data_3FIA
# 
_entry.id   3FIA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3FIA         
RCSB  RCSB050625   
WWPDB D_1000050625 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          HR3646e 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3FIA 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vorobiev, S.M.'                                  1  
'Chen, Y.'                                        2  
'Seetharaman, J.'                                 3  
'Devices, C.'                                     4  
'Zhao, L.'                                        5  
'Foote, E.L.'                                     6  
'Ciccosanti, C.'                                  7  
'Mao, L.'                                         8  
'Xiao, R.'                                        9  
'Acton, T.B.'                                     10 
'Montelione, G.T.'                                11 
'Hunt, J.F.'                                      12 
'Tong, L.'                                        13 
'Northeast Structural Genomics Consortium (NESG)' 14 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the EH 1 domain from human intersectin-1 protein.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vorobiev, S.M.'   1  
primary 'Chen, Y.'         2  
primary 'Seetharaman, J.'  3  
primary 'Devices, C.'      4  
primary 'Zhao, L.'         5  
primary 'Foote, E.L.'      6  
primary 'Ciccosanti, C.'   7  
primary 'Mao, L.'          8  
primary 'Xiao, R.'         9  
primary 'Acton, T.B.'      10 
primary 'Montelione, G.T.' 11 
primary 'Hunt, J.F.'       12 
primary 'Tong, L.'         13 
# 
_cell.entry_id           3FIA 
_cell.length_a           94.848 
_cell.length_b           32.021 
_cell.length_c           33.287 
_cell.angle_alpha        90.00 
_cell.angle_beta         106.45 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3FIA 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Intersectin-1 13816.960 1   ? 'M1V, I14T' 'residues 1-111' ? 
2 non-polymer syn 'CALCIUM ION' 40.078    1   ? ?           ?                ? 
3 non-polymer syn 'SULFATE ION' 96.063    1   ? ?           ?                ? 
4 water       nat water         18.015    133 ? ?           ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SH3 domain-containing protein 1A, SH3P17' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)GHHHHHHSHVAQFPTPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALAD
(MSE)NNDGR(MSE)DQVEFSIA(MSE)KLIKLKLQGYQLPSALPPV(MSE)KQQPVAISS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHSHVAQFPTPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNND
GRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         HR3646e 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   GLY n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   SER n 
1 10  HIS n 
1 11  VAL n 
1 12  ALA n 
1 13  GLN n 
1 14  PHE n 
1 15  PRO n 
1 16  THR n 
1 17  PRO n 
1 18  PHE n 
1 19  GLY n 
1 20  GLY n 
1 21  SER n 
1 22  LEU n 
1 23  ASP n 
1 24  THR n 
1 25  TRP n 
1 26  ALA n 
1 27  ILE n 
1 28  THR n 
1 29  VAL n 
1 30  GLU n 
1 31  GLU n 
1 32  ARG n 
1 33  ALA n 
1 34  LYS n 
1 35  HIS n 
1 36  ASP n 
1 37  GLN n 
1 38  GLN n 
1 39  PHE n 
1 40  HIS n 
1 41  SER n 
1 42  LEU n 
1 43  LYS n 
1 44  PRO n 
1 45  ILE n 
1 46  SER n 
1 47  GLY n 
1 48  PHE n 
1 49  ILE n 
1 50  THR n 
1 51  GLY n 
1 52  ASP n 
1 53  GLN n 
1 54  ALA n 
1 55  ARG n 
1 56  ASN n 
1 57  PHE n 
1 58  PHE n 
1 59  PHE n 
1 60  GLN n 
1 61  SER n 
1 62  GLY n 
1 63  LEU n 
1 64  PRO n 
1 65  GLN n 
1 66  PRO n 
1 67  VAL n 
1 68  LEU n 
1 69  ALA n 
1 70  GLN n 
1 71  ILE n 
1 72  TRP n 
1 73  ALA n 
1 74  LEU n 
1 75  ALA n 
1 76  ASP n 
1 77  MSE n 
1 78  ASN n 
1 79  ASN n 
1 80  ASP n 
1 81  GLY n 
1 82  ARG n 
1 83  MSE n 
1 84  ASP n 
1 85  GLN n 
1 86  VAL n 
1 87  GLU n 
1 88  PHE n 
1 89  SER n 
1 90  ILE n 
1 91  ALA n 
1 92  MSE n 
1 93  LYS n 
1 94  LEU n 
1 95  ILE n 
1 96  LYS n 
1 97  LEU n 
1 98  LYS n 
1 99  LEU n 
1 100 GLN n 
1 101 GLY n 
1 102 TYR n 
1 103 GLN n 
1 104 LEU n 
1 105 PRO n 
1 106 SER n 
1 107 ALA n 
1 108 LEU n 
1 109 PRO n 
1 110 PRO n 
1 111 VAL n 
1 112 MSE n 
1 113 LYS n 
1 114 GLN n 
1 115 GLN n 
1 116 PRO n 
1 117 VAL n 
1 118 ALA n 
1 119 ILE n 
1 120 SER n 
1 121 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ITSN, ITSN1, SH3D1A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) +Magic' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET 14-15c' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITSN1_HUMAN 
_struct_ref.pdbx_db_accession          Q15811 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSI
AMKLIKLKLQGYQLPSALPPVMKQQPVAISS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3FIA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 11 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 121 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15811 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  111 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       111 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3FIA MSE A 1  ? UNP Q15811 ?   ?  'expression tag' -9 1  
1 3FIA GLY A 2  ? UNP Q15811 ?   ?  'expression tag' -8 2  
1 3FIA HIS A 3  ? UNP Q15811 ?   ?  'expression tag' -7 3  
1 3FIA HIS A 4  ? UNP Q15811 ?   ?  'expression tag' -6 4  
1 3FIA HIS A 5  ? UNP Q15811 ?   ?  'expression tag' -5 5  
1 3FIA HIS A 6  ? UNP Q15811 ?   ?  'expression tag' -4 6  
1 3FIA HIS A 7  ? UNP Q15811 ?   ?  'expression tag' -3 7  
1 3FIA HIS A 8  ? UNP Q15811 ?   ?  'expression tag' -2 8  
1 3FIA SER A 9  ? UNP Q15811 ?   ?  'expression tag' -1 9  
1 3FIA HIS A 10 ? UNP Q15811 ?   ?  'expression tag' 0  10 
1 3FIA VAL A 11 ? UNP Q15811 MET 1  engineered       1  11 
1 3FIA THR A 24 ? UNP Q15811 ILE 14 engineered       14 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'    ? 'Ca 2'           40.078  
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'    ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3FIA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.75 
_exptl_crystal.density_percent_sol   29.89 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'microbatch under oil' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'1.5M ammonium sulfate, 12% glycerol, 0.1M TrisHCl, pH 8.5, microbatch under oil , temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2008-12-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97869 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97869 
# 
_reflns.entry_id                     3FIA 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.45 
_reflns.number_obs                   31879 
_reflns.number_all                   33173 
_reflns.percent_possible_obs         96.1 
_reflns.pdbx_Rmerge_I_obs            0.040 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        33.75 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.45 
_reflns_shell.d_res_low              1.50 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.222 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.9 
_reflns_shell.pdbx_redundancy        3.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3311 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3FIA 
_refine.ls_number_reflns_obs                     16237 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.50 
_refine.ls_d_res_high                            1.45 
_refine.ls_percent_reflns_obs                    99.63 
_refine.ls_R_factor_obs                          0.16047 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.15963 
_refine.ls_R_factor_R_free                       0.17643 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  866 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.960 
_refine.B_iso_mean                               17.003 
_refine.aniso_B[1][1]                            -0.34 
_refine.aniso_B[2][2]                            0.44 
_refine.aniso_B[3][3]                            -0.07 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.04 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.080 
_refine.pdbx_overall_ESU_R_Free                  0.062 
_refine.overall_SU_ML                            0.027 
_refine.overall_SU_B                             1.427 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        778 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             133 
_refine_hist.number_atoms_total               917 
_refine_hist.d_res_high                       1.45 
_refine_hist.d_res_low                        45.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 804  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.831  1.963  ? 1091 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.142  5.000  ? 99   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.613 25.000 ? 36   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.597 15.000 ? 136  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       9.558  15.000 ? 3    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.065  0.200  ? 116  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.015  0.020  ? 616  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.237  0.200  ? 396  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.321  0.200  ? 581  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.152  0.200  ? 74   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.064  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.183  0.200  ? 48   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.194  0.200  ? 25   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.699  1.500  ? 506  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.364  2.000  ? 799  'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.506  3.000  ? 315  'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.253  4.500  ? 292  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           2.895  3.000  ? 821  'X-RAY DIFFRACTION' ? 
r_sphericity_free            10.275 3.000  ? 134  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          6.239  3.000  ? 784  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.451 
_refine_ls_shell.d_res_low                        1.489 
_refine_ls_shell.number_reflns_R_work             1155 
_refine_ls_shell.R_factor_R_work                  0.139 
_refine_ls_shell.percent_reflns_obs               97.75 
_refine_ls_shell.R_factor_R_free                  0.202 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             61 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3FIA 
_struct.title                     
'Crystal structure of the EH 1 domain from human intersectin-1 protein. Northeast Structural Genomics Consortium target HR3646e.' 
_struct.pdbx_descriptor           Intersectin-1 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FIA 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;Intersectin-1; EH 1 domain; NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Alternative splicing, Calcium, Cell junction, Cell projection, Coiled coil, Endocytosis, Membrane, Phosphoprotein, SH3 domain, Synapse, Synaptosome, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'monomer according to aggregation screening' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 28  ? LEU A 42  ? THR A 18 LEU A 32  1 ? 15 
HELX_P HELX_P2 2 GLY A 51  ? PHE A 59  ? GLY A 41 PHE A 49  1 ? 9  
HELX_P HELX_P3 3 GLN A 60  ? GLY A 62  ? GLN A 50 GLY A 52  5 ? 3  
HELX_P HELX_P4 4 PRO A 64  ? ASP A 76  ? PRO A 54 ASP A 66  1 ? 13 
HELX_P HELX_P5 5 ASP A 84  ? GLN A 100 ? ASP A 74 GLN A 90  1 ? 17 
HELX_P HELX_P6 6 PRO A 109 ? LYS A 113 ? PRO A 99 LYS A 103 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ASP 76  C   ? ? ? 1_555 A MSE 77  N  ? ? A ASP 66  A MSE 67  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2 covale ? ? A MSE 77  C   ? ? ? 1_555 A ASN 78  N  ? ? A MSE 67  A ASN 68  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3 covale ? ? A ARG 82  C   ? ? ? 1_555 A MSE 83  N  ? ? A ARG 72  A MSE 73  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale4 covale ? ? A MSE 83  C   ? ? ? 1_555 A ASP 84  N  ? ? A MSE 73  A ASP 74  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale5 covale ? ? A ALA 91  C   ? ? ? 1_555 A MSE 92  N  ? ? A ALA 81  A MSE 82  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale6 covale ? ? A MSE 92  C   ? ? ? 1_555 A LYS 93  N  ? ? A MSE 82  A LYS 83  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale7 covale ? ? A VAL 111 C   ? ? ? 1_555 A MSE 112 N  ? ? A VAL 101 A MSE 102 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale8 covale ? ? A MSE 112 C   ? ? ? 1_555 A LYS 113 N  ? ? A MSE 102 A LYS 103 1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc1 metalc ? ? A ASP 76  OD1 ? ? ? 1_555 B CA  .   CA ? ? A ASP 66  A CA  201 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc2 metalc ? ? A ASN 78  OD1 ? ? ? 1_555 B CA  .   CA ? ? A ASN 68  A CA  201 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc3 metalc ? ? A ASP 80  OD1 ? ? ? 1_555 B CA  .   CA ? ? A ASP 70  A CA  201 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc4 metalc ? ? A ARG 82  O   ? ? ? 1_555 B CA  .   CA ? ? A ARG 72  A CA  201 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc5 metalc ? ? A GLU 87  OE1 ? ? ? 1_555 B CA  .   CA ? ? A GLU 77  A CA  201 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc6 metalc ? ? A GLU 87  OE2 ? ? ? 1_555 B CA  .   CA ? ? A GLU 77  A CA  201 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc7 metalc ? ? B CA  .   CA  ? ? ? 1_555 D HOH .   O  ? ? A CA  201 A HOH 403 1_555 ? ? ? ? ? ? ? 2.406 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 49 ? THR A 50 ? ILE A 39 THR A 40 
A 2 ARG A 82 ? MSE A 83 ? ARG A 72 MSE A 73 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    49 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     39 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   MSE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    83 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    MSE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     73 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 201'  
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 76  ? ASP A 66  . ? 1_555 ? 
2  AC1 6 ASN A 78  ? ASN A 68  . ? 1_555 ? 
3  AC1 6 ASP A 80  ? ASP A 70  . ? 1_555 ? 
4  AC1 6 ARG A 82  ? ARG A 72  . ? 1_555 ? 
5  AC1 6 GLU A 87  ? GLU A 77  . ? 1_555 ? 
6  AC1 6 HOH D .   ? HOH A 403 . ? 1_555 ? 
7  AC2 8 GLU A 31  ? GLU A 21  . ? 1_555 ? 
8  AC2 8 LYS A 96  ? LYS A 86  . ? 1_555 ? 
9  AC2 8 GLN A 100 ? GLN A 90  . ? 1_555 ? 
10 AC2 8 PRO A 105 ? PRO A 95  . ? 4_556 ? 
11 AC2 8 SER A 106 ? SER A 96  . ? 4_556 ? 
12 AC2 8 HOH D .   ? HOH A 465 . ? 1_555 ? 
13 AC2 8 HOH D .   ? HOH A 485 . ? 4_556 ? 
14 AC2 8 HOH D .   ? HOH A 503 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3FIA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3FIA 
_atom_sites.fract_transf_matrix[1][1]   0.010543 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003113 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.031230 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.031324 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . THR A 1 16  ? 15.234 14.939 8.082  1.00 31.38 ? 6   THR A N   1 
ATOM   2   C  CA  . THR A 1 16  ? 15.487 14.155 6.838  1.00 30.26 ? 6   THR A CA  1 
ATOM   3   C  C   . THR A 1 16  ? 14.319 13.218 6.543  1.00 26.71 ? 6   THR A C   1 
ATOM   4   O  O   . THR A 1 16  ? 13.507 12.943 7.423  1.00 27.59 ? 6   THR A O   1 
ATOM   5   C  CB  . THR A 1 16  ? 16.784 13.364 6.967  1.00 32.07 ? 6   THR A CB  1 
ATOM   6   N  N   . PRO A 1 17  ? 14.259 12.694 5.307  1.00 27.18 ? 7   PRO A N   1 
ATOM   7   C  CA  . PRO A 1 17  ? 13.325 11.631 4.939  1.00 25.35 ? 7   PRO A CA  1 
ATOM   8   C  C   . PRO A 1 17  ? 13.567 10.318 5.691  1.00 24.05 ? 7   PRO A C   1 
ATOM   9   O  O   . PRO A 1 17  ? 12.648 9.509  5.805  1.00 26.41 ? 7   PRO A O   1 
ATOM   10  C  CB  . PRO A 1 17  ? 13.572 11.437 3.436  1.00 26.88 ? 7   PRO A CB  1 
ATOM   11  C  CG  . PRO A 1 17  ? 14.829 12.188 3.122  1.00 27.07 ? 7   PRO A CG  1 
ATOM   12  C  CD  . PRO A 1 17  ? 14.945 13.265 4.138  1.00 27.48 ? 7   PRO A CD  1 
ATOM   13  N  N   . PHE A 1 18  ? 14.749 10.181 6.292  1.00 20.08 ? 8   PHE A N   1 
ATOM   14  C  CA  . PHE A 1 18  ? 15.218 8.916  6.874  1.00 16.66 ? 8   PHE A CA  1 
ATOM   15  C  C   . PHE A 1 18  ? 15.222 8.960  8.397  1.00 19.53 ? 8   PHE A C   1 
ATOM   16  O  O   . PHE A 1 18  ? 15.781 8.084  9.048  1.00 18.82 ? 8   PHE A O   1 
ATOM   17  C  CB  . PHE A 1 18  ? 16.639 8.598  6.379  1.00 13.48 ? 8   PHE A CB  1 
ATOM   18  C  CG  . PHE A 1 18  ? 16.728 8.426  4.896  1.00 11.19 ? 8   PHE A CG  1 
ATOM   19  C  CD1 . PHE A 1 18  ? 16.301 7.243  4.306  1.00 11.26 ? 8   PHE A CD1 1 
ATOM   20  C  CD2 . PHE A 1 18  ? 17.112 9.476  4.085  1.00 12.26 ? 8   PHE A CD2 1 
ATOM   21  C  CE1 . PHE A 1 18  ? 16.234 7.116  2.930  1.00 11.51 ? 8   PHE A CE1 1 
ATOM   22  C  CE2 . PHE A 1 18  ? 17.109 9.337  2.701  1.00 12.30 ? 8   PHE A CE2 1 
ATOM   23  C  CZ  . PHE A 1 18  ? 16.639 8.159  2.124  1.00 11.76 ? 8   PHE A CZ  1 
ATOM   24  N  N   . GLY A 1 19  ? 14.667 10.031 8.954  1.00 20.68 ? 9   GLY A N   1 
ATOM   25  C  CA  . GLY A 1 19  ? 14.643 10.206 10.400 1.00 21.70 ? 9   GLY A CA  1 
ATOM   26  C  C   . GLY A 1 19  ? 15.971 10.685 10.950 1.00 21.93 ? 9   GLY A C   1 
ATOM   27  O  O   . GLY A 1 19  ? 16.165 10.709 12.169 1.00 23.53 ? 9   GLY A O   1 
ATOM   28  N  N   . GLY A 1 20  ? 16.851 11.143 10.060 1.00 19.94 ? 10  GLY A N   1 
ATOM   29  C  CA  . GLY A 1 20  ? 18.134 11.721 10.458 1.00 19.61 ? 10  GLY A CA  1 
ATOM   30  C  C   . GLY A 1 20  ? 19.182 11.588 9.368  1.00 17.50 ? 10  GLY A C   1 
ATOM   31  O  O   . GLY A 1 20  ? 18.951 10.935 8.352  1.00 19.45 ? 10  GLY A O   1 
ATOM   32  N  N   . SER A 1 21  ? 20.308 12.268 9.553  1.00 17.24 ? 11  SER A N   1 
ATOM   33  C  CA  . SER A 1 21  ? 21.421 12.220 8.612  1.00 15.81 ? 11  SER A CA  1 
ATOM   34  C  C   . SER A 1 21  ? 22.663 11.632 9.276  1.00 15.61 ? 11  SER A C   1 
ATOM   35  O  O   . SER A 1 21  ? 22.661 11.335 10.468 1.00 14.25 ? 11  SER A O   1 
ATOM   36  C  CB  . SER A 1 21  ? 21.750 13.626 8.106  1.00 17.98 ? 11  SER A CB  1 
ATOM   37  O  OG  . SER A 1 21  ? 22.508 14.337 9.080  1.00 18.66 ? 11  SER A OG  1 
ATOM   38  N  N   . LEU A 1 22  ? 23.758 11.579 8.529  1.00 14.00 ? 12  LEU A N   1 
ATOM   39  C  CA  . LEU A 1 22  ? 25.040 11.193 9.101  1.00 13.17 ? 12  LEU A CA  1 
ATOM   40  C  C   . LEU A 1 22  ? 25.457 12.104 10.252 1.00 13.12 ? 12  LEU A C   1 
ATOM   41  O  O   . LEU A 1 22  ? 26.288 11.722 11.079 1.00 15.50 ? 12  LEU A O   1 
ATOM   42  C  CB  . LEU A 1 22  ? 26.117 11.213 8.021  1.00 13.50 ? 12  LEU A CB  1 
ATOM   43  C  CG  . LEU A 1 22  ? 26.059 10.071 7.015  1.00 15.11 ? 12  LEU A CG  1 
ATOM   44  C  CD1 . LEU A 1 22  ? 26.982 10.374 5.851  1.00 18.10 ? 12  LEU A CD1 1 
ATOM   45  C  CD2 . LEU A 1 22  ? 26.438 8.770  7.693  1.00 19.20 ? 12  LEU A CD2 1 
ATOM   46  N  N   . ASP A 1 23  ? 24.933 13.327 10.271 1.00 12.73 ? 13  ASP A N   1 
ATOM   47  C  CA  . ASP A 1 23  ? 25.371 14.314 11.248 1.00 13.36 ? 13  ASP A CA  1 
ATOM   48  C  C   . ASP A 1 23  ? 24.381 14.542 12.382 1.00 13.07 ? 13  ASP A C   1 
ATOM   49  O  O   . ASP A 1 23  ? 24.679 15.288 13.313 1.00 15.32 ? 13  ASP A O   1 
ATOM   50  C  CB  . ASP A 1 23  ? 25.696 15.631 10.549 1.00 13.57 ? 13  ASP A CB  1 
ATOM   51  C  CG  . ASP A 1 23  ? 26.898 15.515 9.623  1.00 13.37 ? 13  ASP A CG  1 
ATOM   52  O  OD1 . ASP A 1 23  ? 27.907 14.931 10.067 1.00 18.93 ? 13  ASP A OD1 1 
ATOM   53  O  OD2 . ASP A 1 23  ? 26.803 15.906 8.440  1.00 14.77 ? 13  ASP A OD2 1 
ATOM   54  N  N   . THR A 1 24  ? 23.222 13.885 12.337 1.00 10.91 ? 14  THR A N   1 
ATOM   55  C  CA  . THR A 1 24  ? 22.195 14.147 13.341 1.00 12.08 ? 14  THR A CA  1 
ATOM   56  C  C   . THR A 1 24  ? 22.688 13.826 14.752 1.00 12.39 ? 14  THR A C   1 
ATOM   57  O  O   . THR A 1 24  ? 22.587 14.659 15.657 1.00 15.36 ? 14  THR A O   1 
ATOM   58  C  CB  . THR A 1 24  ? 20.902 13.373 13.045 1.00 11.58 ? 14  THR A CB  1 
ATOM   59  O  OG1 . THR A 1 24  ? 20.429 13.738 11.743 1.00 14.87 ? 14  THR A OG1 1 
ATOM   60  C  CG2 . THR A 1 24  ? 19.828 13.690 14.096 1.00 12.78 ? 14  THR A CG2 1 
ATOM   61  N  N   . TRP A 1 25  ? 23.178 12.606 14.951 1.00 14.43 ? 15  TRP A N   1 
ATOM   62  C  CA  . TRP A 1 25  ? 23.478 12.125 16.300 1.00 15.64 ? 15  TRP A CA  1 
ATOM   63  C  C   . TRP A 1 25  ? 24.960 12.140 16.632 1.00 18.32 ? 15  TRP A C   1 
ATOM   64  O  O   . TRP A 1 25  ? 25.348 11.875 17.761 1.00 22.57 ? 15  TRP A O   1 
ATOM   65  C  CB  . TRP A 1 25  ? 22.925 10.720 16.519 1.00 17.83 ? 15  TRP A CB  1 
ATOM   66  C  CG  . TRP A 1 25  ? 21.460 10.624 16.328 1.00 16.20 ? 15  TRP A CG  1 
ATOM   67  C  CD1 . TRP A 1 25  ? 20.483 11.037 17.193 1.00 15.83 ? 15  TRP A CD1 1 
ATOM   68  C  CD2 . TRP A 1 25  ? 20.789 10.118 15.177 1.00 14.78 ? 15  TRP A CD2 1 
ATOM   69  N  NE1 . TRP A 1 25  ? 19.249 10.791 16.655 1.00 17.90 ? 15  TRP A NE1 1 
ATOM   70  C  CE2 . TRP A 1 25  ? 19.409 10.241 15.409 1.00 15.58 ? 15  TRP A CE2 1 
ATOM   71  C  CE3 . TRP A 1 25  ? 21.224 9.582  13.959 1.00 17.64 ? 15  TRP A CE3 1 
ATOM   72  C  CZ2 . TRP A 1 25  ? 18.458 9.883  14.457 1.00 21.35 ? 15  TRP A CZ2 1 
ATOM   73  C  CZ3 . TRP A 1 25  ? 20.281 9.204  13.027 1.00 23.58 ? 15  TRP A CZ3 1 
ATOM   74  C  CH2 . TRP A 1 25  ? 18.913 9.325  13.291 1.00 20.71 ? 15  TRP A CH2 1 
ATOM   75  N  N   . ALA A 1 26  ? 25.794 12.344 15.624 1.00 16.37 ? 16  ALA A N   1 
ATOM   76  C  CA  . ALA A 1 26  ? 27.223 12.473 15.863 1.00 17.35 ? 16  ALA A CA  1 
ATOM   77  C  C   . ALA A 1 26  ? 27.543 13.813 16.512 1.00 19.14 ? 16  ALA A C   1 
ATOM   78  O  O   . ALA A 1 26  ? 26.878 14.820 16.259 1.00 20.08 ? 16  ALA A O   1 
ATOM   79  C  CB  . ALA A 1 26  ? 27.984 12.309 14.568 1.00 18.07 ? 16  ALA A CB  1 
ATOM   80  N  N   . ILE A 1 27  ? 28.540 13.808 17.388 1.00 15.03 ? 17  ILE A N   1 
ATOM   81  C  CA  . ILE A 1 27  ? 29.004 15.028 18.024 1.00 15.08 ? 17  ILE A CA  1 
ATOM   82  C  C   . ILE A 1 27  ? 30.308 15.475 17.377 1.00 16.54 ? 17  ILE A C   1 
ATOM   83  O  O   . ILE A 1 27  ? 31.280 14.724 17.325 1.00 17.38 ? 17  ILE A O   1 
ATOM   84  C  CB  . ILE A 1 27  ? 29.191 14.819 19.539 1.00 14.55 ? 17  ILE A CB  1 
ATOM   85  C  CG1 . ILE A 1 27  ? 27.854 14.394 20.160 1.00 14.77 ? 17  ILE A CG1 1 
ATOM   86  C  CG2 . ILE A 1 27  ? 29.724 16.080 20.180 1.00 16.31 ? 17  ILE A CG2 1 
ATOM   87  C  CD1 . ILE A 1 27  ? 27.944 13.900 21.588 1.00 15.77 ? 17  ILE A CD1 1 
ATOM   88  N  N   . THR A 1 28  ? 30.300 16.683 16.831 1.00 14.88 ? 18  THR A N   1 
ATOM   89  C  CA  . THR A 1 28  ? 31.457 17.164 16.088 1.00 16.35 ? 18  THR A CA  1 
ATOM   90  C  C   . THR A 1 28  ? 32.556 17.606 17.046 1.00 15.70 ? 18  THR A C   1 
ATOM   91  O  O   . THR A 1 28  ? 32.316 17.780 18.241 1.00 16.16 ? 18  THR A O   1 
ATOM   92  C  CB  . THR A 1 28  ? 31.102 18.348 15.173 1.00 16.70 ? 18  THR A CB  1 
ATOM   93  O  OG1 . THR A 1 28  ? 30.725 19.476 15.970 1.00 18.51 ? 18  THR A OG1 1 
ATOM   94  C  CG2 . THR A 1 28  ? 29.973 17.983 14.212 1.00 18.22 ? 18  THR A CG2 1 
ATOM   95  N  N   . VAL A 1 29  ? 33.751 17.834 16.514 1.00 17.27 ? 19  VAL A N   1 
ATOM   96  C  CA  . VAL A 1 29  ? 34.846 18.359 17.314 1.00 17.07 ? 19  VAL A CA  1 
ATOM   97  C  C   . VAL A 1 29  ? 34.481 19.723 17.892 1.00 16.66 ? 19  VAL A C   1 
ATOM   98  O  O   . VAL A 1 29  ? 34.749 20.008 19.062 1.00 15.75 ? 19  VAL A O   1 
ATOM   99  C  CB  . VAL A 1 29  ? 36.130 18.478 16.473 1.00 19.53 ? 19  VAL A CB  1 
ATOM   100 C  CG1 . VAL A 1 29  ? 37.228 19.177 17.258 1.00 21.25 ? 19  VAL A CG1 1 
ATOM   101 C  CG2 . VAL A 1 29  ? 36.572 17.105 16.004 1.00 21.11 ? 19  VAL A CG2 1 
ATOM   102 N  N   . GLU A 1 30  ? 33.868 20.567 17.067 1.00 17.64 ? 20  GLU A N   1 
ATOM   103 C  CA  . GLU A 1 30  ? 33.462 21.887 17.517 1.00 19.06 ? 20  GLU A CA  1 
ATOM   104 C  C   . GLU A 1 30  ? 32.408 21.805 18.622 1.00 16.56 ? 20  GLU A C   1 
ATOM   105 O  O   . GLU A 1 30  ? 32.458 22.566 19.581 1.00 16.95 ? 20  GLU A O   1 
ATOM   106 C  CB  . GLU A 1 30  ? 32.951 22.728 16.342 1.00 22.43 ? 20  GLU A CB  1 
ATOM   107 C  CG  . GLU A 1 30  ? 32.303 24.052 16.750 1.00 27.18 ? 20  GLU A CG  1 
ATOM   108 C  CD  . GLU A 1 30  ? 32.034 24.967 15.563 1.00 35.15 ? 20  GLU A CD  1 
ATOM   109 O  OE1 . GLU A 1 30  ? 31.712 24.451 14.471 1.00 39.86 ? 20  GLU A OE1 1 
ATOM   110 O  OE2 . GLU A 1 30  ? 32.187 26.199 15.715 1.00 38.13 ? 20  GLU A OE2 1 
ATOM   111 N  N   . GLU A 1 31  ? 31.423 20.923 18.455 1.00 15.77 ? 21  GLU A N   1 
ATOM   112 C  CA  . GLU A 1 31  ? 30.385 20.750 19.466 1.00 14.35 ? 21  GLU A CA  1 
ATOM   113 C  C   . GLU A 1 31  ? 31.015 20.309 20.779 1.00 13.01 ? 21  GLU A C   1 
ATOM   114 O  O   . GLU A 1 31  ? 30.703 20.851 21.845 1.00 14.05 ? 21  GLU A O   1 
ATOM   115 C  CB  . GLU A 1 31  ? 29.350 19.724 19.000 1.00 15.29 ? 21  GLU A CB  1 
ATOM   116 C  CG  . GLU A 1 31  ? 28.348 20.291 18.007 1.00 18.17 ? 21  GLU A CG  1 
ATOM   117 C  CD  . GLU A 1 31  ? 27.359 19.257 17.506 1.00 16.30 ? 21  GLU A CD  1 
ATOM   118 O  OE1 . GLU A 1 31  ? 27.754 18.095 17.280 1.00 18.86 ? 21  GLU A OE1 1 
ATOM   119 O  OE2 . GLU A 1 31  ? 26.208 19.649 17.201 1.00 23.00 ? 21  GLU A OE2 1 
ATOM   120 N  N   . ARG A 1 32  ? 31.891 19.316 20.703 1.00 13.30 ? 22  ARG A N   1 
ATOM   121 C  CA  . ARG A 1 32  ? 32.514 18.792 21.909 1.00 12.83 ? 22  ARG A CA  1 
ATOM   122 C  C   . ARG A 1 32  ? 33.342 19.850 22.626 1.00 12.30 ? 22  ARG A C   1 
ATOM   123 O  O   . ARG A 1 32  ? 33.330 19.919 23.853 1.00 14.01 ? 22  ARG A O   1 
ATOM   124 C  CB  . ARG A 1 32  ? 33.353 17.548 21.603 1.00 12.13 ? 22  ARG A CB  1 
ATOM   125 C  CG  . ARG A 1 32  ? 34.135 16.990 22.785 1.00 12.49 ? 22  ARG A CG  1 
ATOM   126 C  CD  . ARG A 1 32  ? 33.227 16.636 23.950 1.00 12.98 ? 22  ARG A CD  1 
ATOM   127 N  NE  . ARG A 1 32  ? 33.979 16.035 25.052 1.00 11.06 ? 22  ARG A NE  1 
ATOM   128 C  CZ  . ARG A 1 32  ? 34.404 14.772 25.079 1.00 12.75 ? 22  ARG A CZ  1 
ATOM   129 N  NH1 . ARG A 1 32  ? 33.939 13.890 24.204 1.00 14.19 ? 22  ARG A NH1 1 
ATOM   130 N  NH2 . ARG A 1 32  ? 35.231 14.372 26.041 1.00 12.75 ? 22  ARG A NH2 1 
ATOM   131 N  N   . ALA A 1 33  ? 33.990 20.725 21.858 1.00 13.89 ? 23  ALA A N   1 
ATOM   132 C  CA  . ALA A 1 33  ? 34.775 21.794 22.464 1.00 14.62 ? 23  ALA A CA  1 
ATOM   133 C  C   . ALA A 1 33  ? 33.879 22.778 23.227 1.00 14.73 ? 23  ALA A C   1 
ATOM   134 O  O   . ALA A 1 33  ? 34.209 23.201 24.339 1.00 15.92 ? 23  ALA A O   1 
ATOM   135 C  CB  . ALA A 1 33  ? 35.610 22.519 21.403 1.00 15.94 ? 23  ALA A CB  1 
ATOM   136 N  N   . LYS A 1 34  ? 32.718 23.100 22.655 1.00 14.92 ? 24  LYS A N   1 
ATOM   137 C  CA  . LYS A 1 34  ? 31.719 23.914 23.346 1.00 15.50 ? 24  LYS A CA  1 
ATOM   138 C  C   . LYS A 1 34  ? 31.188 23.227 24.614 1.00 14.29 ? 24  LYS A C   1 
ATOM   139 O  O   . LYS A 1 34  ? 31.066 23.846 25.672 1.00 16.86 ? 24  LYS A O   1 
ATOM   140 C  CB  . LYS A 1 34  ? 30.568 24.280 22.401 1.00 16.98 ? 24  LYS A CB  1 
ATOM   141 C  CG  . LYS A 1 34  ? 30.965 25.244 21.277 1.00 21.31 ? 24  LYS A CG  1 
ATOM   142 C  CD  . LYS A 1 34  ? 29.743 25.747 20.514 1.00 25.33 ? 24  LYS A CD  1 
ATOM   143 C  CE  . LYS A 1 34  ? 28.769 26.468 21.445 1.00 33.13 ? 24  LYS A CE  1 
ATOM   144 N  NZ  . LYS A 1 34  ? 27.428 25.808 21.506 1.00 38.80 ? 24  LYS A NZ  1 
ATOM   145 N  N   . HIS A 1 35  ? 30.886 21.939 24.509 1.00 13.57 ? 25  HIS A N   1 
ATOM   146 C  CA  . HIS A 1 35  ? 30.403 21.194 25.662 1.00 12.65 ? 25  HIS A CA  1 
ATOM   147 C  C   . HIS A 1 35  ? 31.443 21.190 26.774 1.00 12.04 ? 25  HIS A C   1 
ATOM   148 O  O   . HIS A 1 35  ? 31.113 21.404 27.932 1.00 12.48 ? 25  HIS A O   1 
ATOM   149 C  CB  . HIS A 1 35  ? 30.087 19.766 25.259 1.00 12.34 ? 25  HIS A CB  1 
ATOM   150 C  CG  . HIS A 1 35  ? 29.029 19.662 24.208 1.00 11.27 ? 25  HIS A CG  1 
ATOM   151 N  ND1 . HIS A 1 35  ? 28.862 18.534 23.435 1.00 12.49 ? 25  HIS A ND1 1 
ATOM   152 C  CD2 . HIS A 1 35  ? 28.110 20.559 23.774 1.00 12.86 ? 25  HIS A CD2 1 
ATOM   153 C  CE1 . HIS A 1 35  ? 27.873 18.733 22.584 1.00 12.61 ? 25  HIS A CE1 1 
ATOM   154 N  NE2 . HIS A 1 35  ? 27.432 19.971 22.734 1.00 13.46 ? 25  HIS A NE2 1 
ATOM   155 N  N   . ASP A 1 36  ? 32.707 20.986 26.407 1.00 13.41 ? 26  ASP A N   1 
ATOM   156 C  CA  . ASP A 1 36  ? 33.777 20.925 27.387 1.00 13.80 ? 26  ASP A CA  1 
ATOM   157 C  C   . ASP A 1 36  ? 33.916 22.254 28.121 1.00 13.72 ? 26  ASP A C   1 
ATOM   158 O  O   . ASP A 1 36  ? 34.213 22.289 29.313 1.00 15.88 ? 26  ASP A O   1 
ATOM   159 C  CB  . ASP A 1 36  ? 35.105 20.532 26.728 1.00 14.64 ? 26  ASP A CB  1 
ATOM   160 C  CG  . ASP A 1 36  ? 35.144 19.072 26.302 1.00 13.64 ? 26  ASP A CG  1 
ATOM   161 O  OD1 . ASP A 1 36  ? 34.216 18.318 26.653 1.00 12.77 ? 26  ASP A OD1 1 
ATOM   162 O  OD2 . ASP A 1 36  ? 36.102 18.671 25.597 1.00 15.86 ? 26  ASP A OD2 1 
ATOM   163 N  N   . GLN A 1 37  ? 33.709 23.350 27.400 1.00 15.49 ? 27  GLN A N   1 
ATOM   164 C  CA  . GLN A 1 37  ? 33.736 24.669 28.022 1.00 17.67 ? 27  GLN A CA  1 
ATOM   165 C  C   . GLN A 1 37  ? 32.601 24.857 29.030 1.00 17.61 ? 27  GLN A C   1 
ATOM   166 O  O   . GLN A 1 37  ? 32.809 25.392 30.121 1.00 18.75 ? 27  GLN A O   1 
ATOM   167 C  CB  . GLN A 1 37  ? 33.697 25.768 26.959 1.00 19.11 ? 27  GLN A CB  1 
ATOM   168 C  CG  . GLN A 1 37  ? 35.016 25.967 26.232 1.00 26.54 ? 27  GLN A CG  1 
ATOM   169 C  CD  . GLN A 1 37  ? 36.124 26.473 27.145 1.00 32.77 ? 27  GLN A CD  1 
ATOM   170 O  OE1 . GLN A 1 37  ? 35.864 27.107 28.170 1.00 31.21 ? 27  GLN A OE1 1 
ATOM   171 N  NE2 . GLN A 1 37  ? 37.369 26.197 26.771 1.00 38.05 ? 27  GLN A NE2 1 
ATOM   172 N  N   . GLN A 1 38  ? 31.398 24.415 28.664 1.00 16.59 ? 28  GLN A N   1 
ATOM   173 C  CA  . GLN A 1 38  ? 30.255 24.496 29.571 1.00 16.48 ? 28  GLN A CA  1 
ATOM   174 C  C   . GLN A 1 38  ? 30.458 23.582 30.780 1.00 14.55 ? 28  GLN A C   1 
ATOM   175 O  O   . GLN A 1 38  ? 30.137 23.947 31.906 1.00 16.84 ? 28  GLN A O   1 
ATOM   176 C  CB  . GLN A 1 38  ? 28.946 24.152 28.845 1.00 17.70 ? 28  GLN A CB  1 
ATOM   177 C  CG  . GLN A 1 38  ? 28.408 25.254 27.936 1.00 20.00 ? 28  GLN A CG  1 
ATOM   178 C  CD  . GLN A 1 38  ? 28.190 26.559 28.677 1.00 27.13 ? 28  GLN A CD  1 
ATOM   179 O  OE1 . GLN A 1 38  ? 27.453 26.610 29.663 1.00 30.88 ? 28  GLN A OE1 1 
ATOM   180 N  NE2 . GLN A 1 38  ? 28.876 27.610 28.240 1.00 32.69 ? 28  GLN A NE2 1 
ATOM   181 N  N   . PHE A 1 39  ? 31.009 22.398 30.550 1.00 13.52 ? 29  PHE A N   1 
ATOM   182 C  CA  . PHE A 1 39  ? 31.259 21.472 31.642 1.00 12.67 ? 29  PHE A CA  1 
ATOM   183 C  C   . PHE A 1 39  ? 32.218 22.088 32.654 1.00 13.37 ? 29  PHE A C   1 
ATOM   184 O  O   . PHE A 1 39  ? 31.979 22.040 33.858 1.00 14.46 ? 29  PHE A O   1 
ATOM   185 C  CB  . PHE A 1 39  ? 31.848 20.176 31.081 1.00 11.16 ? 29  PHE A CB  1 
ATOM   186 C  CG  . PHE A 1 39  ? 31.957 19.056 32.096 1.00 10.71 ? 29  PHE A CG  1 
ATOM   187 C  CD1 . PHE A 1 39  ? 30.825 18.544 32.710 1.00 10.59 ? 29  PHE A CD1 1 
ATOM   188 C  CD2 . PHE A 1 39  ? 33.189 18.507 32.417 1.00 11.50 ? 29  PHE A CD2 1 
ATOM   189 C  CE1 . PHE A 1 39  ? 30.912 17.465 33.584 1.00 10.99 ? 29  PHE A CE1 1 
ATOM   190 C  CE2 . PHE A 1 39  ? 33.296 17.473 33.344 1.00 12.52 ? 29  PHE A CE2 1 
ATOM   191 C  CZ  . PHE A 1 39  ? 32.150 16.932 33.901 1.00 11.02 ? 29  PHE A CZ  1 
ATOM   192 N  N   . HIS A 1 40  ? 33.281 22.704 32.149 1.00 14.43 ? 30  HIS A N   1 
ATOM   193 C  CA  . HIS A 1 40  ? 34.260 23.357 33.008 1.00 16.21 ? 30  HIS A CA  1 
ATOM   194 C  C   . HIS A 1 40  ? 33.636 24.460 33.861 1.00 17.62 ? 30  HIS A C   1 
ATOM   195 O  O   . HIS A 1 40  ? 33.976 24.616 35.033 1.00 18.23 ? 30  HIS A O   1 
ATOM   196 C  CB  . HIS A 1 40  ? 35.401 23.921 32.169 1.00 17.23 ? 30  HIS A CB  1 
ATOM   197 C  CG  . HIS A 1 40  ? 36.479 24.567 32.979 1.00 18.71 ? 30  HIS A CG  1 
ATOM   198 N  ND1 . HIS A 1 40  ? 37.322 23.848 33.799 1.00 19.69 ? 30  HIS A ND1 1 
ATOM   199 C  CD2 . HIS A 1 40  ? 36.868 25.860 33.078 1.00 24.41 ? 30  HIS A CD2 1 
ATOM   200 C  CE1 . HIS A 1 40  ? 38.174 24.673 34.382 1.00 23.07 ? 30  HIS A CE1 1 
ATOM   201 N  NE2 . HIS A 1 40  ? 37.922 25.899 33.958 1.00 23.24 ? 30  HIS A NE2 1 
ATOM   202 N  N   . SER A 1 41  ? 32.676 25.180 33.290 1.00 18.56 ? 31  SER A N   1 
ATOM   203 C  CA  . SER A 1 41  ? 32.015 26.270 33.999 1.00 19.69 ? 31  SER A CA  1 
ATOM   204 C  C   . SER A 1 41  ? 31.225 25.794 35.219 1.00 19.86 ? 31  SER A C   1 
ATOM   205 O  O   . SER A 1 41  ? 30.948 26.577 36.129 1.00 20.81 ? 31  SER A O   1 
ATOM   206 C  CB  . SER A 1 41  ? 31.099 27.045 33.049 1.00 22.82 ? 31  SER A CB  1 
ATOM   207 O  OG  . SER A 1 41  ? 29.815 26.444 32.967 1.00 25.57 ? 31  SER A OG  1 
ATOM   208 N  N   . LEU A 1 42  ? 30.876 24.509 35.240 1.00 16.87 ? 32  LEU A N   1 
ATOM   209 C  CA  . LEU A 1 42  ? 30.163 23.924 36.375 1.00 17.46 ? 32  LEU A CA  1 
ATOM   210 C  C   . LEU A 1 42  ? 31.102 23.514 37.507 1.00 18.71 ? 32  LEU A C   1 
ATOM   211 O  O   . LEU A 1 42  ? 30.651 23.014 38.538 1.00 19.59 ? 32  LEU A O   1 
ATOM   212 C  CB  . LEU A 1 42  ? 29.324 22.721 35.928 1.00 17.99 ? 32  LEU A CB  1 
ATOM   213 C  CG  . LEU A 1 42  ? 28.202 23.025 34.936 1.00 18.20 ? 32  LEU A CG  1 
ATOM   214 C  CD1 . LEU A 1 42  ? 27.485 21.747 34.519 1.00 18.31 ? 32  LEU A CD1 1 
ATOM   215 C  CD2 . LEU A 1 42  ? 27.216 24.037 35.525 1.00 20.25 ? 32  LEU A CD2 1 
ATOM   216 N  N   . LYS A 1 43  ? 32.404 23.710 37.302 1.00 17.41 ? 33  LYS A N   1 
ATOM   217 C  CA  . LYS A 1 43  ? 33.415 23.361 38.302 1.00 19.76 ? 33  LYS A CA  1 
ATOM   218 C  C   . LYS A 1 43  ? 33.312 21.901 38.743 1.00 17.13 ? 33  LYS A C   1 
ATOM   219 O  O   . LYS A 1 43  ? 33.151 21.609 39.929 1.00 20.13 ? 33  LYS A O   1 
ATOM   220 C  CB  . LYS A 1 43  ? 33.324 24.292 39.515 1.00 22.05 ? 33  LYS A CB  1 
ATOM   221 C  CG  . LYS A 1 43  ? 33.319 25.773 39.162 1.00 28.91 ? 33  LYS A CG  1 
ATOM   222 C  CD  . LYS A 1 43  ? 34.736 26.300 38.977 1.00 37.37 ? 33  LYS A CD  1 
ATOM   223 C  CE  . LYS A 1 43  ? 34.736 27.742 38.484 1.00 39.27 ? 33  LYS A CE  1 
ATOM   224 N  NZ  . LYS A 1 43  ? 36.117 28.246 38.225 1.00 42.52 ? 33  LYS A NZ  1 
ATOM   225 N  N   . PRO A 1 44  ? 33.484 20.972 37.798 1.00 15.15 ? 34  PRO A N   1 
ATOM   226 C  CA  . PRO A 1 44  ? 33.500 19.562 38.173 1.00 14.28 ? 34  PRO A CA  1 
ATOM   227 C  C   . PRO A 1 44  ? 34.586 19.292 39.205 1.00 15.11 ? 34  PRO A C   1 
ATOM   228 O  O   . PRO A 1 44  ? 35.628 19.950 39.196 1.00 15.65 ? 34  PRO A O   1 
ATOM   229 C  CB  . PRO A 1 44  ? 33.826 18.845 36.860 1.00 14.16 ? 34  PRO A CB  1 
ATOM   230 C  CG  . PRO A 1 44  ? 33.616 19.861 35.775 1.00 17.63 ? 34  PRO A CG  1 
ATOM   231 C  CD  . PRO A 1 44  ? 33.850 21.189 36.390 1.00 15.46 ? 34  PRO A CD  1 
ATOM   232 N  N   . ILE A 1 45  ? 34.368 18.275 40.027 1.00 14.17 ? 35  ILE A N   1 
ATOM   233 C  CA  . ILE A 1 45  ? 35.336 17.876 41.035 1.00 15.08 ? 35  ILE A CA  1 
ATOM   234 C  C   . ILE A 1 45  ? 35.995 16.587 40.576 1.00 12.81 ? 35  ILE A C   1 
ATOM   235 O  O   . ILE A 1 45  ? 35.323 15.575 40.397 1.00 13.26 ? 35  ILE A O   1 
ATOM   236 C  CB  . ILE A 1 45  ? 34.653 17.638 42.403 1.00 14.45 ? 35  ILE A CB  1 
ATOM   237 C  CG1 . ILE A 1 45  ? 33.938 18.909 42.862 1.00 16.34 ? 35  ILE A CG1 1 
ATOM   238 C  CG2 . ILE A 1 45  ? 35.688 17.220 43.444 1.00 16.05 ? 35  ILE A CG2 1 
ATOM   239 C  CD1 . ILE A 1 45  ? 33.123 18.736 44.133 1.00 19.08 ? 35  ILE A CD1 1 
ATOM   240 N  N   . SER A 1 46  ? 37.289 16.664 40.266 1.00 13.77 ? 36  SER A N   1 
ATOM   241 C  CA  . SER A 1 46  ? 38.007 15.515 39.721 1.00 13.62 ? 36  SER A CA  1 
ATOM   242 C  C   . SER A 1 46  ? 37.296 14.941 38.504 1.00 13.79 ? 36  SER A C   1 
ATOM   243 O  O   . SER A 1 46  ? 37.233 13.725 38.334 1.00 15.63 ? 36  SER A O   1 
ATOM   244 C  CB  . SER A 1 46  ? 38.194 14.419 40.773 1.00 13.87 ? 36  SER A CB  1 
ATOM   245 O  OG  . SER A 1 46  ? 39.215 14.752 41.698 1.00 17.79 ? 36  SER A OG  1 
ATOM   246 N  N   . GLY A 1 47  ? 36.718 15.819 37.690 1.00 12.60 ? 37  GLY A N   1 
ATOM   247 C  CA  . GLY A 1 47  ? 36.146 15.410 36.407 1.00 14.01 ? 37  GLY A CA  1 
ATOM   248 C  C   . GLY A 1 47  ? 34.686 14.979 36.453 1.00 12.53 ? 37  GLY A C   1 
ATOM   249 O  O   . GLY A 1 47  ? 34.164 14.488 35.462 1.00 12.60 ? 37  GLY A O   1 
ATOM   250 N  N   . PHE A 1 48  ? 34.036 15.133 37.605 1.00 11.97 ? 38  PHE A N   1 
ATOM   251 C  CA  . PHE A 1 48  ? 32.645 14.707 37.754 1.00 11.19 ? 38  PHE A CA  1 
ATOM   252 C  C   . PHE A 1 48  ? 31.785 15.832 38.303 1.00 11.14 ? 38  PHE A C   1 
ATOM   253 O  O   . PHE A 1 48  ? 32.203 16.557 39.211 1.00 11.90 ? 38  PHE A O   1 
ATOM   254 C  CB  . PHE A 1 48  ? 32.544 13.501 38.700 1.00 12.99 ? 38  PHE A CB  1 
ATOM   255 C  CG  . PHE A 1 48  ? 33.186 12.258 38.166 1.00 14.56 ? 38  PHE A CG  1 
ATOM   256 C  CD1 . PHE A 1 48  ? 32.504 11.424 37.296 1.00 12.44 ? 38  PHE A CD1 1 
ATOM   257 C  CD2 . PHE A 1 48  ? 34.466 11.904 38.559 1.00 15.44 ? 38  PHE A CD2 1 
ATOM   258 C  CE1 . PHE A 1 48  ? 33.085 10.255 36.820 1.00 16.14 ? 38  PHE A CE1 1 
ATOM   259 C  CE2 . PHE A 1 48  ? 35.057 10.744 38.083 1.00 17.60 ? 38  PHE A CE2 1 
ATOM   260 C  CZ  . PHE A 1 48  ? 34.378 9.930  37.200 1.00 17.63 ? 38  PHE A CZ  1 
ATOM   261 N  N   . ILE A 1 49  ? 30.545 15.895 37.820 1.00 11.16 ? 39  ILE A N   1 
ATOM   262 C  CA  . ILE A 1 49  ? 29.479 16.611 38.522 1.00 11.64 ? 39  ILE A CA  1 
ATOM   263 C  C   . ILE A 1 49  ? 28.434 15.630 39.034 1.00 10.90 ? 39  ILE A C   1 
ATOM   264 O  O   . ILE A 1 49  ? 28.309 14.513 38.526 1.00 11.36 ? 39  ILE A O   1 
ATOM   265 C  CB  . ILE A 1 49  ? 28.812 17.689 37.632 1.00 11.07 ? 39  ILE A CB  1 
ATOM   266 C  CG1 . ILE A 1 49  ? 28.158 17.055 36.395 1.00 12.57 ? 39  ILE A CG1 1 
ATOM   267 C  CG2 . ILE A 1 49  ? 29.838 18.728 37.222 1.00 13.60 ? 39  ILE A CG2 1 
ATOM   268 C  CD1 . ILE A 1 49  ? 27.497 18.054 35.473 1.00 13.12 ? 39  ILE A CD1 1 
ATOM   269 N  N   . THR A 1 50  ? 27.759 15.995 40.117 1.00 11.84 ? 40  THR A N   1 
ATOM   270 C  CA  . THR A 1 50  ? 26.736 15.110 40.658 1.00 11.88 ? 40  THR A CA  1 
ATOM   271 C  C   . THR A 1 50  ? 25.533 15.083 39.725 1.00 11.44 ? 40  THR A C   1 
ATOM   272 O  O   . THR A 1 50  ? 25.322 16.001 38.940 1.00 11.17 ? 40  THR A O   1 
ATOM   273 C  CB  . THR A 1 50  ? 26.275 15.546 42.053 1.00 12.68 ? 40  THR A CB  1 
ATOM   274 O  OG1 . THR A 1 50  ? 25.658 16.836 41.972 1.00 14.41 ? 40  THR A OG1 1 
ATOM   275 C  CG2 . THR A 1 50  ? 27.453 15.589 43.010 1.00 15.52 ? 40  THR A CG2 1 
ATOM   276 N  N   . GLY A 1 51  ? 24.716 14.045 39.838 1.00 11.93 ? 41  GLY A N   1 
ATOM   277 C  CA  . GLY A 1 51  ? 23.480 13.994 39.073 1.00 11.18 ? 41  GLY A CA  1 
ATOM   278 C  C   . GLY A 1 51  ? 22.588 15.189 39.344 1.00 11.50 ? 41  GLY A C   1 
ATOM   279 O  O   . GLY A 1 51  ? 22.017 15.759 38.420 1.00 12.04 ? 41  GLY A O   1 
ATOM   280 N  N   . ASP A 1 52  ? 22.474 15.597 40.604 1.00 11.82 ? 42  ASP A N   1 
ATOM   281 C  CA  . ASP A 1 52  ? 21.600 16.727 40.899 1.00 13.01 ? 42  ASP A CA  1 
ATOM   282 C  C   . ASP A 1 52  ? 22.127 18.019 40.294 1.00 12.80 ? 42  ASP A C   1 
ATOM   283 O  O   . ASP A 1 52  ? 21.369 18.816 39.761 1.00 12.62 ? 42  ASP A O   1 
ATOM   284 C  CB  . ASP A 1 52  ? 21.359 16.886 42.401 1.00 15.32 ? 42  ASP A CB  1 
ATOM   285 C  CG  . ASP A 1 52  ? 22.630 17.150 43.171 1.00 19.51 ? 42  ASP A CG  1 
ATOM   286 O  OD1 . ASP A 1 52  ? 23.378 16.181 43.411 1.00 25.43 ? 42  ASP A OD1 1 
ATOM   287 O  OD2 . ASP A 1 52  ? 22.858 18.313 43.582 1.00 26.29 ? 42  ASP A OD2 1 
ATOM   288 N  N   . GLN A 1 53  ? 23.445 18.168 40.283 1.00 12.70 ? 43  GLN A N   1 
ATOM   289 C  CA  . GLN A 1 53  ? 24.062 19.321 39.664 1.00 12.56 ? 43  GLN A CA  1 
ATOM   290 C  C   . GLN A 1 53  ? 23.800 19.354 38.165 1.00 10.83 ? 43  GLN A C   1 
ATOM   291 O  O   . GLN A 1 53  ? 23.474 20.397 37.602 1.00 12.27 ? 43  GLN A O   1 
ATOM   292 C  CB  . GLN A 1 53  ? 25.561 19.264 39.924 1.00 14.64 ? 43  GLN A CB  1 
ATOM   293 C  CG  . GLN A 1 53  ? 26.355 20.462 39.503 1.00 22.19 ? 43  GLN A CG  1 
ATOM   294 C  CD  . GLN A 1 53  ? 27.799 20.302 39.912 1.00 23.57 ? 43  GLN A CD  1 
ATOM   295 O  OE1 . GLN A 1 53  ? 28.163 19.312 40.566 1.00 23.07 ? 43  GLN A OE1 1 
ATOM   296 N  NE2 . GLN A 1 53  ? 28.623 21.289 39.582 1.00 27.04 ? 43  GLN A NE2 1 
ATOM   297 N  N   . ALA A 1 54  ? 24.011 18.222 37.510 1.00 10.11 ? 44  ALA A N   1 
ATOM   298 C  CA  . ALA A 1 54  ? 23.765 18.127 36.081 1.00 8.81  ? 44  ALA A CA  1 
ATOM   299 C  C   . ALA A 1 54  ? 22.311 18.445 35.758 1.00 9.54  ? 44  ALA A C   1 
ATOM   300 O  O   . ALA A 1 54  ? 22.022 19.256 34.878 1.00 9.83  ? 44  ALA A O   1 
ATOM   301 C  CB  . ALA A 1 54  ? 24.126 16.735 35.585 1.00 10.84 ? 44  ALA A CB  1 
ATOM   302 N  N   . ARG A 1 55  ? 21.392 17.800 36.471 1.00 9.04  ? 45  ARG A N   1 
ATOM   303 C  CA  . ARG A 1 55  ? 19.982 17.962 36.160 1.00 9.46  ? 45  ARG A CA  1 
ATOM   304 C  C   . ARG A 1 55  ? 19.510 19.388 36.431 1.00 10.49 ? 45  ARG A C   1 
ATOM   305 O  O   . ARG A 1 55  ? 18.736 19.951 35.656 1.00 10.53 ? 45  ARG A O   1 
ATOM   306 C  CB  . ARG A 1 55  ? 19.139 16.935 36.915 1.00 10.39 ? 45  ARG A CB  1 
ATOM   307 C  CG  . ARG A 1 55  ? 19.356 15.499 36.415 1.00 10.90 ? 45  ARG A CG  1 
ATOM   308 C  CD  . ARG A 1 55  ? 18.418 14.501 37.105 1.00 11.15 ? 45  ARG A CD  1 
ATOM   309 N  NE  . ARG A 1 55  ? 18.773 14.295 38.511 1.00 11.11 ? 45  ARG A NE  1 
ATOM   310 C  CZ  . ARG A 1 55  ? 19.678 13.413 38.937 1.00 11.71 ? 45  ARG A CZ  1 
ATOM   311 N  NH1 . ARG A 1 55  ? 20.307 12.631 38.073 1.00 11.53 ? 45  ARG A NH1 1 
ATOM   312 N  NH2 . ARG A 1 55  ? 19.926 13.287 40.234 1.00 11.49 ? 45  ARG A NH2 1 
ATOM   313 N  N   . ASN A 1 56  ? 20.067 20.009 37.464 1.00 12.19 ? 46  ASN A N   1 
ATOM   314 C  CA  . ASN A 1 56  ? 19.751 21.404 37.735 1.00 14.15 ? 46  ASN A CA  1 
ATOM   315 C  C   . ASN A 1 56  ? 20.218 22.340 36.629 1.00 11.78 ? 46  ASN A C   1 
ATOM   316 O  O   . ASN A 1 56  ? 19.486 23.247 36.208 1.00 12.48 ? 46  ASN A O   1 
ATOM   317 C  CB  . ASN A 1 56  ? 20.315 21.833 39.088 1.00 15.34 ? 46  ASN A CB  1 
ATOM   318 C  CG  . ASN A 1 56  ? 19.255 21.893 40.156 1.00 25.36 ? 46  ASN A CG  1 
ATOM   319 O  OD1 . ASN A 1 56  ? 18.792 20.858 40.639 1.00 32.96 ? 46  ASN A OD1 1 
ATOM   320 N  ND2 . ASN A 1 56  ? 18.729 23.089 40.387 1.00 34.59 ? 46  ASN A ND2 1 
ATOM   321 N  N   . PHE A 1 57  ? 21.396 22.056 36.086 1.00 10.30 ? 47  PHE A N   1 
ATOM   322 C  CA  . PHE A 1 57  ? 21.877 22.825 34.955 1.00 9.47  ? 47  PHE A CA  1 
ATOM   323 C  C   . PHE A 1 57  ? 20.994 22.606 33.725 1.00 10.17 ? 47  PHE A C   1 
ATOM   324 O  O   . PHE A 1 57  ? 20.605 23.550 33.044 1.00 10.48 ? 47  PHE A O   1 
ATOM   325 C  CB  . PHE A 1 57  ? 23.331 22.479 34.646 1.00 11.85 ? 47  PHE A CB  1 
ATOM   326 C  CG  . PHE A 1 57  ? 23.881 23.208 33.458 1.00 11.71 ? 47  PHE A CG  1 
ATOM   327 C  CD1 . PHE A 1 57  ? 24.106 24.575 33.509 1.00 13.90 ? 47  PHE A CD1 1 
ATOM   328 C  CD2 . PHE A 1 57  ? 24.184 22.525 32.295 1.00 11.62 ? 47  PHE A CD2 1 
ATOM   329 C  CE1 . PHE A 1 57  ? 24.605 25.252 32.405 1.00 15.97 ? 47  PHE A CE1 1 
ATOM   330 C  CE2 . PHE A 1 57  ? 24.659 23.190 31.183 1.00 12.75 ? 47  PHE A CE2 1 
ATOM   331 C  CZ  . PHE A 1 57  ? 24.867 24.550 31.236 1.00 14.75 ? 47  PHE A CZ  1 
ATOM   332 N  N   . PHE A 1 58  ? 20.673 21.351 33.435 1.00 8.97  ? 48  PHE A N   1 
ATOM   333 C  CA  . PHE A 1 58  ? 19.859 21.046 32.274 1.00 10.29 ? 48  PHE A CA  1 
ATOM   334 C  C   . PHE A 1 58  ? 18.520 21.772 32.291 1.00 9.35  ? 48  PHE A C   1 
ATOM   335 O  O   . PHE A 1 58  ? 17.966 22.093 31.244 1.00 9.77  ? 48  PHE A O   1 
ATOM   336 C  CB  . PHE A 1 58  ? 19.683 19.537 32.122 1.00 9.95  ? 48  PHE A CB  1 
ATOM   337 C  CG  . PHE A 1 58  ? 20.980 18.797 31.874 1.00 11.83 ? 48  PHE A CG  1 
ATOM   338 C  CD1 . PHE A 1 58  ? 22.082 19.459 31.344 1.00 14.44 ? 48  PHE A CD1 1 
ATOM   339 C  CD2 . PHE A 1 58  ? 21.119 17.466 32.241 1.00 16.64 ? 48  PHE A CD2 1 
ATOM   340 C  CE1 . PHE A 1 58  ? 23.283 18.797 31.118 1.00 15.47 ? 48  PHE A CE1 1 
ATOM   341 C  CE2 . PHE A 1 58  ? 22.331 16.791 32.018 1.00 13.36 ? 48  PHE A CE2 1 
ATOM   342 C  CZ  . PHE A 1 58  ? 23.420 17.482 31.514 1.00 14.81 ? 48  PHE A CZ  1 
ATOM   343 N  N   . PHE A 1 59  ? 17.979 21.977 33.490 1.00 9.78  ? 49  PHE A N   1 
ATOM   344 C  CA  . PHE A 1 59  ? 16.652 22.582 33.651 1.00 12.60 ? 49  PHE A CA  1 
ATOM   345 C  C   . PHE A 1 59  ? 16.650 24.016 33.089 1.00 13.16 ? 49  PHE A C   1 
ATOM   346 O  O   . PHE A 1 59  ? 15.602 24.570 32.731 1.00 19.03 ? 49  PHE A O   1 
ATOM   347 C  CB  . PHE A 1 59  ? 16.298 22.576 35.146 1.00 14.74 ? 49  PHE A CB  1 
ATOM   348 C  CG  . PHE A 1 59  ? 14.869 22.213 35.466 1.00 18.52 ? 49  PHE A CG  1 
ATOM   349 C  CD1 . PHE A 1 59  ? 13.971 21.822 34.484 1.00 17.39 ? 49  PHE A CD1 1 
ATOM   350 C  CD2 . PHE A 1 59  ? 14.400 22.382 36.764 1.00 17.52 ? 49  PHE A CD2 1 
ATOM   351 C  CE1 . PHE A 1 59  ? 12.625 21.627 34.788 1.00 15.61 ? 49  PHE A CE1 1 
ATOM   352 C  CE2 . PHE A 1 59  ? 13.042 22.243 37.067 1.00 18.80 ? 49  PHE A CE2 1 
ATOM   353 C  CZ  . PHE A 1 59  ? 12.159 21.842 36.079 1.00 17.80 ? 49  PHE A CZ  1 
ATOM   354 N  N   . GLN A 1 60  ? 17.835 24.586 32.934 1.00 10.64 ? 50  GLN A N   1 
ATOM   355 C  CA  . GLN A 1 60  ? 17.961 25.930 32.375 1.00 12.40 ? 50  GLN A CA  1 
ATOM   356 C  C   . GLN A 1 60  ? 17.781 25.972 30.855 1.00 10.87 ? 50  GLN A C   1 
ATOM   357 O  O   . GLN A 1 60  ? 17.806 27.047 30.241 1.00 11.67 ? 50  GLN A O   1 
ATOM   358 C  CB  . GLN A 1 60  ? 19.303 26.548 32.776 1.00 13.91 ? 50  GLN A CB  1 
ATOM   359 C  CG  . GLN A 1 60  ? 19.435 26.755 34.268 1.00 17.23 ? 50  GLN A CG  1 
ATOM   360 C  CD  . GLN A 1 60  ? 20.869 27.019 34.728 1.00 25.27 ? 50  GLN A CD  1 
ATOM   361 O  OE1 . GLN A 1 60  ? 21.211 26.761 35.881 1.00 29.70 ? 50  GLN A OE1 1 
ATOM   362 N  NE2 . GLN A 1 60  ? 21.698 27.560 33.840 1.00 22.35 ? 50  GLN A NE2 1 
ATOM   363 N  N   . SER A 1 61  ? 17.563 24.800 30.251 1.00 10.92 ? 51  SER A N   1 
ATOM   364 C  CA  . SER A 1 61  ? 17.346 24.733 28.813 1.00 9.93  ? 51  SER A CA  1 
ATOM   365 C  C   . SER A 1 61  ? 15.937 25.166 28.419 1.00 9.89  ? 51  SER A C   1 
ATOM   366 O  O   . SER A 1 61  ? 15.696 25.495 27.260 1.00 13.08 ? 51  SER A O   1 
ATOM   367 C  CB  . SER A 1 61  ? 17.610 23.326 28.280 1.00 11.19 ? 51  SER A CB  1 
ATOM   368 O  OG  . SER A 1 61  ? 16.657 22.425 28.809 1.00 9.72  ? 51  SER A OG  1 
ATOM   369 N  N   . GLY A 1 62  ? 14.991 25.061 29.348 1.00 9.59  ? 52  GLY A N   1 
ATOM   370 C  CA  . GLY A 1 62  ? 13.595 25.305 29.024 1.00 9.31  ? 52  GLY A CA  1 
ATOM   371 C  C   . GLY A 1 62  ? 12.801 24.052 28.685 1.00 9.43  ? 52  GLY A C   1 
ATOM   372 O  O   . GLY A 1 62  ? 11.586 24.122 28.528 1.00 10.48 ? 52  GLY A O   1 
ATOM   373 N  N   . LEU A 1 63  ? 13.484 22.922 28.497 1.00 10.35 ? 53  LEU A N   1 
ATOM   374 C  CA  . LEU A 1 63  ? 12.804 21.701 28.074 1.00 12.47 ? 53  LEU A CA  1 
ATOM   375 C  C   . LEU A 1 63  ? 11.983 21.164 29.233 1.00 12.29 ? 53  LEU A C   1 
ATOM   376 O  O   . LEU A 1 63  ? 12.317 21.400 30.391 1.00 12.46 ? 53  LEU A O   1 
ATOM   377 C  CB  . LEU A 1 63  ? 13.809 20.631 27.620 1.00 11.23 ? 53  LEU A CB  1 
ATOM   378 C  CG  . LEU A 1 63  ? 14.465 20.878 26.265 1.00 12.07 ? 53  LEU A CG  1 
ATOM   379 C  CD1 . LEU A 1 63  ? 15.568 19.863 26.007 1.00 11.25 ? 53  LEU A CD1 1 
ATOM   380 C  CD2 . LEU A 1 63  ? 13.440 20.843 25.153 1.00 13.80 ? 53  LEU A CD2 1 
ATOM   381 N  N   . PRO A 1 64  ? 10.906 20.431 28.920 1.00 15.81 ? 54  PRO A N   1 
ATOM   382 C  CA  . PRO A 1 64  ? 10.085 19.815 29.946 1.00 17.62 ? 54  PRO A CA  1 
ATOM   383 C  C   . PRO A 1 64  ? 10.909 18.912 30.859 1.00 16.41 ? 54  PRO A C   1 
ATOM   384 O  O   . PRO A 1 64  ? 11.780 18.174 30.385 1.00 16.04 ? 54  PRO A O   1 
ATOM   385 C  CB  . PRO A 1 64  ? 9.066  19.000 29.139 1.00 17.36 ? 54  PRO A CB  1 
ATOM   386 C  CG  . PRO A 1 64  ? 9.022  19.634 27.802 1.00 18.02 ? 54  PRO A CG  1 
ATOM   387 C  CD  . PRO A 1 64  ? 10.412 20.160 27.561 1.00 16.64 ? 54  PRO A CD  1 
ATOM   388 N  N   . GLN A 1 65  ? 10.541 18.864 32.134 1.00 19.51 ? 55  GLN A N   1 
ATOM   389 C  CA  . GLN A 1 65  ? 11.203 17.985 33.089 1.00 19.06 ? 55  GLN A CA  1 
ATOM   390 C  C   . GLN A 1 65  ? 11.221 16.506 32.650 1.00 17.89 ? 55  GLN A C   1 
ATOM   391 O  O   . GLN A 1 65  ? 12.268 15.854 32.748 1.00 18.99 ? 55  GLN A O   1 
ATOM   392 C  CB  . GLN A 1 65  ? 10.611 18.130 34.497 1.00 22.70 ? 55  GLN A CB  1 
ATOM   393 C  CG  . GLN A 1 65  ? 11.566 17.717 35.617 1.00 27.70 ? 55  GLN A CG  1 
ATOM   394 C  CD  . GLN A 1 65  ? 10.950 16.720 36.578 1.00 32.87 ? 55  GLN A CD  1 
ATOM   395 O  OE1 . GLN A 1 65  ? 10.295 15.764 36.158 1.00 30.33 ? 55  GLN A OE1 1 
ATOM   396 N  NE2 . GLN A 1 65  ? 11.068 16.998 37.877 1.00 30.97 ? 55  GLN A NE2 1 
ATOM   397 N  N   . PRO A 1 66  ? 10.095 15.998 32.095 1.00 18.32 ? 56  PRO A N   1 
ATOM   398 C  CA  . PRO A 1 66  ? 10.079 14.585 31.713 1.00 17.70 ? 56  PRO A CA  1 
ATOM   399 C  C   . PRO A 1 66  ? 11.080 14.320 30.607 1.00 14.86 ? 56  PRO A C   1 
ATOM   400 O  O   . PRO A 1 66  ? 11.708 13.266 30.567 1.00 16.63 ? 56  PRO A O   1 
ATOM   401 C  CB  . PRO A 1 66  ? 8.656  14.365 31.178 1.00 21.29 ? 56  PRO A CB  1 
ATOM   402 C  CG  . PRO A 1 66  ? 7.844  15.442 31.777 1.00 18.91 ? 56  PRO A CG  1 
ATOM   403 C  CD  . PRO A 1 66  ? 8.767  16.624 31.949 1.00 19.09 ? 56  PRO A CD  1 
ATOM   404 N  N   . VAL A 1 67  ? 11.190 15.273 29.692 1.00 14.09 ? 57  VAL A N   1 
ATOM   405 C  CA  . VAL A 1 67  ? 12.150 15.193 28.607 1.00 12.68 ? 57  VAL A CA  1 
ATOM   406 C  C   . VAL A 1 67  ? 13.579 15.171 29.149 1.00 10.92 ? 57  VAL A C   1 
ATOM   407 O  O   . VAL A 1 67  ? 14.394 14.344 28.728 1.00 10.14 ? 57  VAL A O   1 
ATOM   408 C  CB  . VAL A 1 67  ? 11.948 16.351 27.600 1.00 13.17 ? 57  VAL A CB  1 
ATOM   409 C  CG1 . VAL A 1 67  ? 13.081 16.401 26.592 1.00 14.75 ? 57  VAL A CG1 1 
ATOM   410 C  CG2 . VAL A 1 67  ? 10.594 16.219 26.908 1.00 16.85 ? 57  VAL A CG2 1 
ATOM   411 N  N   . LEU A 1 68  ? 13.888 16.085 30.066 1.00 10.25 ? 58  LEU A N   1 
ATOM   412 C  CA  . LEU A 1 68  ? 15.215 16.126 30.658 1.00 9.38  ? 58  LEU A CA  1 
ATOM   413 C  C   . LEU A 1 68  ? 15.575 14.884 31.469 1.00 9.82  ? 58  LEU A C   1 
ATOM   414 O  O   . LEU A 1 68  ? 16.745 14.521 31.570 1.00 10.20 ? 58  LEU A O   1 
ATOM   415 C  CB  . LEU A 1 68  ? 15.413 17.400 31.479 1.00 10.88 ? 58  LEU A CB  1 
ATOM   416 C  CG  . LEU A 1 68  ? 15.370 18.665 30.624 1.00 10.54 ? 58  LEU A CG  1 
ATOM   417 C  CD1 . LEU A 1 68  ? 15.312 19.870 31.541 1.00 11.16 ? 58  LEU A CD1 1 
ATOM   418 C  CD2 . LEU A 1 68  ? 16.571 18.728 29.702 1.00 9.52  ? 58  LEU A CD2 1 
ATOM   419 N  N   . ALA A 1 69  ? 14.575 14.278 32.107 1.00 10.86 ? 59  ALA A N   1 
ATOM   420 C  CA  . ALA A 1 69  ? 14.785 13.026 32.818 1.00 10.24 ? 59  ALA A CA  1 
ATOM   421 C  C   . ALA A 1 69  ? 15.225 11.925 31.862 1.00 9.50  ? 59  ALA A C   1 
ATOM   422 O  O   . ALA A 1 69  ? 16.152 11.168 32.160 1.00 9.93  ? 59  ALA A O   1 
ATOM   423 C  CB  . ALA A 1 69  ? 13.507 12.621 33.551 1.00 11.02 ? 59  ALA A CB  1 
ATOM   424 N  N   . GLN A 1 70  ? 14.572 11.854 30.709 1.00 9.26  ? 60  GLN A N   1 
ATOM   425 C  CA  . GLN A 1 70  ? 14.960 10.893 29.689 1.00 9.30  ? 60  GLN A CA  1 
ATOM   426 C  C   . GLN A 1 70  ? 16.373 11.184 29.180 1.00 8.55  ? 60  GLN A C   1 
ATOM   427 O  O   . GLN A 1 70  ? 17.166 10.276 28.951 1.00 9.52  ? 60  GLN A O   1 
ATOM   428 C  CB  . GLN A 1 70  ? 13.971 10.916 28.536 1.00 9.86  ? 60  GLN A CB  1 
ATOM   429 C  CG  . GLN A 1 70  ? 14.294 9.917  27.440 1.00 10.61 ? 60  GLN A CG  1 
ATOM   430 C  CD  . GLN A 1 70  ? 13.214 9.839  26.394 1.00 13.30 ? 60  GLN A CD  1 
ATOM   431 O  OE1 . GLN A 1 70  ? 12.176 10.498 26.509 1.00 16.59 ? 60  GLN A OE1 1 
ATOM   432 N  NE2 . GLN A 1 70  ? 13.463 9.061  25.339 1.00 15.96 ? 60  GLN A NE2 1 
ATOM   433 N  N   . ILE A 1 71  ? 16.684 12.463 28.985 1.00 8.20  ? 61  ILE A N   1 
ATOM   434 C  CA  . ILE A 1 71  ? 18.019 12.836 28.532 1.00 8.29  ? 61  ILE A CA  1 
ATOM   435 C  C   . ILE A 1 71  ? 19.081 12.450 29.555 1.00 8.73  ? 61  ILE A C   1 
ATOM   436 O  O   . ILE A 1 71  ? 20.123 11.896 29.192 1.00 9.05  ? 61  ILE A O   1 
ATOM   437 C  CB  . ILE A 1 71  ? 18.107 14.327 28.159 1.00 8.11  ? 61  ILE A CB  1 
ATOM   438 C  CG1 . ILE A 1 71  ? 17.310 14.576 26.878 1.00 7.89  ? 61  ILE A CG1 1 
ATOM   439 C  CG2 . ILE A 1 71  ? 19.557 14.766 28.010 1.00 10.36 ? 61  ILE A CG2 1 
ATOM   440 C  CD1 . ILE A 1 71  ? 17.175 16.017 26.482 1.00 9.92  ? 61  ILE A CD1 1 
ATOM   441 N  N   . TRP A 1 72  ? 18.806 12.702 30.833 1.00 8.93  ? 62  TRP A N   1 
ATOM   442 C  CA  . TRP A 1 72  ? 19.728 12.281 31.873 1.00 8.48  ? 62  TRP A CA  1 
ATOM   443 C  C   . TRP A 1 72  ? 20.014 10.777 31.756 1.00 9.13  ? 62  TRP A C   1 
ATOM   444 O  O   . TRP A 1 72  ? 21.164 10.342 31.808 1.00 10.29 ? 62  TRP A O   1 
ATOM   445 C  CB  . TRP A 1 72  ? 19.181 12.616 33.264 1.00 9.09  ? 62  TRP A CB  1 
ATOM   446 C  CG  . TRP A 1 72  ? 19.912 11.878 34.324 1.00 9.04  ? 62  TRP A CG  1 
ATOM   447 C  CD1 . TRP A 1 72  ? 19.556 10.672 34.874 1.00 10.26 ? 62  TRP A CD1 1 
ATOM   448 C  CD2 . TRP A 1 72  ? 21.236 12.154 34.796 1.00 9.09  ? 62  TRP A CD2 1 
ATOM   449 N  NE1 . TRP A 1 72  ? 20.551 10.223 35.704 1.00 12.00 ? 62  TRP A NE1 1 
ATOM   450 C  CE2 . TRP A 1 72  ? 21.615 11.084 35.632 1.00 9.69  ? 62  TRP A CE2 1 
ATOM   451 C  CE3 . TRP A 1 72  ? 22.140 13.210 34.595 1.00 10.57 ? 62  TRP A CE3 1 
ATOM   452 C  CZ2 . TRP A 1 72  ? 22.856 11.036 36.268 1.00 12.46 ? 62  TRP A CZ2 1 
ATOM   453 C  CZ3 . TRP A 1 72  ? 23.382 13.145 35.204 1.00 12.93 ? 62  TRP A CZ3 1 
ATOM   454 C  CH2 . TRP A 1 72  ? 23.726 12.065 36.037 1.00 13.70 ? 62  TRP A CH2 1 
ATOM   455 N  N   . ALA A 1 73  ? 18.963 9.978  31.620 1.00 10.25 ? 63  ALA A N   1 
ATOM   456 C  CA  . ALA A 1 73  ? 19.128 8.523  31.648 1.00 11.97 ? 63  ALA A CA  1 
ATOM   457 C  C   . ALA A 1 73  ? 19.872 8.027  30.406 1.00 9.77  ? 63  ALA A C   1 
ATOM   458 O  O   . ALA A 1 73  ? 20.634 7.059  30.461 1.00 12.14 ? 63  ALA A O   1 
ATOM   459 C  CB  . ALA A 1 73  ? 17.778 7.856  31.751 1.00 14.11 ? 63  ALA A CB  1 
ATOM   460 N  N   . LEU A 1 74  ? 19.640 8.690  29.278 1.00 8.83  ? 64  LEU A N   1 
ATOM   461 C  CA  . LEU A 1 74  ? 20.375 8.360  28.059 1.00 8.41  ? 64  LEU A CA  1 
ATOM   462 C  C   . LEU A 1 74  ? 21.861 8.669  28.227 1.00 8.90  ? 64  LEU A C   1 
ATOM   463 O  O   . LEU A 1 74  ? 22.727 7.901  27.792 1.00 9.54  ? 64  LEU A O   1 
ATOM   464 C  CB  . LEU A 1 74  ? 19.808 9.143  26.876 1.00 9.47  ? 64  LEU A CB  1 
ATOM   465 C  CG  . LEU A 1 74  ? 18.518 8.601  26.259 1.00 7.96  ? 64  LEU A CG  1 
ATOM   466 C  CD1 . LEU A 1 74  ? 17.868 9.664  25.381 1.00 10.84 ? 64  LEU A CD1 1 
ATOM   467 C  CD2 . LEU A 1 74  ? 18.865 7.366  25.430 1.00 7.98  ? 64  LEU A CD2 1 
ATOM   468 N  N   . ALA A 1 75  ? 22.147 9.825  28.823 1.00 9.45  ? 65  ALA A N   1 
ATOM   469 C  CA  . ALA A 1 75  ? 23.514 10.344 28.868 1.00 9.66  ? 65  ALA A CA  1 
ATOM   470 C  C   . ALA A 1 75  ? 24.367 9.712  29.962 1.00 10.66 ? 65  ALA A C   1 
ATOM   471 O  O   . ALA A 1 75  ? 25.592 9.679  29.851 1.00 11.82 ? 65  ALA A O   1 
ATOM   472 C  CB  . ALA A 1 75  ? 23.501 11.858 29.024 1.00 10.02 ? 65  ALA A CB  1 
ATOM   473 N  N   . ASP A 1 76  ? 23.731 9.283  31.047 1.00 9.59  ? 66  ASP A N   1 
ATOM   474 C  CA  . ASP A 1 76  ? 24.462 8.638  32.134 1.00 10.87 ? 66  ASP A CA  1 
ATOM   475 C  C   . ASP A 1 76  ? 24.793 7.204  31.737 1.00 12.00 ? 66  ASP A C   1 
ATOM   476 O  O   . ASP A 1 76  ? 24.167 6.240  32.205 1.00 12.02 ? 66  ASP A O   1 
ATOM   477 C  CB  . ASP A 1 76  ? 23.656 8.672  33.433 1.00 10.66 ? 66  ASP A CB  1 
ATOM   478 C  CG  . ASP A 1 76  ? 24.415 8.060  34.609 1.00 11.81 ? 66  ASP A CG  1 
ATOM   479 O  OD1 . ASP A 1 76  ? 25.653 7.907  34.508 1.00 11.15 ? 66  ASP A OD1 1 
ATOM   480 O  OD2 . ASP A 1 76  ? 23.769 7.708  35.621 1.00 11.88 ? 66  ASP A OD2 1 
HETATM 481 N  N   . MSE A 1 77  ? 25.753 7.074  30.824 1.00 12.43 ? 67  MSE A N   1 
HETATM 482 C  CA  . MSE A 1 77  ? 25.984 5.827  30.110 1.00 14.73 ? 67  MSE A CA  1 
HETATM 483 C  C   . MSE A 1 77  ? 26.307 4.659  31.028 1.00 14.09 ? 67  MSE A C   1 
HETATM 484 O  O   . MSE A 1 77  ? 26.004 3.515  30.701 1.00 16.86 ? 67  MSE A O   1 
HETATM 485 C  CB  . MSE A 1 77  ? 27.136 5.987  29.130 1.00 18.02 ? 67  MSE A CB  1 
HETATM 486 C  CG  . MSE A 1 77  ? 26.817 6.842  27.944 1.00 20.03 ? 67  MSE A CG  1 
HETATM 487 SE SE  . MSE A 1 77  ? 28.259 6.672  26.674 1.00 28.30 ? 67  MSE A SE  1 
HETATM 488 C  CE  . MSE A 1 77  ? 29.635 7.612  27.666 1.00 24.48 ? 67  MSE A CE  1 
ATOM   489 N  N   . ASN A 1 78  ? 27.039 4.930  32.102 1.00 13.01 ? 68  ASN A N   1 
ATOM   490 C  CA  . ASN A 1 78  ? 27.420 3.855  33.025 1.00 14.11 ? 68  ASN A CA  1 
ATOM   491 C  C   . ASN A 1 78  ? 26.485 3.722  34.223 1.00 14.20 ? 68  ASN A C   1 
ATOM   492 O  O   . ASN A 1 78  ? 26.726 2.910  35.120 1.00 16.89 ? 68  ASN A O   1 
ATOM   493 C  CB  . ASN A 1 78  ? 28.876 4.006  33.478 1.00 14.28 ? 68  ASN A CB  1 
ATOM   494 C  CG  . ASN A 1 78  ? 29.070 5.133  34.480 1.00 13.76 ? 68  ASN A CG  1 
ATOM   495 O  OD1 . ASN A 1 78  ? 28.259 6.062  34.571 1.00 13.80 ? 68  ASN A OD1 1 
ATOM   496 N  ND2 . ASN A 1 78  ? 30.205 5.110  35.165 1.00 18.08 ? 68  ASN A ND2 1 
ATOM   497 N  N   . ASN A 1 79  ? 25.393 4.483  34.206 1.00 15.21 ? 69  ASN A N   1 
ATOM   498 C  CA  . ASN A 1 79  ? 24.306 4.310  35.168 1.00 14.95 ? 69  ASN A CA  1 
ATOM   499 C  C   . ASN A 1 79  ? 24.753 4.493  36.613 1.00 15.94 ? 69  ASN A C   1 
ATOM   500 O  O   . ASN A 1 79  ? 24.124 3.969  37.539 1.00 18.34 ? 69  ASN A O   1 
ATOM   501 C  CB  . ASN A 1 79  ? 23.620 2.947  34.986 1.00 14.75 ? 69  ASN A CB  1 
ATOM   502 C  CG  . ASN A 1 79  ? 23.106 2.748  33.583 1.00 15.33 ? 69  ASN A CG  1 
ATOM   503 O  OD1 . ASN A 1 79  ? 22.430 3.614  33.026 1.00 18.46 ? 69  ASN A OD1 1 
ATOM   504 N  ND2 . ASN A 1 79  ? 23.473 1.623  32.978 1.00 18.30 ? 69  ASN A ND2 1 
ATOM   505 N  N   . ASP A 1 80  ? 25.790 5.301  36.815 1.00 15.65 ? 70  ASP A N   1 
ATOM   506 C  CA  . ASP A 1 80  ? 26.321 5.510  38.157 1.00 16.20 ? 70  ASP A CA  1 
ATOM   507 C  C   . ASP A 1 80  ? 25.784 6.730  38.887 1.00 14.67 ? 70  ASP A C   1 
ATOM   508 O  O   . ASP A 1 80  ? 26.127 6.957  40.042 1.00 17.17 ? 70  ASP A O   1 
ATOM   509 C  CB  . ASP A 1 80  ? 27.853 5.483  38.175 1.00 16.10 ? 70  ASP A CB  1 
ATOM   510 C  CG  . ASP A 1 80  ? 28.481 6.724  37.560 1.00 15.86 ? 70  ASP A CG  1 
ATOM   511 O  OD1 . ASP A 1 80  ? 27.740 7.573  37.016 1.00 13.56 ? 70  ASP A OD1 1 
ATOM   512 O  OD2 . ASP A 1 80  ? 29.727 6.830  37.599 1.00 17.29 ? 70  ASP A OD2 1 
ATOM   513 N  N   . GLY A 1 81  ? 24.899 7.485  38.237 1.00 14.82 ? 71  GLY A N   1 
ATOM   514 C  CA  . GLY A 1 81  ? 24.210 8.585  38.902 1.00 14.37 ? 71  GLY A CA  1 
ATOM   515 C  C   . GLY A 1 81  ? 24.999 9.885  38.961 1.00 13.43 ? 71  GLY A C   1 
ATOM   516 O  O   . GLY A 1 81  ? 24.528 10.877 39.523 1.00 13.99 ? 71  GLY A O   1 
ATOM   517 N  N   . ARG A 1 82  ? 26.218 9.867  38.429 1.00 12.05 ? 72  ARG A N   1 
ATOM   518 C  CA  . ARG A 1 82  ? 27.019 11.084 38.310 1.00 13.19 ? 72  ARG A CA  1 
ATOM   519 C  C   . ARG A 1 82  ? 27.479 11.215 36.858 1.00 12.43 ? 72  ARG A C   1 
ATOM   520 O  O   . ARG A 1 82  ? 27.266 10.304 36.059 1.00 12.07 ? 72  ARG A O   1 
ATOM   521 C  CB  . ARG A 1 82  ? 28.234 11.028 39.243 1.00 13.82 ? 72  ARG A CB  1 
ATOM   522 C  CG  . ARG A 1 82  ? 29.139 9.858  38.952 1.00 15.02 ? 72  ARG A CG  1 
ATOM   523 C  CD  . ARG A 1 82  ? 30.412 9.855  39.788 1.00 15.83 ? 72  ARG A CD  1 
ATOM   524 N  NE  . ARG A 1 82  ? 31.217 8.681  39.453 1.00 17.72 ? 72  ARG A NE  1 
ATOM   525 C  CZ  . ARG A 1 82  ? 32.467 8.475  39.847 1.00 19.68 ? 72  ARG A CZ  1 
ATOM   526 N  NH1 . ARG A 1 82  ? 33.042 9.306  40.704 1.00 17.65 ? 72  ARG A NH1 1 
ATOM   527 N  NH2 . ARG A 1 82  ? 33.112 7.392  39.437 1.00 22.14 ? 72  ARG A NH2 1 
HETATM 528 N  N   . MSE A 1 83  ? 28.124 12.332 36.522 1.00 11.69 ? 73  MSE A N   1 
HETATM 529 C  CA  . MSE A 1 83  ? 28.356 12.657 35.122 1.00 12.36 ? 73  MSE A CA  1 
HETATM 530 C  C   . MSE A 1 83  ? 29.770 13.179 34.876 1.00 10.22 ? 73  MSE A C   1 
HETATM 531 O  O   . MSE A 1 83  ? 30.241 14.078 35.573 1.00 11.78 ? 73  MSE A O   1 
HETATM 532 C  CB  . MSE A 1 83  ? 27.318 13.681 34.672 1.00 13.13 ? 73  MSE A CB  1 
HETATM 533 C  CG  . MSE A 1 83  ? 27.474 14.156 33.246 1.00 12.51 ? 73  MSE A CG  1 
HETATM 534 SE SE  . MSE A 1 83  ? 25.792 14.887 32.600 1.00 18.91 ? 73  MSE A SE  1 
HETATM 535 C  CE  . MSE A 1 83  ? 24.926 13.252 32.034 1.00 16.29 ? 73  MSE A CE  1 
ATOM   536 N  N   . ASP A 1 84  ? 30.460 12.564 33.916 1.00 10.37 ? 74  ASP A N   1 
ATOM   537 C  CA  . ASP A 1 84  ? 31.764 13.047 33.494 1.00 10.24 ? 74  ASP A CA  1 
ATOM   538 C  C   . ASP A 1 84  ? 31.656 13.831 32.191 1.00 10.13 ? 74  ASP A C   1 
ATOM   539 O  O   . ASP A 1 84  ? 30.560 14.137 31.717 1.00 9.84  ? 74  ASP A O   1 
ATOM   540 C  CB  . ASP A 1 84  ? 32.771 11.901 33.373 1.00 13.50 ? 74  ASP A CB  1 
ATOM   541 C  CG  . ASP A 1 84  ? 32.413 10.906 32.285 1.00 12.21 ? 74  ASP A CG  1 
ATOM   542 O  OD1 . ASP A 1 84  ? 31.528 11.190 31.451 1.00 12.74 ? 74  ASP A OD1 1 
ATOM   543 O  OD2 . ASP A 1 84  ? 33.066 9.842  32.227 1.00 17.16 ? 74  ASP A OD2 1 
ATOM   544 N  N   . GLN A 1 85  ? 32.798 14.204 31.636 1.00 9.85  ? 75  GLN A N   1 
ATOM   545 C  CA  . GLN A 1 85  ? 32.800 15.125 30.509 1.00 10.55 ? 75  GLN A CA  1 
ATOM   546 C  C   . GLN A 1 85  ? 32.159 14.533 29.255 1.00 10.40 ? 75  GLN A C   1 
ATOM   547 O  O   . GLN A 1 85  ? 31.437 15.225 28.538 1.00 10.83 ? 75  GLN A O   1 
ATOM   548 C  CB  . GLN A 1 85  ? 34.226 15.568 30.218 1.00 12.16 ? 75  GLN A CB  1 
ATOM   549 C  CG  . GLN A 1 85  ? 34.378 16.596 29.126 1.00 10.72 ? 75  GLN A CG  1 
ATOM   550 C  CD  . GLN A 1 85  ? 35.826 16.774 28.748 1.00 11.45 ? 75  GLN A CD  1 
ATOM   551 O  OE1 . GLN A 1 85  ? 36.436 15.890 28.143 1.00 12.50 ? 75  GLN A OE1 1 
ATOM   552 N  NE2 . GLN A 1 85  ? 36.411 17.877 29.184 1.00 13.91 ? 75  GLN A NE2 1 
ATOM   553 N  N   A VAL A 1 86  ? 32.429 13.255 29.002 0.50 9.53  ? 76  VAL A N   1 
ATOM   554 N  N   B VAL A 1 86  ? 32.411 13.255 28.992 0.50 9.72  ? 76  VAL A N   1 
ATOM   555 C  CA  A VAL A 1 86  ? 31.872 12.557 27.843 0.50 10.38 ? 76  VAL A CA  1 
ATOM   556 C  CA  B VAL A 1 86  ? 31.844 12.612 27.806 0.50 10.87 ? 76  VAL A CA  1 
ATOM   557 C  C   A VAL A 1 86  ? 30.351 12.490 27.947 0.50 9.97  ? 76  VAL A C   1 
ATOM   558 C  C   B VAL A 1 86  ? 30.330 12.470 27.931 0.50 10.18 ? 76  VAL A C   1 
ATOM   559 O  O   A VAL A 1 86  ? 29.639 12.869 27.021 0.50 10.49 ? 76  VAL A O   1 
ATOM   560 O  O   B VAL A 1 86  ? 29.596 12.769 26.993 0.50 10.73 ? 76  VAL A O   1 
ATOM   561 C  CB  A VAL A 1 86  ? 32.445 11.123 27.723 0.50 11.33 ? 76  VAL A CB  1 
ATOM   562 C  CB  B VAL A 1 86  ? 32.481 11.234 27.525 0.50 12.35 ? 76  VAL A CB  1 
ATOM   563 C  CG1 A VAL A 1 86  ? 31.714 10.340 26.643 0.50 12.38 ? 76  VAL A CG1 1 
ATOM   564 C  CG1 B VAL A 1 86  ? 33.929 11.393 27.070 0.50 17.24 ? 76  VAL A CG1 1 
ATOM   565 C  CG2 A VAL A 1 86  ? 33.944 11.167 27.442 0.50 16.44 ? 76  VAL A CG2 1 
ATOM   566 C  CG2 B VAL A 1 86  ? 32.390 10.346 28.750 0.50 16.24 ? 76  VAL A CG2 1 
ATOM   567 N  N   . GLU A 1 87  ? 29.862 12.081 29.114 1.00 9.44  ? 77  GLU A N   1 
ATOM   568 C  CA  . GLU A 1 87  ? 28.422 11.969 29.357 1.00 8.56  ? 77  GLU A CA  1 
ATOM   569 C  C   . GLU A 1 87  ? 27.749 13.333 29.247 1.00 8.88  ? 77  GLU A C   1 
ATOM   570 O  O   . GLU A 1 87  ? 26.659 13.470 28.692 1.00 8.68  ? 77  GLU A O   1 
ATOM   571 C  CB  . GLU A 1 87  ? 28.160 11.341 30.725 1.00 9.20  ? 77  GLU A CB  1 
ATOM   572 C  CG  . GLU A 1 87  ? 28.599 9.891  30.821 1.00 9.57  ? 77  GLU A CG  1 
ATOM   573 C  CD  . GLU A 1 87  ? 28.408 9.323  32.215 1.00 9.83  ? 77  GLU A CD  1 
ATOM   574 O  OE1 . GLU A 1 87  ? 28.306 10.131 33.165 1.00 12.00 ? 77  GLU A OE1 1 
ATOM   575 O  OE2 . GLU A 1 87  ? 28.356 8.075  32.363 1.00 11.89 ? 77  GLU A OE2 1 
ATOM   576 N  N   . PHE A 1 88  ? 28.422 14.358 29.749 1.00 8.47  ? 78  PHE A N   1 
ATOM   577 C  CA  . PHE A 1 88  ? 27.885 15.705 29.662 1.00 8.91  ? 78  PHE A CA  1 
ATOM   578 C  C   . PHE A 1 88  ? 27.717 16.161 28.204 1.00 8.47  ? 78  PHE A C   1 
ATOM   579 O  O   . PHE A 1 88  ? 26.702 16.760 27.840 1.00 8.61  ? 78  PHE A O   1 
ATOM   580 C  CB  . PHE A 1 88  ? 28.798 16.663 30.423 1.00 8.97  ? 78  PHE A CB  1 
ATOM   581 C  CG  . PHE A 1 88  ? 28.285 18.077 30.489 1.00 8.32  ? 78  PHE A CG  1 
ATOM   582 C  CD1 . PHE A 1 88  ? 27.341 18.435 31.439 1.00 11.29 ? 78  PHE A CD1 1 
ATOM   583 C  CD2 . PHE A 1 88  ? 28.729 19.042 29.589 1.00 10.06 ? 78  PHE A CD2 1 
ATOM   584 C  CE1 . PHE A 1 88  ? 26.898 19.736 31.535 1.00 11.15 ? 78  PHE A CE1 1 
ATOM   585 C  CE2 . PHE A 1 88  ? 28.278 20.358 29.680 1.00 11.14 ? 78  PHE A CE2 1 
ATOM   586 C  CZ  . PHE A 1 88  ? 27.356 20.692 30.647 1.00 10.53 ? 78  PHE A CZ  1 
ATOM   587 N  N   . SER A 1 89  ? 28.694 15.830 27.365 1.00 9.56  ? 79  SER A N   1 
ATOM   588 C  CA  . SER A 1 89  ? 28.641 16.187 25.954 1.00 9.36  ? 79  SER A CA  1 
ATOM   589 C  C   . SER A 1 89  ? 27.434 15.525 25.294 1.00 8.61  ? 79  SER A C   1 
ATOM   590 O  O   . SER A 1 89  ? 26.722 16.137 24.508 1.00 9.01  ? 79  SER A O   1 
ATOM   591 C  CB  . SER A 1 89  ? 29.939 15.751 25.259 1.00 9.74  ? 79  SER A CB  1 
ATOM   592 O  OG  . SER A 1 89  ? 29.859 15.940 23.854 1.00 10.87 ? 79  SER A OG  1 
ATOM   593 N  N   . ILE A 1 90  ? 27.249 14.243 25.581 1.00 9.48  ? 80  ILE A N   1 
ATOM   594 C  CA  . ILE A 1 90  ? 26.092 13.524 25.088 1.00 9.28  ? 80  ILE A CA  1 
ATOM   595 C  C   . ILE A 1 90  ? 24.770 14.194 25.490 1.00 8.24  ? 80  ILE A C   1 
ATOM   596 O  O   . ILE A 1 90  ? 23.893 14.412 24.644 1.00 8.99  ? 80  ILE A O   1 
ATOM   597 C  CB  . ILE A 1 90  ? 26.134 12.057 25.545 1.00 8.58  ? 80  ILE A CB  1 
ATOM   598 C  CG1 . ILE A 1 90  ? 27.303 11.337 24.859 1.00 13.00 ? 80  ILE A CG1 1 
ATOM   599 C  CG2 . ILE A 1 90  ? 24.820 11.342 25.247 1.00 8.99  ? 80  ILE A CG2 1 
ATOM   600 C  CD1 . ILE A 1 90  ? 27.668 9.995  25.455 1.00 12.61 ? 80  ILE A CD1 1 
ATOM   601 N  N   . ALA A 1 91  ? 24.654 14.571 26.763 1.00 7.82  ? 81  ALA A N   1 
ATOM   602 C  CA  . ALA A 1 91  ? 23.458 15.257 27.236 1.00 7.83  ? 81  ALA A CA  1 
ATOM   603 C  C   . ALA A 1 91  ? 23.243 16.574 26.498 1.00 7.54  ? 81  ALA A C   1 
ATOM   604 O  O   . ALA A 1 91  ? 22.128 16.894 26.073 1.00 8.98  ? 81  ALA A O   1 
ATOM   605 C  CB  . ALA A 1 91  ? 23.560 15.527 28.716 1.00 8.36  ? 81  ALA A CB  1 
HETATM 606 N  N   . MSE A 1 92  ? 24.329 17.318 26.289 1.00 8.95  ? 82  MSE A N   1 
HETATM 607 C  CA  . MSE A 1 92  ? 24.216 18.608 25.623 1.00 9.51  ? 82  MSE A CA  1 
HETATM 608 C  C   . MSE A 1 92  ? 23.763 18.439 24.177 1.00 9.34  ? 82  MSE A C   1 
HETATM 609 O  O   . MSE A 1 92  ? 22.938 19.215 23.683 1.00 9.44  ? 82  MSE A O   1 
HETATM 610 C  CB  . MSE A 1 92  ? 25.534 19.372 25.688 1.00 11.06 ? 82  MSE A CB  1 
HETATM 611 C  CG  . MSE A 1 92  ? 25.938 19.796 27.089 1.00 11.52 ? 82  MSE A CG  1 
HETATM 612 SE SE  . MSE A 1 92  ? 24.688 21.043 27.905 1.00 18.26 ? 82  MSE A SE  1 
HETATM 613 C  CE  . MSE A 1 92  ? 25.244 22.663 27.013 1.00 21.01 ? 82  MSE A CE  1 
ATOM   614 N  N   . LYS A 1 93  ? 24.256 17.398 23.514 1.00 8.82  ? 83  LYS A N   1 
ATOM   615 C  CA  . LYS A 1 93  ? 23.837 17.135 22.146 1.00 9.19  ? 83  LYS A CA  1 
ATOM   616 C  C   . LYS A 1 93  ? 22.346 16.793 22.089 1.00 7.78  ? 83  LYS A C   1 
ATOM   617 O  O   . LYS A 1 93  ? 21.611 17.284 21.238 1.00 9.43  ? 83  LYS A O   1 
ATOM   618 C  CB  . LYS A 1 93  ? 24.651 15.985 21.563 1.00 10.89 ? 83  LYS A CB  1 
ATOM   619 C  CG  . LYS A 1 93  ? 24.288 15.632 20.133 1.00 14.55 ? 83  LYS A CG  1 
ATOM   620 C  CD  . LYS A 1 93  ? 24.724 16.707 19.163 1.00 18.39 ? 83  LYS A CD  1 
ATOM   621 C  CE  . LYS A 1 93  ? 24.189 16.428 17.774 1.00 24.76 ? 83  LYS A CE  1 
ATOM   622 N  NZ  . LYS A 1 93  ? 25.189 16.743 16.724 1.00 21.67 ? 83  LYS A NZ  1 
ATOM   623 N  N   . LEU A 1 94  ? 21.896 15.955 23.019 1.00 8.19  ? 84  LEU A N   1 
ATOM   624 C  CA  . LEU A 1 94  ? 20.490 15.559 23.062 1.00 8.42  ? 84  LEU A CA  1 
ATOM   625 C  C   . LEU A 1 94  ? 19.589 16.757 23.358 1.00 6.96  ? 84  LEU A C   1 
ATOM   626 O  O   . LEU A 1 94  ? 18.502 16.889 22.784 1.00 8.78  ? 84  LEU A O   1 
ATOM   627 C  CB  . LEU A 1 94  ? 20.268 14.444 24.088 1.00 9.42  ? 84  LEU A CB  1 
ATOM   628 C  CG  . LEU A 1 94  ? 20.919 13.102 23.748 1.00 9.12  ? 84  LEU A CG  1 
ATOM   629 C  CD1 . LEU A 1 94  ? 20.897 12.190 24.955 1.00 9.50  ? 84  LEU A CD1 1 
ATOM   630 C  CD2 . LEU A 1 94  ? 20.234 12.444 22.565 1.00 10.67 ? 84  LEU A CD2 1 
ATOM   631 N  N   . ILE A 1 95  ? 20.037 17.638 24.249 1.00 8.21  ? 85  ILE A N   1 
ATOM   632 C  CA  . ILE A 1 95  ? 19.263 18.837 24.542 1.00 8.58  ? 85  ILE A CA  1 
ATOM   633 C  C   . ILE A 1 95  ? 19.096 19.719 23.305 1.00 8.84  ? 85  ILE A C   1 
ATOM   634 O  O   . ILE A 1 95  ? 17.992 20.162 22.990 1.00 9.55  ? 85  ILE A O   1 
ATOM   635 C  CB  . ILE A 1 95  ? 19.874 19.632 25.701 1.00 8.50  ? 85  ILE A CB  1 
ATOM   636 C  CG1 . ILE A 1 95  ? 19.683 18.875 27.019 1.00 8.98  ? 85  ILE A CG1 1 
ATOM   637 C  CG2 . ILE A 1 95  ? 19.304 21.049 25.754 1.00 10.35 ? 85  ILE A CG2 1 
ATOM   638 C  CD1 . ILE A 1 95  ? 20.479 19.453 28.184 1.00 10.18 ? 85  ILE A CD1 1 
ATOM   639 N  N   . LYS A 1 96  ? 20.180 19.909 22.562 1.00 9.18  ? 86  LYS A N   1 
ATOM   640 C  CA  . LYS A 1 96  ? 20.110 20.707 21.340 1.00 11.24 ? 86  LYS A CA  1 
ATOM   641 C  C   . LYS A 1 96  ? 19.166 20.083 20.324 1.00 11.17 ? 86  LYS A C   1 
ATOM   642 O  O   . LYS A 1 96  ? 18.327 20.766 19.730 1.00 11.63 ? 86  LYS A O   1 
ATOM   643 C  CB  . LYS A 1 96  ? 21.495 20.921 20.729 1.00 12.89 ? 86  LYS A CB  1 
ATOM   644 C  CG  . LYS A 1 96  ? 21.463 21.795 19.482 1.00 16.32 ? 86  LYS A CG  1 
ATOM   645 C  CD  . LYS A 1 96  ? 22.842 22.311 19.117 1.00 21.19 ? 86  LYS A CD  1 
ATOM   646 C  CE  . LYS A 1 96  ? 23.619 21.289 18.304 1.00 26.52 ? 86  LYS A CE  1 
ATOM   647 N  NZ  . LYS A 1 96  ? 24.714 21.927 17.507 1.00 27.57 ? 86  LYS A NZ  1 
ATOM   648 N  N   . LEU A 1 97  ? 19.292 18.777 20.128 1.00 11.25 ? 87  LEU A N   1 
ATOM   649 C  CA  . LEU A 1 97  ? 18.395 18.086 19.209 1.00 10.43 ? 87  LEU A CA  1 
ATOM   650 C  C   . LEU A 1 97  ? 16.931 18.250 19.614 1.00 10.31 ? 87  LEU A C   1 
ATOM   651 O  O   . LEU A 1 97  ? 16.074 18.538 18.776 1.00 11.23 ? 87  LEU A O   1 
ATOM   652 C  CB  . LEU A 1 97  ? 18.750 16.603 19.118 1.00 11.78 ? 87  LEU A CB  1 
ATOM   653 C  CG  . LEU A 1 97  ? 20.041 16.252 18.379 1.00 12.77 ? 87  LEU A CG  1 
ATOM   654 C  CD1 . LEU A 1 97  ? 20.338 14.772 18.591 1.00 14.20 ? 87  LEU A CD1 1 
ATOM   655 C  CD2 . LEU A 1 97  ? 19.903 16.583 16.878 1.00 15.57 ? 87  LEU A CD2 1 
ATOM   656 N  N   . LYS A 1 98  ? 16.644 18.087 20.901 1.00 10.15 ? 88  LYS A N   1 
ATOM   657 C  CA  . LYS A 1 98  ? 15.262 18.223 21.358 1.00 10.60 ? 88  LYS A CA  1 
ATOM   658 C  C   . LYS A 1 98  ? 14.749 19.659 21.171 1.00 11.74 ? 88  LYS A C   1 
ATOM   659 O  O   . LYS A 1 98  ? 13.605 19.871 20.771 1.00 12.97 ? 88  LYS A O   1 
ATOM   660 C  CB  . LYS A 1 98  ? 15.129 17.786 22.821 1.00 12.17 ? 88  LYS A CB  1 
ATOM   661 C  CG  . LYS A 1 98  ? 13.690 17.627 23.313 1.00 20.65 ? 88  LYS A CG  1 
ATOM   662 C  CD  . LYS A 1 98  ? 12.854 16.751 22.389 1.00 20.33 ? 88  LYS A CD  1 
ATOM   663 C  CE  . LYS A 1 98  ? 11.667 16.127 23.109 1.00 27.64 ? 88  LYS A CE  1 
ATOM   664 N  NZ  . LYS A 1 98  ? 10.475 16.013 22.225 1.00 30.37 ? 88  LYS A NZ  1 
ATOM   665 N  N   . LEU A 1 99  ? 15.584 20.646 21.478 1.00 11.20 ? 89  LEU A N   1 
ATOM   666 C  CA  . LEU A 1 99  ? 15.205 22.037 21.235 1.00 12.80 ? 89  LEU A CA  1 
ATOM   667 C  C   . LEU A 1 99  ? 14.904 22.322 19.759 1.00 13.57 ? 89  LEU A C   1 
ATOM   668 O  O   . LEU A 1 99  ? 14.108 23.205 19.431 1.00 15.49 ? 89  LEU A O   1 
ATOM   669 C  CB  . LEU A 1 99  ? 16.283 22.984 21.751 1.00 13.56 ? 89  LEU A CB  1 
ATOM   670 C  CG  . LEU A 1 99  ? 16.392 23.128 23.271 1.00 13.56 ? 89  LEU A CG  1 
ATOM   671 C  CD1 . LEU A 1 99  ? 17.678 23.852 23.633 1.00 16.11 ? 89  LEU A CD1 1 
ATOM   672 C  CD2 . LEU A 1 99  ? 15.170 23.869 23.820 1.00 14.02 ? 89  LEU A CD2 1 
ATOM   673 N  N   . GLN A 1 100 ? 15.611 21.634 18.874 1.00 12.16 ? 90  GLN A N   1 
ATOM   674 C  CA  . GLN A 1 100 ? 15.404 21.771 17.440 1.00 12.47 ? 90  GLN A CA  1 
ATOM   675 C  C   . GLN A 1 100 ? 14.174 21.003 16.961 1.00 12.59 ? 90  GLN A C   1 
ATOM   676 O  O   . GLN A 1 100 ? 13.825 21.062 15.790 1.00 14.34 ? 90  GLN A O   1 
ATOM   677 C  CB  . GLN A 1 100 ? 16.648 21.311 16.674 1.00 12.02 ? 90  GLN A CB  1 
ATOM   678 C  CG  . GLN A 1 100 ? 17.827 22.275 16.790 1.00 11.55 ? 90  GLN A CG  1 
ATOM   679 C  CD  . GLN A 1 100 ? 19.073 21.768 16.081 1.00 16.38 ? 90  GLN A CD  1 
ATOM   680 O  OE1 . GLN A 1 100 ? 19.296 20.561 15.976 1.00 21.12 ? 90  GLN A OE1 1 
ATOM   681 N  NE2 . GLN A 1 100 ? 19.941 22.689 15.693 1.00 21.94 ? 90  GLN A NE2 1 
ATOM   682 N  N   . GLY A 1 101 ? 13.573 20.219 17.856 1.00 13.94 ? 91  GLY A N   1 
ATOM   683 C  CA  . GLY A 1 101 ? 12.329 19.510 17.541 1.00 14.49 ? 91  GLY A CA  1 
ATOM   684 C  C   . GLY A 1 101 ? 12.478 18.059 17.115 1.00 12.76 ? 91  GLY A C   1 
ATOM   685 O  O   . GLY A 1 101 ? 11.505 17.426 16.703 1.00 14.69 ? 91  GLY A O   1 
ATOM   686 N  N   . TYR A 1 102 ? 13.684 17.510 17.237 1.00 13.43 ? 92  TYR A N   1 
ATOM   687 C  CA  . TYR A 1 102 ? 13.865 16.074 17.046 1.00 13.60 ? 92  TYR A CA  1 
ATOM   688 C  C   . TYR A 1 102 ? 13.243 15.285 18.187 1.00 14.35 ? 92  TYR A C   1 
ATOM   689 O  O   . TYR A 1 102 ? 13.164 15.757 19.317 1.00 15.83 ? 92  TYR A O   1 
ATOM   690 C  CB  . TYR A 1 102 ? 15.342 15.720 16.923 1.00 13.70 ? 92  TYR A CB  1 
ATOM   691 C  CG  . TYR A 1 102 ? 15.987 16.277 15.679 1.00 14.39 ? 92  TYR A CG  1 
ATOM   692 C  CD1 . TYR A 1 102 ? 16.561 17.543 15.678 1.00 14.48 ? 92  TYR A CD1 1 
ATOM   693 C  CD2 . TYR A 1 102 ? 15.985 15.553 14.492 1.00 14.95 ? 92  TYR A CD2 1 
ATOM   694 C  CE1 . TYR A 1 102 ? 17.132 18.069 14.525 1.00 14.61 ? 92  TYR A CE1 1 
ATOM   695 C  CE2 . TYR A 1 102 ? 16.529 16.080 13.328 1.00 16.60 ? 92  TYR A CE2 1 
ATOM   696 C  CZ  . TYR A 1 102 ? 17.116 17.324 13.357 1.00 14.07 ? 92  TYR A CZ  1 
ATOM   697 O  OH  . TYR A 1 102 ? 17.662 17.838 12.209 1.00 18.22 ? 92  TYR A OH  1 
ATOM   698 N  N   . GLN A 1 103 ? 12.808 14.068 17.890 1.00 14.02 ? 93  GLN A N   1 
ATOM   699 C  CA  . GLN A 1 103 ? 12.400 13.150 18.947 1.00 15.20 ? 93  GLN A CA  1 
ATOM   700 C  C   . GLN A 1 103 ? 13.627 12.470 19.545 1.00 12.67 ? 93  GLN A C   1 
ATOM   701 O  O   . GLN A 1 103 ? 14.580 12.151 18.828 1.00 16.53 ? 93  GLN A O   1 
ATOM   702 C  CB  . GLN A 1 103 ? 11.437 12.103 18.391 1.00 17.39 ? 93  GLN A CB  1 
ATOM   703 C  CG  . GLN A 1 103 ? 10.121 12.674 17.870 1.00 24.53 ? 93  GLN A CG  1 
ATOM   704 C  CD  . GLN A 1 103 ? 9.403  13.538 18.893 1.00 32.82 ? 93  GLN A CD  1 
ATOM   705 O  OE1 . GLN A 1 103 ? 9.224  13.142 20.049 1.00 38.23 ? 93  GLN A OE1 1 
ATOM   706 N  NE2 . GLN A 1 103 ? 8.961  14.717 18.463 1.00 37.57 ? 93  GLN A NE2 1 
ATOM   707 N  N   . LEU A 1 104 ? 13.578 12.200 20.846 1.00 11.92 ? 94  LEU A N   1 
ATOM   708 C  CA  . LEU A 1 104 ? 14.665 11.486 21.500 1.00 12.43 ? 94  LEU A CA  1 
ATOM   709 C  C   . LEU A 1 104 ? 14.616 10.009 21.138 1.00 12.70 ? 94  LEU A C   1 
ATOM   710 O  O   . LEU A 1 104 ? 13.538 9.431  21.003 1.00 13.32 ? 94  LEU A O   1 
ATOM   711 C  CB  . LEU A 1 104 ? 14.590 11.644 23.020 1.00 11.96 ? 94  LEU A CB  1 
ATOM   712 C  CG  . LEU A 1 104 ? 14.824 13.051 23.582 1.00 11.12 ? 94  LEU A CG  1 
ATOM   713 C  CD1 . LEU A 1 104 ? 14.500 13.074 25.067 1.00 14.58 ? 94  LEU A CD1 1 
ATOM   714 C  CD2 . LEU A 1 104 ? 16.258 13.477 23.339 1.00 14.15 ? 94  LEU A CD2 1 
ATOM   715 N  N   . PRO A 1 105 ? 15.787 9.367  21.079 1.00 13.13 ? 95  PRO A N   1 
ATOM   716 C  CA  . PRO A 1 105 ? 15.852 7.932  20.816 1.00 14.70 ? 95  PRO A CA  1 
ATOM   717 C  C   . PRO A 1 105 ? 15.511 7.094  22.051 1.00 14.97 ? 95  PRO A C   1 
ATOM   718 O  O   . PRO A 1 105 ? 15.589 7.576  23.175 1.00 15.48 ? 95  PRO A O   1 
ATOM   719 C  CB  . PRO A 1 105 ? 17.315 7.731  20.414 1.00 14.66 ? 95  PRO A CB  1 
ATOM   720 C  CG  . PRO A 1 105 ? 18.051 8.769  21.205 1.00 14.76 ? 95  PRO A CG  1 
ATOM   721 C  CD  . PRO A 1 105 ? 17.127 9.970  21.230 1.00 14.13 ? 95  PRO A CD  1 
ATOM   722 N  N   . SER A 1 106 ? 15.145 5.832  21.842 1.00 14.10 ? 96  SER A N   1 
ATOM   723 C  CA  . SER A 1 106 ? 14.781 4.952  22.952 1.00 16.25 ? 96  SER A CA  1 
ATOM   724 C  C   . SER A 1 106 ? 16.009 4.406  23.676 1.00 16.51 ? 96  SER A C   1 
ATOM   725 O  O   . SER A 1 106 ? 15.893 3.777  24.731 1.00 19.22 ? 96  SER A O   1 
ATOM   726 C  CB  . SER A 1 106 ? 13.910 3.795  22.456 1.00 16.61 ? 96  SER A CB  1 
ATOM   727 O  OG  . SER A 1 106 ? 14.640 2.941  21.590 1.00 19.75 ? 96  SER A OG  1 
ATOM   728 N  N   . ALA A 1 107 ? 17.141 4.457  22.986 1.00 14.46 ? 97  ALA A N   1 
ATOM   729 C  CA  . ALA A 1 107 ? 18.425 4.075  23.555 1.00 14.07 ? 97  ALA A CA  1 
ATOM   730 C  C   . ALA A 1 107 ? 19.485 4.964  22.921 1.00 11.49 ? 97  ALA A C   1 
ATOM   731 O  O   . ALA A 1 107 ? 19.251 5.598  21.877 1.00 13.03 ? 97  ALA A O   1 
ATOM   732 C  CB  . ALA A 1 107 ? 18.724 2.598  23.269 1.00 16.81 ? 97  ALA A CB  1 
ATOM   733 N  N   . LEU A 1 108 ? 20.623 5.082  23.592 1.00 12.84 ? 98  LEU A N   1 
ATOM   734 C  CA  . LEU A 1 108 ? 21.686 5.958  23.118 1.00 13.71 ? 98  LEU A CA  1 
ATOM   735 C  C   . LEU A 1 108 ? 22.245 5.458  21.781 1.00 13.54 ? 98  LEU A C   1 
ATOM   736 O  O   . LEU A 1 108 ? 22.663 4.307  21.682 1.00 14.31 ? 98  LEU A O   1 
ATOM   737 C  CB  . LEU A 1 108 ? 22.796 6.002  24.160 1.00 16.98 ? 98  LEU A CB  1 
ATOM   738 C  CG  . LEU A 1 108 ? 23.825 7.104  23.942 1.00 19.03 ? 98  LEU A CG  1 
ATOM   739 C  CD1 . LEU A 1 108 ? 23.139 8.469  23.925 1.00 18.78 ? 98  LEU A CD1 1 
ATOM   740 C  CD2 . LEU A 1 108 ? 24.874 7.033  25.029 1.00 24.52 ? 98  LEU A CD2 1 
ATOM   741 N  N   . PRO A 1 109 ? 22.156 6.278  20.723 1.00 12.12 ? 99  PRO A N   1 
ATOM   742 C  CA  . PRO A 1 109 ? 22.744 5.851  19.453 1.00 12.10 ? 99  PRO A CA  1 
ATOM   743 C  C   . PRO A 1 109 ? 24.241 5.579  19.599 1.00 13.11 ? 99  PRO A C   1 
ATOM   744 O  O   . PRO A 1 109 ? 24.975 6.409  20.141 1.00 12.81 ? 99  PRO A O   1 
ATOM   745 C  CB  . PRO A 1 109 ? 22.519 7.059  18.544 1.00 14.28 ? 99  PRO A CB  1 
ATOM   746 C  CG  . PRO A 1 109 ? 21.302 7.725  19.112 1.00 13.57 ? 99  PRO A CG  1 
ATOM   747 C  CD  . PRO A 1 109 ? 21.446 7.564  20.599 1.00 13.37 ? 99  PRO A CD  1 
ATOM   748 N  N   . PRO A 1 110 ? 24.698 4.405  19.136 1.00 12.91 ? 100 PRO A N   1 
ATOM   749 C  CA  . PRO A 1 110 ? 26.120 4.062  19.253 1.00 12.72 ? 100 PRO A CA  1 
ATOM   750 C  C   . PRO A 1 110 ? 27.054 5.124  18.663 1.00 13.67 ? 100 PRO A C   1 
ATOM   751 O  O   . PRO A 1 110 ? 28.107 5.403  19.241 1.00 15.75 ? 100 PRO A O   1 
ATOM   752 C  CB  . PRO A 1 110 ? 26.217 2.745  18.470 1.00 13.90 ? 100 PRO A CB  1 
ATOM   753 C  CG  . PRO A 1 110 ? 24.882 2.110  18.697 1.00 15.66 ? 100 PRO A CG  1 
ATOM   754 C  CD  . PRO A 1 110 ? 23.889 3.259  18.677 1.00 14.67 ? 100 PRO A CD  1 
ATOM   755 N  N   . VAL A 1 111 ? 26.617 5.813  17.613 1.00 13.56 ? 101 VAL A N   1 
ATOM   756 C  CA  . VAL A 1 111 ? 27.459 6.845  16.994 1.00 13.88 ? 101 VAL A CA  1 
ATOM   757 C  C   . VAL A 1 111 ? 27.746 8.019  17.944 1.00 15.60 ? 101 VAL A C   1 
ATOM   758 O  O   . VAL A 1 111 ? 28.720 8.750  17.760 1.00 17.62 ? 101 VAL A O   1 
ATOM   759 C  CB  . VAL A 1 111 ? 26.855 7.361  15.680 1.00 17.08 ? 101 VAL A CB  1 
ATOM   760 C  CG1 . VAL A 1 111 ? 25.588 8.159  15.944 1.00 16.22 ? 101 VAL A CG1 1 
ATOM   761 C  CG2 . VAL A 1 111 ? 27.885 8.183  14.908 1.00 19.95 ? 101 VAL A CG2 1 
HETATM 762 N  N   . MSE A 1 112 ? 26.934 8.166  18.989 1.00 15.31 ? 102 MSE A N   1 
HETATM 763 C  CA  . MSE A 1 112 ? 27.103 9.275  19.921 1.00 17.96 ? 102 MSE A CA  1 
HETATM 764 C  C   . MSE A 1 112 ? 28.199 9.006  20.933 1.00 18.22 ? 102 MSE A C   1 
HETATM 765 O  O   . MSE A 1 112 ? 28.581 9.905  21.692 1.00 20.16 ? 102 MSE A O   1 
HETATM 766 C  CB  . MSE A 1 112 ? 25.809 9.505  20.679 1.00 18.38 ? 102 MSE A CB  1 
HETATM 767 C  CG  . MSE A 1 112 ? 24.751 10.214 19.902 1.00 22.08 ? 102 MSE A CG  1 
HETATM 768 SE SE  . MSE A 1 112 ? 23.496 11.056 21.135 1.00 26.76 ? 102 MSE A SE  1 
HETATM 769 C  CE  . MSE A 1 112 ? 24.429 12.699 21.439 1.00 24.07 ? 102 MSE A CE  1 
ATOM   770 N  N   . LYS A 1 113 ? 28.518 7.729  21.108 1.00 20.00 ? 103 LYS A N   1 
ATOM   771 C  CA  . LYS A 1 113 ? 29.493 7.308  22.105 1.00 23.64 ? 103 LYS A CA  1 
ATOM   772 C  C   . LYS A 1 113 ? 30.910 7.412  21.566 1.00 26.17 ? 103 LYS A C   1 
ATOM   773 O  O   . LYS A 1 113 ? 31.875 7.349  22.328 1.00 29.04 ? 103 LYS A O   1 
ATOM   774 C  CB  . LYS A 1 113 ? 29.207 5.876  22.561 1.00 24.35 ? 103 LYS A CB  1 
ATOM   775 C  CG  . LYS A 1 113 ? 27.797 5.674  23.097 1.00 28.86 ? 103 LYS A CG  1 
ATOM   776 C  CD  . LYS A 1 113 ? 27.396 4.208  23.087 1.00 34.18 ? 103 LYS A CD  1 
ATOM   777 C  CE  . LYS A 1 113 ? 25.902 4.055  22.848 1.00 35.62 ? 103 LYS A CE  1 
ATOM   778 N  NZ  . LYS A 1 113 ? 25.390 2.726  23.297 1.00 39.01 ? 103 LYS A NZ  1 
HETATM 779 CA CA  . CA  B 2 .   ? 27.866 8.410  34.792 1.00 11.60 ? 201 CA  A CA  1 
HETATM 780 S  S   . SO4 C 3 .   ? 23.628 21.630 13.932 1.00 29.31 ? 301 SO4 A S   1 
HETATM 781 O  O1  . SO4 C 3 .   ? 23.870 21.206 12.558 1.00 34.87 ? 301 SO4 A O1  1 
HETATM 782 O  O2  . SO4 C 3 .   ? 22.197 21.851 14.123 1.00 32.63 ? 301 SO4 A O2  1 
HETATM 783 O  O3  . SO4 C 3 .   ? 24.090 20.583 14.845 1.00 33.44 ? 301 SO4 A O3  1 
HETATM 784 O  O4  . SO4 C 3 .   ? 24.329 22.888 14.190 1.00 34.29 ? 301 SO4 A O4  1 
HETATM 785 O  O   . HOH D 4 .   ? 35.370 14.246 33.067 1.00 12.68 ? 401 HOH A O   1 
HETATM 786 O  O   . HOH D 4 .   ? 31.596 17.989 27.647 1.00 12.00 ? 402 HOH A O   1 
HETATM 787 O  O   . HOH D 4 .   ? 30.159 8.591  35.498 1.00 14.53 ? 403 HOH A O   1 
HETATM 788 O  O   . HOH D 4 .   ? 38.600 18.642 26.446 1.00 14.13 ? 404 HOH A O   1 
HETATM 789 O  O   . HOH D 4 .   ? 37.221 19.087 23.163 1.00 15.49 ? 405 HOH A O   1 
HETATM 790 O  O   . HOH D 4 .   ? 35.939 20.434 30.527 1.00 14.29 ? 406 HOH A O   1 
HETATM 791 O  O   . HOH D 4 .   ? 20.943 5.904  32.922 1.00 16.78 ? 407 HOH A O   1 
HETATM 792 O  O   . HOH D 4 .   ? 31.431 13.999 22.586 1.00 15.11 ? 408 HOH A O   1 
HETATM 793 O  O   . HOH D 4 .   ? 24.585 16.121 6.926  1.00 20.37 ? 409 HOH A O   1 
HETATM 794 O  O   . HOH D 4 .   ? 22.705 5.153  27.831 1.00 16.10 ? 410 HOH A O   1 
HETATM 795 O  O   . HOH D 4 .   ? 32.242 7.809  33.872 1.00 22.27 ? 411 HOH A O   1 
HETATM 796 O  O   . HOH D 4 .   ? 36.800 18.944 20.455 1.00 17.35 ? 412 HOH A O   1 
HETATM 797 O  O   . HOH D 4 .   ? 18.456 20.310 12.425 1.00 19.97 ? 413 HOH A O   1 
HETATM 798 O  O   . HOH D 4 .   ? 14.646 14.448 36.695 1.00 17.69 ? 414 HOH A O   1 
HETATM 799 O  O   . HOH D 4 .   ? 25.565 12.098 41.931 1.00 18.33 ? 415 HOH A O   1 
HETATM 800 O  O   . HOH D 4 .   ? 30.508 6.674  31.649 1.00 21.18 ? 416 HOH A O   1 
HETATM 801 O  O   . HOH D 4 .   ? 39.247 18.387 29.134 1.00 19.27 ? 417 HOH A O   1 
HETATM 802 O  O   . HOH D 4 .   ? 36.929 16.494 32.831 1.00 18.66 ? 418 HOH A O   1 
HETATM 803 O  O   . HOH D 4 .   ? 20.583 3.957  26.467 1.00 17.79 ? 419 HOH A O   1 
HETATM 804 O  O   . HOH D 4 .   ? 16.963 18.323 34.326 1.00 18.85 ? 420 HOH A O   1 
HETATM 805 O  O   . HOH D 4 .   ? 14.385 5.861  8.303  1.00 23.44 ? 421 HOH A O   1 
HETATM 806 O  O   . HOH D 4 .   ? 9.197  23.541 27.220 1.00 16.95 ? 422 HOH A O   1 
HETATM 807 O  O   . HOH D 4 .   ? 13.966 23.096 31.791 1.00 21.89 ? 423 HOH A O   1 
HETATM 808 O  O   . HOH D 4 .   ? 11.106 12.668 22.276 1.00 22.72 ? 424 HOH A O   1 
HETATM 809 O  O   . HOH D 4 .   ? 27.958 9.517  11.040 1.00 18.23 ? 425 HOH A O   1 
HETATM 810 O  O   . HOH D 4 .   ? 21.818 10.954 39.827 1.00 17.25 ? 426 HOH A O   1 
HETATM 811 O  O   . HOH D 4 .   ? 34.868 11.984 30.274 1.00 22.43 ? 427 HOH A O   1 
HETATM 812 O  O   . HOH D 4 .   ? 32.164 8.033  30.115 1.00 27.50 ? 428 HOH A O   1 
HETATM 813 O  O   . HOH D 4 .   ? 38.946 16.139 43.986 1.00 20.72 ? 429 HOH A O   1 
HETATM 814 O  O   . HOH D 4 .   ? 12.925 13.162 15.119 1.00 24.59 ? 430 HOH A O   1 
HETATM 815 O  O   . HOH D 4 .   ? 30.267 18.528 42.190 1.00 22.19 ? 431 HOH A O   1 
HETATM 816 O  O   . HOH D 4 .   ? 38.615 21.502 23.242 1.00 22.15 ? 432 HOH A O   1 
HETATM 817 O  O   . HOH D 4 .   ? 24.169 10.549 12.936 1.00 21.40 ? 433 HOH A O   1 
HETATM 818 O  O   . HOH D 4 .   ? 16.366 15.447 34.631 1.00 22.70 ? 434 HOH A O   1 
HETATM 819 O  O   . HOH D 4 .   ? 35.014 11.192 23.906 1.00 28.34 ? 435 HOH A O   1 
HETATM 820 O  O   . HOH D 4 .   ? 34.113 16.512 13.840 1.00 28.55 ? 436 HOH A O   1 
HETATM 821 O  O   . HOH D 4 .   ? 14.203 11.878 37.583 1.00 19.59 ? 437 HOH A O   1 
HETATM 822 O  O   . HOH D 4 .   ? 29.306 18.457 44.787 1.00 21.84 ? 438 HOH A O   1 
HETATM 823 O  O   . HOH D 4 .   ? 20.704 8.766  41.123 1.00 19.38 ? 439 HOH A O   1 
HETATM 824 O  O   . HOH D 4 .   ? 31.244 15.824 41.830 1.00 19.19 ? 440 HOH A O   1 
HETATM 825 O  O   . HOH D 4 .   ? 17.857 28.312 27.558 1.00 27.40 ? 441 HOH A O   1 
HETATM 826 O  O   . HOH D 4 .   ? 29.835 11.163 18.105 1.00 20.98 ? 442 HOH A O   1 
HETATM 827 O  O   . HOH D 4 .   ? 23.012 17.392 14.739 1.00 24.25 ? 443 HOH A O   1 
HETATM 828 O  O   . HOH D 4 .   ? 19.045 25.697 37.604 1.00 21.93 ? 444 HOH A O   1 
HETATM 829 O  O   . HOH D 4 .   ? 27.990 18.490 8.409  1.00 22.10 ? 445 HOH A O   1 
HETATM 830 O  O   . HOH D 4 .   ? 38.679 20.908 19.562 1.00 27.06 ? 446 HOH A O   1 
HETATM 831 O  O   . HOH D 4 .   ? 19.748 16.222 11.242 1.00 25.15 ? 447 HOH A O   1 
HETATM 832 O  O   . HOH D 4 .   ? 33.018 9.686  23.370 1.00 33.28 ? 448 HOH A O   1 
HETATM 833 O  O   . HOH D 4 .   ? 19.601 4.537  29.860 1.00 20.73 ? 449 HOH A O   1 
HETATM 834 O  O   . HOH D 4 .   ? 28.889 14.799 12.636 1.00 24.68 ? 450 HOH A O   1 
HETATM 835 O  O   . HOH D 4 .   ? 24.026 22.924 38.564 1.00 24.42 ? 451 HOH A O   1 
HETATM 836 O  O   . HOH D 4 .   ? 28.216 12.167 43.102 1.00 30.00 ? 452 HOH A O   1 
HETATM 837 O  O   . HOH D 4 .   ? 25.435 21.152 21.219 1.00 27.04 ? 453 HOH A O   1 
HETATM 838 O  O   . HOH D 4 .   ? 26.219 23.682 19.637 1.00 29.92 ? 454 HOH A O   1 
HETATM 839 O  O   . HOH D 4 .   ? 36.999 12.142 32.673 1.00 27.59 ? 455 HOH A O   1 
HETATM 840 O  O   . HOH D 4 .   ? 27.044 16.298 14.072 1.00 24.86 ? 456 HOH A O   1 
HETATM 841 O  O   . HOH D 4 .   ? 21.398 6.593  35.211 1.00 21.69 ? 457 HOH A O   1 
HETATM 842 O  O   . HOH D 4 .   ? 34.371 13.524 42.153 1.00 27.77 ? 458 HOH A O   1 
HETATM 843 O  O   . HOH D 4 .   ? 22.497 17.114 7.937  1.00 29.38 ? 459 HOH A O   1 
HETATM 844 O  O   . HOH D 4 .   ? 20.000 10.436 5.932  1.00 21.39 ? 460 HOH A O   1 
HETATM 845 O  O   . HOH D 4 .   ? 23.078 13.647 42.784 1.00 27.06 ? 461 HOH A O   1 
HETATM 846 O  O   . HOH D 4 .   ? 37.038 13.263 29.031 1.00 21.57 ? 462 HOH A O   1 
HETATM 847 O  O   . HOH D 4 .   ? 13.558 2.819  26.224 1.00 23.88 ? 463 HOH A O   1 
HETATM 848 O  O   . HOH D 4 .   ? 7.638  17.157 36.159 1.00 26.94 ? 464 HOH A O   1 
HETATM 849 O  O   . HOH D 4 .   ? 21.846 19.578 16.073 1.00 27.56 ? 465 HOH A O   1 
HETATM 850 O  O   . HOH D 4 .   ? 36.977 15.165 45.748 1.00 24.43 ? 466 HOH A O   1 
HETATM 851 O  O   . HOH D 4 .   ? 26.516 7.209  11.427 1.00 24.73 ? 467 HOH A O   1 
HETATM 852 O  O   . HOH D 4 .   ? 11.707 14.508 8.332  1.00 43.55 ? 468 HOH A O   1 
HETATM 853 O  O   . HOH D 4 .   ? 37.854 21.555 34.642 1.00 28.62 ? 469 HOH A O   1 
HETATM 854 O  O   . HOH D 4 .   ? 37.028 23.243 24.787 1.00 26.08 ? 470 HOH A O   1 
HETATM 855 O  O   . HOH D 4 .   ? 11.680 9.149  22.927 1.00 29.40 ? 471 HOH A O   1 
HETATM 856 O  O   . HOH D 4 .   ? 30.025 13.359 41.439 1.00 19.71 ? 472 HOH A O   1 
HETATM 857 O  O   . HOH D 4 .   ? 32.349 11.833 41.950 1.00 18.43 ? 473 HOH A O   1 
HETATM 858 O  O   . HOH D 4 .   ? 30.005 16.155 45.763 1.00 26.04 ? 474 HOH A O   1 
HETATM 859 O  O   . HOH D 4 .   ? 30.375 20.594 46.171 1.00 27.42 ? 475 HOH A O   1 
HETATM 860 O  O   . HOH D 4 .   ? 21.884 16.750 10.045 1.00 25.14 ? 476 HOH A O   1 
HETATM 861 O  O   . HOH D 4 .   ? 35.534 16.875 47.490 1.00 28.40 ? 477 HOH A O   1 
HETATM 862 O  O   . HOH D 4 .   ? 8.239  22.781 24.643 1.00 22.22 ? 478 HOH A O   1 
HETATM 863 O  O   . HOH D 4 .   ? 25.921 9.144  41.942 1.00 25.61 ? 479 HOH A O   1 
HETATM 864 O  O   . HOH D 4 .   ? 30.752 11.277 22.486 1.00 26.09 ? 480 HOH A O   1 
HETATM 865 O  O   . HOH D 4 .   ? 35.689 9.972  33.210 1.00 29.86 ? 481 HOH A O   1 
HETATM 866 O  O   . HOH D 4 .   ? 34.596 13.920 44.664 1.00 34.88 ? 482 HOH A O   1 
HETATM 867 O  O   . HOH D 4 .   ? 11.008 12.909 25.461 1.00 28.74 ? 483 HOH A O   1 
HETATM 868 O  O   . HOH D 4 .   ? 30.024 10.314 12.512 1.00 27.88 ? 484 HOH A O   1 
HETATM 869 O  O   . HOH D 4 .   ? 13.855 2.464  19.335 1.00 27.51 ? 485 HOH A O   1 
HETATM 870 O  O   . HOH D 4 .   ? 29.895 2.948  19.653 1.00 42.10 ? 486 HOH A O   1 
HETATM 871 O  O   . HOH D 4 .   ? 31.000 4.297  30.740 1.00 34.59 ? 487 HOH A O   1 
HETATM 872 O  O   . HOH D 4 .   ? 31.125 20.917 41.491 1.00 36.45 ? 488 HOH A O   1 
HETATM 873 O  O   . HOH D 4 .   ? 39.046 11.886 37.750 1.00 27.96 ? 489 HOH A O   1 
HETATM 874 O  O   . HOH D 4 .   ? 26.663 4.876  10.051 1.00 30.48 ? 490 HOH A O   1 
HETATM 875 O  O   . HOH D 4 .   ? 19.770 28.957 29.422 1.00 28.84 ? 491 HOH A O   1 
HETATM 876 O  O   . HOH D 4 .   ? 22.423 5.048  39.539 1.00 30.15 ? 492 HOH A O   1 
HETATM 877 O  O   . HOH D 4 .   ? 12.197 7.253  7.776  1.00 31.67 ? 493 HOH A O   1 
HETATM 878 O  O   . HOH D 4 .   ? 10.448 16.736 19.749 1.00 28.41 ? 494 HOH A O   1 
HETATM 879 O  O   . HOH D 4 .   ? 31.858 14.978 44.277 1.00 32.59 ? 495 HOH A O   1 
HETATM 880 O  O   . HOH D 4 .   ? 36.341 20.024 33.082 1.00 31.53 ? 497 HOH A O   1 
HETATM 881 O  O   . HOH D 4 .   ? 25.768 1.558  28.292 1.00 31.37 ? 498 HOH A O   1 
HETATM 882 O  O   . HOH D 4 .   ? 5.895  17.173 33.971 1.00 25.58 ? 499 HOH A O   1 
HETATM 883 O  O   . HOH D 4 .   ? 32.748 14.055 20.195 1.00 27.53 ? 500 HOH A O   1 
HETATM 884 O  O   . HOH D 4 .   ? 39.611 22.654 20.914 1.00 28.05 ? 501 HOH A O   1 
HETATM 885 O  O   . HOH D 4 .   ? 26.385 20.251 6.887  1.00 23.56 ? 502 HOH A O   1 
HETATM 886 O  O   . HOH D 4 .   ? 21.252 20.124 12.169 1.00 27.88 ? 503 HOH A O   1 
HETATM 887 O  O   . HOH D 4 .   ? 22.285 3.574  30.148 1.00 30.83 ? 504 HOH A O   1 
HETATM 888 O  O   . HOH D 4 .   ? 32.681 27.663 23.913 1.00 40.32 ? 505 HOH A O   1 
HETATM 889 O  O   . HOH D 4 .   ? 27.510 1.919  37.441 1.00 38.12 ? 506 HOH A O   1 
HETATM 890 O  O   . HOH D 4 .   ? 37.892 22.345 14.938 1.00 36.03 ? 507 HOH A O   1 
HETATM 891 O  O   . HOH D 4 .   ? 26.541 18.610 44.038 1.00 26.43 ? 508 HOH A O   1 
HETATM 892 O  O   . HOH D 4 .   ? 33.819 25.023 19.475 1.00 29.68 ? 510 HOH A O   1 
HETATM 893 O  O   . HOH D 4 .   ? 10.405 19.518 36.901 1.00 24.19 ? 511 HOH A O   1 
HETATM 894 O  O   . HOH D 4 .   ? 38.761 21.900 26.489 1.00 29.59 ? 513 HOH A O   1 
HETATM 895 O  O   . HOH D 4 .   ? 40.679 19.758 16.690 1.00 40.28 ? 514 HOH A O   1 
HETATM 896 O  O   . HOH D 4 .   ? 27.005 18.408 12.446 1.00 45.60 ? 516 HOH A O   1 
HETATM 897 O  O   . HOH D 4 .   ? 28.664 24.035 17.927 1.00 52.01 ? 517 HOH A O   1 
HETATM 898 O  O   . HOH D 4 .   ? 37.116 22.824 17.671 1.00 37.37 ? 518 HOH A O   1 
HETATM 899 O  O   . HOH D 4 .   ? 3.780  15.838 34.361 1.00 31.11 ? 519 HOH A O   1 
HETATM 900 O  O   . HOH D 4 .   ? 10.036 20.560 23.810 1.00 31.92 ? 520 HOH A O   1 
HETATM 901 O  O   . HOH D 4 .   ? 6.888  15.961 27.445 1.00 22.17 ? 521 HOH A O   1 
HETATM 902 O  O   . HOH D 4 .   ? 24.252 20.669 46.049 1.00 26.52 ? 522 HOH A O   1 
HETATM 903 O  O   . HOH D 4 .   ? 24.795 3.430  26.508 1.00 35.19 ? 524 HOH A O   1 
HETATM 904 O  O   . HOH D 4 .   ? 31.398 4.763  38.605 1.00 32.22 ? 525 HOH A O   1 
HETATM 905 O  O   . HOH D 4 .   ? 22.521 1.766  22.291 1.00 31.84 ? 528 HOH A O   1 
HETATM 906 O  O   . HOH D 4 .   ? 29.404 21.353 14.717 1.00 32.87 ? 529 HOH A O   1 
HETATM 907 O  O   . HOH D 4 .   ? 23.488 22.385 41.620 1.00 39.00 ? 530 HOH A O   1 
HETATM 908 O  O   . HOH D 4 .   ? 31.044 12.265 24.549 1.00 37.68 ? 531 HOH A O   1 
HETATM 909 O  O   . HOH D 4 .   ? 32.241 3.018  34.550 1.00 32.92 ? 532 HOH A O   1 
HETATM 910 O  O   . HOH D 4 .   ? 10.271 15.454 15.296 1.00 31.49 ? 533 HOH A O   1 
HETATM 911 O  O   . HOH D 4 .   ? 28.308 14.008 45.989 1.00 48.76 ? 534 HOH A O   1 
HETATM 912 O  O   . HOH D 4 .   ? 32.196 10.354 44.216 1.00 34.65 ? 535 HOH A O   1 
HETATM 913 O  O   . HOH D 4 .   ? 28.665 13.163 48.622 1.00 40.01 ? 536 HOH A O   1 
HETATM 914 O  O   . HOH D 4 .   ? 32.433 7.656  44.196 1.00 34.97 ? 537 HOH A O   1 
HETATM 915 O  O   . HOH D 4 .   ? 36.394 11.582 43.612 1.00 50.86 ? 538 HOH A O   1 
HETATM 916 O  O   . HOH D 4 .   ? 33.624 9.043  20.486 1.00 32.38 ? 539 HOH A O   1 
HETATM 917 O  O   . HOH D 4 .   ? 15.675 12.209 0.841  1.00 30.14 ? 540 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N  N   . THR A 16  ? 0.4039 0.4070 0.3812 0.0053  0.0108  -0.0120 6   THR A N   
2   C  CA  . THR A 16  ? 0.3764 0.3937 0.3797 -0.0024 0.0014  -0.0136 6   THR A CA  
3   C  C   . THR A 16  ? 0.3459 0.3331 0.3357 0.0118  -0.0124 -0.0206 6   THR A C   
4   O  O   . THR A 16  ? 0.3498 0.3225 0.3758 0.0305  -0.0135 -0.0415 6   THR A O   
5   C  CB  . THR A 16  ? 0.4096 0.4212 0.3877 0.0021  -0.0007 0.0008  6   THR A CB  
6   N  N   . PRO A 17  ? 0.3454 0.3377 0.3494 0.0224  -0.0135 -0.0105 7   PRO A N   
7   C  CA  . PRO A 17  ? 0.3266 0.3043 0.3323 0.0195  -0.0017 0.0041  7   PRO A CA  
8   C  C   . PRO A 17  ? 0.3060 0.2891 0.3184 0.0235  -0.0019 -0.0003 7   PRO A C   
9   O  O   . PRO A 17  ? 0.3254 0.3144 0.3637 0.0333  0.0168  -0.0092 7   PRO A O   
10  C  CB  . PRO A 17  ? 0.3395 0.3378 0.3436 0.0262  -0.0111 0.0026  7   PRO A CB  
11  C  CG  . PRO A 17  ? 0.3632 0.3287 0.3366 0.0108  -0.0186 -0.0069 7   PRO A CG  
12  C  CD  . PRO A 17  ? 0.3485 0.3521 0.3435 0.0072  -0.0088 -0.0185 7   PRO A CD  
13  N  N   . PHE A 18  ? 0.2475 0.2821 0.2332 0.0346  0.0003  -0.0136 8   PHE A N   
14  C  CA  . PHE A 18  ? 0.2003 0.2304 0.2023 -0.0030 0.0311  -0.0228 8   PHE A CA  
15  C  C   . PHE A 18  ? 0.2333 0.2613 0.2474 0.0018  0.0057  -0.0223 8   PHE A C   
16  O  O   . PHE A 18  ? 0.2476 0.2608 0.2065 -0.0276 0.0140  -0.0173 8   PHE A O   
17  C  CB  . PHE A 18  ? 0.1685 0.1840 0.1596 0.0035  0.0115  -0.0252 8   PHE A CB  
18  C  CG  . PHE A 18  ? 0.1238 0.1407 0.1604 0.0000  0.0308  0.0006  8   PHE A CG  
19  C  CD1 . PHE A 18  ? 0.1202 0.1154 0.1921 -0.0172 0.0148  -0.0110 8   PHE A CD1 
20  C  CD2 . PHE A 18  ? 0.1215 0.1752 0.1689 0.0020  0.0440  -0.0048 8   PHE A CD2 
21  C  CE1 . PHE A 18  ? 0.1440 0.1377 0.1557 0.0253  0.0308  0.0060  8   PHE A CE1 
22  C  CE2 . PHE A 18  ? 0.1933 0.1357 0.1384 0.0059  0.0492  -0.0129 8   PHE A CE2 
23  C  CZ  . PHE A 18  ? 0.1554 0.1334 0.1577 0.0020  0.0207  -0.0007 8   PHE A CZ  
24  N  N   . GLY A 19  ? 0.2402 0.3047 0.2409 0.0059  0.0156  -0.0601 9   GLY A N   
25  C  CA  . GLY A 19  ? 0.2607 0.3151 0.2485 -0.0003 0.0153  -0.0409 9   GLY A CA  
26  C  C   . GLY A 19  ? 0.2487 0.3303 0.2540 0.0044  0.0121  -0.0300 9   GLY A C   
27  O  O   . GLY A 19  ? 0.2778 0.3595 0.2565 -0.0031 0.0220  -0.0234 9   GLY A O   
28  N  N   . GLY A 20  ? 0.2249 0.2888 0.2439 -0.0003 0.0031  -0.0331 10  GLY A N   
29  C  CA  . GLY A 20  ? 0.2197 0.2778 0.2474 0.0068  0.0155  -0.0308 10  GLY A CA  
30  C  C   . GLY A 20  ? 0.2177 0.2532 0.1939 -0.0031 0.0033  -0.0148 10  GLY A C   
31  O  O   . GLY A 20  ? 0.2268 0.2729 0.2393 -0.0119 0.0207  -0.0534 10  GLY A O   
32  N  N   . SER A 21  ? 0.2017 0.2484 0.2047 0.0104  -0.0103 -0.0230 11  SER A N   
33  C  CA  . SER A 21  ? 0.2087 0.2093 0.1827 0.0044  -0.0105 -0.0232 11  SER A CA  
34  C  C   . SER A 21  ? 0.2019 0.1941 0.1970 -0.0039 0.0008  -0.0167 11  SER A C   
35  O  O   . SER A 21  ? 0.1913 0.1790 0.1711 -0.0174 0.0028  -0.0111 11  SER A O   
36  C  CB  . SER A 21  ? 0.2548 0.2237 0.2044 -0.0064 -0.0105 -0.0100 11  SER A CB  
37  O  OG  . SER A 21  ? 0.2749 0.2034 0.2305 0.0400  -0.0215 -0.0177 11  SER A OG  
38  N  N   . LEU A 22  ? 0.1882 0.1639 0.1798 -0.0229 0.0119  -0.0205 12  LEU A N   
39  C  CA  . LEU A 22  ? 0.1752 0.1614 0.1638 -0.0201 0.0218  -0.0287 12  LEU A CA  
40  C  C   . LEU A 22  ? 0.1795 0.1685 0.1504 0.0071  0.0157  -0.0206 12  LEU A C   
41  O  O   . LEU A 22  ? 0.2307 0.1927 0.1652 0.0218  -0.0208 -0.0315 12  LEU A O   
42  C  CB  . LEU A 22  ? 0.1802 0.1705 0.1622 -0.0428 0.0422  -0.0429 12  LEU A CB  
43  C  CG  . LEU A 22  ? 0.1829 0.2138 0.1774 -0.0383 0.0303  -0.0504 12  LEU A CG  
44  C  CD1 . LEU A 22  ? 0.2030 0.2562 0.2284 -0.0872 0.0566  -0.0532 12  LEU A CD1 
45  C  CD2 . LEU A 22  ? 0.2256 0.2124 0.2913 -0.0127 0.0103  -0.0375 12  LEU A CD2 
46  N  N   . ASP A 23  ? 0.1835 0.1577 0.1426 -0.0125 0.0231  -0.0328 13  ASP A N   
47  C  CA  . ASP A 23  ? 0.1886 0.1645 0.1543 0.0042  0.0310  -0.0337 13  ASP A CA  
48  C  C   . ASP A 23  ? 0.1730 0.1687 0.1548 -0.0246 0.0278  -0.0322 13  ASP A C   
49  O  O   . ASP A 23  ? 0.2091 0.1915 0.1814 -0.0365 0.0312  -0.0794 13  ASP A O   
50  C  CB  . ASP A 23  ? 0.2086 0.1563 0.1505 -0.0025 0.0532  -0.0335 13  ASP A CB  
51  C  CG  . ASP A 23  ? 0.2059 0.1619 0.1400 0.0034  0.0373  -0.0151 13  ASP A CG  
52  O  OD1 . ASP A 23  ? 0.2131 0.3077 0.1982 0.0166  0.0311  -0.0180 13  ASP A OD1 
53  O  OD2 . ASP A 23  ? 0.2220 0.1837 0.1552 0.0029  0.0429  -0.0183 13  ASP A OD2 
54  N  N   . THR A 24  ? 0.1425 0.1376 0.1343 -0.0047 0.0390  -0.0179 14  THR A N   
55  C  CA  . THR A 24  ? 0.1639 0.1523 0.1427 -0.0026 0.0099  -0.0225 14  THR A CA  
56  C  C   . THR A 24  ? 0.1724 0.1610 0.1371 0.0048  0.0080  -0.0289 14  THR A C   
57  O  O   . THR A 24  ? 0.2180 0.2066 0.1587 -0.0062 0.0156  -0.0347 14  THR A O   
58  C  CB  . THR A 24  ? 0.1578 0.1410 0.1411 -0.0002 0.0190  -0.0109 14  THR A CB  
59  O  OG1 . THR A 24  ? 0.1938 0.2072 0.1638 0.0135  0.0074  -0.0132 14  THR A OG1 
60  C  CG2 . THR A 24  ? 0.1900 0.1350 0.1606 0.0020  0.0200  -0.0259 14  THR A CG2 
61  N  N   . TRP A 25  ? 0.1827 0.2137 0.1518 0.0041  0.0055  0.0136  15  TRP A N   
62  C  CA  . TRP A 25  ? 0.1795 0.2488 0.1658 0.0052  0.0161  0.0178  15  TRP A CA  
63  C  C   . TRP A 25  ? 0.1966 0.3041 0.1952 0.0059  0.0070  0.0142  15  TRP A C   
64  O  O   . TRP A 25  ? 0.2458 0.3803 0.2312 -0.0012 0.0018  0.0606  15  TRP A O   
65  C  CB  . TRP A 25  ? 0.1934 0.2541 0.2300 -0.0030 0.0265  0.0112  15  TRP A CB  
66  C  CG  . TRP A 25  ? 0.1954 0.2232 0.1970 0.0219  0.0295  0.0369  15  TRP A CG  
67  C  CD1 . TRP A 25  ? 0.2194 0.1641 0.2177 0.0149  0.0329  -0.0087 15  TRP A CD1 
68  C  CD2 . TRP A 25  ? 0.2329 0.1059 0.2226 -0.0033 0.0274  0.0019  15  TRP A CD2 
69  N  NE1 . TRP A 25  ? 0.2710 0.1862 0.2226 -0.0288 0.0147  -0.0094 15  TRP A NE1 
70  C  CE2 . TRP A 25  ? 0.2256 0.1434 0.2228 -0.0200 0.0415  0.0041  15  TRP A CE2 
71  C  CE3 . TRP A 25  ? 0.2257 0.1956 0.2486 -0.0055 0.0650  -0.0171 15  TRP A CE3 
72  C  CZ2 . TRP A 25  ? 0.2993 0.2502 0.2615 -0.0118 0.0239  -0.0244 15  TRP A CZ2 
73  C  CZ3 . TRP A 25  ? 0.3176 0.2722 0.3060 0.0058  0.0197  -0.0177 15  TRP A CZ3 
74  C  CH2 . TRP A 25  ? 0.2972 0.2305 0.2592 0.0036  0.0314  -0.0213 15  TRP A CH2 
75  N  N   . ALA A 26  ? 0.1712 0.2646 0.1859 -0.0151 0.0214  0.0096  16  ALA A N   
76  C  CA  . ALA A 26  ? 0.1922 0.2752 0.1918 -0.0019 0.0108  0.0000  16  ALA A CA  
77  C  C   . ALA A 26  ? 0.2140 0.2855 0.2276 0.0011  0.0023  0.0069  16  ALA A C   
78  O  O   . ALA A 26  ? 0.2343 0.2869 0.2416 0.0150  -0.0261 -0.0096 16  ALA A O   
79  C  CB  . ALA A 26  ? 0.1883 0.2922 0.2061 -0.0163 0.0560  -0.0068 16  ALA A CB  
80  N  N   . ILE A 27  ? 0.1630 0.2442 0.1637 -0.0148 0.0070  0.0188  17  ILE A N   
81  C  CA  . ILE A 27  ? 0.1636 0.2553 0.1539 -0.0064 0.0139  0.0393  17  ILE A CA  
82  C  C   . ILE A 27  ? 0.1857 0.2642 0.1783 -0.0120 0.0157  0.0292  17  ILE A C   
83  O  O   . ILE A 27  ? 0.1867 0.2772 0.1961 -0.0246 0.0346  0.0364  17  ILE A O   
84  C  CB  . ILE A 27  ? 0.1677 0.2455 0.1396 -0.0117 0.0256  0.0338  17  ILE A CB  
85  C  CG1 . ILE A 27  ? 0.1470 0.2792 0.1349 -0.0126 0.0196  0.0044  17  ILE A CG1 
86  C  CG2 . ILE A 27  ? 0.1924 0.2500 0.1771 0.0040  0.0000  0.0288  17  ILE A CG2 
87  C  CD1 . ILE A 27  ? 0.1911 0.2625 0.1455 0.0168  0.0173  0.0241  17  ILE A CD1 
88  N  N   . THR A 28  ? 0.1662 0.2702 0.1289 -0.0336 0.0165  0.0326  18  THR A N   
89  C  CA  . THR A 28  ? 0.1785 0.2878 0.1547 -0.0263 0.0240  0.0428  18  THR A CA  
90  C  C   . THR A 28  ? 0.1601 0.2784 0.1579 -0.0137 0.0134  0.0236  18  THR A C   
91  O  O   . THR A 28  ? 0.1810 0.2971 0.1359 0.0000  0.0294  0.0441  18  THR A O   
92  C  CB  . THR A 28  ? 0.1998 0.2776 0.1570 -0.0307 -0.0087 0.0443  18  THR A CB  
93  O  OG1 . THR A 28  ? 0.2199 0.2986 0.1847 -0.0452 0.0184  0.0466  18  THR A OG1 
94  C  CG2 . THR A 28  ? 0.2318 0.3234 0.1371 -0.0370 -0.0253 0.0573  18  THR A CG2 
95  N  N   . VAL A 29  ? 0.1949 0.2809 0.1803 -0.0344 0.0160  0.0320  19  VAL A N   
96  C  CA  . VAL A 29  ? 0.1768 0.2862 0.1853 -0.0255 0.0140  0.0206  19  VAL A CA  
97  C  C   . VAL A 29  ? 0.1694 0.2690 0.1943 -0.0316 0.0173  0.0319  19  VAL A C   
98  O  O   . VAL A 29  ? 0.1637 0.2521 0.1824 -0.0469 0.0076  0.0294  19  VAL A O   
99  C  CB  . VAL A 29  ? 0.1849 0.3114 0.2456 -0.0348 0.0098  -0.0067 19  VAL A CB  
100 C  CG1 . VAL A 29  ? 0.2148 0.3497 0.2428 -0.0265 -0.0049 0.0137  19  VAL A CG1 
101 C  CG2 . VAL A 29  ? 0.2204 0.3092 0.2724 -0.0227 0.0079  0.0088  19  VAL A CG2 
102 N  N   . GLU A 30  ? 0.1619 0.2959 0.2122 -0.0229 0.0195  0.0413  20  GLU A N   
103 C  CA  . GLU A 30  ? 0.2171 0.2778 0.2292 -0.0242 0.0074  0.0472  20  GLU A CA  
104 C  C   . GLU A 30  ? 0.1918 0.2484 0.1889 -0.0159 -0.0078 0.0488  20  GLU A C   
105 O  O   . GLU A 30  ? 0.1941 0.2725 0.1771 -0.0349 0.0128  0.0603  20  GLU A O   
106 C  CB  . GLU A 30  ? 0.2656 0.3219 0.2645 -0.0051 -0.0019 0.0485  20  GLU A CB  
107 C  CG  . GLU A 30  ? 0.3409 0.3650 0.3268 -0.0056 0.0029  0.0277  20  GLU A CG  
108 C  CD  . GLU A 30  ? 0.4358 0.4544 0.4451 -0.0054 -0.0080 0.0174  20  GLU A CD  
109 O  OE1 . GLU A 30  ? 0.5278 0.5346 0.4521 0.0038  -0.0268 0.0201  20  GLU A OE1 
110 O  OE2 . GLU A 30  ? 0.5015 0.4285 0.5184 0.0203  -0.0054 0.0152  20  GLU A OE2 
111 N  N   . GLU A 31  ? 0.1972 0.2602 0.1415 -0.0223 0.0000  0.0641  21  GLU A N   
112 C  CA  . GLU A 31  ? 0.1585 0.2284 0.1583 -0.0118 -0.0120 0.0538  21  GLU A CA  
113 C  C   . GLU A 31  ? 0.1457 0.2083 0.1401 -0.0103 -0.0044 0.0315  21  GLU A C   
114 O  O   . GLU A 31  ? 0.1692 0.2069 0.1577 0.0021  0.0124  0.0302  21  GLU A O   
115 C  CB  . GLU A 31  ? 0.1770 0.2519 0.1520 -0.0051 -0.0237 0.0433  21  GLU A CB  
116 C  CG  . GLU A 31  ? 0.1896 0.3011 0.1996 -0.0133 -0.0236 0.0675  21  GLU A CG  
117 C  CD  . GLU A 31  ? 0.1962 0.2495 0.1733 -0.0085 -0.0172 0.0558  21  GLU A CD  
118 O  OE1 . GLU A 31  ? 0.1713 0.3137 0.2313 0.0011  0.0028  0.0745  21  GLU A OE1 
119 O  OE2 . GLU A 31  ? 0.1550 0.3869 0.3318 -0.0002 -0.0311 0.0426  21  GLU A OE2 
120 N  N   . ARG A 32  ? 0.1330 0.2079 0.1643 -0.0246 -0.0061 0.0468  22  ARG A N   
121 C  CA  . ARG A 32  ? 0.1395 0.1934 0.1543 -0.0079 -0.0093 0.0279  22  ARG A CA  
122 C  C   . ARG A 32  ? 0.1309 0.1803 0.1561 -0.0241 0.0151  0.0520  22  ARG A C   
123 O  O   . ARG A 32  ? 0.1592 0.2010 0.1722 -0.0083 -0.0096 0.0438  22  ARG A O   
124 C  CB  . ARG A 32  ? 0.1331 0.1719 0.1559 0.0174  0.0002  0.0447  22  ARG A CB  
125 C  CG  . ARG A 32  ? 0.1308 0.1935 0.1501 -0.0086 0.0178  0.0426  22  ARG A CG  
126 C  CD  . ARG A 32  ? 0.1662 0.2000 0.1268 -0.0276 0.0092  0.0510  22  ARG A CD  
127 N  NE  . ARG A 32  ? 0.1244 0.1540 0.1416 0.0009  0.0135  0.0491  22  ARG A NE  
128 C  CZ  . ARG A 32  ? 0.1522 0.1853 0.1468 0.0243  0.0042  -0.0058 22  ARG A CZ  
129 N  NH1 . ARG A 32  ? 0.1495 0.2301 0.1593 0.0067  0.0163  -0.0014 22  ARG A NH1 
130 N  NH2 . ARG A 32  ? 0.1362 0.1783 0.1701 0.0044  0.0061  0.0186  22  ARG A NH2 
131 N  N   . ALA A 33  ? 0.1445 0.1856 0.1974 -0.0271 -0.0096 0.0546  23  ALA A N   
132 C  CA  . ALA A 33  ? 0.1777 0.1785 0.1991 -0.0527 0.0002  0.0547  23  ALA A CA  
133 C  C   . ALA A 33  ? 0.1746 0.1794 0.2056 -0.0254 -0.0118 0.0516  23  ALA A C   
134 O  O   . ALA A 33  ? 0.1947 0.1926 0.2176 -0.0382 -0.0066 0.0654  23  ALA A O   
135 C  CB  . ALA A 33  ? 0.1935 0.1900 0.2221 -0.0498 0.0104  0.0513  23  ALA A CB  
136 N  N   . LYS A 34  ? 0.1844 0.1920 0.1904 -0.0210 -0.0161 0.0692  24  LYS A N   
137 C  CA  . LYS A 34  ? 0.2120 0.1910 0.1857 -0.0220 -0.0142 0.0585  24  LYS A CA  
138 C  C   . LYS A 34  ? 0.2067 0.1484 0.1878 -0.0212 -0.0016 0.0442  24  LYS A C   
139 O  O   . LYS A 34  ? 0.2145 0.2074 0.2184 -0.0187 0.0000  0.0417  24  LYS A O   
140 C  CB  . LYS A 34  ? 0.2243 0.2063 0.2145 -0.0295 -0.0094 0.0732  24  LYS A CB  
141 C  CG  . LYS A 34  ? 0.2527 0.3035 0.2534 -0.0188 -0.0022 0.0656  24  LYS A CG  
142 C  CD  . LYS A 34  ? 0.2993 0.3450 0.3181 0.0039  -0.0032 0.0521  24  LYS A CD  
143 C  CE  . LYS A 34  ? 0.3920 0.4447 0.4219 0.0088  0.0142  -0.0132 24  LYS A CE  
144 N  NZ  . LYS A 34  ? 0.4611 0.5058 0.5070 -0.0222 -0.0089 0.0103  24  LYS A NZ  
145 N  N   . HIS A 35  ? 0.1895 0.1536 0.1722 -0.0121 -0.0039 0.0460  25  HIS A N   
146 C  CA  . HIS A 35  ? 0.1818 0.1698 0.1289 -0.0052 -0.0086 0.0307  25  HIS A CA  
147 C  C   . HIS A 35  ? 0.1490 0.1582 0.1502 -0.0112 -0.0127 0.0181  25  HIS A C   
148 O  O   . HIS A 35  ? 0.1620 0.1579 0.1543 -0.0224 -0.0166 0.0133  25  HIS A O   
149 C  CB  . HIS A 35  ? 0.1699 0.1630 0.1357 -0.0070 -0.0160 0.0073  25  HIS A CB  
150 C  CG  . HIS A 35  ? 0.1345 0.1750 0.1184 -0.0097 0.0007  0.0332  25  HIS A CG  
151 N  ND1 . HIS A 35  ? 0.1564 0.1944 0.1235 -0.0278 0.0084  0.0368  25  HIS A ND1 
152 C  CD2 . HIS A 35  ? 0.1648 0.1782 0.1455 -0.0193 0.0131  0.0459  25  HIS A CD2 
153 C  CE1 . HIS A 35  ? 0.1430 0.2092 0.1269 -0.0090 -0.0043 0.0392  25  HIS A CE1 
154 N  NE2 . HIS A 35  ? 0.1798 0.1867 0.1447 -0.0050 0.0110  0.0372  25  HIS A NE2 
155 N  N   . ASP A 36  ? 0.1611 0.1751 0.1732 -0.0156 -0.0171 0.0227  26  ASP A N   
156 C  CA  . ASP A 36  ? 0.1707 0.1710 0.1826 -0.0108 -0.0250 0.0137  26  ASP A CA  
157 C  C   . ASP A 36  ? 0.1804 0.1627 0.1780 -0.0352 -0.0448 0.0308  26  ASP A C   
158 O  O   . ASP A 36  ? 0.1999 0.2139 0.1893 -0.0388 -0.0229 0.0319  26  ASP A O   
159 C  CB  . ASP A 36  ? 0.1630 0.1995 0.1937 -0.0173 -0.0038 0.0161  26  ASP A CB  
160 C  CG  . ASP A 36  ? 0.1306 0.2141 0.1733 -0.0202 -0.0265 0.0214  26  ASP A CG  
161 O  OD1 . ASP A 36  ? 0.1222 0.1953 0.1674 -0.0240 0.0052  0.0396  26  ASP A OD1 
162 O  OD2 . ASP A 36  ? 0.1570 0.2649 0.1807 0.0163  -0.0010 0.0400  26  ASP A OD2 
163 N  N   . GLN A 37  ? 0.2030 0.1605 0.2249 -0.0342 -0.0525 0.0149  27  GLN A N   
164 C  CA  . GLN A 37  ? 0.2445 0.1771 0.2498 -0.0269 -0.0318 0.0222  27  GLN A CA  
165 C  C   . GLN A 37  ? 0.2362 0.2017 0.2312 -0.0072 -0.0447 0.0186  27  GLN A C   
166 O  O   . GLN A 37  ? 0.2605 0.1943 0.2576 -0.0508 -0.0300 0.0231  27  GLN A O   
167 C  CB  . GLN A 37  ? 0.2762 0.1881 0.2616 -0.0314 -0.0144 0.0303  27  GLN A CB  
168 C  CG  . GLN A 37  ? 0.3343 0.3110 0.3630 -0.0010 -0.0152 0.0085  27  GLN A CG  
169 C  CD  . GLN A 37  ? 0.4125 0.4017 0.4306 -0.0085 -0.0284 0.0157  27  GLN A CD  
170 O  OE1 . GLN A 37  ? 0.4354 0.3491 0.4013 -0.0362 -0.0346 0.0163  27  GLN A OE1 
171 N  NE2 . GLN A 37  ? 0.4689 0.4813 0.4953 -0.0028 -0.0161 0.0292  27  GLN A NE2 
172 N  N   . GLN A 38  ? 0.2234 0.1639 0.2428 -0.0407 -0.0340 0.0311  28  GLN A N   
173 C  CA  . GLN A 38  ? 0.2253 0.1721 0.2288 -0.0094 -0.0460 0.0173  28  GLN A CA  
174 C  C   . GLN A 38  ? 0.1873 0.1464 0.2190 -0.0019 -0.0284 0.0134  28  GLN A C   
175 O  O   . GLN A 38  ? 0.2446 0.1667 0.2283 -0.0025 -0.0199 0.0129  28  GLN A O   
176 C  CB  . GLN A 38  ? 0.2611 0.1450 0.2661 -0.0237 -0.0566 0.0207  28  GLN A CB  
177 C  CG  . GLN A 38  ? 0.3055 0.1962 0.2580 -0.0115 -0.0275 0.0191  28  GLN A CG  
178 C  CD  . GLN A 38  ? 0.3755 0.3049 0.3502 0.0027  0.0043  -0.0035 28  GLN A CD  
179 O  OE1 . GLN A 38  ? 0.3846 0.3776 0.4107 0.0223  0.0175  -0.0011 28  GLN A OE1 
180 N  NE2 . GLN A 38  ? 0.4483 0.3704 0.4233 -0.0114 0.0055  0.0251  28  GLN A NE2 
181 N  N   . PHE A 39  ? 0.1880 0.1327 0.1928 -0.0134 -0.0256 0.0146  29  PHE A N   
182 C  CA  . PHE A 39  ? 0.1773 0.1443 0.1596 -0.0106 -0.0252 -0.0062 29  PHE A CA  
183 C  C   . PHE A 39  ? 0.1919 0.1443 0.1715 -0.0087 -0.0154 -0.0037 29  PHE A C   
184 O  O   . PHE A 39  ? 0.2020 0.1801 0.1670 -0.0214 -0.0297 -0.0406 29  PHE A O   
185 C  CB  . PHE A 39  ? 0.1705 0.0961 0.1571 0.0126  -0.0005 -0.0093 29  PHE A CB  
186 C  CG  . PHE A 39  ? 0.1437 0.1409 0.1222 -0.0194 -0.0365 -0.0015 29  PHE A CG  
187 C  CD1 . PHE A 39  ? 0.1448 0.1320 0.1253 -0.0129 0.0035  -0.0154 29  PHE A CD1 
188 C  CD2 . PHE A 39  ? 0.1249 0.1667 0.1453 -0.0196 -0.0048 0.0017  29  PHE A CD2 
189 C  CE1 . PHE A 39  ? 0.1507 0.1391 0.1276 -0.0208 -0.0102 -0.0302 29  PHE A CE1 
190 C  CE2 . PHE A 39  ? 0.1399 0.1583 0.1774 -0.0180 -0.0119 -0.0013 29  PHE A CE2 
191 C  CZ  . PHE A 39  ? 0.1615 0.1400 0.1171 -0.0223 -0.0042 -0.0029 29  PHE A CZ  
192 N  N   . HIS A 40  ? 0.1955 0.1713 0.1815 -0.0367 -0.0353 -0.0224 30  HIS A N   
193 C  CA  . HIS A 40  ? 0.2131 0.1853 0.2175 -0.0326 -0.0213 -0.0163 30  HIS A CA  
194 C  C   . HIS A 40  ? 0.2274 0.2015 0.2405 -0.0048 -0.0248 -0.0138 30  HIS A C   
195 O  O   . HIS A 40  ? 0.2586 0.1904 0.2435 -0.0193 -0.0406 -0.0180 30  HIS A O   
196 C  CB  . HIS A 40  ? 0.2061 0.2190 0.2295 -0.0365 -0.0295 0.0082  30  HIS A CB  
197 C  CG  . HIS A 40  ? 0.2522 0.2144 0.2439 -0.0267 -0.0258 -0.0273 30  HIS A CG  
198 N  ND1 . HIS A 40  ? 0.2264 0.2897 0.2320 -0.0124 -0.0189 -0.0322 30  HIS A ND1 
199 C  CD2 . HIS A 40  ? 0.2976 0.2867 0.3431 -0.0166 -0.0149 -0.0171 30  HIS A CD2 
200 C  CE1 . HIS A 40  ? 0.2594 0.3159 0.3009 -0.0313 -0.0172 -0.0092 30  HIS A CE1 
201 N  NE2 . HIS A 40  ? 0.2777 0.2985 0.3066 -0.0034 -0.0561 -0.0039 30  HIS A NE2 
202 N  N   . SER A 41  ? 0.2589 0.1915 0.2547 -0.0006 -0.0380 -0.0104 31  SER A N   
203 C  CA  . SER A 41  ? 0.2771 0.2100 0.2609 0.0034  -0.0267 -0.0245 31  SER A CA  
204 C  C   . SER A 41  ? 0.2666 0.2209 0.2670 0.0027  -0.0169 -0.0379 31  SER A C   
205 O  O   . SER A 41  ? 0.2830 0.2179 0.2895 -0.0076 -0.0071 -0.0520 31  SER A O   
206 C  CB  . SER A 41  ? 0.3015 0.2431 0.3223 0.0104  -0.0377 -0.0019 31  SER A CB  
207 O  OG  . SER A 41  ? 0.3539 0.2590 0.3587 -0.0065 -0.0438 0.0019  31  SER A OG  
208 N  N   . LEU A 42  ? 0.2381 0.1826 0.2200 -0.0086 -0.0227 -0.0254 32  LEU A N   
209 C  CA  . LEU A 42  ? 0.2285 0.1984 0.2362 -0.0076 -0.0122 -0.0572 32  LEU A CA  
210 C  C   . LEU A 42  ? 0.2523 0.2178 0.2408 -0.0002 -0.0073 -0.0409 32  LEU A C   
211 O  O   . LEU A 42  ? 0.2643 0.2592 0.2208 -0.0011 0.0032  -0.0396 32  LEU A O   
212 C  CB  . LEU A 42  ? 0.2610 0.1770 0.2453 -0.0178 -0.0232 -0.0457 32  LEU A CB  
213 C  CG  . LEU A 42  ? 0.2173 0.1718 0.3023 0.0000  -0.0224 -0.0575 32  LEU A CG  
214 C  CD1 . LEU A 42  ? 0.2357 0.2196 0.2401 -0.0272 -0.0353 -0.0695 32  LEU A CD1 
215 C  CD2 . LEU A 42  ? 0.2555 0.2297 0.2840 0.0082  -0.0242 -0.0612 32  LEU A CD2 
216 N  N   . LYS A 43  ? 0.2211 0.2229 0.2172 -0.0046 -0.0249 -0.0467 33  LYS A N   
217 C  CA  . LYS A 43  ? 0.2609 0.2522 0.2375 -0.0060 -0.0306 -0.0265 33  LYS A CA  
218 C  C   . LYS A 43  ? 0.2127 0.2436 0.1942 -0.0066 -0.0322 -0.0236 33  LYS A C   
219 O  O   . LYS A 43  ? 0.2364 0.2884 0.2399 -0.0011 -0.0085 -0.0260 33  LYS A O   
220 C  CB  . LYS A 43  ? 0.3008 0.2678 0.2691 0.0107  -0.0255 -0.0253 33  LYS A CB  
221 C  CG  . LYS A 43  ? 0.4009 0.3439 0.3534 0.0068  -0.0169 0.0037  33  LYS A CG  
222 C  CD  . LYS A 43  ? 0.4570 0.4663 0.4964 -0.0135 0.0039  0.0027  33  LYS A CD  
223 C  CE  . LYS A 43  ? 0.4902 0.4834 0.5185 -0.0119 -0.0005 0.0099  33  LYS A CE  
224 N  NZ  . LYS A 43  ? 0.5188 0.5371 0.5595 -0.0057 0.0106  0.0107  33  LYS A NZ  
225 N  N   . PRO A 44  ? 0.1815 0.2193 0.1749 -0.0141 -0.0160 -0.0139 34  PRO A N   
226 C  CA  . PRO A 44  ? 0.1686 0.2224 0.1516 -0.0056 -0.0152 -0.0114 34  PRO A CA  
227 C  C   . PRO A 44  ? 0.1754 0.2460 0.1524 -0.0142 -0.0099 -0.0077 34  PRO A C   
228 O  O   . PRO A 44  ? 0.1601 0.2649 0.1697 -0.0236 -0.0199 -0.0181 34  PRO A O   
229 C  CB  . PRO A 44  ? 0.1820 0.1971 0.1589 -0.0098 -0.0210 -0.0255 34  PRO A CB  
230 C  CG  . PRO A 44  ? 0.2498 0.2113 0.2085 -0.0030 0.0190  -0.0052 34  PRO A CG  
231 C  CD  . PRO A 44  ? 0.1947 0.2423 0.1504 -0.0194 -0.0259 -0.0351 34  PRO A CD  
232 N  N   . ILE A 45  ? 0.1595 0.2402 0.1384 -0.0041 -0.0174 0.0003  35  ILE A N   
233 C  CA  . ILE A 45  ? 0.1658 0.2564 0.1507 -0.0075 0.0059  0.0027  35  ILE A CA  
234 C  C   . ILE A 45  ? 0.1319 0.2098 0.1448 -0.0150 0.0070  0.0136  35  ILE A C   
235 O  O   . ILE A 45  ? 0.1504 0.2157 0.1375 -0.0113 0.0097  -0.0161 35  ILE A O   
236 C  CB  . ILE A 45  ? 0.1518 0.2550 0.1420 0.0007  -0.0038 0.0220  35  ILE A CB  
237 C  CG1 . ILE A 45  ? 0.1740 0.2629 0.1840 -0.0010 -0.0011 -0.0077 35  ILE A CG1 
238 C  CG2 . ILE A 45  ? 0.1247 0.2938 0.1912 0.0221  -0.0361 0.0200  35  ILE A CG2 
239 C  CD1 . ILE A 45  ? 0.2163 0.2901 0.2183 0.0071  0.0254  -0.0101 35  ILE A CD1 
240 N  N   . SER A 46  ? 0.1325 0.2375 0.1531 -0.0151 0.0139  -0.0129 36  SER A N   
241 C  CA  . SER A 46  ? 0.1403 0.2112 0.1659 -0.0098 -0.0113 -0.0036 36  SER A CA  
242 C  C   . SER A 46  ? 0.1286 0.2308 0.1644 -0.0119 -0.0068 -0.0055 36  SER A C   
243 O  O   . SER A 46  ? 0.1418 0.2383 0.2136 -0.0187 -0.0013 0.0022  36  SER A O   
244 C  CB  . SER A 46  ? 0.1507 0.2036 0.1725 -0.0132 0.0012  0.0141  36  SER A CB  
245 O  OG  . SER A 46  ? 0.2263 0.2471 0.2025 -0.0125 -0.0233 0.0234  36  SER A OG  
246 N  N   . GLY A 47  ? 0.1078 0.2195 0.1511 -0.0038 -0.0190 -0.0037 37  GLY A N   
247 C  CA  . GLY A 47  ? 0.1148 0.2597 0.1577 -0.0170 -0.0109 -0.0112 37  GLY A CA  
248 C  C   . GLY A 47  ? 0.1113 0.2342 0.1306 0.0002  0.0013  0.0012  37  GLY A C   
249 O  O   . GLY A 47  ? 0.1286 0.2165 0.1335 -0.0014 -0.0164 -0.0049 37  GLY A O   
250 N  N   . PHE A 48  ? 0.1215 0.1914 0.1419 -0.0128 0.0139  -0.0133 38  PHE A N   
251 C  CA  . PHE A 48  ? 0.1106 0.1905 0.1238 -0.0005 -0.0002 -0.0016 38  PHE A CA  
252 C  C   . PHE A 48  ? 0.1119 0.1837 0.1277 -0.0094 0.0049  -0.0017 38  PHE A C   
253 O  O   . PHE A 48  ? 0.1182 0.1851 0.1487 -0.0108 -0.0181 -0.0051 38  PHE A O   
254 C  CB  . PHE A 48  ? 0.1699 0.2020 0.1215 -0.0023 0.0023  0.0075  38  PHE A CB  
255 C  CG  . PHE A 48  ? 0.1739 0.1976 0.1815 0.0202  -0.0115 0.0208  38  PHE A CG  
256 C  CD1 . PHE A 48  ? 0.1294 0.1924 0.1506 0.0080  0.0166  0.0110  38  PHE A CD1 
257 C  CD2 . PHE A 48  ? 0.1582 0.2078 0.2203 0.0344  0.0099  0.0370  38  PHE A CD2 
258 C  CE1 . PHE A 48  ? 0.1766 0.2213 0.2151 0.0177  -0.0137 0.0270  38  PHE A CE1 
259 C  CE2 . PHE A 48  ? 0.2077 0.2128 0.2482 0.0414  -0.0149 0.0145  38  PHE A CE2 
260 C  CZ  . PHE A 48  ? 0.2054 0.2194 0.2450 0.0209  0.0104  0.0130  38  PHE A CZ  
261 N  N   . ILE A 49  ? 0.1008 0.1933 0.1296 0.0116  -0.0050 0.0019  39  ILE A N   
262 C  CA  . ILE A 49  ? 0.1208 0.1764 0.1451 0.0111  -0.0012 0.0163  39  ILE A CA  
263 C  C   . ILE A 49  ? 0.1330 0.1621 0.1187 0.0119  -0.0006 0.0023  39  ILE A C   
264 O  O   . ILE A 49  ? 0.1347 0.1762 0.1203 0.0147  -0.0026 0.0099  39  ILE A O   
265 C  CB  . ILE A 49  ? 0.1185 0.1620 0.1400 -0.0018 -0.0080 0.0126  39  ILE A CB  
266 C  CG1 . ILE A 49  ? 0.1343 0.1843 0.1587 0.0028  -0.0113 0.0216  39  ILE A CG1 
267 C  CG2 . ILE A 49  ? 0.1534 0.1698 0.1933 -0.0131 0.0090  0.0163  39  ILE A CG2 
268 C  CD1 . ILE A 49  ? 0.1554 0.1879 0.1552 -0.0064 0.0044  0.0446  39  ILE A CD1 
269 N  N   . THR A 50  ? 0.1305 0.2186 0.1005 -0.0068 0.0027  0.0045  40  THR A N   
270 C  CA  . THR A 50  ? 0.1444 0.1831 0.1237 -0.0065 0.0002  0.0098  40  THR A CA  
271 C  C   . THR A 50  ? 0.1307 0.1638 0.1398 -0.0075 -0.0009 -0.0023 40  THR A C   
272 O  O   . THR A 50  ? 0.1519 0.1531 0.1193 -0.0055 0.0046  -0.0017 40  THR A O   
273 C  CB  . THR A 50  ? 0.1571 0.2089 0.1156 0.0087  -0.0134 0.0072  40  THR A CB  
274 O  OG1 . THR A 50  ? 0.1783 0.2169 0.1521 0.0035  -0.0035 -0.0140 40  THR A OG1 
275 C  CG2 . THR A 50  ? 0.1787 0.2586 0.1520 0.0054  -0.0288 0.0180  40  THR A CG2 
276 N  N   . GLY A 51  ? 0.1260 0.1814 0.1458 -0.0278 0.0163  0.0237  41  GLY A N   
277 C  CA  . GLY A 51  ? 0.1125 0.1800 0.1319 -0.0051 -0.0087 0.0046  41  GLY A CA  
278 C  C   . GLY A 51  ? 0.1345 0.1824 0.1198 -0.0219 -0.0021 -0.0053 41  GLY A C   
279 O  O   . GLY A 51  ? 0.1339 0.1853 0.1380 -0.0111 -0.0018 0.0163  41  GLY A O   
280 N  N   . ASP A 52  ? 0.1355 0.1849 0.1286 -0.0241 0.0057  -0.0087 42  ASP A N   
281 C  CA  . ASP A 52  ? 0.1777 0.1967 0.1197 -0.0046 0.0109  -0.0081 42  ASP A CA  
282 C  C   . ASP A 52  ? 0.1561 0.2128 0.1175 -0.0120 0.0114  -0.0182 42  ASP A C   
283 O  O   . ASP A 52  ? 0.1724 0.2147 0.0924 0.0061  0.0067  -0.0146 42  ASP A O   
284 C  CB  . ASP A 52  ? 0.2193 0.2438 0.1190 -0.0040 0.0218  -0.0162 42  ASP A CB  
285 C  CG  . ASP A 52  ? 0.2689 0.2706 0.2017 -0.0102 -0.0110 0.0103  42  ASP A CG  
286 O  OD1 . ASP A 52  ? 0.3013 0.3617 0.3029 0.0327  -0.0275 -0.0302 42  ASP A OD1 
287 O  OD2 . ASP A 52  ? 0.3852 0.3504 0.2631 -0.0051 -0.0128 -0.0261 42  ASP A OD2 
288 N  N   . GLN A 53  ? 0.1577 0.2093 0.1152 -0.0112 0.0095  0.0024  43  GLN A N   
289 C  CA  . GLN A 53  ? 0.1601 0.1811 0.1359 -0.0174 -0.0022 -0.0094 43  GLN A CA  
290 C  C   . GLN A 53  ? 0.1344 0.1512 0.1258 -0.0171 0.0010  -0.0119 43  GLN A C   
291 O  O   . GLN A 53  ? 0.1648 0.1538 0.1474 -0.0200 0.0012  -0.0033 43  GLN A O   
292 C  CB  . GLN A 53  ? 0.1534 0.2230 0.1798 -0.0499 -0.0013 -0.0190 43  GLN A CB  
293 C  CG  . GLN A 53  ? 0.2755 0.3022 0.2652 -0.0261 0.0039  -0.0054 43  GLN A CG  
294 C  CD  . GLN A 53  ? 0.2757 0.3272 0.2924 0.0175  -0.0251 -0.0145 43  GLN A CD  
295 O  OE1 . GLN A 53  ? 0.2336 0.3192 0.3238 -0.0088 -0.0331 -0.0970 43  GLN A OE1 
296 N  NE2 . GLN A 53  ? 0.3336 0.3843 0.3092 -0.0079 -0.0013 -0.0211 43  GLN A NE2 
297 N  N   . ALA A 54  ? 0.1260 0.1590 0.0990 -0.0166 0.0016  -0.0117 44  ALA A N   
298 C  CA  . ALA A 54  ? 0.1229 0.1349 0.0768 -0.0128 0.0060  -0.0011 44  ALA A CA  
299 C  C   . ALA A 54  ? 0.1338 0.1383 0.0904 -0.0093 0.0242  0.0176  44  ALA A C   
300 O  O   . ALA A 54  ? 0.1554 0.1114 0.1067 0.0074  0.0123  0.0031  44  ALA A O   
301 C  CB  . ALA A 54  ? 0.1510 0.1416 0.1190 0.0139  0.0208  0.0003  44  ALA A CB  
302 N  N   . ARG A 55  ? 0.1107 0.1230 0.1097 -0.0037 0.0219  -0.0007 45  ARG A N   
303 C  CA  . ARG A 55  ? 0.1140 0.1281 0.1172 -0.0022 0.0160  -0.0015 45  ARG A CA  
304 C  C   . ARG A 55  ? 0.1438 0.1515 0.1030 -0.0050 0.0149  -0.0173 45  ARG A C   
305 O  O   . ARG A 55  ? 0.1326 0.1389 0.1283 -0.0085 0.0219  -0.0139 45  ARG A O   
306 C  CB  . ARG A 55  ? 0.1237 0.1454 0.1256 -0.0323 0.0353  -0.0211 45  ARG A CB  
307 C  CG  . ARG A 55  ? 0.1675 0.1415 0.1050 -0.0210 0.0101  -0.0171 45  ARG A CG  
308 C  CD  . ARG A 55  ? 0.1503 0.1453 0.1279 -0.0154 0.0025  0.0240  45  ARG A CD  
309 N  NE  . ARG A 55  ? 0.1320 0.1745 0.1154 -0.0298 0.0145  0.0350  45  ARG A NE  
310 C  CZ  . ARG A 55  ? 0.1707 0.1266 0.1476 -0.0135 0.0211  -0.0021 45  ARG A CZ  
311 N  NH1 . ARG A 55  ? 0.1562 0.1077 0.1740 -0.0021 0.0125  -0.0031 45  ARG A NH1 
312 N  NH2 . ARG A 55  ? 0.1562 0.1636 0.1166 -0.0247 0.0235  0.0318  45  ARG A NH2 
313 N  N   . ASN A 56  ? 0.1569 0.1684 0.1377 -0.0009 0.0267  -0.0213 46  ASN A N   
314 C  CA  . ASN A 56  ? 0.2069 0.1783 0.1524 -0.0071 -0.0015 -0.0214 46  ASN A CA  
315 C  C   . ASN A 56  ? 0.1591 0.1422 0.1462 0.0143  0.0031  -0.0277 46  ASN A C   
316 O  O   . ASN A 56  ? 0.1796 0.1354 0.1589 0.0065  0.0135  -0.0198 46  ASN A O   
317 C  CB  . ASN A 56  ? 0.2457 0.1875 0.1495 0.0038  0.0083  -0.0403 46  ASN A CB  
318 C  CG  . ASN A 56  ? 0.3462 0.3213 0.2958 -0.0111 0.0324  0.0017  46  ASN A CG  
319 O  OD1 . ASN A 56  ? 0.4463 0.3698 0.4361 -0.0191 0.0386  -0.0065 46  ASN A OD1 
320 N  ND2 . ASN A 56  ? 0.4737 0.3876 0.4526 0.0237  0.0042  -0.0428 46  ASN A ND2 
321 N  N   . PHE A 57  ? 0.1535 0.1221 0.1154 -0.0114 0.0188  -0.0228 47  PHE A N   
322 C  CA  . PHE A 57  ? 0.1210 0.1179 0.1207 -0.0074 -0.0037 -0.0094 47  PHE A CA  
323 C  C   . PHE A 57  ? 0.1376 0.1123 0.1365 -0.0062 -0.0087 -0.0195 47  PHE A C   
324 O  O   . PHE A 57  ? 0.1297 0.1126 0.1557 0.0040  0.0124  0.0091  47  PHE A O   
325 C  CB  . PHE A 57  ? 0.1153 0.1618 0.1729 -0.0128 0.0056  -0.0199 47  PHE A CB  
326 C  CG  . PHE A 57  ? 0.1324 0.1259 0.1864 -0.0005 -0.0106 -0.0246 47  PHE A CG  
327 C  CD1 . PHE A 57  ? 0.1859 0.1508 0.1913 -0.0044 0.0293  -0.0089 47  PHE A CD1 
328 C  CD2 . PHE A 57  ? 0.1264 0.1853 0.1295 0.0133  -0.0197 -0.0031 47  PHE A CD2 
329 C  CE1 . PHE A 57  ? 0.2274 0.1574 0.2218 0.0053  0.0464  0.0004  47  PHE A CE1 
330 C  CE2 . PHE A 57  ? 0.1303 0.1916 0.1625 0.0119  0.0109  0.0059  47  PHE A CE2 
331 C  CZ  . PHE A 57  ? 0.2130 0.1558 0.1913 0.0113  0.0240  0.0008  47  PHE A CZ  
332 N  N   . PHE A 58  ? 0.1327 0.0785 0.1295 -0.0161 0.0120  -0.0184 48  PHE A N   
333 C  CA  . PHE A 58  ? 0.1366 0.1206 0.1338 0.0015  0.0072  0.0017  48  PHE A CA  
334 C  C   . PHE A 58  ? 0.1334 0.0949 0.1270 -0.0100 0.0062  -0.0051 48  PHE A C   
335 O  O   . PHE A 58  ? 0.1216 0.0920 0.1575 -0.0016 0.0137  0.0010  48  PHE A O   
336 C  CB  . PHE A 58  ? 0.1401 0.1028 0.1350 0.0058  0.0029  -0.0238 48  PHE A CB  
337 C  CG  . PHE A 58  ? 0.1884 0.1602 0.1006 0.0310  -0.0054 -0.0394 48  PHE A CG  
338 C  CD1 . PHE A 58  ? 0.1459 0.2280 0.1747 0.0518  -0.0060 -0.0447 48  PHE A CD1 
339 C  CD2 . PHE A 58  ? 0.2758 0.2392 0.1169 0.0587  0.0274  0.0034  48  PHE A CD2 
340 C  CE1 . PHE A 58  ? 0.2175 0.2079 0.1622 0.0306  -0.0022 -0.0477 48  PHE A CE1 
341 C  CE2 . PHE A 58  ? 0.1937 0.1979 0.1159 0.0493  0.0182  -0.0282 48  PHE A CE2 
342 C  CZ  . PHE A 58  ? 0.2333 0.1933 0.1360 0.0479  0.0125  -0.0153 48  PHE A CZ  
343 N  N   . PHE A 59  ? 0.1238 0.1056 0.1421 -0.0021 0.0322  -0.0124 49  PHE A N   
344 C  CA  . PHE A 59  ? 0.1561 0.1416 0.1809 0.0046  0.0322  0.0024  49  PHE A CA  
345 C  C   . PHE A 59  ? 0.1382 0.1299 0.2320 0.0235  0.0096  -0.0156 49  PHE A C   
346 O  O   . PHE A 59  ? 0.1733 0.1412 0.4085 0.0212  0.0042  0.0051  49  PHE A O   
347 C  CB  . PHE A 59  ? 0.1816 0.2288 0.1497 -0.0073 0.0265  -0.0321 49  PHE A CB  
348 C  CG  . PHE A 59  ? 0.2632 0.2594 0.1810 -0.0322 -0.0018 -0.0375 49  PHE A CG  
349 C  CD1 . PHE A 59  ? 0.2242 0.2185 0.2179 -0.0216 0.0171  -0.0212 49  PHE A CD1 
350 C  CD2 . PHE A 59  ? 0.1851 0.2686 0.2117 0.0333  0.0677  -0.0301 49  PHE A CD2 
351 C  CE1 . PHE A 59  ? 0.2633 0.1057 0.2240 0.0151  0.0249  -0.0216 49  PHE A CE1 
352 C  CE2 . PHE A 59  ? 0.1956 0.2654 0.2532 0.0070  0.0144  0.0141  49  PHE A CE2 
353 C  CZ  . PHE A 59  ? 0.2537 0.1944 0.2280 0.0229  -0.0090 -0.0007 49  PHE A CZ  
354 N  N   . GLN A 60  ? 0.1585 0.0895 0.1560 0.0070  0.0225  -0.0148 50  GLN A N   
355 C  CA  . GLN A 60  ? 0.1740 0.1119 0.1851 0.0021  0.0009  -0.0156 50  GLN A CA  
356 C  C   . GLN A 60  ? 0.1613 0.0888 0.1626 0.0243  0.0051  -0.0009 50  GLN A C   
357 O  O   . GLN A 60  ? 0.1661 0.0786 0.1985 0.0263  0.0151  -0.0103 50  GLN A O   
358 C  CB  . GLN A 60  ? 0.2006 0.1363 0.1913 -0.0239 -0.0078 0.0040  50  GLN A CB  
359 C  CG  . GLN A 60  ? 0.2709 0.1632 0.2203 -0.0404 -0.0306 -0.0159 50  GLN A CG  
360 C  CD  . GLN A 60  ? 0.3239 0.3001 0.3360 -0.0277 -0.0250 -0.0026 50  GLN A CD  
361 O  OE1 . GLN A 60  ? 0.4092 0.3796 0.3395 -0.0069 -0.0071 -0.0289 50  GLN A OE1 
362 N  NE2 . GLN A 60  ? 0.2811 0.3004 0.2676 -0.0628 -0.0595 -0.0317 50  GLN A NE2 
363 N  N   . SER A 61  ? 0.1369 0.1111 0.1666 0.0018  -0.0159 -0.0055 51  SER A N   
364 C  CA  . SER A 61  ? 0.1272 0.0898 0.1602 0.0033  0.0033  0.0096  51  SER A CA  
365 C  C   . SER A 61  ? 0.1320 0.0943 0.1493 0.0120  0.0183  0.0219  51  SER A C   
366 O  O   . SER A 61  ? 0.1812 0.1708 0.1447 0.0200  0.0184  0.0520  51  SER A O   
367 C  CB  . SER A 61  ? 0.1385 0.1080 0.1785 -0.0035 0.0094  0.0001  51  SER A CB  
368 O  OG  . SER A 61  ? 0.1251 0.1070 0.1370 0.0115  0.0089  0.0177  51  SER A OG  
369 N  N   . GLY A 62  ? 0.1166 0.0982 0.1493 0.0072  0.0087  -0.0055 52  GLY A N   
370 C  CA  . GLY A 62  ? 0.1117 0.0907 0.1511 0.0120  0.0095  -0.0077 52  GLY A CA  
371 C  C   . GLY A 62  ? 0.1346 0.0765 0.1471 0.0144  0.0197  0.0112  52  GLY A C   
372 O  O   . GLY A 62  ? 0.1495 0.0724 0.1762 0.0148  0.0033  0.0050  52  GLY A O   
373 N  N   . LEU A 63  ? 0.1451 0.0824 0.1656 0.0034  0.0136  0.0010  53  LEU A N   
374 C  CA  . LEU A 63  ? 0.1501 0.0975 0.2261 0.0280  0.0125  -0.0213 53  LEU A CA  
375 C  C   . LEU A 63  ? 0.1329 0.0812 0.2526 0.0281  0.0203  -0.0260 53  LEU A C   
376 O  O   . LEU A 63  ? 0.1628 0.0606 0.2498 0.0186  0.0518  0.0049  53  LEU A O   
377 C  CB  . LEU A 63  ? 0.1259 0.0935 0.2073 0.0220  0.0004  -0.0215 53  LEU A CB  
378 C  CG  . LEU A 63  ? 0.1374 0.1456 0.1753 0.0140  0.0016  -0.0192 53  LEU A CG  
379 C  CD1 . LEU A 63  ? 0.1137 0.1149 0.1987 0.0410  -0.0042 -0.0613 53  LEU A CD1 
380 C  CD2 . LEU A 63  ? 0.1558 0.1695 0.1987 0.0000  -0.0340 0.0004  53  LEU A CD2 
381 N  N   . PRO A 64  ? 0.1554 0.1236 0.3217 0.0335  0.0503  -0.0164 54  PRO A N   
382 C  CA  . PRO A 64  ? 0.1933 0.1456 0.3303 -0.0137 0.0555  -0.0185 54  PRO A CA  
383 C  C   . PRO A 64  ? 0.1546 0.1455 0.3231 -0.0038 0.0930  -0.0111 54  PRO A C   
384 O  O   . PRO A 64  ? 0.1880 0.1053 0.3159 -0.0003 0.1197  -0.0272 54  PRO A O   
385 C  CB  . PRO A 64  ? 0.1633 0.1517 0.3445 0.0023  0.0598  -0.0572 54  PRO A CB  
386 C  CG  . PRO A 64  ? 0.1305 0.1659 0.3879 -0.0242 0.0257  -0.0390 54  PRO A CG  
387 C  CD  . PRO A 64  ? 0.1437 0.1456 0.3429 0.0070  0.0424  -0.0187 54  PRO A CD  
388 N  N   . GLN A 65  ? 0.2624 0.1458 0.3330 -0.0173 0.0670  -0.0530 55  GLN A N   
389 C  CA  . GLN A 65  ? 0.2239 0.1930 0.3071 -0.0181 0.1003  -0.0242 55  GLN A CA  
390 C  C   . GLN A 65  ? 0.2006 0.1646 0.3143 0.0050  0.0895  -0.0294 55  GLN A C   
391 O  O   . GLN A 65  ? 0.2337 0.1656 0.3220 -0.0150 0.1259  0.0137  55  GLN A O   
392 C  CB  . GLN A 65  ? 0.2947 0.2338 0.3337 0.0048  0.0790  -0.0355 55  GLN A CB  
393 C  CG  . GLN A 65  ? 0.3286 0.3605 0.3634 -0.0236 0.0512  -0.0530 55  GLN A CG  
394 C  CD  . GLN A 65  ? 0.4631 0.3812 0.4045 0.0033  -0.0089 -0.0044 55  GLN A CD  
395 O  OE1 . GLN A 65  ? 0.4486 0.2440 0.4595 0.0171  0.0245  0.0245  55  GLN A OE1 
396 N  NE2 . GLN A 65  ? 0.4160 0.3957 0.3649 -0.0054 -0.0238 -0.0038 55  GLN A NE2 
397 N  N   . PRO A 66  ? 0.2041 0.1508 0.3412 0.0097  0.0863  -0.0154 56  PRO A N   
398 C  CA  . PRO A 66  ? 0.1922 0.1354 0.3446 -0.0186 0.0663  -0.0112 56  PRO A CA  
399 C  C   . PRO A 66  ? 0.1564 0.0944 0.3138 0.0163  0.0564  -0.0168 56  PRO A C   
400 O  O   . PRO A 66  ? 0.2023 0.0833 0.3460 0.0053  0.1001  0.0161  56  PRO A O   
401 C  CB  . PRO A 66  ? 0.2288 0.1955 0.3846 -0.0185 0.0556  -0.0048 56  PRO A CB  
402 C  CG  . PRO A 66  ? 0.2120 0.1665 0.3400 0.0108  0.0524  -0.0215 56  PRO A CG  
403 C  CD  . PRO A 66  ? 0.1931 0.1634 0.3688 -0.0124 0.0728  -0.0410 56  PRO A CD  
404 N  N   . VAL A 67  ? 0.1420 0.1180 0.2750 0.0015  0.0608  0.0053  57  VAL A N   
405 C  CA  . VAL A 67  ? 0.1473 0.1227 0.2118 -0.0061 0.0095  -0.0070 57  VAL A CA  
406 C  C   . VAL A 67  ? 0.1367 0.0987 0.1791 -0.0058 0.0103  -0.0255 57  VAL A C   
407 O  O   . VAL A 67  ? 0.1304 0.0901 0.1645 0.0006  0.0315  -0.0089 57  VAL A O   
408 C  CB  . VAL A 67  ? 0.1311 0.1416 0.2276 -0.0189 -0.0150 -0.0028 57  VAL A CB  
409 C  CG1 . VAL A 67  ? 0.1755 0.1627 0.2220 0.0095  -0.0051 -0.0042 57  VAL A CG1 
410 C  CG2 . VAL A 67  ? 0.1898 0.1588 0.2916 0.0167  -0.0369 -0.0164 57  VAL A CG2 
411 N  N   . LEU A 68  ? 0.1366 0.0915 0.1611 -0.0316 0.0195  -0.0063 58  LEU A N   
412 C  CA  . LEU A 68  ? 0.1455 0.0741 0.1368 -0.0176 0.0186  -0.0376 58  LEU A CA  
413 C  C   . LEU A 68  ? 0.1523 0.0934 0.1274 -0.0089 0.0462  -0.0260 58  LEU A C   
414 O  O   . LEU A 68  ? 0.1540 0.0880 0.1454 0.0017  0.0538  0.0084  58  LEU A O   
415 C  CB  . LEU A 68  ? 0.1623 0.0849 0.1660 -0.0266 0.0323  -0.0095 58  LEU A CB  
416 C  CG  . LEU A 68  ? 0.1378 0.0829 0.1797 -0.0070 0.0492  -0.0091 58  LEU A CG  
417 C  CD1 . LEU A 68  ? 0.1752 0.0596 0.1893 -0.0193 0.0605  -0.0261 58  LEU A CD1 
418 C  CD2 . LEU A 68  ? 0.1387 0.0718 0.1512 -0.0333 0.0429  -0.0071 58  LEU A CD2 
419 N  N   . ALA A 69  ? 0.1675 0.0950 0.1498 -0.0139 0.0374  -0.0007 59  ALA A N   
420 C  CA  . ALA A 69  ? 0.1582 0.0941 0.1367 0.0029  0.0759  -0.0134 59  ALA A CA  
421 C  C   . ALA A 69  ? 0.1431 0.0902 0.1276 -0.0085 0.0381  -0.0062 59  ALA A C   
422 O  O   . ALA A 69  ? 0.1619 0.0715 0.1437 -0.0092 0.0338  -0.0026 59  ALA A O   
423 C  CB  . ALA A 69  ? 0.1602 0.1011 0.1575 0.0044  0.0945  0.0054  59  ALA A CB  
424 N  N   . GLN A 70  ? 0.1308 0.0751 0.1459 -0.0014 0.0344  -0.0337 60  GLN A N   
425 C  CA  . GLN A 70  ? 0.1279 0.0883 0.1370 -0.0101 0.0242  -0.0197 60  GLN A CA  
426 C  C   . GLN A 70  ? 0.1110 0.0768 0.1367 0.0051  0.0214  -0.0044 60  GLN A C   
427 O  O   . GLN A 70  ? 0.1388 0.0784 0.1443 0.0140  0.0091  0.0011  60  GLN A O   
428 C  CB  . GLN A 70  ? 0.1346 0.0910 0.1490 0.0082  0.0028  -0.0158 60  GLN A CB  
429 C  CG  . GLN A 70  ? 0.1574 0.1055 0.1400 -0.0029 0.0021  -0.0045 60  GLN A CG  
430 C  CD  . GLN A 70  ? 0.1840 0.1577 0.1637 -0.0041 0.0000  -0.0011 60  GLN A CD  
431 O  OE1 . GLN A 70  ? 0.1612 0.2493 0.2197 -0.0025 -0.0224 0.0181  60  GLN A OE1 
432 N  NE2 . GLN A 70  ? 0.2431 0.1052 0.2579 -0.0166 -0.0029 -0.0252 60  GLN A NE2 
433 N  N   . ILE A 71  ? 0.1121 0.0782 0.1210 -0.0199 0.0168  -0.0072 61  ILE A N   
434 C  CA  . ILE A 71  ? 0.1129 0.0911 0.1110 0.0018  0.0108  0.0064  61  ILE A CA  
435 C  C   . ILE A 71  ? 0.1195 0.1063 0.1056 0.0002  0.0154  -0.0120 61  ILE A C   
436 O  O   . ILE A 71  ? 0.1262 0.0972 0.1204 0.0129  0.0212  -0.0141 61  ILE A O   
437 C  CB  . ILE A 71  ? 0.1148 0.0839 0.1093 0.0004  0.0235  0.0066  61  ILE A CB  
438 C  CG1 . ILE A 71  ? 0.1281 0.0803 0.0913 0.0093  0.0122  0.0013  61  ILE A CG1 
439 C  CG2 . ILE A 71  ? 0.1110 0.1336 0.1488 -0.0204 0.0215  0.0175  61  ILE A CG2 
440 C  CD1 . ILE A 71  ? 0.1589 0.0846 0.1334 0.0364  -0.0011 0.0052  61  ILE A CD1 
441 N  N   . TRP A 72  ? 0.1281 0.0973 0.1139 -0.0157 0.0036  -0.0100 62  TRP A N   
442 C  CA  . TRP A 72  ? 0.1442 0.0909 0.0867 -0.0108 0.0254  -0.0105 62  TRP A CA  
443 C  C   . TRP A 72  ? 0.1472 0.1037 0.0960 -0.0109 0.0249  -0.0036 62  TRP A C   
444 O  O   . TRP A 72  ? 0.1493 0.1083 0.1331 -0.0012 0.0214  0.0066  62  TRP A O   
445 C  CB  . TRP A 72  ? 0.1403 0.1254 0.0796 0.0050  0.0321  -0.0085 62  TRP A CB  
446 C  CG  . TRP A 72  ? 0.1374 0.1053 0.1005 -0.0109 0.0295  0.0094  62  TRP A CG  
447 C  CD1 . TRP A 72  ? 0.1810 0.1070 0.1016 -0.0018 0.0245  0.0072  62  TRP A CD1 
448 C  CD2 . TRP A 72  ? 0.1347 0.1003 0.1104 -0.0109 0.0133  -0.0095 62  TRP A CD2 
449 N  NE1 . TRP A 72  ? 0.1761 0.1572 0.1225 0.0087  0.0033  -0.0010 62  TRP A NE1 
450 C  CE2 . TRP A 72  ? 0.1571 0.0917 0.1192 -0.0078 -0.0240 -0.0149 62  TRP A CE2 
451 C  CE3 . TRP A 72  ? 0.1605 0.1294 0.1116 -0.0280 0.0120  -0.0222 62  TRP A CE3 
452 C  CZ2 . TRP A 72  ? 0.1826 0.1494 0.1413 0.0046  -0.0115 0.0162  62  TRP A CZ2 
453 C  CZ3 . TRP A 72  ? 0.2142 0.1395 0.1373 -0.0233 -0.0118 -0.0161 62  TRP A CZ3 
454 C  CH2 . TRP A 72  ? 0.1833 0.2007 0.1364 -0.0129 -0.0099 0.0035  62  TRP A CH2 
455 N  N   . ALA A 73  ? 0.1752 0.0986 0.1156 -0.0153 0.0212  0.0017  63  ALA A N   
456 C  CA  . ALA A 73  ? 0.1932 0.1107 0.1509 -0.0105 0.0421  0.0054  63  ALA A CA  
457 C  C   . ALA A 73  ? 0.1544 0.0910 0.1257 -0.0080 0.0261  -0.0062 63  ALA A C   
458 O  O   . ALA A 73  ? 0.1652 0.1310 0.1648 0.0085  0.0033  0.0016  63  ALA A O   
459 C  CB  . ALA A 73  ? 0.2114 0.1336 0.1910 -0.0305 0.0410  -0.0002 63  ALA A CB  
460 N  N   . LEU A 74  ? 0.1230 0.0862 0.1263 -0.0239 0.0325  0.0052  64  LEU A N   
461 C  CA  . LEU A 74  ? 0.1137 0.0918 0.1138 -0.0039 0.0331  -0.0063 64  LEU A CA  
462 C  C   . LEU A 74  ? 0.1172 0.0910 0.1301 0.0104  0.0188  -0.0009 64  LEU A C   
463 O  O   . LEU A 74  ? 0.1135 0.0949 0.1539 -0.0059 0.0279  -0.0134 64  LEU A O   
464 C  CB  . LEU A 74  ? 0.1258 0.1015 0.1323 -0.0055 0.0166  -0.0081 64  LEU A CB  
465 C  CG  . LEU A 74  ? 0.1099 0.0715 0.1208 -0.0008 0.0292  -0.0156 64  LEU A CG  
466 C  CD1 . LEU A 74  ? 0.1552 0.1119 0.1448 0.0084  0.0030  -0.0196 64  LEU A CD1 
467 C  CD2 . LEU A 74  ? 0.1289 0.0785 0.0957 0.0147  0.0169  -0.0183 64  LEU A CD2 
468 N  N   . ALA A 75  ? 0.1180 0.1056 0.1353 -0.0156 0.0043  0.0011  65  ALA A N   
469 C  CA  . ALA A 75  ? 0.1150 0.1141 0.1380 -0.0131 0.0114  0.0157  65  ALA A CA  
470 C  C   . ALA A 75  ? 0.1290 0.1297 0.1463 -0.0038 0.0078  0.0027  65  ALA A C   
471 O  O   . ALA A 75  ? 0.1155 0.1486 0.1850 -0.0148 0.0155  0.0290  65  ALA A O   
472 C  CB  . ALA A 75  ? 0.1451 0.1001 0.1355 -0.0110 0.0074  0.0100  65  ALA A CB  
473 N  N   . ASP A 76  ? 0.1347 0.1079 0.1218 0.0001  -0.0030 0.0095  66  ASP A N   
474 C  CA  . ASP A 76  ? 0.1543 0.1324 0.1262 0.0035  -0.0028 0.0182  66  ASP A CA  
475 C  C   . ASP A 76  ? 0.1388 0.1310 0.1859 -0.0001 0.0023  0.0188  66  ASP A C   
476 O  O   . ASP A 76  ? 0.1457 0.1294 0.1815 0.0078  -0.0031 0.0263  66  ASP A O   
477 C  CB  . ASP A 76  ? 0.1454 0.1328 0.1269 0.0182  0.0067  0.0251  66  ASP A CB  
478 C  CG  . ASP A 76  ? 0.1432 0.1549 0.1505 -0.0006 -0.0116 0.0077  66  ASP A CG  
479 O  OD1 . ASP A 76  ? 0.1290 0.1241 0.1706 -0.0144 -0.0173 0.0268  66  ASP A OD1 
480 O  OD2 . ASP A 76  ? 0.1507 0.1512 0.1493 -0.0066 0.0023  0.0409  66  ASP A OD2 
481 N  N   . MSE A 77  ? 0.1680 0.1468 0.1574 0.0098  0.0075  0.0149  67  MSE A N   
482 C  CA  . MSE A 77  ? 0.1972 0.1699 0.1925 0.0301  -0.0081 0.0023  67  MSE A CA  
483 C  C   . MSE A 77  ? 0.1855 0.1506 0.1992 0.0050  0.0004  0.0127  67  MSE A C   
484 O  O   . MSE A 77  ? 0.2309 0.1657 0.2438 0.0257  -0.0032 -0.0108 67  MSE A O   
485 C  CB  . MSE A 77  ? 0.2559 0.1992 0.2292 0.0140  0.0145  -0.0122 67  MSE A CB  
486 C  CG  . MSE A 77  ? 0.2465 0.2525 0.2621 0.0294  0.0016  0.0037  67  MSE A CG  
487 SE SE  . MSE A 77  ? 0.3986 0.3478 0.3288 -0.0066 0.0344  -0.0190 67  MSE A SE  
488 C  CE  . MSE A 77  ? 0.3366 0.2920 0.3012 0.0035  0.0149  -0.0302 67  MSE A CE  
489 N  N   . ASN A 78  ? 0.1816 0.1207 0.1917 0.0158  -0.0043 0.0199  68  ASN A N   
490 C  CA  . ASN A 78  ? 0.1779 0.1554 0.2028 0.0137  -0.0243 0.0215  68  ASN A CA  
491 C  C   . ASN A 78  ? 0.1738 0.1553 0.2104 -0.0085 -0.0240 0.0331  68  ASN A C   
492 O  O   . ASN A 78  ? 0.2151 0.1784 0.2478 -0.0047 -0.0328 0.0571  68  ASN A O   
493 C  CB  . ASN A 78  ? 0.1684 0.1533 0.2207 0.0163  -0.0143 0.0248  68  ASN A CB  
494 C  CG  . ASN A 78  ? 0.1707 0.1612 0.1908 0.0020  -0.0295 0.0328  68  ASN A CG  
495 O  OD1 . ASN A 78  ? 0.1970 0.1285 0.1986 -0.0052 -0.0188 0.0284  68  ASN A OD1 
496 N  ND2 . ASN A 78  ? 0.1755 0.2179 0.2934 0.0167  -0.0428 0.0212  68  ASN A ND2 
497 N  N   . ASN A 79  ? 0.1973 0.1701 0.2105 -0.0022 -0.0046 0.0142  69  ASN A N   
498 C  CA  . ASN A 79  ? 0.2060 0.1412 0.2207 -0.0312 -0.0020 0.0179  69  ASN A CA  
499 C  C   . ASN A 79  ? 0.2036 0.1821 0.2199 -0.0243 -0.0098 0.0290  69  ASN A C   
500 O  O   . ASN A 79  ? 0.2575 0.1946 0.2445 -0.0255 0.0066  0.0362  69  ASN A O   
501 C  CB  . ASN A 79  ? 0.1972 0.1501 0.2129 -0.0425 0.0005  0.0013  69  ASN A CB  
502 C  CG  . ASN A 79  ? 0.1689 0.1678 0.2456 -0.0330 -0.0045 0.0226  69  ASN A CG  
503 O  OD1 . ASN A 79  ? 0.2133 0.2248 0.2631 -0.0553 -0.0473 0.0676  69  ASN A OD1 
504 N  ND2 . ASN A 79  ? 0.2761 0.1824 0.2365 -0.0443 -0.0276 -0.0314 69  ASN A ND2 
505 N  N   . ASP A 80  ? 0.2048 0.1725 0.2172 -0.0221 -0.0083 0.0443  70  ASP A N   
506 C  CA  . ASP A 80  ? 0.2159 0.2028 0.1967 -0.0193 -0.0042 0.0343  70  ASP A CA  
507 C  C   . ASP A 80  ? 0.1891 0.1844 0.1838 -0.0169 -0.0093 0.0519  70  ASP A C   
508 O  O   . ASP A 80  ? 0.2303 0.2324 0.1897 -0.0153 -0.0062 0.0458  70  ASP A O   
509 C  CB  . ASP A 80  ? 0.2069 0.1914 0.2131 -0.0116 -0.0099 0.0561  70  ASP A CB  
510 C  CG  . ASP A 80  ? 0.2014 0.1903 0.2106 -0.0244 -0.0204 0.0214  70  ASP A CG  
511 O  OD1 . ASP A 80  ? 0.1688 0.1579 0.1883 -0.0044 -0.0140 0.0253  70  ASP A OD1 
512 O  OD2 . ASP A 80  ? 0.2146 0.2120 0.2301 0.0048  -0.0506 0.0541  70  ASP A OD2 
513 N  N   . GLY A 81  ? 0.1930 0.1863 0.1836 0.0042  0.0081  0.0583  71  GLY A N   
514 C  CA  . GLY A 81  ? 0.2011 0.1694 0.1755 -0.0262 0.0172  0.0469  71  GLY A CA  
515 C  C   . GLY A 81  ? 0.1864 0.1668 0.1570 -0.0146 -0.0022 0.0351  71  GLY A C   
516 O  O   . GLY A 81  ? 0.2017 0.1828 0.1468 -0.0210 0.0188  0.0268  71  GLY A O   
517 N  N   . ARG A 82  ? 0.1741 0.1701 0.1133 -0.0126 -0.0140 0.0563  72  ARG A N   
518 C  CA  . ARG A 82  ? 0.1748 0.1867 0.1395 -0.0124 -0.0093 0.0155  72  ARG A CA  
519 C  C   . ARG A 82  ? 0.1626 0.1774 0.1320 -0.0185 -0.0031 0.0273  72  ARG A C   
520 O  O   . ARG A 82  ? 0.1653 0.1610 0.1321 -0.0133 -0.0108 0.0305  72  ARG A O   
521 C  CB  . ARG A 82  ? 0.1933 0.2043 0.1274 -0.0118 -0.0044 0.0158  72  ARG A CB  
522 C  CG  . ARG A 82  ? 0.2000 0.2212 0.1492 0.0047  -0.0245 0.0234  72  ARG A CG  
523 C  CD  . ARG A 82  ? 0.1835 0.2374 0.1804 0.0046  -0.0098 0.0261  72  ARG A CD  
524 N  NE  . ARG A 82  ? 0.2116 0.2336 0.2279 0.0239  -0.0401 0.0390  72  ARG A NE  
525 C  CZ  . ARG A 82  ? 0.2313 0.2624 0.2540 0.0195  -0.0294 0.0254  72  ARG A CZ  
526 N  NH1 . ARG A 82  ? 0.2005 0.2313 0.2388 -0.0033 -0.0389 0.0412  72  ARG A NH1 
527 N  NH2 . ARG A 82  ? 0.2491 0.2632 0.3287 0.0319  -0.0301 0.0229  72  ARG A NH2 
528 N  N   . MSE A 83  ? 0.1575 0.1678 0.1189 0.0051  -0.0148 0.0131  73  MSE A N   
529 C  CA  . MSE A 83  ? 0.1552 0.1687 0.1456 -0.0030 0.0023  0.0214  73  MSE A CA  
530 C  C   . MSE A 83  ? 0.1382 0.1315 0.1187 0.0115  -0.0044 0.0003  73  MSE A C   
531 O  O   . MSE A 83  ? 0.1564 0.1489 0.1422 0.0033  0.0164  0.0179  73  MSE A O   
532 C  CB  . MSE A 83  ? 0.1493 0.1862 0.1630 -0.0020 -0.0082 0.0128  73  MSE A CB  
533 C  CG  . MSE A 83  ? 0.1350 0.1849 0.1554 0.0279  0.0095  0.0095  73  MSE A CG  
534 SE SE  . MSE A 83  ? 0.2348 0.2849 0.1988 0.0560  0.0065  0.0240  73  MSE A SE  
535 C  CE  . MSE A 83  ? 0.1687 0.2840 0.1662 0.0480  0.0417  0.0174  73  MSE A CE  
536 N  N   . ASP A 84  ? 0.1256 0.1502 0.1182 -0.0075 0.0140  0.0186  74  ASP A N   
537 C  CA  . ASP A 84  ? 0.1196 0.1492 0.1200 0.0112  0.0026  0.0077  74  ASP A CA  
538 C  C   . ASP A 84  ? 0.1255 0.1319 0.1275 -0.0061 -0.0073 0.0013  74  ASP A C   
539 O  O   . ASP A 84  ? 0.1142 0.1233 0.1362 -0.0060 -0.0004 0.0006  74  ASP A O   
540 C  CB  . ASP A 84  ? 0.1816 0.1717 0.1594 0.0245  -0.0157 0.0188  74  ASP A CB  
541 C  CG  . ASP A 84  ? 0.1440 0.1387 0.1812 0.0196  0.0024  0.0123  74  ASP A CG  
542 O  OD1 . ASP A 84  ? 0.1469 0.1628 0.1742 -0.0050 0.0078  0.0072  74  ASP A OD1 
543 O  OD2 . ASP A 84  ? 0.2130 0.1717 0.2673 0.0355  0.0045  0.0130  74  ASP A OD2 
544 N  N   . GLN A 85  ? 0.1199 0.1350 0.1192 -0.0070 -0.0021 0.0095  75  GLN A N   
545 C  CA  . GLN A 85  ? 0.1125 0.1505 0.1379 -0.0124 0.0006  0.0192  75  GLN A CA  
546 C  C   . GLN A 85  ? 0.1158 0.1360 0.1430 -0.0073 0.0124  0.0044  75  GLN A C   
547 O  O   . GLN A 85  ? 0.1190 0.1489 0.1433 -0.0139 0.0017  0.0096  75  GLN A O   
548 C  CB  . GLN A 85  ? 0.1169 0.1766 0.1683 -0.0154 0.0132  0.0362  75  GLN A CB  
549 C  CG  . GLN A 85  ? 0.1221 0.1548 0.1302 -0.0062 0.0161  0.0197  75  GLN A CG  
550 C  CD  . GLN A 85  ? 0.1270 0.1598 0.1479 -0.0083 -0.0089 0.0193  75  GLN A CD  
551 O  OE1 . GLN A 85  ? 0.1197 0.1825 0.1725 0.0068  0.0070  0.0400  75  GLN A OE1 
552 N  NE2 . GLN A 85  ? 0.1606 0.1700 0.1978 -0.0124 -0.0302 0.0191  75  GLN A NE2 
553 N  N   A VAL A 86  ? 0.1062 0.1291 0.1267 -0.0086 0.0090  -0.0021 76  VAL A N   
554 N  N   B VAL A 86  ? 0.1088 0.1308 0.1297 -0.0088 0.0088  -0.0019 76  VAL A N   
555 C  CA  A VAL A 86  ? 0.1147 0.1336 0.1458 0.0015  0.0059  -0.0038 76  VAL A CA  
556 C  CA  B VAL A 86  ? 0.1222 0.1399 0.1506 0.0018  0.0049  -0.0021 76  VAL A CA  
557 C  C   A VAL A 86  ? 0.1261 0.1256 0.1268 -0.0019 0.0022  0.0020  76  VAL A C   
558 C  C   B VAL A 86  ? 0.1299 0.1280 0.1287 -0.0013 0.0018  0.0017  76  VAL A C   
559 O  O   A VAL A 86  ? 0.1386 0.1307 0.1291 0.0064  -0.0072 -0.0019 76  VAL A O   
560 O  O   B VAL A 86  ? 0.1417 0.1338 0.1319 0.0069  -0.0071 0.0037  76  VAL A O   
561 C  CB  A VAL A 86  ? 0.0976 0.1654 0.1672 0.0092  0.0134  -0.0055 76  VAL A CB  
562 C  CB  B VAL A 86  ? 0.1096 0.1795 0.1800 0.0092  0.0127  -0.0105 76  VAL A CB  
563 C  CG1 A VAL A 86  ? 0.1180 0.1611 0.1909 0.0160  0.0071  -0.0140 76  VAL A CG1 
564 C  CG1 B VAL A 86  ? 0.1551 0.2357 0.2642 0.0038  0.0124  0.0150  76  VAL A CG1 
565 C  CG2 A VAL A 86  ? 0.1331 0.2318 0.2596 0.0064  0.0153  0.0190  76  VAL A CG2 
566 C  CG2 B VAL A 86  ? 0.1784 0.1964 0.2420 0.0147  -0.0019 0.0034  76  VAL A CG2 
567 N  N   . GLU A 87  ? 0.1182 0.1100 0.1302 0.0051  0.0180  0.0169  77  GLU A N   
568 C  CA  . GLU A 87  ? 0.1144 0.0962 0.1146 -0.0016 0.0125  0.0126  77  GLU A CA  
569 C  C   . GLU A 87  ? 0.1090 0.1110 0.1171 -0.0033 0.0047  0.0002  77  GLU A C   
570 O  O   . GLU A 87  ? 0.1136 0.1099 0.1064 -0.0070 -0.0062 -0.0050 77  GLU A O   
571 C  CB  . GLU A 87  ? 0.1493 0.0836 0.1164 0.0065  0.0109  0.0289  77  GLU A CB  
572 C  CG  . GLU A 87  ? 0.1323 0.0962 0.1350 -0.0005 0.0110  0.0053  77  GLU A CG  
573 C  CD  . GLU A 87  ? 0.1451 0.0924 0.1358 -0.0211 0.0135  0.0042  77  GLU A CD  
574 O  OE1 . GLU A 87  ? 0.1794 0.1177 0.1588 0.0096  0.0224  0.0106  77  GLU A OE1 
575 O  OE2 . GLU A 87  ? 0.1606 0.1291 0.1619 -0.0023 0.0031  0.0242  77  GLU A OE2 
576 N  N   . PHE A 88  ? 0.1151 0.0974 0.1091 -0.0151 0.0099  0.0001  78  PHE A N   
577 C  CA  . PHE A 88  ? 0.1308 0.1061 0.1016 -0.0071 -0.0070 0.0050  78  PHE A CA  
578 C  C   . PHE A 88  ? 0.0986 0.1222 0.1009 0.0035  0.0013  0.0037  78  PHE A C   
579 O  O   . PHE A 88  ? 0.1029 0.1084 0.1158 0.0167  -0.0074 0.0063  78  PHE A O   
580 C  CB  . PHE A 88  ? 0.1205 0.0970 0.1232 0.0000  0.0024  -0.0229 78  PHE A CB  
581 C  CG  . PHE A 88  ? 0.0920 0.1037 0.1201 0.0012  -0.0195 -0.0056 78  PHE A CG  
582 C  CD1 . PHE A 88  ? 0.1033 0.1596 0.1658 0.0207  -0.0017 -0.0104 78  PHE A CD1 
583 C  CD2 . PHE A 88  ? 0.1217 0.1004 0.1597 -0.0131 -0.0299 0.0023  78  PHE A CD2 
584 C  CE1 . PHE A 88  ? 0.1184 0.1269 0.1782 0.0094  -0.0046 -0.0269 78  PHE A CE1 
585 C  CE2 . PHE A 88  ? 0.1496 0.1129 0.1606 0.0000  -0.0108 -0.0005 78  PHE A CE2 
586 C  CZ  . PHE A 88  ? 0.1267 0.1087 0.1647 0.0045  -0.0300 -0.0214 78  PHE A CZ  
587 N  N   . SER A 89  ? 0.1075 0.1527 0.1028 -0.0051 0.0030  0.0153  79  SER A N   
588 C  CA  . SER A 89  ? 0.0831 0.1687 0.1036 -0.0169 0.0110  -0.0029 79  SER A CA  
589 C  C   . SER A 89  ? 0.1024 0.1228 0.1018 -0.0013 0.0125  -0.0112 79  SER A C   
590 O  O   . SER A 89  ? 0.1169 0.1156 0.1099 0.0001  0.0181  0.0040  79  SER A O   
591 C  CB  . SER A 89  ? 0.0896 0.1630 0.1174 0.0062  0.0164  0.0342  79  SER A CB  
592 O  OG  . SER A 89  ? 0.1328 0.1737 0.1062 -0.0153 0.0052  0.0212  79  SER A OG  
593 N  N   . ILE A 90  ? 0.1204 0.1193 0.1203 -0.0087 0.0126  -0.0074 80  ILE A N   
594 C  CA  . ILE A 90  ? 0.1162 0.1189 0.1171 0.0026  0.0052  -0.0149 80  ILE A CA  
595 C  C   . ILE A 90  ? 0.1104 0.1007 0.1018 -0.0016 -0.0019 -0.0239 80  ILE A C   
596 O  O   . ILE A 90  ? 0.1123 0.1194 0.1096 -0.0020 -0.0012 0.0018  80  ILE A O   
597 C  CB  . ILE A 90  ? 0.1111 0.0891 0.1258 -0.0135 0.0006  -0.0094 80  ILE A CB  
598 C  CG1 . ILE A 90  ? 0.1611 0.1382 0.1944 0.0165  0.0113  0.0036  80  ILE A CG1 
599 C  CG2 . ILE A 90  ? 0.1228 0.1062 0.1123 -0.0066 -0.0308 -0.0104 80  ILE A CG2 
600 C  CD1 . ILE A 90  ? 0.1610 0.1318 0.1861 0.0269  0.0094  -0.0093 80  ILE A CD1 
601 N  N   . ALA A 91  ? 0.1094 0.0965 0.0910 0.0222  0.0127  -0.0093 81  ALA A N   
602 C  CA  . ALA A 91  ? 0.1004 0.0986 0.0984 0.0152  0.0165  -0.0127 81  ALA A CA  
603 C  C   . ALA A 91  ? 0.0998 0.0953 0.0911 0.0124  0.0020  0.0107  81  ALA A C   
604 O  O   . ALA A 91  ? 0.1146 0.1204 0.1059 0.0077  0.0047  0.0000  81  ALA A O   
605 C  CB  . ALA A 91  ? 0.1368 0.1016 0.0790 0.0032  0.0149  0.0079  81  ALA A CB  
606 N  N   . MSE A 92  ? 0.1096 0.1223 0.1078 0.0065  0.0095  -0.0011 82  MSE A N   
607 C  CA  . MSE A 92  ? 0.1258 0.1128 0.1226 0.0073  -0.0015 -0.0038 82  MSE A CA  
608 C  C   . MSE A 92  ? 0.1198 0.1178 0.1172 -0.0012 0.0135  0.0096  82  MSE A C   
609 O  O   . MSE A 92  ? 0.1307 0.1124 0.1156 -0.0090 -0.0054 0.0132  82  MSE A O   
610 C  CB  . MSE A 92  ? 0.1314 0.1506 0.1379 -0.0108 0.0013  0.0187  82  MSE A CB  
611 C  CG  . MSE A 92  ? 0.1410 0.1189 0.1775 0.0322  -0.0301 -0.0300 82  MSE A CG  
612 SE SE  . MSE A 92  ? 0.2584 0.2014 0.2340 0.0153  -0.0233 -0.0141 82  MSE A SE  
613 C  CE  . MSE A 92  ? 0.2774 0.1990 0.3218 0.0024  -0.0139 0.0011  82  MSE A CE  
614 N  N   . LYS A 93  ? 0.1107 0.1327 0.0914 -0.0062 0.0128  0.0136  83  LYS A N   
615 C  CA  . LYS A 93  ? 0.1146 0.1298 0.1045 0.0061  0.0067  0.0158  83  LYS A CA  
616 C  C   . LYS A 93  ? 0.1067 0.1028 0.0860 0.0061  -0.0030 0.0056  83  LYS A C   
617 O  O   . LYS A 93  ? 0.1147 0.1368 0.1065 0.0133  0.0038  0.0147  83  LYS A O   
618 C  CB  . LYS A 93  ? 0.1222 0.1774 0.1138 -0.0083 0.0051  -0.0322 83  LYS A CB  
619 C  CG  . LYS A 93  ? 0.1711 0.2504 0.1314 -0.0050 -0.0094 -0.0340 83  LYS A CG  
620 C  CD  . LYS A 93  ? 0.2407 0.3102 0.1476 -0.0389 -0.0179 -0.0187 83  LYS A CD  
621 C  CE  . LYS A 93  ? 0.3131 0.4189 0.2086 -0.0280 -0.0124 -0.0219 83  LYS A CE  
622 N  NZ  . LYS A 93  ? 0.2715 0.3396 0.2122 -0.0248 0.0023  -0.0004 83  LYS A NZ  
623 N  N   . LEU A 94  ? 0.1017 0.1059 0.1035 0.0146  0.0213  0.0136  84  LEU A N   
624 C  CA  . LEU A 94  ? 0.1046 0.1159 0.0995 0.0162  0.0047  0.0167  84  LEU A CA  
625 C  C   . LEU A 94  ? 0.1070 0.0724 0.0849 0.0010  -0.0013 0.0031  84  LEU A C   
626 O  O   . LEU A 94  ? 0.1105 0.1064 0.1166 0.0044  -0.0022 -0.0032 84  LEU A O   
627 C  CB  . LEU A 94  ? 0.1210 0.1227 0.1142 0.0190  0.0152  0.0042  84  LEU A CB  
628 C  CG  . LEU A 94  ? 0.1128 0.1060 0.1276 0.0053  0.0206  -0.0103 84  LEU A CG  
629 C  CD1 . LEU A 94  ? 0.1248 0.0873 0.1486 -0.0160 0.0064  0.0188  84  LEU A CD1 
630 C  CD2 . LEU A 94  ? 0.1293 0.1325 0.1434 0.0011  0.0101  -0.0307 84  LEU A CD2 
631 N  N   . ILE A 95  ? 0.1170 0.0834 0.1115 0.0210  0.0066  -0.0084 85  ILE A N   
632 C  CA  . ILE A 95  ? 0.1259 0.0960 0.1038 0.0208  0.0024  -0.0025 85  ILE A CA  
633 C  C   . ILE A 95  ? 0.1169 0.0889 0.1299 0.0039  -0.0158 0.0001  85  ILE A C   
634 O  O   . ILE A 95  ? 0.1169 0.1111 0.1347 0.0206  -0.0064 0.0103  85  ILE A O   
635 C  CB  . ILE A 95  ? 0.1235 0.0796 0.1199 0.0120  -0.0016 -0.0006 85  ILE A CB  
636 C  CG1 . ILE A 95  ? 0.1340 0.1266 0.0804 -0.0005 0.0057  0.0102  85  ILE A CG1 
637 C  CG2 . ILE A 95  ? 0.1621 0.0802 0.1509 0.0242  -0.0105 0.0127  85  ILE A CG2 
638 C  CD1 . ILE A 95  ? 0.1559 0.1295 0.1011 0.0039  0.0203  -0.0138 85  ILE A CD1 
639 N  N   . LYS A 96  ? 0.1570 0.0897 0.1019 -0.0068 0.0000  0.0118  86  LYS A N   
640 C  CA  . LYS A 96  ? 0.1619 0.1363 0.1286 -0.0046 -0.0005 0.0159  86  LYS A CA  
641 C  C   . LYS A 96  ? 0.1580 0.1372 0.1291 0.0062  -0.0060 0.0121  86  LYS A C   
642 O  O   . LYS A 96  ? 0.1704 0.1355 0.1360 -0.0014 -0.0329 0.0117  86  LYS A O   
643 C  CB  . LYS A 96  ? 0.1736 0.1713 0.1445 -0.0292 -0.0094 0.0204  86  LYS A CB  
644 C  CG  . LYS A 96  ? 0.2243 0.2229 0.1726 -0.0260 0.0042  0.0580  86  LYS A CG  
645 C  CD  . LYS A 96  ? 0.2417 0.3070 0.2562 -0.0440 0.0259  0.0355  86  LYS A CD  
646 C  CE  . LYS A 96  ? 0.3039 0.3748 0.3290 -0.0327 0.0237  0.0161  86  LYS A CE  
647 N  NZ  . LYS A 96  ? 0.2839 0.4279 0.3355 -0.0428 0.0335  0.0122  86  LYS A NZ  
648 N  N   . LEU A 97  ? 0.1487 0.1624 0.1161 -0.0087 -0.0002 -0.0015 87  LEU A N   
649 C  CA  . LEU A 97  ? 0.1422 0.1431 0.1109 0.0049  -0.0035 -0.0047 87  LEU A CA  
650 C  C   . LEU A 97  ? 0.1322 0.1468 0.1128 0.0144  -0.0056 -0.0005 87  LEU A C   
651 O  O   . LEU A 97  ? 0.1338 0.1571 0.1356 0.0248  -0.0160 0.0120  87  LEU A O   
652 C  CB  . LEU A 97  ? 0.1660 0.1499 0.1314 0.0158  0.0043  -0.0306 87  LEU A CB  
653 C  CG  . LEU A 97  ? 0.1742 0.1787 0.1321 0.0207  0.0120  0.0051  87  LEU A CG  
654 C  CD1 . LEU A 97  ? 0.1912 0.1774 0.1707 0.0527  -0.0055 -0.0147 87  LEU A CD1 
655 C  CD2 . LEU A 97  ? 0.2164 0.2346 0.1402 0.0242  -0.0073 0.0210  87  LEU A CD2 
656 N  N   . LYS A 98  ? 0.1235 0.1282 0.1338 0.0107  0.0010  0.0220  88  LYS A N   
657 C  CA  . LYS A 98  ? 0.1305 0.1420 0.1302 0.0221  0.0130  0.0139  88  LYS A CA  
658 C  C   . LYS A 98  ? 0.1442 0.1391 0.1625 0.0112  -0.0042 0.0257  88  LYS A C   
659 O  O   . LYS A 98  ? 0.1421 0.1667 0.1840 0.0246  -0.0087 0.0179  88  LYS A O   
660 C  CB  . LYS A 98  ? 0.1749 0.1643 0.1231 0.0131  0.0146  0.0280  88  LYS A CB  
661 C  CG  . LYS A 98  ? 0.2616 0.3025 0.2202 -0.0267 0.0125  0.0155  88  LYS A CG  
662 C  CD  . LYS A 98  ? 0.2677 0.2742 0.2303 -0.0276 0.0222  0.0046  88  LYS A CD  
663 C  CE  . LYS A 98  ? 0.3429 0.3607 0.3463 -0.0296 0.0012  0.0122  88  LYS A CE  
664 N  NZ  . LYS A 98  ? 0.3662 0.4085 0.3790 -0.0032 -0.0218 0.0015  88  LYS A NZ  
665 N  N   . LEU A 99  ? 0.1390 0.1161 0.1705 0.0322  0.0026  0.0135  89  LEU A N   
666 C  CA  . LEU A 99  ? 0.1660 0.1368 0.1835 0.0362  -0.0123 0.0141  89  LEU A CA  
667 C  C   . LEU A 99  ? 0.1653 0.1628 0.1873 0.0275  -0.0148 0.0198  89  LEU A C   
668 O  O   . LEU A 99  ? 0.1852 0.1823 0.2209 0.0416  -0.0327 0.0099  89  LEU A O   
669 C  CB  . LEU A 99  ? 0.1729 0.1402 0.2019 0.0294  -0.0006 0.0088  89  LEU A CB  
670 C  CG  . LEU A 99  ? 0.1733 0.1585 0.1833 0.0556  -0.0033 0.0198  89  LEU A CG  
671 C  CD1 . LEU A 99  ? 0.2160 0.2021 0.1938 0.0373  -0.0207 -0.0265 89  LEU A CD1 
672 C  CD2 . LEU A 99  ? 0.2049 0.1278 0.2000 0.0442  -0.0016 -0.0091 89  LEU A CD2 
673 N  N   . GLN A 100 ? 0.1571 0.1332 0.1717 0.0176  -0.0099 0.0295  90  GLN A N   
674 C  CA  . GLN A 100 ? 0.1607 0.1378 0.1753 0.0084  -0.0261 0.0213  90  GLN A CA  
675 C  C   . GLN A 100 ? 0.1661 0.1448 0.1672 -0.0007 -0.0298 0.0282  90  GLN A C   
676 O  O   . GLN A 100 ? 0.1876 0.1638 0.1931 -0.0102 -0.0483 0.0480  90  GLN A O   
677 C  CB  . GLN A 100 ? 0.1474 0.1331 0.1761 -0.0035 -0.0260 0.0313  90  GLN A CB  
678 C  CG  . GLN A 100 ? 0.1594 0.1362 0.1429 -0.0227 -0.0195 0.0300  90  GLN A CG  
679 C  CD  . GLN A 100 ? 0.1929 0.2135 0.2159 0.0037  -0.0082 0.0207  90  GLN A CD  
680 O  OE1 . GLN A 100 ? 0.2286 0.2777 0.2960 -0.0227 0.0136  0.0277  90  GLN A OE1 
681 N  NE2 . GLN A 100 ? 0.2527 0.2884 0.2923 -0.0319 -0.0041 0.0380  90  GLN A NE2 
682 N  N   . GLY A 101 ? 0.1609 0.1771 0.1914 -0.0113 -0.0312 0.0361  91  GLY A N   
683 C  CA  . GLY A 101 ? 0.1597 0.1812 0.2094 -0.0097 -0.0233 0.0222  91  GLY A CA  
684 C  C   . GLY A 101 ? 0.1316 0.1635 0.1894 -0.0108 -0.0174 0.0253  91  GLY A C   
685 O  O   . GLY A 101 ? 0.1731 0.1606 0.2244 -0.0162 -0.0358 0.0304  91  GLY A O   
686 N  N   . TYR A 102 ? 0.1594 0.1556 0.1952 -0.0102 -0.0122 0.0408  92  TYR A N   
687 C  CA  . TYR A 102 ? 0.1478 0.1613 0.2075 -0.0132 -0.0214 0.0234  92  TYR A CA  
688 C  C   . TYR A 102 ? 0.1603 0.1863 0.1985 -0.0183 -0.0113 0.0196  92  TYR A C   
689 O  O   . TYR A 102 ? 0.2157 0.1827 0.2030 -0.0518 -0.0197 0.0121  92  TYR A O   
690 C  CB  . TYR A 102 ? 0.1502 0.1583 0.2119 0.0011  -0.0090 0.0408  92  TYR A CB  
691 C  CG  . TYR A 102 ? 0.1787 0.1962 0.1715 -0.0021 -0.0331 0.0243  92  TYR A CG  
692 C  CD1 . TYR A 102 ? 0.1788 0.1843 0.1868 0.0138  -0.0488 0.0556  92  TYR A CD1 
693 C  CD2 . TYR A 102 ? 0.2432 0.1710 0.1538 -0.0076 -0.0057 0.0469  92  TYR A CD2 
694 C  CE1 . TYR A 102 ? 0.1855 0.2159 0.1535 0.0232  -0.0148 0.0223  92  TYR A CE1 
695 C  CE2 . TYR A 102 ? 0.2621 0.2046 0.1639 0.0001  -0.0005 0.0190  92  TYR A CE2 
696 C  CZ  . TYR A 102 ? 0.1923 0.1746 0.1674 -0.0107 0.0051  0.0170  92  TYR A CZ  
697 O  OH  . TYR A 102 ? 0.2668 0.2259 0.1994 0.0121  0.0219  0.0339  92  TYR A OH  
698 N  N   . GLN A 103 ? 0.1827 0.1461 0.2039 -0.0079 -0.0099 0.0313  93  GLN A N   
699 C  CA  . GLN A 103 ? 0.1829 0.1928 0.2018 -0.0084 -0.0315 0.0407  93  GLN A CA  
700 C  C   . GLN A 103 ? 0.1319 0.1723 0.1769 -0.0149 -0.0156 0.0185  93  GLN A C   
701 O  O   . GLN A 103 ? 0.1857 0.2335 0.2089 0.0151  -0.0028 0.0379  93  GLN A O   
702 C  CB  . GLN A 103 ? 0.2217 0.1942 0.2449 -0.0268 -0.0291 0.0496  93  GLN A CB  
703 C  CG  . GLN A 103 ? 0.2712 0.3265 0.3343 -0.0104 -0.0416 0.0365  93  GLN A CG  
704 C  CD  . GLN A 103 ? 0.4098 0.3973 0.4397 0.0084  -0.0112 0.0114  93  GLN A CD  
705 O  OE1 . GLN A 103 ? 0.4695 0.5128 0.4701 0.0192  -0.0116 0.0060  93  GLN A OE1 
706 N  NE2 . GLN A 103 ? 0.4820 0.4455 0.4997 0.0236  -0.0285 0.0195  93  GLN A NE2 
707 N  N   . LEU A 104 ? 0.1417 0.1236 0.1874 -0.0090 -0.0111 0.0239  94  LEU A N   
708 C  CA  . LEU A 104 ? 0.1486 0.1344 0.1890 0.0110  -0.0058 -0.0001 94  LEU A CA  
709 C  C   . LEU A 104 ? 0.1619 0.1256 0.1947 0.0078  -0.0052 0.0044  94  LEU A C   
710 O  O   . LEU A 104 ? 0.1823 0.1187 0.2051 0.0078  -0.0127 -0.0200 94  LEU A O   
711 C  CB  . LEU A 104 ? 0.1820 0.1098 0.1625 0.0098  -0.0156 0.0094  94  LEU A CB  
712 C  CG  . LEU A 104 ? 0.1655 0.0963 0.1607 0.0032  0.0007  -0.0095 94  LEU A CG  
713 C  CD1 . LEU A 104 ? 0.2075 0.1808 0.1656 0.0061  0.0210  -0.0508 94  LEU A CD1 
714 C  CD2 . LEU A 104 ? 0.1914 0.1509 0.1950 -0.0140 -0.0021 -0.0006 94  LEU A CD2 
715 N  N   . PRO A 105 ? 0.1481 0.1248 0.2257 0.0068  -0.0106 -0.0066 95  PRO A N   
716 C  CA  . PRO A 105 ? 0.1858 0.1380 0.2346 0.0193  0.0011  -0.0275 95  PRO A CA  
717 C  C   . PRO A 105 ? 0.1846 0.1573 0.2268 0.0284  -0.0051 -0.0237 95  PRO A C   
718 O  O   . PRO A 105 ? 0.2013 0.1661 0.2205 0.0268  -0.0189 -0.0252 95  PRO A O   
719 C  CB  . PRO A 105 ? 0.1861 0.1491 0.2218 0.0171  0.0040  -0.0209 95  PRO A CB  
720 C  CG  . PRO A 105 ? 0.1942 0.1599 0.2064 0.0262  0.0072  -0.0417 95  PRO A CG  
721 C  CD  . PRO A 105 ? 0.1700 0.1333 0.2334 0.0096  -0.0055 -0.0088 95  PRO A CD  
722 N  N   . SER A 106 ? 0.1703 0.1358 0.2295 0.0147  0.0035  -0.0181 96  SER A N   
723 C  CA  . SER A 106 ? 0.1824 0.2020 0.2328 0.0119  0.0128  -0.0109 96  SER A CA  
724 C  C   . SER A 106 ? 0.2067 0.2051 0.2156 0.0173  0.0128  0.0046  96  SER A C   
725 O  O   . SER A 106 ? 0.2392 0.2686 0.2223 0.0317  0.0078  -0.0060 96  SER A O   
726 C  CB  . SER A 106 ? 0.2324 0.1748 0.2237 0.0298  -0.0051 -0.0393 96  SER A CB  
727 O  OG  . SER A 106 ? 0.2685 0.2221 0.2596 -0.0295 0.0301  -0.0420 96  SER A OG  
728 N  N   . ALA A 107 ? 0.1824 0.1626 0.2043 0.0172  0.0178  -0.0151 97  ALA A N   
729 C  CA  . ALA A 107 ? 0.1873 0.1211 0.2262 0.0207  0.0224  -0.0259 97  ALA A CA  
730 C  C   . ALA A 107 ? 0.1375 0.1208 0.1781 0.0036  0.0093  -0.0273 97  ALA A C   
731 O  O   . ALA A 107 ? 0.1533 0.1350 0.2067 0.0003  -0.0059 -0.0214 97  ALA A O   
732 C  CB  . ALA A 107 ? 0.2123 0.1657 0.2605 0.0080  0.0072  -0.0402 97  ALA A CB  
733 N  N   . LEU A 108 ? 0.1581 0.1411 0.1884 0.0066  0.0091  -0.0373 98  LEU A N   
734 C  CA  . LEU A 108 ? 0.1664 0.1762 0.1782 0.0004  0.0122  -0.0306 98  LEU A CA  
735 C  C   . LEU A 108 ? 0.1700 0.1579 0.1865 0.0099  0.0188  -0.0287 98  LEU A C   
736 O  O   . LEU A 108 ? 0.1888 0.1371 0.2177 0.0194  0.0159  -0.0490 98  LEU A O   
737 C  CB  . LEU A 108 ? 0.2010 0.2370 0.2069 -0.0190 -0.0024 -0.0341 98  LEU A CB  
738 C  CG  . LEU A 108 ? 0.2372 0.2563 0.2294 -0.0345 0.0276  0.0090  98  LEU A CG  
739 C  CD1 . LEU A 108 ? 0.2908 0.1965 0.2261 -0.0639 0.0110  0.0117  98  LEU A CD1 
740 C  CD2 . LEU A 108 ? 0.2688 0.3602 0.3023 -0.0202 -0.0184 -0.0340 98  LEU A CD2 
741 N  N   . PRO A 109 ? 0.1669 0.1112 0.1823 0.0094  -0.0011 -0.0582 99  PRO A N   
742 C  CA  . PRO A 109 ? 0.1531 0.1330 0.1734 0.0168  0.0120  -0.0335 99  PRO A CA  
743 C  C   . PRO A 109 ? 0.1506 0.1645 0.1831 0.0094  -0.0098 -0.0449 99  PRO A C   
744 O  O   . PRO A 109 ? 0.1511 0.1593 0.1763 -0.0147 -0.0019 -0.0518 99  PRO A O   
745 C  CB  . PRO A 109 ? 0.1823 0.1536 0.2066 0.0136  -0.0011 -0.0241 99  PRO A CB  
746 C  CG  . PRO A 109 ? 0.1729 0.1538 0.1887 0.0268  -0.0106 -0.0463 99  PRO A CG  
747 C  CD  . PRO A 109 ? 0.1664 0.1410 0.2003 0.0239  -0.0013 -0.0210 99  PRO A CD  
748 N  N   . PRO A 110 ? 0.1588 0.1371 0.1944 0.0027  -0.0241 -0.0579 100 PRO A N   
749 C  CA  . PRO A 110 ? 0.1574 0.1489 0.1767 0.0167  -0.0085 -0.0637 100 PRO A CA  
750 C  C   . PRO A 110 ? 0.1578 0.1719 0.1894 0.0310  -0.0108 -0.0502 100 PRO A C   
751 O  O   . PRO A 110 ? 0.1729 0.2111 0.2143 0.0184  -0.0297 -0.0629 100 PRO A O   
752 C  CB  . PRO A 110 ? 0.1783 0.1374 0.2123 0.0269  -0.0231 -0.0381 100 PRO A CB  
753 C  CG  . PRO A 110 ? 0.1914 0.1565 0.2468 0.0070  -0.0269 -0.0665 100 PRO A CG  
754 C  CD  . PRO A 110 ? 0.1953 0.1422 0.2197 0.0028  -0.0133 -0.0426 100 PRO A CD  
755 N  N   . VAL A 111 ? 0.1730 0.1559 0.1861 0.0141  0.0164  -0.0488 101 VAL A N   
756 C  CA  . VAL A 111 ? 0.1647 0.1849 0.1775 0.0025  0.0178  -0.0519 101 VAL A CA  
757 C  C   . VAL A 111 ? 0.1786 0.2088 0.2053 -0.0135 0.0281  -0.0631 101 VAL A C   
758 O  O   . VAL A 111 ? 0.1917 0.2494 0.2283 -0.0175 0.0421  -0.0642 101 VAL A O   
759 C  CB  . VAL A 111 ? 0.1968 0.2161 0.2359 -0.0020 0.0151  -0.0284 101 VAL A CB  
760 C  CG1 . VAL A 111 ? 0.1773 0.2062 0.2325 0.0051  -0.0101 -0.0284 101 VAL A CG1 
761 C  CG2 . VAL A 111 ? 0.2443 0.3092 0.2042 -0.0043 0.0421  -0.0148 101 VAL A CG2 
762 N  N   . MSE A 112 ? 0.1904 0.1885 0.2025 -0.0274 0.0132  -0.0630 102 MSE A N   
763 C  CA  . MSE A 112 ? 0.2105 0.2177 0.2540 -0.0209 0.0066  -0.0399 102 MSE A CA  
764 C  C   . MSE A 112 ? 0.2209 0.2377 0.2335 -0.0268 0.0061  -0.0486 102 MSE A C   
765 O  O   . MSE A 112 ? 0.2533 0.2529 0.2597 -0.0395 -0.0004 -0.0670 102 MSE A O   
766 C  CB  . MSE A 112 ? 0.2249 0.2083 0.2650 -0.0182 0.0451  -0.0610 102 MSE A CB  
767 C  CG  . MSE A 112 ? 0.2730 0.2967 0.2689 -0.0131 0.0186  0.0034  102 MSE A CG  
768 SE SE  . MSE A 112 ? 0.3015 0.3686 0.3464 0.0666  0.0809  0.1080  102 MSE A SE  
769 C  CE  . MSE A 112 ? 0.3409 0.3454 0.2279 0.1227  0.0386  -0.0742 102 MSE A CE  
770 N  N   . LYS A 113 ? 0.2512 0.2537 0.2550 -0.0204 -0.0120 -0.0409 103 LYS A N   
771 C  CA  . LYS A 113 ? 0.2921 0.3212 0.2849 -0.0270 -0.0140 -0.0147 103 LYS A CA  
772 C  C   . LYS A 113 ? 0.3153 0.3729 0.3061 -0.0114 -0.0128 -0.0052 103 LYS A C   
773 O  O   . LYS A 113 ? 0.3436 0.4061 0.3536 -0.0207 -0.0276 0.0037  103 LYS A O   
774 C  CB  . LYS A 113 ? 0.3156 0.3261 0.2833 -0.0213 -0.0177 0.0045  103 LYS A CB  
775 C  CG  . LYS A 113 ? 0.3726 0.3923 0.3314 -0.0137 0.0085  -0.0193 103 LYS A CG  
776 C  CD  . LYS A 113 ? 0.4793 0.4262 0.3930 -0.0127 -0.0033 0.0140  103 LYS A CD  
777 C  CE  . LYS A 113 ? 0.4731 0.4586 0.4215 -0.0063 0.0164  -0.0036 103 LYS A CE  
778 N  NZ  . LYS A 113 ? 0.5042 0.4627 0.5152 -0.0035 0.0127  0.0054  103 LYS A NZ  
779 CA CA  . CA  B .   ? 0.1420 0.1430 0.1558 -0.0006 -0.0102 0.0309  201 CA  A CA  
780 S  S   . SO4 C .   ? 0.3867 0.3128 0.4142 -0.0099 0.0038  0.1088  301 SO4 A S   
781 O  O1  . SO4 C .   ? 0.4859 0.4089 0.4299 0.0263  -0.0046 0.0122  301 SO4 A O1  
782 O  O2  . SO4 C .   ? 0.3691 0.4221 0.4485 0.0266  0.0058  0.0363  301 SO4 A O2  
783 O  O3  . SO4 C .   ? 0.4491 0.3934 0.4278 0.0249  -0.0244 0.0787  301 SO4 A O3  
784 O  O4  . SO4 C .   ? 0.4496 0.3830 0.4701 -0.0279 -0.0120 0.0295  301 SO4 A O4  
785 O  O   . HOH D .   ? 0.1158 0.2179 0.1477 0.0078  -0.0141 -0.0047 401 HOH A O   
786 O  O   . HOH D .   ? 0.1299 0.1632 0.1626 -0.0274 0.0027  0.0214  402 HOH A O   
787 O  O   . HOH D .   ? 0.1646 0.1816 0.2057 -0.0039 -0.0266 0.0172  403 HOH A O   
788 O  O   . HOH D .   ? 0.1497 0.2522 0.1349 0.0157  -0.0260 0.0032  404 HOH A O   
789 O  O   . HOH D .   ? 0.1409 0.2519 0.1955 -0.0135 -0.0188 0.0390  405 HOH A O   
790 O  O   . HOH D .   ? 0.1878 0.1880 0.1669 -0.0107 0.0010  -0.0201 406 HOH A O   
791 O  O   . HOH D .   ? 0.2320 0.1804 0.2250 -0.0212 -0.0047 0.0186  407 HOH A O   
792 O  O   . HOH D .   ? 0.1534 0.2281 0.1925 -0.0111 -0.0079 -0.0100 408 HOH A O   
793 O  O   . HOH D .   ? 0.2770 0.2511 0.2456 0.0013  0.0216  -0.0394 409 HOH A O   
794 O  O   . HOH D .   ? 0.2363 0.1241 0.2511 -0.0069 0.0334  0.0092  410 HOH A O   
795 O  O   . HOH D .   ? 0.2971 0.2522 0.2967 0.0449  0.0316  0.0105  411 HOH A O   
796 O  O   . HOH D .   ? 0.1863 0.3195 0.1533 -0.0450 0.0221  0.0425  412 HOH A O   
797 O  O   . HOH D .   ? 0.3152 0.1857 0.2578 -0.0007 0.0110  0.0404  413 HOH A O   
798 O  O   . HOH D .   ? 0.2266 0.1994 0.2461 0.0150  -0.0080 -0.0536 414 HOH A O   
799 O  O   . HOH D .   ? 0.2863 0.2479 0.1619 -0.0050 -0.0276 0.0461  415 HOH A O   
800 O  O   . HOH D .   ? 0.2617 0.2223 0.3205 0.0989  0.0241  -0.0061 416 HOH A O   
801 O  O   . HOH D .   ? 0.1822 0.3334 0.2165 -0.0102 -0.0337 0.0054  417 HOH A O   
802 O  O   . HOH D .   ? 0.2158 0.3230 0.1700 -0.0472 0.0241  0.0025  418 HOH A O   
803 O  O   . HOH D .   ? 0.1884 0.1186 0.3688 -0.0141 -0.0325 0.0020  419 HOH A O   
804 O  O   . HOH D .   ? 0.2415 0.1387 0.3358 -0.0240 -0.0791 -0.0055 420 HOH A O   
805 O  O   . HOH D .   ? 0.2975 0.2248 0.3682 0.0321  -0.0835 -0.0723 421 HOH A O   
806 O  O   . HOH D .   ? 0.1898 0.1886 0.2656 -0.0154 -0.0042 -0.0355 422 HOH A O   
807 O  O   . HOH D .   ? 0.3322 0.2321 0.2673 0.1192  -0.1745 -0.0893 423 HOH A O   
808 O  O   . HOH D .   ? 0.1905 0.3547 0.3180 -0.0044 0.0187  0.0371  424 HOH A O   
809 O  O   . HOH D .   ? 0.2767 0.2089 0.2068 -0.0034 0.0388  -0.0013 425 HOH A O   
810 O  O   . HOH D .   ? 0.1995 0.2181 0.2377 0.0120  -0.0034 0.0611  426 HOH A O   
811 O  O   . HOH D .   ? 0.2064 0.3155 0.3301 0.0287  0.0155  0.0396  427 HOH A O   
812 O  O   . HOH D .   ? 0.4178 0.3097 0.3172 -0.0338 0.0369  -0.0322 428 HOH A O   
813 O  O   . HOH D .   ? 0.2547 0.3168 0.2154 -0.0128 -0.0142 0.0092  429 HOH A O   
814 O  O   . HOH D .   ? 0.4047 0.2344 0.2952 0.0013  -0.0146 -0.0061 430 HOH A O   
815 O  O   . HOH D .   ? 0.2518 0.3350 0.2562 -0.0103 0.0113  -0.0089 431 HOH A O   
816 O  O   . HOH D .   ? 0.2361 0.3031 0.3022 -0.0264 -0.0670 0.0687  432 HOH A O   
817 O  O   . HOH D .   ? 0.3405 0.2484 0.2242 0.0393  0.0968  -0.0120 433 HOH A O   
818 O  O   . HOH D .   ? 0.4614 0.2045 0.1964 -0.0324 -0.0707 0.0056  434 HOH A O   
819 O  O   . HOH D .   ? 0.2843 0.3983 0.3942 0.0677  0.0150  -0.0153 435 HOH A O   
820 O  O   . HOH D .   ? 0.3712 0.4593 0.2542 0.0244  0.0694  -0.0130 436 HOH A O   
821 O  O   . HOH D .   ? 0.4054 0.2038 0.1350 -0.0194 0.0015  -0.0394 437 HOH A O   
822 O  O   . HOH D .   ? 0.2299 0.3569 0.2428 -0.0215 0.0518  -0.0100 438 HOH A O   
823 O  O   . HOH D .   ? 0.2453 0.2664 0.2245 -0.0321 0.0037  0.0427  439 HOH A O   
824 O  O   . HOH D .   ? 0.1920 0.3280 0.2088 -0.0226 0.0070  -0.0258 440 HOH A O   
825 O  O   . HOH D .   ? 0.4480 0.2233 0.3699 0.0165  0.0471  0.0952  441 HOH A O   
826 O  O   . HOH D .   ? 0.1989 0.2580 0.3402 -0.0169 -0.0295 0.0300  442 HOH A O   
827 O  O   . HOH D .   ? 0.3901 0.2524 0.2786 0.0365  -0.0007 -0.0006 443 HOH A O   
828 O  O   . HOH D .   ? 0.2651 0.2894 0.2784 0.0385  -0.0064 -0.0305 444 HOH A O   
829 O  O   . HOH D .   ? 0.2933 0.2894 0.2570 0.0003  0.0287  0.0253  445 HOH A O   
830 O  O   . HOH D .   ? 0.2750 0.3169 0.4362 -0.0223 0.0138  0.0771  446 HOH A O   
831 O  O   . HOH D .   ? 0.3504 0.2381 0.3670 0.0476  0.0779  0.0753  447 HOH A O   
832 O  O   . HOH D .   ? 0.4380 0.4303 0.3961 0.0263  -0.0185 0.0205  448 HOH A O   
833 O  O   . HOH D .   ? 0.2755 0.2121 0.3000 -0.0559 0.0679  -0.0412 449 HOH A O   
834 O  O   . HOH D .   ? 0.3175 0.3398 0.2801 -0.0423 0.0338  0.0455  450 HOH A O   
835 O  O   . HOH D .   ? 0.3757 0.2607 0.2911 -0.0349 -0.0235 -0.0650 451 HOH A O   
836 O  O   . HOH D .   ? 0.3549 0.4286 0.3562 -0.0301 0.0455  0.0346  452 HOH A O   
837 O  O   . HOH D .   ? 0.2708 0.3928 0.3637 0.0226  -0.0379 0.0444  453 HOH A O   
838 O  O   . HOH D .   ? 0.3764 0.3987 0.3614 -0.0190 0.0000  -0.0126 454 HOH A O   
839 O  O   . HOH D .   ? 0.3036 0.3024 0.4420 0.0765  0.0763  -0.0221 455 HOH A O   
840 O  O   . HOH D .   ? 0.2921 0.4072 0.2451 -0.0304 0.0240  -0.0029 456 HOH A O   
841 O  O   . HOH D .   ? 0.1999 0.2627 0.3612 0.0109  0.0456  0.0749  457 HOH A O   
842 O  O   . HOH D .   ? 0.3778 0.3932 0.2841 -0.0606 -0.0162 0.0480  458 HOH A O   
843 O  O   . HOH D .   ? 0.3520 0.3254 0.4387 0.0595  0.0254  -0.0306 459 HOH A O   
844 O  O   . HOH D .   ? 0.2504 0.2599 0.3024 -0.0397 0.0469  -0.0483 460 HOH A O   
845 O  O   . HOH D .   ? 0.3901 0.3684 0.2695 0.0241  0.0625  0.0785  461 HOH A O   
846 O  O   . HOH D .   ? 0.2393 0.2763 0.3037 0.0386  0.0423  0.0877  462 HOH A O   
847 O  O   . HOH D .   ? 0.2832 0.2905 0.3336 -0.0441 0.0175  0.0561  463 HOH A O   
848 O  O   . HOH D .   ? 0.3189 0.2415 0.4631 0.0228  0.0677  0.0848  464 HOH A O   
849 O  O   . HOH D .   ? 0.3478 0.2872 0.4121 0.0124  0.0311  0.0288  465 HOH A O   
850 O  O   . HOH D .   ? 0.3018 0.3484 0.2778 0.0043  -0.0416 0.0119  466 HOH A O   
851 O  O   . HOH D .   ? 0.3086 0.2682 0.3628 -0.0548 0.0381  -0.0565 467 HOH A O   
852 O  O   . HOH D .   ? 0.5865 0.5350 0.5331 -0.0005 0.0163  -0.0282 468 HOH A O   
853 O  O   . HOH D .   ? 0.3511 0.4385 0.2976 0.0096  -0.0680 -0.0664 469 HOH A O   
854 O  O   . HOH D .   ? 0.2408 0.3774 0.3727 -0.0315 -0.0261 0.0379  470 HOH A O   
855 O  O   . HOH D .   ? 0.3750 0.4049 0.3372 -0.0765 -0.0255 -0.0134 471 HOH A O   
856 O  O   . HOH D .   ? 0.2258 0.3146 0.2084 0.0023  0.0136  -0.0048 472 HOH A O   
857 O  O   . HOH D .   ? 0.2314 0.2711 0.1978 0.0108  -0.0016 0.0290  473 HOH A O   
858 O  O   . HOH D .   ? 0.3602 0.3407 0.2881 0.0009  -0.0339 -0.0215 474 HOH A O   
859 O  O   . HOH D .   ? 0.4044 0.3330 0.3041 -0.0363 0.0322  -0.0171 475 HOH A O   
860 O  O   . HOH D .   ? 0.3165 0.2118 0.4268 0.0372  0.0143  0.0360  476 HOH A O   
861 O  O   . HOH D .   ? 0.3018 0.4637 0.3132 -0.0296 0.0169  -0.0048 477 HOH A O   
862 O  O   . HOH D .   ? 0.4086 0.2005 0.2348 -0.0210 0.0730  -0.0388 478 HOH A O   
863 O  O   . HOH D .   ? 0.3818 0.3087 0.2823 0.0303  -0.0764 0.0040  479 HOH A O   
864 O  O   . HOH D .   ? 0.2465 0.3584 0.3864 -0.0018 -0.0454 -0.0340 480 HOH A O   
865 O  O   . HOH D .   ? 0.2657 0.3866 0.4823 0.0560  -0.0130 0.0136  481 HOH A O   
866 O  O   . HOH D .   ? 0.4771 0.4486 0.3993 -0.0007 -0.0219 -0.0146 482 HOH A O   
867 O  O   . HOH D .   ? 0.3461 0.2625 0.4830 0.0131  0.0053  -0.0365 483 HOH A O   
868 O  O   . HOH D .   ? 0.4009 0.4261 0.2320 -0.0083 0.0233  -0.0542 484 HOH A O   
869 O  O   . HOH D .   ? 0.3543 0.3993 0.2917 -0.0389 0.0330  -0.0460 485 HOH A O   
870 O  O   . HOH D .   ? 0.4853 0.5557 0.5585 0.0048  -0.0286 0.0000  486 HOH A O   
871 O  O   . HOH D .   ? 0.4956 0.3724 0.4461 0.0393  0.0304  0.0256  487 HOH A O   
872 O  O   . HOH D .   ? 0.3604 0.4880 0.5365 -0.0215 0.0261  0.0265  488 HOH A O   
873 O  O   . HOH D .   ? 0.2644 0.3427 0.4550 0.0178  0.0304  -0.0175 489 HOH A O   
874 O  O   . HOH D .   ? 0.3178 0.4174 0.4226 -0.0170 0.0407  -0.0240 490 HOH A O   
875 O  O   . HOH D .   ? 0.4010 0.2584 0.4362 -0.0020 0.0184  -0.0196 491 HOH A O   
876 O  O   . HOH D .   ? 0.3645 0.3948 0.3862 0.0016  0.0326  0.0313  492 HOH A O   
877 O  O   . HOH D .   ? 0.3707 0.4058 0.4269 -0.0006 -0.0019 0.0135  493 HOH A O   
878 O  O   . HOH D .   ? 0.3442 0.3980 0.3372 -0.0333 0.0228  0.0045  494 HOH A O   
879 O  O   . HOH D .   ? 0.4597 0.4761 0.3022 0.0395  -0.0180 0.0207  495 HOH A O   
880 O  O   . HOH D .   ? 0.3826 0.5177 0.2975 0.0194  -0.0244 0.0742  497 HOH A O   
881 O  O   . HOH D .   ? 0.2923 0.4462 0.4533 -0.0193 0.0359  0.0222  498 HOH A O   
882 O  O   . HOH D .   ? 0.3421 0.2255 0.4042 -0.0013 0.0764  -0.0320 499 HOH A O   
883 O  O   . HOH D .   ? 0.3191 0.3927 0.3339 0.0270  0.0360  -0.0139 500 HOH A O   
884 O  O   . HOH D .   ? 0.3191 0.3772 0.3695 -0.0391 0.0011  0.0566  501 HOH A O   
885 O  O   . HOH D .   ? 0.2648 0.3406 0.2898 -0.0193 0.0195  -0.0138 502 HOH A O   
886 O  O   . HOH D .   ? 0.3919 0.3632 0.3040 -0.0184 0.0197  -0.0052 503 HOH A O   
887 O  O   . HOH D .   ? 0.4924 0.3631 0.3158 0.0539  0.0269  0.0657  504 HOH A O   
888 O  O   . HOH D .   ? 0.5440 0.4644 0.5236 -0.0203 0.0166  0.0167  505 HOH A O   
889 O  O   . HOH D .   ? 0.5443 0.3983 0.5054 0.0139  -0.0647 0.0424  506 HOH A O   
890 O  O   . HOH D .   ? 0.4460 0.4499 0.4732 0.0214  -0.0248 0.0209  507 HOH A O   
891 O  O   . HOH D .   ? 0.3594 0.3918 0.2530 -0.0011 -0.0128 -0.0186 508 HOH A O   
892 O  O   . HOH D .   ? 0.4017 0.3653 0.3605 -0.0493 -0.0029 0.0410  510 HOH A O   
893 O  O   . HOH D .   ? 0.3278 0.2086 0.3827 -0.0023 0.0618  0.0275  511 HOH A O   
894 O  O   . HOH D .   ? 0.3388 0.4027 0.3828 0.0542  -0.0351 0.0299  513 HOH A O   
895 O  O   . HOH D .   ? 0.4999 0.4793 0.5513 -0.0246 -0.0585 0.0147  514 HOH A O   
896 O  O   . HOH D .   ? 0.5508 0.5893 0.5923 0.0105  -0.0252 0.0023  516 HOH A O   
897 O  O   . HOH D .   ? 0.6378 0.6208 0.7173 0.0000  0.0076  0.0021  517 HOH A O   
898 O  O   . HOH D .   ? 0.4848 0.4756 0.4593 -0.0095 0.0234  0.0291  518 HOH A O   
899 O  O   . HOH D .   ? 0.4526 0.3132 0.4159 0.0163  -0.0638 0.0027  519 HOH A O   
900 O  O   . HOH D .   ? 0.3563 0.4805 0.3759 -0.0251 -0.0197 -0.0107 520 HOH A O   
901 O  O   . HOH D .   ? 0.2431 0.2606 0.3386 0.0555  0.0028  -0.0089 521 HOH A O   
902 O  O   . HOH D .   ? 0.3342 0.4169 0.2562 -0.0262 0.0551  0.1004  522 HOH A O   
903 O  O   . HOH D .   ? 0.4619 0.4665 0.4085 0.0008  0.0256  0.0518  524 HOH A O   
904 O  O   . HOH D .   ? 0.4173 0.3450 0.4619 0.0661  -0.0702 -0.0151 525 HOH A O   
905 O  O   . HOH D .   ? 0.4553 0.2839 0.4702 0.0406  0.0556  0.0308  528 HOH A O   
906 O  O   . HOH D .   ? 0.4375 0.4800 0.3313 0.0071  -0.0609 0.0500  529 HOH A O   
907 O  O   . HOH D .   ? 0.5674 0.4906 0.4237 0.0127  0.0046  -0.0590 530 HOH A O   
908 O  O   . HOH D .   ? 0.4677 0.4990 0.4650 0.0141  0.0046  -0.0232 531 HOH A O   
909 O  O   . HOH D .   ? 0.3734 0.3691 0.5082 0.0338  -0.0180 -0.0245 532 HOH A O   
910 O  O   . HOH D .   ? 0.3726 0.3914 0.4325 -0.0379 -0.0863 -0.0322 533 HOH A O   
911 O  O   . HOH D .   ? 0.6131 0.6214 0.6179 -0.0069 0.0048  0.0098  534 HOH A O   
912 O  O   . HOH D .   ? 0.4507 0.4469 0.4188 -0.0161 0.0007  0.0359  535 HOH A O   
913 O  O   . HOH D .   ? 0.5295 0.4456 0.5449 -0.0172 0.0102  -0.0402 536 HOH A O   
914 O  O   . HOH D .   ? 0.4654 0.4626 0.4006 -0.0162 0.0351  0.0541  537 HOH A O   
915 O  O   . HOH D .   ? 0.6548 0.6194 0.6582 0.0138  -0.0115 0.0052  538 HOH A O   
916 O  O   . HOH D .   ? 0.4614 0.4585 0.3101 -0.0218 0.0216  -0.0057 539 HOH A O   
917 O  O   . HOH D .   ? 0.4047 0.3152 0.4252 -0.0404 -0.0035 0.0455  540 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   -9  ?   ?   ?   A . n 
A 1 2   GLY 2   -8  ?   ?   ?   A . n 
A 1 3   HIS 3   -7  ?   ?   ?   A . n 
A 1 4   HIS 4   -6  ?   ?   ?   A . n 
A 1 5   HIS 5   -5  ?   ?   ?   A . n 
A 1 6   HIS 6   -4  ?   ?   ?   A . n 
A 1 7   HIS 7   -3  ?   ?   ?   A . n 
A 1 8   HIS 8   -2  ?   ?   ?   A . n 
A 1 9   SER 9   -1  ?   ?   ?   A . n 
A 1 10  HIS 10  0   ?   ?   ?   A . n 
A 1 11  VAL 11  1   ?   ?   ?   A . n 
A 1 12  ALA 12  2   ?   ?   ?   A . n 
A 1 13  GLN 13  3   ?   ?   ?   A . n 
A 1 14  PHE 14  4   ?   ?   ?   A . n 
A 1 15  PRO 15  5   ?   ?   ?   A . n 
A 1 16  THR 16  6   6   THR ALA A . n 
A 1 17  PRO 17  7   7   PRO PRO A . n 
A 1 18  PHE 18  8   8   PHE PHE A . n 
A 1 19  GLY 19  9   9   GLY GLY A . n 
A 1 20  GLY 20  10  10  GLY GLY A . n 
A 1 21  SER 21  11  11  SER SER A . n 
A 1 22  LEU 22  12  12  LEU LEU A . n 
A 1 23  ASP 23  13  13  ASP ASP A . n 
A 1 24  THR 24  14  14  THR THR A . n 
A 1 25  TRP 25  15  15  TRP TRP A . n 
A 1 26  ALA 26  16  16  ALA ALA A . n 
A 1 27  ILE 27  17  17  ILE ILE A . n 
A 1 28  THR 28  18  18  THR THR A . n 
A 1 29  VAL 29  19  19  VAL VAL A . n 
A 1 30  GLU 30  20  20  GLU GLU A . n 
A 1 31  GLU 31  21  21  GLU GLU A . n 
A 1 32  ARG 32  22  22  ARG ARG A . n 
A 1 33  ALA 33  23  23  ALA ALA A . n 
A 1 34  LYS 34  24  24  LYS LYS A . n 
A 1 35  HIS 35  25  25  HIS HIS A . n 
A 1 36  ASP 36  26  26  ASP ASP A . n 
A 1 37  GLN 37  27  27  GLN GLN A . n 
A 1 38  GLN 38  28  28  GLN GLN A . n 
A 1 39  PHE 39  29  29  PHE PHE A . n 
A 1 40  HIS 40  30  30  HIS HIS A . n 
A 1 41  SER 41  31  31  SER SER A . n 
A 1 42  LEU 42  32  32  LEU LEU A . n 
A 1 43  LYS 43  33  33  LYS LYS A . n 
A 1 44  PRO 44  34  34  PRO PRO A . n 
A 1 45  ILE 45  35  35  ILE ILE A . n 
A 1 46  SER 46  36  36  SER SER A . n 
A 1 47  GLY 47  37  37  GLY GLY A . n 
A 1 48  PHE 48  38  38  PHE PHE A . n 
A 1 49  ILE 49  39  39  ILE ILE A . n 
A 1 50  THR 50  40  40  THR THR A . n 
A 1 51  GLY 51  41  41  GLY GLY A . n 
A 1 52  ASP 52  42  42  ASP ASP A . n 
A 1 53  GLN 53  43  43  GLN GLN A . n 
A 1 54  ALA 54  44  44  ALA ALA A . n 
A 1 55  ARG 55  45  45  ARG ARG A . n 
A 1 56  ASN 56  46  46  ASN ASN A . n 
A 1 57  PHE 57  47  47  PHE PHE A . n 
A 1 58  PHE 58  48  48  PHE PHE A . n 
A 1 59  PHE 59  49  49  PHE PHE A . n 
A 1 60  GLN 60  50  50  GLN GLN A . n 
A 1 61  SER 61  51  51  SER SER A . n 
A 1 62  GLY 62  52  52  GLY GLY A . n 
A 1 63  LEU 63  53  53  LEU LEU A . n 
A 1 64  PRO 64  54  54  PRO PRO A . n 
A 1 65  GLN 65  55  55  GLN GLN A . n 
A 1 66  PRO 66  56  56  PRO PRO A . n 
A 1 67  VAL 67  57  57  VAL VAL A . n 
A 1 68  LEU 68  58  58  LEU LEU A . n 
A 1 69  ALA 69  59  59  ALA ALA A . n 
A 1 70  GLN 70  60  60  GLN GLN A . n 
A 1 71  ILE 71  61  61  ILE ILE A . n 
A 1 72  TRP 72  62  62  TRP TRP A . n 
A 1 73  ALA 73  63  63  ALA ALA A . n 
A 1 74  LEU 74  64  64  LEU LEU A . n 
A 1 75  ALA 75  65  65  ALA ALA A . n 
A 1 76  ASP 76  66  66  ASP ASP A . n 
A 1 77  MSE 77  67  67  MSE MSE A . n 
A 1 78  ASN 78  68  68  ASN ASN A . n 
A 1 79  ASN 79  69  69  ASN ASN A . n 
A 1 80  ASP 80  70  70  ASP ASP A . n 
A 1 81  GLY 81  71  71  GLY GLY A . n 
A 1 82  ARG 82  72  72  ARG ARG A . n 
A 1 83  MSE 83  73  73  MSE MSE A . n 
A 1 84  ASP 84  74  74  ASP ASP A . n 
A 1 85  GLN 85  75  75  GLN GLN A . n 
A 1 86  VAL 86  76  76  VAL VAL A . n 
A 1 87  GLU 87  77  77  GLU GLU A . n 
A 1 88  PHE 88  78  78  PHE PHE A . n 
A 1 89  SER 89  79  79  SER SER A . n 
A 1 90  ILE 90  80  80  ILE ILE A . n 
A 1 91  ALA 91  81  81  ALA ALA A . n 
A 1 92  MSE 92  82  82  MSE MSE A . n 
A 1 93  LYS 93  83  83  LYS LYS A . n 
A 1 94  LEU 94  84  84  LEU LEU A . n 
A 1 95  ILE 95  85  85  ILE ILE A . n 
A 1 96  LYS 96  86  86  LYS LYS A . n 
A 1 97  LEU 97  87  87  LEU LEU A . n 
A 1 98  LYS 98  88  88  LYS LYS A . n 
A 1 99  LEU 99  89  89  LEU LEU A . n 
A 1 100 GLN 100 90  90  GLN GLN A . n 
A 1 101 GLY 101 91  91  GLY GLY A . n 
A 1 102 TYR 102 92  92  TYR TYR A . n 
A 1 103 GLN 103 93  93  GLN GLN A . n 
A 1 104 LEU 104 94  94  LEU LEU A . n 
A 1 105 PRO 105 95  95  PRO PRO A . n 
A 1 106 SER 106 96  96  SER SER A . n 
A 1 107 ALA 107 97  97  ALA ALA A . n 
A 1 108 LEU 108 98  98  LEU LEU A . n 
A 1 109 PRO 109 99  99  PRO PRO A . n 
A 1 110 PRO 110 100 100 PRO PRO A . n 
A 1 111 VAL 111 101 101 VAL VAL A . n 
A 1 112 MSE 112 102 102 MSE MSE A . n 
A 1 113 LYS 113 103 103 LYS LYS A . n 
A 1 114 GLN 114 104 ?   ?   ?   A . n 
A 1 115 GLN 115 105 ?   ?   ?   A . n 
A 1 116 PRO 116 106 ?   ?   ?   A . n 
A 1 117 VAL 117 107 ?   ?   ?   A . n 
A 1 118 ALA 118 108 ?   ?   ?   A . n 
A 1 119 ILE 119 109 ?   ?   ?   A . n 
A 1 120 SER 120 110 ?   ?   ?   A . n 
A 1 121 SER 121 111 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Northeast Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     NESG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   201 201 CA  CA  A . 
C 3 SO4 1   301 301 SO4 SO4 A . 
D 4 HOH 1   401 401 HOH HOH A . 
D 4 HOH 2   402 402 HOH HOH A . 
D 4 HOH 3   403 403 HOH HOH A . 
D 4 HOH 4   404 404 HOH HOH A . 
D 4 HOH 5   405 405 HOH HOH A . 
D 4 HOH 6   406 406 HOH HOH A . 
D 4 HOH 7   407 407 HOH HOH A . 
D 4 HOH 8   408 408 HOH HOH A . 
D 4 HOH 9   409 409 HOH HOH A . 
D 4 HOH 10  410 410 HOH HOH A . 
D 4 HOH 11  411 411 HOH HOH A . 
D 4 HOH 12  412 412 HOH HOH A . 
D 4 HOH 13  413 413 HOH HOH A . 
D 4 HOH 14  414 414 HOH HOH A . 
D 4 HOH 15  415 415 HOH HOH A . 
D 4 HOH 16  416 416 HOH HOH A . 
D 4 HOH 17  417 417 HOH HOH A . 
D 4 HOH 18  418 418 HOH HOH A . 
D 4 HOH 19  419 419 HOH HOH A . 
D 4 HOH 20  420 420 HOH HOH A . 
D 4 HOH 21  421 421 HOH HOH A . 
D 4 HOH 22  422 422 HOH HOH A . 
D 4 HOH 23  423 423 HOH HOH A . 
D 4 HOH 24  424 424 HOH HOH A . 
D 4 HOH 25  425 425 HOH HOH A . 
D 4 HOH 26  426 426 HOH HOH A . 
D 4 HOH 27  427 427 HOH HOH A . 
D 4 HOH 28  428 428 HOH HOH A . 
D 4 HOH 29  429 429 HOH HOH A . 
D 4 HOH 30  430 430 HOH HOH A . 
D 4 HOH 31  431 431 HOH HOH A . 
D 4 HOH 32  432 432 HOH HOH A . 
D 4 HOH 33  433 433 HOH HOH A . 
D 4 HOH 34  434 434 HOH HOH A . 
D 4 HOH 35  435 435 HOH HOH A . 
D 4 HOH 36  436 436 HOH HOH A . 
D 4 HOH 37  437 437 HOH HOH A . 
D 4 HOH 38  438 438 HOH HOH A . 
D 4 HOH 39  439 439 HOH HOH A . 
D 4 HOH 40  440 440 HOH HOH A . 
D 4 HOH 41  441 441 HOH HOH A . 
D 4 HOH 42  442 442 HOH HOH A . 
D 4 HOH 43  443 443 HOH HOH A . 
D 4 HOH 44  444 444 HOH HOH A . 
D 4 HOH 45  445 445 HOH HOH A . 
D 4 HOH 46  446 446 HOH HOH A . 
D 4 HOH 47  447 447 HOH HOH A . 
D 4 HOH 48  448 448 HOH HOH A . 
D 4 HOH 49  449 449 HOH HOH A . 
D 4 HOH 50  450 450 HOH HOH A . 
D 4 HOH 51  451 451 HOH HOH A . 
D 4 HOH 52  452 452 HOH HOH A . 
D 4 HOH 53  453 453 HOH HOH A . 
D 4 HOH 54  454 454 HOH HOH A . 
D 4 HOH 55  455 455 HOH HOH A . 
D 4 HOH 56  456 456 HOH HOH A . 
D 4 HOH 57  457 457 HOH HOH A . 
D 4 HOH 58  458 458 HOH HOH A . 
D 4 HOH 59  459 459 HOH HOH A . 
D 4 HOH 60  460 460 HOH HOH A . 
D 4 HOH 61  461 461 HOH HOH A . 
D 4 HOH 62  462 462 HOH HOH A . 
D 4 HOH 63  463 463 HOH HOH A . 
D 4 HOH 64  464 464 HOH HOH A . 
D 4 HOH 65  465 465 HOH HOH A . 
D 4 HOH 66  466 466 HOH HOH A . 
D 4 HOH 67  467 467 HOH HOH A . 
D 4 HOH 68  468 468 HOH HOH A . 
D 4 HOH 69  469 469 HOH HOH A . 
D 4 HOH 70  470 470 HOH HOH A . 
D 4 HOH 71  471 471 HOH HOH A . 
D 4 HOH 72  472 472 HOH HOH A . 
D 4 HOH 73  473 473 HOH HOH A . 
D 4 HOH 74  474 474 HOH HOH A . 
D 4 HOH 75  475 475 HOH HOH A . 
D 4 HOH 76  476 476 HOH HOH A . 
D 4 HOH 77  477 477 HOH HOH A . 
D 4 HOH 78  478 478 HOH HOH A . 
D 4 HOH 79  479 479 HOH HOH A . 
D 4 HOH 80  480 480 HOH HOH A . 
D 4 HOH 81  481 481 HOH HOH A . 
D 4 HOH 82  482 482 HOH HOH A . 
D 4 HOH 83  483 483 HOH HOH A . 
D 4 HOH 84  484 484 HOH HOH A . 
D 4 HOH 85  485 485 HOH HOH A . 
D 4 HOH 86  486 486 HOH HOH A . 
D 4 HOH 87  487 487 HOH HOH A . 
D 4 HOH 88  488 488 HOH HOH A . 
D 4 HOH 89  489 489 HOH HOH A . 
D 4 HOH 90  490 490 HOH HOH A . 
D 4 HOH 91  491 491 HOH HOH A . 
D 4 HOH 92  492 492 HOH HOH A . 
D 4 HOH 93  493 493 HOH HOH A . 
D 4 HOH 94  494 494 HOH HOH A . 
D 4 HOH 95  495 495 HOH HOH A . 
D 4 HOH 96  497 497 HOH HOH A . 
D 4 HOH 97  498 498 HOH HOH A . 
D 4 HOH 98  499 499 HOH HOH A . 
D 4 HOH 99  500 500 HOH HOH A . 
D 4 HOH 100 501 501 HOH HOH A . 
D 4 HOH 101 502 502 HOH HOH A . 
D 4 HOH 102 503 503 HOH HOH A . 
D 4 HOH 103 504 504 HOH HOH A . 
D 4 HOH 104 505 505 HOH HOH A . 
D 4 HOH 105 506 506 HOH HOH A . 
D 4 HOH 106 507 507 HOH HOH A . 
D 4 HOH 107 508 508 HOH HOH A . 
D 4 HOH 108 510 510 HOH HOH A . 
D 4 HOH 109 511 511 HOH HOH A . 
D 4 HOH 110 513 513 HOH HOH A . 
D 4 HOH 111 514 514 HOH HOH A . 
D 4 HOH 112 516 516 HOH HOH A . 
D 4 HOH 113 517 517 HOH HOH A . 
D 4 HOH 114 518 518 HOH HOH A . 
D 4 HOH 115 519 519 HOH HOH A . 
D 4 HOH 116 520 520 HOH HOH A . 
D 4 HOH 117 521 521 HOH HOH A . 
D 4 HOH 118 522 522 HOH HOH A . 
D 4 HOH 119 524 524 HOH HOH A . 
D 4 HOH 120 525 525 HOH HOH A . 
D 4 HOH 121 528 528 HOH HOH A . 
D 4 HOH 122 529 529 HOH HOH A . 
D 4 HOH 123 530 530 HOH HOH A . 
D 4 HOH 124 531 531 HOH HOH A . 
D 4 HOH 125 532 532 HOH HOH A . 
D 4 HOH 126 533 533 HOH HOH A . 
D 4 HOH 127 534 534 HOH HOH A . 
D 4 HOH 128 535 535 HOH HOH A . 
D 4 HOH 129 536 536 HOH HOH A . 
D 4 HOH 130 537 537 HOH HOH A . 
D 4 HOH 131 538 538 HOH HOH A . 
D 4 HOH 132 539 539 HOH HOH A . 
D 4 HOH 133 540 540 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 77  A MSE 67  ? MET SELENOMETHIONINE 
2 A MSE 83  A MSE 73  ? MET SELENOMETHIONINE 
3 A MSE 92  A MSE 82  ? MET SELENOMETHIONINE 
4 A MSE 112 A MSE 102 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 76 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASN 78 ? A ASN 68  ? 1_555 86.1  ? 
2  OD1 ? A ASP 76 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 80 ? A ASP 70  ? 1_555 89.3  ? 
3  OD1 ? A ASN 78 ? A ASN 68 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 80 ? A ASP 70  ? 1_555 75.5  ? 
4  OD1 ? A ASP 76 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? A ARG 82 ? A ARG 72  ? 1_555 89.8  ? 
5  OD1 ? A ASN 78 ? A ASN 68 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? A ARG 82 ? A ARG 72  ? 1_555 151.8 ? 
6  OD1 ? A ASP 80 ? A ASP 70 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? A ARG 82 ? A ARG 72  ? 1_555 76.5  ? 
7  OD1 ? A ASP 76 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 87 ? A GLU 77  ? 1_555 104.5 ? 
8  OD1 ? A ASN 78 ? A ASN 68 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 87 ? A GLU 77  ? 1_555 127.5 ? 
9  OD1 ? A ASP 80 ? A ASP 70 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 87 ? A GLU 77  ? 1_555 153.2 ? 
10 O   ? A ARG 82 ? A ARG 72 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 87 ? A GLU 77  ? 1_555 80.5  ? 
11 OD1 ? A ASP 76 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 87 ? A GLU 77  ? 1_555 92.3  ? 
12 OD1 ? A ASN 78 ? A ASN 68 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 87 ? A GLU 77  ? 1_555 75.3  ? 
13 OD1 ? A ASP 80 ? A ASP 70 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 87 ? A GLU 77  ? 1_555 150.6 ? 
14 O   ? A ARG 82 ? A ARG 72 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 87 ? A GLU 77  ? 1_555 132.8 ? 
15 OE1 ? A GLU 87 ? A GLU 77 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 87 ? A GLU 77  ? 1_555 53.4  ? 
16 OD1 ? A ASP 76 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? D HOH .  ? A HOH 403 ? 1_555 167.2 ? 
17 OD1 ? A ASN 78 ? A ASN 68 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? D HOH .  ? A HOH 403 ? 1_555 86.8  ? 
18 OD1 ? A ASP 80 ? A ASP 70 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? D HOH .  ? A HOH 403 ? 1_555 78.6  ? 
19 O   ? A ARG 82 ? A ARG 72 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? D HOH .  ? A HOH 403 ? 1_555 91.4  ? 
20 OE1 ? A GLU 87 ? A GLU 77 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? D HOH .  ? A HOH 403 ? 1_555 88.3  ? 
21 OE2 ? A GLU 87 ? A GLU 77 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O   ? D HOH .  ? A HOH 403 ? 1_555 96.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-12-30 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance'  
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Refinement description'     
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_struct_assembly_auth_evidence 
2 3 'Structure model' software                           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .        ? 1 
SnB       phasing           .        ? 2 
RESOLVE   'model building'  .        ? 3 
REFMAC    refinement        5.2.0019 ? 4 
HKL-2000  'data reduction'  .        ? 5 
SCALEPACK 'data scaling'    .        ? 6 
RESOLVE   phasing           .        ? 7 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A THR 6 ? OG1 ? A THR 16 OG1 
2 1 Y 1 A THR 6 ? CG2 ? A THR 16 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE -9  ? A MSE 1   
2  1 Y 1 A GLY -8  ? A GLY 2   
3  1 Y 1 A HIS -7  ? A HIS 3   
4  1 Y 1 A HIS -6  ? A HIS 4   
5  1 Y 1 A HIS -5  ? A HIS 5   
6  1 Y 1 A HIS -4  ? A HIS 6   
7  1 Y 1 A HIS -3  ? A HIS 7   
8  1 Y 1 A HIS -2  ? A HIS 8   
9  1 Y 1 A SER -1  ? A SER 9   
10 1 Y 1 A HIS 0   ? A HIS 10  
11 1 Y 1 A VAL 1   ? A VAL 11  
12 1 Y 1 A ALA 2   ? A ALA 12  
13 1 Y 1 A GLN 3   ? A GLN 13  
14 1 Y 1 A PHE 4   ? A PHE 14  
15 1 Y 1 A PRO 5   ? A PRO 15  
16 1 Y 1 A GLN 104 ? A GLN 114 
17 1 Y 1 A GLN 105 ? A GLN 115 
18 1 Y 1 A PRO 106 ? A PRO 116 
19 1 Y 1 A VAL 107 ? A VAL 117 
20 1 Y 1 A ALA 108 ? A ALA 118 
21 1 Y 1 A ILE 109 ? A ILE 119 
22 1 Y 1 A SER 110 ? A SER 120 
23 1 Y 1 A SER 111 ? A SER 121 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 'SULFATE ION' SO4 
4 water         HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'assay for oligomerization' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#