 74  HIS B CB    1 
ATOM   3141 C CG    . HIS B 1 28  ? 33.550  -15.558 -32.577 1.00 31.18 ? 74  HIS B CG    1 
ATOM   3142 N ND1   . HIS B 1 28  ? 32.289  -16.103 -32.692 1.00 32.23 ? 74  HIS B ND1   1 
ATOM   3143 C CD2   . HIS B 1 28  ? 33.912  -15.158 -33.826 1.00 33.55 ? 74  HIS B CD2   1 
ATOM   3144 C CE1   . HIS B 1 28  ? 31.916  -16.057 -33.962 1.00 36.51 ? 74  HIS B CE1   1 
ATOM   3145 N NE2   . HIS B 1 28  ? 32.886  -15.499 -34.671 1.00 34.60 ? 74  HIS B NE2   1 
ATOM   3146 N N     . THR B 1 29  ? 33.351  -12.045 -31.877 1.00 28.52 ? 75  THR B N     1 
ATOM   3147 C CA    . THR B 1 29  ? 33.698  -10.949 -32.805 1.00 29.16 ? 75  THR B CA    1 
ATOM   3148 C C     . THR B 1 29  ? 34.101  -9.667  -32.080 1.00 29.94 ? 75  THR B C     1 
ATOM   3149 O O     . THR B 1 29  ? 33.908  -9.534  -30.889 1.00 30.69 ? 75  THR B O     1 
ATOM   3150 C CB    . THR B 1 29  ? 32.596  -10.604 -33.884 1.00 29.68 ? 75  THR B CB    1 
ATOM   3151 O OG1   . THR B 1 29  ? 31.482  -9.968  -33.261 1.00 28.31 ? 75  THR B OG1   1 
ATOM   3152 C CG2   . THR B 1 29  ? 32.136  -11.842 -34.687 1.00 29.60 ? 75  THR B CG2   1 
ATOM   3153 N N     . ASN B 1 30  ? 34.687  -8.733  -32.809 1.00 30.97 ? 76  ASN B N     1 
ATOM   3154 C CA    . ASN B 1 30  ? 35.028  -7.432  -32.243 1.00 31.10 ? 76  ASN B CA    1 
ATOM   3155 C C     . ASN B 1 30  ? 33.786  -6.583  -32.027 1.00 30.79 ? 76  ASN B C     1 
ATOM   3156 O O     . ASN B 1 30  ? 33.881  -5.432  -31.598 1.00 31.26 ? 76  ASN B O     1 
ATOM   3157 C CB    . ASN B 1 30  ? 36.130  -6.713  -33.094 1.00 32.32 ? 76  ASN B CB    1 
ATOM   3158 C CG    . ASN B 1 30  ? 35.598  -6.082  -34.403 1.00 31.74 ? 76  ASN B CG    1 
ATOM   3159 O OD1   . ASN B 1 30  ? 34.706  -6.618  -35.060 1.00 35.22 ? 76  ASN B OD1   1 
ATOM   3160 N ND2   . ASN B 1 30  ? 36.180  -4.938  -34.783 1.00 28.40 ? 76  ASN B ND2   1 
ATOM   3161 N N     . LYS B 1 31  ? 32.612  -7.174  -32.276 1.00 30.05 ? 77  LYS B N     1 
ATOM   3162 C CA    . LYS B 1 31  ? 31.308  -6.513  -32.001 1.00 29.78 ? 77  LYS B CA    1 
ATOM   3163 C C     . LYS B 1 31  ? 30.602  -7.104  -30.770 1.00 28.86 ? 77  LYS B C     1 
ATOM   3164 O O     . LYS B 1 31  ? 29.629  -6.532  -30.235 1.00 26.41 ? 77  LYS B O     1 
ATOM   3165 C CB    . LYS B 1 31  ? 30.401  -6.498  -33.251 1.00 31.02 ? 77  LYS B CB    1 
ATOM   3166 C CG    . LYS B 1 31  ? 30.919  -5.538  -34.315 1.00 31.29 ? 77  LYS B CG    1 
ATOM   3167 C CD    . LYS B 1 31  ? 30.111  -5.731  -35.557 1.00 39.57 ? 77  LYS B CD    1 
ATOM   3168 C CE    . LYS B 1 31  ? 29.058  -4.566  -35.844 1.00 42.45 ? 77  LYS B CE    1 
ATOM   3169 N NZ    . LYS B 1 31  ? 28.828  -4.460  -37.306 1.00 39.16 ? 77  LYS B NZ    1 
ATOM   3170 N N     . GLY B 1 32  ? 31.153  -8.238  -30.323 1.00 27.61 ? 78  GLY B N     1 
ATOM   3171 C CA    . GLY B 1 32  ? 30.814  -8.821  -29.050 1.00 26.54 ? 78  GLY B CA    1 
ATOM   3172 C C     . GLY B 1 32  ? 31.342  -8.039  -27.840 1.00 25.63 ? 78  GLY B C     1 
ATOM   3173 O O     . GLY B 1 32  ? 32.036  -7.019  -27.957 1.00 23.76 ? 78  GLY B O     1 
ATOM   3174 N N     . THR B 1 33  ? 30.965  -8.559  -26.678 1.00 25.14 ? 79  THR B N     1 
ATOM   3175 C CA    . THR B 1 33  ? 31.410  -8.105  -25.403 1.00 24.76 ? 79  THR B CA    1 
ATOM   3176 C C     . THR B 1 33  ? 32.628  -8.910  -24.942 1.00 25.49 ? 79  THR B C     1 
ATOM   3177 O O     . THR B 1 33  ? 32.690  -10.142 -25.113 1.00 26.35 ? 79  THR B O     1 
ATOM   3178 C CB    . THR B 1 33  ? 30.289  -8.260  -24.430 1.00 24.51 ? 79  THR B CB    1 
ATOM   3179 O OG1   . THR B 1 33  ? 29.271  -7.301  -24.746 1.00 24.47 ? 79  THR B OG1   1 
ATOM   3180 C CG2   . THR B 1 33  ? 30.787  -8.053  -23.008 1.00 24.73 ? 79  THR B CG2   1 
ATOM   3181 N N     . PHE B 1 34  ? 33.614  -8.195  -24.426 1.00 25.48 ? 80  PHE B N     1 
ATOM   3182 C CA    . PHE B 1 34  ? 34.800  -8.781  -23.810 1.00 25.50 ? 80  PHE B CA    1 
ATOM   3183 C C     . PHE B 1 34  ? 34.879  -8.093  -22.456 1.00 25.84 ? 80  PHE B C     1 
ATOM   3184 O O     . PHE B 1 34  ? 34.882  -6.868  -22.356 1.00 26.00 ? 80  PHE B O     1 
ATOM   3185 C CB    . PHE B 1 34  ? 36.049  -8.488  -24.650 1.00 24.88 ? 80  PHE B CB    1 
ATOM   3186 C CG    . PHE B 1 34  ? 37.289  -9.299  -24.262 1.00 25.60 ? 80  PHE B CG    1 
ATOM   3187 C CD1   . PHE B 1 34  ? 37.211  -10.399 -23.433 1.00 25.38 ? 80  PHE B CD1   1 
ATOM   3188 C CD2   . PHE B 1 34  ? 38.555  -8.936  -24.767 1.00 24.10 ? 80  PHE B CD2   1 
ATOM   3189 C CE1   . PHE B 1 34  ? 38.384  -11.169 -23.123 1.00 24.99 ? 80  PHE B CE1   1 
ATOM   3190 C CE2   . PHE B 1 34  ? 39.703  -9.679  -24.485 1.00 24.18 ? 80  PHE B CE2   1 
ATOM   3191 C CZ    . PHE B 1 34  ? 39.613  -10.808 -23.644 1.00 22.61 ? 80  PHE B CZ    1 
ATOM   3192 N N     . LEU B 1 35  ? 34.901  -8.878  -21.394 1.00 26.11 ? 81  LEU B N     1 
ATOM   3193 C CA    . LEU B 1 35  ? 35.031  -8.290  -20.088 1.00 24.74 ? 81  LEU B CA    1 
ATOM   3194 C C     . LEU B 1 35  ? 35.785  -9.242  -19.191 1.00 24.75 ? 81  LEU B C     1 
ATOM   3195 O O     . LEU B 1 35  ? 35.837  -10.451 -19.461 1.00 23.80 ? 81  LEU B O     1 
ATOM   3196 C CB    . LEU B 1 35  ? 33.652  -7.926  -19.522 1.00 23.83 ? 81  LEU B CB    1 
ATOM   3197 C CG    . LEU B 1 35  ? 32.648  -9.048  -19.365 1.00 23.95 ? 81  LEU B CG    1 
ATOM   3198 C CD1   . LEU B 1 35  ? 32.912  -9.736  -18.088 1.00 21.74 ? 81  LEU B CD1   1 
ATOM   3199 C CD2   . LEU B 1 35  ? 31.195  -8.520  -19.420 1.00 22.44 ? 81  LEU B CD2   1 
ATOM   3200 N N     . ARG B 1 36  ? 36.427  -8.662  -18.170 1.00 23.64 ? 82  ARG B N     1 
ATOM   3201 C CA    . ARG B 1 36  ? 36.901  -9.415  -17.065 1.00 23.18 ? 82  ARG B CA    1 
ATOM   3202 C C     . ARG B 1 36  ? 35.962  -9.198  -15.869 1.00 24.09 ? 82  ARG B C     1 
ATOM   3203 O O     . ARG B 1 36  ? 35.633  -8.054  -15.498 1.00 22.09 ? 82  ARG B O     1 
ATOM   3204 C CB    . ARG B 1 36  ? 38.321  -8.993  -16.705 1.00 23.41 ? 82  ARG B CB    1 
ATOM   3205 C CG    . ARG B 1 36  ? 38.806  -9.601  -15.394 1.00 22.54 ? 82  ARG B CG    1 
ATOM   3206 C CD    . ARG B 1 36  ? 40.320  -9.452  -15.291 1.00 24.11 ? 82  ARG B CD    1 
ATOM   3207 N NE    . ARG B 1 36  ? 40.926  -10.441 -16.173 1.00 26.99 ? 82  ARG B NE    1 
ATOM   3208 C CZ    . ARG B 1 36  ? 42.189  -10.865 -16.127 1.00 25.91 ? 82  ARG B CZ    1 
ATOM   3209 N NH1   . ARG B 1 36  ? 43.039  -10.392 -15.224 1.00 23.43 ? 82  ARG B NH1   1 
ATOM   3210 N NH2   . ARG B 1 36  ? 42.584  -11.792 -17.010 1.00 26.09 ? 82  ARG B NH2   1 
ATOM   3211 N N     . LEU B 1 37  ? 35.601  -10.320 -15.261 1.00 24.25 ? 83  LEU B N     1 
ATOM   3212 C CA    . LEU B 1 37  ? 34.709  -10.388 -14.135 1.00 24.97 ? 83  LEU B CA    1 
ATOM   3213 C C     . LEU B 1 37  ? 35.449  -10.608 -12.809 1.00 25.54 ? 83  LEU B C     1 
ATOM   3214 O O     . LEU B 1 37  ? 36.214  -11.582 -12.656 1.00 24.22 ? 83  LEU B O     1 
ATOM   3215 C CB    . LEU B 1 37  ? 33.796  -11.598 -14.395 1.00 25.07 ? 83  LEU B CB    1 
ATOM   3216 C CG    . LEU B 1 37  ? 32.278  -11.592 -14.170 1.00 28.88 ? 83  LEU B CG    1 
ATOM   3217 C CD1   . LEU B 1 37  ? 31.939  -12.183 -12.774 1.00 30.08 ? 83  LEU B CD1   1 
ATOM   3218 C CD2   . LEU B 1 37  ? 31.535  -10.241 -14.428 1.00 24.89 ? 83  LEU B CD2   1 
ATOM   3219 N N     . TYR B 1 38  ? 35.186  -9.725  -11.843 1.00 26.87 ? 84  TYR B N     1 
ATOM   3220 C CA    . TYR B 1 38  ? 35.523  -9.927  -10.399 1.00 28.42 ? 84  TYR B CA    1 
ATOM   3221 C C     . TYR B 1 38  ? 34.232  -10.155 -9.637  1.00 30.47 ? 84  TYR B C     1 
ATOM   3222 O O     . TYR B 1 38  ? 33.235  -9.441  -9.842  1.00 30.34 ? 84  TYR B O     1 
ATOM   3223 C CB    . TYR B 1 38  ? 36.221  -8.711  -9.795  1.00 27.18 ? 84  TYR B CB    1 
ATOM   3224 C CG    . TYR B 1 38  ? 37.384  -8.224  -10.629 1.00 25.93 ? 84  TYR B CG    1 
ATOM   3225 C CD1   . TYR B 1 38  ? 38.630  -8.899  -10.581 1.00 23.14 ? 84  TYR B CD1   1 
ATOM   3226 C CD2   . TYR B 1 38  ? 37.250  -7.120  -11.484 1.00 26.43 ? 84  TYR B CD2   1 
ATOM   3227 C CE1   . TYR B 1 38  ? 39.696  -8.491  -11.341 1.00 23.29 ? 84  TYR B CE1   1 
ATOM   3228 C CE2   . TYR B 1 38  ? 38.337  -6.684  -12.286 1.00 25.17 ? 84  TYR B CE2   1 
ATOM   3229 C CZ    . TYR B 1 38  ? 39.562  -7.376  -12.208 1.00 26.45 ? 84  TYR B CZ    1 
ATOM   3230 O OH    . TYR B 1 38  ? 40.677  -6.971  -12.951 1.00 26.05 ? 84  TYR B OH    1 
ATOM   3231 N N     . TYR B 1 39  ? 34.236  -11.165 -8.774  1.00 32.39 ? 85  TYR B N     1 
ATOM   3232 C CA    . TYR B 1 39  ? 33.004  -11.616 -8.144  1.00 33.75 ? 85  TYR B CA    1 
ATOM   3233 C C     . TYR B 1 39  ? 33.252  -12.216 -6.731  1.00 35.02 ? 85  TYR B C     1 
ATOM   3234 O O     . TYR B 1 39  ? 34.337  -12.702 -6.433  1.00 35.14 ? 85  TYR B O     1 
ATOM   3235 C CB    . TYR B 1 39  ? 32.278  -12.583 -9.094  1.00 32.82 ? 85  TYR B CB    1 
ATOM   3236 C CG    . TYR B 1 39  ? 33.123  -13.741 -9.531  1.00 34.61 ? 85  TYR B CG    1 
ATOM   3237 C CD1   . TYR B 1 39  ? 33.132  -14.940 -8.806  1.00 35.88 ? 85  TYR B CD1   1 
ATOM   3238 C CD2   . TYR B 1 39  ? 33.933  -13.649 -10.663 1.00 37.43 ? 85  TYR B CD2   1 
ATOM   3239 C CE1   . TYR B 1 39  ? 33.930  -16.010 -9.201  1.00 37.27 ? 85  TYR B CE1   1 
ATOM   3240 C CE2   . TYR B 1 39  ? 34.723  -14.725 -11.083 1.00 36.72 ? 85  TYR B CE2   1 
ATOM   3241 C CZ    . TYR B 1 39  ? 34.727  -15.883 -10.340 1.00 34.72 ? 85  TYR B CZ    1 
ATOM   3242 O OH    . TYR B 1 39  ? 35.516  -16.908 -10.737 1.00 32.32 ? 85  TYR B OH    1 
ATOM   3243 N N     . PRO B 1 40  ? 32.255  -12.145 -5.833  1.00 37.15 ? 86  PRO B N     1 
ATOM   3244 C CA    . PRO B 1 40  ? 32.433  -12.901 -4.567  1.00 37.70 ? 86  PRO B CA    1 
ATOM   3245 C C     . PRO B 1 40  ? 32.551  -14.398 -4.870  1.00 39.11 ? 86  PRO B C     1 
ATOM   3246 O O     . PRO B 1 40  ? 31.666  -14.968 -5.496  1.00 38.88 ? 86  PRO B O     1 
ATOM   3247 C CB    . PRO B 1 40  ? 31.165  -12.562 -3.786  1.00 36.21 ? 86  PRO B CB    1 
ATOM   3248 C CG    . PRO B 1 40  ? 30.715  -11.230 -4.380  1.00 36.73 ? 86  PRO B CG    1 
ATOM   3249 C CD    . PRO B 1 40  ? 30.991  -11.374 -5.838  1.00 36.56 ? 86  PRO B CD    1 
ATOM   3250 N N     . SER B 1 41  ? 33.665  -15.005 -4.481  1.00 42.02 ? 87  SER B N     1 
ATOM   3251 C CA    . SER B 1 41  ? 33.920  -16.428 -4.734  1.00 45.30 ? 87  SER B CA    1 
ATOM   3252 C C     . SER B 1 41  ? 33.746  -17.358 -3.518  1.00 48.39 ? 87  SER B C     1 
ATOM   3253 O O     . SER B 1 41  ? 33.657  -16.917 -2.373  1.00 48.49 ? 87  SER B O     1 
ATOM   3254 C CB    . SER B 1 41  ? 35.318  -16.649 -5.345  1.00 45.16 ? 87  SER B CB    1 
ATOM   3255 O OG    . SER B 1 41  ? 36.362  -16.325 -4.428  1.00 43.79 ? 87  SER B OG    1 
ATOM   3256 N N     . GLN B 1 42  ? 33.704  -18.653 -3.802  1.00 52.40 ? 88  GLN B N     1 
ATOM   3257 C CA    . GLN B 1 42  ? 33.593  -19.665 -2.786  1.00 56.64 ? 88  GLN B CA    1 
ATOM   3258 C C     . GLN B 1 42  ? 35.019  -20.058 -2.388  1.00 59.14 ? 88  GLN B C     1 
ATOM   3259 O O     . GLN B 1 42  ? 35.437  -19.842 -1.234  1.00 59.13 ? 88  GLN B O     1 
ATOM   3260 C CB    . GLN B 1 42  ? 32.771  -20.853 -3.306  1.00 56.13 ? 88  GLN B CB    1 
ATOM   3261 C CG    . GLN B 1 42  ? 32.180  -21.786 -2.202  1.00 59.37 ? 88  GLN B CG    1 
ATOM   3262 C CD    . GLN B 1 42  ? 30.994  -21.194 -1.403  1.00 62.38 ? 88  GLN B CD    1 
ATOM   3263 O OE1   . GLN B 1 42  ? 30.987  -20.011 -1.009  1.00 62.93 ? 88  GLN B OE1   1 
ATOM   3264 N NE2   . GLN B 1 42  ? 29.996  -22.040 -1.138  1.00 62.49 ? 88  GLN B NE2   1 
ATOM   3265 N N     . ASP B 1 43  ? 35.761  -20.589 -3.371  1.00 62.37 ? 89  ASP B N     1 
ATOM   3266 C CA    . ASP B 1 43  ? 37.144  -21.079 -3.195  1.00 65.01 ? 89  ASP B CA    1 
ATOM   3267 C C     . ASP B 1 43  ? 38.155  -19.996 -2.778  1.00 66.34 ? 89  ASP B C     1 
ATOM   3268 O O     . ASP B 1 43  ? 37.985  -18.793 -3.094  1.00 66.43 ? 89  ASP B O     1 
ATOM   3269 C CB    . ASP B 1 43  ? 37.667  -21.771 -4.483  1.00 64.95 ? 89  ASP B CB    1 
ATOM   3270 C CG    . ASP B 1 43  ? 36.902  -23.053 -4.844  1.00 67.43 ? 89  ASP B CG    1 
ATOM   3271 O OD1   . ASP B 1 43  ? 37.282  -23.680 -5.876  1.00 68.97 ? 89  ASP B OD1   1 
ATOM   3272 O OD2   . ASP B 1 43  ? 35.936  -23.434 -4.122  1.00 67.89 ? 89  ASP B OD2   1 
ATOM   3273 N N     . ASN B 1 44  ? 39.194  -20.461 -2.066  1.00 67.83 ? 90  ASN B N     1 
ATOM   3274 C CA    . ASN B 1 44  ? 40.448  -19.726 -1.805  1.00 68.92 ? 90  ASN B CA    1 
ATOM   3275 C C     . ASN B 1 44  ? 41.577  -20.673 -1.357  1.00 69.39 ? 90  ASN B C     1 
ATOM   3276 O O     . ASN B 1 44  ? 41.754  -20.922 -0.154  1.00 69.97 ? 90  ASN B O     1 
ATOM   3277 C CB    . ASN B 1 44  ? 40.257  -18.576 -0.796  1.00 68.97 ? 90  ASN B CB    1 
ATOM   3278 C CG    . ASN B 1 44  ? 41.531  -17.731 -0.592  1.00 69.83 ? 90  ASN B CG    1 
ATOM   3279 O OD1   . ASN B 1 44  ? 41.538  -16.826 0.240   1.00 70.11 ? 90  ASN B OD1   1 
ATOM   3280 N ND2   . ASN B 1 44  ? 42.601  -18.022 -1.348  1.00 69.95 ? 90  ASN B ND2   1 
ATOM   3281 N N     . ASP B 1 45  ? 42.309  -21.210 -2.338  1.00 69.66 ? 91  ASP B N     1 
ATOM   3282 C CA    . ASP B 1 45  ? 43.602  -21.900 -2.116  1.00 69.48 ? 91  ASP B CA    1 
ATOM   3283 C C     . ASP B 1 45  ? 44.693  -21.215 -2.958  1.00 68.58 ? 91  ASP B C     1 
ATOM   3284 O O     . ASP B 1 45  ? 45.850  -21.665 -3.002  1.00 68.72 ? 91  ASP B O     1 
ATOM   3285 C CB    . ASP B 1 45  ? 43.508  -23.375 -2.522  1.00 69.70 ? 91  ASP B CB    1 
ATOM   3286 C CG    . ASP B 1 45  ? 42.305  -24.073 -1.926  1.00 71.69 ? 91  ASP B CG    1 
ATOM   3287 O OD1   . ASP B 1 45  ? 42.354  -24.389 -0.709  1.00 73.60 ? 91  ASP B OD1   1 
ATOM   3288 O OD2   . ASP B 1 45  ? 41.319  -24.309 -2.675  1.00 72.59 ? 91  ASP B OD2   1 
ATOM   3289 N N     . ARG B 1 46  ? 44.300  -20.119 -3.612  1.00 67.02 ? 92  ARG B N     1 
ATOM   3290 C CA    . ARG B 1 46  ? 45.016  -19.558 -4.747  1.00 65.01 ? 92  ARG B CA    1 
ATOM   3291 C C     . ARG B 1 46  ? 44.576  -18.110 -4.948  1.00 62.86 ? 92  ARG B C     1 
ATOM   3292 O O     . ARG B 1 46  ? 43.386  -17.786 -4.766  1.00 63.25 ? 92  ARG B O     1 
ATOM   3293 C CB    . ARG B 1 46  ? 44.682  -20.368 -6.012  1.00 65.80 ? 92  ARG B CB    1 
ATOM   3294 C CG    . ARG B 1 46  ? 43.271  -20.072 -6.575  1.00 68.47 ? 92  ARG B CG    1 
ATOM   3295 C CD    . ARG B 1 46  ? 42.707  -21.187 -7.410  1.00 73.11 ? 92  ARG B CD    1 
ATOM   3296 N NE    . ARG B 1 46  ? 42.284  -22.309 -6.567  1.00 76.03 ? 92  ARG B NE    1 
ATOM   3297 C CZ    . ARG B 1 46  ? 41.022  -22.732 -6.422  1.00 77.28 ? 92  ARG B CZ    1 
ATOM   3298 N NH1   . ARG B 1 46  ? 40.013  -22.144 -7.079  1.00 75.94 ? 92  ARG B NH1   1 
ATOM   3299 N NH2   . ARG B 1 46  ? 40.779  -23.771 -5.624  1.00 76.96 ? 92  ARG B NH2   1 
ATOM   3300 N N     . LEU B 1 47  ? 45.526  -17.246 -5.308  1.00 59.46 ? 93  LEU B N     1 
ATOM   3301 C CA    . LEU B 1 47  ? 45.242  -15.858 -5.720  1.00 55.94 ? 93  LEU B CA    1 
ATOM   3302 C C     . LEU B 1 47  ? 46.014  -15.655 -7.029  1.00 53.59 ? 93  LEU B C     1 
ATOM   3303 O O     . LEU B 1 47  ? 46.901  -14.816 -7.144  1.00 53.23 ? 93  LEU B O     1 
ATOM   3304 C CB    . LEU B 1 47  ? 45.683  -14.841 -4.647  1.00 56.21 ? 93  LEU B CB    1 
ATOM   3305 C CG    . LEU B 1 47  ? 45.075  -14.762 -3.233  1.00 55.74 ? 93  LEU B CG    1 
ATOM   3306 C CD1   . LEU B 1 47  ? 45.992  -13.906 -2.343  1.00 56.87 ? 93  LEU B CD1   1 
ATOM   3307 C CD2   . LEU B 1 47  ? 43.617  -14.240 -3.184  1.00 55.64 ? 93  LEU B CD2   1 
ATOM   3308 N N     . ASP B 1 48  ? 45.637  -16.459 -8.013  1.00 50.60 ? 94  ASP B N     1 
ATOM   3309 C CA    . ASP B 1 48  ? 46.534  -16.889 -9.079  1.00 47.24 ? 94  ASP B CA    1 
ATOM   3310 C C     . ASP B 1 48  ? 46.130  -16.322 -10.437 1.00 43.05 ? 94  ASP B C     1 
ATOM   3311 O O     . ASP B 1 48  ? 46.203  -17.012 -11.437 1.00 41.90 ? 94  ASP B O     1 
ATOM   3312 C CB    . ASP B 1 48  ? 46.542  -18.436 -9.131  1.00 47.80 ? 94  ASP B CB    1 
ATOM   3313 C CG    . ASP B 1 48  ? 45.139  -19.023 -9.233  1.00 50.93 ? 94  ASP B CG    1 
ATOM   3314 O OD1   . ASP B 1 48  ? 44.163  -18.269 -8.962  1.00 52.15 ? 94  ASP B OD1   1 
ATOM   3315 O OD2   . ASP B 1 48  ? 45.000  -20.230 -9.580  1.00 53.53 ? 94  ASP B OD2   1 
ATOM   3316 N N     . THR B 1 49  ? 45.687  -15.067 -10.445 1.00 38.94 ? 95  THR B N     1 
ATOM   3317 C CA    . THR B 1 49  ? 45.153  -14.428 -11.658 1.00 33.79 ? 95  THR B CA    1 
ATOM   3318 C C     . THR B 1 49  ? 46.298  -13.685 -12.293 1.00 32.32 ? 95  THR B C     1 
ATOM   3319 O O     . THR B 1 49  ? 46.944  -12.910 -11.651 1.00 31.62 ? 95  THR B O     1 
ATOM   3320 C CB    . THR B 1 49  ? 43.932  -13.503 -11.322 1.00 33.45 ? 95  THR B CB    1 
ATOM   3321 O OG1   . THR B 1 49  ? 42.849  -14.309 -10.859 1.00 29.76 ? 95  THR B OG1   1 
ATOM   3322 C CG2   . THR B 1 49  ? 43.481  -12.660 -12.485 1.00 28.48 ? 95  THR B CG2   1 
ATOM   3323 N N     . LEU B 1 50  ? 46.577  -13.963 -13.559 1.00 31.49 ? 96  LEU B N     1 
ATOM   3324 C CA    . LEU B 1 50  ? 47.642  -13.261 -14.250 1.00 30.19 ? 96  LEU B CA    1 
ATOM   3325 C C     . LEU B 1 50  ? 47.211  -11.839 -14.560 1.00 29.49 ? 96  LEU B C     1 
ATOM   3326 O O     . LEU B 1 50  ? 46.171  -11.629 -15.141 1.00 30.23 ? 96  LEU B O     1 
ATOM   3327 C CB    . LEU B 1 50  ? 48.031  -14.015 -15.521 1.00 30.49 ? 96  LEU B CB    1 
ATOM   3328 C CG    . LEU B 1 50  ? 49.369  -13.682 -16.186 1.00 29.95 ? 96  LEU B CG    1 
ATOM   3329 C CD1   . LEU B 1 50  ? 50.521  -13.861 -15.219 1.00 28.02 ? 96  LEU B CD1   1 
ATOM   3330 C CD2   . LEU B 1 50  ? 49.561  -14.570 -17.465 1.00 30.16 ? 96  LEU B CD2   1 
ATOM   3331 N N     . TRP B 1 51  ? 47.987  -10.864 -14.124 1.00 27.78 ? 97  TRP B N     1 
ATOM   3332 C CA    . TRP B 1 51  ? 47.593  -9.483  -14.279 1.00 26.50 ? 97  TRP B CA    1 
ATOM   3333 C C     . TRP B 1 51  ? 47.478  -8.986  -15.774 1.00 26.41 ? 97  TRP B C     1 
ATOM   3334 O O     . TRP B 1 51  ? 46.451  -8.396  -16.187 1.00 26.29 ? 97  TRP B O     1 
ATOM   3335 C CB    . TRP B 1 51  ? 48.535  -8.634  -13.424 1.00 24.69 ? 97  TRP B CB    1 
ATOM   3336 C CG    . TRP B 1 51  ? 48.255  -7.171  -13.451 1.00 23.46 ? 97  TRP B CG    1 
ATOM   3337 C CD1   . TRP B 1 51  ? 47.027  -6.551  -13.296 1.00 21.53 ? 97  TRP B CD1   1 
ATOM   3338 C CD2   . TRP B 1 51  ? 49.214  -6.121  -13.622 1.00 22.07 ? 97  TRP B CD2   1 
ATOM   3339 N NE1   . TRP B 1 51  ? 47.183  -5.199  -13.367 1.00 20.89 ? 97  TRP B NE1   1 
ATOM   3340 C CE2   . TRP B 1 51  ? 48.505  -4.903  -13.580 1.00 19.70 ? 97  TRP B CE2   1 
ATOM   3341 C CE3   . TRP B 1 51  ? 50.599  -6.092  -13.834 1.00 21.53 ? 97  TRP B CE3   1 
ATOM   3342 C CZ2   . TRP B 1 51  ? 49.144  -3.664  -13.710 1.00 24.10 ? 97  TRP B CZ2   1 
ATOM   3343 C CZ3   . TRP B 1 51  ? 51.234  -4.861  -13.954 1.00 21.27 ? 97  TRP B CZ3   1 
ATOM   3344 C CH2   . TRP B 1 51  ? 50.511  -3.668  -13.897 1.00 22.00 ? 97  TRP B CH2   1 
ATOM   3345 N N     . ILE B 1 52  ? 48.514  -9.243  -16.587 1.00 25.62 ? 98  ILE B N     1 
ATOM   3346 C CA    . ILE B 1 52  ? 48.489  -8.842  -17.999 1.00 25.48 ? 98  ILE B CA    1 
ATOM   3347 C C     . ILE B 1 52  ? 48.769  -10.093 -18.788 1.00 25.74 ? 98  ILE B C     1 
ATOM   3348 O O     . ILE B 1 52  ? 49.938  -10.443 -18.959 1.00 27.14 ? 98  ILE B O     1 
ATOM   3349 C CB    . ILE B 1 52  ? 49.523  -7.693  -18.319 1.00 24.82 ? 98  ILE B CB    1 
ATOM   3350 C CG1   . ILE B 1 52  ? 49.226  -6.456  -17.450 1.00 23.17 ? 98  ILE B CG1   1 
ATOM   3351 C CG2   . ILE B 1 52  ? 49.513  -7.333  -19.850 1.00 24.29 ? 98  ILE B CG2   1 
ATOM   3352 C CD1   . ILE B 1 52  ? 50.300  -5.383  -17.453 1.00 25.53 ? 98  ILE B CD1   1 
ATOM   3353 N N     . PRO B 1 53  ? 47.706  -10.782 -19.269 1.00 26.20 ? 99  PRO B N     1 
ATOM   3354 C CA    . PRO B 1 53  ? 47.834  -12.156 -19.763 1.00 26.50 ? 99  PRO B CA    1 
ATOM   3355 C C     . PRO B 1 53  ? 48.437  -12.431 -21.158 1.00 27.32 ? 99  PRO B C     1 
ATOM   3356 O O     . PRO B 1 53  ? 48.537  -13.590 -21.541 1.00 28.07 ? 99  PRO B O     1 
ATOM   3357 C CB    . PRO B 1 53  ? 46.394  -12.694 -19.701 1.00 26.36 ? 99  PRO B CB    1 
ATOM   3358 C CG    . PRO B 1 53  ? 45.516  -11.500 -19.688 1.00 26.86 ? 99  PRO B CG    1 
ATOM   3359 C CD    . PRO B 1 53  ? 46.322  -10.276 -19.408 1.00 25.67 ? 99  PRO B CD    1 
ATOM   3360 N N     . ASN B 1 54  ? 48.862  -11.432 -21.912 1.00 27.69 ? 100 ASN B N     1 
ATOM   3361 C CA    . ASN B 1 54  ? 49.336  -11.710 -23.267 1.00 28.02 ? 100 ASN B CA    1 
ATOM   3362 C C     . ASN B 1 54  ? 50.424  -10.739 -23.616 1.00 27.55 ? 100 ASN B C     1 
ATOM   3363 O O     . ASN B 1 54  ? 50.365  -9.592  -23.183 1.00 27.12 ? 100 ASN B O     1 
ATOM   3364 C CB    . ASN B 1 54  ? 48.222  -11.561 -24.342 1.00 28.14 ? 100 ASN B CB    1 
ATOM   3365 C CG    . ASN B 1 54  ? 47.015  -12.433 -24.085 1.00 30.23 ? 100 ASN B CG    1 
ATOM   3366 O OD1   . ASN B 1 54  ? 47.061  -13.662 -24.241 1.00 29.93 ? 100 ASN B OD1   1 
ATOM   3367 N ND2   . ASN B 1 54  ? 45.906  -11.793 -23.687 1.00 33.52 ? 100 ASN B ND2   1 
ATOM   3368 N N     . LYS B 1 55  ? 51.369  -11.178 -24.467 1.00 27.72 ? 101 LYS B N     1 
ATOM   3369 C CA    . LYS B 1 55  ? 52.517  -10.342 -24.862 1.00 27.20 ? 101 LYS B CA    1 
ATOM   3370 C C     . LYS B 1 55  ? 52.096  -9.081  -25.579 1.00 26.81 ? 101 LYS B C     1 
ATOM   3371 O O     . LYS B 1 55  ? 52.772  -8.055  -25.461 1.00 28.69 ? 101 LYS B O     1 
ATOM   3372 C CB    . LYS B 1 55  ? 53.546  -11.111 -25.714 1.00 26.45 ? 101 LYS B CB    1 
ATOM   3373 C CG    . LYS B 1 55  ? 53.062  -11.553 -27.092 1.00 27.04 ? 101 LYS B CG    1 
ATOM   3374 C CD    . LYS B 1 55  ? 53.877  -12.707 -27.653 1.00 27.91 ? 101 LYS B CD    1 
ATOM   3375 C CE    . LYS B 1 55  ? 53.367  -13.124 -29.032 1.00 32.42 ? 101 LYS B CE    1 
ATOM   3376 N NZ    . LYS B 1 55  ? 52.035  -13.839 -29.064 1.00 32.58 ? 101 LYS B NZ    1 
ATOM   3377 N N     . GLU B 1 56  ? 50.986  -9.149  -26.301 1.00 26.24 ? 102 GLU B N     1 
ATOM   3378 C CA    . GLU B 1 56  ? 50.555  -8.090  -27.201 1.00 26.51 ? 102 GLU B CA    1 
ATOM   3379 C C     . GLU B 1 56  ? 50.068  -6.843  -26.496 1.00 25.47 ? 102 GLU B C     1 
ATOM   3380 O O     . GLU B 1 56  ? 50.045  -5.758  -27.094 1.00 26.29 ? 102 GLU B O     1 
ATOM   3381 C CB    . GLU B 1 56  ? 49.425  -8.625  -28.113 1.00 27.30 ? 102 GLU B CB    1 
ATOM   3382 C CG    . GLU B 1 56  ? 49.870  -9.519  -29.264 1.00 30.36 ? 102 GLU B CG    1 
ATOM   3383 C CD    . GLU B 1 56  ? 49.970  -10.967 -28.859 1.00 35.22 ? 102 GLU B CD    1 
ATOM   3384 O OE1   . GLU B 1 56  ? 49.576  -11.279 -27.728 1.00 42.19 ? 102 GLU B OE1   1 
ATOM   3385 O OE2   . GLU B 1 56  ? 50.414  -11.810 -29.657 1.00 38.69 ? 102 GLU B OE2   1 
ATOM   3386 N N     . TYR B 1 57  ? 49.624  -7.003  -25.244 1.00 25.13 ? 103 TYR B N     1 
ATOM   3387 C CA    . TYR B 1 57  ? 49.273  -5.873  -24.378 1.00 24.36 ? 103 TYR B CA    1 
ATOM   3388 C C     . TYR B 1 57  ? 50.511  -5.065  -24.110 1.00 24.58 ? 103 TYR B C     1 
ATOM   3389 O O     . TYR B 1 57  ? 50.487  -3.853  -24.205 1.00 25.53 ? 103 TYR B O     1 
ATOM   3390 C CB    . TYR B 1 57  ? 48.625  -6.318  -23.059 1.00 22.85 ? 103 TYR B CB    1 
ATOM   3391 C CG    . TYR B 1 57  ? 47.228  -6.873  -23.270 1.00 22.35 ? 103 TYR B CG    1 
ATOM   3392 C CD1   . TYR B 1 57  ? 46.188  -6.042  -23.763 1.00 19.75 ? 103 TYR B CD1   1 
ATOM   3393 C CD2   . TYR B 1 57  ? 46.941  -8.211  -23.006 1.00 16.54 ? 103 TYR B CD2   1 
ATOM   3394 C CE1   . TYR B 1 57  ? 44.900  -6.550  -23.984 1.00 20.56 ? 103 TYR B CE1   1 
ATOM   3395 C CE2   . TYR B 1 57  ? 45.628  -8.729  -23.237 1.00 21.36 ? 103 TYR B CE2   1 
ATOM   3396 C CZ    . TYR B 1 57  ? 44.632  -7.894  -23.704 1.00 21.01 ? 103 TYR B CZ    1 
ATOM   3397 O OH    . TYR B 1 57  ? 43.363  -8.388  -23.950 1.00 21.27 ? 103 TYR B OH    1 
ATOM   3398 N N     . PHE B 1 58  ? 51.616  -5.732  -23.845 1.00 25.66 ? 104 PHE B N     1 
ATOM   3399 C CA    . PHE B 1 58  ? 52.913  -5.010  -23.730 1.00 27.03 ? 104 PHE B CA    1 
ATOM   3400 C C     . PHE B 1 58  ? 53.378  -4.283  -24.988 1.00 27.71 ? 104 PHE B C     1 
ATOM   3401 O O     . PHE B 1 58  ? 53.930  -3.195  -24.875 1.00 27.42 ? 104 PHE B O     1 
ATOM   3402 C CB    . PHE B 1 58  ? 53.991  -5.939  -23.174 1.00 25.84 ? 104 PHE B CB    1 
ATOM   3403 C CG    . PHE B 1 58  ? 53.650  -6.452  -21.829 1.00 24.12 ? 104 PHE B CG    1 
ATOM   3404 C CD1   . PHE B 1 58  ? 53.624  -5.578  -20.728 1.00 24.04 ? 104 PHE B CD1   1 
ATOM   3405 C CD2   . PHE B 1 58  ? 53.304  -7.781  -21.639 1.00 24.02 ? 104 PHE B CD2   1 
ATOM   3406 C CE1   . PHE B 1 58  ? 53.291  -6.040  -19.440 1.00 20.41 ? 104 PHE B CE1   1 
ATOM   3407 C CE2   . PHE B 1 58  ? 52.970  -8.244  -20.362 1.00 22.23 ? 104 PHE B CE2   1 
ATOM   3408 C CZ    . PHE B 1 58  ? 52.975  -7.339  -19.259 1.00 21.38 ? 104 PHE B CZ    1 
ATOM   3409 N N     . TRP B 1 59  ? 53.150  -4.891  -26.161 1.00 27.99 ? 105 TRP B N     1 
ATOM   3410 C CA    . TRP B 1 59  ? 53.449  -4.274  -27.448 1.00 29.34 ? 105 TRP B CA    1 
ATOM   3411 C C     . TRP B 1 59  ? 52.584  -2.991  -27.585 1.00 30.18 ? 105 TRP B C     1 
ATOM   3412 O O     . TRP B 1 59  ? 53.082  -1.902  -27.886 1.00 28.63 ? 105 TRP B O     1 
ATOM   3413 C CB    . TRP B 1 59  ? 53.178  -5.274  -28.635 1.00 30.85 ? 105 TRP B CB    1 
ATOM   3414 C CG    . TRP B 1 59  ? 54.056  -6.594  -28.689 1.00 33.17 ? 105 TRP B CG    1 
ATOM   3415 C CD1   . TRP B 1 59  ? 55.170  -6.883  -27.927 1.00 35.58 ? 105 TRP B CD1   1 
ATOM   3416 C CD2   . TRP B 1 59  ? 53.873  -7.744  -29.560 1.00 34.78 ? 105 TRP B CD2   1 
ATOM   3417 N NE1   . TRP B 1 59  ? 55.670  -8.134  -28.256 1.00 37.41 ? 105 TRP B NE1   1 
ATOM   3418 C CE2   . TRP B 1 59  ? 54.910  -8.672  -29.261 1.00 34.31 ? 105 TRP B CE2   1 
ATOM   3419 C CE3   . TRP B 1 59  ? 52.943  -8.069  -30.570 1.00 34.38 ? 105 TRP B CE3   1 
ATOM   3420 C CZ2   . TRP B 1 59  ? 55.037  -9.913  -29.928 1.00 34.52 ? 105 TRP B CZ2   1 
ATOM   3421 C CZ3   . TRP B 1 59  ? 53.074  -9.315  -31.240 1.00 35.55 ? 105 TRP B CZ3   1 
ATOM   3422 C CH2   . TRP B 1 59  ? 54.113  -10.214 -30.913 1.00 35.09 ? 105 TRP B CH2   1 
ATOM   3423 N N     . GLY B 1 60  ? 51.267  -3.145  -27.336 1.00 31.85 ? 106 GLY B N     1 
ATOM   3424 C CA    . GLY B 1 60  ? 50.266  -2.053  -27.381 1.00 30.57 ? 106 GLY B CA    1 
ATOM   3425 C C     . GLY B 1 60  ? 50.612  -0.926  -26.443 1.00 30.36 ? 106 GLY B C     1 
ATOM   3426 O O     . GLY B 1 60  ? 50.533  0.254   -26.829 1.00 30.60 ? 106 GLY B O     1 
ATOM   3427 N N     . LEU B 1 61  ? 51.007  -1.282  -25.223 1.00 30.38 ? 107 LEU B N     1 
ATOM   3428 C CA    . LEU B 1 61  ? 51.376  -0.308  -24.201 1.00 30.54 ? 107 LEU B CA    1 
ATOM   3429 C C     . LEU B 1 61  ? 52.571  0.525   -24.621 1.00 31.76 ? 107 LEU B C     1 
ATOM   3430 O O     . LEU B 1 61  ? 52.536  1.754   -24.537 1.00 31.25 ? 107 LEU B O     1 
ATOM   3431 C CB    . LEU B 1 61  ? 51.670  -0.994  -22.889 1.00 30.04 ? 107 LEU B CB    1 
ATOM   3432 C CG    . LEU B 1 61  ? 50.513  -1.296  -21.951 1.00 29.00 ? 107 LEU B CG    1 
ATOM   3433 C CD1   . LEU B 1 61  ? 50.905  -2.331  -20.894 1.00 24.22 ? 107 LEU B CD1   1 
ATOM   3434 C CD2   . LEU B 1 61  ? 49.993  -0.002  -21.298 1.00 30.03 ? 107 LEU B CD2   1 
ATOM   3435 N N     . SER B 1 62  ? 53.626  -0.127  -25.108 1.00 33.13 ? 108 SER B N     1 
ATOM   3436 C CA    . SER B 1 62  ? 54.771  0.617   -25.637 1.00 35.01 ? 108 SER B CA    1 
ATOM   3437 C C     . SER B 1 62  ? 54.431  1.521   -26.824 1.00 36.79 ? 108 SER B C     1 
ATOM   3438 O O     . SER B 1 62  ? 55.014  2.601   -26.949 1.00 37.73 ? 108 SER B O     1 
ATOM   3439 C CB    . SER B 1 62  ? 55.914  -0.316  -26.025 1.00 35.39 ? 108 SER B CB    1 
ATOM   3440 O OG    . SER B 1 62  ? 56.740  0.357   -26.939 1.00 35.12 ? 108 SER B OG    1 
ATOM   3441 N N     . LYS B 1 63  ? 53.514  1.089   -27.705 1.00 37.71 ? 109 LYS B N     1 
ATOM   3442 C CA    . LYS B 1 63  ? 52.978  1.979   -28.761 1.00 39.09 ? 109 LYS B CA    1 
ATOM   3443 C C     . LYS B 1 63  ? 52.230  3.209   -28.225 1.00 38.53 ? 109 LYS B C     1 
ATOM   3444 O O     . LYS B 1 63  ? 52.283  4.281   -28.831 1.00 39.95 ? 109 LYS B O     1 
ATOM   3445 C CB    . LYS B 1 63  ? 52.119  1.206   -29.776 1.00 39.50 ? 109 LYS B CB    1 
ATOM   3446 C CG    . LYS B 1 63  ? 52.791  -0.127  -30.285 1.00 43.20 ? 109 LYS B CG    1 
ATOM   3447 C CD    . LYS B 1 63  ? 52.361  -0.578  -31.721 1.00 42.41 ? 109 LYS B CD    1 
ATOM   3448 C CE    . LYS B 1 63  ? 52.178  -2.099  -31.839 1.00 44.73 ? 109 LYS B CE    1 
ATOM   3449 N NZ    . LYS B 1 63  ? 52.198  -2.471  -33.290 1.00 48.37 ? 109 LYS B NZ    1 
ATOM   3450 N N     . PHE B 1 64  ? 51.545  3.066   -27.092 1.00 37.50 ? 110 PHE B N     1 
ATOM   3451 C CA    . PHE B 1 64  ? 50.839  4.164   -26.452 1.00 36.42 ? 110 PHE B CA    1 
ATOM   3452 C C     . PHE B 1 64  ? 51.811  5.137   -25.724 1.00 37.40 ? 110 PHE B C     1 
ATOM   3453 O O     . PHE B 1 64  ? 51.574  6.372   -25.614 1.00 36.63 ? 110 PHE B O     1 
ATOM   3454 C CB    . PHE B 1 64  ? 49.797  3.581   -25.504 1.00 34.88 ? 110 PHE B CB    1 
ATOM   3455 C CG    . PHE B 1 64  ? 49.276  4.553   -24.501 1.00 34.03 ? 110 PHE B CG    1 
ATOM   3456 C CD1   . PHE B 1 64  ? 48.332  5.505   -24.855 1.00 29.23 ? 110 PHE B CD1   1 
ATOM   3457 C CD2   . PHE B 1 64  ? 49.701  4.506   -23.186 1.00 33.50 ? 110 PHE B CD2   1 
ATOM   3458 C CE1   . PHE B 1 64  ? 47.864  6.425   -23.907 1.00 28.34 ? 110 PHE B CE1   1 
ATOM   3459 C CE2   . PHE B 1 64  ? 49.218  5.427   -22.266 1.00 32.32 ? 110 PHE B CE2   1 
ATOM   3460 C CZ    . PHE B 1 64  ? 48.304  6.385   -22.649 1.00 29.24 ? 110 PHE B CZ    1 
ATOM   3461 N N     . LEU B 1 65  ? 52.893  4.566   -25.209 1.00 38.14 ? 111 LEU B N     1 
ATOM   3462 C CA    . LEU B 1 65  ? 53.983  5.354   -24.655 1.00 39.42 ? 111 LEU B CA    1 
ATOM   3463 C C     . LEU B 1 65  ? 54.796  6.049   -25.748 1.00 40.61 ? 111 LEU B C     1 
ATOM   3464 O O     . LEU B 1 65  ? 55.357  7.088   -25.498 1.00 41.89 ? 111 LEU B O     1 
ATOM   3465 C CB    . LEU B 1 65  ? 54.888  4.527   -23.723 1.00 38.12 ? 111 LEU B CB    1 
ATOM   3466 C CG    . LEU B 1 65  ? 54.231  3.910   -22.480 1.00 37.47 ? 111 LEU B CG    1 
ATOM   3467 C CD1   . LEU B 1 65  ? 55.191  2.898   -21.843 1.00 34.94 ? 111 LEU B CD1   1 
ATOM   3468 C CD2   . LEU B 1 65  ? 53.721  4.960   -21.465 1.00 34.25 ? 111 LEU B CD2   1 
ATOM   3469 N N     . GLY B 1 66  ? 54.820  5.524   -26.961 1.00 42.13 ? 112 GLY B N     1 
ATOM   3470 C CA    . GLY B 1 66  ? 55.495  6.249   -28.049 1.00 44.92 ? 112 GLY B CA    1 
ATOM   3471 C C     . GLY B 1 66  ? 56.933  5.772   -28.189 1.00 46.93 ? 112 GLY B C     1 
ATOM   3472 O O     . GLY B 1 66  ? 57.807  6.457   -28.773 1.00 47.69 ? 112 GLY B O     1 
ATOM   3473 N N     . THR B 1 67  ? 57.164  4.592   -27.622 1.00 47.87 ? 113 THR B N     1 
ATOM   3474 C CA    . THR B 1 67  ? 58.400  3.875   -27.749 1.00 48.98 ? 113 THR B CA    1 
ATOM   3475 C C     . THR B 1 67  ? 58.187  2.668   -28.656 1.00 50.19 ? 113 THR B C     1 
ATOM   3476 O O     . THR B 1 67  ? 57.148  2.504   -29.305 1.00 49.54 ? 113 THR B O     1 
ATOM   3477 C CB    . THR B 1 67  ? 58.931  3.412   -26.397 1.00 48.37 ? 113 THR B CB    1 
ATOM   3478 O OG1   . THR B 1 67  ? 57.900  2.690   -25.737 1.00 48.39 ? 113 THR B OG1   1 
ATOM   3479 C CG2   . THR B 1 67  ? 59.317  4.593   -25.523 1.00 48.74 ? 113 THR B CG2   1 
ATOM   3480 N N     . HIS B 1 68  ? 59.182  1.796   -28.622 1.00 52.46 ? 114 HIS B N     1 
ATOM   3481 C CA    . HIS B 1 68  ? 59.537  0.899   -29.713 1.00 53.99 ? 114 HIS B CA    1 
ATOM   3482 C C     . HIS B 1 68  ? 59.172  -0.539  -29.346 1.00 54.83 ? 114 HIS B C     1 
ATOM   3483 O O     . HIS B 1 68  ? 58.399  -0.790  -28.413 1.00 54.78 ? 114 HIS B O     1 
ATOM   3484 C CB    . HIS B 1 68  ? 61.059  1.046   -29.936 1.00 54.51 ? 114 HIS B CB    1 
ATOM   3485 C CG    . HIS B 1 68  ? 61.814  1.445   -28.684 1.00 55.31 ? 114 HIS B CG    1 
ATOM   3486 N ND1   . HIS B 1 68  ? 62.251  0.531   -27.752 1.00 55.33 ? 114 HIS B ND1   1 
ATOM   3487 C CD2   . HIS B 1 68  ? 62.159  2.663   -28.198 1.00 54.69 ? 114 HIS B CD2   1 
ATOM   3488 C CE1   . HIS B 1 68  ? 62.854  1.165   -26.762 1.00 55.98 ? 114 HIS B CE1   1 
ATOM   3489 N NE2   . HIS B 1 68  ? 62.805  2.461   -27.004 1.00 54.29 ? 114 HIS B NE2   1 
ATOM   3490 N N     . TRP B 1 69  ? 59.759  -1.482  -30.068 1.00 56.10 ? 115 TRP B N     1 
ATOM   3491 C CA    . TRP B 1 69  ? 59.579  -2.908  -29.826 1.00 56.97 ? 115 TRP B CA    1 
ATOM   3492 C C     . TRP B 1 69  ? 60.571  -3.437  -28.785 1.00 55.86 ? 115 TRP B C     1 
ATOM   3493 O O     . TRP B 1 69  ? 60.470  -4.582  -28.353 1.00 56.69 ? 115 TRP B O     1 
ATOM   3494 C CB    . TRP B 1 69  ? 59.675  -3.625  -31.174 1.00 59.78 ? 115 TRP B CB    1 
ATOM   3495 C CG    . TRP B 1 69  ? 59.039  -2.712  -32.258 1.00 62.82 ? 115 TRP B CG    1 
ATOM   3496 C CD1   . TRP B 1 69  ? 59.671  -1.729  -32.996 1.00 64.79 ? 115 TRP B CD1   1 
ATOM   3497 C CD2   . TRP B 1 69  ? 57.647  -2.644  -32.620 1.00 65.16 ? 115 TRP B CD2   1 
ATOM   3498 N NE1   . TRP B 1 69  ? 58.759  -1.084  -33.817 1.00 65.06 ? 115 TRP B NE1   1 
ATOM   3499 C CE2   . TRP B 1 69  ? 57.517  -1.622  -33.612 1.00 64.95 ? 115 TRP B CE2   1 
ATOM   3500 C CE3   . TRP B 1 69  ? 56.498  -3.347  -32.208 1.00 65.75 ? 115 TRP B CE3   1 
ATOM   3501 C CZ2   . TRP B 1 69  ? 56.292  -1.301  -34.210 1.00 64.40 ? 115 TRP B CZ2   1 
ATOM   3502 C CZ3   . TRP B 1 69  ? 55.269  -3.028  -32.813 1.00 64.80 ? 115 TRP B CZ3   1 
ATOM   3503 C CH2   . TRP B 1 69  ? 55.180  -2.011  -33.804 1.00 63.96 ? 115 TRP B CH2   1 
ATOM   3504 N N     . LEU B 1 70  ? 61.495  -2.591  -28.340 1.00 53.98 ? 116 LEU B N     1 
ATOM   3505 C CA    . LEU B 1 70  ? 62.379  -2.964  -27.245 1.00 52.48 ? 116 LEU B CA    1 
ATOM   3506 C C     . LEU B 1 70  ? 61.695  -2.641  -25.923 1.00 51.25 ? 116 LEU B C     1 
ATOM   3507 O O     . LEU B 1 70  ? 61.739  -3.443  -24.976 1.00 50.18 ? 116 LEU B O     1 
ATOM   3508 C CB    . LEU B 1 70  ? 63.761  -2.283  -27.371 1.00 52.70 ? 116 LEU B CB    1 
ATOM   3509 C CG    . LEU B 1 70  ? 64.977  -2.487  -26.427 1.00 53.36 ? 116 LEU B CG    1 
ATOM   3510 C CD1   . LEU B 1 70  ? 65.174  -1.283  -25.497 1.00 55.04 ? 116 LEU B CD1   1 
ATOM   3511 C CD2   . LEU B 1 70  ? 64.996  -3.811  -25.630 1.00 53.27 ? 116 LEU B CD2   1 
ATOM   3512 N N     . MET B 1 71  ? 61.048  -1.474  -25.861 1.00 50.03 ? 117 MET B N     1 
ATOM   3513 C CA    . MET B 1 71  ? 60.262  -1.111  -24.662 1.00 48.87 ? 117 MET B CA    1 
ATOM   3514 C C     . MET B 1 71  ? 59.209  -2.174  -24.354 1.00 47.12 ? 117 MET B C     1 
ATOM   3515 O O     . MET B 1 71  ? 59.032  -2.556  -23.203 1.00 47.03 ? 117 MET B O     1 
ATOM   3516 C CB    . MET B 1 71  ? 59.600  0.254   -24.791 1.00 49.12 ? 117 MET B CB    1 
ATOM   3517 C CG    . MET B 1 71  ? 59.074  0.764   -23.468 1.00 51.67 ? 117 MET B CG    1 
ATOM   3518 S SD    . MET B 1 71  ? 60.457  1.138   -22.365 1.00 58.44 ? 117 MET B SD    1 
ATOM   3519 C CE    . MET B 1 71  ? 59.919  0.416   -20.831 1.00 52.03 ? 117 MET B CE    1 
ATOM   3520 N N     . GLY B 1 72  ? 58.529  -2.646  -25.393 1.00 45.07 ? 118 GLY B N     1 
ATOM   3521 C CA    . GLY B 1 72  ? 57.521  -3.657  -25.264 1.00 43.21 ? 118 GLY B CA    1 
ATOM   3522 C C     . GLY B 1 72  ? 58.075  -4.860  -24.569 1.00 42.85 ? 118 GLY B C     1 
ATOM   3523 O O     . GLY B 1 72  ? 57.447  -5.385  -23.638 1.00 43.00 ? 118 GLY B O     1 
ATOM   3524 N N     . ASN B 1 73  ? 59.267  -5.280  -24.994 1.00 42.73 ? 119 ASN B N     1 
ATOM   3525 C CA    . ASN B 1 73  ? 59.882  -6.504  -24.477 1.00 42.28 ? 119 ASN B CA    1 
ATOM   3526 C C     . ASN B 1 73  ? 60.399  -6.382  -23.050 1.00 41.47 ? 119 ASN B C     1 
ATOM   3527 O O     . ASN B 1 73  ? 60.202  -7.307  -22.243 1.00 40.97 ? 119 ASN B O     1 
ATOM   3528 C CB    . ASN B 1 73  ? 60.917  -7.075  -25.453 1.00 42.39 ? 119 ASN B CB    1 
ATOM   3529 C CG    . ASN B 1 73  ? 60.265  -7.725  -26.677 1.00 44.83 ? 119 ASN B CG    1 
ATOM   3530 O OD1   . ASN B 1 73  ? 59.341  -8.560  -26.567 1.00 46.94 ? 119 ASN B OD1   1 
ATOM   3531 N ND2   . ASN B 1 73  ? 60.730  -7.335  -27.853 1.00 44.81 ? 119 ASN B ND2   1 
ATOM   3532 N N     . ILE B 1 74  ? 61.009  -5.222  -22.755 1.00 40.94 ? 120 ILE B N     1 
ATOM   3533 C CA    . ILE B 1 74  ? 61.394  -4.783  -21.397 1.00 40.62 ? 120 ILE B CA    1 
ATOM   3534 C C     . ILE B 1 74  ? 60.199  -4.839  -20.450 1.00 40.47 ? 120 ILE B C     1 
ATOM   3535 O O     . ILE B 1 74  ? 60.309  -5.383  -19.354 1.00 40.85 ? 120 ILE B O     1 
ATOM   3536 C CB    . ILE B 1 74  ? 61.944  -3.296  -21.348 1.00 40.25 ? 120 ILE B CB    1 
ATOM   3537 C CG1   . ILE B 1 74  ? 63.128  -3.081  -22.286 1.00 41.40 ? 120 ILE B CG1   1 
ATOM   3538 C CG2   . ILE B 1 74  ? 62.379  -2.898  -19.952 1.00 39.59 ? 120 ILE B CG2   1 
ATOM   3539 C CD1   . ILE B 1 74  ? 63.881  -1.736  -22.029 1.00 41.80 ? 120 ILE B CD1   1 
ATOM   3540 N N     . LEU B 1 75  ? 59.083  -4.230  -20.865 1.00 39.72 ? 121 LEU B N     1 
ATOM   3541 C CA    . LEU B 1 75  ? 57.847  -4.184  -20.080 1.00 39.24 ? 121 LEU B CA    1 
ATOM   3542 C C     . LEU B 1 75  ? 57.331  -5.584  -19.799 1.00 39.23 ? 121 LEU B C     1 
ATOM   3543 O O     . LEU B 1 75  ? 56.894  -5.910  -18.690 1.00 38.74 ? 121 LEU B O     1 
ATOM   3544 C CB    . LEU B 1 75  ? 56.779  -3.395  -20.840 1.00 39.07 ? 121 LEU B CB    1 
ATOM   3545 C CG    . LEU B 1 75  ? 56.863  -1.890  -20.985 1.00 38.06 ? 121 LEU B CG    1 
ATOM   3546 C CD1   . LEU B 1 75  ? 55.698  -1.411  -21.886 1.00 37.83 ? 121 LEU B CD1   1 
ATOM   3547 C CD2   . LEU B 1 75  ? 56.878  -1.184  -19.599 1.00 37.92 ? 121 LEU B CD2   1 
ATOM   3548 N N     . ARG B 1 76  ? 57.389  -6.417  -20.830 1.00 39.39 ? 122 ARG B N     1 
ATOM   3549 C CA    . ARG B 1 76  ? 56.934  -7.784  -20.720 1.00 39.67 ? 122 ARG B CA    1 
ATOM   3550 C C     . ARG B 1 76  ? 57.800  -8.571  -19.695 1.00 40.52 ? 122 ARG B C     1 
ATOM   3551 O O     . ARG B 1 76  ? 57.286  -9.391  -18.911 1.00 39.44 ? 122 ARG B O     1 
ATOM   3552 C CB    . ARG B 1 76  ? 56.945  -8.418  -22.100 1.00 39.09 ? 122 ARG B CB    1 
ATOM   3553 C CG    . ARG B 1 76  ? 56.501  -9.832  -22.115 1.00 39.27 ? 122 ARG B CG    1 
ATOM   3554 C CD    . ARG B 1 76  ? 56.601  -10.399 -23.512 1.00 39.39 ? 122 ARG B CD    1 
ATOM   3555 N NE    . ARG B 1 76  ? 56.233  -11.810 -23.526 1.00 42.14 ? 122 ARG B NE    1 
ATOM   3556 C CZ    . ARG B 1 76  ? 56.497  -12.666 -24.526 1.00 44.22 ? 122 ARG B CZ    1 
ATOM   3557 N NH1   . ARG B 1 76  ? 57.114  -12.270 -25.652 1.00 42.50 ? 122 ARG B NH1   1 
ATOM   3558 N NH2   . ARG B 1 76  ? 56.117  -13.928 -24.404 1.00 44.47 ? 122 ARG B NH2   1 
ATOM   3559 N N     . LEU B 1 77  ? 59.109  -8.298  -19.704 1.00 41.31 ? 123 LEU B N     1 
ATOM   3560 C CA    . LEU B 1 77  ? 60.067  -8.963  -18.779 1.00 41.99 ? 123 LEU B CA    1 
ATOM   3561 C C     . LEU B 1 77  ? 59.876  -8.540  -17.324 1.00 41.43 ? 123 LEU B C     1 
ATOM   3562 O O     . LEU B 1 77  ? 59.912  -9.370  -16.389 1.00 40.97 ? 123 LEU B O     1 
ATOM   3563 C CB    . LEU B 1 77  ? 61.525  -8.706  -19.207 1.00 41.72 ? 123 LEU B CB    1 
ATOM   3564 C CG    . LEU B 1 77  ? 61.921  -9.758  -20.229 1.00 44.60 ? 123 LEU B CG    1 
ATOM   3565 C CD1   . LEU B 1 77  ? 63.155  -9.377  -21.034 1.00 45.70 ? 123 LEU B CD1   1 
ATOM   3566 C CD2   . LEU B 1 77  ? 62.091  -11.124 -19.502 1.00 50.21 ? 123 LEU B CD2   1 
ATOM   3567 N N     . LEU B 1 78  ? 59.706  -7.236  -17.161 1.00 40.44 ? 124 LEU B N     1 
ATOM   3568 C CA    . LEU B 1 78  ? 59.329  -6.654  -15.891 1.00 40.87 ? 124 LEU B CA    1 
ATOM   3569 C C     . LEU B 1 78  ? 57.966  -7.097  -15.330 1.00 39.97 ? 124 LEU B C     1 
ATOM   3570 O O     . LEU B 1 78  ? 57.884  -7.402  -14.151 1.00 39.84 ? 124 LEU B O     1 
ATOM   3571 C CB    . LEU B 1 78  ? 59.414  -5.130  -15.985 1.00 41.38 ? 124 LEU B CB    1 
ATOM   3572 C CG    . LEU B 1 78  ? 60.823  -4.557  -16.106 1.00 41.66 ? 124 LEU B CG    1 
ATOM   3573 C CD1   . LEU B 1 78  ? 60.702  -3.148  -16.632 1.00 43.97 ? 124 LEU B CD1   1 
ATOM   3574 C CD2   . LEU B 1 78  ? 61.492  -4.588  -14.726 1.00 45.09 ? 124 LEU B CD2   1 
ATOM   3575 N N     . PHE B 1 79  ? 56.917  -7.171  -16.160 1.00 38.98 ? 125 PHE B N     1 
ATOM   3576 C CA    . PHE B 1 79  ? 55.522  -7.331  -15.628 1.00 37.56 ? 125 PHE B CA    1 
ATOM   3577 C C     . PHE B 1 79  ? 54.695  -8.543  -16.032 1.00 36.80 ? 125 PHE B C     1 
ATOM   3578 O O     . PHE B 1 79  ? 53.583  -8.734  -15.530 1.00 37.01 ? 125 PHE B O     1 
ATOM   3579 C CB    . PHE B 1 79  ? 54.715  -6.074  -15.964 1.00 37.30 ? 125 PHE B CB    1 
ATOM   3580 C CG    . PHE B 1 79  ? 55.338  -4.823  -15.451 1.00 36.59 ? 125 PHE B CG    1 
ATOM   3581 C CD1   . PHE B 1 79  ? 55.492  -4.623  -14.075 1.00 36.02 ? 125 PHE B CD1   1 
ATOM   3582 C CD2   . PHE B 1 79  ? 55.777  -3.850  -16.329 1.00 35.17 ? 125 PHE B CD2   1 
ATOM   3583 C CE1   . PHE B 1 79  ? 56.080  -3.439  -13.567 1.00 37.62 ? 125 PHE B CE1   1 
ATOM   3584 C CE2   . PHE B 1 79  ? 56.368  -2.678  -15.847 1.00 39.61 ? 125 PHE B CE2   1 
ATOM   3585 C CZ    . PHE B 1 79  ? 56.514  -2.471  -14.459 1.00 38.36 ? 125 PHE B CZ    1 
ATOM   3586 N N     . GLY B 1 80  ? 55.214  -9.349  -16.955 1.00 36.34 ? 126 GLY B N     1 
ATOM   3587 C CA    . GLY B 1 80  ? 54.392  -10.354 -17.627 1.00 35.92 ? 126 GLY B CA    1 
ATOM   3588 C C     . GLY B 1 80  ? 54.098  -11.624 -16.866 1.00 35.29 ? 126 GLY B C     1 
ATOM   3589 O O     . GLY B 1 80  ? 53.375  -12.484 -17.342 1.00 34.57 ? 126 GLY B O     1 
ATOM   3590 N N     . SER B 1 81  ? 54.654  -11.739 -15.673 1.00 35.89 ? 127 SER B N     1 
ATOM   3591 C CA    . SER B 1 81  ? 54.340  -12.860 -14.834 1.00 36.93 ? 127 SER B CA    1 
ATOM   3592 C C     . SER B 1 81  ? 53.732  -12.377 -13.488 1.00 37.52 ? 127 SER B C     1 
ATOM   3593 O O     . SER B 1 81  ? 53.460  -13.175 -12.569 1.00 37.48 ? 127 SER B O     1 
ATOM   3594 C CB    . SER B 1 81  ? 55.592  -13.713 -14.654 1.00 37.84 ? 127 SER B CB    1 
ATOM   3595 O OG    . SER B 1 81  ? 56.612  -12.965 -14.023 1.00 39.03 ? 127 SER B OG    1 
ATOM   3596 N N     . MET B 1 82  ? 53.505  -11.068 -13.391 1.00 37.00 ? 128 MET B N     1 
ATOM   3597 C CA    . MET B 1 82  ? 52.797  -10.488 -12.265 1.00 38.71 ? 128 MET B CA    1 
ATOM   3598 C C     . MET B 1 82  ? 51.335  -11.008 -12.146 1.00 36.46 ? 128 MET B C     1 
ATOM   3599 O O     . MET B 1 82  ? 50.581  -11.064 -13.134 1.00 36.07 ? 128 MET B O     1 
ATOM   3600 C CB    . MET B 1 82  ? 52.825  -8.973  -12.387 1.00 38.40 ? 128 MET B CB    1 
ATOM   3601 C CG    . MET B 1 82  ? 52.565  -8.207  -11.105 1.00 42.09 ? 128 MET B CG    1 
ATOM   3602 S SD    . MET B 1 82  ? 53.356  -6.559  -11.244 1.00 44.91 ? 128 MET B SD    1 
ATOM   3603 C CE    . MET B 1 82  ? 55.107  -7.015  -11.229 1.00 47.72 ? 128 MET B CE    1 
ATOM   3604 N N     . THR B 1 83  ? 50.972  -11.416 -10.936 1.00 35.25 ? 129 THR B N     1 
ATOM   3605 C CA    . THR B 1 83  ? 49.608  -11.797 -10.626 1.00 33.91 ? 129 THR B CA    1 
ATOM   3606 C C     . THR B 1 83  ? 48.831  -10.659 -9.933  1.00 32.50 ? 129 THR B C     1 
ATOM   3607 O O     . THR B 1 83  ? 49.386  -9.621  -9.560  1.00 30.82 ? 129 THR B O     1 
ATOM   3608 C CB    . THR B 1 83  ? 49.524  -13.124 -9.789  1.00 34.31 ? 129 THR B CB    1 
ATOM   3609 O OG1   . THR B 1 83  ? 50.120  -12.934 -8.494  1.00 37.04 ? 129 THR B OG1   1 
ATOM   3610 C CG2   . THR B 1 83  ? 50.201  -14.301 -10.531 1.00 34.01 ? 129 THR B CG2   1 
ATOM   3611 N N     . THR B 1 84  ? 47.524  -10.869 -9.797  1.00 31.65 ? 130 THR B N     1 
ATOM   3612 C CA    . THR B 1 84  ? 46.667  -9.959  -9.024  1.00 30.31 ? 130 THR B CA    1 
ATOM   3613 C C     . THR B 1 84  ? 45.813  -10.828 -8.068  1.00 30.15 ? 130 THR B C     1 
ATOM   3614 O O     . THR B 1 84  ? 45.473  -11.980 -8.436  1.00 28.14 ? 130 THR B O     1 
ATOM   3615 C CB    . THR B 1 84  ? 45.833  -8.964  -9.938  1.00 29.28 ? 130 THR B CB    1 
ATOM   3616 O OG1   . THR B 1 84  ? 45.037  -8.152  -9.111  1.00 29.37 ? 130 THR B OG1   1 
ATOM   3617 C CG2   . THR B 1 84  ? 44.912  -9.679  -10.863 1.00 27.83 ? 130 THR B CG2   1 
ATOM   3618 N N     . PRO B 1 85  ? 45.543  -10.312 -6.838  1.00 29.62 ? 131 PRO B N     1 
ATOM   3619 C CA    . PRO B 1 85  ? 44.951  -11.119 -5.777  1.00 31.02 ? 131 PRO B CA    1 
ATOM   3620 C C     . PRO B 1 85  ? 43.511  -11.562 -5.951  1.00 31.63 ? 131 PRO B C     1 
ATOM   3621 O O     . PRO B 1 85  ? 42.660  -11.167 -5.148  1.00 32.20 ? 131 PRO B O     1 
ATOM   3622 C CB    . PRO B 1 85  ? 45.106  -10.253 -4.496  1.00 31.09 ? 131 PRO B CB    1 
ATOM   3623 C CG    . PRO B 1 85  ? 45.474  -8.918  -4.913  1.00 30.97 ? 131 PRO B CG    1 
ATOM   3624 C CD    . PRO B 1 85  ? 45.886  -8.949  -6.375  1.00 30.35 ? 131 PRO B CD    1 
ATOM   3625 N N     . ALA B 1 86  ? 43.258  -12.415 -6.952  1.00 31.40 ? 132 ALA B N     1 
ATOM   3626 C CA    . ALA B 1 86  ? 41.927  -12.966 -7.187  1.00 31.62 ? 132 ALA B CA    1 
ATOM   3627 C C     . ALA B 1 86  ? 42.044  -14.435 -7.520  1.00 31.70 ? 132 ALA B C     1 
ATOM   3628 O O     . ALA B 1 86  ? 43.005  -14.846 -8.159  1.00 31.44 ? 132 ALA B O     1 
ATOM   3629 C CB    . ALA B 1 86  ? 41.183  -12.212 -8.320  1.00 31.40 ? 132 ALA B CB    1 
ATOM   3630 N N     . ASN B 1 87  ? 41.067  -15.212 -7.060  1.00 31.74 ? 133 ASN B N     1 
ATOM   3631 C CA    . ASN B 1 87  ? 40.991  -16.635 -7.348  1.00 33.10 ? 133 ASN B CA    1 
ATOM   3632 C C     . ASN B 1 87  ? 40.579  -16.919 -8.774  1.00 32.00 ? 133 ASN B C     1 
ATOM   3633 O O     . ASN B 1 87  ? 39.401  -16.892 -9.053  1.00 32.19 ? 133 ASN B O     1 
ATOM   3634 C CB    . ASN B 1 87  ? 39.912  -17.256 -6.473  1.00 34.43 ? 133 ASN B CB    1 
ATOM   3635 C CG    . ASN B 1 87  ? 40.435  -17.740 -5.146  1.00 40.01 ? 133 ASN B CG    1 
ATOM   3636 O OD1   . ASN B 1 87  ? 40.555  -18.972 -4.932  1.00 46.47 ? 133 ASN B OD1   1 
ATOM   3637 N ND2   . ASN B 1 87  ? 40.715  -16.794 -4.215  1.00 38.71 ? 133 ASN B ND2   1 
ATOM   3638 N N     . TRP B 1 88  ? 41.523  -17.228 -9.664  1.00 31.51 ? 134 TRP B N     1 
ATOM   3639 C CA    . TRP B 1 88  ? 41.203  -17.506 -11.077 1.00 31.11 ? 134 TRP B CA    1 
ATOM   3640 C C     . TRP B 1 88  ? 40.198  -18.638 -11.268 1.00 31.47 ? 134 TRP B C     1 
ATOM   3641 O O     . TRP B 1 88  ? 40.476  -19.806 -10.900 1.00 31.12 ? 134 TRP B O     1 
ATOM   3642 C CB    . TRP B 1 88  ? 42.483  -17.803 -11.869 1.00 31.03 ? 134 TRP B CB    1 
ATOM   3643 C CG    . TRP B 1 88  ? 42.286  -17.933 -13.353 1.00 31.44 ? 134 TRP B CG    1 
ATOM   3644 C CD1   . TRP B 1 88  ? 42.514  -19.056 -14.115 1.00 30.84 ? 134 TRP B CD1   1 
ATOM   3645 C CD2   . TRP B 1 88  ? 41.842  -16.904 -14.271 1.00 32.03 ? 134 TRP B CD2   1 
ATOM   3646 N NE1   . TRP B 1 88  ? 42.245  -18.788 -15.432 1.00 32.39 ? 134 TRP B NE1   1 
ATOM   3647 C CE2   . TRP B 1 88  ? 41.838  -17.481 -15.568 1.00 32.50 ? 134 TRP B CE2   1 
ATOM   3648 C CE3   . TRP B 1 88  ? 41.462  -15.546 -14.121 1.00 30.60 ? 134 TRP B CE3   1 
ATOM   3649 C CZ2   . TRP B 1 88  ? 41.460  -16.754 -16.722 1.00 31.16 ? 134 TRP B CZ2   1 
ATOM   3650 C CZ3   . TRP B 1 88  ? 41.083  -14.825 -15.256 1.00 31.31 ? 134 TRP B CZ3   1 
ATOM   3651 C CH2   . TRP B 1 88  ? 41.071  -15.436 -16.543 1.00 31.13 ? 134 TRP B CH2   1 
ATOM   3652 N N     . ASN B 1 89  ? 39.052  -18.294 -11.861 1.00 31.25 ? 135 ASN B N     1 
ATOM   3653 C CA    . ASN B 1 89  ? 37.966  -19.246 -12.191 1.00 32.33 ? 135 ASN B CA    1 
ATOM   3654 C C     . ASN B 1 89  ? 37.343  -19.955 -10.977 1.00 32.80 ? 135 ASN B C     1 
ATOM   3655 O O     . ASN B 1 89  ? 36.704  -20.974 -11.110 1.00 30.97 ? 135 ASN B O     1 
ATOM   3656 C CB    . ASN B 1 89  ? 38.426  -20.339 -13.140 1.00 32.68 ? 135 ASN B CB    1 
ATOM   3657 C CG    . ASN B 1 89  ? 38.610  -19.885 -14.565 1.00 33.32 ? 135 ASN B CG    1 
ATOM   3658 O OD1   . ASN B 1 89  ? 39.481  -20.429 -15.247 1.00 36.70 ? 135 ASN B OD1   1 
ATOM   3659 N ND2   . ASN B 1 89  ? 37.791  -18.942 -15.045 1.00 33.26 ? 135 ASN B ND2   1 
ATOM   3660 N N     . SER B 1 90  ? 37.558  -19.402 -9.797  1.00 34.27 ? 136 SER B N     1 
ATOM   3661 C CA    . SER B 1 90  ? 36.982  -19.931 -8.577  1.00 36.14 ? 136 SER B CA    1 
ATOM   3662 C C     . SER B 1 90  ? 35.449  -19.848 -8.641  1.00 36.47 ? 136 SER B C     1 
ATOM   3663 O O     . SER B 1 90  ? 34.903  -18.882 -9.169  1.00 37.53 ? 136 SER B O     1 
ATOM   3664 C CB    . SER B 1 90  ? 37.521  -19.107 -7.431  1.00 35.62 ? 136 SER B CB    1 
ATOM   3665 O OG    . SER B 1 90  ? 37.207  -19.711 -6.214  1.00 41.33 ? 136 SER B OG    1 
ATOM   3666 N N     . PRO B 1 91  ? 34.732  -20.873 -8.166  1.00 37.12 ? 137 PRO B N     1 
ATOM   3667 C CA    . PRO B 1 91  ? 33.253  -20.757 -8.285  1.00 36.51 ? 137 PRO B CA    1 
ATOM   3668 C C     . PRO B 1 91  ? 32.634  -19.494 -7.616  1.00 36.72 ? 137 PRO B C     1 
ATOM   3669 O O     . PRO B 1 91  ? 33.182  -18.936 -6.644  1.00 36.03 ? 137 PRO B O     1 
ATOM   3670 C CB    . PRO B 1 91  ? 32.725  -22.039 -7.613  1.00 36.60 ? 137 PRO B CB    1 
ATOM   3671 C CG    . PRO B 1 91  ? 33.862  -22.990 -7.579  1.00 37.91 ? 137 PRO B CG    1 
ATOM   3672 C CD    . PRO B 1 91  ? 35.164  -22.161 -7.588  1.00 37.23 ? 137 PRO B CD    1 
ATOM   3673 N N     . LEU B 1 92  ? 31.500  -19.052 -8.132  1.00 36.59 ? 138 LEU B N     1 
ATOM   3674 C CA    . LEU B 1 92  ? 30.801  -17.927 -7.544  1.00 38.04 ? 138 LEU B CA    1 
ATOM   3675 C C     . LEU B 1 92  ? 30.217  -18.319 -6.169  1.00 39.47 ? 138 LEU B C     1 
ATOM   3676 O O     . LEU B 1 92  ? 29.762  -19.435 -5.997  1.00 40.52 ? 138 LEU B O     1 
ATOM   3677 C CB    . LEU B 1 92  ? 29.683  -17.479 -8.495  1.00 37.62 ? 138 LEU B CB    1 
ATOM   3678 C CG    . LEU B 1 92  ? 28.808  -16.315 -8.032  1.00 36.56 ? 138 LEU B CG    1 
ATOM   3679 C CD1   . LEU B 1 92  ? 29.500  -14.953 -8.168  1.00 35.09 ? 138 LEU B CD1   1 
ATOM   3680 C CD2   . LEU B 1 92  ? 27.527  -16.373 -8.812  1.00 40.76 ? 138 LEU B CD2   1 
ATOM   3681 N N     . ARG B 1 93  ? 30.230  -17.409 -5.205  1.00 40.38 ? 139 ARG B N     1 
ATOM   3682 C CA    . ARG B 1 93  ? 29.576  -17.629 -3.926  1.00 42.11 ? 139 ARG B CA    1 
ATOM   3683 C C     . ARG B 1 93  ? 28.046  -17.640 -4.095  1.00 42.94 ? 139 ARG B C     1 
ATOM   3684 O O     . ARG B 1 93  ? 27.436  -16.576 -4.358  1.00 42.49 ? 139 ARG B O     1 
ATOM   3685 C CB    . ARG B 1 93  ? 30.001  -16.534 -2.913  1.00 41.96 ? 139 ARG B CB    1 
ATOM   3686 C CG    . ARG B 1 93  ? 29.603  -16.781 -1.440  1.00 44.23 ? 139 ARG B CG    1 
ATOM   3687 C CD    . ARG B 1 93  ? 29.242  -15.438 -0.763  1.00 49.18 ? 139 ARG B CD    1 
ATOM   3688 N NE    . ARG B 1 93  ? 28.450  -15.528 0.472   1.00 51.82 ? 139 ARG B NE    1 
ATOM   3689 C CZ    . ARG B 1 93  ? 27.281  -14.900 0.715   1.00 56.63 ? 139 ARG B CZ    1 
ATOM   3690 N NH1   . ARG B 1 93  ? 26.678  -14.088 -0.187  1.00 53.02 ? 139 ARG B NH1   1 
ATOM   3691 N NH2   . ARG B 1 93  ? 26.695  -15.088 1.908   1.00 57.96 ? 139 ARG B NH2   1 
ATOM   3692 N N     . PRO B 1 94  ? 27.401  -18.827 -3.895  1.00 44.20 ? 140 PRO B N     1 
ATOM   3693 C CA    . PRO B 1 94  ? 25.934  -18.939 -4.067  1.00 44.54 ? 140 PRO B CA    1 
ATOM   3694 C C     . PRO B 1 94  ? 25.073  -18.476 -2.860  1.00 45.83 ? 140 PRO B C     1 
ATOM   3695 O O     . PRO B 1 94  ? 25.604  -18.149 -1.773  1.00 46.11 ? 140 PRO B O     1 
ATOM   3696 C CB    . PRO B 1 94  ? 25.735  -20.419 -4.373  1.00 44.42 ? 140 PRO B CB    1 
ATOM   3697 C CG    . PRO B 1 94  ? 26.922  -21.110 -3.842  1.00 44.07 ? 140 PRO B CG    1 
ATOM   3698 C CD    . PRO B 1 94  ? 27.996  -20.116 -3.507  1.00 43.69 ? 140 PRO B CD    1 
ATOM   3699 N N     . GLY B 1 95  ? 23.759  -18.412 -3.072  1.00 46.75 ? 141 GLY B N     1 
ATOM   3700 C CA    . GLY B 1 95  ? 22.814  -18.039 -2.015  1.00 47.96 ? 141 GLY B CA    1 
ATOM   3701 C C     . GLY B 1 95  ? 22.452  -16.556 -1.915  1.00 48.86 ? 141 GLY B C     1 
ATOM   3702 O O     . GLY B 1 95  ? 21.683  -16.149 -1.015  1.00 49.22 ? 141 GLY B O     1 
ATOM   3703 N N     . GLU B 1 96  ? 23.002  -15.739 -2.822  1.00 48.33 ? 142 GLU B N     1 
ATOM   3704 C CA    . GLU B 1 96  ? 22.752  -14.302 -2.801  1.00 47.14 ? 142 GLU B CA    1 
ATOM   3705 C C     . GLU B 1 96  ? 22.701  -13.740 -4.232  1.00 46.64 ? 142 GLU B C     1 
ATOM   3706 O O     . GLU B 1 96  ? 23.238  -14.340 -5.193  1.00 46.85 ? 142 GLU B O     1 
ATOM   3707 C CB    . GLU B 1 96  ? 23.792  -13.566 -1.932  1.00 46.96 ? 142 GLU B CB    1 
ATOM   3708 C CG    . GLU B 1 96  ? 23.322  -12.191 -1.389  1.00 47.56 ? 142 GLU B CG    1 
ATOM   3709 C CD    . GLU B 1 96  ? 24.478  -11.148 -1.160  1.00 48.68 ? 142 GLU B CD    1 
ATOM   3710 O OE1   . GLU B 1 96  ? 25.468  -11.510 -0.447  1.00 50.00 ? 142 GLU B OE1   1 
ATOM   3711 O OE2   . GLU B 1 96  ? 24.369  -9.965  -1.672  1.00 45.03 ? 142 GLU B OE2   1 
ATOM   3712 N N     . LYS B 1 97  ? 21.999  -12.610 -4.361  1.00 44.99 ? 143 LYS B N     1 
ATOM   3713 C CA    . LYS B 1 97  ? 21.999  -11.776 -5.548  1.00 42.91 ? 143 LYS B CA    1 
ATOM   3714 C C     . LYS B 1 97  ? 22.967  -10.602 -5.280  1.00 40.67 ? 143 LYS B C     1 
ATOM   3715 O O     . LYS B 1 97  ? 23.022  -10.082 -4.159  1.00 39.60 ? 143 LYS B O     1 
ATOM   3716 C CB    . LYS B 1 97  ? 20.588  -11.268 -5.796  1.00 42.61 ? 143 LYS B CB    1 
ATOM   3717 C CG    . LYS B 1 97  ? 19.715  -12.276 -6.523  1.00 45.52 ? 143 LYS B CG    1 
ATOM   3718 C CD    . LYS B 1 97  ? 18.298  -11.773 -6.804  1.00 45.80 ? 143 LYS B CD    1 
ATOM   3719 C CE    . LYS B 1 97  ? 17.682  -12.529 -8.016  1.00 52.23 ? 143 LYS B CE    1 
ATOM   3720 N NZ    . LYS B 1 97  ? 18.150  -12.011 -9.387  1.00 53.33 ? 143 LYS B NZ    1 
ATOM   3721 N N     . TYR B 1 98  ? 23.739  -10.198 -6.294  1.00 37.82 ? 144 TYR B N     1 
ATOM   3722 C CA    . TYR B 1 98  ? 24.802  -9.201  -6.081  1.00 35.17 ? 144 TYR B CA    1 
ATOM   3723 C C     . TYR B 1 98  ? 24.542  -7.953  -6.861  1.00 33.91 ? 144 TYR B C     1 
ATOM   3724 O O     . TYR B 1 98  ? 24.078  -8.029  -7.996  1.00 33.66 ? 144 TYR B O     1 
ATOM   3725 C CB    . TYR B 1 98  ? 26.203  -9.756  -6.419  1.00 34.59 ? 144 TYR B CB    1 
ATOM   3726 C CG    . TYR B 1 98  ? 26.570  -10.967 -5.603  1.00 34.39 ? 144 TYR B CG    1 
ATOM   3727 C CD1   . TYR B 1 98  ? 26.883  -10.852 -4.234  1.00 34.54 ? 144 TYR B CD1   1 
ATOM   3728 C CD2   . TYR B 1 98  ? 26.579  -12.224 -6.173  1.00 31.27 ? 144 TYR B CD2   1 
ATOM   3729 C CE1   . TYR B 1 98  ? 27.222  -11.974 -3.482  1.00 32.88 ? 144 TYR B CE1   1 
ATOM   3730 C CE2   . TYR B 1 98  ? 26.902  -13.335 -5.436  1.00 30.17 ? 144 TYR B CE2   1 
ATOM   3731 C CZ    . TYR B 1 98  ? 27.211  -13.212 -4.087  1.00 34.03 ? 144 TYR B CZ    1 
ATOM   3732 O OH    . TYR B 1 98  ? 27.533  -14.344 -3.355  1.00 34.62 ? 144 TYR B OH    1 
ATOM   3733 N N     . PRO B 1 99  ? 24.830  -6.788  -6.246  1.00 32.32 ? 145 PRO B N     1 
ATOM   3734 C CA    . PRO B 1 99  ? 24.894  -5.528  -7.004  1.00 31.53 ? 145 PRO B CA    1 
ATOM   3735 C C     . PRO B 1 99  ? 25.888  -5.598  -8.184  1.00 29.65 ? 145 PRO B C     1 
ATOM   3736 O O     . PRO B 1 99  ? 26.897  -6.308  -8.119  1.00 28.97 ? 145 PRO B O     1 
ATOM   3737 C CB    . PRO B 1 99  ? 25.340  -4.478  -5.933  1.00 31.22 ? 145 PRO B CB    1 
ATOM   3738 C CG    . PRO B 1 99  ? 25.899  -5.297  -4.789  1.00 30.99 ? 145 PRO B CG    1 
ATOM   3739 C CD    . PRO B 1 99  ? 25.137  -6.596  -4.814  1.00 32.12 ? 145 PRO B CD    1 
ATOM   3740 N N     . LEU B 1 100 ? 25.593  -4.874  -9.256  1.00 28.88 ? 146 LEU B N     1 
ATOM   3741 C CA    . LEU B 1 100 ? 26.436  -4.928  -10.453 1.00 27.48 ? 146 LEU B CA    1 
ATOM   3742 C C     . LEU B 1 100 ? 27.131  -3.596  -10.799 1.00 26.32 ? 146 LEU B C     1 
ATOM   3743 O O     . LEU B 1 100 ? 26.473  -2.566  -10.902 1.00 26.86 ? 146 LEU B O     1 
ATOM   3744 C CB    . LEU B 1 100 ? 25.636  -5.435  -11.657 1.00 27.07 ? 146 LEU B CB    1 
ATOM   3745 C CG    . LEU B 1 100 ? 26.384  -5.558  -12.994 1.00 27.55 ? 146 LEU B CG    1 
ATOM   3746 C CD1   . LEU B 1 100 ? 27.663  -6.421  -12.925 1.00 26.79 ? 146 LEU B CD1   1 
ATOM   3747 C CD2   . LEU B 1 100 ? 25.484  -6.009  -14.115 1.00 26.35 ? 146 LEU B CD2   1 
ATOM   3748 N N     . VAL B 1 101 ? 28.462  -3.645  -10.995 1.00 24.87 ? 147 VAL B N     1 
ATOM   3749 C CA    . VAL B 1 101 ? 29.238  -2.508  -11.516 1.00 22.61 ? 147 VAL B CA    1 
ATOM   3750 C C     . VAL B 1 101 ? 29.780  -2.859  -12.875 1.00 21.84 ? 147 VAL B C     1 
ATOM   3751 O O     . VAL B 1 101 ? 30.444  -3.856  -13.031 1.00 21.54 ? 147 VAL B O     1 
ATOM   3752 C CB    . VAL B 1 101 ? 30.420  -2.126  -10.563 1.00 22.40 ? 147 VAL B CB    1 
ATOM   3753 C CG1   . VAL B 1 101 ? 31.396  -1.150  -11.236 1.00 20.28 ? 147 VAL B CG1   1 
ATOM   3754 C CG2   . VAL B 1 101 ? 29.886  -1.564  -9.225  1.00 22.32 ? 147 VAL B CG2   1 
ATOM   3755 N N     . VAL B 1 102 ? 29.541  -2.012  -13.864 1.00 21.54 ? 148 VAL B N     1 
ATOM   3756 C CA    . VAL B 1 102 ? 30.251  -2.128  -15.120 1.00 19.91 ? 148 VAL B CA    1 
ATOM   3757 C C     . VAL B 1 102 ? 31.421  -1.121  -15.076 1.00 21.11 ? 148 VAL B C     1 
ATOM   3758 O O     . VAL B 1 102 ? 31.210  0.062   -14.784 1.00 19.41 ? 148 VAL B O     1 
ATOM   3759 C CB    . VAL B 1 102 ? 29.306  -1.899  -16.296 1.00 19.87 ? 148 VAL B CB    1 
ATOM   3760 C CG1   . VAL B 1 102 ? 30.076  -1.860  -17.608 1.00 16.99 ? 148 VAL B CG1   1 
ATOM   3761 C CG2   . VAL B 1 102 ? 28.163  -2.987  -16.274 1.00 15.99 ? 148 VAL B CG2   1 
ATOM   3762 N N     . PHE B 1 103 ? 32.654  -1.603  -15.337 1.00 20.88 ? 149 PHE B N     1 
ATOM   3763 C CA    . PHE B 1 103 ? 33.818  -0.747  -15.273 1.00 19.58 ? 149 PHE B CA    1 
ATOM   3764 C C     . PHE B 1 103 ? 34.446  -0.409  -16.641 1.00 20.91 ? 149 PHE B C     1 
ATOM   3765 O O     . PHE B 1 103 ? 34.741  -1.296  -17.435 1.00 21.54 ? 149 PHE B O     1 
ATOM   3766 C CB    . PHE B 1 103 ? 34.834  -1.359  -14.337 1.00 19.10 ? 149 PHE B CB    1 
ATOM   3767 C CG    . PHE B 1 103 ? 35.894  -0.386  -13.893 1.00 19.17 ? 149 PHE B CG    1 
ATOM   3768 C CD1   . PHE B 1 103 ? 35.721  0.383   -12.721 1.00 19.07 ? 149 PHE B CD1   1 
ATOM   3769 C CD2   . PHE B 1 103 ? 37.046  -0.208  -14.640 1.00 16.14 ? 149 PHE B CD2   1 
ATOM   3770 C CE1   . PHE B 1 103 ? 36.690  1.338   -12.338 1.00 19.61 ? 149 PHE B CE1   1 
ATOM   3771 C CE2   . PHE B 1 103 ? 37.994  0.741   -14.280 1.00 16.02 ? 149 PHE B CE2   1 
ATOM   3772 C CZ    . PHE B 1 103 ? 37.826  1.512   -13.121 1.00 19.64 ? 149 PHE B CZ    1 
ATOM   3773 N N     . SER B 1 104 ? 34.691  0.880   -16.887 1.00 21.11 ? 150 SER B N     1 
ATOM   3774 C CA    . SER B 1 104 ? 35.292  1.363   -18.123 1.00 21.85 ? 150 SER B CA    1 
ATOM   3775 C C     . SER B 1 104 ? 36.733  1.863   -17.947 1.00 22.34 ? 150 SER B C     1 
ATOM   3776 O O     . SER B 1 104 ? 36.994  2.784   -17.168 1.00 23.20 ? 150 SER B O     1 
ATOM   3777 C CB    . SER B 1 104 ? 34.465  2.482   -18.745 1.00 21.02 ? 150 SER B CB    1 
ATOM   3778 O OG    . SER B 1 104 ? 34.912  2.687   -20.089 1.00 22.29 ? 150 SER B OG    1 
ATOM   3779 N N     . HIS B 1 105 ? 37.664  1.284   -18.724 1.00 22.46 ? 151 HIS B N     1 
ATOM   3780 C CA    . HIS B 1 105 ? 39.070  1.589   -18.598 1.00 20.44 ? 151 HIS B CA    1 
ATOM   3781 C C     . HIS B 1 105 ? 39.428  2.886   -19.396 1.00 21.46 ? 151 HIS B C     1 
ATOM   3782 O O     . HIS B 1 105 ? 38.683  3.314   -20.285 1.00 20.10 ? 151 HIS B O     1 
ATOM   3783 C CB    . HIS B 1 105 ? 39.889  0.375   -19.070 1.00 20.00 ? 151 HIS B CB    1 
ATOM   3784 C CG    . HIS B 1 105 ? 39.770  0.102   -20.547 1.00 16.04 ? 151 HIS B CG    1 
ATOM   3785 N ND1   . HIS B 1 105 ? 40.292  0.950   -21.502 1.00 13.17 ? 151 HIS B ND1   1 
ATOM   3786 C CD2   . HIS B 1 105 ? 39.185  -0.917  -21.231 1.00 11.55 ? 151 HIS B CD2   1 
ATOM   3787 C CE1   . HIS B 1 105 ? 40.047  0.467   -22.710 1.00 13.39 ? 151 HIS B CE1   1 
ATOM   3788 N NE2   . HIS B 1 105 ? 39.357  -0.655  -22.575 1.00 14.73 ? 151 HIS B NE2   1 
ATOM   3789 N N     . GLY B 1 106 ? 40.574  3.508   -19.060 1.00 22.43 ? 152 GLY B N     1 
ATOM   3790 C CA    . GLY B 1 106 ? 41.066  4.671   -19.774 1.00 22.03 ? 152 GLY B CA    1 
ATOM   3791 C C     . GLY B 1 106 ? 41.715  4.387   -21.102 1.00 23.11 ? 152 GLY B C     1 
ATOM   3792 O O     . GLY B 1 106 ? 41.833  3.244   -21.554 1.00 24.22 ? 152 GLY B O     1 
ATOM   3793 N N     . LEU B 1 107 ? 42.143  5.464   -21.738 1.00 23.68 ? 153 LEU B N     1 
ATOM   3794 C CA    . LEU B 1 107 ? 42.863  5.426   -22.978 1.00 23.51 ? 153 LEU B CA    1 
ATOM   3795 C C     . LEU B 1 107 ? 44.228  4.738   -22.747 1.00 23.65 ? 153 LEU B C     1 
ATOM   3796 O O     . LEU B 1 107 ? 44.803  4.883   -21.702 1.00 23.95 ? 153 LEU B O     1 
ATOM   3797 C CB    . LEU B 1 107 ? 43.030  6.874   -23.487 1.00 23.08 ? 153 LEU B CB    1 
ATOM   3798 C CG    . LEU B 1 107 ? 43.792  6.980   -24.796 1.00 23.50 ? 153 LEU B CG    1 
ATOM   3799 C CD1   . LEU B 1 107 ? 42.908  6.635   -25.943 1.00 20.23 ? 153 LEU B CD1   1 
ATOM   3800 C CD2   . LEU B 1 107 ? 44.520  8.314   -24.976 1.00 21.83 ? 153 LEU B CD2   1 
ATOM   3801 N N     . GLY B 1 108 ? 44.703  3.920   -23.694 1.00 23.41 ? 154 GLY B N     1 
ATOM   3802 C CA    . GLY B 1 108 ? 45.898  3.123   -23.471 1.00 22.25 ? 154 GLY B CA    1 
ATOM   3803 C C     . GLY B 1 108 ? 45.789  2.031   -22.412 1.00 23.24 ? 154 GLY B C     1 
ATOM   3804 O O     . GLY B 1 108 ? 46.756  1.284   -22.201 1.00 23.60 ? 154 GLY B O     1 
ATOM   3805 N N     . ALA B 1 109 ? 44.642  1.872   -21.755 1.00 22.82 ? 155 ALA B N     1 
ATOM   3806 C CA    . ALA B 1 109 ? 44.537  0.755   -20.778 1.00 21.93 ? 155 ALA B CA    1 
ATOM   3807 C C     . ALA B 1 109 ? 43.818  -0.419  -21.457 1.00 21.34 ? 155 ALA B C     1 
ATOM   3808 O O     . ALA B 1 109 ? 43.770  -0.458  -22.691 1.00 22.61 ? 155 ALA B O     1 
ATOM   3809 C CB    . ALA B 1 109 ? 43.848  1.173   -19.504 1.00 19.82 ? 155 ALA B CB    1 
ATOM   3810 N N     . PHE B 1 110 ? 43.319  -1.362  -20.658 1.00 20.27 ? 156 PHE B N     1 
ATOM   3811 C CA    . PHE B 1 110 ? 42.528  -2.518  -21.099 1.00 21.06 ? 156 PHE B CA    1 
ATOM   3812 C C     . PHE B 1 110 ? 41.845  -3.118  -19.874 1.00 21.41 ? 156 PHE B C     1 
ATOM   3813 O O     . PHE B 1 110 ? 41.957  -2.559  -18.792 1.00 21.05 ? 156 PHE B O     1 
ATOM   3814 C CB    . PHE B 1 110 ? 43.310  -3.536  -21.966 1.00 19.53 ? 156 PHE B CB    1 
ATOM   3815 C CG    . PHE B 1 110 ? 44.677  -3.829  -21.457 1.00 22.32 ? 156 PHE B CG    1 
ATOM   3816 C CD1   . PHE B 1 110 ? 44.889  -4.877  -20.528 1.00 16.54 ? 156 PHE B CD1   1 
ATOM   3817 C CD2   . PHE B 1 110 ? 45.765  -3.066  -21.898 1.00 19.54 ? 156 PHE B CD2   1 
ATOM   3818 C CE1   . PHE B 1 110 ? 46.139  -5.128  -20.052 1.00 20.55 ? 156 PHE B CE1   1 
ATOM   3819 C CE2   . PHE B 1 110 ? 47.043  -3.285  -21.392 1.00 20.11 ? 156 PHE B CE2   1 
ATOM   3820 C CZ    . PHE B 1 110 ? 47.241  -4.317  -20.458 1.00 21.42 ? 156 PHE B CZ    1 
ATOM   3821 N N     . ARG B 1 111 ? 41.126  -4.231  -20.039 1.00 21.97 ? 157 ARG B N     1 
ATOM   3822 C CA    . ARG B 1 111 ? 40.227  -4.702  -19.005 1.00 21.58 ? 157 ARG B CA    1 
ATOM   3823 C C     . ARG B 1 111 ? 40.875  -5.032  -17.654 1.00 22.30 ? 157 ARG B C     1 
ATOM   3824 O O     . ARG B 1 111 ? 40.214  -4.976  -16.645 1.00 22.37 ? 157 ARG B O     1 
ATOM   3825 C CB    . ARG B 1 111 ? 39.430  -5.902  -19.497 1.00 22.29 ? 157 ARG B CB    1 
ATOM   3826 C CG    . ARG B 1 111 ? 40.123  -7.247  -19.403 1.00 20.72 ? 157 ARG B CG    1 
ATOM   3827 C CD    . ARG B 1 111 ? 39.330  -8.318  -20.182 1.00 20.84 ? 157 ARG B CD    1 
ATOM   3828 N NE    . ARG B 1 111 ? 40.102  -9.559  -20.183 1.00 22.72 ? 157 ARG B NE    1 
ATOM   3829 C CZ    . ARG B 1 111 ? 41.238  -9.739  -20.867 1.00 23.16 ? 157 ARG B CZ    1 
ATOM   3830 N NH1   . ARG B 1 111 ? 41.744  -8.777  -21.640 1.00 22.41 ? 157 ARG B NH1   1 
ATOM   3831 N NH2   . ARG B 1 111 ? 41.878  -10.894 -20.782 1.00 25.20 ? 157 ARG B NH2   1 
ATOM   3832 N N     . THR B 1 112 ? 42.174  -5.325  -17.625 1.00 22.42 ? 158 THR B N     1 
ATOM   3833 C CA    . THR B 1 112 ? 42.758  -5.976  -16.472 1.00 22.41 ? 158 THR B CA    1 
ATOM   3834 C C     . THR B 1 112 ? 43.510  -5.032  -15.523 1.00 22.63 ? 158 THR B C     1 
ATOM   3835 O O     . THR B 1 112 ? 44.064  -5.475  -14.529 1.00 22.53 ? 158 THR B O     1 
ATOM   3836 C CB    . THR B 1 112 ? 43.729  -7.144  -16.866 1.00 22.35 ? 158 THR B CB    1 
ATOM   3837 O OG1   . THR B 1 112 ? 44.910  -6.610  -17.433 1.00 22.28 ? 158 THR B OG1   1 
ATOM   3838 C CG2   . THR B 1 112 ? 43.127  -8.143  -17.846 1.00 23.19 ? 158 THR B CG2   1 
ATOM   3839 N N     . LEU B 1 113 ? 43.517  -3.738  -15.830 1.00 23.81 ? 159 LEU B N     1 
ATOM   3840 C CA    . LEU B 1 113 ? 44.446  -2.777  -15.198 1.00 23.35 ? 159 LEU B CA    1 
ATOM   3841 C C     . LEU B 1 113 ? 43.830  -2.043  -14.034 1.00 24.28 ? 159 LEU B C     1 
ATOM   3842 O O     . LEU B 1 113 ? 44.472  -1.149  -13.481 1.00 25.03 ? 159 LEU B O     1 
ATOM   3843 C CB    . LEU B 1 113 ? 44.970  -1.780  -16.221 1.00 22.92 ? 159 LEU B CB    1 
ATOM   3844 C CG    . LEU B 1 113 ? 45.861  -2.364  -17.359 1.00 23.66 ? 159 LEU B CG    1 
ATOM   3845 C CD1   . LEU B 1 113 ? 46.488  -1.236  -18.205 1.00 20.73 ? 159 LEU B CD1   1 
ATOM   3846 C CD2   . LEU B 1 113 ? 46.939  -3.273  -16.823 1.00 21.41 ? 159 LEU B CD2   1 
ATOM   3847 N N     . TYR B 1 114 ? 42.615  -2.456  -13.640 1.00 22.80 ? 160 TYR B N     1 
ATOM   3848 C CA    . TYR B 1 114 ? 41.881  -1.831  -12.565 1.00 23.10 ? 160 TYR B CA    1 
ATOM   3849 C C     . TYR B 1 114 ? 41.409  -2.885  -11.532 1.00 23.91 ? 160 TYR B C     1 
ATOM   3850 O O     . TYR B 1 114 ? 40.304  -2.811  -10.964 1.00 25.01 ? 160 TYR B O     1 
ATOM   3851 C CB    . TYR B 1 114 ? 40.715  -0.978  -13.132 1.00 21.32 ? 160 TYR B CB    1 
ATOM   3852 C CG    . TYR B 1 114 ? 41.184  0.147   -14.065 1.00 20.76 ? 160 TYR B CG    1 
ATOM   3853 C CD1   . TYR B 1 114 ? 41.471  1.416   -13.563 1.00 21.46 ? 160 TYR B CD1   1 
ATOM   3854 C CD2   . TYR B 1 114 ? 41.334  -0.063  -15.449 1.00 15.60 ? 160 TYR B CD2   1 
ATOM   3855 C CE1   . TYR B 1 114 ? 41.910  2.481   -14.402 1.00 20.12 ? 160 TYR B CE1   1 
ATOM   3856 C CE2   . TYR B 1 114 ? 41.790  0.971   -16.279 1.00 20.17 ? 160 TYR B CE2   1 
ATOM   3857 C CZ    . TYR B 1 114 ? 42.067  2.233   -15.732 1.00 21.01 ? 160 TYR B CZ    1 
ATOM   3858 O OH    . TYR B 1 114 ? 42.436  3.249   -16.533 1.00 22.74 ? 160 TYR B OH    1 
ATOM   3859 N N     . SER B 1 115 ? 42.253  -3.878  -11.303 1.00 24.57 ? 161 SER B N     1 
ATOM   3860 C CA    . SER B 1 115 ? 41.859  -5.002  -10.472 1.00 26.10 ? 161 SER B CA    1 
ATOM   3861 C C     . SER B 1 115 ? 41.843  -4.543  -9.024  1.00 26.61 ? 161 SER B C     1 
ATOM   3862 O O     . SER B 1 115 ? 41.118  -5.110  -8.215  1.00 27.94 ? 161 SER B O     1 
ATOM   3863 C CB    . SER B 1 115 ? 42.845  -6.194  -10.610 1.00 23.98 ? 161 SER B CB    1 
ATOM   3864 O OG    . SER B 1 115 ? 44.171  -5.812  -10.241 1.00 26.33 ? 161 SER B OG    1 
ATOM   3865 N N     . ALA B 1 116 ? 42.694  -3.574  -8.682  1.00 27.13 ? 162 ALA B N     1 
ATOM   3866 C CA    . ALA B 1 116 ? 42.775  -3.141  -7.303  1.00 28.20 ? 162 ALA B CA    1 
ATOM   3867 C C     . ALA B 1 116 ? 41.388  -2.641  -6.889  1.00 28.96 ? 162 ALA B C     1 
ATOM   3868 O O     . ALA B 1 116 ? 40.902  -2.948  -5.796  1.00 29.44 ? 162 ALA B O     1 
ATOM   3869 C CB    . ALA B 1 116 ? 43.847  -2.069  -7.125  1.00 27.11 ? 162 ALA B CB    1 
ATOM   3870 N N     . ILE B 1 117 ? 40.751  -1.913  -7.804  1.00 29.81 ? 163 ILE B N     1 
ATOM   3871 C CA    . ILE B 1 117 ? 39.410  -1.352  -7.590  1.00 30.39 ? 163 ILE B CA    1 
ATOM   3872 C C     . ILE B 1 117 ? 38.393  -2.431  -7.748  1.00 30.04 ? 163 ILE B C     1 
ATOM   3873 O O     . ILE B 1 117 ? 37.484  -2.544  -6.911  1.00 30.06 ? 163 ILE B O     1 
ATOM   3874 C CB    . ILE B 1 117 ? 39.088  -0.219  -8.584  1.00 30.30 ? 163 ILE B CB    1 
ATOM   3875 C CG1   . ILE B 1 117 ? 40.127  0.901   -8.476  1.00 31.46 ? 163 ILE B CG1   1 
ATOM   3876 C CG2   . ILE B 1 117 ? 37.685  0.301   -8.361  1.00 31.85 ? 163 ILE B CG2   1 
ATOM   3877 C CD1   . ILE B 1 117 ? 39.705  2.235   -9.186  1.00 31.24 ? 163 ILE B CD1   1 
ATOM   3878 N N     . GLY B 1 118 ? 38.524  -3.252  -8.804  1.00 29.17 ? 164 GLY B N     1 
ATOM   3879 C CA    . GLY B 1 118 ? 37.542  -4.324  -9.010  1.00 28.45 ? 164 GLY B CA    1 
ATOM   3880 C C     . GLY B 1 118 ? 37.522  -5.396  -7.940  1.00 28.51 ? 164 GLY B C     1 
ATOM   3881 O O     . GLY B 1 118 ? 36.463  -5.909  -7.572  1.00 28.17 ? 164 GLY B O     1 
ATOM   3882 N N     . ILE B 1 119 ? 38.710  -5.774  -7.479  1.00 28.79 ? 165 ILE B N     1 
ATOM   3883 C CA    . ILE B 1 119 ? 38.866  -6.777  -6.397  1.00 29.43 ? 165 ILE B CA    1 
ATOM   3884 C C     . ILE B 1 119 ? 38.319  -6.260  -5.041  1.00 30.08 ? 165 ILE B C     1 
ATOM   3885 O O     . ILE B 1 119 ? 37.659  -6.994  -4.297  1.00 30.68 ? 165 ILE B O     1 
ATOM   3886 C CB    . ILE B 1 119 ? 40.362  -7.224  -6.252  1.00 28.83 ? 165 ILE B CB    1 
ATOM   3887 C CG1   . ILE B 1 119 ? 40.707  -8.193  -7.396  1.00 26.74 ? 165 ILE B CG1   1 
ATOM   3888 C CG2   . ILE B 1 119 ? 40.621  -7.881  -4.864  1.00 28.88 ? 165 ILE B CG2   1 
ATOM   3889 C CD1   . ILE B 1 119 ? 42.134  -8.287  -7.707  1.00 21.55 ? 165 ILE B CD1   1 
ATOM   3890 N N     . ASP B 1 120 ? 38.573  -4.998  -4.748  1.00 30.29 ? 166 ASP B N     1 
ATOM   3891 C CA    . ASP B 1 120 ? 38.033  -4.380  -3.572  1.00 31.15 ? 166 ASP B CA    1 
ATOM   3892 C C     . ASP B 1 120 ? 36.491  -4.319  -3.586  1.00 31.05 ? 166 ASP B C     1 
ATOM   3893 O O     . ASP B 1 120 ? 35.874  -4.656  -2.610  1.00 32.16 ? 166 ASP B O     1 
ATOM   3894 C CB    . ASP B 1 120 ? 38.657  -2.993  -3.317  1.00 31.03 ? 166 ASP B CB    1 
ATOM   3895 C CG    . ASP B 1 120 ? 38.331  -2.480  -1.909  1.00 34.37 ? 166 ASP B CG    1 
ATOM   3896 O OD1   . ASP B 1 120 ? 38.737  -3.146  -0.925  1.00 34.84 ? 166 ASP B OD1   1 
ATOM   3897 O OD2   . ASP B 1 120 ? 37.608  -1.460  -1.793  1.00 38.21 ? 166 ASP B OD2   1 
ATOM   3898 N N     . LEU B 1 121 ? 35.874  -3.948  -4.694  1.00 31.48 ? 167 LEU B N     1 
ATOM   3899 C CA    . LEU B 1 121 ? 34.413  -3.936  -4.822  1.00 31.07 ? 167 LEU B CA    1 
ATOM   3900 C C     . LEU B 1 121 ? 33.803  -5.332  -4.699  1.00 32.13 ? 167 LEU B C     1 
ATOM   3901 O O     . LEU B 1 121 ? 32.765  -5.530  -4.006  1.00 31.09 ? 167 LEU B O     1 
ATOM   3902 C CB    . LEU B 1 121 ? 33.983  -3.267  -6.121  1.00 31.50 ? 167 LEU B CB    1 
ATOM   3903 C CG    . LEU B 1 121 ? 34.245  -1.766  -6.331  1.00 31.41 ? 167 LEU B CG    1 
ATOM   3904 C CD1   . LEU B 1 121 ? 34.039  -1.365  -7.779  1.00 30.23 ? 167 LEU B CD1   1 
ATOM   3905 C CD2   . LEU B 1 121 ? 33.355  -0.891  -5.434  1.00 33.46 ? 167 LEU B CD2   1 
ATOM   3906 N N     . ALA B 1 122 ? 34.470  -6.311  -5.322  1.00 32.14 ? 168 ALA B N     1 
ATOM   3907 C CA    . ALA B 1 122 ? 34.010  -7.689  -5.271  1.00 31.61 ? 168 ALA B CA    1 
ATOM   3908 C C     . ALA B 1 122 ? 34.097  -8.207  -3.843  1.00 32.29 ? 168 ALA B C     1 
ATOM   3909 O O     . ALA B 1 122 ? 33.189  -8.898  -3.382  1.00 32.65 ? 168 ALA B O     1 
ATOM   3910 C CB    . ALA B 1 122 ? 34.820  -8.537  -6.187  1.00 32.01 ? 168 ALA B CB    1 
ATOM   3911 N N     . SER B 1 123 ? 35.179  -7.868  -3.137  1.00 31.94 ? 169 SER B N     1 
ATOM   3912 C CA    . SER B 1 123 ? 35.375  -8.348  -1.759  1.00 31.77 ? 169 SER B CA    1 
ATOM   3913 C C     . SER B 1 123 ? 34.345  -7.736  -0.767  1.00 31.94 ? 169 SER B C     1 
ATOM   3914 O O     . SER B 1 123 ? 34.240  -8.191  0.335   1.00 31.44 ? 169 SER B O     1 
ATOM   3915 C CB    . SER B 1 123 ? 36.808  -8.077  -1.270  1.00 31.18 ? 169 SER B CB    1 
ATOM   3916 O OG    . SER B 1 123 ? 36.933  -6.729  -0.827  1.00 29.51 ? 169 SER B OG    1 
ATOM   3917 N N     . HIS B 1 124 ? 33.596  -6.724  -1.207  1.00 32.53 ? 170 HIS B N     1 
ATOM   3918 C CA    . HIS B 1 124 ? 32.428  -6.190  -0.520  1.00 32.90 ? 170 HIS B CA    1 
ATOM   3919 C C     . HIS B 1 124 ? 31.083  -6.663  -1.104  1.00 33.27 ? 170 HIS B C     1 
ATOM   3920 O O     . HIS B 1 124 ? 30.023  -6.141  -0.722  1.00 34.03 ? 170 HIS B O     1 
ATOM   3921 C CB    . HIS B 1 124 ? 32.474  -4.666  -0.554  1.00 32.57 ? 170 HIS B CB    1 
ATOM   3922 C CG    . HIS B 1 124 ? 33.511  -4.087  0.352   1.00 34.57 ? 170 HIS B CG    1 
ATOM   3923 N ND1   . HIS B 1 124 ? 34.688  -3.540  -0.113  1.00 34.42 ? 170 HIS B ND1   1 
ATOM   3924 C CD2   . HIS B 1 124 ? 33.566  -4.010  1.703   1.00 32.80 ? 170 HIS B CD2   1 
ATOM   3925 C CE1   . HIS B 1 124 ? 35.403  -3.116  0.915   1.00 36.52 ? 170 HIS B CE1   1 
ATOM   3926 N NE2   . HIS B 1 124 ? 34.752  -3.403  2.027   1.00 32.52 ? 170 HIS B NE2   1 
ATOM   3927 N N     . GLY B 1 125 ? 31.120  -7.609  -2.047  1.00 32.36 ? 171 GLY B N     1 
ATOM   3928 C CA    . GLY B 1 125 ? 29.895  -8.236  -2.553  1.00 31.50 ? 171 GLY B CA    1 
ATOM   3929 C C     . GLY B 1 125 ? 29.266  -7.616  -3.789  1.00 30.91 ? 171 GLY B C     1 
ATOM   3930 O O     . GLY B 1 125 ? 28.050  -7.692  -3.983  1.00 31.28 ? 171 GLY B O     1 
ATOM   3931 N N     . PHE B 1 126 ? 30.096  -7.000  -4.621  1.00 29.58 ? 172 PHE B N     1 
ATOM   3932 C CA    . PHE B 1 126 ? 29.710  -6.556  -5.948  1.00 28.09 ? 172 PHE B CA    1 
ATOM   3933 C C     . PHE B 1 126 ? 30.130  -7.600  -6.959  1.00 27.17 ? 172 PHE B C     1 
ATOM   3934 O O     . PHE B 1 126 ? 31.123  -8.293  -6.797  1.00 26.25 ? 172 PHE B O     1 
ATOM   3935 C CB    . PHE B 1 126 ? 30.387  -5.211  -6.288  1.00 27.85 ? 172 PHE B CB    1 
ATOM   3936 C CG    . PHE B 1 126 ? 29.780  -4.024  -5.577  1.00 27.74 ? 172 PHE B CG    1 
ATOM   3937 C CD1   . PHE B 1 126 ? 28.850  -3.237  -6.206  1.00 29.04 ? 172 PHE B CD1   1 
ATOM   3938 C CD2   . PHE B 1 126 ? 30.112  -3.734  -4.253  1.00 27.52 ? 172 PHE B CD2   1 
ATOM   3939 C CE1   . PHE B 1 126 ? 28.264  -2.169  -5.549  1.00 29.56 ? 172 PHE B CE1   1 
ATOM   3940 C CE2   . PHE B 1 126 ? 29.566  -2.673  -3.596  1.00 27.97 ? 172 PHE B CE2   1 
ATOM   3941 C CZ    . PHE B 1 126 ? 28.625  -1.880  -4.247  1.00 27.87 ? 172 PHE B CZ    1 
ATOM   3942 N N     . ILE B 1 127 ? 29.373  -7.716  -8.035  1.00 26.85 ? 173 ILE B N     1 
ATOM   3943 C CA    . ILE B 1 127 ? 29.974  -8.297  -9.235  1.00 25.23 ? 173 ILE B CA    1 
ATOM   3944 C C     . ILE B 1 127 ? 30.501  -7.088  -10.019 1.00 25.73 ? 173 ILE B C     1 
ATOM   3945 O O     . ILE B 1 127 ? 29.801  -6.053  -10.150 1.00 25.03 ? 173 ILE B O     1 
ATOM   3946 C CB    . ILE B 1 127 ? 29.022  -9.244  -10.029 1.00 25.33 ? 173 ILE B CB    1 
ATOM   3947 C CG1   . ILE B 1 127 ? 28.785  -10.531 -9.232  1.00 23.72 ? 173 ILE B CG1   1 
ATOM   3948 C CG2   . ILE B 1 127 ? 29.641  -9.605  -11.438 1.00 26.11 ? 173 ILE B CG2   1 
ATOM   3949 C CD1   . ILE B 1 127 ? 27.552  -11.448 -9.729  1.00 23.70 ? 173 ILE B CD1   1 
ATOM   3950 N N     . VAL B 1 128 ? 31.771  -7.178  -10.450 1.00 25.11 ? 174 VAL B N     1 
ATOM   3951 C CA    . VAL B 1 128 ? 32.380  -6.130  -11.279 1.00 23.86 ? 174 VAL B CA    1 
ATOM   3952 C C     . VAL B 1 128 ? 32.593  -6.678  -12.699 1.00 23.93 ? 174 VAL B C     1 
ATOM   3953 O O     . VAL B 1 128 ? 33.331  -7.618  -12.885 1.00 23.87 ? 174 VAL B O     1 
ATOM   3954 C CB    . VAL B 1 128 ? 33.733  -5.598  -10.666 1.00 23.95 ? 174 VAL B CB    1 
ATOM   3955 C CG1   . VAL B 1 128 ? 34.291  -4.380  -11.436 1.00 24.43 ? 174 VAL B CG1   1 
ATOM   3956 C CG2   . VAL B 1 128 ? 33.579  -5.253  -9.197  1.00 21.72 ? 174 VAL B CG2   1 
ATOM   3957 N N     . ALA B 1 129 ? 31.931  -6.107  -13.697 1.00 23.11 ? 175 ALA B N     1 
ATOM   3958 C CA    . ALA B 1 129 ? 32.251  -6.412  -15.096 1.00 22.05 ? 175 ALA B CA    1 
ATOM   3959 C C     . ALA B 1 129 ? 33.188  -5.321  -15.740 1.00 22.67 ? 175 ALA B C     1 
ATOM   3960 O O     . ALA B 1 129 ? 32.703  -4.261  -16.243 1.00 21.12 ? 175 ALA B O     1 
ATOM   3961 C CB    . ALA B 1 129 ? 30.961  -6.595  -15.921 1.00 20.85 ? 175 ALA B CB    1 
ATOM   3962 N N     . ALA B 1 130 ? 34.508  -5.581  -15.737 1.00 21.68 ? 176 ALA B N     1 
ATOM   3963 C CA    . ALA B 1 130 ? 35.462  -4.647  -16.360 1.00 22.08 ? 176 ALA B CA    1 
ATOM   3964 C C     . ALA B 1 130 ? 35.543  -4.910  -17.855 1.00 22.48 ? 176 ALA B C     1 
ATOM   3965 O O     . ALA B 1 130 ? 36.073  -5.927  -18.302 1.00 23.99 ? 176 ALA B O     1 
ATOM   3966 C CB    . ALA B 1 130 ? 36.888  -4.724  -15.701 1.00 19.97 ? 176 ALA B CB    1 
ATOM   3967 N N     . VAL B 1 131 ? 35.032  -3.973  -18.623 1.00 23.85 ? 177 VAL B N     1 
ATOM   3968 C CA    . VAL B 1 131 ? 34.855  -4.118  -20.056 1.00 24.49 ? 177 VAL B CA    1 
ATOM   3969 C C     . VAL B 1 131 ? 36.193  -3.818  -20.732 1.00 25.00 ? 177 VAL B C     1 
ATOM   3970 O O     . VAL B 1 131 ? 36.955  -2.950  -20.296 1.00 26.34 ? 177 VAL B O     1 
ATOM   3971 C CB    . VAL B 1 131 ? 33.644  -3.198  -20.591 1.00 25.04 ? 177 VAL B CB    1 
ATOM   3972 C CG1   . VAL B 1 131 ? 33.785  -2.875  -22.053 1.00 26.33 ? 177 VAL B CG1   1 
ATOM   3973 C CG2   . VAL B 1 131 ? 32.222  -3.850  -20.322 1.00 22.23 ? 177 VAL B CG2   1 
ATOM   3974 N N     . GLU B 1 132 ? 36.501  -4.579  -21.773 1.00 24.71 ? 178 GLU B N     1 
ATOM   3975 C CA    . GLU B 1 132 ? 37.578  -4.204  -22.691 1.00 23.42 ? 178 GLU B CA    1 
ATOM   3976 C C     . GLU B 1 132 ? 37.012  -3.552  -23.946 1.00 22.67 ? 178 GLU B C     1 
ATOM   3977 O O     . GLU B 1 132 ? 36.309  -4.171  -24.742 1.00 23.55 ? 178 GLU B O     1 
ATOM   3978 C CB    . GLU B 1 132 ? 38.442  -5.399  -23.050 1.00 23.28 ? 178 GLU B CB    1 
ATOM   3979 C CG    . GLU B 1 132 ? 39.752  -4.989  -23.724 1.00 24.00 ? 178 GLU B CG    1 
ATOM   3980 C CD    . GLU B 1 132 ? 40.854  -6.029  -23.564 1.00 22.20 ? 178 GLU B CD    1 
ATOM   3981 O OE1   . GLU B 1 132 ? 41.224  -6.705  -24.537 1.00 24.40 ? 178 GLU B OE1   1 
ATOM   3982 O OE2   . GLU B 1 132 ? 41.381  -6.147  -22.459 1.00 23.60 ? 178 GLU B OE2   1 
ATOM   3983 N N     . HIS B 1 133 ? 37.356  -2.306  -24.171 1.00 21.70 ? 179 HIS B N     1 
ATOM   3984 C CA    . HIS B 1 133 ? 36.830  -1.668  -25.347 1.00 21.53 ? 179 HIS B CA    1 
ATOM   3985 C C     . HIS B 1 133 ? 37.500  -2.048  -26.648 1.00 20.57 ? 179 HIS B C     1 
ATOM   3986 O O     . HIS B 1 133 ? 38.665  -2.333  -26.684 1.00 20.89 ? 179 HIS B O     1 
ATOM   3987 C CB    . HIS B 1 133 ? 36.760  -0.171  -25.156 1.00 20.75 ? 179 HIS B CB    1 
ATOM   3988 C CG    . HIS B 1 133 ? 35.952  0.238   -23.962 1.00 21.49 ? 179 HIS B CG    1 
ATOM   3989 N ND1   . HIS B 1 133 ? 34.573  0.183   -23.941 1.00 22.74 ? 179 HIS B ND1   1 
ATOM   3990 C CD2   . HIS B 1 133 ? 36.327  0.771   -22.772 1.00 18.30 ? 179 HIS B CD2   1 
ATOM   3991 C CE1   . HIS B 1 133 ? 34.134  0.684   -22.798 1.00 19.93 ? 179 HIS B CE1   1 
ATOM   3992 N NE2   . HIS B 1 133 ? 35.178  1.038   -22.069 1.00 18.81 ? 179 HIS B NE2   1 
ATOM   3993 N N     . ARG B 1 134 ? 36.718  -2.014  -27.721 1.00 21.96 ? 180 ARG B N     1 
ATOM   3994 C CA    . ARG B 1 134 ? 37.151  -2.339  -29.078 1.00 22.23 ? 180 ARG B CA    1 
ATOM   3995 C C     . ARG B 1 134 ? 37.081  -1.076  -29.952 1.00 24.28 ? 180 ARG B C     1 
ATOM   3996 O O     . ARG B 1 134 ? 37.153  -1.159  -31.207 1.00 25.78 ? 180 ARG B O     1 
ATOM   3997 C CB    . ARG B 1 134 ? 36.261  -3.463  -29.643 1.00 21.98 ? 180 ARG B CB    1 
ATOM   3998 C CG    . ARG B 1 134 ? 36.891  -4.885  -29.485 1.00 21.89 ? 180 ARG B CG    1 
ATOM   3999 C CD    . ARG B 1 134 ? 36.982  -5.342  -27.999 1.00 21.92 ? 180 ARG B CD    1 
ATOM   4000 N NE    . ARG B 1 134 ? 37.242  -6.755  -28.026 1.00 24.61 ? 180 ARG B NE    1 
ATOM   4001 C CZ    . ARG B 1 134 ? 36.294  -7.683  -28.110 1.00 22.56 ? 180 ARG B CZ    1 
ATOM   4002 N NH1   . ARG B 1 134 ? 35.017  -7.324  -28.067 1.00 20.15 ? 180 ARG B NH1   1 
ATOM   4003 N NH2   . ARG B 1 134 ? 36.641  -8.958  -28.225 1.00 17.92 ? 180 ARG B NH2   1 
ATOM   4004 N N     . ASP B 1 135 ? 36.908  0.083   -29.293 1.00 24.13 ? 181 ASP B N     1 
ATOM   4005 C CA    . ASP B 1 135 ? 36.876  1.404   -29.936 1.00 24.57 ? 181 ASP B CA    1 
ATOM   4006 C C     . ASP B 1 135 ? 38.235  1.887   -30.448 1.00 25.29 ? 181 ASP B C     1 
ATOM   4007 O O     . ASP B 1 135 ? 38.337  3.003   -30.914 1.00 24.55 ? 181 ASP B O     1 
ATOM   4008 C CB    . ASP B 1 135 ? 36.253  2.465   -28.996 1.00 23.65 ? 181 ASP B CB    1 
ATOM   4009 C CG    . ASP B 1 135 ? 37.160  2.841   -27.826 1.00 23.39 ? 181 ASP B CG    1 
ATOM   4010 O OD1   . ASP B 1 135 ? 37.994  2.038   -27.387 1.00 19.96 ? 181 ASP B OD1   1 
ATOM   4011 O OD2   . ASP B 1 135 ? 37.019  3.948   -27.284 1.00 23.97 ? 181 ASP B OD2   1 
ATOM   4012 N N     . ARG B 1 136 ? 39.274  1.045   -30.346 1.00 26.76 ? 182 ARG B N     1 
ATOM   4013 C CA    . ARG B 1 136 ? 40.667  1.390   -30.733 1.00 27.66 ? 182 ARG B CA    1 
ATOM   4014 C C     . ARG B 1 136 ? 41.346  2.421   -29.768 1.00 27.18 ? 182 ARG B C     1 
ATOM   4015 O O     . ARG B 1 136 ? 42.338  3.063   -30.132 1.00 27.96 ? 182 ARG B O     1 
ATOM   4016 C CB    . ARG B 1 136 ? 40.771  1.655   -32.287 1.00 26.94 ? 182 ARG B CB    1 
ATOM   4017 C CG    . ARG B 1 136 ? 40.592  0.289   -33.150 1.00 27.94 ? 182 ARG B CG    1 
ATOM   4018 C CD    . ARG B 1 136 ? 40.657  0.388   -34.789 1.00 34.50 ? 182 ARG B CD    1 
ATOM   4019 N NE    . ARG B 1 136 ? 41.890  -0.093  -35.485 1.00 32.94 ? 182 ARG B NE    1 
ATOM   4020 C CZ    . ARG B 1 136 ? 42.991  -0.341  -34.796 1.00 34.53 ? 182 ARG B CZ    1 
ATOM   4021 N NH1   . ARG B 1 136 ? 42.931  -0.217  -33.474 1.00 35.30 ? 182 ARG B NH1   1 
ATOM   4022 N NH2   . ARG B 1 136 ? 44.110  -0.721  -35.366 1.00 31.77 ? 182 ARG B NH2   1 
ATOM   4023 N N     . SER B 1 137 ? 40.801  2.573   -28.543 1.00 26.75 ? 183 SER B N     1 
ATOM   4024 C CA    . SER B 1 137 ? 41.420  3.324   -27.416 1.00 27.38 ? 183 SER B CA    1 
ATOM   4025 C C     . SER B 1 137 ? 42.175  2.457   -26.394 1.00 27.50 ? 183 SER B C     1 
ATOM   4026 O O     . SER B 1 137 ? 42.942  2.971   -25.581 1.00 26.56 ? 183 SER B O     1 
ATOM   4027 C CB    . SER B 1 137 ? 40.376  4.071   -26.593 1.00 28.13 ? 183 SER B CB    1 
ATOM   4028 O OG    . SER B 1 137 ? 39.632  3.157   -25.795 1.00 29.11 ? 183 SER B OG    1 
ATOM   4029 N N     . ALA B 1 138 ? 41.889  1.157   -26.368 1.00 26.52 ? 184 ALA B N     1 
ATOM   4030 C CA    . ALA B 1 138 ? 42.691  0.211   -25.632 1.00 26.12 ? 184 ALA B CA    1 
ATOM   4031 C C     . ALA B 1 138 ? 44.094  0.174   -26.319 1.00 27.26 ? 184 ALA B C     1 
ATOM   4032 O O     . ALA B 1 138 ? 44.178  0.232   -27.560 1.00 27.17 ? 184 ALA B O     1 
ATOM   4033 C CB    . ALA B 1 138 ? 42.013  -1.149  -25.726 1.00 25.16 ? 184 ALA B CB    1 
ATOM   4034 N N     . SER B 1 139 ? 45.171  0.121   -25.539 1.00 26.69 ? 185 SER B N     1 
ATOM   4035 C CA    . SER B 1 139 ? 46.516  -0.143  -26.081 1.00 27.33 ? 185 SER B CA    1 
ATOM   4036 C C     . SER B 1 139 ? 46.495  -1.364  -27.002 1.00 27.38 ? 185 SER B C     1 
ATOM   4037 O O     . SER B 1 139 ? 47.176  -1.366  -28.025 1.00 26.85 ? 185 SER B O     1 
ATOM   4038 C CB    . SER B 1 139 ? 47.472  -0.503  -24.950 1.00 27.28 ? 185 SER B CB    1 
ATOM   4039 O OG    . SER B 1 139 ? 47.856  0.643   -24.270 1.00 28.75 ? 185 SER B OG    1 
ATOM   4040 N N     . ALA B 1 140 ? 45.739  -2.404  -26.586 1.00 25.98 ? 186 ALA B N     1 
ATOM   4041 C CA    . ALA B 1 140 ? 45.490  -3.587  -27.402 1.00 24.50 ? 186 ALA B CA    1 
ATOM   4042 C C     . ALA B 1 140 ? 44.203  -4.257  -26.937 1.00 24.72 ? 186 ALA B C     1 
ATOM   4043 O O     . ALA B 1 140 ? 43.803  -4.150  -25.783 1.00 24.25 ? 186 ALA B O     1 
ATOM   4044 C CB    . ALA B 1 140 ? 46.665  -4.557  -27.308 1.00 23.97 ? 186 ALA B CB    1 
ATOM   4045 N N     . THR B 1 141 ? 43.541  -4.940  -27.849 1.00 24.64 ? 187 THR B N     1 
ATOM   4046 C CA    . THR B 1 141 ? 42.528  -5.892  -27.478 1.00 25.15 ? 187 THR B CA    1 
ATOM   4047 C C     . THR B 1 141 ? 42.506  -6.970  -28.567 1.00 26.10 ? 187 THR B C     1 
ATOM   4048 O O     . THR B 1 141 ? 43.252  -6.886  -29.525 1.00 27.32 ? 187 THR B O     1 
ATOM   4049 C CB    . THR B 1 141 ? 41.135  -5.221  -27.260 1.00 24.93 ? 187 THR B CB    1 
ATOM   4050 O OG1   . THR B 1 141 ? 40.190  -6.223  -26.866 1.00 26.23 ? 187 THR B OG1   1 
ATOM   4051 C CG2   . THR B 1 141 ? 40.649  -4.520  -28.500 1.00 20.49 ? 187 THR B CG2   1 
ATOM   4052 N N     . TYR B 1 142 ? 41.680  -7.996  -28.432 1.00 26.91 ? 188 TYR B N     1 
ATOM   4053 C CA    . TYR B 1 142 ? 41.591  -8.972  -29.505 1.00 25.97 ? 188 TYR B CA    1 
ATOM   4054 C C     . TYR B 1 142 ? 40.203  -9.497  -29.651 1.00 26.61 ? 188 TYR B C     1 
ATOM   4055 O O     . TYR B 1 142 ? 39.335  -9.263  -28.806 1.00 26.37 ? 188 TYR B O     1 
ATOM   4056 C CB    . TYR B 1 142 ? 42.580  -10.110 -29.309 1.00 25.45 ? 188 TYR B CB    1 
ATOM   4057 C CG    . TYR B 1 142 ? 42.394  -10.951 -28.042 1.00 26.03 ? 188 TYR B CG    1 
ATOM   4058 C CD1   . TYR B 1 142 ? 41.707  -12.158 -28.078 1.00 27.00 ? 188 TYR B CD1   1 
ATOM   4059 C CD2   . TYR B 1 142 ? 42.919  -10.534 -26.804 1.00 28.23 ? 188 TYR B CD2   1 
ATOM   4060 C CE1   . TYR B 1 142 ? 41.569  -12.952 -26.922 1.00 29.01 ? 188 TYR B CE1   1 
ATOM   4061 C CE2   . TYR B 1 142 ? 42.784  -11.309 -25.652 1.00 25.76 ? 188 TYR B CE2   1 
ATOM   4062 C CZ    . TYR B 1 142 ? 42.109  -12.527 -25.718 1.00 27.15 ? 188 TYR B CZ    1 
ATOM   4063 O OH    . TYR B 1 142 ? 41.951  -13.330 -24.586 1.00 24.99 ? 188 TYR B OH    1 
ATOM   4064 N N     . TYR B 1 143 ? 40.002  -10.186 -30.775 1.00 28.10 ? 189 TYR B N     1 
ATOM   4065 C CA    . TYR B 1 143 ? 38.796  -10.928 -31.068 1.00 28.39 ? 189 TYR B CA    1 
ATOM   4066 C C     . TYR B 1 143 ? 39.211  -12.128 -31.954 1.00 29.12 ? 189 TYR B C     1 
ATOM   4067 O O     . TYR B 1 143 ? 40.409  -12.366 -32.208 1.00 27.38 ? 189 TYR B O     1 
ATOM   4068 C CB    . TYR B 1 143 ? 37.780  -10.010 -31.765 1.00 28.61 ? 189 TYR B CB    1 
ATOM   4069 C CG    . TYR B 1 143 ? 38.233  -9.552  -33.134 1.00 28.94 ? 189 TYR B CG    1 
ATOM   4070 C CD1   . TYR B 1 143 ? 37.641  -10.053 -34.291 1.00 28.88 ? 189 TYR B CD1   1 
ATOM   4071 C CD2   . TYR B 1 143 ? 39.299  -8.667  -33.273 1.00 31.35 ? 189 TYR B CD2   1 
ATOM   4072 C CE1   . TYR B 1 143 ? 38.089  -9.672  -35.531 1.00 30.96 ? 189 TYR B CE1   1 
ATOM   4073 C CE2   . TYR B 1 143 ? 39.777  -8.284  -34.544 1.00 29.88 ? 189 TYR B CE2   1 
ATOM   4074 C CZ    . TYR B 1 143 ? 39.154  -8.774  -35.644 1.00 30.53 ? 189 TYR B CZ    1 
ATOM   4075 O OH    . TYR B 1 143 ? 39.608  -8.399  -36.886 1.00 33.65 ? 189 TYR B OH    1 
ATOM   4076 N N     . PHE B 1 144 ? 38.208  -12.856 -32.430 1.00 29.71 ? 190 PHE B N     1 
ATOM   4077 C CA    . PHE B 1 144 ? 38.434  -13.958 -33.344 1.00 31.42 ? 190 PHE B CA    1 
ATOM   4078 C C     . PHE B 1 144 ? 37.678  -13.716 -34.654 1.00 32.87 ? 190 PHE B C     1 
ATOM   4079 O O     . PHE B 1 144 ? 36.526  -13.190 -34.662 1.00 32.93 ? 190 PHE B O     1 
ATOM   4080 C CB    . PHE B 1 144 ? 38.056  -15.286 -32.689 1.00 30.58 ? 190 PHE B CB    1 
ATOM   4081 C CG    . PHE B 1 144 ? 38.791  -15.543 -31.397 1.00 31.56 ? 190 PHE B CG    1 
ATOM   4082 C CD1   . PHE B 1 144 ? 40.082  -16.036 -31.405 1.00 29.41 ? 190 PHE B CD1   1 
ATOM   4083 C CD2   . PHE B 1 144 ? 38.182  -15.263 -30.165 1.00 30.72 ? 190 PHE B CD2   1 
ATOM   4084 C CE1   . PHE B 1 144 ? 40.761  -16.269 -30.196 1.00 30.98 ? 190 PHE B CE1   1 
ATOM   4085 C CE2   . PHE B 1 144 ? 38.843  -15.487 -28.976 1.00 28.37 ? 190 PHE B CE2   1 
ATOM   4086 C CZ    . PHE B 1 144 ? 40.122  -15.997 -28.983 1.00 29.87 ? 190 PHE B CZ    1 
ATOM   4087 N N     . LYS B 1 145 ? 38.351  -14.063 -35.752 1.00 34.41 ? 191 LYS B N     1 
ATOM   4088 C CA    . LYS B 1 145 ? 37.813  -13.833 -37.102 1.00 36.61 ? 191 LYS B CA    1 
ATOM   4089 C C     . LYS B 1 145 ? 36.578  -14.643 -37.408 1.00 38.11 ? 191 LYS B C     1 
ATOM   4090 O O     . LYS B 1 145 ? 35.714  -14.171 -38.129 1.00 39.46 ? 191 LYS B O     1 
ATOM   4091 C CB    . LYS B 1 145 ? 38.885  -14.029 -38.182 1.00 37.02 ? 191 LYS B CB    1 
ATOM   4092 C CG    . LYS B 1 145 ? 39.258  -12.705 -38.827 1.00 34.86 ? 191 LYS B CG    1 
ATOM   4093 C CD    . LYS B 1 145 ? 40.700  -12.557 -38.942 1.00 38.14 ? 191 LYS B CD    1 
ATOM   4094 C CE    . LYS B 1 145 ? 41.014  -11.128 -39.312 1.00 41.49 ? 191 LYS B CE    1 
ATOM   4095 N NZ    . LYS B 1 145 ? 42.405  -11.033 -39.826 1.00 44.44 ? 191 LYS B NZ    1 
ATOM   4096 N N     . ASP B 1 146 ? 36.495  -15.824 -36.800 1.00 39.94 ? 192 ASP B N     1 
ATOM   4097 C CA    . ASP B 1 146 ? 35.407  -16.796 -36.963 1.00 42.22 ? 192 ASP B CA    1 
ATOM   4098 C C     . ASP B 1 146 ? 35.558  -17.828 -35.844 1.00 42.83 ? 192 ASP B C     1 
ATOM   4099 O O     . ASP B 1 146 ? 36.475  -17.718 -35.019 1.00 42.83 ? 192 ASP B O     1 
ATOM   4100 C CB    . ASP B 1 146 ? 35.492  -17.506 -38.314 1.00 42.34 ? 192 ASP B CB    1 
ATOM   4101 C CG    . ASP B 1 146 ? 36.869  -18.041 -38.595 1.00 45.26 ? 192 ASP B CG    1 
ATOM   4102 O OD1   . ASP B 1 146 ? 37.439  -18.780 -37.755 1.00 50.08 ? 192 ASP B OD1   1 
ATOM   4103 O OD2   . ASP B 1 146 ? 37.421  -17.695 -39.653 1.00 50.25 ? 192 ASP B OD2   1 
ATOM   4104 N N     . GLN B 1 147 ? 34.688  -18.837 -35.841 1.00 43.83 ? 193 GLN B N     1 
ATOM   4105 C CA    . GLN B 1 147 ? 34.653  -19.843 -34.772 1.00 45.54 ? 193 GLN B CA    1 
ATOM   4106 C C     . GLN B 1 147 ? 35.912  -20.755 -34.704 1.00 45.54 ? 193 GLN B C     1 
ATOM   4107 O O     . GLN B 1 147 ? 36.388  -21.100 -33.603 1.00 45.12 ? 193 GLN B O     1 
ATOM   4108 C CB    . GLN B 1 147 ? 33.387  -20.686 -34.917 1.00 46.27 ? 193 GLN B CB    1 
ATOM   4109 C CG    . GLN B 1 147 ? 32.958  -21.436 -33.668 1.00 48.85 ? 193 GLN B CG    1 
ATOM   4110 C CD    . GLN B 1 147 ? 32.139  -20.558 -32.731 1.00 56.22 ? 193 GLN B CD    1 
ATOM   4111 O OE1   . GLN B 1 147 ? 31.089  -19.994 -33.134 1.00 57.47 ? 193 GLN B OE1   1 
ATOM   4112 N NE2   . GLN B 1 147 ? 32.614  -20.420 -31.464 1.00 55.53 ? 193 GLN B NE2   1 
ATOM   4113 N N     . SER B 1 148 ? 36.425  -21.130 -35.886 1.00 44.97 ? 194 SER B N     1 
ATOM   4114 C CA    . SER B 1 148 ? 37.600  -21.992 -36.049 1.00 43.47 ? 194 SER B CA    1 
ATOM   4115 C C     . SER B 1 148 ? 38.853  -21.329 -35.538 1.00 42.68 ? 194 SER B C     1 
ATOM   4116 O O     . SER B 1 148 ? 39.691  -21.976 -34.874 1.00 41.91 ? 194 SER B O     1 
ATOM   4117 C CB    . SER B 1 148 ? 37.770  -22.324 -37.514 1.00 44.28 ? 194 SER B CB    1 
ATOM   4118 O OG    . SER B 1 148 ? 36.727  -23.196 -37.897 1.00 45.10 ? 194 SER B OG    1 
ATOM   4119 N N     . ALA B 1 149 ? 38.954  -20.027 -35.835 1.00 41.22 ? 195 ALA B N     1 
ATOM   4120 C CA    . ALA B 1 149 ? 39.892  -19.113 -35.157 1.00 39.97 ? 195 ALA B CA    1 
ATOM   4121 C C     . ALA B 1 149 ? 39.784  -19.212 -33.643 1.00 38.73 ? 195 ALA B C     1 
ATOM   4122 O O     . ALA B 1 149 ? 40.786  -19.410 -32.990 1.00 38.08 ? 195 ALA B O     1 
ATOM   4123 C CB    . ALA B 1 149 ? 39.712  -17.636 -35.625 1.00 38.88 ? 195 ALA B CB    1 
ATOM   4124 N N     . ALA B 1 150 ? 38.570  -19.098 -33.104 1.00 39.30 ? 196 ALA B N     1 
ATOM   4125 C CA    . ALA B 1 150 ? 38.339  -19.164 -31.645 1.00 39.53 ? 196 ALA B CA    1 
ATOM   4126 C C     . ALA B 1 150 ? 38.740  -20.502 -31.050 1.00 40.34 ? 196 ALA B C     1 
ATOM   4127 O O     . ALA B 1 150 ? 39.350  -20.566 -29.971 1.00 40.30 ? 196 ALA B O     1 
ATOM   4128 C CB    . ALA B 1 150 ? 36.910  -18.830 -31.294 1.00 38.26 ? 196 ALA B CB    1 
ATOM   4129 N N     . GLU B 1 151 ? 38.423  -21.580 -31.759 1.00 41.80 ? 197 GLU B N     1 
ATOM   4130 C CA    . GLU B 1 151 ? 38.730  -22.942 -31.259 1.00 42.57 ? 197 GLU B CA    1 
ATOM   4131 C C     . GLU B 1 151 ? 40.220  -23.258 -31.230 1.00 42.52 ? 197 GLU B C     1 
ATOM   4132 O O     . GLU B 1 151 ? 40.661  -24.091 -30.451 1.00 42.96 ? 197 GLU B O     1 
ATOM   4133 C CB    . GLU B 1 151 ? 37.937  -23.982 -32.037 1.00 42.50 ? 197 GLU B CB    1 
ATOM   4134 C CG    . GLU B 1 151 ? 36.450  -23.827 -31.725 1.00 45.56 ? 197 GLU B CG    1 
ATOM   4135 C CD    . GLU B 1 151 ? 35.504  -24.546 -32.676 1.00 49.13 ? 197 GLU B CD    1 
ATOM   4136 O OE1   . GLU B 1 151 ? 34.309  -24.736 -32.296 1.00 51.61 ? 197 GLU B OE1   1 
ATOM   4137 O OE2   . GLU B 1 151 ? 35.939  -24.903 -33.789 1.00 50.21 ? 197 GLU B OE2   1 
ATOM   4138 N N     . ILE B 1 152 ? 40.993  -22.532 -32.032 1.00 42.41 ? 198 ILE B N     1 
ATOM   4139 C CA    . ILE B 1 152 ? 42.427  -22.779 -32.175 1.00 42.27 ? 198 ILE B CA    1 
ATOM   4140 C C     . ILE B 1 152 ? 43.208  -21.704 -31.399 1.00 41.13 ? 198 ILE B C     1 
ATOM   4141 O O     . ILE B 1 152 ? 44.436  -21.763 -31.295 1.00 39.93 ? 198 ILE B O     1 
ATOM   4142 C CB    . ILE B 1 152 ? 42.803  -23.012 -33.729 1.00 42.92 ? 198 ILE B CB    1 
ATOM   4143 C CG1   . ILE B 1 152 ? 43.403  -24.403 -33.948 1.00 44.39 ? 198 ILE B CG1   1 
ATOM   4144 C CG2   . ILE B 1 152 ? 43.668  -21.939 -34.363 1.00 42.98 ? 198 ILE B CG2   1 
ATOM   4145 C CD1   . ILE B 1 152 ? 42.461  -25.540 -33.610 1.00 44.34 ? 198 ILE B CD1   1 
ATOM   4146 N N     . GLY B 1 153 ? 42.448  -20.764 -30.812 1.00 40.07 ? 199 GLY B N     1 
ATOM   4147 C CA    . GLY B 1 153 ? 42.974  -19.625 -30.035 1.00 38.27 ? 199 GLY B CA    1 
ATOM   4148 C C     . GLY B 1 153 ? 43.754  -18.715 -30.954 1.00 38.15 ? 199 GLY B C     1 
ATOM   4149 O O     . GLY B 1 153 ? 44.777  -18.113 -30.570 1.00 38.21 ? 199 GLY B O     1 
ATOM   4150 N N     . ASP B 1 154 ? 43.310  -18.628 -32.198 1.00 37.09 ? 200 ASP B N     1 
ATOM   4151 C CA    . ASP B 1 154 ? 44.025  -17.801 -33.139 1.00 36.87 ? 200 ASP B CA    1 
ATOM   4152 C C     . ASP B 1 154 ? 43.451  -16.361 -33.154 1.00 35.42 ? 200 ASP B C     1 
ATOM   4153 O O     . ASP B 1 154 ? 42.539  -16.015 -33.941 1.00 36.44 ? 200 ASP B O     1 
ATOM   4154 C CB    . ASP B 1 154 ? 44.062  -18.435 -34.529 1.00 37.42 ? 200 ASP B CB    1 
ATOM   4155 C CG    . ASP B 1 154 ? 44.639  -17.503 -35.562 1.00 41.13 ? 200 ASP B CG    1 
ATOM   4156 O OD1   . ASP B 1 154 ? 45.625  -16.775 -35.247 1.00 43.92 ? 200 ASP B OD1   1 
ATOM   4157 O OD2   . ASP B 1 154 ? 44.086  -17.483 -36.682 1.00 46.21 ? 200 ASP B OD2   1 
ATOM   4158 N N     . LYS B 1 155 ? 44.056  -15.531 -32.305 1.00 32.55 ? 201 LYS B N     1 
ATOM   4159 C CA    . LYS B 1 155 ? 43.593  -14.189 -32.007 1.00 30.38 ? 201 LYS B CA    1 
ATOM   4160 C C     . LYS B 1 155 ? 43.956  -13.181 -33.080 1.00 29.20 ? 201 LYS B C     1 
ATOM   4161 O O     . LYS B 1 155 ? 45.090  -13.212 -33.619 1.00 28.92 ? 201 LYS B O     1 
ATOM   4162 C CB    . LYS B 1 155 ? 44.199  -13.716 -30.681 1.00 28.42 ? 201 LYS B CB    1 
ATOM   4163 C CG    . LYS B 1 155 ? 43.977  -14.602 -29.534 1.00 28.61 ? 201 LYS B CG    1 
ATOM   4164 C CD    . LYS B 1 155 ? 44.762  -14.040 -28.356 1.00 32.72 ? 201 LYS B CD    1 
ATOM   4165 C CE    . LYS B 1 155 ? 44.601  -14.855 -27.115 1.00 33.36 ? 201 LYS B CE    1 
ATOM   4166 N NZ    . LYS B 1 155 ? 45.647  -15.906 -27.005 1.00 36.98 ? 201 LYS B NZ    1 
ATOM   4167 N N     . SER B 1 156 ? 43.029  -12.258 -33.356 1.00 27.69 ? 202 SER B N     1 
ATOM   4168 C CA    . SER B 1 156 ? 43.347  -11.050 -34.141 1.00 27.57 ? 202 SER B CA    1 
ATOM   4169 C C     . SER B 1 156 ? 43.319  -9.888  -33.179 1.00 28.26 ? 202 SER B C     1 
ATOM   4170 O O     . SER B 1 156 ? 42.279  -9.597  -32.553 1.00 27.35 ? 202 SER B O     1 
ATOM   4171 C CB    . SER B 1 156 ? 42.343  -10.716 -35.233 1.00 26.77 ? 202 SER B CB    1 
ATOM   4172 O OG    . SER B 1 156 ? 41.831  -11.837 -35.899 1.00 32.09 ? 202 SER B OG    1 
ATOM   4173 N N     . TRP B 1 157 ? 44.462  -9.213  -33.122 1.00 28.94 ? 203 TRP B N     1 
ATOM   4174 C CA    . TRP B 1 157 ? 44.720  -8.079  -32.267 1.00 29.27 ? 203 TRP B CA    1 
ATOM   4175 C C     . TRP B 1 157 ? 44.420  -6.752  -32.960 1.00 30.24 ? 203 TRP B C     1 
ATOM   4176 O O     . TRP B 1 157 ? 44.513  -6.642  -34.181 1.00 28.78 ? 203 TRP B O     1 
ATOM   4177 C CB    . TRP B 1 157 ? 46.165  -8.117  -31.829 1.00 28.89 ? 203 TRP B CB    1 
ATOM   4178 C CG    . TRP B 1 157 ? 46.404  -9.247  -30.888 1.00 29.44 ? 203 TRP B CG    1 
ATOM   4179 C CD1   . TRP B 1 157 ? 46.819  -10.531 -31.202 1.00 28.71 ? 203 TRP B CD1   1 
ATOM   4180 C CD2   . TRP B 1 157 ? 46.253  -9.206  -29.462 1.00 28.08 ? 203 TRP B CD2   1 
ATOM   4181 N NE1   . TRP B 1 157 ? 46.901  -11.283 -30.044 1.00 28.33 ? 203 TRP B NE1   1 
ATOM   4182 C CE2   . TRP B 1 157 ? 46.567  -10.490 -28.969 1.00 28.39 ? 203 TRP B CE2   1 
ATOM   4183 C CE3   . TRP B 1 157 ? 45.870  -8.203  -28.554 1.00 30.02 ? 203 TRP B CE3   1 
ATOM   4184 C CZ2   . TRP B 1 157 ? 46.525  -10.792 -27.598 1.00 27.88 ? 203 TRP B CZ2   1 
ATOM   4185 C CZ3   . TRP B 1 157 ? 45.808  -8.514  -27.206 1.00 29.01 ? 203 TRP B CZ3   1 
ATOM   4186 C CH2   . TRP B 1 157 ? 46.132  -9.802  -26.751 1.00 27.79 ? 203 TRP B CH2   1 
ATOM   4187 N N     . LEU B 1 158 ? 44.025  -5.760  -32.146 1.00 30.41 ? 204 LEU B N     1 
ATOM   4188 C CA    . LEU B 1 158 ? 43.664  -4.412  -32.617 1.00 30.81 ? 204 LEU B CA    1 
ATOM   4189 C C     . LEU B 1 158 ? 44.315  -3.486  -31.617 1.00 30.51 ? 204 LEU B C     1 
ATOM   4190 O O     . LEU B 1 158 ? 44.062  -3.580  -30.402 1.00 31.85 ? 204 LEU B O     1 
ATOM   4191 C CB    . LEU B 1 158 ? 42.139  -4.219  -32.604 1.00 29.95 ? 204 LEU B CB    1 
ATOM   4192 C CG    . LEU B 1 158 ? 41.221  -4.214  -33.845 1.00 30.41 ? 204 LEU B CG    1 
ATOM   4193 C CD1   . LEU B 1 158 ? 41.860  -4.694  -35.173 1.00 31.60 ? 204 LEU B CD1   1 
ATOM   4194 C CD2   . LEU B 1 158 ? 39.914  -4.940  -33.529 1.00 30.24 ? 204 LEU B CD2   1 
ATOM   4195 N N     . TYR B 1 159 ? 45.185  -2.635  -32.124 1.00 30.01 ? 205 TYR B N     1 
ATOM   4196 C CA    . TYR B 1 159 ? 46.018  -1.772  -31.310 1.00 29.64 ? 205 TYR B CA    1 
ATOM   4197 C C     . TYR B 1 159 ? 45.451  -0.381  -31.275 1.00 29.00 ? 205 TYR B C     1 
ATOM   4198 O O     . TYR B 1 159 ? 44.663  -0.008  -32.127 1.00 26.54 ? 205 TYR B O     1 
ATOM   4199 C CB    . TYR B 1 159 ? 47.458  -1.728  -31.856 1.00 29.62 ? 205 TYR B CB    1 
ATOM   4200 C CG    . TYR B 1 159 ? 48.098  -3.073  -31.730 1.00 30.27 ? 205 TYR B CG    1 
ATOM   4201 C CD1   . TYR B 1 159 ? 48.544  -3.522  -30.499 1.00 27.63 ? 205 TYR B CD1   1 
ATOM   4202 C CD2   . TYR B 1 159 ? 48.187  -3.934  -32.842 1.00 28.25 ? 205 TYR B CD2   1 
ATOM   4203 C CE1   . TYR B 1 159 ? 49.119  -4.807  -30.375 1.00 32.07 ? 205 TYR B CE1   1 
ATOM   4204 C CE2   . TYR B 1 159 ? 48.745  -5.184  -32.734 1.00 28.42 ? 205 TYR B CE2   1 
ATOM   4205 C CZ    . TYR B 1 159 ? 49.220  -5.623  -31.486 1.00 29.96 ? 205 TYR B CZ    1 
ATOM   4206 O OH    . TYR B 1 159 ? 49.771  -6.888  -31.365 1.00 32.79 ? 205 TYR B OH    1 
ATOM   4207 N N     . LEU B 1 160 ? 45.860  0.355   -30.256 1.00 29.52 ? 206 LEU B N     1 
ATOM   4208 C CA    . LEU B 1 160 ? 45.525  1.729   -30.133 1.00 30.83 ? 206 LEU B CA    1 
ATOM   4209 C C     . LEU B 1 160 ? 45.710  2.416   -31.528 1.00 32.02 ? 206 LEU B C     1 
ATOM   4210 O O     . LEU B 1 160 ? 46.750  2.210   -32.222 1.00 29.54 ? 206 LEU B O     1 
ATOM   4211 C CB    . LEU B 1 160 ? 46.459  2.342   -29.096 1.00 29.71 ? 206 LEU B CB    1 
ATOM   4212 C CG    . LEU B 1 160 ? 46.278  3.823   -28.806 1.00 30.89 ? 206 LEU B CG    1 
ATOM   4213 C CD1   . LEU B 1 160 ? 45.292  4.031   -27.690 1.00 31.15 ? 206 LEU B CD1   1 
ATOM   4214 C CD2   . LEU B 1 160 ? 47.574  4.472   -28.459 1.00 30.15 ? 206 LEU B CD2   1 
ATOM   4215 N N     . ARG B 1 161 ? 44.701  3.203   -31.921 1.00 33.61 ? 207 ARG B N     1 
ATOM   4216 C CA    . ARG B 1 161 ? 44.831  4.194   -33.019 1.00 36.83 ? 207 ARG B CA    1 
ATOM   4217 C C     . ARG B 1 161 ? 45.377  5.497   -32.506 1.00 37.40 ? 207 ARG B C     1 
ATOM   4218 O O     . ARG B 1 161 ? 44.836  6.082   -31.580 1.00 38.00 ? 207 ARG B O     1 
ATOM   4219 C CB    . ARG B 1 161 ? 43.500  4.505   -33.689 1.00 37.78 ? 207 ARG B CB    1 
ATOM   4220 C CG    . ARG B 1 161 ? 43.062  3.466   -34.712 1.00 42.23 ? 207 ARG B CG    1 
ATOM   4221 C CD    . ARG B 1 161 ? 42.113  4.044   -35.745 1.00 47.42 ? 207 ARG B CD    1 
ATOM   4222 N NE    . ARG B 1 161 ? 42.820  4.617   -36.890 1.00 50.77 ? 207 ARG B NE    1 
ATOM   4223 C CZ    . ARG B 1 161 ? 42.826  5.906   -37.232 1.00 53.00 ? 207 ARG B CZ    1 
ATOM   4224 N NH1   . ARG B 1 161 ? 42.169  6.829   -36.537 1.00 53.90 ? 207 ARG B NH1   1 
ATOM   4225 N NH2   . ARG B 1 161 ? 43.499  6.271   -38.301 1.00 54.83 ? 207 ARG B NH2   1 
ATOM   4226 N N     . THR B 1 162 ? 46.457  5.966   -33.111 1.00 39.33 ? 208 THR B N     1 
ATOM   4227 C CA    . THR B 1 162 ? 46.983  7.277   -32.745 1.00 40.53 ? 208 THR B CA    1 
ATOM   4228 C C     . THR B 1 162 ? 46.300  8.263   -33.669 1.00 40.55 ? 208 THR B C     1 
ATOM   4229 O O     . THR B 1 162 ? 46.123  7.976   -34.819 1.00 39.83 ? 208 THR B O     1 
ATOM   4230 C CB    . THR B 1 162 ? 48.503  7.363   -32.896 1.00 40.17 ? 208 THR B CB    1 
ATOM   4231 O OG1   . THR B 1 162 ? 48.868  7.000   -34.235 1.00 42.95 ? 208 THR B OG1   1 
ATOM   4232 C CG2   . THR B 1 162 ? 49.153  6.423   -31.952 1.00 40.67 ? 208 THR B CG2   1 
ATOM   4233 N N     . LEU B 1 163 ? 45.911  9.420   -33.155 1.00 42.27 ? 209 LEU B N     1 
ATOM   4234 C CA    . LEU B 1 163 ? 45.118  10.358  -33.947 1.00 43.15 ? 209 LEU B CA    1 
ATOM   4235 C C     . LEU B 1 163 ? 45.961  11.553  -34.377 1.00 45.45 ? 209 LEU B C     1 
ATOM   4236 O O     . LEU B 1 163 ? 46.824  12.034  -33.607 1.00 45.28 ? 209 LEU B O     1 
ATOM   4237 C CB    . LEU B 1 163 ? 43.873  10.810  -33.150 1.00 41.58 ? 209 LEU B CB    1 
ATOM   4238 C CG    . LEU B 1 163 ? 42.985  9.679   -32.584 1.00 39.31 ? 209 LEU B CG    1 
ATOM   4239 C CD1   . LEU B 1 163 ? 41.770  10.249  -31.887 1.00 36.73 ? 209 LEU B CD1   1 
ATOM   4240 C CD2   . LEU B 1 163 ? 42.546  8.728   -33.672 1.00 37.81 ? 209 LEU B CD2   1 
ATOM   4241 N N     . LYS B 1 164 ? 45.706  12.030  -35.602 1.00 47.85 ? 210 LYS B N     1 
ATOM   4242 C CA    . LYS B 1 164 ? 46.189  13.363  -36.035 1.00 49.75 ? 210 LYS B CA    1 
ATOM   4243 C C     . LYS B 1 164 ? 45.293  14.352  -35.342 1.00 50.60 ? 210 LYS B C     1 
ATOM   4244 O O     . LYS B 1 164 ? 44.141  14.040  -35.055 1.00 51.00 ? 210 LYS B O     1 
ATOM   4245 C CB    . LYS B 1 164 ? 46.109  13.529  -37.553 1.00 49.99 ? 210 LYS B CB    1 
ATOM   4246 C CG    . LYS B 1 164 ? 47.148  12.702  -38.307 1.00 50.40 ? 210 LYS B CG    1 
ATOM   4247 C CD    . LYS B 1 164 ? 46.923  12.746  -39.814 1.00 51.81 ? 210 LYS B CD    1 
ATOM   4248 C CE    . LYS B 1 164 ? 45.655  12.006  -40.231 1.00 52.40 ? 210 LYS B CE    1 
ATOM   4249 N NZ    . LYS B 1 164 ? 45.755  11.620  -41.649 1.00 52.70 ? 210 LYS B NZ    1 
ATOM   4250 N N     . GLN B 1 165 ? 45.804  15.538  -35.038 1.00 51.98 ? 211 GLN B N     1 
ATOM   4251 C CA    . GLN B 1 165 ? 45.093  16.396  -34.079 1.00 52.27 ? 211 GLN B CA    1 
ATOM   4252 C C     . GLN B 1 165 ? 43.782  17.001  -34.613 1.00 52.00 ? 211 GLN B C     1 
ATOM   4253 O O     . GLN B 1 165 ? 42.869  17.236  -33.841 1.00 51.80 ? 211 GLN B O     1 
ATOM   4254 C CB    . GLN B 1 165 ? 46.050  17.420  -33.442 1.00 52.91 ? 211 GLN B CB    1 
ATOM   4255 C CG    . GLN B 1 165 ? 45.957  18.849  -33.930 1.00 54.52 ? 211 GLN B CG    1 
ATOM   4256 C CD    . GLN B 1 165 ? 45.374  19.762  -32.861 1.00 58.45 ? 211 GLN B CD    1 
ATOM   4257 O OE1   . GLN B 1 165 ? 45.988  19.963  -31.798 1.00 59.00 ? 211 GLN B OE1   1 
ATOM   4258 N NE2   . GLN B 1 165 ? 44.184  20.328  -33.132 1.00 58.21 ? 211 GLN B NE2   1 
ATOM   4259 N N     . GLU B 1 166 ? 43.671  17.201  -35.927 1.00 52.14 ? 212 GLU B N     1 
ATOM   4260 C CA    . GLU B 1 166 ? 42.459  17.818  -36.511 1.00 52.86 ? 212 GLU B CA    1 
ATOM   4261 C C     . GLU B 1 166 ? 41.201  16.892  -36.560 1.00 52.29 ? 212 GLU B C     1 
ATOM   4262 O O     . GLU B 1 166 ? 40.110  17.307  -36.978 1.00 51.70 ? 212 GLU B O     1 
ATOM   4263 C CB    . GLU B 1 166 ? 42.758  18.418  -37.895 1.00 53.26 ? 212 GLU B CB    1 
ATOM   4264 C CG    . GLU B 1 166 ? 42.242  17.609  -39.095 1.00 56.94 ? 212 GLU B CG    1 
ATOM   4265 C CD    . GLU B 1 166 ? 43.353  17.148  -40.000 1.00 61.72 ? 212 GLU B CD    1 
ATOM   4266 O OE1   . GLU B 1 166 ? 44.003  18.032  -40.611 1.00 65.54 ? 212 GLU B OE1   1 
ATOM   4267 O OE2   . GLU B 1 166 ? 43.571  15.920  -40.109 1.00 62.09 ? 212 GLU B OE2   1 
ATOM   4268 N N     . GLU B 1 167 ? 41.384  15.651  -36.126 1.00 51.41 ? 213 GLU B N     1 
ATOM   4269 C CA    . GLU B 1 167 ? 40.352  14.633  -36.180 1.00 50.59 ? 213 GLU B CA    1 
ATOM   4270 C C     . GLU B 1 167 ? 40.088  14.188  -34.746 1.00 49.96 ? 213 GLU B C     1 
ATOM   4271 O O     . GLU B 1 167 ? 39.245  13.349  -34.528 1.00 49.82 ? 213 GLU B O     1 
ATOM   4272 C CB    . GLU B 1 167 ? 40.819  13.448  -37.063 1.00 50.64 ? 213 GLU B CB    1 
ATOM   4273 C CG    . GLU B 1 167 ? 41.902  12.568  -36.413 1.00 49.27 ? 213 GLU B CG    1 
ATOM   4274 C CD    . GLU B 1 167 ? 42.602  11.560  -37.341 1.00 49.84 ? 213 GLU B CD    1 
ATOM   4275 O OE1   . GLU B 1 167 ? 43.620  11.016  -36.904 1.00 51.49 ? 213 GLU B OE1   1 
ATOM   4276 O OE2   . GLU B 1 167 ? 42.187  11.291  -38.482 1.00 47.97 ? 213 GLU B OE2   1 
ATOM   4277 N N     . GLU B 1 168 ? 40.831  14.754  -33.787 1.00 48.90 ? 214 GLU B N     1 
ATOM   4278 C CA    . GLU B 1 168 ? 40.716  14.394  -32.378 1.00 47.88 ? 214 GLU B CA    1 
ATOM   4279 C C     . GLU B 1 168 ? 39.278  14.569  -31.870 1.00 47.30 ? 214 GLU B C     1 
ATOM   4280 O O     . GLU B 1 168 ? 38.721  13.631  -31.281 1.00 46.10 ? 214 GLU B O     1 
ATOM   4281 C CB    . GLU B 1 168 ? 41.700  15.186  -31.498 1.00 47.86 ? 214 GLU B CB    1 
ATOM   4282 C CG    . GLU B 1 168 ? 43.100  14.584  -31.329 1.00 49.90 ? 214 GLU B CG    1 
ATOM   4283 C CD    . GLU B 1 168 ? 43.282  13.706  -30.063 1.00 55.92 ? 214 GLU B CD    1 
ATOM   4284 O OE1   . GLU B 1 168 ? 44.326  12.988  -29.998 1.00 55.93 ? 214 GLU B OE1   1 
ATOM   4285 O OE2   . GLU B 1 168 ? 42.404  13.718  -29.144 1.00 54.67 ? 214 GLU B OE2   1 
ATOM   4286 N N     . THR B 1 169 ? 38.697  15.754  -32.108 1.00 46.67 ? 215 THR B N     1 
ATOM   4287 C CA    . THR B 1 169 ? 37.339  16.118  -31.642 1.00 45.83 ? 215 THR B CA    1 
ATOM   4288 C C     . THR B 1 169 ? 36.263  15.148  -32.138 1.00 44.50 ? 215 THR B C     1 
ATOM   4289 O O     . THR B 1 169 ? 35.349  14.800  -31.409 1.00 43.98 ? 215 THR B O     1 
ATOM   4290 C CB    . THR B 1 169 ? 36.928  17.571  -32.069 1.00 46.65 ? 215 THR B CB    1 
ATOM   4291 O OG1   . THR B 1 169 ? 37.840  18.538  -31.513 1.00 47.74 ? 215 THR B OG1   1 
ATOM   4292 C CG2   . THR B 1 169 ? 35.461  17.910  -31.632 1.00 46.93 ? 215 THR B CG2   1 
ATOM   4293 N N     . HIS B 1 170 ? 36.391  14.724  -33.386 1.00 43.42 ? 216 HIS B N     1 
ATOM   4294 C CA    . HIS B 1 170 ? 35.396  13.857  -34.013 1.00 42.70 ? 216 HIS B CA    1 
ATOM   4295 C C     . HIS B 1 170 ? 35.559  12.399  -33.560 1.00 41.03 ? 216 HIS B C     1 
ATOM   4296 O O     . HIS B 1 170 ? 34.604  11.790  -33.079 1.00 40.29 ? 216 HIS B O     1 
ATOM   4297 C CB    . HIS B 1 170 ? 35.490  13.943  -35.540 1.00 43.07 ? 216 HIS B CB    1 
ATOM   4298 C CG    . HIS B 1 170 ? 34.559  13.011  -36.252 1.00 44.32 ? 216 HIS B CG    1 
ATOM   4299 N ND1   . HIS B 1 170 ? 33.186  13.114  -36.148 1.00 46.63 ? 216 HIS B ND1   1 
ATOM   4300 C CD2   . HIS B 1 170 ? 34.800  11.960  -37.075 1.00 43.61 ? 216 HIS B CD2   1 
ATOM   4301 C CE1   . HIS B 1 170 ? 32.622  12.170  -36.886 1.00 45.96 ? 216 HIS B CE1   1 
ATOM   4302 N NE2   . HIS B 1 170 ? 33.580  11.454  -37.454 1.00 43.30 ? 216 HIS B NE2   1 
ATOM   4303 N N     . ILE B 1 171 ? 36.768  11.865  -33.758 1.00 38.70 ? 217 ILE B N     1 
ATOM   4304 C CA    . ILE B 1 171 ? 37.116  10.514  -33.353 1.00 37.22 ? 217 ILE B CA    1 
ATOM   4305 C C     . ILE B 1 171 ? 36.817  10.252  -31.869 1.00 35.39 ? 217 ILE B C     1 
ATOM   4306 O O     . ILE B 1 171 ? 36.121  9.303   -31.571 1.00 35.83 ? 217 ILE B O     1 
ATOM   4307 C CB    . ILE B 1 171 ? 38.582  10.136  -33.700 1.00 36.77 ? 217 ILE B CB    1 
ATOM   4308 C CG1   . ILE B 1 171 ? 38.962  10.592  -35.111 1.00 36.43 ? 217 ILE B CG1   1 
ATOM   4309 C CG2   . ILE B 1 171 ? 38.849  8.657   -33.420 1.00 35.07 ? 217 ILE B CG2   1 
ATOM   4310 C CD1   . ILE B 1 171 ? 38.335  9.867   -36.203 1.00 37.03 ? 217 ILE B CD1   1 
ATOM   4311 N N     . ARG B 1 172 ? 37.296  11.084  -30.956 1.00 34.30 ? 218 ARG B N     1 
ATOM   4312 C CA    . ARG B 1 172 ? 37.026  10.867  -29.526 1.00 33.32 ? 218 ARG B CA    1 
ATOM   4313 C C     . ARG B 1 172 ? 35.540  10.790  -29.199 1.00 33.09 ? 218 ARG B C     1 
ATOM   4314 O O     . ARG B 1 172 ? 35.131  10.031  -28.296 1.00 33.22 ? 218 ARG B O     1 
ATOM   4315 C CB    . ARG B 1 172 ? 37.667  11.912  -28.620 1.00 33.14 ? 218 ARG B CB    1 
ATOM   4316 C CG    . ARG B 1 172 ? 39.209  11.893  -28.559 1.00 34.55 ? 218 ARG B CG    1 
ATOM   4317 C CD    . ARG B 1 172 ? 39.814  10.466  -28.458 1.00 31.94 ? 218 ARG B CD    1 
ATOM   4318 N NE    . ARG B 1 172 ? 41.254  10.540  -28.423 1.00 28.68 ? 218 ARG B NE    1 
ATOM   4319 C CZ    . ARG B 1 172 ? 42.068  9.506   -28.502 1.00 30.44 ? 218 ARG B CZ    1 
ATOM   4320 N NH1   . ARG B 1 172 ? 41.592  8.269   -28.630 1.00 34.21 ? 218 ARG B NH1   1 
ATOM   4321 N NH2   . ARG B 1 172 ? 43.369  9.714   -28.485 1.00 30.47 ? 218 ARG B NH2   1 
ATOM   4322 N N     . ASN B 1 173 ? 34.722  11.572  -29.904 1.00 32.02 ? 219 ASN B N     1 
ATOM   4323 C CA    . ASN B 1 173 ? 33.289  11.542  -29.608 1.00 30.80 ? 219 ASN B CA    1 
ATOM   4324 C C     . ASN B 1 173 ? 32.638  10.277  -30.114 1.00 29.43 ? 219 ASN B C     1 
ATOM   4325 O O     . ASN B 1 173 ? 31.838  9.659   -29.433 1.00 28.19 ? 219 ASN B O     1 
ATOM   4326 C CB    . ASN B 1 173 ? 32.558  12.768  -30.109 1.00 30.32 ? 219 ASN B CB    1 
ATOM   4327 C CG    . ASN B 1 173 ? 31.166  12.825  -29.584 1.00 30.12 ? 219 ASN B CG    1 
ATOM   4328 O OD1   . ASN B 1 173 ? 30.225  12.499  -30.291 1.00 30.52 ? 219 ASN B OD1   1 
ATOM   4329 N ND2   . ASN B 1 173 ? 31.017  13.195  -28.318 1.00 31.31 ? 219 ASN B ND2   1 
ATOM   4330 N N     . GLU B 1 174 ? 33.043  9.871   -31.301 1.00 30.05 ? 220 GLU B N     1 
ATOM   4331 C CA    . GLU B 1 174 ? 32.600  8.611   -31.884 1.00 30.63 ? 220 GLU B CA    1 
ATOM   4332 C C     . GLU B 1 174 ? 32.998  7.404   -30.979 1.00 30.36 ? 220 GLU B C     1 
ATOM   4333 O O     . GLU B 1 174 ? 32.159  6.530   -30.698 1.00 31.43 ? 220 GLU B O     1 
ATOM   4334 C CB    . GLU B 1 174 ? 33.132  8.540   -33.297 1.00 30.62 ? 220 GLU B CB    1 
ATOM   4335 C CG    . GLU B 1 174 ? 32.223  7.886   -34.328 1.00 35.42 ? 220 GLU B CG    1 
ATOM   4336 C CD    . GLU B 1 174 ? 30.800  8.480   -34.449 1.00 37.28 ? 220 GLU B CD    1 
ATOM   4337 O OE1   . GLU B 1 174 ? 30.633  9.725   -34.503 1.00 38.63 ? 220 GLU B OE1   1 
ATOM   4338 O OE2   . GLU B 1 174 ? 29.849  7.668   -34.500 1.00 36.26 ? 220 GLU B OE2   1 
ATOM   4339 N N     . GLN B 1 175 ? 34.243  7.397   -30.481 1.00 29.00 ? 221 GLN B N     1 
ATOM   4340 C CA    . GLN B 1 175 ? 34.753  6.390   -29.531 1.00 26.41 ? 221 GLN B CA    1 
ATOM   4341 C C     . GLN B 1 175 ? 34.034  6.373   -28.209 1.00 26.07 ? 221 GLN B C     1 
ATOM   4342 O O     . GLN B 1 175 ? 33.755  5.290   -27.758 1.00 27.39 ? 221 GLN B O     1 
ATOM   4343 C CB    . GLN B 1 175 ? 36.264  6.515   -29.265 1.00 27.03 ? 221 GLN B CB    1 
ATOM   4344 C CG    . GLN B 1 175 ? 37.208  6.283   -30.483 1.00 23.45 ? 221 GLN B CG    1 
ATOM   4345 C CD    . GLN B 1 175 ? 38.653  6.569   -30.123 1.00 25.51 ? 221 GLN B CD    1 
ATOM   4346 O OE1   . GLN B 1 175 ? 38.965  7.604   -29.527 1.00 26.10 ? 221 GLN B OE1   1 
ATOM   4347 N NE2   . GLN B 1 175 ? 39.547  5.655   -30.467 1.00 23.43 ? 221 GLN B NE2   1 
ATOM   4348 N N     . VAL B 1 176 ? 33.731  7.520   -27.583 1.00 25.73 ? 222 VAL B N     1 
ATOM   4349 C CA    . VAL B 1 176 ? 32.870  7.564   -26.375 1.00 26.03 ? 222 VAL B CA    1 
ATOM   4350 C C     . VAL B 1 176 ? 31.427  7.040   -26.566 1.00 27.11 ? 222 VAL B C     1 
ATOM   4351 O O     . VAL B 1 176 ? 30.860  6.431   -25.669 1.00 27.72 ? 222 VAL B O     1 
ATOM   4352 C CB    . VAL B 1 176 ? 32.868  8.953   -25.615 1.00 26.35 ? 222 VAL B CB    1 
ATOM   4353 C CG1   . VAL B 1 176 ? 31.725  9.911   -26.047 1.00 27.62 ? 222 VAL B CG1   1 
ATOM   4354 C CG2   . VAL B 1 176 ? 32.703  8.752   -24.121 1.00 25.07 ? 222 VAL B CG2   1 
ATOM   4355 N N     . ARG B 1 177 ? 30.835  7.277   -27.728 1.00 28.11 ? 223 ARG B N     1 
ATOM   4356 C CA    . ARG B 1 177 ? 29.594  6.599   -28.124 1.00 29.72 ? 223 ARG B CA    1 
ATOM   4357 C C     . ARG B 1 177 ? 29.752  5.064   -28.274 1.00 29.17 ? 223 ARG B C     1 
ATOM   4358 O O     . ARG B 1 177 ? 28.966  4.287   -27.719 1.00 29.83 ? 223 ARG B O     1 
ATOM   4359 C CB    . ARG B 1 177 ? 29.005  7.248   -29.374 1.00 29.15 ? 223 ARG B CB    1 
ATOM   4360 C CG    . ARG B 1 177 ? 28.603  8.741   -29.144 1.00 31.34 ? 223 ARG B CG    1 
ATOM   4361 C CD    . ARG B 1 177 ? 28.159  9.436   -30.456 1.00 33.36 ? 223 ARG B CD    1 
ATOM   4362 N NE    . ARG B 1 177 ? 28.029  10.887  -30.263 1.00 40.97 ? 223 ARG B NE    1 
ATOM   4363 C CZ    . ARG B 1 177 ? 27.131  11.482  -29.464 1.00 42.61 ? 223 ARG B CZ    1 
ATOM   4364 N NH1   . ARG B 1 177 ? 26.251  10.759  -28.783 1.00 42.79 ? 223 ARG B NH1   1 
ATOM   4365 N NH2   . ARG B 1 177 ? 27.103  12.810  -29.361 1.00 41.26 ? 223 ARG B NH2   1 
ATOM   4366 N N     . GLN B 1 178 ? 30.779  4.621   -28.975 1.00 28.76 ? 224 GLN B N     1 
ATOM   4367 C CA    . GLN B 1 178 ? 31.051  3.190   -29.054 1.00 28.00 ? 224 GLN B CA    1 
ATOM   4368 C C     . GLN B 1 178 ? 31.271  2.583   -27.641 1.00 26.95 ? 224 GLN B C     1 
ATOM   4369 O O     . GLN B 1 178 ? 30.682  1.543   -27.293 1.00 26.77 ? 224 GLN B O     1 
ATOM   4370 C CB    . GLN B 1 178 ? 32.214  2.880   -30.013 1.00 28.02 ? 224 GLN B CB    1 
ATOM   4371 C CG    . GLN B 1 178 ? 32.654  1.366   -29.862 1.00 31.15 ? 224 GLN B CG    1 
ATOM   4372 C CD    . GLN B 1 178 ? 33.388  0.808   -31.062 1.00 34.02 ? 224 GLN B CD    1 
ATOM   4373 O OE1   . GLN B 1 178 ? 33.747  1.553   -31.990 1.00 34.98 ? 224 GLN B OE1   1 
ATOM   4374 N NE2   . GLN B 1 178 ? 33.621  -0.517  -31.053 1.00 30.59 ? 224 GLN B NE2   1 
ATOM   4375 N N     . ARG B 1 179 ? 32.062  3.268   -26.804 1.00 25.80 ? 225 ARG B N     1 
ATOM   4376 C CA    . ARG B 1 179 ? 32.244  2.861   -25.394 1.00 24.17 ? 225 ARG B CA    1 
ATOM   4377 C C     . ARG B 1 179 ? 30.934  2.732   -24.587 1.00 23.30 ? 225 ARG B C     1 
ATOM   4378 O O     . ARG B 1 179 ? 30.769  1.782   -23.838 1.00 22.87 ? 225 ARG B O     1 
ATOM   4379 C CB    . ARG B 1 179 ? 33.215  3.791   -24.653 1.00 22.44 ? 225 ARG B CB    1 
ATOM   4380 C CG    . ARG B 1 179 ? 34.597  3.759   -25.207 1.00 22.34 ? 225 ARG B CG    1 
ATOM   4381 C CD    . ARG B 1 179 ? 35.458  4.920   -24.695 1.00 23.08 ? 225 ARG B CD    1 
ATOM   4382 N NE    . ARG B 1 179 ? 36.814  4.417   -24.478 1.00 25.04 ? 225 ARG B NE    1 
ATOM   4383 C CZ    . ARG B 1 179 ? 37.313  4.143   -23.284 1.00 24.76 ? 225 ARG B CZ    1 
ATOM   4384 N NH1   . ARG B 1 179 ? 36.602  4.407   -22.188 1.00 24.03 ? 225 ARG B NH1   1 
ATOM   4385 N NH2   . ARG B 1 179 ? 38.526  3.628   -23.190 1.00 23.07 ? 225 ARG B NH2   1 
ATOM   4386 N N     . ALA B 1 180 ? 30.062  3.728   -24.676 1.00 23.99 ? 226 ALA B N     1 
ATOM   4387 C CA    . ALA B 1 180 ? 28.746  3.691   -24.000 1.00 25.24 ? 226 ALA B CA    1 
ATOM   4388 C C     . ALA B 1 180 ? 27.940  2.505   -24.525 1.00 25.98 ? 226 ALA B C     1 
ATOM   4389 O O     . ALA B 1 180 ? 27.404  1.725   -23.749 1.00 26.83 ? 226 ALA B O     1 
ATOM   4390 C CB    . ALA B 1 180 ? 27.971  5.005   -24.221 1.00 24.83 ? 226 ALA B CB    1 
ATOM   4391 N N     . LYS B 1 181 ? 27.932  2.337   -25.840 1.00 26.72 ? 227 LYS B N     1 
ATOM   4392 C CA    . LYS B 1 181 ? 27.278  1.210   -26.437 1.00 29.52 ? 227 LYS B CA    1 
ATOM   4393 C C     . LYS B 1 181 ? 27.836  -0.095  -25.835 1.00 28.08 ? 227 LYS B C     1 
ATOM   4394 O O     . LYS B 1 181 ? 27.070  -0.997  -25.455 1.00 27.87 ? 227 LYS B O     1 
ATOM   4395 C CB    . LYS B 1 181 ? 27.423  1.278   -27.970 1.00 29.97 ? 227 LYS B CB    1 
ATOM   4396 C CG    . LYS B 1 181 ? 26.792  0.116   -28.700 1.00 32.92 ? 227 LYS B CG    1 
ATOM   4397 C CD    . LYS B 1 181 ? 26.823  0.310   -30.237 1.00 34.63 ? 227 LYS B CD    1 
ATOM   4398 C CE    . LYS B 1 181 ? 26.211  -0.887  -30.980 1.00 38.15 ? 227 LYS B CE    1 
ATOM   4399 N NZ    . LYS B 1 181 ? 26.903  -2.177  -30.548 1.00 42.35 ? 227 LYS B NZ    1 
ATOM   4400 N N     . GLU B 1 182 ? 29.160  -0.168  -25.710 1.00 26.97 ? 228 GLU B N     1 
ATOM   4401 C CA    . GLU B 1 182 ? 29.807  -1.328  -25.136 1.00 26.25 ? 228 GLU B CA    1 
ATOM   4402 C C     . GLU B 1 182 ? 29.468  -1.587  -23.656 1.00 25.50 ? 228 GLU B C     1 
ATOM   4403 O O     . GLU B 1 182 ? 29.227  -2.740  -23.257 1.00 24.87 ? 228 GLU B O     1 
ATOM   4404 C CB    . GLU B 1 182 ? 31.316  -1.311  -25.441 1.00 26.51 ? 228 GLU B CB    1 
ATOM   4405 C CG    . GLU B 1 182 ? 31.589  -1.327  -26.964 1.00 27.17 ? 228 GLU B CG    1 
ATOM   4406 C CD    . GLU B 1 182 ? 33.073  -1.350  -27.339 1.00 27.60 ? 228 GLU B CD    1 
ATOM   4407 O OE1   . GLU B 1 182 ? 33.921  -0.687  -26.685 1.00 24.07 ? 228 GLU B OE1   1 
ATOM   4408 O OE2   . GLU B 1 182 ? 33.375  -2.070  -28.311 1.00 32.56 ? 228 GLU B OE2   1 
ATOM   4409 N N     . CYS B 1 183 ? 29.377  -0.547  -22.841 1.00 24.58 ? 229 CYS B N     1 
ATOM   4410 C CA    . CYS B 1 183 ? 28.934  -0.768  -21.444 1.00 24.36 ? 229 CYS B CA    1 
ATOM   4411 C C     . CYS B 1 183 ? 27.466  -1.251  -21.350 1.00 23.93 ? 229 CYS B C     1 
ATOM   4412 O O     . CYS B 1 183 ? 27.133  -2.109  -20.540 1.00 22.60 ? 229 CYS B O     1 
ATOM   4413 C CB    . CYS B 1 183 ? 29.130  0.489   -20.548 1.00 25.48 ? 229 CYS B CB    1 
ATOM   4414 S SG    . CYS B 1 183 ? 30.822  1.104   -20.286 1.00 25.81 ? 229 CYS B SG    1 
ATOM   4415 N N     . SER B 1 184 ? 26.596  -0.661  -22.161 1.00 24.58 ? 230 SER B N     1 
ATOM   4416 C CA    . SER B 1 184 ? 25.206  -1.139  -22.339 1.00 24.82 ? 230 SER B CA    1 
ATOM   4417 C C     . SER B 1 184 ? 25.020  -2.587  -22.782 1.00 25.34 ? 230 SER B C     1 
ATOM   4418 O O     . SER B 1 184 ? 24.233  -3.314  -22.204 1.00 26.77 ? 230 SER B O     1 
ATOM   4419 C CB    . SER B 1 184 ? 24.461  -0.232  -23.272 1.00 23.19 ? 230 SER B CB    1 
ATOM   4420 O OG    . SER B 1 184 ? 24.236  0.978   -22.612 1.00 25.17 ? 230 SER B OG    1 
ATOM   4421 N N     . GLN B 1 185 ? 25.713  -2.976  -23.827 1.00 25.54 ? 231 GLN B N     1 
ATOM   4422 C CA    . GLN B 1 185 ? 25.781  -4.352  -24.258 1.00 26.48 ? 231 GLN B CA    1 
ATOM   4423 C C     . GLN B 1 185 ? 26.382  -5.302  -23.207 1.00 27.22 ? 231 GLN B C     1 
ATOM   4424 O O     . GLN B 1 185 ? 25.913  -6.439  -23.016 1.00 28.78 ? 231 GLN B O     1 
ATOM   4425 C CB    . GLN B 1 185 ? 26.574  -4.418  -25.556 1.00 25.52 ? 231 GLN B CB    1 
ATOM   4426 C CG    . GLN B 1 185 ? 26.588  -5.812  -26.160 1.00 29.75 ? 231 GLN B CG    1 
ATOM   4427 C CD    . GLN B 1 185 ? 27.466  -5.889  -27.377 1.00 31.71 ? 231 GLN B CD    1 
ATOM   4428 O OE1   . GLN B 1 185 ? 27.197  -5.259  -28.407 1.00 34.78 ? 231 GLN B OE1   1 
ATOM   4429 N NE2   . GLN B 1 185 ? 28.523  -6.642  -27.272 1.00 32.38 ? 231 GLN B NE2   1 
ATOM   4430 N N     . ALA B 1 186 ? 27.424  -4.871  -22.515 1.00 27.25 ? 232 ALA B N     1 
ATOM   4431 C CA    . ALA B 1 186 ? 27.943  -5.696  -21.440 1.00 27.09 ? 232 ALA B CA    1 
ATOM   4432 C C     . ALA B 1 186 ? 26.875  -5.915  -20.350 1.00 27.29 ? 232 ALA B C     1 
ATOM   4433 O O     . ALA B 1 186 ? 26.729  -7.034  -19.843 1.00 28.26 ? 232 ALA B O     1 
ATOM   4434 C CB    . ALA B 1 186 ? 29.200  -5.094  -20.872 1.00 26.08 ? 232 ALA B CB    1 
ATOM   4435 N N     . LEU B 1 187 ? 26.130  -4.860  -19.998 1.00 26.79 ? 233 LEU B N     1 
ATOM   4436 C CA    . LEU B 1 187 ? 25.007  -4.962  -19.057 1.00 26.47 ? 233 LEU B CA    1 
ATOM   4437 C C     . LEU B 1 187 ? 23.866  -5.854  -19.593 1.00 25.80 ? 233 LEU B C     1 
ATOM   4438 O O     . LEU B 1 187 ? 23.439  -6.759  -18.897 1.00 23.77 ? 233 LEU B O     1 
ATOM   4439 C CB    . LEU B 1 187 ? 24.436  -3.593  -18.647 1.00 26.33 ? 233 LEU B CB    1 
ATOM   4440 C CG    . LEU B 1 187 ? 23.247  -3.589  -17.669 1.00 25.98 ? 233 LEU B CG    1 
ATOM   4441 C CD1   . LEU B 1 187 ? 23.550  -4.336  -16.375 1.00 22.50 ? 233 LEU B CD1   1 
ATOM   4442 C CD2   . LEU B 1 187 ? 22.851  -2.163  -17.336 1.00 25.95 ? 233 LEU B CD2   1 
ATOM   4443 N N     . SER B 1 188 ? 23.434  -5.628  -20.835 1.00 25.80 ? 234 SER B N     1 
ATOM   4444 C CA    . SER B 1 188 ? 22.461  -6.521  -21.475 1.00 26.19 ? 234 SER B CA    1 
ATOM   4445 C C     . SER B 1 188 ? 22.893  -8.003  -21.435 1.00 27.26 ? 234 SER B C     1 
ATOM   4446 O O     . SER B 1 188 ? 22.105  -8.856  -21.030 1.00 27.60 ? 234 SER B O     1 
ATOM   4447 C CB    . SER B 1 188 ? 22.203  -6.112  -22.892 1.00 25.63 ? 234 SER B CB    1 
ATOM   4448 O OG    . SER B 1 188 ? 21.521  -4.897  -22.927 1.00 27.45 ? 234 SER B OG    1 
ATOM   4449 N N     . LEU B 1 189 ? 24.147  -8.293  -21.805 1.00 27.40 ? 235 LEU B N     1 
ATOM   4450 C CA    . LEU B 1 189 ? 24.679  -9.652  -21.702 1.00 27.45 ? 235 LEU B CA    1 
ATOM   4451 C C     . LEU B 1 189 ? 24.568  -10.268 -20.291 1.00 28.98 ? 235 LEU B C     1 
ATOM   4452 O O     . LEU B 1 189 ? 24.023  -11.367 -20.133 1.00 29.94 ? 235 LEU B O     1 
ATOM   4453 C CB    . LEU B 1 189 ? 26.115  -9.732  -22.235 1.00 26.59 ? 235 LEU B CB    1 
ATOM   4454 C CG    . LEU B 1 189 ? 26.754  -11.119 -22.232 1.00 26.56 ? 235 LEU B CG    1 
ATOM   4455 C CD1   . LEU B 1 189 ? 25.893  -12.222 -23.032 1.00 28.88 ? 235 LEU B CD1   1 
ATOM   4456 C CD2   . LEU B 1 189 ? 28.186  -11.063 -22.681 1.00 26.31 ? 235 LEU B CD2   1 
ATOM   4457 N N     . ILE B 1 190 ? 25.071  -9.583  -19.270 1.00 29.18 ? 236 ILE B N     1 
ATOM   4458 C CA    . ILE B 1 190 ? 24.961  -10.098 -17.895 1.00 29.60 ? 236 ILE B CA    1 
ATOM   4459 C C     . ILE B 1 190 ? 23.518  -10.306 -17.368 1.00 29.48 ? 236 ILE B C     1 
ATOM   4460 O O     . ILE B 1 190 ? 23.262  -11.254 -16.607 1.00 29.89 ? 236 ILE B O     1 
ATOM   4461 C CB    . ILE B 1 190 ? 25.787  -9.236  -16.864 1.00 28.93 ? 236 ILE B CB    1 
ATOM   4462 C CG1   . ILE B 1 190 ? 27.253  -9.615  -16.919 1.00 31.09 ? 236 ILE B CG1   1 
ATOM   4463 C CG2   . ILE B 1 190 ? 25.405  -9.564  -15.439 1.00 31.03 ? 236 ILE B CG2   1 
ATOM   4464 C CD1   . ILE B 1 190 ? 28.052  -8.653  -17.623 1.00 30.48 ? 236 ILE B CD1   1 
ATOM   4465 N N     . LEU B 1 191 ? 22.610  -9.389  -17.707 1.00 28.72 ? 237 LEU B N     1 
ATOM   4466 C CA    . LEU B 1 191 ? 21.210  -9.516  -17.355 1.00 27.79 ? 237 LEU B CA    1 
ATOM   4467 C C     . LEU B 1 191 ? 20.524  -10.700 -18.086 1.00 29.13 ? 237 LEU B C     1 
ATOM   4468 O O     . LEU B 1 191 ? 19.647  -11.365 -17.496 1.00 29.79 ? 237 LEU B O     1 
ATOM   4469 C CB    . LEU B 1 191 ? 20.469  -8.240  -17.698 1.00 26.21 ? 237 LEU B CB    1 
ATOM   4470 C CG    . LEU B 1 191 ? 20.888  -7.032  -16.851 1.00 25.26 ? 237 LEU B CG    1 
ATOM   4471 C CD1   . LEU B 1 191 ? 20.184  -5.694  -17.373 1.00 22.44 ? 237 LEU B CD1   1 
ATOM   4472 C CD2   . LEU B 1 191 ? 20.599  -7.348  -15.391 1.00 21.71 ? 237 LEU B CD2   1 
ATOM   4473 N N     . ASP B 1 192 ? 20.888  -10.924 -19.359 1.00 28.72 ? 238 ASP B N     1 
ATOM   4474 C CA    . ASP B 1 192 ? 20.343  -12.037 -20.146 1.00 29.87 ? 238 ASP B CA    1 
ATOM   4475 C C     . ASP B 1 192 ? 20.741  -13.391 -19.524 1.00 30.03 ? 238 ASP B C     1 
ATOM   4476 O O     . ASP B 1 192 ? 19.939  -14.321 -19.495 1.00 30.63 ? 238 ASP B O     1 
ATOM   4477 C CB    . ASP B 1 192 ? 20.775  -11.968 -21.626 1.00 29.55 ? 238 ASP B CB    1 
ATOM   4478 C CG    . ASP B 1 192 ? 19.981  -10.936 -22.431 1.00 31.83 ? 238 ASP B CG    1 
ATOM   4479 O OD1   . ASP B 1 192 ? 18.985  -10.374 -21.899 1.00 36.30 ? 238 ASP B OD1   1 
ATOM   4480 O OD2   . ASP B 1 192 ? 20.350  -10.661 -23.595 1.00 31.02 ? 238 ASP B OD2   1 
ATOM   4481 N N     . ILE B 1 193 ? 21.970  -13.456 -19.021 1.00 29.57 ? 239 ILE B N     1 
ATOM   4482 C CA    . ILE B 1 193 ? 22.584  -14.641 -18.421 1.00 29.42 ? 239 ILE B CA    1 
ATOM   4483 C C     . ILE B 1 193 ? 22.014  -14.908 -17.033 1.00 30.67 ? 239 ILE B C     1 
ATOM   4484 O O     . ILE B 1 193 ? 21.851  -16.086 -16.621 1.00 31.63 ? 239 ILE B O     1 
ATOM   4485 C CB    . ILE B 1 193 ? 24.149  -14.434 -18.311 1.00 29.81 ? 239 ILE B CB    1 
ATOM   4486 C CG1   . ILE B 1 193 ? 24.815  -14.487 -19.703 1.00 28.22 ? 239 ILE B CG1   1 
ATOM   4487 C CG2   . ILE B 1 193 ? 24.789  -15.436 -17.342 1.00 28.89 ? 239 ILE B CG2   1 
ATOM   4488 C CD1   . ILE B 1 193 ? 26.409  -14.361 -19.651 1.00 29.71 ? 239 ILE B CD1   1 
ATOM   4489 N N     . ASP B 1 194 ? 21.731  -13.815 -16.310 1.00 30.68 ? 240 ASP B N     1 
ATOM   4490 C CA    . ASP B 1 194 ? 21.062  -13.832 -15.010 1.00 30.26 ? 240 ASP B CA    1 
ATOM   4491 C C     . ASP B 1 194 ? 19.666  -14.485 -15.164 1.00 30.11 ? 240 ASP B C     1 
ATOM   4492 O O     . ASP B 1 194 ? 19.158  -15.119 -14.252 1.00 29.71 ? 240 ASP B O     1 
ATOM   4493 C CB    . ASP B 1 194 ? 20.938  -12.399 -14.441 1.00 29.13 ? 240 ASP B CB    1 
ATOM   4494 C CG    . ASP B 1 194 ? 20.132  -12.350 -13.132 1.00 30.01 ? 240 ASP B CG    1 
ATOM   4495 O OD1   . ASP B 1 194 ? 20.676  -12.773 -12.102 1.00 26.61 ? 240 ASP B OD1   1 
ATOM   4496 O OD2   . ASP B 1 194 ? 18.953  -11.898 -13.118 1.00 30.26 ? 240 ASP B OD2   1 
ATOM   4497 N N     . HIS B 1 195 ? 19.034  -14.272 -16.308 1.00 30.92 ? 241 HIS B N     1 
ATOM   4498 C CA    . HIS B 1 195 ? 17.723  -14.874 -16.573 1.00 31.33 ? 241 HIS B CA    1 
ATOM   4499 C C     . HIS B 1 195 ? 17.865  -16.145 -17.417 1.00 32.53 ? 241 HIS B C     1 
ATOM   4500 O O     . HIS B 1 195 ? 16.924  -16.524 -18.106 1.00 33.83 ? 241 HIS B O     1 
ATOM   4501 C CB    . HIS B 1 195 ? 16.811  -13.869 -17.293 1.00 30.45 ? 241 HIS B CB    1 
ATOM   4502 C CG    . HIS B 1 195 ? 16.116  -12.897 -16.386 1.00 28.55 ? 241 HIS B CG    1 
ATOM   4503 N ND1   . HIS B 1 195 ? 16.162  -12.982 -15.007 1.00 31.45 ? 241 HIS B ND1   1 
ATOM   4504 C CD2   . HIS B 1 195 ? 15.285  -11.868 -16.664 1.00 25.02 ? 241 HIS B CD2   1 
ATOM   4505 C CE1   . HIS B 1 195 ? 15.430  -12.020 -14.474 1.00 27.80 ? 241 HIS B CE1   1 
ATOM   4506 N NE2   . HIS B 1 195 ? 14.882  -11.335 -15.460 1.00 28.91 ? 241 HIS B NE2   1 
ATOM   4507 N N     . GLY B 1 196 ? 19.046  -16.767 -17.410 1.00 33.25 ? 242 GLY B N     1 
ATOM   4508 C CA    . GLY B 1 196 ? 19.278  -18.037 -18.114 1.00 34.82 ? 242 GLY B CA    1 
ATOM   4509 C C     . GLY B 1 196 ? 19.650  -18.072 -19.602 1.00 36.20 ? 242 GLY B C     1 
ATOM   4510 O O     . GLY B 1 196 ? 19.565  -19.129 -20.239 1.00 37.00 ? 242 GLY B O     1 
ATOM   4511 N N     . LYS B 1 197 ? 20.028  -16.955 -20.207 1.00 37.80 ? 243 LYS B N     1 
ATOM   4512 C CA    . LYS B 1 197 ? 20.496  -17.026 -21.603 1.00 38.97 ? 243 LYS B CA    1 
ATOM   4513 C C     . LYS B 1 197 ? 21.728  -17.963 -21.730 1.00 39.89 ? 243 LYS B C     1 
ATOM   4514 O O     . LYS B 1 197 ? 22.696  -17.837 -20.951 1.00 40.15 ? 243 LYS B O     1 
ATOM   4515 C CB    . LYS B 1 197 ? 20.875  -15.668 -22.138 1.00 38.82 ? 243 LYS B CB    1 
ATOM   4516 C CG    . LYS B 1 197 ? 21.586  -15.791 -23.477 1.00 40.05 ? 243 LYS B CG    1 
ATOM   4517 C CD    . LYS B 1 197 ? 22.100  -14.481 -24.060 1.00 42.82 ? 243 LYS B CD    1 
ATOM   4518 C CE    . LYS B 1 197 ? 22.553  -14.682 -25.520 1.00 42.46 ? 243 LYS B CE    1 
ATOM   4519 N NZ    . LYS B 1 197 ? 22.082  -13.561 -26.380 1.00 44.45 ? 243 LYS B NZ    1 
ATOM   4520 N N     . PRO B 1 198 ? 21.691  -18.933 -22.676 1.00 40.69 ? 244 PRO B N     1 
ATOM   4521 C CA    . PRO B 1 198 ? 22.901  -19.764 -22.784 1.00 41.21 ? 244 PRO B CA    1 
ATOM   4522 C C     . PRO B 1 198 ? 23.994  -19.036 -23.575 1.00 41.25 ? 244 PRO B C     1 
ATOM   4523 O O     . PRO B 1 198 ? 23.748  -18.419 -24.642 1.00 40.98 ? 244 PRO B O     1 
ATOM   4524 C CB    . PRO B 1 198 ? 22.420  -21.054 -23.497 1.00 41.06 ? 244 PRO B CB    1 
ATOM   4525 C CG    . PRO B 1 198 ? 21.070  -20.752 -24.050 1.00 40.59 ? 244 PRO B CG    1 
ATOM   4526 C CD    . PRO B 1 198 ? 20.655  -19.341 -23.644 1.00 41.08 ? 244 PRO B CD    1 
ATOM   4527 N N     . VAL B 1 199 ? 25.191  -19.098 -23.021 1.00 41.38 ? 245 VAL B N     1 
ATOM   4528 C CA    . VAL B 1 199 ? 26.318  -18.393 -23.582 1.00 41.44 ? 245 VAL B CA    1 
ATOM   4529 C C     . VAL B 1 199 ? 27.473  -19.342 -23.855 1.00 42.32 ? 245 VAL B C     1 
ATOM   4530 O O     . VAL B 1 199 ? 27.861  -20.155 -23.017 1.00 42.10 ? 245 VAL B O     1 
ATOM   4531 C CB    . VAL B 1 199 ? 26.715  -17.243 -22.657 1.00 41.09 ? 245 VAL B CB    1 
ATOM   4532 C CG1   . VAL B 1 199 ? 28.113  -16.862 -22.869 1.00 41.88 ? 245 VAL B CG1   1 
ATOM   4533 C CG2   . VAL B 1 199 ? 25.788  -16.055 -22.918 1.00 40.56 ? 245 VAL B CG2   1 
ATOM   4534 N N     . LYS B 1 200 ? 28.011  -19.240 -25.058 1.00 42.92 ? 246 LYS B N     1 
ATOM   4535 C CA    . LYS B 1 200 ? 29.267  -19.888 -25.340 1.00 42.74 ? 246 LYS B CA    1 
ATOM   4536 C C     . LYS B 1 200 ? 30.417  -18.850 -25.306 1.00 41.74 ? 246 LYS B C     1 
ATOM   4537 O O     . LYS B 1 200 ? 30.594  -18.032 -26.201 1.00 41.52 ? 246 LYS B O     1 
ATOM   4538 C CB    . LYS B 1 200 ? 29.220  -20.686 -26.659 1.00 42.73 ? 246 LYS B CB    1 
ATOM   4539 C CG    . LYS B 1 200 ? 30.525  -21.406 -26.855 1.00 45.59 ? 246 LYS B CG    1 
ATOM   4540 C CD    . LYS B 1 200 ? 30.492  -22.529 -27.871 1.00 49.13 ? 246 LYS B CD    1 
ATOM   4541 C CE    . LYS B 1 200 ? 31.634  -23.465 -27.484 1.00 53.19 ? 246 LYS B CE    1 
ATOM   4542 N NZ    . LYS B 1 200 ? 31.874  -23.408 -25.991 1.00 53.93 ? 246 LYS B NZ    1 
ATOM   4543 N N     . ASN B 1 201 ? 31.180  -18.913 -24.232 1.00 40.38 ? 247 ASN B N     1 
ATOM   4544 C CA    . ASN B 1 201 ? 32.398  -18.178 -24.099 1.00 39.02 ? 247 ASN B CA    1 
ATOM   4545 C C     . ASN B 1 201 ? 33.413  -18.548 -25.204 1.00 39.07 ? 247 ASN B C     1 
ATOM   4546 O O     . ASN B 1 201 ? 33.760  -19.725 -25.340 1.00 39.35 ? 247 ASN B O     1 
ATOM   4547 C CB    . ASN B 1 201 ? 32.972  -18.494 -22.716 1.00 37.43 ? 247 ASN B CB    1 
ATOM   4548 C CG    . ASN B 1 201 ? 33.993  -17.472 -22.263 1.00 35.63 ? 247 ASN B CG    1 
ATOM   4549 O OD1   . ASN B 1 201 ? 34.381  -16.582 -23.027 1.00 29.70 ? 247 ASN B OD1   1 
ATOM   4550 N ND2   . ASN B 1 201 ? 34.443  -17.597 -21.017 1.00 32.13 ? 247 ASN B ND2   1 
ATOM   4551 N N     . ALA B 1 202 ? 33.895  -17.556 -25.962 1.00 37.96 ? 248 ALA B N     1 
ATOM   4552 C CA    . ALA B 1 202 ? 34.871  -17.810 -27.017 1.00 37.41 ? 248 ALA B CA    1 
ATOM   4553 C C     . ALA B 1 202 ? 36.185  -18.187 -26.414 1.00 37.36 ? 248 ALA B C     1 
ATOM   4554 O O     . ALA B 1 202 ? 36.995  -18.851 -27.047 1.00 37.16 ? 248 ALA B O     1 
ATOM   4555 C CB    . ALA B 1 202 ? 35.036  -16.635 -27.908 1.00 38.05 ? 248 ALA B CB    1 
ATOM   4556 N N     . LEU B 1 203 ? 36.388  -17.748 -25.178 1.00 37.02 ? 249 LEU B N     1 
ATOM   4557 C CA    . LEU B 1 203 ? 37.487  -18.214 -24.385 1.00 36.71 ? 249 LEU B CA    1 
ATOM   4558 C C     . LEU B 1 203 ? 36.998  -19.524 -23.761 1.00 38.79 ? 249 LEU B C     1 
ATOM   4559 O O     . LEU B 1 203 ? 35.819  -19.672 -23.398 1.00 39.43 ? 249 LEU B O     1 
ATOM   4560 C CB    . LEU B 1 203 ? 37.915  -17.162 -23.364 1.00 35.15 ? 249 LEU B CB    1 
ATOM   4561 C CG    . LEU B 1 203 ? 38.164  -15.733 -23.914 1.00 33.04 ? 249 LEU B CG    1 
ATOM   4562 C CD1   . LEU B 1 203 ? 38.476  -14.791 -22.759 1.00 25.56 ? 249 LEU B CD1   1 
ATOM   4563 C CD2   . LEU B 1 203 ? 39.256  -15.645 -25.026 1.00 30.66 ? 249 LEU B CD2   1 
ATOM   4564 N N     . ASP B 1 204 ? 37.845  -20.529 -23.696 1.00 40.00 ? 250 ASP B N     1 
ATOM   4565 C CA    . ASP B 1 204 ? 37.301  -21.773 -23.228 1.00 41.92 ? 250 ASP B CA    1 
ATOM   4566 C C     . ASP B 1 204 ? 37.904  -21.928 -21.851 1.00 42.02 ? 250 ASP B C     1 
ATOM   4567 O O     . ASP B 1 204 ? 39.077  -22.221 -21.698 1.00 43.12 ? 250 ASP B O     1 
ATOM   4568 C CB    . ASP B 1 204 ? 37.599  -22.884 -24.247 1.00 43.22 ? 250 ASP B CB    1 
ATOM   4569 C CG    . ASP B 1 204 ? 37.389  -24.280 -23.682 1.00 47.10 ? 250 ASP B CG    1 
ATOM   4570 O OD1   . ASP B 1 204 ? 36.412  -24.469 -22.900 1.00 49.53 ? 250 ASP B OD1   1 
ATOM   4571 O OD2   . ASP B 1 204 ? 38.230  -25.166 -24.022 1.00 48.36 ? 250 ASP B OD2   1 
ATOM   4572 N N     . LEU B 1 205 ? 37.120  -21.589 -20.837 1.00 42.39 ? 251 LEU B N     1 
ATOM   4573 C CA    . LEU B 1 205 ? 37.640  -21.499 -19.471 1.00 41.92 ? 251 LEU B CA    1 
ATOM   4574 C C     . LEU B 1 205 ? 36.803  -22.316 -18.463 1.00 41.19 ? 251 LEU B C     1 
ATOM   4575 O O     . LEU B 1 205 ? 35.633  -22.649 -18.711 1.00 40.14 ? 251 LEU B O     1 
ATOM   4576 C CB    . LEU B 1 205 ? 37.852  -20.015 -19.039 1.00 41.73 ? 251 LEU B CB    1 
ATOM   4577 C CG    . LEU B 1 205 ? 38.842  -19.180 -19.875 1.00 41.79 ? 251 LEU B CG    1 
ATOM   4578 C CD1   . LEU B 1 205 ? 38.531  -17.705 -19.709 1.00 43.84 ? 251 LEU B CD1   1 
ATOM   4579 C CD2   . LEU B 1 205 ? 40.353  -19.442 -19.595 1.00 40.11 ? 251 LEU B CD2   1 
ATOM   4580 N N     . LYS B 1 206 ? 37.436  -22.673 -17.348 1.00 41.24 ? 252 LYS B N     1 
ATOM   4581 C CA    . LYS B 1 206 ? 36.816  -23.533 -16.349 1.00 42.35 ? 252 LYS B CA    1 
ATOM   4582 C C     . LYS B 1 206 ? 35.956  -22.745 -15.416 1.00 41.69 ? 252 LYS B C     1 
ATOM   4583 O O     . LYS B 1 206 ? 36.124  -22.846 -14.199 1.00 43.17 ? 252 LYS B O     1 
ATOM   4584 C CB    . LYS B 1 206 ? 37.864  -24.313 -15.516 1.00 42.85 ? 252 LYS B CB    1 
ATOM   4585 C CG    . LYS B 1 206 ? 38.946  -25.073 -16.317 1.00 46.30 ? 252 LYS B CG    1 
ATOM   4586 C CD    . LYS B 1 206 ? 38.369  -26.116 -17.293 1.00 50.77 ? 252 LYS B CD    1 
ATOM   4587 C CE    . LYS B 1 206 ? 39.273  -26.269 -18.515 1.00 54.73 ? 252 LYS B CE    1 
ATOM   4588 N NZ    . LYS B 1 206 ? 38.883  -25.313 -19.612 1.00 55.82 ? 252 LYS B NZ    1 
ATOM   4589 N N     . PHE B 1 207 ? 35.045  -21.955 -15.970 1.00 40.97 ? 253 PHE B N     1 
ATOM   4590 C CA    . PHE B 1 207 ? 34.082  -21.204 -15.179 1.00 39.91 ? 253 PHE B CA    1 
ATOM   4591 C C     . PHE B 1 207 ? 32.764  -21.263 -15.893 1.00 40.78 ? 253 PHE B C     1 
ATOM   4592 O O     . PHE B 1 207 ? 32.626  -20.740 -16.976 1.00 41.60 ? 253 PHE B O     1 
ATOM   4593 C CB    . PHE B 1 207 ? 34.470  -19.743 -14.995 1.00 37.84 ? 253 PHE B CB    1 
ATOM   4594 C CG    . PHE B 1 207 ? 33.516  -18.979 -14.113 1.00 34.58 ? 253 PHE B CG    1 
ATOM   4595 C CD1   . PHE B 1 207 ? 33.758  -18.862 -12.749 1.00 31.22 ? 253 PHE B CD1   1 
ATOM   4596 C CD2   . PHE B 1 207 ? 32.371  -18.388 -14.655 1.00 32.34 ? 253 PHE B CD2   1 
ATOM   4597 C CE1   . PHE B 1 207 ? 32.915  -18.175 -11.954 1.00 32.43 ? 253 PHE B CE1   1 
ATOM   4598 C CE2   . PHE B 1 207 ? 31.493  -17.706 -13.879 1.00 30.09 ? 253 PHE B CE2   1 
ATOM   4599 C CZ    . PHE B 1 207 ? 31.754  -17.587 -12.496 1.00 34.60 ? 253 PHE B CZ    1 
ATOM   4600 N N     . ASP B 1 208 ? 31.770  -21.859 -15.271 1.00 41.73 ? 254 ASP B N     1 
ATOM   4601 C CA    . ASP B 1 208 ? 30.551  -22.082 -15.997 1.00 43.06 ? 254 ASP B CA    1 
ATOM   4602 C C     . ASP B 1 208 ? 29.692  -20.841 -15.772 1.00 43.57 ? 254 ASP B C     1 
ATOM   4603 O O     . ASP B 1 208 ? 29.345  -20.525 -14.625 1.00 42.73 ? 254 ASP B O     1 
ATOM   4604 C CB    . ASP B 1 208 ? 29.900  -23.393 -15.550 1.00 42.68 ? 254 ASP B CB    1 
ATOM   4605 C CG    . ASP B 1 208 ? 28.521  -23.561 -16.083 1.00 44.55 ? 254 ASP B CG    1 
ATOM   4606 O OD1   . ASP B 1 208 ? 28.191  -22.996 -17.145 1.00 46.67 ? 254 ASP B OD1   1 
ATOM   4607 O OD2   . ASP B 1 208 ? 27.741  -24.273 -15.425 1.00 51.03 ? 254 ASP B OD2   1 
ATOM   4608 N N     . MET B 1 209 ? 29.398  -20.135 -16.877 1.00 43.97 ? 255 MET B N     1 
ATOM   4609 C CA    . MET B 1 209 ? 28.726  -18.841 -16.832 1.00 44.39 ? 255 MET B CA    1 
ATOM   4610 C C     . MET B 1 209 ? 27.310  -18.959 -16.267 1.00 45.00 ? 255 MET B C     1 
ATOM   4611 O O     . MET B 1 209 ? 26.740  -17.974 -15.802 1.00 44.77 ? 255 MET B O     1 
ATOM   4612 C CB    . MET B 1 209 ? 28.700  -18.186 -18.218 1.00 44.80 ? 255 MET B CB    1 
ATOM   4613 C CG    . MET B 1 209 ? 30.027  -17.480 -18.642 1.00 44.58 ? 255 MET B CG    1 
ATOM   4614 S SD    . MET B 1 209 ? 30.626  -16.241 -17.469 1.00 45.97 ? 255 MET B SD    1 
ATOM   4615 C CE    . MET B 1 209 ? 32.387  -16.434 -17.681 1.00 44.37 ? 255 MET B CE    1 
ATOM   4616 N N     . GLU B 1 210 ? 26.767  -20.182 -16.304 1.00 45.56 ? 256 GLU B N     1 
ATOM   4617 C CA    . GLU B 1 210 ? 25.422  -20.482 -15.822 1.00 46.21 ? 256 GLU B CA    1 
ATOM   4618 C C     . GLU B 1 210 ? 25.357  -20.409 -14.302 1.00 45.11 ? 256 GLU B C     1 
ATOM   4619 O O     . GLU B 1 210 ? 24.287  -20.363 -13.729 1.00 45.83 ? 256 GLU B O     1 
ATOM   4620 C CB    . GLU B 1 210 ? 24.943  -21.845 -16.341 1.00 46.32 ? 256 GLU B CB    1 
ATOM   4621 C CG    . GLU B 1 210 ? 24.533  -21.844 -17.833 1.00 48.01 ? 256 GLU B CG    1 
ATOM   4622 C CD    . GLU B 1 210 ? 23.844  -23.140 -18.280 1.00 48.91 ? 256 GLU B CD    1 
ATOM   4623 O OE1   . GLU B 1 210 ? 23.856  -24.141 -17.515 1.00 54.60 ? 256 GLU B OE1   1 
ATOM   4624 O OE2   . GLU B 1 210 ? 23.301  -23.172 -19.408 1.00 51.66 ? 256 GLU B OE2   1 
ATOM   4625 N N     . GLN B 1 211 ? 26.511  -20.410 -13.659 1.00 44.27 ? 257 GLN B N     1 
ATOM   4626 C CA    . GLN B 1 211 ? 26.632  -19.990 -12.275 1.00 44.07 ? 257 GLN B CA    1 
ATOM   4627 C C     . GLN B 1 211 ? 25.949  -18.633 -12.006 1.00 43.15 ? 257 GLN B C     1 
ATOM   4628 O O     . GLN B 1 211 ? 25.464  -18.387 -10.915 1.00 42.93 ? 257 GLN B O     1 
ATOM   4629 C CB    . GLN B 1 211 ? 28.120  -19.825 -11.906 1.00 43.90 ? 257 GLN B CB    1 
ATOM   4630 C CG    . GLN B 1 211 ? 28.841  -21.082 -11.620 1.00 44.48 ? 257 GLN B CG    1 
ATOM   4631 C CD    . GLN B 1 211 ? 30.305  -20.835 -11.404 1.00 47.45 ? 257 GLN B CD    1 
ATOM   4632 O OE1   . GLN B 1 211 ? 30.738  -20.669 -10.272 1.00 49.07 ? 257 GLN B OE1   1 
ATOM   4633 N NE2   . GLN B 1 211 ? 31.085  -20.780 -12.498 1.00 49.45 ? 257 GLN B NE2   1 
ATOM   4634 N N     . LEU B 1 212 ? 25.956  -17.749 -12.991 1.00 42.60 ? 258 LEU B N     1 
ATOM   4635 C CA    . LEU B 1 212 ? 25.469  -16.399 -12.772 1.00 42.82 ? 258 LEU B CA    1 
ATOM   4636 C C     . LEU B 1 212 ? 23.941  -16.262 -12.917 1.00 42.50 ? 258 LEU B C     1 
ATOM   4637 O O     . LEU B 1 212 ? 23.393  -15.206 -12.643 1.00 42.60 ? 258 LEU B O     1 
ATOM   4638 C CB    . LEU B 1 212 ? 26.260  -15.377 -13.609 1.00 43.15 ? 258 LEU B CB    1 
ATOM   4639 C CG    . LEU B 1 212 ? 27.804  -15.448 -13.587 1.00 43.64 ? 258 LEU B CG    1 
ATOM   4640 C CD1   . LEU B 1 212 ? 28.420  -14.737 -14.777 1.00 46.09 ? 258 LEU B CD1   1 
ATOM   4641 C CD2   . LEU B 1 212 ? 28.390  -14.907 -12.324 1.00 45.73 ? 258 LEU B CD2   1 
ATOM   4642 N N     . LYS B 1 213 ? 23.267  -17.343 -13.308 1.00 42.30 ? 259 LYS B N     1 
ATOM   4643 C CA    . LYS B 1 213 ? 21.800  -17.415 -13.343 1.00 42.91 ? 259 LYS B CA    1 
ATOM   4644 C C     . LYS B 1 213 ? 21.214  -17.018 -11.984 1.00 41.97 ? 259 LYS B C     1 
ATOM   4645 O O     . LYS B 1 213 ? 21.602  -17.549 -10.961 1.00 41.98 ? 259 LYS B O     1 
ATOM   4646 C CB    . LYS B 1 213 ? 21.355  -18.833 -13.749 1.00 42.57 ? 259 LYS B CB    1 
ATOM   4647 C CG    . LYS B 1 213 ? 19.929  -18.936 -14.370 1.00 44.53 ? 259 LYS B CG    1 
ATOM   4648 C CD    . LYS B 1 213 ? 19.711  -20.260 -15.177 1.00 45.33 ? 259 LYS B CD    1 
ATOM   4649 C CE    . LYS B 1 213 ? 21.047  -20.766 -15.871 1.00 48.57 ? 259 LYS B CE    1 
ATOM   4650 N NZ    . LYS B 1 213 ? 20.974  -21.295 -17.293 1.00 49.58 ? 259 LYS B NZ    1 
ATOM   4651 N N     . ASP B 1 214 ? 20.309  -16.053 -11.980 1.00 42.02 ? 260 ASP B N     1 
ATOM   4652 C CA    . ASP B 1 214 ? 19.679  -15.533 -10.745 1.00 42.37 ? 260 ASP B CA    1 
ATOM   4653 C C     . ASP B 1 214 ? 20.656  -15.090 -9.647  1.00 42.22 ? 260 ASP B C     1 
ATOM   4654 O O     . ASP B 1 214 ? 20.347  -15.251 -8.453  1.00 42.81 ? 260 ASP B O     1 
ATOM   4655 C CB    . ASP B 1 214 ? 18.629  -16.499 -10.152 1.00 43.16 ? 260 ASP B CB    1 
ATOM   4656 C CG    . ASP B 1 214 ? 17.424  -16.698 -11.066 1.00 44.90 ? 260 ASP B CG    1 
ATOM   4657 O OD1   . ASP B 1 214 ? 16.710  -15.712 -11.405 1.00 47.79 ? 260 ASP B OD1   1 
ATOM   4658 O OD2   . ASP B 1 214 ? 17.195  -17.858 -11.459 1.00 48.44 ? 260 ASP B OD2   1 
ATOM   4659 N N     . SER B 1 215 ? 21.811  -14.544 -10.048 1.00 40.65 ? 261 SER B N     1 
ATOM   4660 C CA    . SER B 1 215 ? 22.786  -14.041 -9.105  1.00 39.43 ? 261 SER B CA    1 
ATOM   4661 C C     . SER B 1 215 ? 22.995  -12.512 -9.195  1.00 37.94 ? 261 SER B C     1 
ATOM   4662 O O     . SER B 1 215 ? 23.765  -11.945 -8.425  1.00 37.64 ? 261 SER B O     1 
ATOM   4663 C CB    . SER B 1 215 ? 24.116  -14.804 -9.231  1.00 40.48 ? 261 SER B CB    1 
ATOM   4664 O OG    . SER B 1 215 ? 24.881  -14.326 -10.339 1.00 42.78 ? 261 SER B OG    1 
ATOM   4665 N N     . ILE B 1 216 ? 22.283  -11.836 -10.082 1.00 36.38 ? 262 ILE B N     1 
ATOM   4666 C CA    . ILE B 1 216 ? 22.357  -10.385 -10.140 1.00 35.37 ? 262 ILE B CA    1 
ATOM   4667 C C     . ILE B 1 216 ? 21.151  -9.674  -9.489  1.00 36.10 ? 262 ILE B C     1 
ATOM   4668 O O     . ILE B 1 216 ? 20.002  -10.018 -9.737  1.00 34.90 ? 262 ILE B O     1 
ATOM   4669 C CB    . ILE B 1 216 ? 22.507  -9.858  -11.606 1.00 35.28 ? 262 ILE B CB    1 
ATOM   4670 C CG1   . ILE B 1 216 ? 23.788  -10.402 -12.260 1.00 33.07 ? 262 ILE B CG1   1 
ATOM   4671 C CG2   . ILE B 1 216 ? 22.366  -8.288  -11.647 1.00 32.85 ? 262 ILE B CG2   1 
ATOM   4672 C CD1   . ILE B 1 216 ? 25.094  -9.692  -11.792 1.00 28.98 ? 262 ILE B CD1   1 
ATOM   4673 N N     . ASP B 1 217 ? 21.446  -8.665  -8.659  1.00 36.68 ? 263 ASP B N     1 
ATOM   4674 C CA    . ASP B 1 217 ? 20.430  -7.707  -8.233  1.00 36.11 ? 263 ASP B CA    1 
ATOM   4675 C C     . ASP B 1 217 ? 20.228  -6.643  -9.322  1.00 35.83 ? 263 ASP B C     1 
ATOM   4676 O O     . ASP B 1 217 ? 20.961  -5.656  -9.404  1.00 35.38 ? 263 ASP B O     1 
ATOM   4677 C CB    . ASP B 1 217 ? 20.773  -7.120  -6.871  1.00 36.08 ? 263 ASP B CB    1 
ATOM   4678 C CG    . ASP B 1 217 ? 19.602  -6.388  -6.248  1.00 38.80 ? 263 ASP B CG    1 
ATOM   4679 O OD1   . ASP B 1 217 ? 18.752  -5.801  -7.017  1.00 36.50 ? 263 ASP B OD1   1 
ATOM   4680 O OD2   . ASP B 1 217 ? 19.552  -6.401  -4.983  1.00 38.47 ? 263 ASP B OD2   1 
ATOM   4681 N N     . ARG B 1 218 ? 19.215  -6.895  -10.158 1.00 35.61 ? 264 ARG B N     1 
ATOM   4682 C CA    . ARG B 1 218 ? 18.949  -6.193  -11.403 1.00 35.03 ? 264 ARG B CA    1 
ATOM   4683 C C     . ARG B 1 218 ? 18.526  -4.726  -11.233 1.00 35.14 ? 264 ARG B C     1 
ATOM   4684 O O     . ARG B 1 218 ? 18.423  -3.981  -12.229 1.00 33.61 ? 264 ARG B O     1 
ATOM   4685 C CB    . ARG B 1 218 ? 17.848  -6.948  -12.204 1.00 36.10 ? 264 ARG B CB    1 
ATOM   4686 C CG    . ARG B 1 218 ? 18.166  -8.432  -12.576 1.00 33.19 ? 264 ARG B CG    1 
ATOM   4687 C CD    . ARG B 1 218 ? 16.979  -9.039  -13.367 1.00 33.84 ? 264 ARG B CD    1 
ATOM   4688 N NE    . ARG B 1 218 ? 16.676  -8.508  -14.727 1.00 30.01 ? 264 ARG B NE    1 
ATOM   4689 C CZ    . ARG B 1 218 ? 17.169  -9.042  -15.853 1.00 27.96 ? 264 ARG B CZ    1 
ATOM   4690 N NH1   . ARG B 1 218 ? 17.989  -10.075 -15.785 1.00 27.64 ? 264 ARG B NH1   1 
ATOM   4691 N NH2   . ARG B 1 218 ? 16.840  -8.562  -17.042 1.00 28.25 ? 264 ARG B NH2   1 
ATOM   4692 N N     . GLU B 1 219 ? 18.265  -4.332  -9.989  1.00 34.44 ? 265 GLU B N     1 
ATOM   4693 C CA    . GLU B 1 219 ? 17.923  -2.952  -9.685  1.00 35.30 ? 265 GLU B CA    1 
ATOM   4694 C C     . GLU B 1 219 ? 19.129  -2.114  -9.183  1.00 33.46 ? 265 GLU B C     1 
ATOM   4695 O O     . GLU B 1 219 ? 19.066  -0.891  -9.142  1.00 33.59 ? 265 GLU B O     1 
ATOM   4696 C CB    . GLU B 1 219 ? 16.785  -2.919  -8.654  1.00 35.54 ? 265 GLU B CB    1 
ATOM   4697 C CG    . GLU B 1 219 ? 15.400  -3.085  -9.255  1.00 36.72 ? 265 GLU B CG    1 
ATOM   4698 C CD    . GLU B 1 219 ? 14.298  -2.961  -8.200  1.00 39.09 ? 265 GLU B CD    1 
ATOM   4699 O OE1   . GLU B 1 219 ? 14.523  -3.464  -7.040  1.00 38.11 ? 265 GLU B OE1   1 
ATOM   4700 O OE2   . GLU B 1 219 ? 13.216  -2.377  -8.557  1.00 41.78 ? 265 GLU B OE2   1 
ATOM   4701 N N     . LYS B 1 220 ? 20.201  -2.782  -8.783  1.00 31.35 ? 266 LYS B N     1 
ATOM   4702 C CA    . LYS B 1 220 ? 21.394  -2.112  -8.278  1.00 29.22 ? 266 LYS B CA    1 
ATOM   4703 C C     . LYS B 1 220 ? 22.543  -2.168  -9.303  1.00 27.96 ? 266 LYS B C     1 
ATOM   4704 O O     . LYS B 1 220 ? 23.480  -2.967  -9.179  1.00 27.45 ? 266 LYS B O     1 
ATOM   4705 C CB    . LYS B 1 220 ? 21.768  -2.775  -6.965  1.00 30.13 ? 266 LYS B CB    1 
ATOM   4706 C CG    . LYS B 1 220 ? 20.635  -2.618  -5.910  1.00 30.31 ? 266 LYS B CG    1 
ATOM   4707 C CD    . LYS B 1 220 ? 20.907  -3.437  -4.709  1.00 33.44 ? 266 LYS B CD    1 
ATOM   4708 C CE    . LYS B 1 220 ? 19.938  -3.152  -3.591  1.00 35.41 ? 266 LYS B CE    1 
ATOM   4709 N NZ    . LYS B 1 220 ? 18.515  -3.321  -4.013  1.00 37.89 ? 266 LYS B NZ    1 
ATOM   4710 N N     . ILE B 1 221 ? 22.438  -1.334  -10.332 1.00 25.97 ? 267 ILE B N     1 
ATOM   4711 C CA    . ILE B 1 221 ? 23.448  -1.250  -11.354 1.00 25.34 ? 267 ILE B CA    1 
ATOM   4712 C C     . ILE B 1 221 ? 24.123  0.121   -11.402 1.00 25.07 ? 267 ILE B C     1 
ATOM   4713 O O     . ILE B 1 221 ? 23.442  1.171   -11.475 1.00 24.62 ? 267 ILE B O     1 
ATOM   4714 C CB    . ILE B 1 221 ? 22.886  -1.658  -12.728 1.00 26.11 ? 267 ILE B CB    1 
ATOM   4715 C CG1   . ILE B 1 221 ? 22.382  -3.109  -12.676 1.00 27.81 ? 267 ILE B CG1   1 
ATOM   4716 C CG2   . ILE B 1 221 ? 23.950  -1.566  -13.812 1.00 24.20 ? 267 ILE B CG2   1 
ATOM   4717 C CD1   . ILE B 1 221 ? 21.099  -3.194  -13.361 1.00 28.21 ? 267 ILE B CD1   1 
ATOM   4718 N N     . ALA B 1 222 ? 25.463  0.076   -11.368 1.00 24.33 ? 268 ALA B N     1 
ATOM   4719 C CA    . ALA B 1 222 ? 26.318  1.259   -11.458 1.00 24.98 ? 268 ALA B CA    1 
ATOM   4720 C C     . ALA B 1 222 ? 27.400  1.109   -12.549 1.00 25.31 ? 268 ALA B C     1 
ATOM   4721 O O     . ALA B 1 222 ? 27.797  0.008   -12.898 1.00 25.82 ? 268 ALA B O     1 
ATOM   4722 C CB    . ALA B 1 222 ? 26.959  1.591   -10.067 1.00 24.06 ? 268 ALA B CB    1 
ATOM   4723 N N     . VAL B 1 223 ? 27.797  2.219   -13.150 1.00 26.69 ? 269 VAL B N     1 
ATOM   4724 C CA    . VAL B 1 223 ? 28.909  2.233   -14.081 1.00 27.55 ? 269 VAL B CA    1 
ATOM   4725 C C     . VAL B 1 223 ? 30.031  3.077   -13.419 1.00 28.25 ? 269 VAL B C     1 
ATOM   4726 O O     . VAL B 1 223 ? 29.770  4.155   -12.841 1.00 29.00 ? 269 VAL B O     1 
ATOM   4727 C CB    . VAL B 1 223 ? 28.511  2.659   -15.528 1.00 27.11 ? 269 VAL B CB    1 
ATOM   4728 C CG1   . VAL B 1 223 ? 27.715  3.937   -15.552 1.00 30.19 ? 269 VAL B CG1   1 
ATOM   4729 C CG2   . VAL B 1 223 ? 29.762  2.812   -16.463 1.00 26.80 ? 269 VAL B CG2   1 
ATOM   4730 N N     . ILE B 1 224 ? 31.242  2.535   -13.411 1.00 26.99 ? 270 ILE B N     1 
ATOM   4731 C CA    . ILE B 1 224 ? 32.410  3.228   -12.875 1.00 26.12 ? 270 ILE B CA    1 
ATOM   4732 C C     . ILE B 1 224 ? 33.464  3.246   -13.968 1.00 26.86 ? 270 ILE B C     1 
ATOM   4733 O O     . ILE B 1 224 ? 33.436  2.400   -14.872 1.00 26.31 ? 270 ILE B O     1 
ATOM   4734 C CB    . ILE B 1 224 ? 32.925  2.605   -11.555 1.00 25.30 ? 270 ILE B CB    1 
ATOM   4735 C CG1   . ILE B 1 224 ? 31.799  2.686   -10.502 1.00 24.12 ? 270 ILE B CG1   1 
ATOM   4736 C CG2   . ILE B 1 224 ? 34.165  3.388   -11.067 1.00 23.43 ? 270 ILE B CG2   1 
ATOM   4737 C CD1   . ILE B 1 224 ? 32.012  1.962   -9.227  1.00 20.81 ? 270 ILE B CD1   1 
ATOM   4738 N N     . GLY B 1 225 ? 34.347  4.245   -13.945 1.00 27.24 ? 271 GLY B N     1 
ATOM   4739 C CA    . GLY B 1 225 ? 35.408  4.287   -14.930 1.00 28.20 ? 271 GLY B CA    1 
ATOM   4740 C C     . GLY B 1 225 ? 36.438  5.366   -14.675 1.00 29.49 ? 271 GLY B C     1 
ATOM   4741 O O     . GLY B 1 225 ? 36.091  6.456   -14.217 1.00 30.27 ? 271 GLY B O     1 
ATOM   4742 N N     . HIS B 1 226 ? 37.687  5.069   -15.061 1.00 29.65 ? 272 HIS B N     1 
ATOM   4743 C CA    . HIS B 1 226 ? 38.830  5.953   -14.940 1.00 27.89 ? 272 HIS B CA    1 
ATOM   4744 C C     . HIS B 1 226 ? 39.070  6.682   -16.223 1.00 27.83 ? 272 HIS B C     1 
ATOM   4745 O O     . HIS B 1 226 ? 39.154  6.103   -17.314 1.00 29.03 ? 272 HIS B O     1 
ATOM   4746 C CB    . HIS B 1 226 ? 40.092  5.168   -14.557 1.00 28.17 ? 272 HIS B CB    1 
ATOM   4747 C CG    . HIS B 1 226 ? 41.352  6.000   -14.497 1.00 29.11 ? 272 HIS B CG    1 
ATOM   4748 N ND1   . HIS B 1 226 ? 42.463  5.723   -15.271 1.00 27.05 ? 272 HIS B ND1   1 
ATOM   4749 C CD2   . HIS B 1 226 ? 41.680  7.088   -13.754 1.00 27.25 ? 272 HIS B CD2   1 
ATOM   4750 C CE1   . HIS B 1 226 ? 43.428  6.580   -14.986 1.00 24.95 ? 272 HIS B CE1   1 
ATOM   4751 N NE2   . HIS B 1 226 ? 42.986  7.413   -14.066 1.00 26.68 ? 272 HIS B NE2   1 
ATOM   4752 N N     . SER B 1 227 ? 39.057  8.319   -16.229 1.00 31.07 ? 273 SER B N     1 
ATOM   4753 C CA    . SER B 1 227 ? 39.827  8.987   -17.254 1.00 32.22 ? 273 SER B CA    1 
ATOM   4754 C C     . SER B 1 227 ? 39.053  8.976   -18.539 1.00 30.83 ? 273 SER B C     1 
ATOM   4755 O O     . SER B 1 227 ? 37.961  9.502   -18.680 1.00 30.41 ? 273 SER B O     1 
ATOM   4756 C CB    . SER B 1 227 ? 41.162  8.296   -17.447 1.00 32.60 ? 273 SER B CB    1 
ATOM   4757 O OG    . SER B 1 227 ? 41.870  9.084   -18.379 1.00 37.32 ? 273 SER B OG    1 
ATOM   4758 N N     . PHE B 1 228 ? 39.234  8.164   -19.946 1.00 22.53 ? 274 PHE B N     1 
ATOM   4759 C CA    . PHE B 1 228 ? 38.348  8.033   -21.060 1.00 22.18 ? 274 PHE B CA    1 
ATOM   4760 C C     . PHE B 1 228 ? 37.192  7.237   -20.442 1.00 24.06 ? 274 PHE B C     1 
ATOM   4761 O O     . PHE B 1 228 ? 36.039  7.418   -20.856 1.00 25.49 ? 274 PHE B O     1 
ATOM   4762 C CB    . PHE B 1 228 ? 39.050  7.317   -22.173 1.00 21.51 ? 274 PHE B CB    1 
ATOM   4763 C CG    . PHE B 1 228 ? 38.486  7.586   -23.537 1.00 20.58 ? 274 PHE B CG    1 
ATOM   4764 C CD1   . PHE B 1 228 ? 39.233  7.302   -24.658 1.00 19.24 ? 274 PHE B CD1   1 
ATOM   4765 C CD2   . PHE B 1 228 ? 37.206  8.085   -23.712 1.00 21.76 ? 274 PHE B CD2   1 
ATOM   4766 C CE1   . PHE B 1 228 ? 38.741  7.533   -25.921 1.00 21.25 ? 274 PHE B CE1   1 
ATOM   4767 C CE2   . PHE B 1 228 ? 36.700  8.310   -25.020 1.00 21.57 ? 274 PHE B CE2   1 
ATOM   4768 C CZ    . PHE B 1 228 ? 37.474  8.045   -26.098 1.00 20.51 ? 274 PHE B CZ    1 
ATOM   4769 N N     . GLY B 1 229 ? 37.479  6.450   -19.401 1.00 24.38 ? 275 GLY B N     1 
ATOM   4770 C CA    . GLY B 1 229 ? 36.442  5.697   -18.688 1.00 25.43 ? 275 GLY B CA    1 
ATOM   4771 C C     . GLY B 1 229 ? 35.466  6.515   -17.865 1.00 25.77 ? 275 GLY B C     1 
ATOM   4772 O O     . GLY B 1 229 ? 34.399  6.040   -17.506 1.00 25.04 ? 275 GLY B O     1 
ATOM   4773 N N     . GLY B 1 230 ? 35.871  7.738   -17.516 1.00 27.41 ? 276 GLY B N     1 
ATOM   4774 C CA    . GLY B 1 230 ? 35.061  8.664   -16.719 1.00 26.72 ? 276 GLY B CA    1 
ATOM   4775 C C     . GLY B 1 230 ? 34.102  9.403   -17.623 1.00 26.68 ? 276 GLY B C     1 
ATOM   4776 O O     . GLY B 1 230 ? 32.974  9.680   -17.240 1.00 27.94 ? 276 GLY B O     1 
ATOM   4777 N N     . ALA B 1 231 ? 34.560  9.757   -18.819 1.00 27.42 ? 277 ALA B N     1 
ATOM   4778 C CA    . ALA B 1 231 ? 33.675  10.266  -19.887 1.00 27.48 ? 277 ALA B CA    1 
ATOM   4779 C C     . ALA B 1 231 ? 32.660  9.202   -20.338 1.00 27.23 ? 277 ALA B C     1 
ATOM   4780 O O     . ALA B 1 231 ? 31.534  9.510   -20.694 1.00 28.83 ? 277 ALA B O     1 
ATOM   4781 C CB    . ALA B 1 231 ? 34.493  10.713  -21.077 1.00 26.13 ? 277 ALA B CB    1 
ATOM   4782 N N     . THR B 1 232 ? 33.100  7.955   -20.351 1.00 27.23 ? 278 THR B N     1 
ATOM   4783 C CA    . THR B 1 232 ? 32.251  6.814   -20.599 1.00 26.57 ? 278 THR B CA    1 
ATOM   4784 C C     . THR B 1 232 ? 31.134  6.677   -19.594 1.00 26.57 ? 278 THR B C     1 
ATOM   4785 O O     . THR B 1 232 ? 30.006  6.495   -19.997 1.00 27.51 ? 278 THR B O     1 
ATOM   4786 C CB    . THR B 1 232 ? 33.091  5.564   -20.717 1.00 25.68 ? 278 THR B CB    1 
ATOM   4787 O OG1   . THR B 1 232 ? 34.018  5.784   -21.779 1.00 27.15 ? 278 THR B OG1   1 
ATOM   4788 C CG2   . THR B 1 232 ? 32.244  4.354   -21.089 1.00 25.42 ? 278 THR B CG2   1 
ATOM   4789 N N     . VAL B 1 233 ? 31.438  6.789   -18.309 1.00 26.47 ? 279 VAL B N     1 
ATOM   4790 C CA    . VAL B 1 233 ? 30.415  6.905   -17.275 1.00 27.12 ? 279 VAL B CA    1 
ATOM   4791 C C     . VAL B 1 233 ? 29.271  7.833   -17.678 1.00 28.55 ? 279 VAL B C     1 
ATOM   4792 O O     . VAL B 1 233 ? 28.108  7.419   -17.762 1.00 30.33 ? 279 VAL B O     1 
ATOM   4793 C CB    . VAL B 1 233 ? 31.000  7.320   -15.866 1.00 26.66 ? 279 VAL B CB    1 
ATOM   4794 C CG1   . VAL B 1 233 ? 29.891  7.610   -14.861 1.00 23.21 ? 279 VAL B CG1   1 
ATOM   4795 C CG2   . VAL B 1 233 ? 31.856  6.197   -15.291 1.00 27.42 ? 279 VAL B CG2   1 
ATOM   4796 N N     . ILE B 1 234 ? 29.612  9.082   -17.941 1.00 29.00 ? 280 ILE B N     1 
ATOM   4797 C CA    . ILE B 1 234 ? 28.647  10.113  -18.221 1.00 29.33 ? 280 ILE B CA    1 
ATOM   4798 C C     . ILE B 1 234 ? 27.831  9.818   -19.468 1.00 29.20 ? 280 ILE B C     1 
ATOM   4799 O O     . ILE B 1 234 ? 26.622  10.029  -19.494 1.00 30.16 ? 280 ILE B O     1 
ATOM   4800 C CB    . ILE B 1 234 ? 29.367  11.500  -18.359 1.00 29.13 ? 280 ILE B CB    1 
ATOM   4801 C CG1   . ILE B 1 234 ? 29.753  11.993  -16.972 1.00 28.11 ? 280 ILE B CG1   1 
ATOM   4802 C CG2   . ILE B 1 234 ? 28.502  12.512  -19.179 1.00 27.83 ? 280 ILE B CG2   1 
ATOM   4803 C CD1   . ILE B 1 234 ? 30.797  13.064  -16.981 1.00 32.82 ? 280 ILE B CD1   1 
ATOM   4804 N N     . GLN B 1 235 ? 28.487  9.371   -20.517 1.00 28.49 ? 281 GLN B N     1 
ATOM   4805 C CA    . GLN B 1 235 ? 27.778  9.129   -21.746 1.00 27.80 ? 281 GLN B CA    1 
ATOM   4806 C C     . GLN B 1 235 ? 26.878  7.878   -21.580 1.00 28.15 ? 281 GLN B C     1 
ATOM   4807 O O     . GLN B 1 235 ? 25.858  7.755   -22.225 1.00 28.21 ? 281 GLN B O     1 
ATOM   4808 C CB    . GLN B 1 235 ? 28.769  8.950   -22.895 1.00 27.09 ? 281 GLN B CB    1 
ATOM   4809 C CG    . GLN B 1 235 ? 28.148  8.659   -24.245 1.00 28.97 ? 281 GLN B CG    1 
ATOM   4810 C CD    . GLN B 1 235 ? 27.699  9.934   -24.941 1.00 34.73 ? 281 GLN B CD    1 
ATOM   4811 O OE1   . GLN B 1 235 ? 28.203  11.007  -24.653 1.00 36.67 ? 281 GLN B OE1   1 
ATOM   4812 N NE2   . GLN B 1 235 ? 26.762  9.816   -25.861 1.00 33.49 ? 281 GLN B NE2   1 
ATOM   4813 N N     . THR B 1 236 ? 27.281  6.938   -20.732 1.00 27.90 ? 282 THR B N     1 
ATOM   4814 C CA    . THR B 1 236 ? 26.551  5.680   -20.639 1.00 27.31 ? 282 THR B CA    1 
ATOM   4815 C C     . THR B 1 236 ? 25.295  5.943   -19.810 1.00 28.35 ? 282 THR B C     1 
ATOM   4816 O O     . THR B 1 236 ? 24.228  5.421   -20.123 1.00 28.56 ? 282 THR B O     1 
ATOM   4817 C CB    . THR B 1 236 ? 27.398  4.563   -19.960 1.00 27.20 ? 282 THR B CB    1 
ATOM   4818 O OG1   . THR B 1 236 ? 28.538  4.250   -20.775 1.00 23.55 ? 282 THR B OG1   1 
ATOM   4819 C CG2   . THR B 1 236 ? 26.563  3.287   -19.702 1.00 24.36 ? 282 THR B CG2   1 
ATOM   4820 N N     . LEU B 1 237 ? 25.456  6.716   -18.737 1.00 28.89 ? 283 LEU B N     1 
ATOM   4821 C CA    . LEU B 1 237 ? 24.344  7.142   -17.883 1.00 29.81 ? 283 LEU B CA    1 
ATOM   4822 C C     . LEU B 1 237 ? 23.234  7.879   -18.642 1.00 30.85 ? 283 LEU B C     1 
ATOM   4823 O O     . LEU B 1 237 ? 22.068  7.669   -18.359 1.00 31.34 ? 283 LEU B O     1 
ATOM   4824 C CB    . LEU B 1 237 ? 24.854  8.047   -16.780 1.00 29.01 ? 283 LEU B CB    1 
ATOM   4825 C CG    . LEU B 1 237 ? 25.537  7.419   -15.567 1.00 26.68 ? 283 LEU B CG    1 
ATOM   4826 C CD1   . LEU B 1 237 ? 26.049  8.531   -14.670 1.00 23.89 ? 283 LEU B CD1   1 
ATOM   4827 C CD2   . LEU B 1 237 ? 24.636  6.481   -14.817 1.00 17.94 ? 283 LEU B CD2   1 
ATOM   4828 N N     . SER B 1 238 ? 23.632  8.761   -19.564 1.00 31.99 ? 284 SER B N     1 
ATOM   4829 C CA    . SER B 1 238 ? 22.754  9.549   -20.436 1.00 32.42 ? 284 SER B CA    1 
ATOM   4830 C C     . SER B 1 238 ? 22.062  8.734   -21.584 1.00 33.13 ? 284 SER B C     1 
ATOM   4831 O O     . SER B 1 238 ? 20.951  9.093   -22.040 1.00 33.57 ? 284 SER B O     1 
ATOM   4832 C CB    . SER B 1 238 ? 23.575  10.676  -21.021 1.00 31.63 ? 284 SER B CB    1 
ATOM   4833 O OG    . SER B 1 238 ? 22.999  11.227  -22.205 1.00 36.28 ? 284 SER B OG    1 
ATOM   4834 N N     . GLU B 1 239 ? 22.719  7.673   -22.066 1.00 32.54 ? 285 GLU B N     1 
ATOM   4835 C CA    . GLU B 1 239 ? 22.134  6.759   -23.041 1.00 32.24 ? 285 GLU B CA    1 
ATOM   4836 C C     . GLU B 1 239 ? 21.295  5.632   -22.403 1.00 31.38 ? 285 GLU B C     1 
ATOM   4837 O O     . GLU B 1 239 ? 20.438  5.070   -23.066 1.00 31.97 ? 285 GLU B O     1 
ATOM   4838 C CB    . GLU B 1 239 ? 23.227  6.168   -23.951 1.00 31.67 ? 285 GLU B CB    1 
ATOM   4839 C CG    . GLU B 1 239 ? 24.124  7.244   -24.560 1.00 31.33 ? 285 GLU B CG    1 
ATOM   4840 C CD    . GLU B 1 239 ? 24.834  6.810   -25.861 1.00 34.51 ? 285 GLU B CD    1 
ATOM   4841 O OE1   . GLU B 1 239 ? 24.872  5.586   -26.139 1.00 37.37 ? 285 GLU B OE1   1 
ATOM   4842 O OE2   . GLU B 1 239 ? 25.333  7.695   -26.616 1.00 33.41 ? 285 GLU B OE2   1 
ATOM   4843 N N     . ASP B 1 240 ? 21.518  5.299   -21.139 1.00 29.40 ? 286 ASP B N     1 
ATOM   4844 C CA    . ASP B 1 240 ? 21.050  4.009   -20.645 1.00 28.43 ? 286 ASP B CA    1 
ATOM   4845 C C     . ASP B 1 240 ? 20.570  4.158   -19.203 1.00 27.70 ? 286 ASP B C     1 
ATOM   4846 O O     . ASP B 1 240 ? 21.332  4.084   -18.232 1.00 26.08 ? 286 ASP B O     1 
ATOM   4847 C CB    . ASP B 1 240 ? 22.152  2.922   -20.832 1.00 28.86 ? 286 ASP B CB    1 
ATOM   4848 C CG    . ASP B 1 240 ? 21.687  1.452   -20.539 1.00 30.57 ? 286 ASP B CG    1 
ATOM   4849 O OD1   . ASP B 1 240 ? 20.651  1.198   -19.892 1.00 34.25 ? 286 ASP B OD1   1 
ATOM   4850 O OD2   . ASP B 1 240 ? 22.407  0.516   -20.940 1.00 28.35 ? 286 ASP B OD2   1 
ATOM   4851 N N     . GLN B 1 241 ? 19.263  4.384   -19.101 1.00 28.43 ? 287 GLN B N     1 
ATOM   4852 C CA    . GLN B 1 241 ? 18.535  4.504   -17.831 1.00 28.86 ? 287 GLN B CA    1 
ATOM   4853 C C     . GLN B 1 241 ? 18.562  3.275   -16.861 1.00 29.55 ? 287 GLN B C     1 
ATOM   4854 O O     . GLN B 1 241 ? 18.139  3.394   -15.705 1.00 31.44 ? 287 GLN B O     1 
ATOM   4855 C CB    . GLN B 1 241 ? 17.096  4.952   -18.168 1.00 28.99 ? 287 GLN B CB    1 
ATOM   4856 C CG    . GLN B 1 241 ? 16.299  5.534   -16.991 1.00 30.16 ? 287 GLN B CG    1 
ATOM   4857 C CD    . GLN B 1 241 ? 16.963  6.752   -16.332 1.00 31.95 ? 287 GLN B CD    1 
ATOM   4858 O OE1   . GLN B 1 241 ? 16.769  6.992   -15.123 1.00 34.46 ? 287 GLN B OE1   1 
ATOM   4859 N NE2   . GLN B 1 241 ? 17.747  7.535   -17.124 1.00 28.82 ? 287 GLN B NE2   1 
ATOM   4860 N N     . ARG B 1 242 ? 19.038  2.096   -17.304 1.00 28.65 ? 288 ARG B N     1 
ATOM   4861 C CA    . ARG B 1 242 ? 19.261  0.959   -16.384 1.00 27.63 ? 288 ARG B CA    1 
ATOM   4862 C C     . ARG B 1 242 ? 20.313  1.180   -15.309 1.00 27.03 ? 288 ARG B C     1 
ATOM   4863 O O     . ARG B 1 242 ? 20.274  0.558   -14.239 1.00 26.02 ? 288 ARG B O     1 
ATOM   4864 C CB    . ARG B 1 242 ? 19.574  -0.345  -17.158 1.00 27.58 ? 288 ARG B CB    1 
ATOM   4865 C CG    . ARG B 1 242 ? 18.367  -0.828  -17.991 1.00 27.47 ? 288 ARG B CG    1 
ATOM   4866 C CD    . ARG B 1 242 ? 18.671  -1.938  -18.985 1.00 26.84 ? 288 ARG B CD    1 
ATOM   4867 N NE    . ARG B 1 242 ? 19.764  -1.637  -19.897 1.00 28.43 ? 288 ARG B NE    1 
ATOM   4868 C CZ    . ARG B 1 242 ? 20.453  -2.554  -20.593 1.00 30.67 ? 288 ARG B CZ    1 
ATOM   4869 N NH1   . ARG B 1 242 ? 20.168  -3.859  -20.484 1.00 24.91 ? 288 ARG B NH1   1 
ATOM   4870 N NH2   . ARG B 1 242 ? 21.434  -2.168  -21.407 1.00 28.25 ? 288 ARG B NH2   1 
ATOM   4871 N N     . PHE B 1 243 ? 21.305  2.018   -15.616 1.00 27.18 ? 289 PHE B N     1 
ATOM   4872 C CA    . PHE B 1 243 ? 22.336  2.347   -14.611 1.00 26.57 ? 289 PHE B CA    1 
ATOM   4873 C C     . PHE B 1 243 ? 21.729  3.371   -13.699 1.00 26.55 ? 289 PHE B C     1 
ATOM   4874 O O     . PHE B 1 243 ? 21.139  4.331   -14.185 1.00 26.68 ? 289 PHE B O     1 
ATOM   4875 C CB    . PHE B 1 243 ? 23.620  2.872   -15.287 1.00 25.21 ? 289 PHE B CB    1 
ATOM   4876 C CG    . PHE B 1 243 ? 24.354  1.827   -16.083 1.00 23.70 ? 289 PHE B CG    1 
ATOM   4877 C CD1   . PHE B 1 243 ? 25.171  0.903   -15.452 1.00 19.52 ? 289 PHE B CD1   1 
ATOM   4878 C CD2   . PHE B 1 243 ? 24.188  1.737   -17.457 1.00 20.87 ? 289 PHE B CD2   1 
ATOM   4879 C CE1   . PHE B 1 243 ? 25.870  -0.070  -16.201 1.00 21.62 ? 289 PHE B CE1   1 
ATOM   4880 C CE2   . PHE B 1 243 ? 24.856  0.758   -18.189 1.00 21.44 ? 289 PHE B CE2   1 
ATOM   4881 C CZ    . PHE B 1 243 ? 25.720  -0.116  -17.571 1.00 21.80 ? 289 PHE B CZ    1 
ATOM   4882 N N     . ARG B 1 244 ? 21.835  3.152   -12.393 1.00 28.20 ? 290 ARG B N     1 
ATOM   4883 C CA    . ARG B 1 244 ? 21.178  3.995   -11.380 1.00 29.88 ? 290 ARG B CA    1 
ATOM   4884 C C     . ARG B 1 244 ? 22.107  5.137   -10.972 1.00 30.93 ? 290 ARG B C     1 
ATOM   4885 O O     . ARG B 1 244 ? 21.676  6.157   -10.470 1.00 31.34 ? 290 ARG B O     1 
ATOM   4886 C CB    . ARG B 1 244 ? 20.926  3.165   -10.109 1.00 31.04 ? 290 ARG B CB    1 
ATOM   4887 C CG    . ARG B 1 244 ? 19.504  2.662   -9.818  1.00 36.23 ? 290 ARG B CG    1 
ATOM   4888 C CD    . ARG B 1 244 ? 18.643  2.519   -11.078 1.00 44.44 ? 290 ARG B CD    1 
ATOM   4889 N NE    . ARG B 1 244 ? 17.737  3.667   -11.157 1.00 50.86 ? 290 ARG B NE    1 
ATOM   4890 C CZ    . ARG B 1 244 ? 17.650  4.532   -12.173 1.00 54.50 ? 290 ARG B CZ    1 
ATOM   4891 N NH1   . ARG B 1 244 ? 18.367  4.382   -13.291 1.00 51.37 ? 290 ARG B NH1   1 
ATOM   4892 N NH2   . ARG B 1 244 ? 16.790  5.552   -12.074 1.00 59.19 ? 290 ARG B NH2   1 
ATOM   4893 N N     . CYS B 1 245 ? 23.414  4.937   -11.141 1.00 31.71 ? 291 CYS B N     1 
ATOM   4894 C CA    . CYS B 1 245 ? 24.401  5.935   -10.697 1.00 31.13 ? 291 CYS B CA    1 
ATOM   4895 C C     . CYS B 1 245 ? 25.728  5.648   -11.377 1.00 30.88 ? 291 CYS B C     1 
ATOM   4896 O O     . CYS B 1 245 ? 25.953  4.529   -11.858 1.00 31.32 ? 291 CYS B O     1 
ATOM   4897 C CB    . CYS B 1 245 ? 24.510  5.983   -9.156  1.00 29.77 ? 291 CYS B CB    1 
ATOM   4898 S SG    . CYS B 1 245 ? 25.362  4.640   -8.297  1.00 28.44 ? 291 CYS B SG    1 
ATOM   4899 N N     . GLY B 1 246 ? 26.579  6.661   -11.415 1.00 30.46 ? 292 GLY B N     1 
ATOM   4900 C CA    . GLY B 1 246 ? 27.917  6.561   -11.944 1.00 29.63 ? 292 GLY B CA    1 
ATOM   4901 C C     . GLY B 1 246 ? 28.942  7.185   -11.000 1.00 30.51 ? 292 GLY B C     1 
ATOM   4902 O O     . GLY B 1 246 ? 28.615  8.079   -10.183 1.00 30.86 ? 292 GLY B O     1 
ATOM   4903 N N     . ILE B 1 247 ? 30.174  6.671   -11.077 1.00 29.71 ? 293 ILE B N     1 
ATOM   4904 C CA    . ILE B 1 247 ? 31.359  7.277   -10.486 1.00 29.18 ? 293 ILE B CA    1 
ATOM   4905 C C     . ILE B 1 247 ? 32.442  7.467   -11.570 1.00 29.41 ? 293 ILE B C     1 
ATOM   4906 O O     . ILE B 1 247 ? 32.899  6.496   -12.188 1.00 29.39 ? 293 ILE B O     1 
ATOM   4907 C CB    . ILE B 1 247 ? 31.911  6.448   -9.323  1.00 29.24 ? 293 ILE B CB    1 
ATOM   4908 C CG1   . ILE B 1 247 ? 30.822  6.215   -8.279  1.00 26.55 ? 293 ILE B CG1   1 
ATOM   4909 C CG2   . ILE B 1 247 ? 33.158  7.121   -8.736  1.00 29.18 ? 293 ILE B CG2   1 
ATOM   4910 C CD1   . ILE B 1 247 ? 31.110  5.146   -7.248  1.00 24.32 ? 293 ILE B CD1   1 
ATOM   4911 N N     . ALA B 1 248 ? 32.804  8.730   -11.803 1.00 28.02 ? 294 ALA B N     1 
ATOM   4912 C CA    . ALA B 1 248 ? 33.799  9.134   -12.795 1.00 27.73 ? 294 ALA B CA    1 
ATOM   4913 C C     . ALA B 1 248 ? 35.142  9.413   -12.060 1.00 28.21 ? 294 ALA B C     1 
ATOM   4914 O O     . ALA B 1 248 ? 35.266  10.414  -11.302 1.00 26.93 ? 294 ALA B O     1 
ATOM   4915 C CB    . ALA B 1 248 ? 33.326  10.366  -13.506 1.00 27.05 ? 294 ALA B CB    1 
ATOM   4916 N N     . LEU B 1 249 ? 36.122  8.514   -12.263 1.00 27.85 ? 295 LEU B N     1 
ATOM   4917 C CA    . LEU B 1 249 ? 37.408  8.581   -11.576 1.00 27.42 ? 295 LEU B CA    1 
ATOM   4918 C C     . LEU B 1 249 ? 38.299  9.319   -12.494 1.00 28.33 ? 295 LEU B C     1 
ATOM   4919 O O     . LEU B 1 249 ? 38.647  8.815   -13.548 1.00 27.47 ? 295 LEU B O     1 
ATOM   4920 C CB    . LEU B 1 249 ? 37.954  7.195   -11.236 1.00 27.67 ? 295 LEU B CB    1 
ATOM   4921 C CG    . LEU B 1 249 ? 37.069  6.235   -10.417 1.00 25.52 ? 295 LEU B CG    1 
ATOM   4922 C CD1   . LEU B 1 249 ? 37.725  4.797   -10.394 1.00 24.08 ? 295 LEU B CD1   1 
ATOM   4923 C CD2   . LEU B 1 249 ? 36.739  6.748   -8.986  1.00 19.20 ? 295 LEU B CD2   1 
ATOM   4924 N N     . ASP B 1 250 ? 38.591  10.581  -12.139 1.00 29.50 ? 296 ASP B N     1 
ATOM   4925 C CA    . ASP B 1 250 ? 39.532  11.412  -12.905 1.00 30.08 ? 296 ASP B CA    1 
ATOM   4926 C C     . ASP B 1 250 ? 39.225  11.442  -14.396 1.00 30.92 ? 296 ASP B C     1 
ATOM   4927 O O     . ASP B 1 250 ? 40.082  11.049  -15.244 1.00 30.23 ? 296 ASP B O     1 
ATOM   4928 C CB    . ASP B 1 250 ? 40.961  10.958  -12.653 1.00 30.73 ? 296 ASP B CB    1 
ATOM   4929 C CG    . ASP B 1 250 ? 41.935  12.141  -12.398 1.00 35.14 ? 296 ASP B CG    1 
ATOM   4930 O OD1   . ASP B 1 250 ? 41.490  13.264  -11.979 1.00 35.99 ? 296 ASP B OD1   1 
ATOM   4931 O OD2   . ASP B 1 250 ? 43.146  11.915  -12.624 1.00 32.52 ? 296 ASP B OD2   1 
ATOM   4932 N N     . ALA B 1 251 ? 38.019  11.950  -14.718 1.00 29.94 ? 297 ALA B N     1 
ATOM   4933 C CA    . ALA B 1 251 ? 37.470  11.823  -16.033 1.00 29.90 ? 297 ALA B CA    1 
ATOM   4934 C C     . ALA B 1 251 ? 38.114  12.796  -17.001 1.00 31.32 ? 297 ALA B C     1 
ATOM   4935 O O     . ALA B 1 251 ? 38.499  13.900  -16.641 1.00 32.45 ? 297 ALA B O     1 
ATOM   4936 C CB    . ALA B 1 251 ? 35.913  12.013  -15.995 1.00 30.73 ? 297 ALA B CB    1 
ATOM   4937 N N     . TRP B 1 252 ? 38.229  12.374  -18.243 1.00 31.01 ? 298 TRP B N     1 
ATOM   4938 C CA    . TRP B 1 252 ? 38.763  13.193  -19.240 1.00 32.29 ? 298 TRP B CA    1 
ATOM   4939 C C     . TRP B 1 252 ? 37.586  13.573  -20.125 1.00 33.47 ? 298 TRP B C     1 
ATOM   4940 O O     . TRP B 1 252 ? 37.049  12.728  -20.866 1.00 34.61 ? 298 TRP B O     1 
ATOM   4941 C CB    . TRP B 1 252 ? 39.841  12.425  -19.981 1.00 31.60 ? 298 TRP B CB    1 
ATOM   4942 C CG    . TRP B 1 252 ? 40.355  13.143  -21.129 1.00 29.57 ? 298 TRP B CG    1 
ATOM   4943 C CD1   . TRP B 1 252 ? 40.848  14.431  -21.147 1.00 30.13 ? 298 TRP B CD1   1 
ATOM   4944 C CD2   . TRP B 1 252 ? 40.534  12.619  -22.438 1.00 27.50 ? 298 TRP B CD2   1 
ATOM   4945 N NE1   . TRP B 1 252 ? 41.270  14.742  -22.415 1.00 27.43 ? 298 TRP B NE1   1 
ATOM   4946 C CE2   . TRP B 1 252 ? 41.096  13.643  -23.224 1.00 28.20 ? 298 TRP B CE2   1 
ATOM   4947 C CE3   . TRP B 1 252 ? 40.284  11.374  -23.029 1.00 26.88 ? 298 TRP B CE3   1 
ATOM   4948 C CZ2   . TRP B 1 252 ? 41.388  13.467  -24.581 1.00 28.04 ? 298 TRP B CZ2   1 
ATOM   4949 C CZ3   . TRP B 1 252 ? 40.566  11.212  -24.386 1.00 28.14 ? 298 TRP B CZ3   1 
ATOM   4950 C CH2   . TRP B 1 252 ? 41.100  12.254  -25.139 1.00 28.98 ? 298 TRP B CH2   1 
ATOM   4951 N N     . MET B 1 253 ? 37.173  14.837  -20.044 1.00 33.47 ? 299 MET B N     1 
ATOM   4952 C CA    . MET B 1 253 ? 35.843  15.209  -20.539 1.00 33.56 ? 299 MET B CA    1 
ATOM   4953 C C     . MET B 1 253 ? 35.825  15.588  -21.972 1.00 33.97 ? 299 MET B C     1 
ATOM   4954 O O     . MET B 1 253 ? 34.767  15.637  -22.590 1.00 35.55 ? 299 MET B O     1 
ATOM   4955 C CB    . MET B 1 253 ? 35.240  16.316  -19.705 1.00 33.74 ? 299 MET B CB    1 
ATOM   4956 C CG    . MET B 1 253 ? 35.321  16.086  -18.252 1.00 33.00 ? 299 MET B CG    1 
ATOM   4957 S SD    . MET B 1 253 ? 34.025  15.046  -17.612 1.00 39.77 ? 299 MET B SD    1 
ATOM   4958 C CE    . MET B 1 253 ? 32.559  15.993  -18.060 1.00 38.88 ? 299 MET B CE    1 
ATOM   4959 N N     . PHE B 1 254 ? 36.997  15.833  -22.544 1.00 33.88 ? 300 PHE B N     1 
ATOM   4960 C CA    . PHE B 1 254 ? 37.082  16.151  -23.952 1.00 33.21 ? 300 PHE B CA    1 
ATOM   4961 C C     . PHE B 1 254 ? 36.244  15.265  -24.923 1.00 33.30 ? 300 PHE B C     1 
ATOM   4962 O O     . PHE B 1 254 ? 35.677  15.779  -25.889 1.00 33.51 ? 300 PHE B O     1 
ATOM   4963 C CB    . PHE B 1 254 ? 38.557  16.176  -24.344 1.00 34.32 ? 300 PHE B CB    1 
ATOM   4964 C CG    . PHE B 1 254 ? 38.811  16.432  -25.803 1.00 34.02 ? 300 PHE B CG    1 
ATOM   4965 C CD1   . PHE B 1 254 ? 38.821  17.741  -26.303 1.00 35.50 ? 300 PHE B CD1   1 
ATOM   4966 C CD2   . PHE B 1 254 ? 39.103  15.381  -26.654 1.00 33.59 ? 300 PHE B CD2   1 
ATOM   4967 C CE1   . PHE B 1 254 ? 39.075  17.980  -27.607 1.00 32.59 ? 300 PHE B CE1   1 
ATOM   4968 C CE2   . PHE B 1 254 ? 39.373  15.613  -27.968 1.00 32.33 ? 300 PHE B CE2   1 
ATOM   4969 C CZ    . PHE B 1 254 ? 39.339  16.911  -28.445 1.00 35.77 ? 300 PHE B CZ    1 
ATOM   4970 N N     . PRO B 1 255 ? 36.203  13.932  -24.720 1.00 33.13 ? 301 PRO B N     1 
ATOM   4971 C CA    . PRO B 1 255 ? 35.412  13.130  -25.681 1.00 33.59 ? 301 PRO B CA    1 
ATOM   4972 C C     . PRO B 1 255 ? 33.917  13.508  -25.840 1.00 33.77 ? 301 PRO B C     1 
ATOM   4973 O O     . PRO B 1 255 ? 33.340  13.245  -26.896 1.00 34.26 ? 301 PRO B O     1 
ATOM   4974 C CB    . PRO B 1 255 ? 35.528  11.700  -25.102 1.00 32.62 ? 301 PRO B CB    1 
ATOM   4975 C CG    . PRO B 1 255 ? 36.865  11.723  -24.452 1.00 32.48 ? 301 PRO B CG    1 
ATOM   4976 C CD    . PRO B 1 255 ? 36.859  13.045  -23.737 1.00 32.68 ? 301 PRO B CD    1 
ATOM   4977 N N     . LEU B 1 256 ? 33.324  14.075  -24.787 1.00 33.08 ? 302 LEU B N     1 
ATOM   4978 C CA    . LEU B 1 256 ? 31.896  14.299  -24.714 1.00 33.64 ? 302 LEU B CA    1 
ATOM   4979 C C     . LEU B 1 256 ? 31.410  15.499  -25.540 1.00 34.78 ? 302 LEU B C     1 
ATOM   4980 O O     . LEU B 1 256 ? 32.082  16.577  -25.632 1.00 35.09 ? 302 LEU B O     1 
ATOM   4981 C CB    . LEU B 1 256 ? 31.467  14.483  -23.256 1.00 31.94 ? 302 LEU B CB    1 
ATOM   4982 C CG    . LEU B 1 256 ? 31.743  13.343  -22.311 1.00 31.44 ? 302 LEU B CG    1 
ATOM   4983 C CD1   . LEU B 1 256 ? 31.481  13.761  -20.871 1.00 29.81 ? 302 LEU B CD1   1 
ATOM   4984 C CD2   . LEU B 1 256 ? 30.906  12.047  -22.703 1.00 30.02 ? 302 LEU B CD2   1 
ATOM   4985 N N     . GLY B 1 257 ? 30.243  15.296  -26.144 1.00 35.55 ? 303 GLY B N     1 
ATOM   4986 C CA    . GLY B 1 257 ? 29.537  16.342  -26.832 1.00 36.58 ? 303 GLY B CA    1 
ATOM   4987 C C     . GLY B 1 257 ? 28.886  17.278  -25.854 1.00 37.31 ? 303 GLY B C     1 
ATOM   4988 O O     . GLY B 1 257 ? 28.582  16.923  -24.705 1.00 36.14 ? 303 GLY B O     1 
ATOM   4989 N N     . ASP B 1 258 ? 28.647  18.498  -26.325 1.00 39.79 ? 304 ASP B N     1 
ATOM   4990 C CA    . ASP B 1 258 ? 28.113  19.567  -25.462 1.00 41.63 ? 304 ASP B CA    1 
ATOM   4991 C C     . ASP B 1 258 ? 26.673  19.322  -25.000 1.00 40.90 ? 304 ASP B C     1 
ATOM   4992 O O     . ASP B 1 258 ? 26.236  19.843  -23.973 1.00 40.05 ? 304 ASP B O     1 
ATOM   4993 C CB    . ASP B 1 258 ? 28.249  20.888  -26.204 1.00 43.27 ? 304 ASP B CB    1 
ATOM   4994 C CG    . ASP B 1 258 ? 29.722  21.239  -26.494 1.00 48.42 ? 304 ASP B CG    1 
ATOM   4995 O OD1   . ASP B 1 258 ? 30.596  21.020  -25.598 1.00 51.77 ? 304 ASP B OD1   1 
ATOM   4996 O OD2   . ASP B 1 258 ? 30.002  21.728  -27.619 1.00 53.16 ? 304 ASP B OD2   1 
ATOM   4997 N N     . GLU B 1 259 ? 25.978  18.483  -25.760 1.00 41.42 ? 305 GLU B N     1 
ATOM   4998 C CA    . GLU B 1 259 ? 24.585  18.080  -25.487 1.00 42.94 ? 305 GLU B CA    1 
ATOM   4999 C C     . GLU B 1 259 ? 24.374  17.287  -24.196 1.00 42.33 ? 305 GLU B C     1 
ATOM   5000 O O     . GLU B 1 259 ? 23.334  17.404  -23.581 1.00 42.52 ? 305 GLU B O     1 
ATOM   5001 C CB    . GLU B 1 259 ? 24.038  17.271  -26.674 1.00 43.12 ? 305 GLU B CB    1 
ATOM   5002 C CG    . GLU B 1 259 ? 24.423  15.756  -26.648 1.00 46.79 ? 305 GLU B CG    1 
ATOM   5003 C CD    . GLU B 1 259 ? 25.701  15.363  -27.479 1.00 47.20 ? 305 GLU B CD    1 
ATOM   5004 O OE1   . GLU B 1 259 ? 26.339  16.234  -28.143 1.00 44.25 ? 305 GLU B OE1   1 
ATOM   5005 O OE2   . GLU B 1 259 ? 26.038  14.156  -27.441 1.00 45.42 ? 305 GLU B OE2   1 
ATOM   5006 N N     . VAL B 1 260 ? 25.369  16.497  -23.785 1.00 41.79 ? 306 VAL B N     1 
ATOM   5007 C CA    . VAL B 1 260 ? 25.134  15.435  -22.822 1.00 41.22 ? 306 VAL B CA    1 
ATOM   5008 C C     . VAL B 1 260 ? 25.112  15.904  -21.382 1.00 40.70 ? 306 VAL B C     1 
ATOM   5009 O O     . VAL B 1 260 ? 24.457  15.280  -20.542 1.00 39.68 ? 306 VAL B O     1 
ATOM   5010 C CB    . VAL B 1 260 ? 26.110  14.163  -23.053 1.00 41.71 ? 306 VAL B CB    1 
ATOM   5011 C CG1   . VAL B 1 260 ? 25.883  13.059  -22.026 1.00 40.70 ? 306 VAL B CG1   1 
ATOM   5012 C CG2   . VAL B 1 260 ? 25.884  13.554  -24.389 1.00 41.94 ? 306 VAL B CG2   1 
ATOM   5013 N N     . TYR B 1 261 ? 25.810  17.005  -21.095 1.00 41.49 ? 307 TYR B N     1 
ATOM   5014 C CA    . TYR B 1 261 ? 25.996  17.508  -19.694 1.00 42.11 ? 307 TYR B CA    1 
ATOM   5015 C C     . TYR B 1 261 ? 24.705  17.804  -18.988 1.00 41.12 ? 307 TYR B C     1 
ATOM   5016 O O     . TYR B 1 261 ? 24.610  17.643  -17.770 1.00 40.95 ? 307 TYR B O     1 
ATOM   5017 C CB    . TYR B 1 261 ? 26.913  18.765  -19.619 1.00 43.46 ? 307 TYR B CB    1 
ATOM   5018 C CG    . TYR B 1 261 ? 28.246  18.621  -20.332 1.00 45.09 ? 307 TYR B CG    1 
ATOM   5019 C CD1   . TYR B 1 261 ? 29.210  17.732  -19.874 1.00 46.37 ? 307 TYR B CD1   1 
ATOM   5020 C CD2   . TYR B 1 261 ? 28.540  19.380  -21.466 1.00 47.73 ? 307 TYR B CD2   1 
ATOM   5021 C CE1   . TYR B 1 261 ? 30.425  17.592  -20.543 1.00 48.10 ? 307 TYR B CE1   1 
ATOM   5022 C CE2   . TYR B 1 261 ? 29.759  19.242  -22.131 1.00 47.95 ? 307 TYR B CE2   1 
ATOM   5023 C CZ    . TYR B 1 261 ? 30.678  18.341  -21.667 1.00 45.63 ? 307 TYR B CZ    1 
ATOM   5024 O OH    . TYR B 1 261 ? 31.866  18.177  -22.319 1.00 47.31 ? 307 TYR B OH    1 
ATOM   5025 N N     . SER B 1 262 ? 23.716  18.247  -19.763 1.00 41.31 ? 308 SER B N     1 
ATOM   5026 C CA    . SER B 1 262 ? 22.378  18.535  -19.232 1.00 41.86 ? 308 SER B CA    1 
ATOM   5027 C C     . SER B 1 262 ? 21.420  17.312  -19.209 1.00 41.18 ? 308 SER B C     1 
ATOM   5028 O O     . SER B 1 262 ? 20.245  17.472  -18.946 1.00 41.68 ? 308 SER B O     1 
ATOM   5029 C CB    . SER B 1 262 ? 21.755  19.706  -20.007 1.00 41.89 ? 308 SER B CB    1 
ATOM   5030 O OG    . SER B 1 262 ? 21.302  19.309  -21.293 1.00 46.22 ? 308 SER B OG    1 
ATOM   5031 N N     . ARG B 1 263 ? 21.936  16.102  -19.467 1.00 39.50 ? 309 ARG B N     1 
ATOM   5032 C CA    . ARG B 1 263 ? 21.103  14.935  -19.771 1.00 37.81 ? 309 ARG B CA    1 
ATOM   5033 C C     . ARG B 1 263 ? 21.590  13.697  -19.048 1.00 36.70 ? 309 ARG B C     1 
ATOM   5034 O O     . ARG B 1 263 ? 21.663  12.602  -19.635 1.00 37.55 ? 309 ARG B O     1 
ATOM   5035 C CB    . ARG B 1 263 ? 21.078  14.672  -21.275 1.00 37.58 ? 309 ARG B CB    1 
ATOM   5036 C CG    . ARG B 1 263 ? 20.461  15.781  -22.058 1.00 38.80 ? 309 ARG B CG    1 
ATOM   5037 C CD    . ARG B 1 263 ? 20.451  15.428  -23.501 1.00 40.08 ? 309 ARG B CD    1 
ATOM   5038 N NE    . ARG B 1 263 ? 19.589  16.290  -24.305 1.00 40.72 ? 309 ARG B NE    1 
ATOM   5039 C CZ    . ARG B 1 263 ? 19.710  16.390  -25.632 1.00 48.02 ? 309 ARG B CZ    1 
ATOM   5040 N NH1   . ARG B 1 263 ? 20.655  15.684  -26.265 1.00 49.09 ? 309 ARG B NH1   1 
ATOM   5041 N NH2   . ARG B 1 263 ? 18.917  17.203  -26.345 1.00 49.67 ? 309 ARG B NH2   1 
ATOM   5042 N N     . ILE B 1 264 ? 21.971  13.894  -17.795 1.00 34.71 ? 310 ILE B N     1 
ATOM   5043 C CA    . ILE B 1 264 ? 22.369  12.820  -16.921 1.00 33.91 ? 310 ILE B CA    1 
ATOM   5044 C C     . ILE B 1 264 ? 21.447  12.926  -15.712 1.00 33.68 ? 310 ILE B C     1 
ATOM   5045 O O     . ILE B 1 264 ? 21.742  13.717  -14.805 1.00 34.40 ? 310 ILE B O     1 
ATOM   5046 C CB    . ILE B 1 264 ? 23.860  12.938  -16.409 1.00 33.14 ? 310 ILE B CB    1 
ATOM   5047 C CG1   . ILE B 1 264 ? 24.820  13.343  -17.540 1.00 32.98 ? 310 ILE B CG1   1 
ATOM   5048 C CG2   . ILE B 1 264 ? 24.257  11.678  -15.710 1.00 31.04 ? 310 ILE B CG2   1 
ATOM   5049 C CD1   . ILE B 1 264 ? 25.847  14.452  -17.163 1.00 30.14 ? 310 ILE B CD1   1 
ATOM   5050 N N     . PRO B 1 265 ? 20.309  12.166  -15.707 1.00 32.68 ? 311 PRO B N     1 
ATOM   5051 C CA    . PRO B 1 265 ? 19.385  12.013  -14.569 1.00 31.76 ? 311 PRO B CA    1 
ATOM   5052 C C     . PRO B 1 265 ? 19.986  11.483  -13.271 1.00 31.75 ? 311 PRO B C     1 
ATOM   5053 O O     . PRO B 1 265 ? 19.648  11.917  -12.152 1.00 32.19 ? 311 PRO B O     1 
ATOM   5054 C CB    . PRO B 1 265 ? 18.391  10.961  -15.079 1.00 32.97 ? 311 PRO B CB    1 
ATOM   5055 C CG    . PRO B 1 265 ? 18.469  11.024  -16.528 1.00 32.02 ? 311 PRO B CG    1 
ATOM   5056 C CD    . PRO B 1 265 ? 19.812  11.488  -16.919 1.00 31.67 ? 311 PRO B CD    1 
ATOM   5057 N N     . GLN B 1 266 ? 20.844  10.494  -13.401 1.00 30.82 ? 312 GLN B N     1 
ATOM   5058 C CA    . GLN B 1 266 ? 21.200  9.694   -12.267 1.00 30.10 ? 312 GLN B CA    1 
ATOM   5059 C C     . GLN B 1 266 ? 22.224  10.408  -11.401 1.00 29.78 ? 312 GLN B C     1 
ATOM   5060 O O     . GLN B 1 266 ? 22.926  11.298  -11.888 1.00 30.09 ? 312 GLN B O     1 
ATOM   5061 C CB    . GLN B 1 266 ? 21.714  8.327   -12.789 1.00 30.49 ? 312 GLN B CB    1 
ATOM   5062 C CG    . GLN B 1 266 ? 20.789  7.718   -13.830 1.00 28.83 ? 312 GLN B CG    1 
ATOM   5063 C CD    . GLN B 1 266 ? 21.283  7.844   -15.247 1.00 29.69 ? 312 GLN B CD    1 
ATOM   5064 O OE1   . GLN B 1 266 ? 21.590  8.926   -15.747 1.00 26.91 ? 312 GLN B OE1   1 
ATOM   5065 N NE2   . GLN B 1 266 ? 21.330  6.724   -15.926 1.00 29.61 ? 312 GLN B NE2   1 
ATOM   5066 N N     . PRO B 1 267 ? 22.302  10.052  -10.106 1.00 29.88 ? 313 PRO B N     1 
ATOM   5067 C CA    . PRO B 1 267 ? 23.463  10.511  -9.304  1.00 30.38 ? 313 PRO B CA    1 
ATOM   5068 C C     . PRO B 1 267 ? 24.889  10.212  -9.920  1.00 31.60 ? 313 PRO B C     1 
ATOM   5069 O O     . PRO B 1 267 ? 25.169  9.090   -10.409 1.00 31.91 ? 313 PRO B O     1 
ATOM   5070 C CB    . PRO B 1 267 ? 23.282  9.785   -7.963  1.00 29.99 ? 313 PRO B CB    1 
ATOM   5071 C CG    . PRO B 1 267 ? 21.801  9.385   -7.930  1.00 30.01 ? 313 PRO B CG    1 
ATOM   5072 C CD    . PRO B 1 267 ? 21.335  9.249   -9.323  1.00 28.82 ? 313 PRO B CD    1 
ATOM   5073 N N     . LEU B 1 268 ? 25.780  11.208  -9.813  1.00 31.93 ? 314 LEU B N     1 
ATOM   5074 C CA    . LEU B 1 268 ? 27.080  11.246  -10.489 1.00 32.43 ? 314 LEU B CA    1 
ATOM   5075 C C     . LEU B 1 268 ? 28.202  11.799  -9.563  1.00 33.04 ? 314 LEU B C     1 
ATOM   5076 O O     . LEU B 1 268 ? 28.136  12.941  -9.115  1.00 33.65 ? 314 LEU B O     1 
ATOM   5077 C CB    . LEU B 1 268 ? 26.972  12.061  -11.799 1.00 32.05 ? 314 LEU B CB    1 
ATOM   5078 C CG    . LEU B 1 268 ? 28.268  12.265  -12.604 1.00 32.30 ? 314 LEU B CG    1 
ATOM   5079 C CD1   . LEU B 1 268 ? 28.929  10.909  -13.022 1.00 28.10 ? 314 LEU B CD1   1 
ATOM   5080 C CD2   . LEU B 1 268 ? 28.008  13.172  -13.763 1.00 30.92 ? 314 LEU B CD2   1 
ATOM   5081 N N     . PHE B 1 269 ? 29.201  10.964  -9.277  1.00 33.56 ? 315 PHE B N     1 
ATOM   5082 C CA    . PHE B 1 269 ? 30.291  11.237  -8.306  1.00 33.48 ? 315 PHE B CA    1 
ATOM   5083 C C     . PHE B 1 269 ? 31.622  11.329  -9.040  1.00 34.45 ? 315 PHE B C     1 
ATOM   5084 O O     . PHE B 1 269 ? 32.086  10.337  -9.612  1.00 35.51 ? 315 PHE B O     1 
ATOM   5085 C CB    . PHE B 1 269 ? 30.337  10.106  -7.290  1.00 32.43 ? 315 PHE B CB    1 
ATOM   5086 C CG    . PHE B 1 269 ? 31.205  10.349  -6.080  1.00 31.52 ? 315 PHE B CG    1 
ATOM   5087 C CD1   . PHE B 1 269 ? 31.672  11.626  -5.720  1.00 33.78 ? 315 PHE B CD1   1 
ATOM   5088 C CD2   . PHE B 1 269 ? 31.521  9.284   -5.261  1.00 28.54 ? 315 PHE B CD2   1 
ATOM   5089 C CE1   . PHE B 1 269 ? 32.478  11.780  -4.570  1.00 28.73 ? 315 PHE B CE1   1 
ATOM   5090 C CE2   . PHE B 1 269 ? 32.268  9.440   -4.136  1.00 28.28 ? 315 PHE B CE2   1 
ATOM   5091 C CZ    . PHE B 1 269 ? 32.767  10.689  -3.796  1.00 29.71 ? 315 PHE B CZ    1 
ATOM   5092 N N     . PHE B 1 270 ? 32.197  12.538  -9.072  1.00 34.82 ? 316 PHE B N     1 
ATOM   5093 C CA    . PHE B 1 270 ? 33.553  12.765  -9.598  1.00 33.11 ? 316 PHE B CA    1 
ATOM   5094 C C     . PHE B 1 270 ? 34.581  12.563  -8.488  1.00 33.84 ? 316 PHE B C     1 
ATOM   5095 O O     . PHE B 1 270 ? 34.541  13.262  -7.459  1.00 34.71 ? 316 PHE B O     1 
ATOM   5096 C CB    . PHE B 1 270 ? 33.680  14.150  -10.157 1.00 31.75 ? 316 PHE B CB    1 
ATOM   5097 C CG    . PHE B 1 270 ? 32.777  14.442  -11.340 1.00 29.96 ? 316 PHE B CG    1 
ATOM   5098 C CD1   . PHE B 1 270 ? 33.212  14.206  -12.640 1.00 26.72 ? 316 PHE B CD1   1 
ATOM   5099 C CD2   . PHE B 1 270 ? 31.520  15.053  -11.145 1.00 30.61 ? 316 PHE B CD2   1 
ATOM   5100 C CE1   . PHE B 1 270 ? 32.377  14.512  -13.757 1.00 29.14 ? 316 PHE B CE1   1 
ATOM   5101 C CE2   . PHE B 1 270 ? 30.682  15.370  -12.209 1.00 28.57 ? 316 PHE B CE2   1 
ATOM   5102 C CZ    . PHE B 1 270 ? 31.105  15.107  -13.545 1.00 29.61 ? 316 PHE B CZ    1 
ATOM   5103 N N     . ILE B 1 271 ? 35.452  11.567  -8.643  1.00 33.06 ? 317 ILE B N     1 
ATOM   5104 C CA    . ILE B 1 271 ? 36.610  11.428  -7.762  1.00 32.64 ? 317 ILE B CA    1 
ATOM   5105 C C     . ILE B 1 271 ? 37.813  11.709  -8.634  1.00 33.79 ? 317 ILE B C     1 
ATOM   5106 O O     . ILE B 1 271 ? 38.096  10.960  -9.589  1.00 34.72 ? 317 ILE B O     1 
ATOM   5107 C CB    . ILE B 1 271 ? 36.714  10.082  -7.055  1.00 32.55 ? 317 ILE B CB    1 
ATOM   5108 C CG1   . ILE B 1 271 ? 35.469  9.800   -6.224  1.00 29.28 ? 317 ILE B CG1   1 
ATOM   5109 C CG2   . ILE B 1 271 ? 37.928  10.005  -6.089  1.00 29.42 ? 317 ILE B CG2   1 
ATOM   5110 C CD1   . ILE B 1 271 ? 35.439  8.383   -5.712  1.00 19.72 ? 317 ILE B CD1   1 
ATOM   5111 N N     . ASN B 1 272 ? 38.440  12.856  -8.357  1.00 33.89 ? 318 ASN B N     1 
ATOM   5112 C CA    . ASN B 1 272 ? 39.619  13.347  -9.058  1.00 33.76 ? 318 ASN B CA    1 
ATOM   5113 C C     . ASN B 1 272 ? 41.023  13.183  -8.409  1.00 32.78 ? 318 ASN B C     1 
ATOM   5114 O O     . ASN B 1 272 ? 41.181  12.937  -7.197  1.00 31.91 ? 318 ASN B O     1 
ATOM   5115 C CB    . ASN B 1 272 ? 39.410  14.809  -9.360  1.00 34.73 ? 318 ASN B CB    1 
ATOM   5116 C CG    . ASN B 1 272 ? 38.134  15.067  -10.140 1.00 35.40 ? 318 ASN B CG    1 
ATOM   5117 O OD1   . ASN B 1 272 ? 37.712  14.282  -11.042 1.00 32.22 ? 318 ASN B OD1   1 
ATOM   5118 N ND2   . ASN B 1 272 ? 37.504  16.199  -9.809  1.00 35.41 ? 318 ASN B ND2   1 
ATOM   5119 N N     . SER B 1 273 ? 42.047  13.274  -9.256  1.00 32.47 ? 319 SER B N     1 
ATOM   5120 C CA    . SER B 1 273 ? 43.419  13.340  -8.737  1.00 32.18 ? 319 SER B CA    1 
ATOM   5121 C C     . SER B 1 273 ? 43.748  14.803  -8.577  1.00 33.40 ? 319 SER B C     1 
ATOM   5122 O O     . SER B 1 273 ? 43.185  15.676  -9.263  1.00 30.98 ? 319 SER B O     1 
ATOM   5123 C CB    . SER B 1 273 ? 44.464  12.637  -9.620  1.00 30.10 ? 319 SER B CB    1 
ATOM   5124 O OG    . SER B 1 273 ? 44.778  13.391  -10.795 1.00 27.80 ? 319 SER B OG    1 
ATOM   5125 N N     . GLU B 1 274 ? 44.645  15.058  -7.631  1.00 36.61 ? 320 GLU B N     1 
ATOM   5126 C CA    . GLU B 1 274 ? 45.144  16.409  -7.437  1.00 38.29 ? 320 GLU B CA    1 
ATOM   5127 C C     . GLU B 1 274 ? 45.777  16.976  -8.674  1.00 38.06 ? 320 GLU B C     1 
ATOM   5128 O O     . GLU B 1 274 ? 45.430  18.083  -9.011  1.00 38.80 ? 320 GLU B O     1 
ATOM   5129 C CB    . GLU B 1 274 ? 46.048  16.510  -6.221  1.00 39.36 ? 320 GLU B CB    1 
ATOM   5130 C CG    . GLU B 1 274 ? 46.902  17.766  -6.287  1.00 43.92 ? 320 GLU B CG    1 
ATOM   5131 C CD    . GLU B 1 274 ? 46.971  18.561  -5.016  1.00 46.21 ? 320 GLU B CD    1 
ATOM   5132 O OE1   . GLU B 1 274 ? 47.220  17.937  -3.943  1.00 48.88 ? 320 GLU B OE1   1 
ATOM   5133 O OE2   . GLU B 1 274 ? 46.804  19.825  -5.134  1.00 46.21 ? 320 GLU B OE2   1 
ATOM   5134 N N     . TYR B 1 275 ? 46.610  16.207  -9.400  1.00 38.82 ? 321 TYR B N     1 
ATOM   5135 C CA    . TYR B 1 275 ? 47.457  16.732  -10.527 1.00 38.28 ? 321 TYR B CA    1 
ATOM   5136 C C     . TYR B 1 275 ? 47.018  16.556  -11.965 1.00 37.44 ? 321 TYR B C     1 
ATOM   5137 O O     . TYR B 1 275 ? 47.554  17.213  -12.870 1.00 36.95 ? 321 TYR B O     1 
ATOM   5138 C CB    . TYR B 1 275 ? 48.900  16.233  -10.424 1.00 40.47 ? 321 TYR B CB    1 
ATOM   5139 C CG    . TYR B 1 275 ? 49.618  16.820  -9.256  1.00 42.72 ? 321 TYR B CG    1 
ATOM   5140 C CD1   . TYR B 1 275 ? 50.289  18.047  -9.358  1.00 47.05 ? 321 TYR B CD1   1 
ATOM   5141 C CD2   . TYR B 1 275 ? 49.595  16.179  -8.033  1.00 44.60 ? 321 TYR B CD2   1 
ATOM   5142 C CE1   . TYR B 1 275 ? 50.951  18.608  -8.236  1.00 48.31 ? 321 TYR B CE1   1 
ATOM   5143 C CE2   . TYR B 1 275 ? 50.224  16.705  -6.933  1.00 46.98 ? 321 TYR B CE2   1 
ATOM   5144 C CZ    . TYR B 1 275 ? 50.910  17.909  -7.028  1.00 47.03 ? 321 TYR B CZ    1 
ATOM   5145 O OH    . TYR B 1 275 ? 51.520  18.385  -5.890  1.00 46.68 ? 321 TYR B OH    1 
ATOM   5146 N N     . PHE B 1 276 ? 46.078  15.657  -12.231 1.00 36.49 ? 322 PHE B N     1 
ATOM   5147 C CA    . PHE B 1 276 ? 45.621  15.526  -13.614 1.00 35.07 ? 322 PHE B CA    1 
ATOM   5148 C C     . PHE B 1 276 ? 44.795  16.726  -14.072 1.00 34.80 ? 322 PHE B C     1 
ATOM   5149 O O     . PHE B 1 276 ? 44.869  17.092  -15.232 1.00 35.50 ? 322 PHE B O     1 
ATOM   5150 C CB    . PHE B 1 276 ? 44.860  14.216  -13.846 1.00 34.65 ? 322 PHE B CB    1 
ATOM   5151 C CG    . PHE B 1 276 ? 44.185  14.102  -15.210 1.00 32.00 ? 322 PHE B CG    1 
ATOM   5152 C CD1   . PHE B 1 276 ? 44.929  13.765  -16.363 1.00 34.72 ? 322 PHE B CD1   1 
ATOM   5153 C CD2   . PHE B 1 276 ? 42.809  14.264  -15.321 1.00 30.37 ? 322 PHE B CD2   1 
ATOM   5154 C CE1   . PHE B 1 276 ? 44.304  13.618  -17.617 1.00 35.16 ? 322 PHE B CE1   1 
ATOM   5155 C CE2   . PHE B 1 276 ? 42.166  14.141  -16.543 1.00 33.11 ? 322 PHE B CE2   1 
ATOM   5156 C CZ    . PHE B 1 276 ? 42.911  13.806  -17.717 1.00 34.29 ? 322 PHE B CZ    1 
ATOM   5157 N N     . GLN B 1 277 ? 44.036  17.334  -13.169 1.00 34.61 ? 323 GLN B N     1 
ATOM   5158 C CA    . GLN B 1 277 ? 43.010  18.323  -13.558 1.00 35.54 ? 323 GLN B CA    1 
ATOM   5159 C C     . GLN B 1 277 ? 43.492  19.679  -14.174 1.00 37.15 ? 323 GLN B C     1 
ATOM   5160 O O     . GLN B 1 277 ? 44.530  20.221  -13.777 1.00 37.19 ? 323 GLN B O     1 
ATOM   5161 C CB    . GLN B 1 277 ? 42.019  18.529  -12.422 1.00 34.29 ? 323 GLN B CB    1 
ATOM   5162 C CG    . GLN B 1 277 ? 41.174  17.278  -12.087 1.00 32.20 ? 323 GLN B CG    1 
ATOM   5163 C CD    . GLN B 1 277 ? 40.330  16.724  -13.301 1.00 33.43 ? 323 GLN B CD    1 
ATOM   5164 O OE1   . GLN B 1 277 ? 39.791  17.472  -14.125 1.00 33.71 ? 323 GLN B OE1   1 
ATOM   5165 N NE2   . GLN B 1 277 ? 40.216  15.421  -13.372 1.00 32.53 ? 323 GLN B NE2   1 
ATOM   5166 N N     . TYR B 1 278 ? 42.759  20.152  -15.196 1.00 37.71 ? 324 TYR B N     1 
ATOM   5167 C CA    . TYR B 1 278 ? 42.913  21.477  -15.752 1.00 38.95 ? 324 TYR B CA    1 
ATOM   5168 C C     . TYR B 1 278 ? 41.545  22.206  -15.748 1.00 40.35 ? 324 TYR B C     1 
ATOM   5169 O O     . TYR B 1 278 ? 40.560  21.633  -15.262 1.00 41.06 ? 324 TYR B O     1 
ATOM   5170 C CB    . TYR B 1 278 ? 43.556  21.423  -17.151 1.00 39.45 ? 324 TYR B CB    1 
ATOM   5171 C CG    . TYR B 1 278 ? 43.025  20.384  -18.140 1.00 41.18 ? 324 TYR B CG    1 
ATOM   5172 C CD1   . TYR B 1 278 ? 42.504  20.793  -19.395 1.00 40.70 ? 324 TYR B CD1   1 
ATOM   5173 C CD2   . TYR B 1 278 ? 43.067  18.988  -17.854 1.00 40.96 ? 324 TYR B CD2   1 
ATOM   5174 C CE1   . TYR B 1 278 ? 42.041  19.854  -20.349 1.00 40.77 ? 324 TYR B CE1   1 
ATOM   5175 C CE2   . TYR B 1 278 ? 42.598  18.031  -18.818 1.00 41.27 ? 324 TYR B CE2   1 
ATOM   5176 C CZ    . TYR B 1 278 ? 42.082  18.473  -20.052 1.00 41.46 ? 324 TYR B CZ    1 
ATOM   5177 O OH    . TYR B 1 278 ? 41.631  17.566  -21.020 1.00 42.35 ? 324 TYR B OH    1 
ATOM   5178 N N     . PRO B 1 279 ? 41.499  23.504  -16.188 1.00 40.66 ? 325 PRO B N     1 
ATOM   5179 C CA    . PRO B 1 279 ? 40.271  24.312  -16.408 1.00 39.76 ? 325 PRO B CA    1 
ATOM   5180 C C     . PRO B 1 279 ? 39.244  23.815  -17.458 1.00 39.26 ? 325 PRO B C     1 
ATOM   5181 O O     . PRO B 1 279 ? 38.089  23.616  -17.147 1.00 38.90 ? 325 PRO B O     1 
ATOM   5182 C CB    . PRO B 1 279 ? 40.845  25.679  -16.842 1.00 39.74 ? 325 PRO B CB    1 
ATOM   5183 C CG    . PRO B 1 279 ? 42.199  25.738  -16.197 1.00 40.71 ? 325 PRO B CG    1 
ATOM   5184 C CD    . PRO B 1 279 ? 42.717  24.341  -16.358 1.00 40.18 ? 325 PRO B CD    1 
ATOM   5185 N N     . ALA B 1 280 ? 39.670  23.709  -18.706 1.00 39.15 ? 326 ALA B N     1 
ATOM   5186 C CA    . ALA B 1 280 ? 38.867  23.219  -19.779 1.00 39.05 ? 326 ALA B CA    1 
ATOM   5187 C C     . ALA B 1 280 ? 38.056  21.972  -19.357 1.00 40.21 ? 326 ALA B C     1 
ATOM   5188 O O     . ALA B 1 280 ? 36.849  21.848  -19.707 1.00 40.56 ? 326 ALA B O     1 
ATOM   5189 C CB    . ALA B 1 280 ? 39.762  22.937  -21.004 1.00 39.30 ? 326 ALA B CB    1 
ATOM   5190 N N     . ASN B 1 281 ? 38.716  21.098  -18.583 1.00 39.68 ? 327 ASN B N     1 
ATOM   5191 C CA    . ASN B 1 281 ? 38.152  19.862  -18.037 1.00 39.08 ? 327 ASN B CA    1 
ATOM   5192 C C     . ASN B 1 281 ? 37.168  20.033  -16.873 1.00 39.09 ? 327 ASN B C     1 
ATOM   5193 O O     . ASN B 1 281 ? 36.028  19.524  -16.966 1.00 38.37 ? 327 ASN B O     1 
ATOM   5194 C CB    . ASN B 1 281 ? 39.260  18.879  -17.648 1.00 38.64 ? 327 ASN B CB    1 
ATOM   5195 C CG    . ASN B 1 281 ? 38.832  17.430  -17.805 1.00 37.19 ? 327 ASN B CG    1 
ATOM   5196 O OD1   . ASN B 1 281 ? 38.713  16.711  -16.824 1.00 31.75 ? 327 ASN B OD1   1 
ATOM   5197 N ND2   . ASN B 1 281 ? 38.602  17.003  -19.050 1.00 33.30 ? 327 ASN B ND2   1 
ATOM   5198 N N     . ILE B 1 282 ? 37.581  20.731  -15.803 1.00 38.83 ? 328 ILE B N     1 
ATOM   5199 C CA    . ILE B 1 282 ? 36.655  21.082  -14.675 1.00 39.73 ? 328 ILE B CA    1 
ATOM   5200 C C     . ILE B 1 282 ? 35.389  21.876  -15.113 1.00 40.46 ? 328 ILE B C     1 
ATOM   5201 O O     . ILE B 1 282 ? 34.362  21.795  -14.470 1.00 40.39 ? 328 ILE B O     1 
ATOM   5202 C CB    . ILE B 1 282 ? 37.377  21.844  -13.519 1.00 39.17 ? 328 ILE B CB    1 
ATOM   5203 C CG1   . ILE B 1 282 ? 38.496  21.005  -12.914 1.00 38.58 ? 328 ILE B CG1   1 
ATOM   5204 C CG2   . ILE B 1 282 ? 36.406  22.316  -12.447 1.00 39.55 ? 328 ILE B CG2   1 
ATOM   5205 C CD1   . ILE B 1 282 ? 38.071  19.948  -11.915 1.00 39.74 ? 328 ILE B CD1   1 
ATOM   5206 N N     . ILE B 1 283 ? 35.463  22.602  -16.231 1.00 41.38 ? 329 ILE B N     1 
ATOM   5207 C CA    . ILE B 1 283 ? 34.288  23.299  -16.771 1.00 42.76 ? 329 ILE B CA    1 
ATOM   5208 C C     . ILE B 1 283 ? 33.216  22.352  -17.378 1.00 42.43 ? 329 ILE B C     1 
ATOM   5209 O O     . ILE B 1 283 ? 32.013  22.646  -17.313 1.00 42.98 ? 329 ILE B O     1 
ATOM   5210 C CB    . ILE B 1 283 ? 34.672  24.535  -17.715 1.00 43.04 ? 329 ILE B CB    1 
ATOM   5211 C CG1   . ILE B 1 283 ? 33.693  25.672  -17.527 1.00 44.76 ? 329 ILE B CG1   1 
ATOM   5212 C CG2   . ILE B 1 283 ? 34.777  24.190  -19.193 1.00 43.59 ? 329 ILE B CG2   1 
ATOM   5213 C CD1   . ILE B 1 283 ? 33.643  26.119  -16.086 1.00 47.45 ? 329 ILE B CD1   1 
ATOM   5214 N N     . LYS B 1 284 ? 33.656  21.236  -17.969 1.00 40.97 ? 330 LYS B N     1 
ATOM   5215 C CA    . LYS B 1 284 ? 32.752  20.218  -18.447 1.00 39.42 ? 330 LYS B CA    1 
ATOM   5216 C C     . LYS B 1 284 ? 32.064  19.545  -17.273 1.00 38.98 ? 330 LYS B C     1 
ATOM   5217 O O     . LYS B 1 284 ? 30.857  19.291  -17.334 1.00 38.37 ? 330 LYS B O     1 
ATOM   5218 C CB    . LYS B 1 284 ? 33.501  19.196  -19.250 1.00 39.87 ? 330 LYS B CB    1 
ATOM   5219 C CG    . LYS B 1 284 ? 34.587  19.788  -20.163 1.00 40.90 ? 330 LYS B CG    1 
ATOM   5220 C CD    . LYS B 1 284 ? 34.087  20.301  -21.487 1.00 41.81 ? 330 LYS B CD    1 
ATOM   5221 C CE    . LYS B 1 284 ? 35.243  20.161  -22.496 1.00 45.61 ? 330 LYS B CE    1 
ATOM   5222 N NZ    . LYS B 1 284 ? 34.876  20.603  -23.865 1.00 43.73 ? 330 LYS B NZ    1 
ATOM   5223 N N     . MET B 1 285 ? 32.808  19.309  -16.189 1.00 37.23 ? 331 MET B N     1 
ATOM   5224 C CA    . MET B 1 285 ? 32.251  18.659  -15.030 1.00 36.80 ? 331 MET B CA    1 
ATOM   5225 C C     . MET B 1 285 ? 31.170  19.506  -14.450 1.00 39.06 ? 331 MET B C     1 
ATOM   5226 O O     . MET B 1 285 ? 30.037  19.047  -14.343 1.00 38.35 ? 331 MET B O     1 
ATOM   5227 C CB    . MET B 1 285 ? 33.300  18.307  -13.966 1.00 36.38 ? 331 MET B CB    1 
ATOM   5228 C CG    . MET B 1 285 ? 34.468  17.428  -14.495 1.00 34.36 ? 331 MET B CG    1 
ATOM   5229 S SD    . MET B 1 285 ? 35.576  16.821  -13.223 1.00 34.26 ? 331 MET B SD    1 
ATOM   5230 C CE    . MET B 1 285 ? 36.770  16.054  -14.286 1.00 33.12 ? 331 MET B CE    1 
ATOM   5231 N N     . LYS B 1 286 ? 31.527  20.763  -14.132 1.00 41.28 ? 332 LYS B N     1 
ATOM   5232 C CA    . LYS B 1 286 ? 30.637  21.788  -13.547 1.00 42.20 ? 332 LYS B CA    1 
ATOM   5233 C C     . LYS B 1 286 ? 29.313  21.883  -14.287 1.00 41.09 ? 332 LYS B C     1 
ATOM   5234 O O     . LYS B 1 286 ? 28.267  22.004  -13.680 1.00 40.79 ? 332 LYS B O     1 
ATOM   5235 C CB    . LYS B 1 286 ? 31.344  23.176  -13.442 1.00 42.72 ? 332 LYS B CB    1 
ATOM   5236 C CG    . LYS B 1 286 ? 32.315  23.240  -12.229 1.00 44.98 ? 332 LYS B CG    1 
ATOM   5237 C CD    . LYS B 1 286 ? 32.630  24.639  -11.643 1.00 44.23 ? 332 LYS B CD    1 
ATOM   5238 C CE    . LYS B 1 286 ? 33.378  24.439  -10.275 1.00 48.16 ? 332 LYS B CE    1 
ATOM   5239 N NZ    . LYS B 1 286 ? 33.248  25.551  -9.205  1.00 47.11 ? 332 LYS B NZ    1 
ATOM   5240 N N     . LYS B 1 287 ? 29.372  21.789  -15.596 1.00 40.53 ? 333 LYS B N     1 
ATOM   5241 C CA    . LYS B 1 287 ? 28.181  21.915  -16.381 1.00 41.18 ? 333 LYS B CA    1 
ATOM   5242 C C     . LYS B 1 287 ? 27.260  20.642  -16.473 1.00 41.68 ? 333 LYS B C     1 
ATOM   5243 O O     . LYS B 1 287 ? 26.215  20.669  -17.166 1.00 40.20 ? 333 LYS B O     1 
ATOM   5244 C CB    . LYS B 1 287 ? 28.504  22.572  -17.718 1.00 41.51 ? 333 LYS B CB    1 
ATOM   5245 C CG    . LYS B 1 287 ? 28.917  21.706  -18.807 1.00 41.43 ? 333 LYS B CG    1 
ATOM   5246 C CD    . LYS B 1 287 ? 28.966  22.538  -20.075 1.00 44.04 ? 333 LYS B CD    1 
ATOM   5247 C CE    . LYS B 1 287 ? 29.837  23.748  -19.927 1.00 45.14 ? 333 LYS B CE    1 
ATOM   5248 N NZ    . LYS B 1 287 ? 29.853  24.536  -21.202 1.00 46.05 ? 333 LYS B NZ    1 
ATOM   5249 N N     . CYS B 1 288 ? 27.648  19.605  -15.704 1.00 41.26 ? 334 CYS B N     1 
ATOM   5250 C CA    . CYS B 1 288 ? 26.833  18.444  -15.338 1.00 41.49 ? 334 CYS B CA    1 
ATOM   5251 C C     . CYS B 1 288 ? 26.017  18.722  -14.067 1.00 42.53 ? 334 CYS B C     1 
ATOM   5252 O O     . CYS B 1 288 ? 25.146  17.921  -13.676 1.00 41.67 ? 334 CYS B O     1 
ATOM   5253 C CB    . CYS B 1 288 ? 27.698  17.166  -15.138 1.00 39.99 ? 334 CYS B CB    1 
ATOM   5254 S SG    . CYS B 1 288 ? 28.656  16.735  -16.625 1.00 37.29 ? 334 CYS B SG    1 
ATOM   5255 N N     . TYR B 1 289 ? 26.290  19.854  -13.430 1.00 43.69 ? 335 TYR B N     1 
ATOM   5256 C CA    . TYR B 1 289 ? 25.598  20.228  -12.184 1.00 45.50 ? 335 TYR B CA    1 
ATOM   5257 C C     . TYR B 1 289 ? 24.152  20.777  -12.363 1.00 46.63 ? 335 TYR B C     1 
ATOM   5258 O O     . TYR B 1 289 ? 23.823  21.323  -13.414 1.00 46.87 ? 335 TYR B O     1 
ATOM   5259 C CB    . TYR B 1 289 ? 26.474  21.184  -11.370 1.00 45.27 ? 335 TYR B CB    1 
ATOM   5260 C CG    . TYR B 1 289 ? 27.454  20.430  -10.509 1.00 45.92 ? 335 TYR B CG    1 
ATOM   5261 C CD1   . TYR B 1 289 ? 28.612  19.834  -11.070 1.00 46.50 ? 335 TYR B CD1   1 
ATOM   5262 C CD2   . TYR B 1 289 ? 27.218  20.258  -9.147  1.00 44.37 ? 335 TYR B CD2   1 
ATOM   5263 C CE1   . TYR B 1 289 ? 29.510  19.111  -10.275 1.00 45.12 ? 335 TYR B CE1   1 
ATOM   5264 C CE2   . TYR B 1 289 ? 28.130  19.551  -8.333  1.00 45.56 ? 335 TYR B CE2   1 
ATOM   5265 C CZ    . TYR B 1 289 ? 29.262  18.977  -8.914  1.00 44.90 ? 335 TYR B CZ    1 
ATOM   5266 O OH    . TYR B 1 289 ? 30.128  18.267  -8.129  1.00 45.06 ? 335 TYR B OH    1 
ATOM   5267 N N     . SER B 1 290 ? 23.313  20.591  -11.331 1.00 48.39 ? 336 SER B N     1 
ATOM   5268 C CA    . SER B 1 290 ? 21.889  21.027  -11.286 1.00 49.84 ? 336 SER B CA    1 
ATOM   5269 C C     . SER B 1 290 ? 21.302  21.019  -9.865  1.00 50.71 ? 336 SER B C     1 
ATOM   5270 O O     . SER B 1 290 ? 21.556  20.092  -9.098  1.00 51.34 ? 336 SER B O     1 
ATOM   5271 C CB    . SER B 1 290 ? 21.017  20.133  -12.169 1.00 49.51 ? 336 SER B CB    1 
ATOM   5272 O OG    . SER B 1 290 ? 20.714  20.772  -13.399 1.00 50.70 ? 336 SER B OG    1 
ATOM   5273 N N     . PRO B 1 291 ? 20.475  22.027  -9.516  1.00 51.77 ? 337 PRO B N     1 
ATOM   5274 C CA    . PRO B 1 291 ? 19.808  21.982  -8.194  1.00 52.09 ? 337 PRO B CA    1 
ATOM   5275 C C     . PRO B 1 291 ? 18.994  20.676  -8.017  1.00 52.43 ? 337 PRO B C     1 
ATOM   5276 O O     . PRO B 1 291 ? 18.845  20.169  -6.887  1.00 51.30 ? 337 PRO B O     1 
ATOM   5277 C CB    . PRO B 1 291 ? 18.869  23.192  -8.233  1.00 52.18 ? 337 PRO B CB    1 
ATOM   5278 C CG    . PRO B 1 291 ? 19.475  24.124  -9.280  1.00 52.60 ? 337 PRO B CG    1 
ATOM   5279 C CD    . PRO B 1 291 ? 20.092  23.222  -10.302 1.00 52.15 ? 337 PRO B CD    1 
ATOM   5280 N N     . ASP B 1 292 ? 18.487  20.167  -9.154  1.00 52.74 ? 338 ASP B N     1 
ATOM   5281 C CA    . ASP B 1 292 ? 17.651  18.972  -9.227  1.00 53.33 ? 338 ASP B CA    1 
ATOM   5282 C C     . ASP B 1 292 ? 18.419  17.630  -9.178  1.00 52.83 ? 338 ASP B C     1 
ATOM   5283 O O     . ASP B 1 292 ? 17.900  16.640  -8.637  1.00 53.24 ? 338 ASP B O     1 
ATOM   5284 C CB    . ASP B 1 292 ? 16.670  19.025  -10.432 1.00 54.14 ? 338 ASP B CB    1 
ATOM   5285 C CG    . ASP B 1 292 ? 17.324  19.501  -11.745 1.00 56.41 ? 338 ASP B CG    1 
ATOM   5286 O OD1   . ASP B 1 292 ? 17.981  20.574  -11.766 1.00 58.13 ? 338 ASP B OD1   1 
ATOM   5287 O OD2   . ASP B 1 292 ? 17.131  18.824  -12.787 1.00 59.21 ? 338 ASP B OD2   1 
ATOM   5288 N N     . LYS B 1 293 ? 19.642  17.606  -9.711  1.00 51.28 ? 339 LYS B N     1 
ATOM   5289 C CA    . LYS B 1 293 ? 20.431  16.382  -9.779  1.00 49.72 ? 339 LYS B CA    1 
ATOM   5290 C C     . LYS B 1 293 ? 21.394  16.194  -8.569  1.00 49.45 ? 339 LYS B C     1 
ATOM   5291 O O     . LYS B 1 293 ? 21.939  17.163  -8.032  1.00 49.97 ? 339 LYS B O     1 
ATOM   5292 C CB    . LYS B 1 293 ? 21.200  16.346  -11.100 1.00 49.91 ? 339 LYS B CB    1 
ATOM   5293 C CG    . LYS B 1 293 ? 20.389  16.615  -12.392 1.00 48.27 ? 339 LYS B CG    1 
ATOM   5294 C CD    . LYS B 1 293 ? 19.515  15.438  -12.828 1.00 48.49 ? 339 LYS B CD    1 
ATOM   5295 C CE    . LYS B 1 293 ? 18.627  15.794  -13.988 1.00 50.11 ? 339 LYS B CE    1 
ATOM   5296 N NZ    . LYS B 1 293 ? 19.438  16.085  -15.218 1.00 53.51 ? 339 LYS B NZ    1 
ATOM   5297 N N     . GLU B 1 294 ? 21.585  14.955  -8.119  1.00 48.37 ? 340 GLU B N     1 
ATOM   5298 C CA    . GLU B 1 294 ? 22.640  14.673  -7.171  1.00 48.05 ? 340 GLU B CA    1 
ATOM   5299 C C     . GLU B 1 294 ? 24.028  14.551  -7.873  1.00 47.67 ? 340 GLU B C     1 
ATOM   5300 O O     . GLU B 1 294 ? 24.227  13.707  -8.770  1.00 46.89 ? 340 GLU B O     1 
ATOM   5301 C CB    . GLU B 1 294 ? 22.317  13.461  -6.304  1.00 48.23 ? 340 GLU B CB    1 
ATOM   5302 C CG    . GLU B 1 294 ? 23.499  12.981  -5.442  1.00 50.00 ? 340 GLU B CG    1 
ATOM   5303 C CD    . GLU B 1 294 ? 23.656  13.702  -4.076  1.00 55.79 ? 340 GLU B CD    1 
ATOM   5304 O OE1   . GLU B 1 294 ? 23.114  14.829  -3.892  1.00 56.63 ? 340 GLU B OE1   1 
ATOM   5305 O OE2   . GLU B 1 294 ? 24.342  13.123  -3.178  1.00 55.63 ? 340 GLU B OE2   1 
ATOM   5306 N N     . ARG B 1 295 ? 24.927  15.475  -7.495  1.00 46.45 ? 341 ARG B N     1 
ATOM   5307 C CA    . ARG B 1 295 ? 26.347  15.471  -7.839  1.00 45.41 ? 341 ARG B CA    1 
ATOM   5308 C C     . ARG B 1 295 ? 27.216  15.595  -6.583  1.00 45.43 ? 341 ARG B C     1 
ATOM   5309 O O     . ARG B 1 295 ? 26.864  16.293  -5.615  1.00 45.76 ? 341 ARG B O     1 
ATOM   5310 C CB    . ARG B 1 295 ? 26.682  16.593  -8.790  1.00 44.69 ? 341 ARG B CB    1 
ATOM   5311 C CG    . ARG B 1 295 ? 26.448  16.284  -10.247 1.00 44.96 ? 341 ARG B CG    1 
ATOM   5312 C CD    . ARG B 1 295 ? 25.016  16.523  -10.543 1.00 42.21 ? 341 ARG B CD    1 
ATOM   5313 N NE    . ARG B 1 295 ? 24.616  16.213  -11.903 1.00 41.43 ? 341 ARG B NE    1 
ATOM   5314 C CZ    . ARG B 1 295 ? 24.051  15.073  -12.323 1.00 35.08 ? 341 ARG B CZ    1 
ATOM   5315 N NH1   . ARG B 1 295 ? 23.822  14.053  -11.509 1.00 30.40 ? 341 ARG B NH1   1 
ATOM   5316 N NH2   . ARG B 1 295 ? 23.695  14.995  -13.585 1.00 29.72 ? 341 ARG B NH2   1 
ATOM   5317 N N     . LYS B 1 296 ? 28.311  14.848  -6.568  1.00 45.13 ? 342 LYS B N     1 
ATOM   5318 C CA    . LYS B 1 296 ? 29.377  15.034  -5.590  1.00 44.47 ? 342 LYS B CA    1 
ATOM   5319 C C     . LYS B 1 296 ? 30.710  15.113  -6.356  1.00 44.46 ? 342 LYS B C     1 
ATOM   5320 O O     . LYS B 1 296 ? 30.775  14.712  -7.548  1.00 44.31 ? 342 LYS B O     1 
ATOM   5321 C CB    . LYS B 1 296 ? 29.371  13.928  -4.546  1.00 44.42 ? 342 LYS B CB    1 
ATOM   5322 C CG    . LYS B 1 296 ? 28.167  13.921  -3.616  1.00 45.04 ? 342 LYS B CG    1 
ATOM   5323 C CD    . LYS B 1 296 ? 28.133  15.187  -2.714  1.00 45.80 ? 342 LYS B CD    1 
ATOM   5324 C CE    . LYS B 1 296 ? 26.957  15.176  -1.744  1.00 44.93 ? 342 LYS B CE    1 
ATOM   5325 N NZ    . LYS B 1 296 ? 26.744  16.545  -1.201  1.00 45.86 ? 342 LYS B NZ    1 
ATOM   5326 N N     . MET B 1 297 ? 31.739  15.664  -5.694  1.00 43.42 ? 343 MET B N     1 
ATOM   5327 C CA    . MET B 1 297 ? 33.080  15.904  -6.285  1.00 41.79 ? 343 MET B CA    1 
ATOM   5328 C C     . MET B 1 297 ? 34.059  15.988  -5.158  1.00 42.17 ? 343 MET B C     1 
ATOM   5329 O O     . MET B 1 297 ? 33.828  16.682  -4.172  1.00 42.93 ? 343 MET B O     1 
ATOM   5330 C CB    . MET B 1 297 ? 33.185  17.192  -7.138  1.00 41.79 ? 343 MET B CB    1 
ATOM   5331 C CG    . MET B 1 297 ? 34.447  17.240  -7.984  1.00 39.24 ? 343 MET B CG    1 
ATOM   5332 S SD    . MET B 1 297 ? 35.000  18.642  -8.986  1.00 40.62 ? 343 MET B SD    1 
ATOM   5333 C CE    . MET B 1 297 ? 34.058  18.617  -10.530 1.00 35.16 ? 343 MET B CE    1 
ATOM   5334 N N     . ILE B 1 298 ? 35.122  15.206  -5.284  1.00 42.29 ? 344 ILE B N     1 
ATOM   5335 C CA    . ILE B 1 298 ? 36.306  15.292  -4.430  1.00 40.40 ? 344 ILE B CA    1 
ATOM   5336 C C     . ILE B 1 298 ? 37.561  15.178  -5.267  1.00 40.05 ? 344 ILE B C     1 
ATOM   5337 O O     . ILE B 1 298 ? 37.511  14.737  -6.427  1.00 38.95 ? 344 ILE B O     1 
ATOM   5338 C CB    . ILE B 1 298 ? 36.335  14.252  -3.304  1.00 39.80 ? 344 ILE B CB    1 
ATOM   5339 C CG1   . ILE B 1 298 ? 36.305  12.808  -3.860  1.00 39.74 ? 344 ILE B CG1   1 
ATOM   5340 C CG2   . ILE B 1 298 ? 35.225  14.555  -2.337  1.00 40.66 ? 344 ILE B CG2   1 
ATOM   5341 C CD1   . ILE B 1 298 ? 36.406  11.697  -2.838  1.00 38.51 ? 344 ILE B CD1   1 
ATOM   5342 N N     . THR B 1 299 ? 38.663  15.619  -4.651  1.00 40.36 ? 345 THR B N     1 
ATOM   5343 C CA    . THR B 1 299 ? 40.010  15.548  -5.159  1.00 40.29 ? 345 THR B CA    1 
ATOM   5344 C C     . THR B 1 299 ? 40.854  14.932  -4.037  1.00 41.64 ? 345 THR B C     1 
ATOM   5345 O O     . THR B 1 299 ? 40.731  15.313  -2.850  1.00 41.09 ? 345 THR B O     1 
ATOM   5346 C CB    . THR B 1 299 ? 40.545  16.932  -5.642  1.00 40.82 ? 345 THR B CB    1 
ATOM   5347 O OG1   . THR B 1 299 ? 39.696  17.494  -6.670  1.00 36.78 ? 345 THR B OG1   1 
ATOM   5348 C CG2   . THR B 1 299 ? 41.978  16.788  -6.226  1.00 40.34 ? 345 THR B CG2   1 
ATOM   5349 N N     . ILE B 1 300 ? 41.636  13.905  -4.409  1.00 42.43 ? 346 ILE B N     1 
ATOM   5350 C CA    . ILE B 1 300 ? 42.544  13.203  -3.482  1.00 42.69 ? 346 ILE B CA    1 
ATOM   5351 C C     . ILE B 1 300 ? 43.883  13.959  -3.513  1.00 43.50 ? 346 ILE B C     1 
ATOM   5352 O O     . ILE B 1 300 ? 44.392  14.336  -4.566  1.00 42.60 ? 346 ILE B O     1 
ATOM   5353 C CB    . ILE B 1 300 ? 42.686  11.681  -3.797  1.00 43.31 ? 346 ILE B CB    1 
ATOM   5354 C CG1   . ILE B 1 300 ? 41.309  10.992  -3.727  1.00 42.69 ? 346 ILE B CG1   1 
ATOM   5355 C CG2   . ILE B 1 300 ? 43.751  10.999  -2.875  1.00 41.86 ? 346 ILE B CG2   1 
ATOM   5356 C CD1   . ILE B 1 300 ? 41.320  9.488   -3.796  1.00 42.17 ? 346 ILE B CD1   1 
ATOM   5357 N N     . ARG B 1 301 ? 44.392  14.241  -2.319  1.00 45.23 ? 347 ARG B N     1 
ATOM   5358 C CA    . ARG B 1 301 ? 45.437  15.244  -2.132  1.00 46.84 ? 347 ARG B CA    1 
ATOM   5359 C C     . ARG B 1 301 ? 46.773  14.600  -2.500  1.00 44.86 ? 347 ARG B C     1 
ATOM   5360 O O     . ARG B 1 301 ? 47.109  13.542  -1.990  1.00 43.98 ? 347 ARG B O     1 
ATOM   5361 C CB    . ARG B 1 301 ? 45.426  15.737  -0.658  1.00 46.65 ? 347 ARG B CB    1 
ATOM   5362 C CG    . ARG B 1 301 ? 45.537  17.278  -0.467  1.00 50.11 ? 347 ARG B CG    1 
ATOM   5363 C CD    . ARG B 1 301 ? 45.201  17.799  0.998   1.00 51.41 ? 347 ARG B CD    1 
ATOM   5364 N NE    . ARG B 1 301 ? 46.249  17.612  2.048   1.00 58.89 ? 347 ARG B NE    1 
ATOM   5365 C CZ    . ARG B 1 301 ? 47.030  16.526  2.240   1.00 60.79 ? 347 ARG B CZ    1 
ATOM   5366 N NH1   . ARG B 1 301 ? 46.921  15.441  1.465   1.00 61.28 ? 347 ARG B NH1   1 
ATOM   5367 N NH2   . ARG B 1 301 ? 47.929  16.510  3.234   1.00 59.92 ? 347 ARG B NH2   1 
ATOM   5368 N N     . GLY B 1 302 ? 47.506  15.267  -3.394  1.00 44.62 ? 348 GLY B N     1 
ATOM   5369 C CA    . GLY B 1 302 ? 48.827  14.814  -3.911  1.00 42.94 ? 348 GLY B CA    1 
ATOM   5370 C C     . GLY B 1 302 ? 48.792  13.925  -5.150  1.00 41.87 ? 348 GLY B C     1 
ATOM   5371 O O     . GLY B 1 302 ? 49.778  13.841  -5.903  1.00 42.81 ? 348 GLY B O     1 
ATOM   5372 N N     . SER B 1 303 ? 47.635  13.298  -5.362  1.00 39.25 ? 349 SER B N     1 
ATOM   5373 C CA    . SER B 1 303 ? 47.465  12.130  -6.194  1.00 36.73 ? 349 SER B CA    1 
ATOM   5374 C C     . SER B 1 303 ? 47.729  12.456  -7.631  1.00 35.36 ? 349 SER B C     1 
ATOM   5375 O O     . SER B 1 303 ? 47.587  13.603  -8.059  1.00 35.60 ? 349 SER B O     1 
ATOM   5376 C CB    . SER B 1 303 ? 46.032  11.591  -6.031  1.00 37.26 ? 349 SER B CB    1 
ATOM   5377 O OG    . SER B 1 303 ? 45.109  12.520  -6.598  1.00 34.51 ? 349 SER B OG    1 
ATOM   5378 N N     . VAL B 1 304 ? 48.129  11.449  -8.399  1.00 33.20 ? 350 VAL B N     1 
ATOM   5379 C CA    . VAL B 1 304 ? 48.292  11.655  -9.836  1.00 30.91 ? 350 VAL B CA    1 
ATOM   5380 C C     . VAL B 1 304 ? 47.220  10.863  -10.591 1.00 29.94 ? 350 VAL B C     1 
ATOM   5381 O O     . VAL B 1 304 ? 46.528  10.047  -10.009 1.00 29.96 ? 350 VAL B O     1 
ATOM   5382 C CB    . VAL B 1 304 ? 49.718  11.246  -10.296 1.00 31.31 ? 350 VAL B CB    1 
ATOM   5383 C CG1   . VAL B 1 304 ? 50.733  12.328  -9.906  1.00 30.55 ? 350 VAL B CG1   1 
ATOM   5384 C CG2   . VAL B 1 304 ? 50.085  9.870   -9.740  1.00 28.90 ? 350 VAL B CG2   1 
ATOM   5385 N N     . HIS B 1 305 ? 47.096  11.096  -11.882 1.00 29.17 ? 351 HIS B N     1 
ATOM   5386 C CA    . HIS B 1 305 ? 46.174  10.341  -12.719 1.00 28.80 ? 351 HIS B CA    1 
ATOM   5387 C C     . HIS B 1 305 ? 46.259  8.803   -12.466 1.00 28.80 ? 351 HIS B C     1 
ATOM   5388 O O     . HIS B 1 305 ? 45.237  8.111   -12.331 1.00 27.86 ? 351 HIS B O     1 
ATOM   5389 C CB    . HIS B 1 305 ? 46.453  10.713  -14.176 1.00 28.19 ? 351 HIS B CB    1 
ATOM   5390 C CG    . HIS B 1 305 ? 45.316  10.449  -15.111 1.00 29.54 ? 351 HIS B CG    1 
ATOM   5391 N ND1   . HIS B 1 305 ? 44.009  10.783  -14.815 1.00 29.43 ? 351 HIS B ND1   1 
ATOM   5392 C CD2   . HIS B 1 305 ? 45.298  9.936   -16.364 1.00 27.23 ? 351 HIS B CD2   1 
ATOM   5393 C CE1   . HIS B 1 305 ? 43.233  10.461  -15.830 1.00 27.49 ? 351 HIS B CE1   1 
ATOM   5394 N NE2   . HIS B 1 305 ? 43.988  9.938   -16.778 1.00 30.02 ? 351 HIS B NE2   1 
ATOM   5395 N N     . GLN B 1 306 ? 47.492  8.297   -12.348 1.00 28.38 ? 352 GLN B N     1 
ATOM   5396 C CA    . GLN B 1 306 ? 47.763  6.872   -12.404 1.00 27.79 ? 352 GLN B CA    1 
ATOM   5397 C C     . GLN B 1 306 ? 47.482  6.180   -11.098 1.00 27.88 ? 352 GLN B C     1 
ATOM   5398 O O     . GLN B 1 306 ? 47.435  4.955   -11.044 1.00 28.02 ? 352 GLN B O     1 
ATOM   5399 C CB    . GLN B 1 306 ? 49.172  6.603   -12.898 1.00 27.10 ? 352 GLN B CB    1 
ATOM   5400 C CG    . GLN B 1 306 ? 49.315  6.901   -14.320 1.00 28.13 ? 352 GLN B CG    1 
ATOM   5401 C CD    . GLN B 1 306 ? 48.499  5.929   -15.170 1.00 33.48 ? 352 GLN B CD    1 
ATOM   5402 O OE1   . GLN B 1 306 ? 48.472  4.704   -14.903 1.00 33.82 ? 352 GLN B OE1   1 
ATOM   5403 N NE2   . GLN B 1 306 ? 47.801  6.466   -16.174 1.00 31.96 ? 352 GLN B NE2   1 
ATOM   5404 N N     . ASN B 1 307 ? 47.280  6.976   -10.044 1.00 27.87 ? 353 ASN B N     1 
ATOM   5405 C CA    . ASN B 1 307 ? 46.832  6.491   -8.747  1.00 26.96 ? 353 ASN B CA    1 
ATOM   5406 C C     . ASN B 1 307 ? 45.563  5.564   -8.769  1.00 26.94 ? 353 ASN B C     1 
ATOM   5407 O O     . ASN B 1 307 ? 45.353  4.738   -7.871  1.00 27.42 ? 353 ASN B O     1 
ATOM   5408 C CB    . ASN B 1 307 ? 46.627  7.726   -7.819  1.00 27.41 ? 353 ASN B CB    1 
ATOM   5409 C CG    . ASN B 1 307 ? 47.895  8.071   -6.926  1.00 26.52 ? 353 ASN B CG    1 
ATOM   5410 O OD1   . ASN B 1 307 ? 48.406  9.167   -6.983  1.00 24.35 ? 353 ASN B OD1   1 
ATOM   5411 N ND2   . ASN B 1 307 ? 48.343  7.130   -6.109  1.00 26.30 ? 353 ASN B ND2   1 
ATOM   5412 N N     . PHE B 1 308 ? 44.703  5.725   -9.767  1.00 27.03 ? 354 PHE B N     1 
ATOM   5413 C CA    . PHE B 1 308 ? 43.458  4.955   -9.837  1.00 28.15 ? 354 PHE B CA    1 
ATOM   5414 C C     . PHE B 1 308 ? 43.650  3.568   -10.495 1.00 28.79 ? 354 PHE B C     1 
ATOM   5415 O O     . PHE B 1 308 ? 42.858  2.664   -10.270 1.00 29.77 ? 354 PHE B O     1 
ATOM   5416 C CB    . PHE B 1 308 ? 42.359  5.771   -10.545 1.00 27.72 ? 354 PHE B CB    1 
ATOM   5417 C CG    . PHE B 1 308 ? 41.927  7.053   -9.788  1.00 29.50 ? 354 PHE B CG    1 
ATOM   5418 C CD1   . PHE B 1 308 ? 41.036  6.998   -8.724  1.00 29.35 ? 354 PHE B CD1   1 
ATOM   5419 C CD2   . PHE B 1 308 ? 42.430  8.307   -10.151 1.00 30.03 ? 354 PHE B CD2   1 
ATOM   5420 C CE1   . PHE B 1 308 ? 40.627  8.202   -8.047  1.00 29.49 ? 354 PHE B CE1   1 
ATOM   5421 C CE2   . PHE B 1 308 ? 42.057  9.471   -9.469  1.00 29.84 ? 354 PHE B CE2   1 
ATOM   5422 C CZ    . PHE B 1 308 ? 41.140  9.418   -8.429  1.00 26.06 ? 354 PHE B CZ    1 
ATOM   5423 N N     . ALA B 1 309 ? 44.713  3.425   -11.292 1.00 28.79 ? 355 ALA B N     1 
ATOM   5424 C CA    . ALA B 1 309 ? 45.031  2.218   -12.067 1.00 28.50 ? 355 ALA B CA    1 
ATOM   5425 C C     . ALA B 1 309 ? 46.140  1.388   -11.405 1.00 28.89 ? 355 ALA B C     1 
ATOM   5426 O O     . ALA B 1 309 ? 46.843  1.866   -10.508 1.00 28.71 ? 355 ALA B O     1 
ATOM   5427 C CB    . ALA B 1 309 ? 45.421  2.614   -13.495 1.00 27.92 ? 355 ALA B CB    1 
ATOM   5428 N N     . ASP B 1 310 ? 46.312  0.150   -11.854 1.00 28.37 ? 356 ASP B N     1 
ATOM   5429 C CA    . ASP B 1 310 ? 47.134  -0.798  -11.122 1.00 28.10 ? 356 ASP B CA    1 
ATOM   5430 C C     . ASP B 1 310 ? 48.635  -0.597  -11.221 1.00 28.27 ? 356 ASP B C     1 
ATOM   5431 O O     . ASP B 1 310 ? 49.358  -1.157  -10.403 1.00 28.05 ? 356 ASP B O     1 
ATOM   5432 C CB    . ASP B 1 310 ? 46.804  -2.237  -11.551 1.00 28.52 ? 356 ASP B CB    1 
ATOM   5433 C CG    . ASP B 1 310 ? 45.457  -2.703  -11.059 1.00 29.61 ? 356 ASP B CG    1 
ATOM   5434 O OD1   . ASP B 1 310 ? 44.925  -2.043  -10.144 1.00 31.67 ? 356 ASP B OD1   1 
ATOM   5435 O OD2   . ASP B 1 310 ? 44.935  -3.731  -11.572 1.00 30.21 ? 356 ASP B OD2   1 
ATOM   5436 N N     . PHE B 1 311 ? 49.106  0.172   -12.202 1.00 28.31 ? 357 PHE B N     1 
ATOM   5437 C CA    . PHE B 1 311 ? 50.566  0.451   -12.393 1.00 29.54 ? 357 PHE B CA    1 
ATOM   5438 C C     . PHE B 1 311 ? 51.143  1.275   -11.235 1.00 30.44 ? 357 PHE B C     1 
ATOM   5439 O O     . PHE B 1 311 ? 52.363  1.355   -11.058 1.00 31.44 ? 357 PHE B O     1 
ATOM   5440 C CB    . PHE B 1 311 ? 50.901  1.118   -13.771 1.00 28.41 ? 357 PHE B CB    1 
ATOM   5441 C CG    . PHE B 1 311 ? 51.191  0.126   -14.875 1.00 31.61 ? 357 PHE B CG    1 
ATOM   5442 C CD1   . PHE B 1 311 ? 52.467  -0.438  -15.015 1.00 32.23 ? 357 PHE B CD1   1 
ATOM   5443 C CD2   . PHE B 1 311 ? 50.185  -0.283  -15.753 1.00 32.96 ? 357 PHE B CD2   1 
ATOM   5444 C CE1   . PHE B 1 311 ? 52.744  -1.381  -16.016 1.00 34.87 ? 357 PHE B CE1   1 
ATOM   5445 C CE2   . PHE B 1 311 ? 50.438  -1.225  -16.745 1.00 35.41 ? 357 PHE B CE2   1 
ATOM   5446 C CZ    . PHE B 1 311 ? 51.728  -1.773  -16.893 1.00 34.67 ? 357 PHE B CZ    1 
ATOM   5447 N N     . THR B 1 312 ? 50.266  1.905   -10.463 1.00 31.20 ? 358 THR B N     1 
ATOM   5448 C CA    . THR B 1 312 ? 50.678  2.563   -9.196  1.00 31.19 ? 358 THR B CA    1 
ATOM   5449 C C     . THR B 1 312 ? 51.215  1.579   -8.184  1.00 30.87 ? 358 THR B C     1 
ATOM   5450 O O     . THR B 1 312 ? 51.908  1.976   -7.282  1.00 31.07 ? 358 THR B O     1 
ATOM   5451 C CB    . THR B 1 312 ? 49.543  3.455   -8.584  1.00 30.67 ? 358 THR B CB    1 
ATOM   5452 O OG1   . THR B 1 312 ? 50.107  4.524   -7.791  1.00 32.40 ? 358 THR B OG1   1 
ATOM   5453 C CG2   . THR B 1 312 ? 48.564  2.653   -7.793  1.00 29.03 ? 358 THR B CG2   1 
ATOM   5454 N N     . PHE B 1 313 ? 50.918  0.299   -8.356  1.00 30.90 ? 359 PHE B N     1 
ATOM   5455 C CA    . PHE B 1 313 ? 51.417  -0.704  -7.441  1.00 32.65 ? 359 PHE B CA    1 
ATOM   5456 C C     . PHE B 1 313 ? 52.546  -1.554  -8.018  1.00 33.94 ? 359 PHE B C     1 
ATOM   5457 O O     . PHE B 1 313 ? 53.069  -2.409  -7.307  1.00 34.48 ? 359 PHE B O     1 
ATOM   5458 C CB    . PHE B 1 313 ? 50.310  -1.640  -6.957  1.00 32.64 ? 359 PHE B CB    1 
ATOM   5459 C CG    . PHE B 1 313 ? 49.090  -0.927  -6.437  1.00 35.95 ? 359 PHE B CG    1 
ATOM   5460 C CD1   . PHE B 1 313 ? 49.043  -0.466  -5.107  1.00 35.75 ? 359 PHE B CD1   1 
ATOM   5461 C CD2   . PHE B 1 313 ? 47.971  -0.725  -7.270  1.00 34.08 ? 359 PHE B CD2   1 
ATOM   5462 C CE1   . PHE B 1 313 ? 47.894  0.206   -4.634  1.00 37.54 ? 359 PHE B CE1   1 
ATOM   5463 C CE2   . PHE B 1 313 ? 46.813  -0.080  -6.797  1.00 33.62 ? 359 PHE B CE2   1 
ATOM   5464 C CZ    . PHE B 1 313 ? 46.767  0.396   -5.492  1.00 34.74 ? 359 PHE B CZ    1 
ATOM   5465 N N     . ALA B 1 314 ? 52.930  -1.314  -9.281  1.00 35.23 ? 360 ALA B N     1 
ATOM   5466 C CA    . ALA B 1 314 ? 53.754  -2.274  -10.039 1.00 35.95 ? 360 ALA B CA    1 
ATOM   5467 C C     . ALA B 1 314 ? 55.260  -2.030  -9.980  1.00 36.10 ? 360 ALA B C     1 
ATOM   5468 O O     . ALA B 1 314 ? 56.064  -2.877  -10.393 1.00 36.26 ? 360 ALA B O     1 
ATOM   5469 C CB    . ALA B 1 314 ? 53.248  -2.399  -11.507 1.00 35.61 ? 360 ALA B CB    1 
ATOM   5470 N N     . THR B 1 315 ? 55.637  -0.867  -9.472  1.00 37.70 ? 361 THR B N     1 
ATOM   5471 C CA    . THR B 1 315 ? 57.055  -0.479  -9.312  1.00 39.28 ? 361 THR B CA    1 
ATOM   5472 C C     . THR B 1 315 ? 57.305  0.041   -7.894  1.00 39.58 ? 361 THR B C     1 
ATOM   5473 O O     . THR B 1 315 ? 56.364  0.216   -7.123  1.00 38.01 ? 361 THR B O     1 
ATOM   5474 C CB    . THR B 1 315 ? 57.499  0.612   -10.362 1.00 39.23 ? 361 THR B CB    1 
ATOM   5475 O OG1   . THR B 1 315 ? 57.112  1.927   -9.930  1.00 40.88 ? 361 THR B OG1   1 
ATOM   5476 C CG2   . THR B 1 315 ? 56.878  0.351   -11.757 1.00 40.69 ? 361 THR B CG2   1 
ATOM   5477 N N     . GLY B 1 316 ? 58.576  0.296   -7.565  1.00 41.18 ? 362 GLY B N     1 
ATOM   5478 C CA    . GLY B 1 316 ? 58.935  0.978   -6.303  1.00 42.78 ? 362 GLY B CA    1 
ATOM   5479 C C     . GLY B 1 316 ? 58.630  2.463   -6.283  1.00 43.64 ? 362 GLY B C     1 
ATOM   5480 O O     . GLY B 1 316 ? 58.322  3.042   -7.326  1.00 43.65 ? 362 GLY B O     1 
ATOM   5481 N N     . LYS B 1 317 ? 58.720  3.074   -5.095  1.00 44.96 ? 363 LYS B N     1 
ATOM   5482 C CA    . LYS B 1 317 ? 58.458  4.510   -4.886  1.00 46.23 ? 363 LYS B CA    1 
ATOM   5483 C C     . LYS B 1 317 ? 59.264  5.437   -5.805  1.00 46.62 ? 363 LYS B C     1 
ATOM   5484 O O     . LYS B 1 317 ? 58.712  6.347   -6.452  1.00 47.10 ? 363 LYS B O     1 
ATOM   5485 C CB    . LYS B 1 317 ? 58.772  4.888   -3.431  1.00 47.29 ? 363 LYS B CB    1 
ATOM   5486 C CG    . LYS B 1 317 ? 57.761  4.397   -2.374  1.00 51.68 ? 363 LYS B CG    1 
ATOM   5487 C CD    . LYS B 1 317 ? 56.920  5.556   -1.726  1.00 55.37 ? 363 LYS B CD    1 
ATOM   5488 C CE    . LYS B 1 317 ? 56.919  6.880   -2.553  1.00 57.96 ? 363 LYS B CE    1 
ATOM   5489 N NZ    . LYS B 1 317 ? 56.734  8.077   -1.652  1.00 58.67 ? 363 LYS B NZ    1 
ATOM   5490 N N     . ILE B 1 318 ? 60.576  5.241   -5.845  1.00 47.02 ? 364 ILE B N     1 
ATOM   5491 C CA    . ILE B 1 318 ? 61.444  6.133   -6.637  1.00 47.03 ? 364 ILE B CA    1 
ATOM   5492 C C     . ILE B 1 318 ? 61.144  6.021   -8.145  1.00 46.68 ? 364 ILE B C     1 
ATOM   5493 O O     . ILE B 1 318 ? 60.935  7.029   -8.791  1.00 47.27 ? 364 ILE B O     1 
ATOM   5494 C CB    . ILE B 1 318 ? 62.994  5.966   -6.310  1.00 46.95 ? 364 ILE B CB    1 
ATOM   5495 C CG1   . ILE B 1 318 ? 63.297  6.374   -4.869  1.00 46.85 ? 364 ILE B CG1   1 
ATOM   5496 C CG2   . ILE B 1 318 ? 63.864  6.802   -7.246  1.00 47.15 ? 364 ILE B CG2   1 
ATOM   5497 C CD1   . ILE B 1 318 ? 64.507  5.619   -4.277  1.00 46.65 ? 364 ILE B CD1   1 
ATOM   5498 N N     . ILE B 1 319 ? 61.130  4.811   -8.693  1.00 46.44 ? 365 ILE B N     1 
ATOM   5499 C CA    . ILE B 1 319 ? 60.721  4.596   -10.094 1.00 46.50 ? 365 ILE B CA    1 
ATOM   5500 C C     . ILE B 1 319 ? 59.272  5.102   -10.294 1.00 46.00 ? 365 ILE B C     1 
ATOM   5501 O O     . ILE B 1 319 ? 58.979  5.863   -11.227 1.00 44.76 ? 365 ILE B O     1 
ATOM   5502 C CB    . ILE B 1 319 ? 60.840  3.065   -10.493 1.00 46.73 ? 365 ILE B CB    1 
ATOM   5503 C CG1   . ILE B 1 319 ? 62.285  2.554   -10.315 1.00 48.84 ? 365 ILE B CG1   1 
ATOM   5504 C CG2   . ILE B 1 319 ? 60.328  2.783   -11.916 1.00 45.72 ? 365 ILE B CG2   1 
ATOM   5505 C CD1   . ILE B 1 319 ? 63.377  3.403   -11.050 1.00 50.43 ? 365 ILE B CD1   1 
ATOM   5506 N N     . GLY B 1 320 ? 58.391  4.686   -9.382  1.00 45.71 ? 366 GLY B N     1 
ATOM   5507 C CA    . GLY B 1 320 ? 56.988  5.083   -9.397  1.00 46.22 ? 366 GLY B CA    1 
ATOM   5508 C C     . GLY B 1 320 ? 56.780  6.566   -9.542  1.00 46.12 ? 366 GLY B C     1 
ATOM   5509 O O     . GLY B 1 320 ? 56.084  7.004   -10.441 1.00 44.00 ? 366 GLY B O     1 
ATOM   5510 N N     . HIS B 1 321 ? 57.426  7.335   -8.669  1.00 47.69 ? 367 HIS B N     1 
ATOM   5511 C CA    . HIS B 1 321 ? 57.329  8.789   -8.712  1.00 49.19 ? 367 HIS B CA    1 
ATOM   5512 C C     . HIS B 1 321 ? 58.004  9.368   -9.952  1.00 49.14 ? 367 HIS B C     1 
ATOM   5513 O O     . HIS B 1 321 ? 57.520  10.343  -10.515 1.00 49.01 ? 367 HIS B O     1 
ATOM   5514 C CB    . HIS B 1 321 ? 57.848  9.425   -7.410  1.00 50.62 ? 367 HIS B CB    1 
ATOM   5515 C CG    . HIS B 1 321 ? 57.460  10.871  -7.248  1.00 55.15 ? 367 HIS B CG    1 
ATOM   5516 N ND1   . HIS B 1 321 ? 56.337  11.269  -6.544  1.00 59.01 ? 367 HIS B ND1   1 
ATOM   5517 C CD2   . HIS B 1 321 ? 58.032  12.010  -7.716  1.00 58.26 ? 367 HIS B CD2   1 
ATOM   5518 C CE1   . HIS B 1 321 ? 56.236  12.590  -6.584  1.00 59.89 ? 367 HIS B CE1   1 
ATOM   5519 N NE2   . HIS B 1 321 ? 57.252  13.064  -7.287  1.00 61.32 ? 367 HIS B NE2   1 
ATOM   5520 N N     . MET B 1 322 ? 59.091  8.744   -10.411 1.00 49.52 ? 368 MET B N     1 
ATOM   5521 C CA    . MET B 1 322 ? 59.783  9.206   -11.619 1.00 50.33 ? 368 MET B CA    1 
ATOM   5522 C C     . MET B 1 322 ? 58.859  9.211   -12.818 1.00 49.33 ? 368 MET B C     1 
ATOM   5523 O O     . MET B 1 322 ? 58.749  10.218  -13.516 1.00 49.30 ? 368 MET B O     1 
ATOM   5524 C CB    . MET B 1 322 ? 61.007  8.348   -11.964 1.00 50.19 ? 368 MET B CB    1 
ATOM   5525 C CG    . MET B 1 322 ? 61.949  8.118   -10.844 1.00 51.24 ? 368 MET B CG    1 
ATOM   5526 S SD    . MET B 1 322 ? 63.588  7.657   -11.420 1.00 53.79 ? 368 MET B SD    1 
ATOM   5527 C CE    . MET B 1 322 ? 64.338  9.312   -11.345 1.00 57.60 ? 368 MET B CE    1 
ATOM   5528 N N     . LEU B 1 323 ? 58.210  8.070   -13.056 1.00 48.33 ? 369 LEU B N     1 
ATOM   5529 C CA    . LEU B 1 323 ? 57.339  7.902   -14.211 1.00 47.26 ? 369 LEU B CA    1 
ATOM   5530 C C     . LEU B 1 323 ? 55.897  8.402   -13.989 1.00 46.02 ? 369 LEU B C     1 
ATOM   5531 O O     . LEU B 1 323 ? 55.064  8.286   -14.876 1.00 45.45 ? 369 LEU B O     1 
ATOM   5532 C CB    . LEU B 1 323 ? 57.308  6.440   -14.624 1.00 47.68 ? 369 LEU B CB    1 
ATOM   5533 C CG    . LEU B 1 323 ? 58.619  5.672   -14.722 1.00 48.42 ? 369 LEU B CG    1 
ATOM   5534 C CD1   . LEU B 1 323 ? 58.295  4.166   -14.642 1.00 46.97 ? 369 LEU B CD1   1 
ATOM   5535 C CD2   . LEU B 1 323 ? 59.380  6.048   -16.004 1.00 47.74 ? 369 LEU B CD2   1 
ATOM   5536 N N     . LYS B 1 324 ? 55.630  8.950   -12.809 1.00 44.77 ? 370 LYS B N     1 
ATOM   5537 C CA    . LYS B 1 324 ? 54.320  9.481   -12.429 1.00 44.03 ? 370 LYS B CA    1 
ATOM   5538 C C     . LYS B 1 324 ? 53.231  8.397   -12.348 1.00 41.84 ? 370 LYS B C     1 
ATOM   5539 O O     . LYS B 1 324 ? 52.071  8.624   -12.695 1.00 41.97 ? 370 LYS B O     1 
ATOM   5540 C CB    . LYS B 1 324 ? 53.927  10.667  -13.324 1.00 45.02 ? 370 LYS B CB    1 
ATOM   5541 C CG    . LYS B 1 324 ? 54.830  11.901  -13.113 1.00 49.02 ? 370 LYS B CG    1 
ATOM   5542 C CD    . LYS B 1 324 ? 54.859  12.788  -14.374 1.00 54.42 ? 370 LYS B CD    1 
ATOM   5543 C CE    . LYS B 1 324 ? 56.142  13.653  -14.443 1.00 57.39 ? 370 LYS B CE    1 
ATOM   5544 N NZ    . LYS B 1 324 ? 56.489  13.998  -15.870 1.00 56.81 ? 370 LYS B NZ    1 
ATOM   5545 N N     . LEU B 1 325 ? 53.636  7.228   -11.867 1.00 38.89 ? 371 LEU B N     1 
ATOM   5546 C CA    . LEU B 1 325 ? 52.743  6.166   -11.435 1.00 37.34 ? 371 LEU B CA    1 
ATOM   5547 C C     . LEU B 1 325 ? 52.264  6.338   -10.000 1.00 37.43 ? 371 LEU B C     1 
ATOM   5548 O O     . LEU B 1 325 ? 51.242  5.764   -9.562  1.00 36.38 ? 371 LEU B O     1 
ATOM   5549 C CB    . LEU B 1 325 ? 53.440  4.832   -11.601 1.00 36.35 ? 371 LEU B CB    1 
ATOM   5550 C CG    . LEU B 1 325 ? 54.023  4.583   -12.985 1.00 36.05 ? 371 LEU B CG    1 
ATOM   5551 C CD1   . LEU B 1 325 ? 54.715  3.208   -13.066 1.00 34.68 ? 371 LEU B CD1   1 
ATOM   5552 C CD2   . LEU B 1 325 ? 52.917  4.706   -14.044 1.00 33.82 ? 371 LEU B CD2   1 
ATOM   5553 N N     . LYS B 1 326 ? 53.002  7.166   -9.271  1.00 38.35 ? 372 LYS B N     1 
ATOM   5554 C CA    . LYS B 1 326 ? 52.787  7.393   -7.836  1.00 39.03 ? 372 LYS B CA    1 
ATOM   5555 C C     . LYS B 1 326 ? 52.796  8.873   -7.609  1.00 39.66 ? 372 LYS B C     1 
ATOM   5556 O O     . LYS B 1 326 ? 53.433  9.609   -8.365  1.00 39.09 ? 372 LYS B O     1 
ATOM   5557 C CB    . LYS B 1 326 ? 53.875  6.728   -6.967  1.00 38.51 ? 372 LYS B CB    1 
ATOM   5558 C CG    . LYS B 1 326 ? 53.775  5.209   -6.926  1.00 37.52 ? 372 LYS B CG    1 
ATOM   5559 C CD    . LYS B 1 326 ? 55.071  4.581   -6.479  1.00 37.50 ? 372 LYS B CD    1 
ATOM   5560 C CE    . LYS B 1 326 ? 54.898  3.122   -6.082  1.00 35.59 ? 372 LYS B CE    1 
ATOM   5561 N NZ    . LYS B 1 326 ? 53.644  2.954   -5.287  1.00 34.07 ? 372 LYS B NZ    1 
ATOM   5562 N N     . GLY B 1 327 ? 52.073  9.305   -6.574  1.00 40.66 ? 373 GLY B N     1 
ATOM   5563 C CA    . GLY B 1 327 ? 52.028  10.724  -6.248  1.00 41.90 ? 373 GLY B CA    1 
ATOM   5564 C C     . GLY B 1 327 ? 52.671  10.924  -4.899  1.00 42.35 ? 373 GLY B C     1 
ATOM   5565 O O     . GLY B 1 327 ? 53.391  10.052  -4.409  1.00 43.04 ? 373 GLY B O     1 
ATOM   5566 N N     . ASP B 1 328 ? 52.395  12.071  -4.297  1.00 42.89 ? 374 ASP B N     1 
ATOM   5567 C CA    . ASP B 1 328 ? 52.820  12.361  -2.933  1.00 43.44 ? 374 ASP B CA    1 
ATOM   5568 C C     . ASP B 1 328 ? 52.231  11.401  -1.921  1.00 43.11 ? 374 ASP B C     1 
ATOM   5569 O O     . ASP B 1 328 ? 52.939  10.778  -1.082  1.00 43.81 ? 374 ASP B O     1 
ATOM   5570 C CB    . ASP B 1 328 ? 52.400  13.765  -2.581  1.00 43.85 ? 374 ASP B CB    1 
ATOM   5571 C CG    . ASP B 1 328 ? 53.493  14.740  -2.803  1.00 47.31 ? 374 ASP B CG    1 
ATOM   5572 O OD1   . ASP B 1 328 ? 54.460  14.398  -3.526  1.00 50.13 ? 374 ASP B OD1   1 
ATOM   5573 O OD2   . ASP B 1 328 ? 53.389  15.850  -2.239  1.00 51.02 ? 374 ASP B OD2   1 
ATOM   5574 N N     . ILE B 1 329 ? 50.921  11.290  -2.029  1.00 42.11 ? 375 ILE B N     1 
ATOM   5575 C CA    . ILE B 1 329 ? 50.110  10.444  -1.208  1.00 40.94 ? 375 ILE B CA    1 
ATOM   5576 C C     . ILE B 1 329 ? 50.582  9.008   -1.466  1.00 39.72 ? 375 ILE B C     1 
ATOM   5577 O O     . ILE B 1 329 ? 51.062  8.690   -2.525  1.00 39.03 ? 375 ILE B O     1 
ATOM   5578 C CB    . ILE B 1 329 ? 48.623  10.725  -1.562  1.00 40.96 ? 375 ILE B CB    1 
ATOM   5579 C CG1   . ILE B 1 329 ? 47.674  10.154  -0.527  1.00 42.07 ? 375 ILE B CG1   1 
ATOM   5580 C CG2   . ILE B 1 329 ? 48.286  10.242  -3.033  1.00 43.13 ? 375 ILE B CG2   1 
ATOM   5581 C CD1   . ILE B 1 329 ? 46.349  10.867  -0.521  1.00 43.96 ? 375 ILE B CD1   1 
ATOM   5582 N N     . ASP B 1 330 ? 50.484  8.140   -0.489  1.00 38.98 ? 376 ASP B N     1 
ATOM   5583 C CA    . ASP B 1 330 ? 50.847  6.791   -0.764  1.00 39.08 ? 376 ASP B CA    1 
ATOM   5584 C C     . ASP B 1 330 ? 49.705  6.130   -1.582  1.00 39.35 ? 376 ASP B C     1 
ATOM   5585 O O     . ASP B 1 330 ? 48.518  6.526   -1.447  1.00 39.02 ? 376 ASP B O     1 
ATOM   5586 C CB    . ASP B 1 330 ? 51.163  6.057   0.554   1.00 39.22 ? 376 ASP B CB    1 
ATOM   5587 C CG    . ASP B 1 330 ? 50.664  4.631   0.575   1.00 40.62 ? 376 ASP B CG    1 
ATOM   5588 O OD1   . ASP B 1 330 ? 51.402  3.711   1.003   1.00 44.77 ? 376 ASP B OD1   1 
ATOM   5589 O OD2   . ASP B 1 330 ? 49.517  4.428   0.152   1.00 42.99 ? 376 ASP B OD2   1 
ATOM   5590 N N     . SER B 1 331 ? 50.085  5.130   -2.394  1.00 38.23 ? 377 SER B N     1 
ATOM   5591 C CA    . SER B 1 331 ? 49.190  4.301   -3.201  1.00 36.94 ? 377 SER B CA    1 
ATOM   5592 C C     . SER B 1 331 ? 48.072  3.501   -2.494  1.00 36.84 ? 377 SER B C     1 
ATOM   5593 O O     . SER B 1 331 ? 46.918  3.667   -2.825  1.00 35.20 ? 377 SER B O     1 
ATOM   5594 C CB    . SER B 1 331 ? 50.011  3.418   -4.129  1.00 36.15 ? 377 SER B CB    1 
ATOM   5595 O OG    . SER B 1 331 ? 50.611  4.245   -5.107  1.00 34.33 ? 377 SER B OG    1 
ATOM   5596 N N     . ASN B 1 332 ? 48.391  2.622   -1.556  1.00 37.43 ? 378 ASN B N     1 
ATOM   5597 C CA    . ASN B 1 332 ? 47.327  1.946   -0.825  1.00 38.65 ? 378 ASN B CA    1 
ATOM   5598 C C     . ASN B 1 332 ? 46.380  2.965   -0.143  1.00 38.74 ? 378 ASN B C     1 
ATOM   5599 O O     . ASN B 1 332 ? 45.159  2.736   -0.035  1.00 37.64 ? 378 ASN B O     1 
ATOM   5600 C CB    . ASN B 1 332 ? 47.874  0.972   0.224   1.00 39.49 ? 378 ASN B CB    1 
ATOM   5601 C CG    . ASN B 1 332 ? 48.956  0.019   -0.321  1.00 43.72 ? 378 ASN B CG    1 
ATOM   5602 O OD1   . ASN B 1 332 ? 48.722  -0.722  -1.272  1.00 48.66 ? 378 ASN B OD1   1 
ATOM   5603 N ND2   . ASN B 1 332 ? 50.140  0.008   0.331   1.00 46.61 ? 378 ASN B ND2   1 
ATOM   5604 N N     . VAL B 1 333 ? 46.948  4.083   0.322   1.00 38.66 ? 379 VAL B N     1 
ATOM   5605 C CA    . VAL B 1 333 ? 46.161  5.076   1.003   1.00 39.26 ? 379 VAL B CA    1 
ATOM   5606 C C     . VAL B 1 333 ? 45.181  5.753   0.075   1.00 39.22 ? 379 VAL B C     1 
ATOM   5607 O O     . VAL B 1 333 ? 44.004  5.884   0.431   1.00 39.77 ? 379 VAL B O     1 
ATOM   5608 C CB    . VAL B 1 333 ? 47.011  6.132   1.716   1.00 40.15 ? 379 VAL B CB    1 
ATOM   5609 C CG1   . VAL B 1 333 ? 46.210  7.448   1.853   1.00 41.08 ? 379 VAL B CG1   1 
ATOM   5610 C CG2   . VAL B 1 333 ? 47.479  5.602   3.096   1.00 37.89 ? 379 VAL B CG2   1 
ATOM   5611 N N     . ALA B 1 334 ? 45.657  6.172   -1.109  1.00 38.97 ? 380 ALA B N     1 
ATOM   5612 C CA    . ALA B 1 334 ? 44.834  6.892   -2.060  1.00 38.40 ? 380 ALA B CA    1 
ATOM   5613 C C     . ALA B 1 334 ? 43.716  5.990   -2.610  1.00 38.76 ? 380 ALA B C     1 
ATOM   5614 O O     . ALA B 1 334 ? 42.595  6.460   -2.845  1.00 39.04 ? 380 ALA B O     1 
ATOM   5615 C CB    . ALA B 1 334 ? 45.679  7.434   -3.175  1.00 38.70 ? 380 ALA B CB    1 
ATOM   5616 N N     . ILE B 1 335 ? 44.015  4.699   -2.787  1.00 38.33 ? 381 ILE B N     1 
ATOM   5617 C CA    . ILE B 1 335 ? 43.045  3.753   -3.358  1.00 37.07 ? 381 ILE B CA    1 
ATOM   5618 C C     . ILE B 1 335 ? 41.975  3.421   -2.327  1.00 37.21 ? 381 ILE B C     1 
ATOM   5619 O O     . ILE B 1 335 ? 40.782  3.307   -2.664  1.00 35.40 ? 381 ILE B O     1 
ATOM   5620 C CB    . ILE B 1 335 ? 43.701  2.483   -4.033  1.00 36.14 ? 381 ILE B CB    1 
ATOM   5621 C CG1   . ILE B 1 335 ? 42.739  1.848   -5.063  1.00 35.52 ? 381 ILE B CG1   1 
ATOM   5622 C CG2   . ILE B 1 335 ? 44.114  1.437   -3.056  1.00 34.87 ? 381 ILE B CG2   1 
ATOM   5623 C CD1   . ILE B 1 335 ? 42.500  2.721   -6.296  1.00 33.11 ? 381 ILE B CD1   1 
ATOM   5624 N N     . ASP B 1 336 ? 42.423  3.294   -1.078  1.00 37.51 ? 382 ASP B N     1 
ATOM   5625 C CA    . ASP B 1 336 ? 41.520  3.161   0.053   1.00 38.81 ? 382 ASP B CA    1 
ATOM   5626 C C     . ASP B 1 336 ? 40.530  4.293   0.127   1.00 38.53 ? 382 ASP B C     1 
ATOM   5627 O O     . ASP B 1 336 ? 39.381  4.046   0.360   1.00 38.45 ? 382 ASP B O     1 
ATOM   5628 C CB    . ASP B 1 336 ? 42.265  2.990   1.377   1.00 39.81 ? 382 ASP B CB    1 
ATOM   5629 C CG    . ASP B 1 336 ? 42.882  1.609   1.517   1.00 41.07 ? 382 ASP B CG    1 
ATOM   5630 O OD1   . ASP B 1 336 ? 42.733  0.801   0.564   1.00 46.48 ? 382 ASP B OD1   1 
ATOM   5631 O OD2   . ASP B 1 336 ? 43.537  1.327   2.549   1.00 41.44 ? 382 ASP B OD2   1 
ATOM   5632 N N     . LEU B 1 337 ? 40.975  5.515   -0.147  1.00 39.29 ? 383 LEU B N     1 
ATOM   5633 C CA    . LEU B 1 337 ? 40.116  6.693   -0.038  1.00 39.39 ? 383 LEU B CA    1 
ATOM   5634 C C     . LEU B 1 337 ? 39.034  6.601   -1.085  1.00 39.28 ? 383 LEU B C     1 
ATOM   5635 O O     . LEU B 1 337 ? 37.856  6.440   -0.725  1.00 39.97 ? 383 LEU B O     1 
ATOM   5636 C CB    . LEU B 1 337 ? 40.908  8.022   -0.189  1.00 39.21 ? 383 LEU B CB    1 
ATOM   5637 C CG    . LEU B 1 337 ? 41.487  8.766   1.019   1.00 38.81 ? 383 LEU B CG    1 
ATOM   5638 C CD1   . LEU B 1 337 ? 42.615  9.678   0.620   1.00 38.71 ? 383 LEU B CD1   1 
ATOM   5639 C CD2   . LEU B 1 337 ? 40.424  9.579   1.677   1.00 41.87 ? 383 LEU B CD2   1 
ATOM   5640 N N     . SER B 1 338 ? 39.449  6.718   -2.354  1.00 38.38 ? 384 SER B N     1 
ATOM   5641 C CA    . SER B 1 338 ? 38.637  6.434   -3.538  1.00 37.62 ? 384 SER B CA    1 
ATOM   5642 C C     . SER B 1 338 ? 37.642  5.243   -3.348  1.00 37.80 ? 384 SER B C     1 
ATOM   5643 O O     . SER B 1 338 ? 36.474  5.403   -3.650  1.00 38.44 ? 384 SER B O     1 
ATOM   5644 C CB    . SER B 1 338 ? 39.562  6.200   -4.748  1.00 38.26 ? 384 SER B CB    1 
ATOM   5645 O OG    . SER B 1 338 ? 38.901  6.120   -6.002  1.00 34.50 ? 384 SER B OG    1 
ATOM   5646 N N     . ASN B 1 339 ? 38.091  4.095   -2.830  1.00 36.99 ? 385 ASN B N     1 
ATOM   5647 C CA    . ASN B 1 339 ? 37.249  2.897   -2.684  1.00 37.29 ? 385 ASN B CA    1 
ATOM   5648 C C     . ASN B 1 339 ? 36.119  3.010   -1.631  1.00 38.78 ? 385 ASN B C     1 
ATOM   5649 O O     . ASN B 1 339 ? 34.951  2.605   -1.891  1.00 37.71 ? 385 ASN B O     1 
ATOM   5650 C CB    . ASN B 1 339 ? 38.100  1.670   -2.353  1.00 36.78 ? 385 ASN B CB    1 
ATOM   5651 C CG    . ASN B 1 339 ? 38.810  1.082   -3.593  1.00 36.55 ? 385 ASN B CG    1 
ATOM   5652 O OD1   . ASN B 1 339 ? 38.413  1.339   -4.734  1.00 35.74 ? 385 ASN B OD1   1 
ATOM   5653 N ND2   . ASN B 1 339 ? 39.860  0.298   -3.362  1.00 31.46 ? 385 ASN B ND2   1 
ATOM   5654 N N     . LYS B 1 340 ? 36.498  3.523   -0.446  1.00 38.22 ? 386 LYS B N     1 
ATOM   5655 C CA    . LYS B 1 340 ? 35.564  3.945   0.588   1.00 38.27 ? 386 LYS B CA    1 
ATOM   5656 C C     . LYS B 1 340 ? 34.660  5.087   0.132   1.00 37.63 ? 386 LYS B C     1 
ATOM   5657 O O     . LYS B 1 340 ? 33.460  4.993   0.229   1.00 39.31 ? 386 LYS B O     1 
ATOM   5658 C CB    . LYS B 1 340 ? 36.314  4.317   1.879   1.00 39.10 ? 386 LYS B CB    1 
ATOM   5659 C CG    . LYS B 1 340 ? 36.973  3.136   2.592   1.00 37.53 ? 386 LYS B CG    1 
ATOM   5660 C CD    . LYS B 1 340 ? 38.022  3.666   3.555   1.00 41.36 ? 386 LYS B CD    1 
ATOM   5661 C CE    . LYS B 1 340 ? 38.266  2.711   4.721   1.00 41.98 ? 386 LYS B CE    1 
ATOM   5662 N NZ    . LYS B 1 340 ? 39.382  1.742   4.568   1.00 44.40 ? 386 LYS B NZ    1 
ATOM   5663 N N     . ALA B 1 341 ? 35.207  6.164   -0.385  1.00 37.10 ? 387 ALA B N     1 
ATOM   5664 C CA    . ALA B 1 341 ? 34.352  7.150   -0.967  1.00 36.50 ? 387 ALA B CA    1 
ATOM   5665 C C     . ALA B 1 341 ? 33.306  6.443   -1.862  1.00 37.57 ? 387 ALA B C     1 
ATOM   5666 O O     . ALA B 1 341 ? 32.090  6.707   -1.714  1.00 38.13 ? 387 ALA B O     1 
ATOM   5667 C CB    . ALA B 1 341 ? 35.157  8.134   -1.757  1.00 36.68 ? 387 ALA B CB    1 
ATOM   5668 N N     . SER B 1 342 ? 33.778  5.524   -2.740  1.00 36.43 ? 388 SER B N     1 
ATOM   5669 C CA    . SER B 1 342 ? 32.955  4.866   -3.764  1.00 34.97 ? 388 SER B CA    1 
ATOM   5670 C C     . SER B 1 342 ? 31.882  3.949   -3.150  1.00 34.61 ? 388 SER B C     1 
ATOM   5671 O O     . SER B 1 342 ? 30.730  3.955   -3.568  1.00 33.49 ? 388 SER B O     1 
ATOM   5672 C CB    . SER B 1 342 ? 33.836  4.083   -4.776  1.00 35.25 ? 388 SER B CB    1 
ATOM   5673 O OG    . SER B 1 342 ? 34.663  4.923   -5.599  1.00 32.81 ? 388 SER B OG    1 
ATOM   5674 N N     . LEU B 1 343 ? 32.274  3.159   -2.160  1.00 34.29 ? 389 LEU B N     1 
ATOM   5675 C CA    . LEU B 1 343 ? 31.346  2.297   -1.487  1.00 34.56 ? 389 LEU B CA    1 
ATOM   5676 C C     . LEU B 1 343 ? 30.219  3.097   -0.802  1.00 35.32 ? 389 LEU B C     1 
ATOM   5677 O O     . LEU B 1 343 ? 29.048  2.672   -0.806  1.00 36.31 ? 389 LEU B O     1 
ATOM   5678 C CB    . LEU B 1 343 ? 32.081  1.366   -0.512  1.00 34.67 ? 389 LEU B CB    1 
ATOM   5679 C CG    . LEU B 1 343 ? 33.003  0.315   -1.145  1.00 35.18 ? 389 LEU B CG    1 
ATOM   5680 C CD1   . LEU B 1 343 ? 34.016  -0.215  -0.141  1.00 32.94 ? 389 LEU B CD1   1 
ATOM   5681 C CD2   . LEU B 1 343 ? 32.269  -0.842  -1.831  1.00 35.48 ? 389 LEU B CD2   1 
ATOM   5682 N N     . ALA B 1 344 ? 30.567  4.248   -0.230  1.00 34.73 ? 390 ALA B N     1 
ATOM   5683 C CA    . ALA B 1 344 ? 29.564  5.086   0.384   1.00 35.20 ? 390 ALA B CA    1 
ATOM   5684 C C     . ALA B 1 344 ? 28.629  5.641   -0.677  1.00 34.40 ? 390 ALA B C     1 
ATOM   5685 O O     . ALA B 1 344 ? 27.425  5.595   -0.519  1.00 34.19 ? 390 ALA B O     1 
ATOM   5686 C CB    . ALA B 1 344 ? 30.208  6.214   1.198   1.00 35.06 ? 390 ALA B CB    1 
ATOM   5687 N N     . PHE B 1 345 ? 29.170  6.174   -1.762  1.00 34.14 ? 391 PHE B N     1 
ATOM   5688 C CA    . PHE B 1 345 ? 28.289  6.729   -2.781  1.00 33.85 ? 391 PHE B CA    1 
ATOM   5689 C C     . PHE B 1 345 ? 27.356  5.678   -3.464  1.00 35.62 ? 391 PHE B C     1 
ATOM   5690 O O     . PHE B 1 345 ? 26.137  5.956   -3.700  1.00 37.24 ? 391 PHE B O     1 
ATOM   5691 C CB    . PHE B 1 345 ? 29.080  7.507   -3.773  1.00 33.10 ? 391 PHE B CB    1 
ATOM   5692 C CG    . PHE B 1 345 ? 28.260  8.176   -4.797  1.00 29.69 ? 391 PHE B CG    1 
ATOM   5693 C CD1   . PHE B 1 345 ? 27.830  9.461   -4.608  1.00 26.04 ? 391 PHE B CD1   1 
ATOM   5694 C CD2   . PHE B 1 345 ? 27.932  7.516   -5.978  1.00 28.66 ? 391 PHE B CD2   1 
ATOM   5695 C CE1   . PHE B 1 345 ? 27.093  10.074  -5.596  1.00 27.37 ? 391 PHE B CE1   1 
ATOM   5696 C CE2   . PHE B 1 345 ? 27.166  8.120   -6.934  1.00 24.56 ? 391 PHE B CE2   1 
ATOM   5697 C CZ    . PHE B 1 345 ? 26.775  9.379   -6.762  1.00 28.93 ? 391 PHE B CZ    1 
ATOM   5698 N N     . LEU B 1 346 ? 27.905  4.488   -3.738  1.00 34.79 ? 392 LEU B N     1 
ATOM   5699 C CA    . LEU B 1 346 ? 27.138  3.338   -4.169  1.00 34.07 ? 392 LEU B CA    1 
ATOM   5700 C C     . LEU B 1 346 ? 26.017  2.917   -3.196  1.00 34.53 ? 392 LEU B C     1 
ATOM   5701 O O     . LEU B 1 346 ? 24.889  2.695   -3.623  1.00 31.63 ? 392 LEU B O     1 
ATOM   5702 C CB    . LEU B 1 346 ? 28.070  2.130   -4.435  1.00 33.78 ? 392 LEU B CB    1 
ATOM   5703 C CG    . LEU B 1 346 ? 29.057  2.196   -5.607  1.00 31.77 ? 392 LEU B CG    1 
ATOM   5704 C CD1   . LEU B 1 346 ? 29.941  0.934   -5.706  1.00 30.57 ? 392 LEU B CD1   1 
ATOM   5705 C CD2   . LEU B 1 346 ? 28.396  2.527   -6.927  1.00 26.64 ? 392 LEU B CD2   1 
ATOM   5706 N N     . GLN B 1 347 ? 26.333  2.763   -1.905  1.00 36.22 ? 393 GLN B N     1 
ATOM   5707 C CA    . GLN B 1 347 ? 25.298  2.419   -0.921  1.00 37.78 ? 393 GLN B CA    1 
ATOM   5708 C C     . GLN B 1 347 ? 24.093  3.385   -0.896  1.00 39.87 ? 393 GLN B C     1 
ATOM   5709 O O     . GLN B 1 347 ? 22.946  2.959   -0.749  1.00 40.38 ? 393 GLN B O     1 
ATOM   5710 C CB    . GLN B 1 347 ? 25.894  2.283   0.466   1.00 38.80 ? 393 GLN B CB    1 
ATOM   5711 C CG    . GLN B 1 347 ? 24.849  2.337   1.633   1.00 39.37 ? 393 GLN B CG    1 
ATOM   5712 C CD    . GLN B 1 347 ? 25.254  1.509   2.835   1.00 39.38 ? 393 GLN B CD    1 
ATOM   5713 O OE1   . GLN B 1 347 ? 25.964  0.524   2.701   1.00 39.78 ? 393 GLN B OE1   1 
ATOM   5714 N NE2   . GLN B 1 347 ? 24.782  1.903   4.025   1.00 40.04 ? 393 GLN B NE2   1 
ATOM   5715 N N     . LYS B 1 348 ? 24.363  4.672   -1.087  1.00 41.26 ? 394 LYS B N     1 
ATOM   5716 C CA    . LYS B 1 348 ? 23.356  5.707   -1.021  1.00 42.69 ? 394 LYS B CA    1 
ATOM   5717 C C     . LYS B 1 348 ? 22.428  5.574   -2.194  1.00 43.43 ? 394 LYS B C     1 
ATOM   5718 O O     . LYS B 1 348 ? 21.209  5.523   -2.048  1.00 45.20 ? 394 LYS B O     1 
ATOM   5719 C CB    . LYS B 1 348 ? 24.039  7.085   -1.041  1.00 42.62 ? 394 LYS B CB    1 
ATOM   5720 C CG    . LYS B 1 348 ? 23.554  8.068   0.018   1.00 44.36 ? 394 LYS B CG    1 
ATOM   5721 C CD    . LYS B 1 348 ? 24.666  9.103   0.339   1.00 47.46 ? 394 LYS B CD    1 
ATOM   5722 C CE    . LYS B 1 348 ? 24.521  9.760   1.729   1.00 49.17 ? 394 LYS B CE    1 
ATOM   5723 N NZ    . LYS B 1 348 ? 24.164  8.771   2.828   1.00 50.82 ? 394 LYS B NZ    1 
ATOM   5724 N N     . HIS B 1 349 ? 23.005  5.501   -3.380  1.00 43.30 ? 395 HIS B N     1 
ATOM   5725 C CA    . HIS B 1 349 ? 22.232  5.663   -4.559  1.00 42.29 ? 395 HIS B CA    1 
ATOM   5726 C C     . HIS B 1 349 ? 21.842  4.336   -5.185  1.00 41.29 ? 395 HIS B C     1 
ATOM   5727 O O     . HIS B 1 349 ? 21.101  4.315   -6.159  1.00 40.21 ? 395 HIS B O     1 
ATOM   5728 C CB    . HIS B 1 349 ? 22.955  6.607   -5.499  1.00 42.95 ? 395 HIS B CB    1 
ATOM   5729 C CG    . HIS B 1 349 ? 23.197  7.953   -4.889  1.00 45.75 ? 395 HIS B CG    1 
ATOM   5730 N ND1   . HIS B 1 349 ? 22.208  8.903   -4.771  1.00 47.67 ? 395 HIS B ND1   1 
ATOM   5731 C CD2   . HIS B 1 349 ? 24.302  8.491   -4.319  1.00 49.14 ? 395 HIS B CD2   1 
ATOM   5732 C CE1   . HIS B 1 349 ? 22.699  9.979   -4.182  1.00 47.33 ? 395 HIS B CE1   1 
ATOM   5733 N NE2   . HIS B 1 349 ? 23.968  9.754   -3.892  1.00 47.52 ? 395 HIS B NE2   1 
ATOM   5734 N N     . LEU B 1 350 ? 22.323  3.248   -4.596  1.00 40.20 ? 396 LEU B N     1 
ATOM   5735 C CA    . LEU B 1 350 ? 21.848  1.910   -4.958  1.00 40.57 ? 396 LEU B CA    1 
ATOM   5736 C C     . LEU B 1 350 ? 20.923  1.333   -3.900  1.00 41.24 ? 396 LEU B C     1 
ATOM   5737 O O     . LEU B 1 350 ? 20.225  0.340   -4.148  1.00 41.70 ? 396 LEU B O     1 
ATOM   5738 C CB    . LEU B 1 350 ? 23.017  0.929   -5.254  1.00 39.15 ? 396 LEU B CB    1 
ATOM   5739 C CG    . LEU B 1 350 ? 23.851  1.198   -6.538  1.00 36.16 ? 396 LEU B CG    1 
ATOM   5740 C CD1   . LEU B 1 350 ? 24.875  0.082   -6.791  1.00 33.93 ? 396 LEU B CD1   1 
ATOM   5741 C CD2   . LEU B 1 350 ? 22.998  1.440   -7.785  1.00 28.41 ? 396 LEU B CD2   1 
ATOM   5742 N N     . GLY B 1 351 ? 20.931  1.948   -2.714  1.00 41.73 ? 397 GLY B N     1 
ATOM   5743 C CA    . GLY B 1 351 ? 20.116  1.478   -1.607  1.00 42.04 ? 397 GLY B CA    1 
ATOM   5744 C C     . GLY B 1 351 ? 20.653  0.171   -1.098  1.00 42.34 ? 397 GLY B C     1 
ATOM   5745 O O     . GLY B 1 351 ? 19.921  -0.794  -0.970  1.00 42.71 ? 397 GLY B O     1 
ATOM   5746 N N     . LEU B 1 352 ? 21.945  0.123   -0.826  1.00 42.92 ? 398 LEU B N     1 
ATOM   5747 C CA    . LEU B 1 352 ? 22.515  -1.096  -0.332  1.00 43.04 ? 398 LEU B CA    1 
ATOM   5748 C C     . LEU B 1 352 ? 22.347  -1.132  1.183   1.00 44.37 ? 398 LEU B C     1 
ATOM   5749 O O     . LEU B 1 352 ? 22.252  -0.086  1.855   1.00 43.65 ? 398 LEU B O     1 
ATOM   5750 C CB    . LEU B 1 352 ? 23.992  -1.224  -0.690  1.00 42.71 ? 398 LEU B CB    1 
ATOM   5751 C CG    . LEU B 1 352 ? 24.465  -1.200  -2.135  1.00 41.49 ? 398 LEU B CG    1 
ATOM   5752 C CD1   . LEU B 1 352 ? 26.002  -1.120  -2.119  1.00 39.05 ? 398 LEU B CD1   1 
ATOM   5753 C CD2   . LEU B 1 352 ? 23.951  -2.413  -2.916  1.00 35.98 ? 398 LEU B CD2   1 
ATOM   5754 N N     . HIS B 1 353 ? 22.351  -2.359  1.698   1.00 45.30 ? 399 HIS B N     1 
ATOM   5755 C CA    . HIS B 1 353 ? 22.088  -2.644  3.088   1.00 46.27 ? 399 HIS B CA    1 
ATOM   5756 C C     . HIS B 1 353 ? 23.373  -3.094  3.736   1.00 46.70 ? 399 HIS B C     1 
ATOM   5757 O O     . HIS B 1 353 ? 23.497  -4.259  4.152   1.00 46.73 ? 399 HIS B O     1 
ATOM   5758 C CB    . HIS B 1 353 ? 20.991  -3.710  3.172   1.00 46.17 ? 399 HIS B CB    1 
ATOM   5759 C CG    . HIS B 1 353 ? 19.751  -3.308  2.445   1.00 47.86 ? 399 HIS B CG    1 
ATOM   5760 N ND1   . HIS B 1 353 ? 18.787  -2.506  3.014   1.00 49.09 ? 399 HIS B ND1   1 
ATOM   5761 C CD2   . HIS B 1 353 ? 19.356  -3.519  1.166   1.00 50.18 ? 399 HIS B CD2   1 
ATOM   5762 C CE1   . HIS B 1 353 ? 17.838  -2.262  2.124   1.00 50.96 ? 399 HIS B CE1   1 
ATOM   5763 N NE2   . HIS B 1 353 ? 18.153  -2.873  0.998   1.00 50.83 ? 399 HIS B NE2   1 
ATOM   5764 N N     . LYS B 1 354 ? 24.329  -2.165  3.780   1.00 47.16 ? 400 LYS B N     1 
ATOM   5765 C CA    . LYS B 1 354 ? 25.654  -2.401  4.383   1.00 48.77 ? 400 LYS B CA    1 
ATOM   5766 C C     . LYS B 1 354 ? 26.124  -1.218  5.274   1.00 49.07 ? 400 LYS B C     1 
ATOM   5767 O O     . LYS B 1 354 ? 25.416  -0.216  5.462   1.00 47.84 ? 400 LYS B O     1 
ATOM   5768 C CB    . LYS B 1 354 ? 26.755  -2.649  3.295   1.00 49.07 ? 400 LYS B CB    1 
ATOM   5769 C CG    . LYS B 1 354 ? 26.479  -3.680  2.198   1.00 48.06 ? 400 LYS B CG    1 
ATOM   5770 C CD    . LYS B 1 354 ? 26.975  -5.058  2.539   1.00 51.83 ? 400 LYS B CD    1 
ATOM   5771 C CE    . LYS B 1 354 ? 26.768  -6.015  1.338   1.00 52.45 ? 400 LYS B CE    1 
ATOM   5772 N NZ    . LYS B 1 354 ? 26.417  -7.409  1.803   1.00 53.53 ? 400 LYS B NZ    1 
ATOM   5773 N N     . ASP B 1 355 ? 27.371  -1.360  5.731   1.00 49.82 ? 401 ASP B N     1 
ATOM   5774 C CA    . ASP B 1 355 ? 28.074  -0.483  6.668   1.00 50.53 ? 401 ASP B CA    1 
ATOM   5775 C C     . ASP B 1 355 ? 28.695  0.737   6.000   1.00 49.95 ? 401 ASP B C     1 
ATOM   5776 O O     . ASP B 1 355 ? 29.131  1.668   6.678   1.00 50.77 ? 401 ASP B O     1 
ATOM   5777 C CB    . ASP B 1 355 ? 29.208  -1.289  7.316   1.00 51.71 ? 401 ASP B CB    1 
ATOM   5778 C CG    . ASP B 1 355 ? 30.027  -2.149  6.264   1.00 54.53 ? 401 ASP B CG    1 
ATOM   5779 O OD1   . ASP B 1 355 ? 31.193  -1.762  5.940   1.00 53.35 ? 401 ASP B OD1   1 
ATOM   5780 O OD2   . ASP B 1 355 ? 29.484  -3.200  5.771   1.00 55.16 ? 401 ASP B OD2   1 
ATOM   5781 N N     . PHE B 1 356 ? 28.720  0.746   4.670   1.00 48.81 ? 402 PHE B N     1 
ATOM   5782 C CA    . PHE B 1 356 ? 29.588  1.654   3.911   1.00 47.17 ? 402 PHE B CA    1 
ATOM   5783 C C     . PHE B 1 356 ? 29.306  3.124   4.160   1.00 47.61 ? 402 PHE B C     1 
ATOM   5784 O O     . PHE B 1 356 ? 30.133  3.980   3.818   1.00 47.72 ? 402 PHE B O     1 
ATOM   5785 C CB    . PHE B 1 356 ? 29.502  1.400   2.389   1.00 46.39 ? 402 PHE B CB    1 
ATOM   5786 C CG    . PHE B 1 356 ? 29.568  -0.050  1.974   1.00 42.85 ? 402 PHE B CG    1 
ATOM   5787 C CD1   . PHE B 1 356 ? 30.310  -0.974  2.687   1.00 40.94 ? 402 PHE B CD1   1 
ATOM   5788 C CD2   . PHE B 1 356 ? 28.951  -0.447  0.798   1.00 40.43 ? 402 PHE B CD2   1 
ATOM   5789 C CE1   . PHE B 1 356 ? 30.382  -2.290  2.290   1.00 39.80 ? 402 PHE B CE1   1 
ATOM   5790 C CE2   . PHE B 1 356 ? 29.012  -1.734  0.375   1.00 39.24 ? 402 PHE B CE2   1 
ATOM   5791 C CZ    . PHE B 1 356 ? 29.729  -2.676  1.122   1.00 41.31 ? 402 PHE B CZ    1 
ATOM   5792 N N     . ASP B 1 357 ? 28.133  3.439   4.708   1.00 48.12 ? 403 ASP B N     1 
ATOM   5793 C CA    . ASP B 1 357 ? 27.809  4.846   5.040   1.00 48.34 ? 403 ASP B CA    1 
ATOM   5794 C C     . ASP B 1 357 ? 28.713  5.382   6.165   1.00 47.97 ? 403 ASP B C     1 
ATOM   5795 O O     . ASP B 1 357 ? 28.888  6.597   6.296   1.00 47.27 ? 403 ASP B O     1 
ATOM   5796 C CB    . ASP B 1 357 ? 26.311  5.080   5.324   1.00 48.92 ? 403 ASP B CB    1 
ATOM   5797 C CG    . ASP B 1 357 ? 25.754  4.155   6.427   1.00 50.30 ? 403 ASP B CG    1 
ATOM   5798 O OD1   . ASP B 1 357 ? 26.242  3.004   6.574   1.00 48.17 ? 403 ASP B OD1   1 
ATOM   5799 O OD2   . ASP B 1 357 ? 24.800  4.589   7.124   1.00 53.52 ? 403 ASP B OD2   1 
ATOM   5800 N N     . GLN B 1 358 ? 29.343  4.476   6.909   1.00 47.86 ? 404 GLN B N     1 
ATOM   5801 C CA    . GLN B 1 358 ? 30.477  4.864   7.756   1.00 49.57 ? 404 GLN B CA    1 
ATOM   5802 C C     . GLN B 1 358 ? 31.472  5.846   7.083   1.00 49.25 ? 404 GLN B C     1 
ATOM   5803 O O     . GLN B 1 358 ? 32.111  6.649   7.769   1.00 49.51 ? 404 GLN B O     1 
ATOM   5804 C CB    . GLN B 1 358 ? 31.204  3.641   8.338   1.00 49.27 ? 404 GLN B CB    1 
ATOM   5805 C CG    . GLN B 1 358 ? 31.709  2.583   7.368   1.00 51.05 ? 404 GLN B CG    1 
ATOM   5806 C CD    . GLN B 1 358 ? 32.633  1.570   8.039   1.00 52.75 ? 404 GLN B CD    1 
ATOM   5807 O OE1   . GLN B 1 358 ? 33.641  1.949   8.642   1.00 57.82 ? 404 GLN B OE1   1 
ATOM   5808 N NE2   . GLN B 1 358 ? 32.300  0.270   7.933   1.00 55.98 ? 404 GLN B NE2   1 
ATOM   5809 N N     . TRP B 1 359 ? 31.534  5.806   5.743   1.00 48.72 ? 405 TRP B N     1 
ATOM   5810 C CA    . TRP B 1 359 ? 32.412  6.644   4.914   1.00 47.68 ? 405 TRP B CA    1 
ATOM   5811 C C     . TRP B 1 359 ? 31.742  7.815   4.171   1.00 48.68 ? 405 TRP B C     1 
ATOM   5812 O O     . TRP B 1 359 ? 32.312  8.339   3.202   1.00 48.98 ? 405 TRP B O     1 
ATOM   5813 C CB    . TRP B 1 359 ? 33.168  5.747   3.909   1.00 47.14 ? 405 TRP B CB    1 
ATOM   5814 C CG    . TRP B 1 359 ? 33.944  4.657   4.574   1.00 44.50 ? 405 TRP B CG    1 
ATOM   5815 C CD1   . TRP B 1 359 ? 34.910  4.824   5.511   1.00 44.28 ? 405 TRP B CD1   1 
ATOM   5816 C CD2   . TRP B 1 359 ? 33.834  3.237   4.355   1.00 43.92 ? 405 TRP B CD2   1 
ATOM   5817 N NE1   . TRP B 1 359 ? 35.394  3.606   5.917   1.00 44.57 ? 405 TRP B NE1   1 
ATOM   5818 C CE2   . TRP B 1 359 ? 34.764  2.612   5.211   1.00 44.31 ? 405 TRP B CE2   1 
ATOM   5819 C CE3   . TRP B 1 359 ? 33.033  2.430   3.536   1.00 44.99 ? 405 TRP B CE3   1 
ATOM   5820 C CZ2   . TRP B 1 359 ? 34.926  1.213   5.262   1.00 44.14 ? 405 TRP B CZ2   1 
ATOM   5821 C CZ3   . TRP B 1 359 ? 33.198  1.030   3.588   1.00 43.23 ? 405 TRP B CZ3   1 
ATOM   5822 C CH2   . TRP B 1 359 ? 34.133  0.448   4.434   1.00 44.08 ? 405 TRP B CH2   1 
ATOM   5823 N N     . ASP B 1 360 ? 30.562  8.260   4.629   1.00 49.93 ? 406 ASP B N     1 
ATOM   5824 C CA    . ASP B 1 360 ? 29.844  9.361   3.957   1.00 50.59 ? 406 ASP B CA    1 
ATOM   5825 C C     . ASP B 1 360 ? 30.569  10.671  4.067   1.00 50.49 ? 406 ASP B C     1 
ATOM   5826 O O     . ASP B 1 360 ? 30.405  11.525  3.182   1.00 51.07 ? 406 ASP B O     1 
ATOM   5827 C CB    . ASP B 1 360 ? 28.402  9.551   4.458   1.00 51.60 ? 406 ASP B CB    1 
ATOM   5828 C CG    . ASP B 1 360 ? 27.581  8.266   4.406   1.00 54.53 ? 406 ASP B CG    1 
ATOM   5829 O OD1   . ASP B 1 360 ? 27.571  7.564   3.343   1.00 54.44 ? 406 ASP B OD1   1 
ATOM   5830 O OD2   . ASP B 1 360 ? 26.955  7.957   5.458   1.00 55.88 ? 406 ASP B OD2   1 
ATOM   5831 N N     . CYS B 1 361 ? 31.372  10.835  5.124   1.00 50.54 ? 407 CYS B N     1 
ATOM   5832 C CA    . CYS B 1 361 ? 32.277  12.013  5.263   1.00 51.05 ? 407 CYS B CA    1 
ATOM   5833 C C     . CYS B 1 361 ? 33.172  12.166  4.033   1.00 50.45 ? 407 CYS B C     1 
ATOM   5834 O O     . CYS B 1 361 ? 33.332  13.279  3.466   1.00 49.88 ? 407 CYS B O     1 
ATOM   5835 C CB    . CYS B 1 361 ? 33.148  11.923  6.532   1.00 51.55 ? 407 CYS B CB    1 
ATOM   5836 S SG    . CYS B 1 361 ? 34.101  10.370  6.816   1.00 55.20 ? 407 CYS B SG    1 
ATOM   5837 N N     . LEU B 1 362 ? 33.713  11.019  3.611   1.00 50.26 ? 408 LEU B N     1 
ATOM   5838 C CA    . LEU B 1 362 ? 34.498  10.914  2.386   1.00 49.99 ? 408 LEU B CA    1 
ATOM   5839 C C     . LEU B 1 362 ? 33.804  11.493  1.157   1.00 50.11 ? 408 LEU B C     1 
ATOM   5840 O O     . LEU B 1 362 ? 34.422  12.268  0.444   1.00 49.67 ? 408 LEU B O     1 
ATOM   5841 C CB    . LEU B 1 362 ? 35.002  9.492   2.175   1.00 49.82 ? 408 LEU B CB    1 
ATOM   5842 C CG    . LEU B 1 362 ? 35.924  9.193   3.343   1.00 49.31 ? 408 LEU B CG    1 
ATOM   5843 C CD1   . LEU B 1 362 ? 36.261  7.721   3.437   1.00 48.83 ? 408 LEU B CD1   1 
ATOM   5844 C CD2   . LEU B 1 362 ? 37.174  10.080  3.273   1.00 46.21 ? 408 LEU B CD2   1 
ATOM   5845 N N     . ILE B 1 363 ? 32.522  11.176  0.935   1.00 50.76 ? 409 ILE B N     1 
ATOM   5846 C CA    . ILE B 1 363 ? 31.799  11.736  -0.221  1.00 51.27 ? 409 ILE B CA    1 
ATOM   5847 C C     . ILE B 1 363 ? 31.900  13.267  -0.235  1.00 52.14 ? 409 ILE B C     1 
ATOM   5848 O O     . ILE B 1 363 ? 31.935  13.876  -1.302  1.00 51.83 ? 409 ILE B O     1 
ATOM   5849 C CB    . ILE B 1 363 ? 30.310  11.261  -0.285  1.00 51.79 ? 409 ILE B CB    1 
ATOM   5850 C CG1   . ILE B 1 363 ? 30.204  9.747   -0.483  1.00 51.31 ? 409 ILE B CG1   1 
ATOM   5851 C CG2   . ILE B 1 363 ? 29.527  11.979  -1.363  1.00 50.53 ? 409 ILE B CG2   1 
ATOM   5852 C CD1   . ILE B 1 363 ? 29.122  9.117   0.422   1.00 51.83 ? 409 ILE B CD1   1 
ATOM   5853 N N     . GLU B 1 364 ? 31.997  13.875  0.953   1.00 53.15 ? 410 GLU B N     1 
ATOM   5854 C CA    . GLU B 1 364 ? 32.053  15.351  1.088   1.00 54.73 ? 410 GLU B CA    1 
ATOM   5855 C C     . GLU B 1 364 ? 33.466  16.030  1.013   1.00 55.41 ? 410 GLU B C     1 
ATOM   5856 O O     . GLU B 1 364 ? 33.584  17.244  0.750   1.00 55.16 ? 410 GLU B O     1 
ATOM   5857 C CB    . GLU B 1 364 ? 31.339  15.773  2.392   1.00 55.09 ? 410 GLU B CB    1 
ATOM   5858 C CG    . GLU B 1 364 ? 29.956  15.119  2.658   1.00 54.01 ? 410 GLU B CG    1 
ATOM   5859 C CD    . GLU B 1 364 ? 28.956  15.351  1.537   1.00 52.80 ? 410 GLU B CD    1 
ATOM   5860 O OE1   . GLU B 1 364 ? 29.076  16.376  0.831   1.00 53.56 ? 410 GLU B OE1   1 
ATOM   5861 O OE2   . GLU B 1 364 ? 28.059  14.498  1.357   1.00 53.24 ? 410 GLU B OE2   1 
ATOM   5862 N N     . GLY B 1 365 ? 34.516  15.250  1.271   1.00 56.12 ? 411 GLY B N     1 
ATOM   5863 C CA    . GLY B 1 365 ? 35.884  15.768  1.356   1.00 56.85 ? 411 GLY B CA    1 
ATOM   5864 C C     . GLY B 1 365 ? 36.447  15.858  2.775   1.00 57.04 ? 411 GLY B C     1 
ATOM   5865 O O     . GLY B 1 365 ? 37.374  16.622  3.002   1.00 57.29 ? 411 GLY B O     1 
ATOM   5866 N N     . ASP B 1 366 ? 35.921  15.054  3.709   1.00 57.32 ? 412 ASP B N     1 
ATOM   5867 C CA    . ASP B 1 366 ? 36.245  15.154  5.153   1.00 57.01 ? 412 ASP B CA    1 
ATOM   5868 C C     . ASP B 1 366 ? 37.407  14.276  5.638   1.00 56.89 ? 412 ASP B C     1 
ATOM   5869 O O     . ASP B 1 366 ? 37.222  13.366  6.489   1.00 56.04 ? 412 ASP B O     1 
ATOM   5870 C CB    . ASP B 1 366 ? 34.995  14.855  5.996   1.00 57.68 ? 412 ASP B CB    1 
ATOM   5871 C CG    . ASP B 1 366 ? 35.119  15.334  7.448   1.00 60.86 ? 412 ASP B CG    1 
ATOM   5872 O OD1   . ASP B 1 366 ? 35.636  16.469  7.649   1.00 62.54 ? 412 ASP B OD1   1 
ATOM   5873 O OD2   . ASP B 1 366 ? 34.694  14.580  8.375   1.00 62.17 ? 412 ASP B OD2   1 
ATOM   5874 N N     . ASP B 1 367 ? 38.607  14.563  5.114   1.00 56.72 ? 413 ASP B N     1 
ATOM   5875 C CA    . ASP B 1 367 ? 39.848  13.829  5.450   1.00 56.57 ? 413 ASP B CA    1 
ATOM   5876 C C     . ASP B 1 367 ? 41.008  14.774  5.157   1.00 57.02 ? 413 ASP B C     1 
ATOM   5877 O O     . ASP B 1 367 ? 40.875  15.649  4.278   1.00 57.05 ? 413 ASP B O     1 
ATOM   5878 C CB    . ASP B 1 367 ? 39.948  12.571  4.575   1.00 56.27 ? 413 ASP B CB    1 
ATOM   5879 C CG    . ASP B 1 367 ? 40.984  11.564  5.067   1.00 56.18 ? 413 ASP B CG    1 
ATOM   5880 O OD1   . ASP B 1 367 ? 40.645  10.733  5.951   1.00 54.33 ? 413 ASP B OD1   1 
ATOM   5881 O OD2   . ASP B 1 367 ? 42.129  11.578  4.533   1.00 55.30 ? 413 ASP B OD2   1 
ATOM   5882 N N     . GLU B 1 368 ? 42.144  14.613  5.858   1.00 57.91 ? 414 GLU B N     1 
ATOM   5883 C CA    . GLU B 1 368 ? 43.369  15.388  5.522   1.00 58.61 ? 414 GLU B CA    1 
ATOM   5884 C C     . GLU B 1 368 ? 43.667  15.302  4.039   1.00 57.59 ? 414 GLU B C     1 
ATOM   5885 O O     . GLU B 1 368 ? 44.196  16.241  3.412   1.00 56.95 ? 414 GLU B O     1 
ATOM   5886 C CB    . GLU B 1 368 ? 44.623  14.840  6.187   1.00 58.67 ? 414 GLU B CB    1 
ATOM   5887 C CG    . GLU B 1 368 ? 44.546  14.311  7.612   1.00 61.65 ? 414 GLU B CG    1 
ATOM   5888 C CD    . GLU B 1 368 ? 45.911  13.744  8.025   1.00 61.79 ? 414 GLU B CD    1 
ATOM   5889 O OE1   . GLU B 1 368 ? 45.953  12.722  8.766   1.00 65.62 ? 414 GLU B OE1   1 
ATOM   5890 O OE2   . GLU B 1 368 ? 46.942  14.317  7.568   1.00 64.07 ? 414 GLU B OE2   1 
ATOM   5891 N N     . ASN B 1 369 ? 43.326  14.142  3.489   1.00 57.38 ? 415 ASN B N     1 
ATOM   5892 C CA    . ASN B 1 369 ? 43.787  13.755  2.172   1.00 56.39 ? 415 ASN B CA    1 
ATOM   5893 C C     . ASN B 1 369 ? 42.755  14.034  1.100   1.00 56.19 ? 415 ASN B C     1 
ATOM   5894 O O     . ASN B 1 369 ? 42.909  13.589  -0.036  1.00 56.27 ? 415 ASN B O     1 
ATOM   5895 C CB    . ASN B 1 369 ? 44.218  12.298  2.194   1.00 56.01 ? 415 ASN B CB    1 
ATOM   5896 C CG    . ASN B 1 369 ? 45.275  12.010  3.270   1.00 54.65 ? 415 ASN B CG    1 
ATOM   5897 O OD1   . ASN B 1 369 ? 45.077  11.168  4.141   1.00 54.88 ? 415 ASN B OD1   1 
ATOM   5898 N ND2   . ASN B 1 369 ? 46.395  12.715  3.205   1.00 52.17 ? 415 ASN B ND2   1 
ATOM   5899 N N     . LEU B 1 370 ? 41.738  14.825  1.458   1.00 55.78 ? 416 LEU B N     1 
ATOM   5900 C CA    . LEU B 1 370 ? 40.648  15.183  0.535   1.00 55.21 ? 416 LEU B CA    1 
ATOM   5901 C C     . LEU B 1 370 ? 40.368  16.685  0.454   1.00 54.33 ? 416 LEU B C     1 
ATOM   5902 O O     . LEU B 1 370 ? 40.492  17.399  1.441   1.00 54.46 ? 416 LEU B O     1 
ATOM   5903 C CB    . LEU B 1 370 ? 39.367  14.457  0.937   1.00 55.12 ? 416 LEU B CB    1 
ATOM   5904 C CG    . LEU B 1 370 ? 39.444  12.932  0.918   1.00 56.70 ? 416 LEU B CG    1 
ATOM   5905 C CD1   . LEU B 1 370 ? 38.180  12.311  1.467   1.00 58.70 ? 416 LEU B CD1   1 
ATOM   5906 C CD2   . LEU B 1 370 ? 39.701  12.439  -0.524  1.00 60.52 ? 416 LEU B CD2   1 
ATOM   5907 N N     . ILE B 1 371 ? 40.005  17.139  -0.741  1.00 53.06 ? 417 ILE B N     1 
ATOM   5908 C CA    . ILE B 1 371 ? 39.427  18.465  -0.975  1.00 52.18 ? 417 ILE B CA    1 
ATOM   5909 C C     . ILE B 1 371 ? 37.987  18.305  -1.595  1.00 51.76 ? 417 ILE B C     1 
ATOM   5910 O O     . ILE B 1 371 ? 37.775  17.462  -2.483  1.00 50.94 ? 417 ILE B O     1 
ATOM   5911 C CB    . ILE B 1 371 ? 40.356  19.248  -1.888  1.00 51.98 ? 417 ILE B CB    1 
ATOM   5912 C CG1   . ILE B 1 371 ? 41.795  19.056  -1.402  1.00 52.89 ? 417 ILE B CG1   1 
ATOM   5913 C CG2   . ILE B 1 371 ? 39.976  20.718  -1.942  1.00 51.37 ? 417 ILE B CG2   1 
ATOM   5914 C CD1   . ILE B 1 371 ? 42.859  19.064  -2.513  1.00 53.58 ? 417 ILE B CD1   1 
ATOM   5915 N N     . PRO B 1 372 ? 36.972  19.065  -1.089  1.00 51.11 ? 418 PRO B N     1 
ATOM   5916 C CA    . PRO B 1 372 ? 35.643  19.001  -1.699  1.00 50.04 ? 418 PRO B CA    1 
ATOM   5917 C C     . PRO B 1 372 ? 35.723  19.677  -3.051  1.00 49.34 ? 418 PRO B C     1 
ATOM   5918 O O     . PRO B 1 372 ? 36.443  20.650  -3.182  1.00 49.87 ? 418 PRO B O     1 
ATOM   5919 C CB    . PRO B 1 372 ? 34.812  19.871  -0.765  1.00 49.98 ? 418 PRO B CB    1 
ATOM   5920 C CG    . PRO B 1 372 ? 35.542  19.897  0.469   1.00 50.86 ? 418 PRO B CG    1 
ATOM   5921 C CD    . PRO B 1 372 ? 36.954  19.979  0.060   1.00 51.21 ? 418 PRO B CD    1 
ATOM   5922 N N     . GLY B 1 373 ? 35.017  19.211  -4.059  1.00 48.37 ? 419 GLY B N     1 
ATOM   5923 C CA    . GLY B 1 373 ? 35.196  19.857  -5.367  1.00 48.67 ? 419 GLY B CA    1 
ATOM   5924 C C     . GLY B 1 373 ? 36.667  19.816  -5.819  1.00 48.58 ? 419 GLY B C     1 
ATOM   5925 O O     . GLY B 1 373 ? 37.350  18.825  -5.604  1.00 48.53 ? 419 GLY B O     1 
ATOM   5926 N N     . THR B 1 374 ? 37.152  20.898  -6.422  1.00 48.17 ? 420 THR B N     1 
ATOM   5927 C CA    . THR B 1 374 ? 38.488  20.934  -6.949  1.00 48.41 ? 420 THR B CA    1 
ATOM   5928 C C     . THR B 1 374 ? 39.259  22.182  -6.455  1.00 49.84 ? 420 THR B C     1 
ATOM   5929 O O     . THR B 1 374 ? 38.634  23.169  -6.014  1.00 48.61 ? 420 THR B O     1 
ATOM   5930 C CB    . THR B 1 374 ? 38.431  20.880  -8.483  1.00 48.41 ? 420 THR B CB    1 
ATOM   5931 O OG1   . THR B 1 374 ? 39.700  21.236  -9.044  1.00 49.63 ? 420 THR B OG1   1 
ATOM   5932 C CG2   . THR B 1 374 ? 37.364  21.805  -9.027  1.00 47.19 ? 420 THR B CG2   1 
ATOM   5933 N N     . ASN B 1 375 ? 40.605  22.139  -6.526  1.00 50.53 ? 421 ASN B N     1 
ATOM   5934 C CA    . ASN B 1 375 ? 41.407  23.340  -6.321  1.00 51.27 ? 421 ASN B CA    1 
ATOM   5935 C C     . ASN B 1 375 ? 41.320  24.299  -7.511  1.00 52.17 ? 421 ASN B C     1 
ATOM   5936 O O     . ASN B 1 375 ? 41.638  25.501  -7.417  1.00 52.31 ? 421 ASN B O     1 
ATOM   5937 C CB    . ASN B 1 375 ? 42.844  23.107  -5.762  1.00 51.45 ? 421 ASN B CB    1 
ATOM   5938 C CG    . ASN B 1 375 ? 43.568  21.795  -6.265  1.00 54.98 ? 421 ASN B CG    1 
ATOM   5939 O OD1   . ASN B 1 375 ? 42.967  20.777  -6.668  1.00 58.65 ? 421 ASN B OD1   1 
ATOM   5940 N ND2   . ASN B 1 375 ? 44.899  21.831  -6.176  1.00 55.68 ? 421 ASN B ND2   1 
ATOM   5941 N N     . ILE B 1 376 ? 40.831  23.785  -8.625  1.00 52.85 ? 422 ILE B N     1 
ATOM   5942 C CA    . ILE B 1 376 ? 40.599  24.632  -9.778  1.00 54.64 ? 422 ILE B CA    1 
ATOM   5943 C C     . ILE B 1 376 ? 39.292  25.376  -9.516  1.00 55.63 ? 422 ILE B C     1 
ATOM   5944 O O     . ILE B 1 376 ? 38.212  24.788  -9.488  1.00 54.86 ? 422 ILE B O     1 
ATOM   5945 C CB    . ILE B 1 376 ? 40.594  23.831  -11.088 1.00 54.20 ? 422 ILE B CB    1 
ATOM   5946 C CG1   . ILE B 1 376 ? 41.803  22.867  -11.122 1.00 55.47 ? 422 ILE B CG1   1 
ATOM   5947 C CG2   . ILE B 1 376 ? 40.550  24.758  -12.271 1.00 54.03 ? 422 ILE B CG2   1 
ATOM   5948 C CD1   . ILE B 1 376 ? 41.971  22.083  -12.429 1.00 55.55 ? 422 ILE B CD1   1 
ATOM   5949 N N     . ASN B 1 377 ? 39.386  26.673  -9.304  1.00 58.08 ? 423 ASN B N     1 
ATOM   5950 C CA    . ASN B 1 377 ? 38.297  27.434  -8.747  1.00 59.13 ? 423 ASN B CA    1 
ATOM   5951 C C     . ASN B 1 377 ? 37.532  28.176  -9.837  1.00 60.78 ? 423 ASN B C     1 
ATOM   5952 O O     . ASN B 1 377 ? 36.516  28.800  -9.582  1.00 60.38 ? 423 ASN B O     1 
ATOM   5953 C CB    . ASN B 1 377 ? 38.829  28.383  -7.683  1.00 58.84 ? 423 ASN B CB    1 
ATOM   5954 C CG    . ASN B 1 377 ? 39.190  27.671  -6.366  1.00 59.96 ? 423 ASN B CG    1 
ATOM   5955 O OD1   . ASN B 1 377 ? 39.111  26.479  -6.257  1.00 55.98 ? 423 ASN B OD1   1 
ATOM   5956 N ND2   . ASN B 1 377 ? 39.581  28.439  -5.365  1.00 60.69 ? 423 ASN B ND2   1 
ATOM   5957 N N     . THR B 1 378 ? 38.021  28.053  -11.061 1.00 62.22 ? 424 THR B N     1 
ATOM   5958 C CA    . THR B 1 378 ? 37.505  28.804  -12.183 1.00 64.26 ? 424 THR B CA    1 
ATOM   5959 C C     . THR B 1 378 ? 36.085  28.453  -12.623 1.00 65.47 ? 424 THR B C     1 
ATOM   5960 O O     . THR B 1 378 ? 35.702  27.299  -12.760 1.00 65.78 ? 424 THR B O     1 
ATOM   5961 C CB    . THR B 1 378 ? 38.512  28.883  -13.356 1.00 64.37 ? 424 THR B CB    1 
ATOM   5962 O OG1   . THR B 1 378 ? 37.812  28.970  -14.592 1.00 64.43 ? 424 THR B OG1   1 
ATOM   5963 C CG2   . THR B 1 378 ? 39.362  27.701  -13.386 1.00 65.35 ? 424 THR B CG2   1 
ATOM   5964 N N     . THR B 1 379 ? 35.350  29.510  -12.911 1.00 66.64 ? 425 THR B N     1 
ATOM   5965 C CA    . THR B 1 379 ? 34.054  29.746  -12.426 1.00 67.74 ? 425 THR B CA    1 
ATOM   5966 C C     . THR B 1 379 ? 33.123  30.447  -13.369 1.00 68.85 ? 425 THR B C     1 
ATOM   5967 O O     . THR B 1 379 ? 33.505  31.263  -14.171 1.00 69.23 ? 425 THR B O     1 
ATOM   5968 C CB    . THR B 1 379 ? 34.162  30.587  -11.158 1.00 68.08 ? 425 THR B CB    1 
ATOM   5969 O OG1   . THR B 1 379 ? 34.483  29.746  -10.055 1.00 68.37 ? 425 THR B OG1   1 
ATOM   5970 C CG2   . THR B 1 379 ? 32.894  31.312  -10.872 1.00 67.69 ? 425 THR B CG2   1 
ATOM   5971 N N     . ASN B 1 380 ? 31.872  30.060  -13.245 1.00 69.33 ? 426 ASN B N     1 
ATOM   5972 C CA    . ASN B 1 380 ? 30.690  30.843  -13.624 1.00 69.97 ? 426 ASN B CA    1 
ATOM   5973 C C     . ASN B 1 380 ? 30.887  32.379  -13.696 1.00 70.45 ? 426 ASN B C     1 
ATOM   5974 O O     . ASN B 1 380 ? 31.301  33.045  -12.721 1.00 70.23 ? 426 ASN B O     1 
ATOM   5975 C CB    . ASN B 1 380 ? 29.557  30.494  -12.634 1.00 70.08 ? 426 ASN B CB    1 
ATOM   5976 C CG    . ASN B 1 380 ? 30.093  30.108  -11.225 1.00 70.89 ? 426 ASN B CG    1 
ATOM   5977 O OD1   . ASN B 1 380 ? 30.851  29.137  -11.057 1.00 70.51 ? 426 ASN B OD1   1 
ATOM   5978 N ND2   . ASN B 1 380 ? 29.715  30.892  -10.222 1.00 71.39 ? 426 ASN B ND2   1 
HETATM 5979 C C1    . DFP C 2 .   ? -8.912  -12.582 -24.090 1.00 54.93 ? 473 DFP A C1    1 
HETATM 5980 C C2    . DFP C 2 .   ? -9.553  -12.540 -25.471 1.00 57.70 ? 473 DFP A C2    1 
HETATM 5981 C C3    . DFP C 2 .   ? -8.807  -14.030 -23.604 1.00 51.95 ? 473 DFP A C3    1 
HETATM 5982 C "C1'" . DFP C 2 .   ? -9.101  -8.954  -25.668 1.00 54.74 ? 473 DFP A "C1'" 1 
HETATM 5983 C "C2'" . DFP C 2 .   ? -10.503 -9.534  -25.857 1.00 54.37 ? 473 DFP A "C2'" 1 
HETATM 5984 C "C3'" . DFP C 2 .   ? -9.129  -7.427  -25.715 1.00 51.64 ? 473 DFP A "C3'" 1 
HETATM 5985 P P     . DFP C 2 .   ? -7.270  -10.304 -23.983 1.00 57.94 ? 473 DFP A P     1 
HETATM 5986 O O1P   . DFP C 2 .   ? -7.623  -11.943 -24.119 1.00 56.42 ? 473 DFP A O1P   1 
HETATM 5987 O O2P   . DFP C 2 .   ? -8.620  -9.402  -24.392 1.00 56.64 ? 473 DFP A O2P   1 
HETATM 5988 O O3P   . DFP C 2 .   ? -5.917  -9.979  -24.775 1.00 49.84 ? 473 DFP A O3P   1 
HETATM 5989 C C1    . DFP D 2 .   ? 44.184  10.419  -20.463 1.00 55.69 ? 473 DFP B C1    1 
HETATM 5990 C C2    . DFP D 2 .   ? 45.568  9.803   -20.672 1.00 56.84 ? 473 DFP B C2    1 
HETATM 5991 C C3    . DFP D 2 .   ? 43.960  11.566  -21.467 1.00 52.70 ? 473 DFP B C3    1 
HETATM 5992 C "C1'" . DFP D 2 .   ? 44.724  6.444   -19.205 1.00 49.84 ? 473 DFP B "C1'" 1 
HETATM 5993 C "C2'" . DFP D 2 .   ? 45.937  7.364   -19.358 1.00 48.72 ? 473 DFP B "C2'" 1 
HETATM 5994 C "C3'" . DFP D 2 .   ? 45.048  5.256   -18.280 1.00 46.29 ? 473 DFP B "C3'" 1 
HETATM 5995 P P     . DFP D 2 .   ? 42.505  8.260   -19.617 1.00 55.41 ? 473 DFP B P     1 
HETATM 5996 O O1P   . DFP D 2 .   ? 43.195  9.387   -20.652 1.00 56.24 ? 473 DFP B O1P   1 
HETATM 5997 O O2P   . DFP D 2 .   ? 43.549  7.190   -18.786 1.00 52.25 ? 473 DFP B O2P   1 
HETATM 5998 O O3P   . DFP D 2 .   ? 41.496  7.470   -20.567 1.00 45.76 ? 473 DFP B O3P   1 
HETATM 5999 O O     . HOH E 3 .   ? -5.307  -7.641  -13.878 1.00 18.12 ? 430 HOH A O     1 
HETATM 6000 O O     . HOH E 3 .   ? -0.966  -0.485  -27.192 1.00 15.88 ? 431 HOH A O     1 
HETATM 6001 O O     . HOH E 3 .   ? 8.215   -0.555  -37.320 1.00 27.54 ? 432 HOH A O     1 
HETATM 6002 O O     . HOH E 3 .   ? 18.432  7.265   -24.162 1.00 28.95 ? 433 HOH A O     1 
HETATM 6003 O O     . HOH E 3 .   ? 2.099   -25.633 -27.235 1.00 34.98 ? 434 HOH A O     1 
HETATM 6004 O O     . HOH E 3 .   ? 11.424  -13.218 -16.844 1.00 28.47 ? 435 HOH A O     1 
HETATM 6005 O O     . HOH E 3 .   ? -23.237 2.525   -13.040 1.00 29.78 ? 436 HOH A O     1 
HETATM 6006 O O     . HOH E 3 .   ? 13.164  3.704   -41.014 1.00 31.39 ? 437 HOH A O     1 
HETATM 6007 O O     . HOH E 3 .   ? -20.570 -0.021  -26.465 1.00 26.93 ? 438 HOH A O     1 
HETATM 6008 O O     . HOH E 3 .   ? -2.694  21.833  -21.917 1.00 31.18 ? 439 HOH A O     1 
HETATM 6009 O O     . HOH E 3 .   ? 12.599  -6.456  -22.585 1.00 33.89 ? 440 HOH A O     1 
HETATM 6010 O O     . HOH E 3 .   ? -13.092 -8.391  -1.359  1.00 41.58 ? 441 HOH A O     1 
HETATM 6011 O O     . HOH E 3 .   ? -8.174  18.261  -25.253 1.00 38.49 ? 442 HOH A O     1 
HETATM 6012 O O     . HOH E 3 .   ? -26.001 -2.087  -19.545 1.00 43.91 ? 443 HOH A O     1 
HETATM 6013 O O     . HOH E 3 .   ? 3.425   -15.511 -35.177 1.00 38.21 ? 444 HOH A O     1 
HETATM 6014 O O     . HOH E 3 .   ? -12.500 5.711   -36.889 1.00 25.80 ? 445 HOH A O     1 
HETATM 6015 O O     . HOH E 3 .   ? 10.782  -4.564  -43.254 1.00 32.89 ? 446 HOH A O     1 
HETATM 6016 O O     . HOH E 3 .   ? 7.289   -16.023 -19.589 1.00 23.88 ? 447 HOH A O     1 
HETATM 6017 O O     . HOH E 3 .   ? 14.625  14.137  -20.387 1.00 24.06 ? 448 HOH A O     1 
HETATM 6018 O O     . HOH E 3 .   ? -7.471  2.785   -16.568 1.00 23.26 ? 449 HOH A O     1 
HETATM 6019 O O     . HOH E 3 .   ? -6.704  6.287   -30.833 1.00 21.92 ? 450 HOH A O     1 
HETATM 6020 O O     . HOH E 3 .   ? -6.448  11.137  -37.103 1.00 23.28 ? 451 HOH A O     1 
HETATM 6021 O O     . HOH E 3 .   ? 6.785   0.687   -52.740 1.00 30.12 ? 452 HOH A O     1 
HETATM 6022 O O     . HOH E 3 .   ? -6.962  -3.238  -2.922  1.00 25.56 ? 453 HOH A O     1 
HETATM 6023 O O     . HOH E 3 .   ? 13.411  4.704   -15.311 1.00 29.64 ? 454 HOH A O     1 
HETATM 6024 O O     . HOH E 3 .   ? -2.477  4.044   -39.546 1.00 21.90 ? 455 HOH A O     1 
HETATM 6025 O O     . HOH E 3 .   ? 11.883  10.572  -9.462  1.00 28.73 ? 456 HOH A O     1 
HETATM 6026 O O     . HOH E 3 .   ? -5.798  8.368   -36.931 1.00 21.03 ? 457 HOH A O     1 
HETATM 6027 O O     . HOH E 3 .   ? 12.374  6.215   -41.594 1.00 38.18 ? 458 HOH A O     1 
HETATM 6028 O O     . HOH E 3 .   ? -20.573 -0.512  -18.954 1.00 37.25 ? 459 HOH A O     1 
HETATM 6029 O O     . HOH E 3 .   ? -4.657  -18.012 -17.265 1.00 38.90 ? 460 HOH A O     1 
HETATM 6030 O O     . HOH E 3 .   ? -4.222  -6.824  -47.038 1.00 29.94 ? 461 HOH A O     1 
HETATM 6031 O O     . HOH E 3 .   ? 2.741   -3.284  -49.880 1.00 25.58 ? 462 HOH A O     1 
HETATM 6032 O O     . HOH E 3 .   ? 2.680   -8.611  -2.160  1.00 24.03 ? 463 HOH A O     1 
HETATM 6033 O O     . HOH E 3 .   ? 3.717   -5.624  -49.156 1.00 38.38 ? 464 HOH A O     1 
HETATM 6034 O O     . HOH E 3 .   ? -3.987  9.232   1.025   1.00 31.61 ? 465 HOH A O     1 
HETATM 6035 O O     . HOH E 3 .   ? 9.633   -14.509 -28.575 1.00 32.08 ? 466 HOH A O     1 
HETATM 6036 O O     . HOH E 3 .   ? -7.656  23.197  -17.631 1.00 34.12 ? 467 HOH A O     1 
HETATM 6037 O O     . HOH E 3 .   ? 18.458  1.968   -27.270 1.00 39.10 ? 468 HOH A O     1 
HETATM 6038 O O     . HOH E 3 .   ? 8.189   8.293   -44.974 1.00 38.85 ? 469 HOH A O     1 
HETATM 6039 O O     . HOH E 3 .   ? -5.548  -15.867 -31.926 1.00 32.27 ? 470 HOH A O     1 
HETATM 6040 O O     . HOH E 3 .   ? -10.644 -1.443  1.615   1.00 39.34 ? 471 HOH A O     1 
HETATM 6041 O O     . HOH E 3 .   ? 11.529  -6.578  -2.411  1.00 39.26 ? 472 HOH A O     1 
HETATM 6042 O O     . HOH E 3 .   ? 16.641  -0.273  -40.281 1.00 44.78 ? 474 HOH A O     1 
HETATM 6043 O O     . HOH E 3 .   ? 12.583  20.288  -28.212 1.00 33.39 ? 475 HOH A O     1 
HETATM 6044 O O     . HOH E 3 .   ? 17.679  9.809   -8.701  1.00 40.49 ? 476 HOH A O     1 
HETATM 6045 O O     . HOH E 3 .   ? 16.951  -10.405 -39.324 1.00 45.04 ? 477 HOH A O     1 
HETATM 6046 O O     . HOH E 3 .   ? -25.680 1.155   -15.107 1.00 39.47 ? 478 HOH A O     1 
HETATM 6047 O O     . HOH E 3 .   ? 9.095   11.597  -41.835 1.00 37.29 ? 479 HOH A O     1 
HETATM 6048 O O     . HOH E 3 .   ? -12.532 -11.022 -1.062  1.00 47.27 ? 480 HOH A O     1 
HETATM 6049 O O     . HOH E 3 .   ? 3.061   -5.842  0.643   1.00 33.18 ? 481 HOH A O     1 
HETATM 6050 O O     . HOH E 3 .   ? -14.740 -5.904  -49.986 1.00 36.64 ? 482 HOH A O     1 
HETATM 6051 O O     . HOH E 3 .   ? 6.463   -14.375 -31.874 1.00 40.10 ? 483 HOH A O     1 
HETATM 6052 O O     . HOH E 3 .   ? 19.961  3.454   -35.609 1.00 53.27 ? 484 HOH A O     1 
HETATM 6053 O O     . HOH E 3 .   ? 4.135   11.661  -4.360  1.00 37.81 ? 485 HOH A O     1 
HETATM 6054 O O     . HOH E 3 .   ? -4.324  -6.662  -3.030  1.00 22.71 ? 486 HOH A O     1 
HETATM 6055 O O     . HOH E 3 .   ? -10.604 -21.809 -13.627 1.00 42.60 ? 487 HOH A O     1 
HETATM 6056 O O     . HOH E 3 .   ? 14.272  2.031   -50.879 1.00 41.02 ? 488 HOH A O     1 
HETATM 6057 O O     . HOH E 3 .   ? -0.902  -26.285 -25.706 1.00 47.76 ? 489 HOH A O     1 
HETATM 6058 O O     . HOH E 3 .   ? -10.031 15.187  -24.154 1.00 37.92 ? 490 HOH A O     1 
HETATM 6059 O O     . HOH E 3 .   ? -1.627  -20.864 -36.316 1.00 38.09 ? 491 HOH A O     1 
HETATM 6060 O O     . HOH E 3 .   ? 0.481   -20.977 -18.617 1.00 41.31 ? 492 HOH A O     1 
HETATM 6061 O O     . HOH E 3 .   ? -2.286  -14.639 -32.357 1.00 29.62 ? 493 HOH A O     1 
HETATM 6062 O O     . HOH E 3 .   ? 7.087   -3.693  -4.535  1.00 29.01 ? 494 HOH A O     1 
HETATM 6063 O O     . HOH E 3 .   ? 20.706  4.516   -26.146 1.00 36.69 ? 495 HOH A O     1 
HETATM 6064 O O     . HOH E 3 .   ? 13.362  13.139  -12.522 1.00 38.87 ? 496 HOH A O     1 
HETATM 6065 O O     . HOH E 3 .   ? 8.276   -3.242  -1.398  1.00 42.77 ? 497 HOH A O     1 
HETATM 6066 O O     . HOH E 3 .   ? 10.841  -15.073 -18.756 1.00 31.06 ? 498 HOH A O     1 
HETATM 6067 O O     . HOH E 3 .   ? 0.067   0.873   -3.780  1.00 30.72 ? 499 HOH A O     1 
HETATM 6068 O O     . HOH E 3 .   ? 16.086  3.871   -30.271 1.00 29.76 ? 500 HOH A O     1 
HETATM 6069 O O     . HOH E 3 .   ? -9.503  6.363   -43.456 1.00 43.16 ? 501 HOH A O     1 
HETATM 6070 O O     . HOH E 3 .   ? 6.451   -4.323  0.706   1.00 43.51 ? 502 HOH A O     1 
HETATM 6071 O O     . HOH E 3 .   ? -18.265 5.437   -41.653 1.00 51.97 ? 503 HOH A O     1 
HETATM 6072 O O     . HOH E 3 .   ? -7.008  -19.445 -19.136 1.00 41.67 ? 504 HOH A O     1 
HETATM 6073 O O     . HOH E 3 .   ? 0.221   -27.111 -37.585 1.00 44.98 ? 505 HOH A O     1 
HETATM 6074 O O     . HOH E 3 .   ? -24.248 -0.094  -19.084 1.00 37.70 ? 506 HOH A O     1 
HETATM 6075 O O     . HOH E 3 .   ? -15.236 13.315  -19.411 1.00 41.77 ? 507 HOH A O     1 
HETATM 6076 O O     . HOH E 3 .   ? -16.978 13.350  -22.141 1.00 46.96 ? 508 HOH A O     1 
HETATM 6077 O O     . HOH E 3 .   ? 7.064   2.870   -4.148  1.00 37.00 ? 509 HOH A O     1 
HETATM 6078 O O     . HOH E 3 .   ? -14.220 -2.785  -25.951 1.00 34.12 ? 510 HOH A O     1 
HETATM 6079 O O     . HOH E 3 .   ? -19.255 -17.030 -38.842 1.00 48.42 ? 511 HOH A O     1 
HETATM 6080 O O     . HOH E 3 .   ? -14.016 13.854  -31.162 1.00 30.60 ? 512 HOH A O     1 
HETATM 6081 O O     . HOH E 3 .   ? -17.214 -9.157  -26.083 1.00 34.68 ? 513 HOH A O     1 
HETATM 6082 O O     . HOH E 3 .   ? 7.180   -10.968 -8.193  1.00 45.36 ? 514 HOH A O     1 
HETATM 6083 O O     . HOH E 3 .   ? 12.504  -10.454 -7.706  1.00 44.10 ? 515 HOH A O     1 
HETATM 6084 O O     . HOH E 3 .   ? -0.677  -0.206  -0.418  0.50 25.45 ? 516 HOH A O     1 
HETATM 6085 O O     . HOH E 3 .   ? -11.501 17.980  -21.270 1.00 44.52 ? 517 HOH A O     1 
HETATM 6086 O O     . HOH E 3 .   ? 6.211   16.003  -42.280 1.00 42.43 ? 518 HOH A O     1 
HETATM 6087 O O     . HOH E 3 .   ? -14.195 15.799  -19.090 1.00 47.43 ? 519 HOH A O     1 
HETATM 6088 O O     . HOH E 3 .   ? 9.738   12.131  -6.394  1.00 41.85 ? 520 HOH A O     1 
HETATM 6089 O O     . HOH E 3 .   ? -7.347  16.611  -39.063 1.00 48.47 ? 521 HOH A O     1 
HETATM 6090 O O     . HOH E 3 .   ? -9.044  8.799   -1.161  1.00 47.48 ? 522 HOH A O     1 
HETATM 6091 O O     . HOH E 3 .   ? -18.669 -15.873 -34.794 1.00 44.38 ? 523 HOH A O     1 
HETATM 6092 O O     . HOH E 3 .   ? -31.939 0.581   -16.644 1.00 55.16 ? 524 HOH A O     1 
HETATM 6093 O O     . HOH E 3 .   ? 14.995  -5.374  -39.586 1.00 47.21 ? 525 HOH A O     1 
HETATM 6094 O O     . HOH E 3 .   ? 4.338   6.255   -44.985 1.00 30.40 ? 526 HOH A O     1 
HETATM 6095 O O     . HOH F 3 .   ? 33.962  -10.079 -28.405 1.00 19.91 ? 430 HOH B O     1 
HETATM 6096 O O     . HOH F 3 .   ? 37.335  -1.606  -18.083 1.00 17.04 ? 431 HOH B O     1 
HETATM 6097 O O     . HOH F 3 .   ? 48.684  3.121   -12.694 1.00 37.03 ? 432 HOH B O     1 
HETATM 6098 O O     . HOH F 3 .   ? 42.705  -0.120  -9.993  1.00 24.09 ? 433 HOH B O     1 
HETATM 6099 O O     . HOH F 3 .   ? 23.923  2.845   -25.228 1.00 31.32 ? 434 HOH B O     1 
HETATM 6100 O O     . HOH F 3 .   ? 51.273  7.080   -5.000  1.00 26.90 ? 435 HOH B O     1 
HETATM 6101 O O     . HOH F 3 .   ? 51.190  -10.064 -15.679 1.00 27.73 ? 436 HOH B O     1 
HETATM 6102 O O     . HOH F 3 .   ? 43.085  -8.189  -13.710 1.00 26.24 ? 437 HOH B O     1 
HETATM 6103 O O     . HOH F 3 .   ? 48.700  -9.531  -2.508  1.00 48.83 ? 438 HOH B O     1 
HETATM 6104 O O     . HOH F 3 .   ? 48.488  -12.207 -5.971  1.00 36.64 ? 439 HOH B O     1 
HETATM 6105 O O     . HOH F 3 .   ? 36.138  12.382  -12.206 1.00 22.10 ? 440 HOH B O     1 
HETATM 6106 O O     . HOH F 3 .   ? 38.350  -0.323  0.755   1.00 27.63 ? 441 HOH B O     1 
HETATM 6107 O O     . HOH F 3 .   ? 36.227  26.285  -14.660 1.00 36.97 ? 442 HOH B O     1 
HETATM 6108 O O     . HOH F 3 .   ? 42.475  6.047   -30.153 1.00 34.93 ? 443 HOH B O     1 
HETATM 6109 O O     . HOH F 3 .   ? 23.557  -14.257 -28.855 1.00 42.89 ? 444 HOH B O     1 
HETATM 6110 O O     . HOH F 3 .   ? 34.150  -21.047 -29.292 1.00 43.52 ? 445 HOH B O     1 
HETATM 6111 O O     . HOH F 3 .   ? 51.907  -12.134 -19.552 1.00 25.26 ? 446 HOH B O     1 
HETATM 6112 O O     . HOH F 3 .   ? 32.262  -14.633 -37.223 1.00 42.01 ? 447 HOH B O     1 
HETATM 6113 O O     . HOH F 3 .   ? 48.126  -13.849 -30.185 1.00 25.87 ? 448 HOH B O     1 
HETATM 6114 O O     . HOH F 3 .   ? 41.969  17.736  -23.628 1.00 33.50 ? 449 HOH B O     1 
HETATM 6115 O O     . HOH F 3 .   ? 34.301  -21.309 -21.214 1.00 26.75 ? 450 HOH B O     1 
HETATM 6116 O O     . HOH F 3 .   ? 24.408  17.704  -5.114  1.00 42.82 ? 451 HOH B O     1 
HETATM 6117 O O     . HOH F 3 .   ? 17.559  -10.068 -18.881 1.00 34.62 ? 452 HOH B O     1 
HETATM 6118 O O     . HOH F 3 .   ? 44.717  -13.550 -16.672 1.00 30.32 ? 453 HOH B O     1 
HETATM 6119 O O     . HOH F 3 .   ? 26.278  4.736   -28.098 1.00 33.07 ? 454 HOH B O     1 
HETATM 6120 O O     . HOH F 3 .   ? 40.027  -19.082 -27.612 1.00 36.07 ? 455 HOH B O     1 
HETATM 6121 O O     . HOH F 3 .   ? 45.303  -16.362 -23.635 1.00 35.46 ? 456 HOH B O     1 
HETATM 6122 O O     . HOH F 3 .   ? 25.119  22.315  -19.603 1.00 42.59 ? 457 HOH B O     1 
HETATM 6123 O O     . HOH F 3 .   ? 33.378  -4.917  -27.774 1.00 18.12 ? 458 HOH B O     1 
HETATM 6124 O O     . HOH F 3 .   ? 19.551  8.385   -4.697  1.00 39.12 ? 459 HOH B O     1 
HETATM 6125 O O     . HOH F 3 .   ? 54.302  -13.899 -9.826  1.00 40.35 ? 460 HOH B O     1 
HETATM 6126 O O     . HOH F 3 .   ? 18.516  4.622   -2.913  1.00 42.48 ? 461 HOH B O     1 
HETATM 6127 O O     . HOH F 3 .   ? 22.741  -10.205 -24.759 1.00 37.20 ? 462 HOH B O     1 
HETATM 6128 O O     . HOH F 3 .   ? 40.807  -0.593  -0.758  1.00 35.10 ? 463 HOH B O     1 
HETATM 6129 O O     . HOH F 3 .   ? 25.940  6.930   8.351   1.00 39.36 ? 464 HOH B O     1 
HETATM 6130 O O     . HOH F 3 .   ? 17.360  -13.854 -21.173 1.00 42.39 ? 465 HOH B O     1 
HETATM 6131 O O     . HOH F 3 .   ? 50.595  9.417   2.338   1.00 49.10 ? 466 HOH B O     1 
HETATM 6132 O O     . HOH F 3 .   ? 42.902  -19.642 -37.975 1.00 44.89 ? 467 HOH B O     1 
HETATM 6133 O O     . HOH F 3 .   ? 14.036  5.279   -11.048 1.00 51.60 ? 468 HOH B O     1 
HETATM 6134 O O     . HOH F 3 .   ? 22.216  -26.654 -18.819 1.00 44.39 ? 469 HOH B O     1 
HETATM 6135 O O     . HOH F 3 .   ? 60.723  6.350   -29.907 1.00 36.43 ? 470 HOH B O     1 
HETATM 6136 O O     . HOH F 3 .   ? 45.339  7.871   -29.213 1.00 37.43 ? 471 HOH B O     1 
HETATM 6137 O O     . HOH F 3 .   ? 40.761  -21.751 1.954   1.00 45.12 ? 472 HOH B O     1 
HETATM 6138 O O     . HOH F 3 .   ? 19.331  8.022   -19.296 1.00 29.00 ? 474 HOH B O     1 
HETATM 6139 O O     . HOH F 3 .   ? 20.642  19.043  -15.799 1.00 48.93 ? 475 HOH B O     1 
HETATM 6140 O O     . HOH F 3 .   ? 37.753  3.438   -6.301  1.00 32.29 ? 476 HOH B O     1 
HETATM 6141 O O     . HOH F 3 .   ? 45.138  -15.759 -14.930 1.00 29.60 ? 477 HOH B O     1 
HETATM 6142 O O     . HOH F 3 .   ? 43.501  -12.593 -22.236 1.00 24.85 ? 478 HOH B O     1 
HETATM 6143 O O     . HOH F 3 .   ? 46.676  -10.257 -35.037 1.00 30.45 ? 479 HOH B O     1 
HETATM 6144 O O     . HOH F 3 .   ? 38.081  -21.306 0.021   1.00 56.10 ? 480 HOH B O     1 
HETATM 6145 O O     . HOH F 3 .   ? 16.063  -7.961  -9.159  1.00 46.48 ? 481 HOH B O     1 
HETATM 6146 O O     . HOH F 3 .   ? 31.613  -16.806 -38.338 1.00 49.28 ? 482 HOH B O     1 
HETATM 6147 O O     . HOH F 3 .   ? 44.529  -1.472  -0.114  1.00 38.21 ? 483 HOH B O     1 
HETATM 6148 O O     . HOH F 3 .   ? 42.198  -4.071  -3.973  1.00 30.26 ? 484 HOH B O     1 
HETATM 6149 O O     . HOH F 3 .   ? 23.358  13.596  -0.709  1.00 45.45 ? 485 HOH B O     1 
HETATM 6150 O O     . HOH F 3 .   ? 37.749  -20.027 -41.072 1.00 38.81 ? 486 HOH B O     1 
HETATM 6151 O O     . HOH F 3 .   ? 29.741  23.754  -29.115 1.00 39.01 ? 487 HOH B O     1 
HETATM 6152 O O     . HOH F 3 .   ? 22.283  -19.892 -9.700  1.00 50.91 ? 488 HOH B O     1 
HETATM 6153 O O     . HOH F 3 .   ? 37.952  -9.455  -39.286 1.00 46.34 ? 489 HOH B O     1 
HETATM 6154 O O     . HOH F 3 .   ? 21.722  -13.047 -28.816 1.00 52.03 ? 490 HOH B O     1 
HETATM 6155 O O     . HOH F 3 .   ? 26.619  2.512   9.475   1.00 47.83 ? 491 HOH B O     1 
HETATM 6156 O O     . HOH F 3 .   ? 34.651  -18.170 0.706   1.00 47.48 ? 492 HOH B O     1 
HETATM 6157 O O     . HOH F 3 .   ? 48.517  9.152   -16.796 1.00 44.09 ? 493 HOH B O     1 
HETATM 6158 O O     . HOH F 3 .   ? 42.325  -2.947  -1.260  1.00 34.96 ? 494 HOH B O     1 
HETATM 6159 O O     . HOH F 3 .   ? 45.999  -2.935  -35.032 1.00 41.24 ? 495 HOH B O     1 
HETATM 6160 O O     . HOH F 3 .   ? 41.855  -10.322 -2.716  1.00 40.38 ? 496 HOH B O     1 
HETATM 6161 O O     . HOH F 3 .   ? 36.890  -2.495  -33.325 1.00 40.37 ? 497 HOH B O     1 
HETATM 6162 O O     . HOH F 3 .   ? 15.818  2.961   -9.496  1.00 47.04 ? 498 HOH B O     1 
HETATM 6163 O O     . HOH F 3 .   ? 38.742  -20.871 3.619   1.00 40.80 ? 499 HOH B O     1 
HETATM 6164 O O     . HOH F 3 .   ? 46.827  4.543   -5.475  1.00 41.56 ? 500 HOH B O     1 
HETATM 6165 O O     . HOH F 3 .   ? 34.043  -22.333 -24.850 1.00 44.21 ? 501 HOH B O     1 
HETATM 6166 O O     . HOH F 3 .   ? 44.822  -4.357  1.503   1.00 42.47 ? 502 HOH B O     1 
HETATM 6167 O O     . HOH F 3 .   ? 26.372  5.574   2.244   1.00 41.80 ? 503 HOH B O     1 
HETATM 6168 O O     . HOH F 3 .   ? 15.931  14.798  -10.411 1.00 43.38 ? 504 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   47  ?   ?   ?   A . n 
A 1 2   ALA 2   48  ?   ?   ?   A . n 
A 1 3   ALA 3   49  ?   ?   ?   A . n 
A 1 4   SER 4   50  ?   ?   ?   A . n 
A 1 5   PHE 5   51  ?   ?   ?   A . n 
A 1 6   GLY 6   52  ?   ?   ?   A . n 
A 1 7   GLN 7   53  ?   ?   ?   A . n 
A 1 8   THR 8   54  54  THR THR A . n 
A 1 9   LYS 9   55  55  LYS LYS A . n 
A 1 10  ILE 10  56  56  ILE ILE A . n 
A 1 11  PRO 11  57  57  PRO PRO A . n 
A 1 12  ARG 12  58  58  ARG ARG A . n 
A 1 13  GLY 13  59  59  GLY GLY A . n 
A 1 14  ASN 14  60  60  ASN ASN A . n 
A 1 15  GLY 15  61  61  GLY GLY A . n 
A 1 16  PRO 16  62  62  PRO PRO A . n 
A 1 17  TYR 17  63  63  TYR TYR A . n 
A 1 18  SER 18  64  64  SER SER A . n 
A 1 19  VAL 19  65  65  VAL VAL A . n 
A 1 20  GLY 20  66  66  GLY GLY A . n 
A 1 21  CYS 21  67  67  CYS CYS A . n 
A 1 22  THR 22  68  68  THR THR A . n 
A 1 23  ASP 23  69  69  ASP ASP A . n 
A 1 24  LEU 24  70  70  LEU LEU A . n 
A 1 25  MET 25  71  71  MET MET A . n 
A 1 26  PHE 26  72  72  PHE PHE A . n 
A 1 27  ASP 27  73  73  ASP ASP A . n 
A 1 28  HIS 28  74  74  HIS HIS A . n 
A 1 29  THR 29  75  75  THR THR A . n 
A 1 30  ASN 30  76  76  ASN ASN A . n 
A 1 31  LYS 31  77  77  LYS LYS A . n 
A 1 32  GLY 32  78  78  GLY GLY A . n 
A 1 33  THR 33  79  79  THR THR A . n 
A 1 34  PHE 34  80  80  PHE PHE A . n 
A 1 35  LEU 35  81  81  LEU LEU A . n 
A 1 36  ARG 36  82  82  ARG ARG A . n 
A 1 37  LEU 37  83  83  LEU LEU A . n 
A 1 38  TYR 38  84  84  TYR TYR A . n 
A 1 39  TYR 39  85  85  TYR TYR A . n 
A 1 40  PRO 40  86  86  PRO PRO A . n 
A 1 41  SER 41  87  87  SER SER A . n 
A 1 42  GLN 42  88  88  GLN GLN A . n 
A 1 43  ASP 43  89  89  ASP ASP A . n 
A 1 44  ASN 44  90  90  ASN ASN A . n 
A 1 45  ASP 45  91  91  ASP ASP A . n 
A 1 46  ARG 46  92  92  ARG ARG A . n 
A 1 47  LEU 47  93  93  LEU LEU A . n 
A 1 48  ASP 48  94  94  ASP ASP A . n 
A 1 49  THR 49  95  95  THR THR A . n 
A 1 50  LEU 50  96  96  LEU LEU A . n 
A 1 51  TRP 51  97  97  TRP TRP A . n 
A 1 52  ILE 52  98  98  ILE ILE A . n 
A 1 53  PRO 53  99  99  PRO PRO A . n 
A 1 54  ASN 54  100 100 ASN ASN A . n 
A 1 55  LYS 55  101 101 LYS LYS A . n 
A 1 56  GLU 56  102 102 GLU GLU A . n 
A 1 57  TYR 57  103 103 TYR TYR A . n 
A 1 58  PHE 58  104 104 PHE PHE A . n 
A 1 59  TRP 59  105 105 TRP TRP A . n 
A 1 60  GLY 60  106 106 GLY GLY A . n 
A 1 61  LEU 61  107 107 LEU LEU A . n 
A 1 62  SER 62  108 108 SER SER A . n 
A 1 63  LYS 63  109 109 LYS LYS A . n 
A 1 64  PHE 64  110 110 PHE PHE A . n 
A 1 65  LEU 65  111 111 LEU LEU A . n 
A 1 66  GLY 66  112 112 GLY GLY A . n 
A 1 67  THR 67  113 113 THR THR A . n 
A 1 68  HIS 68  114 114 HIS HIS A . n 
A 1 69  TRP 69  115 115 TRP TRP A . n 
A 1 70  LEU 70  116 116 LEU LEU A . n 
A 1 71  MET 71  117 117 MET MET A . n 
A 1 72  GLY 72  118 118 GLY GLY A . n 
A 1 73  ASN 73  119 119 ASN ASN A . n 
A 1 74  ILE 74  120 120 ILE ILE A . n 
A 1 75  LEU 75  121 121 LEU LEU A . n 
A 1 76  ARG 76  122 122 ARG ARG A . n 
A 1 77  LEU 77  123 123 LEU LEU A . n 
A 1 78  LEU 78  124 124 LEU LEU A . n 
A 1 79  PHE 79  125 125 PHE PHE A . n 
A 1 80  GLY 80  126 126 GLY GLY A . n 
A 1 81  SER 81  127 127 SER SER A . n 
A 1 82  MET 82  128 128 MET MET A . n 
A 1 83  THR 83  129 129 THR THR A . n 
A 1 84  THR 84  130 130 THR THR A . n 
A 1 85  PRO 85  131 131 PRO PRO A . n 
A 1 86  ALA 86  132 132 ALA ALA A . n 
A 1 87  ASN 87  133 133 ASN ASN A . n 
A 1 88  TRP 88  134 134 TRP TRP A . n 
A 1 89  ASN 89  135 135 ASN ASN A . n 
A 1 90  SER 90  136 136 SER SER A . n 
A 1 91  PRO 91  137 137 PRO PRO A . n 
A 1 92  LEU 92  138 138 LEU LEU A . n 
A 1 93  ARG 93  139 139 ARG ARG A . n 
A 1 94  PRO 94  140 140 PRO PRO A . n 
A 1 95  GLY 95  141 141 GLY GLY A . n 
A 1 96  GLU 96  142 142 GLU GLU A . n 
A 1 97  LYS 97  143 143 LYS LYS A . n 
A 1 98  TYR 98  144 144 TYR TYR A . n 
A 1 99  PRO 99  145 145 PRO PRO A . n 
A 1 100 LEU 100 146 146 LEU LEU A . n 
A 1 101 VAL 101 147 147 VAL VAL A . n 
A 1 102 VAL 102 148 148 VAL VAL A . n 
A 1 103 PHE 103 149 149 PHE PHE A . n 
A 1 104 SER 104 150 150 SER SER A . n 
A 1 105 HIS 105 151 151 HIS HIS A . n 
A 1 106 GLY 106 152 152 GLY GLY A . n 
A 1 107 LEU 107 153 153 LEU LEU A . n 
A 1 108 GLY 108 154 154 GLY GLY A . n 
A 1 109 ALA 109 155 155 ALA ALA A . n 
A 1 110 PHE 110 156 156 PHE PHE A . n 
A 1 111 ARG 111 157 157 ARG ARG A . n 
A 1 112 THR 112 158 158 THR THR A . n 
A 1 113 LEU 113 159 159 LEU LEU A . n 
A 1 114 TYR 114 160 160 TYR TYR A . n 
A 1 115 SER 115 161 161 SER SER A . n 
A 1 116 ALA 116 162 162 ALA ALA A . n 
A 1 117 ILE 117 163 163 ILE ILE A . n 
A 1 118 GLY 118 164 164 GLY GLY A . n 
A 1 119 ILE 119 165 165 ILE ILE A . n 
A 1 120 ASP 120 166 166 ASP ASP A . n 
A 1 121 LEU 121 167 167 LEU LEU A . n 
A 1 122 ALA 122 168 168 ALA ALA A . n 
A 1 123 SER 123 169 169 SER SER A . n 
A 1 124 HIS 124 170 170 HIS HIS A . n 
A 1 125 GLY 125 171 171 GLY GLY A . n 
A 1 126 PHE 126 172 172 PHE PHE A . n 
A 1 127 ILE 127 173 173 ILE ILE A . n 
A 1 128 VAL 128 174 174 VAL VAL A . n 
A 1 129 ALA 129 175 175 ALA ALA A . n 
A 1 130 ALA 130 176 176 ALA ALA A . n 
A 1 131 VAL 131 177 177 VAL VAL A . n 
A 1 132 GLU 132 178 178 GLU GLU A . n 
A 1 133 HIS 133 179 179 HIS HIS A . n 
A 1 134 ARG 134 180 180 ARG ARG A . n 
A 1 135 ASP 135 181 181 ASP ASP A . n 
A 1 136 ARG 136 182 182 ARG ARG A . n 
A 1 137 SER 137 183 183 SER SER A . n 
A 1 138 ALA 138 184 184 ALA ALA A . n 
A 1 139 SER 139 185 185 SER SER A . n 
A 1 140 ALA 140 186 186 ALA ALA A . n 
A 1 141 THR 141 187 187 THR THR A . n 
A 1 142 TYR 142 188 188 TYR TYR A . n 
A 1 143 TYR 143 189 189 TYR TYR A . n 
A 1 144 PHE 144 190 190 PHE PHE A . n 
A 1 145 LYS 145 191 191 LYS LYS A . n 
A 1 146 ASP 146 192 192 ASP ASP A . n 
A 1 147 GLN 147 193 193 GLN GLN A . n 
A 1 148 SER 148 194 194 SER SER A . n 
A 1 149 ALA 149 195 195 ALA ALA A . n 
A 1 150 ALA 150 196 196 ALA ALA A . n 
A 1 151 GLU 151 197 197 GLU GLU A . n 
A 1 152 ILE 152 198 198 ILE ILE A . n 
A 1 153 GLY 153 199 199 GLY GLY A . n 
A 1 154 ASP 154 200 200 ASP ASP A . n 
A 1 155 LYS 155 201 201 LYS LYS A . n 
A 1 156 SER 156 202 202 SER SER A . n 
A 1 157 TRP 157 203 203 TRP TRP A . n 
A 1 158 LEU 158 204 204 LEU LEU A . n 
A 1 159 TYR 159 205 205 TYR TYR A . n 
A 1 160 LEU 160 206 206 LEU LEU A . n 
A 1 161 ARG 161 207 207 ARG ARG A . n 
A 1 162 THR 162 208 208 THR THR A . n 
A 1 163 LEU 163 209 209 LEU LEU A . n 
A 1 164 LYS 164 210 210 LYS LYS A . n 
A 1 165 GLN 165 211 211 GLN GLN A . n 
A 1 166 GLU 166 212 212 GLU GLU A . n 
A 1 167 GLU 167 213 213 GLU GLU A . n 
A 1 168 GLU 168 214 214 GLU GLU A . n 
A 1 169 THR 169 215 215 THR THR A . n 
A 1 170 HIS 170 216 216 HIS HIS A . n 
A 1 171 ILE 171 217 217 ILE ILE A . n 
A 1 172 ARG 172 218 218 ARG ARG A . n 
A 1 173 ASN 173 219 219 ASN ASN A . n 
A 1 174 GLU 174 220 220 GLU GLU A . n 
A 1 175 GLN 175 221 221 GLN GLN A . n 
A 1 176 VAL 176 222 222 VAL VAL A . n 
A 1 177 ARG 177 223 223 ARG ARG A . n 
A 1 178 GLN 178 224 224 GLN GLN A . n 
A 1 179 ARG 179 225 225 ARG ARG A . n 
A 1 180 ALA 180 226 226 ALA ALA A . n 
A 1 181 LYS 181 227 227 LYS LYS A . n 
A 1 182 GLU 182 228 228 GLU GLU A . n 
A 1 183 CYS 183 229 229 CYS CYS A . n 
A 1 184 SER 184 230 230 SER SER A . n 
A 1 185 GLN 185 231 231 GLN GLN A . n 
A 1 186 ALA 186 232 232 ALA ALA A . n 
A 1 187 LEU 187 233 233 LEU LEU A . n 
A 1 188 SER 188 234 234 SER SER A . n 
A 1 189 LEU 189 235 235 LEU LEU A . n 
A 1 190 ILE 190 236 236 ILE ILE A . n 
A 1 191 LEU 191 237 237 LEU LEU A . n 
A 1 192 ASP 192 238 238 ASP ASP A . n 
A 1 193 ILE 193 239 239 ILE ILE A . n 
A 1 194 ASP 194 240 240 ASP ASP A . n 
A 1 195 HIS 195 241 241 HIS HIS A . n 
A 1 196 GLY 196 242 242 GLY GLY A . n 
A 1 197 LYS 197 243 243 LYS LYS A . n 
A 1 198 PRO 198 244 244 PRO PRO A . n 
A 1 199 VAL 199 245 245 VAL VAL A . n 
A 1 200 LYS 200 246 246 LYS LYS A . n 
A 1 201 ASN 201 247 247 ASN ASN A . n 
A 1 202 ALA 202 248 248 ALA ALA A . n 
A 1 203 LEU 203 249 249 LEU LEU A . n 
A 1 204 ASP 204 250 250 ASP ASP A . n 
A 1 205 LEU 205 251 251 LEU LEU A . n 
A 1 206 LYS 206 252 252 LYS LYS A . n 
A 1 207 PHE 207 253 253 PHE PHE A . n 
A 1 208 ASP 208 254 254 ASP ASP A . n 
A 1 209 MET 209 255 255 MET MET A . n 
A 1 210 GLU 210 256 256 GLU GLU A . n 
A 1 211 GLN 211 257 257 GLN GLN A . n 
A 1 212 LEU 212 258 258 LEU LEU A . n 
A 1 213 LYS 213 259 259 LYS LYS A . n 
A 1 214 ASP 214 260 260 ASP ASP A . n 
A 1 215 SER 215 261 261 SER SER A . n 
A 1 216 ILE 216 262 262 ILE ILE A . n 
A 1 217 ASP 217 263 263 ASP ASP A . n 
A 1 218 ARG 218 264 264 ARG ARG A . n 
A 1 219 GLU 219 265 265 GLU GLU A . n 
A 1 220 LYS 220 266 266 LYS LYS A . n 
A 1 221 ILE 221 267 267 ILE ILE A . n 
A 1 222 ALA 222 268 268 ALA ALA A . n 
A 1 223 VAL 223 269 269 VAL VAL A . n 
A 1 224 ILE 224 270 270 ILE ILE A . n 
A 1 225 GLY 225 271 271 GLY GLY A . n 
A 1 226 HIS 226 272 272 HIS HIS A . n 
A 1 227 SER 227 273 273 SER SER A . n 
A 1 228 PHE 228 274 274 PHE PHE A . n 
A 1 229 GLY 229 275 275 GLY GLY A . n 
A 1 230 GLY 230 276 276 GLY GLY A . n 
A 1 231 ALA 231 277 277 ALA ALA A . n 
A 1 232 THR 232 278 278 THR THR A . n 
A 1 233 VAL 233 279 279 VAL VAL A . n 
A 1 234 ILE 234 280 280 ILE ILE A . n 
A 1 235 GLN 235 281 281 GLN GLN A . n 
A 1 236 THR 236 282 282 THR THR A . n 
A 1 237 LEU 237 283 283 LEU LEU A . n 
A 1 238 SER 238 284 284 SER SER A . n 
A 1 239 GLU 239 285 285 GLU GLU A . n 
A 1 240 ASP 240 286 286 ASP ASP A . n 
A 1 241 GLN 241 287 287 GLN GLN A . n 
A 1 242 ARG 242 288 288 ARG ARG A . n 
A 1 243 PHE 243 289 289 PHE PHE A . n 
A 1 244 ARG 244 290 290 ARG ARG A . n 
A 1 245 CYS 245 291 291 CYS CYS A . n 
A 1 246 GLY 246 292 292 GLY GLY A . n 
A 1 247 ILE 247 293 293 ILE ILE A . n 
A 1 248 ALA 248 294 294 ALA ALA A . n 
A 1 249 LEU 249 295 295 LEU LEU A . n 
A 1 250 ASP 250 296 296 ASP ASP A . n 
A 1 251 ALA 251 297 297 ALA ALA A . n 
A 1 252 TRP 252 298 298 TRP TRP A . n 
A 1 253 MET 253 299 299 MET MET A . n 
A 1 254 PHE 254 300 300 PHE PHE A . n 
A 1 255 PRO 255 301 301 PRO PRO A . n 
A 1 256 LEU 256 302 302 LEU LEU A . n 
A 1 257 GLY 257 303 303 GLY GLY A . n 
A 1 258 ASP 258 304 304 ASP ASP A . n 
A 1 259 GLU 259 305 305 GLU GLU A . n 
A 1 260 VAL 260 306 306 VAL VAL A . n 
A 1 261 TYR 261 307 307 TYR TYR A . n 
A 1 262 SER 262 308 308 SER SER A . n 
A 1 263 ARG 263 309 309 ARG ARG A . n 
A 1 264 ILE 264 310 310 ILE ILE A . n 
A 1 265 PRO 265 311 311 PRO PRO A . n 
A 1 266 GLN 266 312 312 GLN GLN A . n 
A 1 267 PRO 267 313 313 PRO PRO A . n 
A 1 268 LEU 268 314 314 LEU LEU A . n 
A 1 269 PHE 269 315 315 PHE PHE A . n 
A 1 270 PHE 270 316 316 PHE PHE A . n 
A 1 271 ILE 271 317 317 ILE ILE A . n 
A 1 272 ASN 272 318 318 ASN ASN A . n 
A 1 273 SER 273 319 319 SER SER A . n 
A 1 274 GLU 274 320 320 GLU GLU A . n 
A 1 275 TYR 275 321 321 TYR TYR A . n 
A 1 276 PHE 276 322 322 PHE PHE A . n 
A 1 277 GLN 277 323 323 GLN GLN A . n 
A 1 278 TYR 278 324 324 TYR TYR A . n 
A 1 279 PRO 279 325 325 PRO PRO A . n 
A 1 280 ALA 280 326 326 ALA ALA A . n 
A 1 281 ASN 281 327 327 ASN ASN A . n 
A 1 282 ILE 282 328 328 ILE ILE A . n 
A 1 283 ILE 283 329 329 ILE ILE A . n 
A 1 284 LYS 284 330 330 LYS LYS A . n 
A 1 285 MET 285 331 331 MET MET A . n 
A 1 286 LYS 286 332 332 LYS LYS A . n 
A 1 287 LYS 287 333 333 LYS LYS A . n 
A 1 288 CYS 288 334 334 CYS CYS A . n 
A 1 289 TYR 289 335 335 TYR TYR A . n 
A 1 290 SER 290 336 336 SER SER A . n 
A 1 291 PRO 291 337 337 PRO PRO A . n 
A 1 292 ASP 292 338 338 ASP ASP A . n 
A 1 293 LYS 293 339 339 LYS LYS A . n 
A 1 294 GLU 294 340 340 GLU GLU A . n 
A 1 295 ARG 295 341 341 ARG ARG A . n 
A 1 296 LYS 296 342 342 LYS LYS A . n 
A 1 297 MET 297 343 343 MET MET A . n 
A 1 298 ILE 298 344 344 ILE ILE A . n 
A 1 299 THR 299 345 345 THR THR A . n 
A 1 300 ILE 300 346 346 ILE ILE A . n 
A 1 301 ARG 301 347 347 ARG ARG A . n 
A 1 302 GLY 302 348 348 GLY GLY A . n 
A 1 303 SER 303 349 349 SER SER A . n 
A 1 304 VAL 304 350 350 VAL VAL A . n 
A 1 305 HIS 305 351 351 HIS HIS A . n 
A 1 306 GLN 306 352 352 GLN GLN A . n 
A 1 307 ASN 307 353 353 ASN ASN A . n 
A 1 308 PHE 308 354 354 PHE PHE A . n 
A 1 309 ALA 309 355 355 ALA ALA A . n 
A 1 310 ASP 310 356 356 ASP ASP A . n 
A 1 311 PHE 311 357 357 PHE PHE A . n 
A 1 312 THR 312 358 358 THR THR A . n 
A 1 313 PHE 313 359 359 PHE PHE A . n 
A 1 314 ALA 314 360 360 ALA ALA A . n 
A 1 315 THR 315 361 361 THR THR A . n 
A 1 316 GLY 316 362 362 GLY GLY A . n 
A 1 317 LYS 317 363 363 LYS LYS A . n 
A 1 318 ILE 318 364 364 ILE ILE A . n 
A 1 319 ILE 319 365 365 ILE ILE A . n 
A 1 320 GLY 320 366 366 GLY GLY A . n 
A 1 321 HIS 321 367 367 HIS HIS A . n 
A 1 322 MET 322 368 368 MET MET A . n 
A 1 323 LEU 323 369 369 LEU LEU A . n 
A 1 324 LYS 324 370 370 LYS LYS A . n 
A 1 325 LEU 325 371 371 LEU LEU A . n 
A 1 326 LYS 326 372 372 LYS LYS A . n 
A 1 327 GLY 327 373 373 GLY GLY A . n 
A 1 328 ASP 328 374 374 ASP ASP A . n 
A 1 329 ILE 329 375 375 ILE ILE A . n 
A 1 330 ASP 330 376 376 ASP ASP A . n 
A 1 331 SER 331 377 377 SER SER A . n 
A 1 332 ASN 332 378 378 ASN ASN A . n 
A 1 333 VAL 333 379 379 VAL VAL A . n 
A 1 334 ALA 334 380 380 ALA ALA A . n 
A 1 335 ILE 335 381 381 ILE ILE A . n 
A 1 336 ASP 336 382 382 ASP ASP A . n 
A 1 337 LEU 337 383 383 LEU LEU A . n 
A 1 338 SER 338 384 384 SER SER A . n 
A 1 339 ASN 339 385 385 ASN ASN A . n 
A 1 340 LYS 340 386 386 LYS LYS A . n 
A 1 341 ALA 341 387 387 ALA ALA A . n 
A 1 342 SER 342 388 388 SER SER A . n 
A 1 343 LEU 343 389 389 LEU LEU A . n 
A 1 344 ALA 344 390 390 ALA ALA A . n 
A 1 345 PHE 345 391 391 PHE PHE A . n 
A 1 346 LEU 346 392 392 LEU LEU A . n 
A 1 347 GLN 347 393 393 GLN GLN A . n 
A 1 348 LYS 348 394 394 LYS LYS A . n 
A 1 349 HIS 349 395 395 HIS HIS A . n 
A 1 350 LEU 350 396 396 LEU LEU A . n 
A 1 351 GLY 351 397 397 GLY GLY A . n 
A 1 352 LEU 352 398 398 LEU LEU A . n 
A 1 353 HIS 353 399 399 HIS HIS A . n 
A 1 354 LYS 354 400 400 LYS LYS A . n 
A 1 355 ASP 355 401 401 ASP ASP A . n 
A 1 356 PHE 356 402 402 PHE PHE A . n 
A 1 357 ASP 357 403 403 ASP ASP A . n 
A 1 358 GLN 358 404 404 GLN GLN A . n 
A 1 359 TRP 359 405 405 TRP TRP A . n 
A 1 360 ASP 360 406 406 ASP ASP A . n 
A 1 361 CYS 361 407 407 CYS CYS A . n 
A 1 362 LEU 362 408 408 LEU LEU A . n 
A 1 363 ILE 363 409 409 ILE ILE A . n 
A 1 364 GLU 364 410 410 GLU GLU A . n 
A 1 365 GLY 365 411 411 GLY GLY A . n 
A 1 366 ASP 366 412 412 ASP ASP A . n 
A 1 367 ASP 367 413 413 ASP ASP A . n 
A 1 368 GLU 368 414 414 GLU GLU A . n 
A 1 369 ASN 369 415 415 ASN ASN A . n 
A 1 370 LEU 370 416 416 LEU LEU A . n 
A 1 371 ILE 371 417 417 ILE ILE A . n 
A 1 372 PRO 372 418 418 PRO PRO A . n 
A 1 373 GLY 373 419 419 GLY GLY A . n 
A 1 374 THR 374 420 420 THR THR A . n 
A 1 375 ASN 375 421 421 ASN ASN A . n 
A 1 376 ILE 376 422 422 ILE ILE A . n 
A 1 377 ASN 377 423 423 ASN ASN A . n 
A 1 378 THR 378 424 424 THR THR A . n 
A 1 379 THR 379 425 425 THR THR A . n 
A 1 380 ASN 380 426 ?   ?   ?   A . n 
A 1 381 GLN 381 427 ?   ?   ?   A . n 
A 1 382 HIS 382 428 ?   ?   ?   A . n 
A 1 383 ILE 383 429 ?   ?   ?   A . n 
B 1 1   ALA 1   47  ?   ?   ?   B . n 
B 1 2   ALA 2   48  ?   ?   ?   B . n 
B 1 3   ALA 3   49  ?   ?   ?   B . n 
B 1 4   SER 4   50  ?   ?   ?   B . n 
B 1 5   PHE 5   51  ?   ?   ?   B . n 
B 1 6   GLY 6   52  ?   ?   ?   B . n 
B 1 7   GLN 7   53  ?   ?   ?   B . n 
B 1 8   THR 8   54  54  THR THR B . n 
B 1 9   LYS 9   55  55  LYS LYS B . n 
B 1 10  ILE 10  56  56  ILE ILE B . n 
B 1 11  PRO 11  57  57  PRO PRO B . n 
B 1 12  ARG 12  58  58  ARG ARG B . n 
B 1 13  GLY 13  59  59  GLY GLY B . n 
B 1 14  ASN 14  60  60  ASN ASN B . n 
B 1 15  GLY 15  61  61  GLY GLY B . n 
B 1 16  PRO 16  62  62  PRO PRO B . n 
B 1 17  TYR 17  63  63  TYR TYR B . n 
B 1 18  SER 18  64  64  SER SER B . n 
B 1 19  VAL 19  65  65  VAL VAL B . n 
B 1 20  GLY 20  66  66  GLY GLY B . n 
B 1 21  CYS 21  67  67  CYS CYS B . n 
B 1 22  THR 22  68  68  THR THR B . n 
B 1 23  ASP 23  69  69  ASP ASP B . n 
B 1 24  LEU 24  70  70  LEU LEU B . n 
B 1 25  MET 25  71  71  MET MET B . n 
B 1 26  PHE 26  72  72  PHE PHE B . n 
B 1 27  ASP 27  73  73  ASP ASP B . n 
B 1 28  HIS 28  74  74  HIS HIS B . n 
B 1 29  THR 29  75  75  THR THR B . n 
B 1 30  ASN 30  76  76  ASN ASN B . n 
B 1 31  LYS 31  77  77  LYS LYS B . n 
B 1 32  GLY 32  78  78  GLY GLY B . n 
B 1 33  THR 33  79  79  THR THR B . n 
B 1 34  PHE 34  80  80  PHE PHE B . n 
B 1 35  LEU 35  81  81  LEU LEU B . n 
B 1 36  ARG 36  82  82  ARG ARG B . n 
B 1 37  LEU 37  83  83  LEU LEU B . n 
B 1 38  TYR 38  84  84  TYR TYR B . n 
B 1 39  TYR 39  85  85  TYR TYR B . n 
B 1 40  PRO 40  86  86  PRO PRO B . n 
B 1 41  SER 41  87  87  SER SER B . n 
B 1 42  GLN 42  88  88  GLN GLN B . n 
B 1 43  ASP 43  89  89  ASP ASP B . n 
B 1 44  ASN 44  90  90  ASN ASN B . n 
B 1 45  ASP 45  91  91  ASP ASP B . n 
B 1 46  ARG 46  92  92  ARG ARG B . n 
B 1 47  LEU 47  93  93  LEU LEU B . n 
B 1 48  ASP 48  94  94  ASP ASP B . n 
B 1 49  THR 49  95  95  THR THR B . n 
B 1 50  LEU 50  96  96  LEU LEU B . n 
B 1 51  TRP 51  97  97  TRP TRP B . n 
B 1 52  ILE 52  98  98  ILE ILE B . n 
B 1 53  PRO 53  99  99  PRO PRO B . n 
B 1 54  ASN 54  100 100 ASN ASN B . n 
B 1 55  LYS 55  101 101 LYS LYS B . n 
B 1 56  GLU 56  102 102 GLU GLU B . n 
B 1 57  TYR 57  103 103 TYR TYR B . n 
B 1 58  PHE 58  104 104 PHE PHE B . n 
B 1 59  TRP 59  105 105 TRP TRP B . n 
B 1 60  GLY 60  106 106 GLY GLY B . n 
B 1 61  LEU 61  107 107 LEU LEU B . n 
B 1 62  SER 62  108 108 SER SER B . n 
B 1 63  LYS 63  109 109 LYS LYS B . n 
B 1 64  PHE 64  110 110 PHE PHE B . n 
B 1 65  LEU 65  111 111 LEU LEU B . n 
B 1 66  GLY 66  112 112 GLY GLY B . n 
B 1 67  THR 67  113 113 THR THR B . n 
B 1 68  HIS 68  114 114 HIS HIS B . n 
B 1 69  TRP 69  115 115 TRP TRP B . n 
B 1 70  LEU 70  116 116 LEU LEU B . n 
B 1 71  MET 71  117 117 MET MET B . n 
B 1 72  GLY 72  118 118 GLY GLY B . n 
B 1 73  ASN 73  119 119 ASN ASN B . n 
B 1 74  ILE 74  120 120 ILE ILE B . n 
B 1 75  LEU 75  121 121 LEU LEU B . n 
B 1 76  ARG 76  122 122 ARG ARG B . n 
B 1 77  LEU 77  123 123 LEU LEU B . n 
B 1 78  LEU 78  124 124 LEU LEU B . n 
B 1 79  PHE 79  125 125 PHE PHE B . n 
B 1 80  GLY 80  126 126 GLY GLY B . n 
B 1 81  SER 81  127 127 SER SER B . n 
B 1 82  MET 82  128 128 MET MET B . n 
B 1 83  THR 83  129 129 THR THR B . n 
B 1 84  THR 84  130 130 THR THR B . n 
B 1 85  PRO 85  131 131 PRO PRO B . n 
B 1 86  ALA 86  132 132 ALA ALA B . n 
B 1 87  ASN 87  133 133 ASN ASN B . n 
B 1 88  TRP 88  134 134 TRP TRP B . n 
B 1 89  ASN 89  135 135 ASN ASN B . n 
B 1 90  SER 90  136 136 SER SER B . n 
B 1 91  PRO 91  137 137 PRO PRO B . n 
B 1 92  LEU 92  138 138 LEU LEU B . n 
B 1 93  ARG 93  139 139 ARG ARG B . n 
B 1 94  PRO 94  140 140 PRO PRO B . n 
B 1 95  GLY 95  141 141 GLY GLY B . n 
B 1 96  GLU 96  142 142 GLU GLU B . n 
B 1 97  LYS 97  143 143 LYS LYS B . n 
B 1 98  TYR 98  144 144 TYR TYR B . n 
B 1 99  PRO 99  145 145 PRO PRO B . n 
B 1 100 LEU 100 146 146 LEU LEU B . n 
B 1 101 VAL 101 147 147 VAL VAL B . n 
B 1 102 VAL 102 148 148 VAL VAL B . n 
B 1 103 PHE 103 149 149 PHE PHE B . n 
B 1 104 SER 104 150 150 SER SER B . n 
B 1 105 HIS 105 151 151 HIS HIS B . n 
B 1 106 GLY 106 152 152 GLY GLY B . n 
B 1 107 LEU 107 153 153 LEU LEU B . n 
B 1 108 GLY 108 154 154 GLY GLY B . n 
B 1 109 ALA 109 155 155 ALA ALA B . n 
B 1 110 PHE 110 156 156 PHE PHE B . n 
B 1 111 ARG 111 157 157 ARG ARG B . n 
B 1 112 THR 112 158 158 THR THR B . n 
B 1 113 LEU 113 159 159 LEU LEU B . n 
B 1 114 TYR 114 160 160 TYR TYR B . n 
B 1 115 SER 115 161 161 SER SER B . n 
B 1 116 ALA 116 162 162 ALA ALA B . n 
B 1 117 ILE 117 163 163 ILE ILE B . n 
B 1 118 GLY 118 164 164 GLY GLY B . n 
B 1 119 ILE 119 165 165 ILE ILE B . n 
B 1 120 ASP 120 166 166 ASP ASP B . n 
B 1 121 LEU 121 167 167 LEU LEU B . n 
B 1 122 ALA 122 168 168 ALA ALA B . n 
B 1 123 SER 123 169 169 SER SER B . n 
B 1 124 HIS 124 170 170 HIS HIS B . n 
B 1 125 GLY 125 171 171 GLY GLY B . n 
B 1 126 PHE 126 172 172 PHE PHE B . n 
B 1 127 ILE 127 173 173 ILE ILE B . n 
B 1 128 VAL 128 174 174 VAL VAL B . n 
B 1 129 ALA 129 175 175 ALA ALA B . n 
B 1 130 ALA 130 176 176 ALA ALA B . n 
B 1 131 VAL 131 177 177 VAL VAL B . n 
B 1 132 GLU 132 178 178 GLU GLU B . n 
B 1 133 HIS 133 179 179 HIS HIS B . n 
B 1 134 ARG 134 180 180 ARG ARG B . n 
B 1 135 ASP 135 181 181 ASP ASP B . n 
B 1 136 ARG 136 182 182 ARG ARG B . n 
B 1 137 SER 137 183 183 SER SER B . n 
B 1 138 ALA 138 184 184 ALA ALA B . n 
B 1 139 SER 139 185 185 SER SER B . n 
B 1 140 ALA 140 186 186 ALA ALA B . n 
B 1 141 THR 141 187 187 THR THR B . n 
B 1 142 TYR 142 188 188 TYR TYR B . n 
B 1 143 TYR 143 189 189 TYR TYR B . n 
B 1 144 PHE 144 190 190 PHE PHE B . n 
B 1 145 LYS 145 191 191 LYS LYS B . n 
B 1 146 ASP 146 192 192 ASP ASP B . n 
B 1 147 GLN 147 193 193 GLN GLN B . n 
B 1 148 SER 148 194 194 SER SER B . n 
B 1 149 ALA 149 195 195 ALA ALA B . n 
B 1 150 ALA 150 196 196 ALA ALA B . n 
B 1 151 GLU 151 197 197 GLU GLU B . n 
B 1 152 ILE 152 198 198 ILE ILE B . n 
B 1 153 GLY 153 199 199 GLY GLY B . n 
B 1 154 ASP 154 200 200 ASP ASP B . n 
B 1 155 LYS 155 201 201 LYS LYS B . n 
B 1 156 SER 156 202 202 SER SER B . n 
B 1 157 TRP 157 203 203 TRP TRP B . n 
B 1 158 LEU 158 204 204 LEU LEU B . n 
B 1 159 TYR 159 205 205 TYR TYR B . n 
B 1 160 LEU 160 206 206 LEU LEU B . n 
B 1 161 ARG 161 207 207 ARG ARG B . n 
B 1 162 THR 162 208 208 THR THR B . n 
B 1 163 LEU 163 209 209 LEU LEU B . n 
B 1 164 LYS 164 210 210 LYS LYS B . n 
B 1 165 GLN 165 211 211 GLN GLN B . n 
B 1 166 GLU 166 212 212 GLU GLU B . n 
B 1 167 GLU 167 213 213 GLU GLU B . n 
B 1 168 GLU 168 214 214 GLU GLU B . n 
B 1 169 THR 169 215 215 THR THR B . n 
B 1 170 HIS 170 216 216 HIS HIS B . n 
B 1 171 ILE 171 217 217 ILE ILE B . n 
B 1 172 ARG 172 218 218 ARG ARG B . n 
B 1 173 ASN 173 219 219 ASN ASN B . n 
B 1 174 GLU 174 220 220 GLU GLU B . n 
B 1 175 GLN 175 221 221 GLN GLN B . n 
B 1 176 VAL 176 222 222 VAL VAL B . n 
B 1 177 ARG 177 223 223 ARG ARG B . n 
B 1 178 GLN 178 224 224 GLN GLN B . n 
B 1 179 ARG 179 225 225 ARG ARG B . n 
B 1 180 ALA 180 226 226 ALA ALA B . n 
B 1 181 LYS 181 227 227 LYS LYS B . n 
B 1 182 GLU 182 228 228 GLU GLU B . n 
B 1 183 CYS 183 229 229 CYS CYS B . n 
B 1 184 SER 184 230 230 SER SER B . n 
B 1 185 GLN 185 231 231 GLN GLN B . n 
B 1 186 ALA 186 232 232 ALA ALA B . n 
B 1 187 LEU 187 233 233 LEU LEU B . n 
B 1 188 SER 188 234 234 SER SER B . n 
B 1 189 LEU 189 235 235 LEU LEU B . n 
B 1 190 ILE 190 236 236 ILE ILE B . n 
B 1 191 LEU 191 237 237 LEU LEU B . n 
B 1 192 ASP 192 238 238 ASP ASP B . n 
B 1 193 ILE 193 239 239 ILE ILE B . n 
B 1 194 ASP 194 240 240 ASP ASP B . n 
B 1 195 HIS 195 241 241 HIS HIS B . n 
B 1 196 GLY 196 242 242 GLY GLY B . n 
B 1 197 LYS 197 243 243 LYS LYS B . n 
B 1 198 PRO 198 244 244 PRO PRO B . n 
B 1 199 VAL 199 245 245 VAL VAL B . n 
B 1 200 LYS 200 246 246 LYS LYS B . n 
B 1 201 ASN 201 247 247 ASN ASN B . n 
B 1 202 ALA 202 248 248 ALA ALA B . n 
B 1 203 LEU 203 249 249 LEU LEU B . n 
B 1 204 ASP 204 250 250 ASP ASP B . n 
B 1 205 LEU 205 251 251 LEU LEU B . n 
B 1 206 LYS 206 252 252 LYS LYS B . n 
B 1 207 PHE 207 253 253 PHE PHE B . n 
B 1 208 ASP 208 254 254 ASP ASP B . n 
B 1 209 MET 209 255 255 MET MET B . n 
B 1 210 GLU 210 256 256 GLU GLU B . n 
B 1 211 GLN 211 257 257 GLN GLN B . n 
B 1 212 LEU 212 258 258 LEU LEU B . n 
B 1 213 LYS 213 259 259 LYS LYS B . n 
B 1 214 ASP 214 260 260 ASP ASP B . n 
B 1 215 SER 215 261 261 SER SER B . n 
B 1 216 ILE 216 262 262 ILE ILE B . n 
B 1 217 ASP 217 263 263 ASP ASP B . n 
B 1 218 ARG 218 264 264 ARG ARG B . n 
B 1 219 GLU 219 265 265 GLU GLU B . n 
B 1 220 LYS 220 266 266 LYS LYS B . n 
B 1 221 ILE 221 267 267 ILE ILE B . n 
B 1 222 ALA 222 268 268 ALA ALA B . n 
B 1 223 VAL 223 269 269 VAL VAL B . n 
B 1 224 ILE 224 270 270 ILE ILE B . n 
B 1 225 GLY 225 271 271 GLY GLY B . n 
B 1 226 HIS 226 272 272 HIS HIS B . n 
B 1 227 SER 227 273 273 SER SER B . n 
B 1 228 PHE 228 274 274 PHE PHE B . n 
B 1 229 GLY 229 275 275 GLY GLY B . n 
B 1 230 GLY 230 276 276 GLY GLY B . n 
B 1 231 ALA 231 277 277 ALA ALA B . n 
B 1 232 THR 232 278 278 THR THR B . n 
B 1 233 VAL 233 279 279 VAL VAL B . n 
B 1 234 ILE 234 280 280 ILE ILE B . n 
B 1 235 GLN 235 281 281 GLN GLN B . n 
B 1 236 THR 236 282 282 THR THR B . n 
B 1 237 LEU 237 283 283 LEU LEU B . n 
B 1 238 SER 238 284 284 SER SER B . n 
B 1 239 GLU 239 285 285 GLU GLU B . n 
B 1 240 ASP 240 286 286 ASP ASP B . n 
B 1 241 GLN 241 287 287 GLN GLN B . n 
B 1 242 ARG 242 288 288 ARG ARG B . n 
B 1 243 PHE 243 289 289 PHE PHE B . n 
B 1 244 ARG 244 290 290 ARG ARG B . n 
B 1 245 CYS 245 291 291 CYS CYS B . n 
B 1 246 GLY 246 292 292 GLY GLY B . n 
B 1 247 ILE 247 293 293 ILE ILE B . n 
B 1 248 ALA 248 294 294 ALA ALA B . n 
B 1 249 LEU 249 295 295 LEU LEU B . n 
B 1 250 ASP 250 296 296 ASP ASP B . n 
B 1 251 ALA 251 297 297 ALA ALA B . n 
B 1 252 TRP 252 298 298 TRP TRP B . n 
B 1 253 MET 253 299 299 MET MET B . n 
B 1 254 PHE 254 300 300 PHE PHE B . n 
B 1 255 PRO 255 301 301 PRO PRO B . n 
B 1 256 LEU 256 302 302 LEU LEU B . n 
B 1 257 GLY 257 303 303 GLY GLY B . n 
B 1 258 ASP 258 304 304 ASP ASP B . n 
B 1 259 GLU 259 305 305 GLU GLU B . n 
B 1 260 VAL 260 306 306 VAL VAL B . n 
B 1 261 TYR 261 307 307 TYR TYR B . n 
B 1 262 SER 262 308 308 SER SER B . n 
B 1 263 ARG 263 309 309 ARG ARG B . n 
B 1 264 ILE 264 310 310 ILE ILE B . n 
B 1 265 PRO 265 311 311 PRO PRO B . n 
B 1 266 GLN 266 312 312 GLN GLN B . n 
B 1 267 PRO 267 313 313 PRO PRO B . n 
B 1 268 LEU 268 314 314 LEU LEU B . n 
B 1 269 PHE 269 315 315 PHE PHE B . n 
B 1 270 PHE 270 316 316 PHE PHE B . n 
B 1 271 ILE 271 317 317 ILE ILE B . n 
B 1 272 ASN 272 318 318 ASN ASN B . n 
B 1 273 SER 273 319 319 SER SER B . n 
B 1 274 GLU 274 320 320 GLU GLU B . n 
B 1 275 TYR 275 321 321 TYR TYR B . n 
B 1 276 PHE 276 322 322 PHE PHE B . n 
B 1 277 GLN 277 323 323 GLN GLN B . n 
B 1 278 TYR 278 324 324 TYR TYR B . n 
B 1 279 PRO 279 325 325 PRO PRO B . n 
B 1 280 ALA 280 326 326 ALA ALA B . n 
B 1 281 ASN 281 327 327 ASN ASN B . n 
B 1 282 ILE 282 328 328 ILE ILE B . n 
B 1 283 ILE 283 329 329 ILE ILE B . n 
B 1 284 LYS 284 330 330 LYS LYS B . n 
B 1 285 MET 285 331 331 MET MET B . n 
B 1 286 LYS 286 332 332 LYS LYS B . n 
B 1 287 LYS 287 333 333 LYS LYS B . n 
B 1 288 CYS 288 334 334 CYS CYS B . n 
B 1 289 TYR 289 335 335 TYR TYR B . n 
B 1 290 SER 290 336 336 SER SER B . n 
B 1 291 PRO 291 337 337 PRO PRO B . n 
B 1 292 ASP 292 338 338 ASP ASP B . n 
B 1 293 LYS 293 339 339 LYS LYS B . n 
B 1 294 GLU 294 340 340 GLU GLU B . n 
B 1 295 ARG 295 341 341 ARG ARG B . n 
B 1 296 LYS 296 342 342 LYS LYS B . n 
B 1 297 MET 297 343 343 MET MET B . n 
B 1 298 ILE 298 344 344 ILE ILE B . n 
B 1 299 THR 299 345 345 THR THR B . n 
B 1 300 ILE 300 346 346 ILE ILE B . n 
B 1 301 ARG 301 347 347 ARG ARG B . n 
B 1 302 GLY 302 348 348 GLY GLY B . n 
B 1 303 SER 303 349 349 SER SER B . n 
B 1 304 VAL 304 350 350 VAL VAL B . n 
B 1 305 HIS 305 351 351 HIS HIS B . n 
B 1 306 GLN 306 352 352 GLN GLN B . n 
B 1 307 ASN 307 353 353 ASN ASN B . n 
B 1 308 PHE 308 354 354 PHE PHE B . n 
B 1 309 ALA 309 355 355 ALA ALA B . n 
B 1 310 ASP 310 356 356 ASP ASP B . n 
B 1 311 PHE 311 357 357 PHE PHE B . n 
B 1 312 THR 312 358 358 THR THR B . n 
B 1 313 PHE 313 359 359 PHE PHE B . n 
B 1 314 ALA 314 360 360 ALA ALA B . n 
B 1 315 THR 315 361 361 THR THR B . n 
B 1 316 GLY 316 362 362 GLY GLY B . n 
B 1 317 LYS 317 363 363 LYS LYS B . n 
B 1 318 ILE 318 364 364 ILE ILE B . n 
B 1 319 ILE 319 365 365 ILE ILE B . n 
B 1 320 GLY 320 366 366 GLY GLY B . n 
B 1 321 HIS 321 367 367 HIS HIS B . n 
B 1 322 MET 322 368 368 MET MET B . n 
B 1 323 LEU 323 369 369 LEU LEU B . n 
B 1 324 LYS 324 370 370 LYS LYS B . n 
B 1 325 LEU 325 371 371 LEU LEU B . n 
B 1 326 LYS 326 372 372 LYS LYS B . n 
B 1 327 GLY 327 373 373 GLY GLY B . n 
B 1 328 ASP 328 374 374 ASP ASP B . n 
B 1 329 ILE 329 375 375 ILE ILE B . n 
B 1 330 ASP 330 376 376 ASP ASP B . n 
B 1 331 SER 331 377 377 SER SER B . n 
B 1 332 ASN 332 378 378 ASN ASN B . n 
B 1 333 VAL 333 379 379 VAL VAL B . n 
B 1 334 ALA 334 380 380 ALA ALA B . n 
B 1 335 ILE 335 381 381 ILE ILE B . n 
B 1 336 ASP 336 382 382 ASP ASP B . n 
B 1 337 LEU 337 383 383 LEU LEU B . n 
B 1 338 SER 338 384 384 SER SER B . n 
B 1 339 ASN 339 385 385 ASN ASN B . n 
B 1 340 LYS 340 386 386 LYS LYS B . n 
B 1 341 ALA 341 387 387 ALA ALA B . n 
B 1 342 SER 342 388 388 SER SER B . n 
B 1 343 LEU 343 389 389 LEU LEU B . n 
B 1 344 ALA 344 390 390 ALA ALA B . n 
B 1 345 PHE 345 391 391 PHE PHE B . n 
B 1 346 LEU 346 392 392 LEU LEU B . n 
B 1 347 GLN 347 393 393 GLN GLN B . n 
B 1 348 LYS 348 394 394 LYS LYS B . n 
B 1 349 HIS 349 395 395 HIS HIS B . n 
B 1 350 LEU 350 396 396 LEU LEU B . n 
B 1 351 GLY 351 397 397 GLY GLY B . n 
B 1 352 LEU 352 398 398 LEU LEU B . n 
B 1 353 HIS 353 399 399 HIS HIS B . n 
B 1 354 LYS 354 400 400 LYS LYS B . n 
B 1 355 ASP 355 401 401 ASP ASP B . n 
B 1 356 PHE 356 402 402 PHE PHE B . n 
B 1 357 ASP 357 403 403 ASP ASP B . n 
B 1 358 GLN 358 404 404 GLN GLN B . n 
B 1 359 TRP 359 405 405 TRP TRP B . n 
B 1 360 ASP 360 406 406 ASP ASP B . n 
B 1 361 CYS 361 407 407 CYS CYS B . n 
B 1 362 LEU 362 408 408 LEU LEU B . n 
B 1 363 ILE 363 409 409 ILE ILE B . n 
B 1 364 GLU 364 410 410 GLU GLU B . n 
B 1 365 GLY 365 411 411 GLY GLY B . n 
B 1 366 ASP 366 412 412 ASP ASP B . n 
B 1 367 ASP 367 413 413 ASP ASP B . n 
B 1 368 GLU 368 414 414 GLU GLU B . n 
B 1 369 ASN 369 415 415 ASN ASN B . n 
B 1 370 LEU 370 416 416 LEU LEU B . n 
B 1 371 ILE 371 417 417 ILE ILE B . n 
B 1 372 PRO 372 418 418 PRO PRO B . n 
B 1 373 GLY 373 419 419 GLY GLY B . n 
B 1 374 THR 374 420 420 THR THR B . n 
B 1 375 ASN 375 421 421 ASN ASN B . n 
B 1 376 ILE 376 422 422 ILE ILE B . n 
B 1 377 ASN 377 423 423 ASN ASN B . n 
B 1 378 THR 378 424 424 THR THR B . n 
B 1 379 THR 379 425 425 THR THR B . n 
B 1 380 ASN 380 426 426 ASN ASN B . n 
B 1 381 GLN 381 427 ?   ?   ?   B . n 
B 1 382 HIS 382 428 ?   ?   ?   B . n 
B 1 383 ILE 383 429 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-23 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
StructureStudio 'data collection' .                               ? 1 
MOLREP          phasing           'OF CCP4I'                      ? 2 
REFMAC          refinement        'OF CCP4I FOR FINAL REFINEMENT' ? 3 
HKL-2000        'data reduction'  .                               ? 4 
HKL-2000        'data scaling'    .                               ? 5 
REFMAC          phasing           'OF CCP4I FOR FINAL REFINEMENT' ? 6 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C A HIS 272 ? ? N A SER 273 ? ? 1.619 1.336 0.283 0.023 Y 
2 1 C A SER 273 ? ? N A PHE 274 ? ? 1.619 1.336 0.283 0.023 Y 
3 1 C B HIS 272 ? ? N B SER 273 ? ? 1.637 1.336 0.301 0.023 Y 
4 1 C B SER 273 ? ? N B PHE 274 ? ? 1.635 1.336 0.299 0.023 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 73  ? ? CG A ASP 73  ? ? OD1 A ASP 73  ? ? 124.18 118.30 5.88   0.90 N 
2 1 CA A SER 273 ? ? C  A SER 273 ? ? N   A PHE 274 ? ? 140.55 117.20 23.35  2.20 Y 
3 1 O  A SER 273 ? ? C  A SER 273 ? ? N   A PHE 274 ? ? 95.27  122.70 -27.43 1.60 Y 
4 1 CA B SER 273 ? ? C  B SER 273 ? ? N   B PHE 274 ? ? 133.15 117.20 15.95  2.20 Y 
5 1 O  B SER 273 ? ? C  B SER 273 ? ? N   B PHE 274 ? ? 102.34 122.70 -20.36 1.60 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 92  ? ? -171.51 142.71  
2  1 THR A 113 ? ? -111.23 -148.23 
3  1 PRO A 131 ? ? -68.88  70.42   
4  1 ALA A 155 ? ? -101.60 -163.92 
5  1 LYS A 266 ? ? -114.00 75.42   
6  1 SER A 273 ? ? 68.63   -105.26 
7  1 SER A 336 ? ? -170.78 134.49  
8  1 HIS A 399 ? ? -118.54 59.38   
9  1 LYS A 400 ? ? -121.25 -166.71 
10 1 THR A 424 ? ? -32.35  114.03  
11 1 GLN B 88  ? ? -90.58  -61.98  
12 1 ASN B 90  ? ? -162.07 88.31   
13 1 THR B 113 ? ? -107.98 -167.02 
14 1 HIS B 114 ? ? -109.04 -162.24 
15 1 PRO B 131 ? ? -68.90  65.83   
16 1 LYS B 266 ? ? -106.74 76.10   
17 1 SER B 273 ? ? 79.58   -108.16 
18 1 HIS B 399 ? ? -109.85 64.66   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   THR 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    424 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   THR 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    425 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -130.93 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A HIS 272 ? ? N A SER 273 ? ? 1.62 
2 1 C A SER 273 ? ? N A PHE 274 ? ? 1.62 
3 1 C B HIS 272 ? ? N B SER 273 ? ? 1.64 
4 1 C B SER 273 ? ? N B PHE 274 ? ? 1.63 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 47  ? A ALA 1   
2  1 Y 1 A ALA 48  ? A ALA 2   
3  1 Y 1 A ALA 49  ? A ALA 3   
4  1 Y 1 A SER 50  ? A SER 4   
5  1 Y 1 A PHE 51  ? A PHE 5   
6  1 Y 1 A GLY 52  ? A GLY 6   
7  1 Y 1 A GLN 53  ? A GLN 7   
8  1 Y 1 A ASN 426 ? A ASN 380 
9  1 Y 1 A GLN 427 ? A GLN 381 
10 1 Y 1 A HIS 428 ? A HIS 382 
11 1 Y 1 A ILE 429 ? A ILE 383 
12 1 Y 1 B ALA 47  ? B ALA 1   
13 1 Y 1 B ALA 48  ? B ALA 2   
14 1 Y 1 B ALA 49  ? B ALA 3   
15 1 Y 1 B SER 50  ? B SER 4   
16 1 Y 1 B PHE 51  ? B PHE 5   
17 1 Y 1 B GLY 52  ? B GLY 6   
18 1 Y 1 B GLN 53  ? B GLN 7   
19 1 Y 1 B GLN 427 ? B GLN 381 
20 1 Y 1 B HIS 428 ? B HIS 382 
21 1 Y 1 B ILE 429 ? B ILE 383 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DIISOPROPYL PHOSPHONATE' DFP 
3 water                     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 DFP 1  473 473 DFP DFP A . 
D 2 DFP 1  473 473 DFP DFP B . 
E 3 HOH 1  430 102 HOH HOH A . 
E 3 HOH 2  431 103 HOH HOH A . 
E 3 HOH 3  432 106 HOH HOH A . 
E 3 HOH 4  433 111 HOH HOH A . 
E 3 HOH 5  434 112 HOH HOH A . 
E 3 HOH 6  435 113 HOH HOH A . 
E 3 HOH 7  436 115 HOH HOH A . 
E 3 HOH 8  437 116 HOH HOH A . 
E 3 HOH 9  438 117 HOH HOH A . 
E 3 HOH 10 439 118 HOH HOH A . 
E 3 HOH 11 440 119 HOH HOH A . 
E 3 HOH 12 441 120 HOH HOH A . 
E 3 HOH 13 442 121 HOH HOH A . 
E 3 HOH 14 443 125 HOH HOH A . 
E 3 HOH 15 444 126 HOH HOH A . 
E 3 HOH 16 445 129 HOH HOH A . 
E 3 HOH 17 446 130 HOH HOH A . 
E 3 HOH 18 447 131 HOH HOH A . 
E 3 HOH 19 448 132 HOH HOH A . 
E 3 HOH 20 449 134 HOH HOH A . 
E 3 HOH 21 450 135 HOH HOH A . 
E 3 HOH 22 451 136 HOH HOH A . 
E 3 HOH 23 452 138 HOH HOH A . 
E 3 HOH 24 453 141 HOH HOH A . 
E 3 HOH 25 454 143 HOH HOH A . 
E 3 HOH 26 455 144 HOH HOH A . 
E 3 HOH 27 456 145 HOH HOH A . 
E 3 HOH 28 457 148 HOH HOH A . 
E 3 HOH 29 458 150 HOH HOH A . 
E 3 HOH 30 459 152 HOH HOH A . 
E 3 HOH 31 460 154 HOH HOH A . 
E 3 HOH 32 461 156 HOH HOH A . 
E 3 HOH 33 462 159 HOH HOH A . 
E 3 HOH 34 463 161 HOH HOH A . 
E 3 HOH 35 464 162 HOH HOH A . 
E 3 HOH 36 465 164 HOH HOH A . 
E 3 HOH 37 466 165 HOH HOH A . 
E 3 HOH 38 467 166 HOH HOH A . 
E 3 HOH 39 468 168 HOH HOH A . 
E 3 HOH 40 469 172 HOH HOH A . 
E 3 HOH 41 470 174 HOH HOH A . 
E 3 HOH 42 471 176 HOH HOH A . 
E 3 HOH 43 472 178 HOH HOH A . 
E 3 HOH 44 474 179 HOH HOH A . 
E 3 HOH 45 475 182 HOH HOH A . 
E 3 HOH 46 476 183 HOH HOH A . 
E 3 HOH 47 477 185 HOH HOH A . 
E 3 HOH 48 478 187 HOH HOH A . 
E 3 HOH 49 479 191 HOH HOH A . 
E 3 HOH 50 480 192 HOH HOH A . 
E 3 HOH 51 481 193 HOH HOH A . 
E 3 HOH 52 482 194 HOH HOH A . 
E 3 HOH 53 483 195 HOH HOH A . 
E 3 HOH 54 484 196 HOH HOH A . 
E 3 HOH 55 485 197 HOH HOH A . 
E 3 HOH 56 486 200 HOH HOH A . 
E 3 HOH 57 487 202 HOH HOH A . 
E 3 HOH 58 488 204 HOH HOH A . 
E 3 HOH 59 489 205 HOH HOH A . 
E 3 HOH 60 490 206 HOH HOH A . 
E 3 HOH 61 491 208 HOH HOH A . 
E 3 HOH 62 492 209 HOH HOH A . 
E 3 HOH 63 493 210 HOH HOH A . 
E 3 HOH 64 494 211 HOH HOH A . 
E 3 HOH 65 495 214 HOH HOH A . 
E 3 HOH 66 496 215 HOH HOH A . 
E 3 HOH 67 497 219 HOH HOH A . 
E 3 HOH 68 498 222 HOH HOH A . 
E 3 HOH 69 499 224 HOH HOH A . 
E 3 HOH 70 500 225 HOH HOH A . 
E 3 HOH 71 501 228 HOH HOH A . 
E 3 HOH 72 502 231 HOH HOH A . 
E 3 HOH 73 503 232 HOH HOH A . 
E 3 HOH 74 504 233 HOH HOH A . 
E 3 HOH 75 505 234 HOH HOH A . 
E 3 HOH 76 506 235 HOH HOH A . 
E 3 HOH 77 507 237 HOH HOH A . 
E 3 HOH 78 508 240 HOH HOH A . 
E 3 HOH 79 509 241 HOH HOH A . 
E 3 HOH 80 510 242 HOH HOH A . 
E 3 HOH 81 511 246 HOH HOH A . 
E 3 HOH 82 512 247 HOH HOH A . 
E 3 HOH 83 513 248 HOH HOH A . 
E 3 HOH 84 514 249 HOH HOH A . 
E 3 HOH 85 515 253 HOH HOH A . 
E 3 HOH 86 516 254 HOH HOH A . 
E 3 HOH 87 517 255 HOH HOH A . 
E 3 HOH 88 518 256 HOH HOH A . 
E 3 HOH 89 519 257 HOH HOH A . 
E 3 HOH 90 520 258 HOH HOH A . 
E 3 HOH 91 521 259 HOH HOH A . 
E 3 HOH 92 522 262 HOH HOH A . 
E 3 HOH 93 523 264 HOH HOH A . 
E 3 HOH 94 524 265 HOH HOH A . 
E 3 HOH 95 525 267 HOH HOH A . 
E 3 HOH 96 526 268 HOH HOH A . 
F 3 HOH 1  430 101 HOH HOH B . 
F 3 HOH 2  431 104 HOH HOH B . 
F 3 HOH 3  432 105 HOH HOH B . 
F 3 HOH 4  433 107 HOH HOH B . 
F 3 HOH 5  434 108 HOH HOH B . 
F 3 HOH 6  435 109 HOH HOH B . 
F 3 HOH 7  436 110 HOH HOH B . 
F 3 HOH 8  437 114 HOH HOH B . 
F 3 HOH 9  438 122 HOH HOH B . 
F 3 HOH 10 439 123 HOH HOH B . 
F 3 HOH 11 440 124 HOH HOH B . 
F 3 HOH 12 441 127 HOH HOH B . 
F 3 HOH 13 442 128 HOH HOH B . 
F 3 HOH 14 443 133 HOH HOH B . 
F 3 HOH 15 444 137 HOH HOH B . 
F 3 HOH 16 445 139 HOH HOH B . 
F 3 HOH 17 446 140 HOH HOH B . 
F 3 HOH 18 447 142 HOH HOH B . 
F 3 HOH 19 448 146 HOH HOH B . 
F 3 HOH 20 449 147 HOH HOH B . 
F 3 HOH 21 450 149 HOH HOH B . 
F 3 HOH 22 451 151 HOH HOH B . 
F 3 HOH 23 452 153 HOH HOH B . 
F 3 HOH 24 453 155 HOH HOH B . 
F 3 HOH 25 454 157 HOH HOH B . 
F 3 HOH 26 455 158 HOH HOH B . 
F 3 HOH 27 456 160 HOH HOH B . 
F 3 HOH 28 457 163 HOH HOH B . 
F 3 HOH 29 458 167 HOH HOH B . 
F 3 HOH 30 459 169 HOH HOH B . 
F 3 HOH 31 460 170 HOH HOH B . 
F 3 HOH 32 461 171 HOH HOH B . 
F 3 HOH 33 462 173 HOH HOH B . 
F 3 HOH 34 463 175 HOH HOH B . 
F 3 HOH 35 464 177 HOH HOH B . 
F 3 HOH 36 465 180 HOH HOH B . 
F 3 HOH 37 466 181 HOH HOH B . 
F 3 HOH 38 467 184 HOH HOH B . 
F 3 HOH 39 468 186 HOH HOH B . 
F 3 HOH 40 469 188 HOH HOH B . 
F 3 HOH 41 470 189 HOH HOH B . 
F 3 HOH 42 471 190 HOH HOH B . 
F 3 HOH 43 472 198 HOH HOH B . 
F 3 HOH 44 474 199 HOH HOH B . 
F 3 HOH 45 475 201 HOH HOH B . 
F 3 HOH 46 476 203 HOH HOH B . 
F 3 HOH 47 477 207 HOH HOH B . 
F 3 HOH 48 478 212 HOH HOH B . 
F 3 HOH 49 479 213 HOH HOH B . 
F 3 HOH 50 480 216 HOH HOH B . 
F 3 HOH 51 481 217 HOH HOH B . 
F 3 HOH 52 482 218 HOH HOH B . 
F 3 HOH 53 483 220 HOH HOH B . 
F 3 HOH 54 484 221 HOH HOH B . 
F 3 HOH 55 485 223 HOH HOH B . 
F 3 HOH 56 486 226 HOH HOH B . 
F 3 HOH 57 487 227 HOH HOH B . 
F 3 HOH 58 488 229 HOH HOH B . 
F 3 HOH 59 489 230 HOH HOH B . 
F 3 HOH 60 490 236 HOH HOH B . 
F 3 HOH 61 491 238 HOH HOH B . 
F 3 HOH 62 492 239 HOH HOH B . 
F 3 HOH 63 493 243 HOH HOH B . 
F 3 HOH 64 494 244 HOH HOH B . 
F 3 HOH 65 495 245 HOH HOH B . 
F 3 HOH 66 496 250 HOH HOH B . 
F 3 HOH 67 497 251 HOH HOH B . 
F 3 HOH 68 498 252 HOH HOH B . 
F 3 HOH 69 499 260 HOH HOH B . 
F 3 HOH 70 500 261 HOH HOH B . 
F 3 HOH 71 501 263 HOH HOH B . 
F 3 HOH 72 502 266 HOH HOH B . 
F 3 HOH 73 503 269 HOH HOH B . 
F 3 HOH 74 504 270 HOH HOH B . 
#