data_3FO5
# 
_entry.id   3FO5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3FO5         
RCSB  RCSB050831   
WWPDB D_1000050831 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3FO5 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Siponen, M.I.'                        1  
'Lehtio, L.'                           2  
'Arrowsmith, C.H.'                     3  
'Berglund, H.'                         4  
'Bountra, C.'                          5  
'Collins, R.'                          6  
'Dahlgren, L.G.'                       7  
'Edwards, A.M.'                        8  
'Flodin, S.'                           9  
'Flores, A.'                           10 
'Graslund, S.'                         11 
'Hammarstrom, M.'                      12 
'Johansson, A.'                        13 
'Johansson, I.'                        14 
'Karlberg, T.'                         15 
'Kotenyova, T.'                        16 
'Moche, M.'                            17 
'Nilsson, M.E.'                        18 
'Nordlund, P.'                         19 
'Nyman, T.'                            20 
'Persson, C.'                          21 
'Sagemark, J.'                         22 
'Thorsell, A.G.'                       23 
'Tresaugues, L.'                       24 
'Van-Den-Berg, S.'                     25 
'Weigelt, J.'                          26 
'Welin, M.'                            27 
'Wikstrom, M.'                         28 
'Wisniewska, M.'                       29 
'Shueler, H.'                          30 
'Structural Genomics Consortium (SGC)' 31 
# 
_citation.id                        primary 
_citation.title                     'Comparative structural analysis of lipid binding START domains.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            6 
_citation.page_first                e19521 
_citation.page_last                 e19521 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21738568 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0019521 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Thorsell, A.G.' 1 
primary 'Lee, W.H.'      2 
primary 'Persson, C.'    3 
primary 'Siponen, M.I.'  4 
primary 'Nilsson, M.'    5 
primary 'Busam, R.D.'    6 
primary 'Kotenyova, T.'  7 
primary 'Schuler, H.'    8 
primary 'Lehtio, L.'     9 
# 
_cell.entry_id           3FO5 
_cell.length_a           52.440 
_cell.length_b           130.080 
_cell.length_c           165.230 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3FO5 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Thioesterase, adipose associated, isoform BFIT2' 29668.473 2   ? ? 'STARTdomain, UNP residues 339-594' ? 
2 non-polymer syn 'PENTAETHYLENE GLYCOL'                            238.278   2   ? ? ?                                   ? 
3 non-polymer syn 'CHLORIDE ION'                                    35.453    1   ? ? ?                                   ? 
4 non-polymer syn GLYCEROL                                          92.094    1   ? ? ?                                   ? 
5 non-polymer syn 
;3,3',3''-phosphanetriyltripropanoic acid
;
250.186   1   ? ? ?                                   ? 
6 water       nat water                                             18.015    168 ? ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acyl-CoA thioesterase 11, Acyl-CoA thioesterase 11, isoform CRA_b' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMRPQPGDGERRYREASARKKIRLDRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLY
TLEDDKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRK
PCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKVSYYNQATPGVLNYVTTNVAGLSSEFYTTFKAC
EQFLLDNRNDLAPSLQTL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMRPQPGDGERRYREASARKKIRLDRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLY
TLEDDKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRK
PCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKVSYYNQATPGVLNYVTTNVAGLSSEFYTTFKAC
EQFLLDNRNDLAPSLQTL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ARG n 
1 4   PRO n 
1 5   GLN n 
1 6   PRO n 
1 7   GLY n 
1 8   ASP n 
1 9   GLY n 
1 10  GLU n 
1 11  ARG n 
1 12  ARG n 
1 13  TYR n 
1 14  ARG n 
1 15  GLU n 
1 16  ALA n 
1 17  SER n 
1 18  ALA n 
1 19  ARG n 
1 20  LYS n 
1 21  LYS n 
1 22  ILE n 
1 23  ARG n 
1 24  LEU n 
1 25  ASP n 
1 26  ARG n 
1 27  LYS n 
1 28  TYR n 
1 29  ILE n 
1 30  VAL n 
1 31  SER n 
1 32  CYS n 
1 33  LYS n 
1 34  GLN n 
1 35  THR n 
1 36  GLU n 
1 37  VAL n 
1 38  PRO n 
1 39  LEU n 
1 40  SER n 
1 41  VAL n 
1 42  PRO n 
1 43  TRP n 
1 44  ASP n 
1 45  PRO n 
1 46  SER n 
1 47  ASN n 
1 48  GLN n 
1 49  VAL n 
1 50  TYR n 
1 51  LEU n 
1 52  SER n 
1 53  TYR n 
1 54  ASN n 
1 55  ASN n 
1 56  VAL n 
1 57  SER n 
1 58  SER n 
1 59  LEU n 
1 60  LYS n 
1 61  MET n 
1 62  LEU n 
1 63  VAL n 
1 64  ALA n 
1 65  LYS n 
1 66  ASP n 
1 67  ASN n 
1 68  TRP n 
1 69  VAL n 
1 70  LEU n 
1 71  SER n 
1 72  SER n 
1 73  GLU n 
1 74  ILE n 
1 75  SER n 
1 76  GLN n 
1 77  VAL n 
1 78  ARG n 
1 79  LEU n 
1 80  TYR n 
1 81  THR n 
1 82  LEU n 
1 83  GLU n 
1 84  ASP n 
1 85  ASP n 
1 86  LYS n 
1 87  PHE n 
1 88  LEU n 
1 89  SER n 
1 90  PHE n 
1 91  HIS n 
1 92  MET n 
1 93  GLU n 
1 94  MET n 
1 95  VAL n 
1 96  VAL n 
1 97  HIS n 
1 98  VAL n 
1 99  ASP n 
1 100 ALA n 
1 101 ALA n 
1 102 GLN n 
1 103 ALA n 
1 104 PHE n 
1 105 LEU n 
1 106 LEU n 
1 107 LEU n 
1 108 SER n 
1 109 ASP n 
1 110 LEU n 
1 111 ARG n 
1 112 GLN n 
1 113 ARG n 
1 114 PRO n 
1 115 GLU n 
1 116 TRP n 
1 117 ASP n 
1 118 LYS n 
1 119 HIS n 
1 120 TYR n 
1 121 ARG n 
1 122 SER n 
1 123 VAL n 
1 124 GLU n 
1 125 LEU n 
1 126 VAL n 
1 127 GLN n 
1 128 GLN n 
1 129 VAL n 
1 130 ASP n 
1 131 GLU n 
1 132 ASP n 
1 133 ASP n 
1 134 ALA n 
1 135 ILE n 
1 136 TYR n 
1 137 HIS n 
1 138 VAL n 
1 139 THR n 
1 140 SER n 
1 141 PRO n 
1 142 ALA n 
1 143 LEU n 
1 144 GLY n 
1 145 GLY n 
1 146 HIS n 
1 147 THR n 
1 148 LYS n 
1 149 PRO n 
1 150 GLN n 
1 151 ASP n 
1 152 PHE n 
1 153 VAL n 
1 154 ILE n 
1 155 LEU n 
1 156 ALA n 
1 157 SER n 
1 158 ARG n 
1 159 ARG n 
1 160 LYS n 
1 161 PRO n 
1 162 CYS n 
1 163 ASP n 
1 164 ASN n 
1 165 GLY n 
1 166 ASP n 
1 167 PRO n 
1 168 TYR n 
1 169 VAL n 
1 170 ILE n 
1 171 ALA n 
1 172 LEU n 
1 173 ARG n 
1 174 SER n 
1 175 VAL n 
1 176 THR n 
1 177 LEU n 
1 178 PRO n 
1 179 THR n 
1 180 HIS n 
1 181 ARG n 
1 182 GLU n 
1 183 THR n 
1 184 PRO n 
1 185 GLU n 
1 186 TYR n 
1 187 ARG n 
1 188 ARG n 
1 189 GLY n 
1 190 GLU n 
1 191 THR n 
1 192 LEU n 
1 193 CYS n 
1 194 SER n 
1 195 GLY n 
1 196 PHE n 
1 197 CYS n 
1 198 LEU n 
1 199 TRP n 
1 200 ARG n 
1 201 GLU n 
1 202 GLY n 
1 203 ASP n 
1 204 GLN n 
1 205 LEU n 
1 206 THR n 
1 207 LYS n 
1 208 VAL n 
1 209 SER n 
1 210 TYR n 
1 211 TYR n 
1 212 ASN n 
1 213 GLN n 
1 214 ALA n 
1 215 THR n 
1 216 PRO n 
1 217 GLY n 
1 218 VAL n 
1 219 LEU n 
1 220 ASN n 
1 221 TYR n 
1 222 VAL n 
1 223 THR n 
1 224 THR n 
1 225 ASN n 
1 226 VAL n 
1 227 ALA n 
1 228 GLY n 
1 229 LEU n 
1 230 SER n 
1 231 SER n 
1 232 GLU n 
1 233 PHE n 
1 234 TYR n 
1 235 THR n 
1 236 THR n 
1 237 PHE n 
1 238 LYS n 
1 239 ALA n 
1 240 CYS n 
1 241 GLU n 
1 242 GLN n 
1 243 PHE n 
1 244 LEU n 
1 245 LEU n 
1 246 ASP n 
1 247 ASN n 
1 248 ARG n 
1 249 ASN n 
1 250 ASP n 
1 251 LEU n 
1 252 ALA n 
1 253 PRO n 
1 254 SER n 
1 255 LEU n 
1 256 GLN n 
1 257 THR n 
1 258 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ACOT11, hCG_33028, RP11-240D10.1-002' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       LEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q52LP1_HUMAN 
_struct_ref.pdbx_db_accession          Q52LP1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RPQPGDGERRYREASARKKIRLDRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLYTL
EDDKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPC
DNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKVSYYNQATPGVLNYVTTNVAGLSSEFYTTFKACEQ
FLLDNRNDLAPSLQTL
;
_struct_ref.pdbx_align_begin           339 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3FO5 A 3 ? 258 ? Q52LP1 339 ? 594 ? 339 594 
2 1 3FO5 B 3 ? 258 ? Q52LP1 339 ? 594 ? 339 594 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3FO5 SER A 1 ? UNP Q52LP1 ? ? 'EXPRESSION TAG' 337 1 
1 3FO5 MET A 2 ? UNP Q52LP1 ? ? 'EXPRESSION TAG' 338 2 
2 3FO5 SER B 1 ? UNP Q52LP1 ? ? 'EXPRESSION TAG' 337 3 
2 3FO5 MET B 2 ? UNP Q52LP1 ? ? 'EXPRESSION TAG' 338 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL'                     PEG400                                            
'C10 H22 O6'     238.278 
ALA 'L-peptide linking' y ALANINE                                    ?                                                 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                   ?                                                 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ?                                                 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ?                                                 
'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                             ?                                                 'Cl -1' 
35.453  
CYS 'L-peptide linking' y CYSTEINE                                   ?                                                 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                  ?                                                 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ?                                                 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                    ?                                                 
'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                                   'GLYCERIN; PROPANE-1,2,3-TRIOL'                   'C3 H8 O3' 
92.094  
HIS 'L-peptide linking' y HISTIDINE                                  ?                                                 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                      ?                                                 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                 ?                                                 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                    ?                                                 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                     ?                                                 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                 ?                                                 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                              ?                                                 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                    ?                                                 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                     ?                                                 
'C3 H7 N O3'     105.093 
TCE non-polymer         . 
;3,3',3''-phosphanetriyltripropanoic acid
;
'3-[bis(2-carboxyethyl)phosphanyl]propanoic acid' 'C9 H15 O6 P'    250.186 
THR 'L-peptide linking' y THREONINE                                  ?                                                 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                 ?                                                 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                   ?                                                 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                     ?                                                 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3FO5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
loop_
_exptl_crystal.id 
_exptl_crystal.density_meas 
_exptl_crystal.density_Matthews 
_exptl_crystal.density_percent_sol 
_exptl_crystal.description 
_exptl_crystal.F_000 
_exptl_crystal.preparation 
1 ? 2.37 48.20 ? ? ? 
2 ? ?    ?     ? ? ? 
# 
loop_
_exptl_crystal_grow.crystal_id 
_exptl_crystal_grow.method 
_exptl_crystal_grow.temp 
_exptl_crystal_grow.temp_details 
_exptl_crystal_grow.pH 
_exptl_crystal_grow.pdbx_details 
_exptl_crystal_grow.pdbx_pH_range 
1 'VAPOR DIFFUSION, SITTING DROP' 293 ? 5.5 
'0.2M Magnesium chloride, 0.1M Bis-tris, pH5.5, 25% PEG3350, VAPOR DIFFUSION, SITTING DROP, temperature 293K' ? 
2 'VAPOR DIFFUSION, SITTING DROP' 293 ? 5.5 
'0.2M Ammonium formate, 20% PEG3350, pH5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K'                  ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1   100 ? 1 
2   100 ? 2 
1,2 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4'  2008-06-26 mirrors 
2 CCD 'RAYONIX MX225HE' 2008-06-26 mirrors 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Si 111' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'Si 111' MAD                 x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.933   1.0 
2 0.97985 1.0 
3 0.97973 1.0 
4 0.97201 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'ESRF BEAMLINE ID14-2' ESRF  ID14-2 ? 0.933                       
2 SYNCHROTRON 'BESSY BEAMLINE 14.2'  BESSY 14.2   ? '0.97985, 0.97973, 0.97201' 
# 
_reflns.entry_id                     3FO5 
_reflns.observed_criterion_sigma_I   15.34 
_reflns.observed_criterion_sigma_F   12.7 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   37936 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.055 
_reflns.pdbx_Rsym_value              0.055 
_reflns.pdbx_netI_over_sigmaI        15.34 
_reflns.B_iso_Wilson_estimate        14.023 
_reflns.pdbx_redundancy              6.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.1 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.545 
_reflns_shell.pdbx_Rsym_value        0.730 
_reflns_shell.meanI_over_sigI_obs    2.57 
_reflns_shell.pdbx_redundancy        63.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5156 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 3FO5 
_refine.ls_number_reflns_obs                     36038 
_refine.ls_number_reflns_all                     36038 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.47 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.20466 
_refine.ls_R_factor_all                          0.20466 
_refine.ls_R_factor_R_work                       0.20222 
_refine.ls_R_factor_R_free                       0.25122 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1897 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.B_iso_mean                               19.969 
_refine.aniso_B[1][1]                            -0.12 
_refine.aniso_B[2][2]                            0.02 
_refine.aniso_B[3][3]                            0.10 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.186 
_refine.pdbx_overall_ESU_R_Free                  0.171 
_refine.overall_SU_ML                            0.126 
_refine.overall_SU_B                             10.139 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3FO5 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.171 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3810 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             168 
_refine_hist.number_atoms_total               4033 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        36.47 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.013  0.022  ? 3967 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.001  0.020  ? 2710 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.386  1.965  ? 5376 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      0.820  3.001  ? 6541 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.979  5.000  ? 471  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 36.262 23.594 ? 192  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 14.186 15.000 ? 654  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 17.295 15.000 ? 31   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.082  0.200  ? 593  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.006  0.021  ? 4355 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.001  0.020  ? 816  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.721  1.500  ? 2366 'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.180  1.500  ? 937  'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.358  2.000  ? 3844 'X-RAY DIFFRACTION' ? 
r_scbond_it            2.138  3.000  ? 1601 'X-RAY DIFFRACTION' ? 
r_scangle_it           3.473  4.500  ? 1531 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             2644 
_refine_ls_shell.R_factor_R_work                  0.255 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.303 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             139 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3FO5 
_struct.title                     'Human START domain of Acyl-coenzyme A thioesterase 11 (ACOT11)' 
_struct.pdbx_descriptor           'Thioesterase, adipose associated, isoform BFIT2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FO5 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
_struct_keywords.text            'Orthogonal Bundle, Consortium, LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 10  ? TYR A 28  ? GLU A 346 TYR A 364 1 ? 19 
HELX_P HELX_P2  2  ASP A 44  ? SER A 46  ? ASP A 380 SER A 382 5 ? 3  
HELX_P HELX_P3  3  ASN A 47  ? ALA A 64  ? ASN A 383 ALA A 400 1 ? 18 
HELX_P HELX_P4  4  ASP A 99  ? ASP A 109 ? ASP A 435 ASP A 445 1 ? 11 
HELX_P HELX_P5  5  LEU A 110 ? TRP A 116 ? LEU A 446 TRP A 452 5 ? 7  
HELX_P HELX_P6  6  THR A 215 ? GLY A 217 ? THR A 551 GLY A 553 5 ? 3  
HELX_P HELX_P7  7  VAL A 218 ? ALA A 227 ? VAL A 554 ALA A 563 1 ? 10 
HELX_P HELX_P8  8  SER A 231 ? ASN A 247 ? SER A 567 ASN A 583 1 ? 17 
HELX_P HELX_P9  9  ALA B 16  ? ILE B 29  ? ALA B 352 ILE B 365 1 ? 14 
HELX_P HELX_P10 10 ASP B 44  ? SER B 46  ? ASP B 380 SER B 382 5 ? 3  
HELX_P HELX_P11 11 ASN B 47  ? LYS B 65  ? ASN B 383 LYS B 401 1 ? 19 
HELX_P HELX_P12 12 ASP B 99  ? ASP B 109 ? ASP B 435 ASP B 445 1 ? 11 
HELX_P HELX_P13 13 LEU B 110 ? TRP B 116 ? LEU B 446 TRP B 452 5 ? 7  
HELX_P HELX_P14 14 THR B 215 ? GLY B 217 ? THR B 551 GLY B 553 5 ? 3  
HELX_P HELX_P15 15 VAL B 218 ? ALA B 227 ? VAL B 554 ALA B 563 1 ? 10 
HELX_P HELX_P16 16 SER B 231 ? ASN B 247 ? SER B 567 ASN B 583 1 ? 17 
HELX_P HELX_P17 17 LEU B 251 ? GLN B 256 ? LEU B 587 GLN B 592 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 8 ? 
C ? 5 ? 
D ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
D 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 40  ? PRO A 42  ? SER A 376 PRO A 378 
A 2 TYR A 168 ? THR A 176 ? TYR A 504 THR A 512 
A 3 GLN A 150 ? ARG A 159 ? GLN A 486 ARG A 495 
A 4 ASP A 133 ? SER A 140 ? ASP A 469 SER A 476 
A 5 SER A 122 ? ASP A 130 ? SER A 458 ASP A 466 
B 1 VAL A 69  ? ILE A 74  ? VAL A 405 ILE A 410 
B 2 VAL A 77  ? GLU A 83  ? VAL A 413 GLU A 419 
B 3 LEU A 88  ? VAL A 96  ? LEU A 424 VAL A 432 
B 4 LEU A 205 ? ASN A 212 ? LEU A 541 ASN A 548 
B 5 SER A 194 ? GLY A 202 ? SER A 530 GLY A 538 
B 6 TYR A 168 ? THR A 176 ? TYR A 504 THR A 512 
B 7 GLN A 150 ? ARG A 159 ? GLN A 486 ARG A 495 
B 8 ARG A 187 ? ARG A 188 ? ARG A 523 ARG A 524 
C 1 VAL B 41  ? PRO B 42  ? VAL B 377 PRO B 378 
C 2 TYR B 168 ? THR B 176 ? TYR B 504 THR B 512 
C 3 GLN B 150 ? ARG B 159 ? GLN B 486 ARG B 495 
C 4 ASP B 133 ? SER B 140 ? ASP B 469 SER B 476 
C 5 SER B 122 ? ASP B 130 ? SER B 458 ASP B 466 
D 1 VAL B 69  ? ILE B 74  ? VAL B 405 ILE B 410 
D 2 VAL B 77  ? GLU B 83  ? VAL B 413 GLU B 419 
D 3 LEU B 88  ? VAL B 96  ? LEU B 424 VAL B 432 
D 4 LEU B 205 ? ASN B 212 ? LEU B 541 ASN B 548 
D 5 SER B 194 ? GLY B 202 ? SER B 530 GLY B 538 
D 6 TYR B 168 ? THR B 176 ? TYR B 504 THR B 512 
D 7 GLN B 150 ? ARG B 159 ? GLN B 486 ARG B 495 
D 8 ARG B 187 ? ARG B 188 ? ARG B 523 ARG B 524 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 41  ? N VAL A 377 O THR A 176 ? O THR A 512 
A 2 3 O ALA A 171 ? O ALA A 507 N SER A 157 ? N SER A 493 
A 3 4 O ALA A 156 ? O ALA A 492 N ALA A 134 ? N ALA A 470 
A 4 5 O ILE A 135 ? O ILE A 471 N GLN A 127 ? N GLN A 463 
B 1 2 N VAL A 69  ? N VAL A 405 O THR A 81  ? O THR A 417 
B 2 3 N TYR A 80  ? N TYR A 416 O HIS A 91  ? O HIS A 427 
B 3 4 N MET A 94  ? N MET A 430 O VAL A 208 ? O VAL A 544 
B 4 5 O TYR A 211 ? O TYR A 547 N GLY A 195 ? N GLY A 531 
B 5 6 O SER A 194 ? O SER A 530 N LEU A 172 ? N LEU A 508 
B 6 7 O ALA A 171 ? O ALA A 507 N SER A 157 ? N SER A 493 
B 7 8 N ASP A 151 ? N ASP A 487 O ARG A 187 ? O ARG A 523 
C 1 2 N VAL B 41  ? N VAL B 377 O THR B 176 ? O THR B 512 
C 2 3 O ARG B 173 ? O ARG B 509 N LEU B 155 ? N LEU B 491 
C 3 4 O ALA B 156 ? O ALA B 492 N ALA B 134 ? N ALA B 470 
C 4 5 O HIS B 137 ? O HIS B 473 N GLU B 124 ? N GLU B 460 
D 1 2 N VAL B 69  ? N VAL B 405 O THR B 81  ? O THR B 417 
D 2 3 N TYR B 80  ? N TYR B 416 O HIS B 91  ? O HIS B 427 
D 3 4 N VAL B 96  ? N VAL B 432 O THR B 206 ? O THR B 542 
D 4 5 O TYR B 211 ? O TYR B 547 N GLY B 195 ? N GLY B 531 
D 5 6 O SER B 194 ? O SER B 530 N LEU B 172 ? N LEU B 508 
D 6 7 O ARG B 173 ? O ARG B 509 N LEU B 155 ? N LEU B 491 
D 7 8 N ASP B 151 ? N ASP B 487 O ARG B 187 ? O ARG B 523 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE 1PE A 2'   
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 1'    
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 595' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE TCE A 596' 
AC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE 1PE B 1'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ARG A 113 ? ARG A 449 . ? 1_555 ? 
2  AC1 5 TYR A 120 ? TYR A 456 . ? 1_555 ? 
3  AC1 5 LEU A 172 ? LEU A 508 . ? 1_555 ? 
4  AC1 5 TYR A 210 ? TYR A 546 . ? 1_555 ? 
5  AC1 5 PHE A 233 ? PHE A 569 . ? 1_555 ? 
6  AC2 4 HIS A 146 ? HIS A 482 . ? 1_555 ? 
7  AC2 4 THR A 147 ? THR A 483 . ? 1_555 ? 
8  AC2 4 LYS A 148 ? LYS A 484 . ? 1_555 ? 
9  AC2 4 ARG A 187 ? ARG A 523 . ? 1_555 ? 
10 AC3 7 PHE A 87  ? PHE A 423 . ? 1_555 ? 
11 AC3 7 LEU A 88  ? LEU A 424 . ? 1_555 ? 
12 AC3 7 ASN A 212 ? ASN A 548 . ? 1_555 ? 
13 AC3 7 ALA A 214 ? ALA A 550 . ? 1_555 ? 
14 AC3 7 THR A 215 ? THR A 551 . ? 1_555 ? 
15 AC3 7 LEU A 219 ? LEU A 555 . ? 1_555 ? 
16 AC3 7 VAL A 222 ? VAL A 558 . ? 1_555 ? 
17 AC4 7 HOH H .   ? HOH A 31  . ? 1_555 ? 
18 AC4 7 HOH H .   ? HOH A 207 . ? 1_555 ? 
19 AC4 7 SER A 17  ? SER A 353 . ? 1_555 ? 
20 AC4 7 LYS A 20  ? LYS A 356 . ? 1_555 ? 
21 AC4 7 SER A 71  ? SER A 407 . ? 1_555 ? 
22 AC4 7 ALA A 227 ? ALA A 563 . ? 1_555 ? 
23 AC4 7 ASN B 249 ? ASN B 585 . ? 8_556 ? 
24 AC5 8 ARG B 113 ? ARG B 449 . ? 1_555 ? 
25 AC5 8 TYR B 120 ? TYR B 456 . ? 1_555 ? 
26 AC5 8 PHE B 152 ? PHE B 488 . ? 1_555 ? 
27 AC5 8 LEU B 172 ? LEU B 508 . ? 1_555 ? 
28 AC5 8 THR B 191 ? THR B 527 . ? 1_555 ? 
29 AC5 8 TYR B 210 ? TYR B 546 . ? 1_555 ? 
30 AC5 8 ASN B 212 ? ASN B 548 . ? 1_555 ? 
31 AC5 8 PHE B 237 ? PHE B 573 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3FO5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3FO5 
_atom_sites.fract_transf_matrix[1][1]   0.019069 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007688 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006052 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 10  ? 38.984  32.238  64.199 1.00 28.50 ? 346 GLU A N   1 
ATOM   2    C  CA  . GLU A 1 10  ? 37.686  32.972  64.261 1.00 28.26 ? 346 GLU A CA  1 
ATOM   3    C  C   . GLU A 1 10  ? 36.773  32.457  65.378 1.00 28.16 ? 346 GLU A C   1 
ATOM   4    O  O   . GLU A 1 10  ? 35.626  32.916  65.501 1.00 28.34 ? 346 GLU A O   1 
ATOM   5    C  CB  . GLU A 1 10  ? 36.965  32.884  62.907 1.00 28.18 ? 346 GLU A CB  1 
ATOM   6    N  N   . ARG A 1 11  ? 37.281  31.518  66.186 1.00 28.03 ? 347 ARG A N   1 
ATOM   7    C  CA  . ARG A 1 11  ? 36.512  30.916  67.285 1.00 27.75 ? 347 ARG A CA  1 
ATOM   8    C  C   . ARG A 1 11  ? 36.043  31.998  68.250 1.00 27.64 ? 347 ARG A C   1 
ATOM   9    O  O   . ARG A 1 11  ? 34.878  32.011  68.688 1.00 26.86 ? 347 ARG A O   1 
ATOM   10   C  CB  . ARG A 1 11  ? 37.340  29.902  68.078 1.00 27.80 ? 347 ARG A CB  1 
ATOM   11   C  CG  . ARG A 1 11  ? 38.012  28.788  67.270 1.00 28.19 ? 347 ARG A CG  1 
ATOM   12   C  CD  . ARG A 1 11  ? 38.419  27.617  68.160 1.00 25.89 ? 347 ARG A CD  1 
ATOM   13   N  N   . ARG A 1 12  ? 36.978  32.892  68.576 1.00 27.09 ? 348 ARG A N   1 
ATOM   14   C  CA  . ARG A 1 12  ? 36.735  33.990  69.492 1.00 26.90 ? 348 ARG A CA  1 
ATOM   15   C  C   . ARG A 1 12  ? 35.549  34.821  69.043 1.00 26.74 ? 348 ARG A C   1 
ATOM   16   O  O   . ARG A 1 12  ? 34.663  35.135  69.842 1.00 26.75 ? 348 ARG A O   1 
ATOM   17   C  CB  . ARG A 1 12  ? 37.975  34.874  69.601 1.00 27.02 ? 348 ARG A CB  1 
ATOM   18   C  CG  . ARG A 1 12  ? 37.929  35.835  70.765 1.00 27.77 ? 348 ARG A CG  1 
ATOM   19   N  N   . TYR A 1 13  ? 35.526  35.146  67.752 1.00 26.24 ? 349 TYR A N   1 
ATOM   20   C  CA  . TYR A 1 13  ? 34.505  36.008  67.186 1.00 25.89 ? 349 TYR A CA  1 
ATOM   21   C  C   . TYR A 1 13  ? 33.126  35.354  67.156 1.00 24.81 ? 349 TYR A C   1 
ATOM   22   O  O   . TYR A 1 13  ? 32.137  36.018  67.405 1.00 24.71 ? 349 TYR A O   1 
ATOM   23   C  CB  . TYR A 1 13  ? 34.928  36.463  65.794 1.00 26.56 ? 349 TYR A CB  1 
ATOM   24   C  CG  . TYR A 1 13  ? 36.105  37.402  65.846 1.00 26.84 ? 349 TYR A CG  1 
ATOM   25   C  CD1 . TYR A 1 13  ? 35.927  38.744  66.145 1.00 28.02 ? 349 TYR A CD1 1 
ATOM   26   C  CD2 . TYR A 1 13  ? 37.399  36.945  65.627 1.00 29.30 ? 349 TYR A CD2 1 
ATOM   27   C  CE1 . TYR A 1 13  ? 37.006  39.611  66.221 1.00 29.92 ? 349 TYR A CE1 1 
ATOM   28   C  CE2 . TYR A 1 13  ? 38.487  37.811  65.689 1.00 29.28 ? 349 TYR A CE2 1 
ATOM   29   C  CZ  . TYR A 1 13  ? 38.278  39.145  65.985 1.00 29.65 ? 349 TYR A CZ  1 
ATOM   30   O  OH  . TYR A 1 13  ? 39.348  40.017  66.056 1.00 33.49 ? 349 TYR A OH  1 
ATOM   31   N  N   . ARG A 1 14  ? 33.093  34.054  66.862 1.00 23.81 ? 350 ARG A N   1 
ATOM   32   C  CA  . ARG A 1 14  ? 31.896  33.203  66.996 1.00 22.58 ? 350 ARG A CA  1 
ATOM   33   C  C   . ARG A 1 14  ? 31.359  33.131  68.418 1.00 21.24 ? 350 ARG A C   1 
ATOM   34   O  O   . ARG A 1 14  ? 30.152  33.131  68.631 1.00 21.27 ? 350 ARG A O   1 
ATOM   35   C  CB  . ARG A 1 14  ? 32.224  31.765  66.583 1.00 23.03 ? 350 ARG A CB  1 
ATOM   36   C  CG  . ARG A 1 14  ? 31.621  31.327  65.295 1.00 23.18 ? 350 ARG A CG  1 
ATOM   37   C  CD  . ARG A 1 14  ? 31.687  29.811  65.179 1.00 26.14 ? 350 ARG A CD  1 
ATOM   38   N  NE  . ARG A 1 14  ? 33.059  29.330  65.121 1.00 28.76 ? 350 ARG A NE  1 
ATOM   39   C  CZ  . ARG A 1 14  ? 33.643  28.493  65.981 1.00 31.83 ? 350 ARG A CZ  1 
ATOM   40   N  NH1 . ARG A 1 14  ? 32.995  27.971  67.021 1.00 32.90 ? 350 ARG A NH1 1 
ATOM   41   N  NH2 . ARG A 1 14  ? 34.912  28.153  65.781 1.00 33.04 ? 350 ARG A NH2 1 
ATOM   42   N  N   . GLU A 1 15  ? 32.261  33.004  69.384 1.00 19.62 ? 351 GLU A N   1 
ATOM   43   C  CA  . GLU A 1 15  ? 31.876  32.984  70.788 1.00 18.75 ? 351 GLU A CA  1 
ATOM   44   C  C   . GLU A 1 15  ? 31.222  34.301  71.204 1.00 17.56 ? 351 GLU A C   1 
ATOM   45   O  O   . GLU A 1 15  ? 30.213  34.292  71.928 1.00 17.18 ? 351 GLU A O   1 
ATOM   46   C  CB  . GLU A 1 15  ? 33.080  32.696  71.682 1.00 18.97 ? 351 GLU A CB  1 
ATOM   47   C  CG  . GLU A 1 15  ? 32.717  32.008  72.994 1.00 20.88 ? 351 GLU A CG  1 
ATOM   48   C  CD  . GLU A 1 15  ? 32.231  30.546  72.833 1.00 23.46 ? 351 GLU A CD  1 
ATOM   49   O  OE1 . GLU A 1 15  ? 31.878  30.098  71.701 1.00 25.25 ? 351 GLU A OE1 1 
ATOM   50   O  OE2 . GLU A 1 15  ? 32.180  29.841  73.864 1.00 25.44 ? 351 GLU A OE2 1 
ATOM   51   N  N   . ALA A 1 16  ? 31.783  35.416  70.725 1.00 16.03 ? 352 ALA A N   1 
ATOM   52   C  CA  . ALA A 1 16  ? 31.227  36.746  70.978 1.00 15.37 ? 352 ALA A CA  1 
ATOM   53   C  C   . ALA A 1 16  ? 29.815  36.840  70.429 1.00 15.08 ? 352 ALA A C   1 
ATOM   54   O  O   . ALA A 1 16  ? 28.910  37.248  71.140 1.00 13.81 ? 352 ALA A O   1 
ATOM   55   C  CB  . ALA A 1 16  ? 32.086  37.830  70.354 1.00 14.95 ? 352 ALA A CB  1 
ATOM   56   N  N   . SER A 1 17  ? 29.650  36.505  69.147 1.00 15.46 ? 353 SER A N   1 
ATOM   57   C  CA  . SER A 1 17  ? 28.317  36.428  68.527 1.00 16.01 ? 353 SER A CA  1 
ATOM   58   C  C   . SER A 1 17  ? 27.322  35.635  69.374 1.00 15.48 ? 353 SER A C   1 
ATOM   59   O  O   . SER A 1 17  ? 26.230  36.128  69.653 1.00 15.50 ? 353 SER A O   1 
ATOM   60   C  CB  . SER A 1 17  ? 28.399  35.780  67.142 1.00 16.58 ? 353 SER A CB  1 
ATOM   61   O  OG  . SER A 1 17  ? 29.051  36.632  66.220 1.00 19.07 ? 353 SER A OG  1 
ATOM   62   N  N   . ALA A 1 18  ? 27.701  34.409  69.756 1.00 15.23 ? 354 ALA A N   1 
ATOM   63   C  CA  . ALA A 1 18  ? 26.846  33.528  70.580 1.00 14.72 ? 354 ALA A CA  1 
ATOM   64   C  C   . ALA A 1 18  ? 26.416  34.192  71.895 1.00 14.70 ? 354 ALA A C   1 
ATOM   65   O  O   . ALA A 1 18  ? 25.251  34.108  72.297 1.00 13.69 ? 354 ALA A O   1 
ATOM   66   C  CB  . ALA A 1 18  ? 27.559  32.221  70.863 1.00 14.51 ? 354 ALA A CB  1 
ATOM   67   N  N   . ARG A 1 19  ? 27.352  34.883  72.541 1.00 14.64 ? 355 ARG A N   1 
ATOM   68   C  CA  . ARG A 1 19  ? 27.061  35.596  73.780 1.00 15.49 ? 355 ARG A CA  1 
ATOM   69   C  C   . ARG A 1 19  ? 26.094  36.752  73.570 1.00 15.61 ? 355 ARG A C   1 
ATOM   70   O  O   . ARG A 1 19  ? 25.186  36.985  74.382 1.00 15.32 ? 355 ARG A O   1 
ATOM   71   C  CB  . ARG A 1 19  ? 28.373  36.051  74.442 1.00 16.39 ? 355 ARG A CB  1 
ATOM   72   C  CG  . ARG A 1 19  ? 29.113  34.863  74.958 1.00 18.28 ? 355 ARG A CG  1 
ATOM   73   C  CD  . ARG A 1 19  ? 30.548  35.108  75.134 1.00 24.29 ? 355 ARG A CD  1 
ATOM   74   N  NE  . ARG A 1 19  ? 30.800  36.163  76.101 1.00 27.57 ? 355 ARG A NE  1 
ATOM   75   C  CZ  . ARG A 1 19  ? 31.962  36.800  76.213 1.00 32.17 ? 355 ARG A CZ  1 
ATOM   76   N  NH1 . ARG A 1 19  ? 32.977  36.477  75.413 1.00 33.99 ? 355 ARG A NH1 1 
ATOM   77   N  NH2 . ARG A 1 19  ? 32.123  37.758  77.131 1.00 32.30 ? 355 ARG A NH2 1 
ATOM   78   N  N   . LYS A 1 20  ? 26.250  37.432  72.437 1.00 15.39 ? 356 LYS A N   1 
ATOM   79   C  CA  . LYS A 1 20  ? 25.420  38.549  72.112 1.00 14.50 ? 356 LYS A CA  1 
ATOM   80   C  C   . LYS A 1 20  ? 23.996  38.080  71.914 1.00 14.34 ? 356 LYS A C   1 
ATOM   81   O  O   . LYS A 1 20  ? 23.093  38.713  72.413 1.00 12.10 ? 356 LYS A O   1 
ATOM   82   C  CB  . LYS A 1 20  ? 25.926  39.282  70.877 1.00 14.93 ? 356 LYS A CB  1 
ATOM   83   C  CG  . LYS A 1 20  ? 25.080  40.485  70.550 1.00 16.16 ? 356 LYS A CG  1 
ATOM   84   C  CD  . LYS A 1 20  ? 25.680  41.432  69.535 1.00 17.24 ? 356 LYS A CD  1 
ATOM   85   C  CE  . LYS A 1 20  ? 24.717  42.558  69.238 1.00 19.36 ? 356 LYS A CE  1 
ATOM   86   N  NZ  . LYS A 1 20  ? 25.246  43.584  68.292 1.00 22.22 ? 356 LYS A NZ  1 
ATOM   87   N  N   . LYS A 1 21  ? 23.805  36.957  71.226 1.00 14.47 ? 357 LYS A N   1 
ATOM   88   C  CA  . LYS A 1 21  ? 22.455  36.412  71.052 1.00 15.16 ? 357 LYS A CA  1 
ATOM   89   C  C   . LYS A 1 21  ? 21.805  36.074  72.400 1.00 14.73 ? 357 LYS A C   1 
ATOM   90   O  O   . LYS A 1 21  ? 20.674  36.460  72.635 1.00 14.39 ? 357 LYS A O   1 
ATOM   91   C  CB  . LYS A 1 21  ? 22.436  35.176  70.153 1.00 16.02 ? 357 LYS A CB  1 
ATOM   92   C  CG  . LYS A 1 21  ? 20.985  34.653  69.999 1.00 16.22 ? 357 LYS A CG  1 
ATOM   93   C  CD  . LYS A 1 21  ? 20.816  33.503  69.056 1.00 17.97 ? 357 LYS A CD  1 
ATOM   94   C  CE  . LYS A 1 21  ? 19.291  33.245  68.831 1.00 19.73 ? 357 LYS A CE  1 
ATOM   95   N  NZ  . LYS A 1 21  ? 18.837  32.240  69.768 1.00 22.36 ? 357 LYS A NZ  1 
ATOM   96   N  N   . ILE A 1 22  ? 22.518  35.370  73.278 1.00 15.40 ? 358 ILE A N   1 
ATOM   97   C  CA  . ILE A 1 22  ? 22.017  35.086  74.636 1.00 15.99 ? 358 ILE A CA  1 
ATOM   98   C  C   . ILE A 1 22  ? 21.597  36.382  75.372 1.00 15.88 ? 358 ILE A C   1 
ATOM   99   O  O   . ILE A 1 22  ? 20.533  36.439  75.961 1.00 14.72 ? 358 ILE A O   1 
ATOM   100  C  CB  . ILE A 1 22  ? 23.049  34.360  75.506 1.00 16.31 ? 358 ILE A CB  1 
ATOM   101  C  CG1 . ILE A 1 22  ? 23.184  32.893  75.097 1.00 18.08 ? 358 ILE A CG1 1 
ATOM   102  C  CG2 . ILE A 1 22  ? 22.658  34.433  76.984 1.00 17.62 ? 358 ILE A CG2 1 
ATOM   103  C  CD1 . ILE A 1 22  ? 24.464  32.248  75.644 1.00 18.97 ? 358 ILE A CD1 1 
ATOM   104  N  N   . ARG A 1 23  ? 22.427  37.414  75.324 1.00 16.30 ? 359 ARG A N   1 
ATOM   105  C  CA  . ARG A 1 23  ? 22.094  38.684  75.994 1.00 17.05 ? 359 ARG A CA  1 
ATOM   106  C  C   . ARG A 1 23  ? 20.781  39.243  75.451 1.00 17.06 ? 359 ARG A C   1 
ATOM   107  O  O   . ARG A 1 23  ? 19.854  39.563  76.206 1.00 17.30 ? 359 ARG A O   1 
ATOM   108  C  CB  . ARG A 1 23  ? 23.213  39.719  75.816 1.00 17.09 ? 359 ARG A CB  1 
ATOM   109  C  CG  . ARG A 1 23  ? 22.859  41.082  76.423 1.00 18.56 ? 359 ARG A CG  1 
ATOM   110  C  CD  . ARG A 1 23  ? 24.016  42.088  76.400 1.00 20.25 ? 359 ARG A CD  1 
ATOM   111  N  NE  . ARG A 1 23  ? 24.325  42.569  75.048 1.00 19.50 ? 359 ARG A NE  1 
ATOM   112  C  CZ  . ARG A 1 23  ? 23.559  43.383  74.331 1.00 21.00 ? 359 ARG A CZ  1 
ATOM   113  N  NH1 . ARG A 1 23  ? 22.398  43.841  74.794 1.00 18.84 ? 359 ARG A NH1 1 
ATOM   114  N  NH2 . ARG A 1 23  ? 23.956  43.739  73.122 1.00 22.37 ? 359 ARG A NH2 1 
ATOM   115  N  N   . LEU A 1 24  ? 20.688  39.328  74.130 1.00 16.86 ? 360 LEU A N   1 
ATOM   116  C  CA  . LEU A 1 24  ? 19.529  39.937  73.502 1.00 16.92 ? 360 LEU A CA  1 
ATOM   117  C  C   . LEU A 1 24  ? 18.253  39.165  73.790 1.00 17.35 ? 360 LEU A C   1 
ATOM   118  O  O   . LEU A 1 24  ? 17.228  39.756  74.122 1.00 17.84 ? 360 LEU A O   1 
ATOM   119  C  CB  . LEU A 1 24  ? 19.756  40.057  71.998 1.00 16.74 ? 360 LEU A CB  1 
ATOM   120  C  CG  . LEU A 1 24  ? 20.740  41.128  71.518 1.00 16.02 ? 360 LEU A CG  1 
ATOM   121  C  CD1 . LEU A 1 24  ? 20.861  41.021  69.996 1.00 14.84 ? 360 LEU A CD1 1 
ATOM   122  C  CD2 . LEU A 1 24  ? 20.287  42.547  71.941 1.00 13.82 ? 360 LEU A CD2 1 
ATOM   123  N  N   . ASP A 1 25  ? 18.328  37.843  73.648 1.00 18.08 ? 361 ASP A N   1 
ATOM   124  C  CA  . ASP A 1 25  ? 17.201  36.958  73.910 1.00 18.74 ? 361 ASP A CA  1 
ATOM   125  C  C   . ASP A 1 25  ? 16.671  37.108  75.325 1.00 18.83 ? 361 ASP A C   1 
ATOM   126  O  O   . ASP A 1 25  ? 15.474  37.207  75.517 1.00 18.60 ? 361 ASP A O   1 
ATOM   127  C  CB  . ASP A 1 25  ? 17.584  35.496  73.628 1.00 18.76 ? 361 ASP A CB  1 
ATOM   128  C  CG  . ASP A 1 25  ? 17.584  35.169  72.128 1.00 20.59 ? 361 ASP A CG  1 
ATOM   129  O  OD1 . ASP A 1 25  ? 17.032  35.959  71.327 1.00 20.89 ? 361 ASP A OD1 1 
ATOM   130  O  OD2 . ASP A 1 25  ? 18.146  34.115  71.757 1.00 22.12 ? 361 ASP A OD2 1 
ATOM   131  N  N   . ARG A 1 26  ? 17.567  37.109  76.310 1.00 19.79 ? 362 ARG A N   1 
ATOM   132  C  CA  . ARG A 1 26  ? 17.190  37.331  77.706 1.00 20.92 ? 362 ARG A CA  1 
ATOM   133  C  C   . ARG A 1 26  ? 16.545  38.706  77.869 1.00 20.96 ? 362 ARG A C   1 
ATOM   134  O  O   . ARG A 1 26  ? 15.554  38.853  78.568 1.00 20.87 ? 362 ARG A O   1 
ATOM   135  C  CB  . ARG A 1 26  ? 18.421  37.258  78.622 1.00 21.27 ? 362 ARG A CB  1 
ATOM   136  C  CG  . ARG A 1 26  ? 18.935  35.876  78.867 1.00 23.02 ? 362 ARG A CG  1 
ATOM   137  C  CD  . ARG A 1 26  ? 20.158  35.922  79.757 1.00 27.03 ? 362 ARG A CD  1 
ATOM   138  N  NE  . ARG A 1 26  ? 20.728  34.591  79.923 1.00 29.42 ? 362 ARG A NE  1 
ATOM   139  C  CZ  . ARG A 1 26  ? 22.000  34.337  80.238 1.00 31.21 ? 362 ARG A CZ  1 
ATOM   140  N  NH1 . ARG A 1 26  ? 22.880  35.320  80.415 1.00 31.37 ? 362 ARG A NH1 1 
ATOM   141  N  NH2 . ARG A 1 26  ? 22.398  33.076  80.363 1.00 33.74 ? 362 ARG A NH2 1 
ATOM   142  N  N   . LYS A 1 27  ? 17.114  39.701  77.208 1.00 21.09 ? 363 LYS A N   1 
ATOM   143  C  CA  . LYS A 1 27  ? 16.631  41.065  77.349 1.00 21.83 ? 363 LYS A CA  1 
ATOM   144  C  C   . LYS A 1 27  ? 15.168  41.220  76.881 1.00 21.59 ? 363 LYS A C   1 
ATOM   145  O  O   . LYS A 1 27  ? 14.391  41.917  77.517 1.00 21.24 ? 363 LYS A O   1 
ATOM   146  C  CB  . LYS A 1 27  ? 17.547  42.018  76.591 1.00 22.03 ? 363 LYS A CB  1 
ATOM   147  C  CG  . LYS A 1 27  ? 17.196  43.466  76.764 1.00 23.63 ? 363 LYS A CG  1 
ATOM   148  C  CD  . LYS A 1 27  ? 18.176  44.346  76.037 1.00 25.94 ? 363 LYS A CD  1 
ATOM   149  C  CE  . LYS A 1 27  ? 17.850  45.831  76.221 1.00 26.21 ? 363 LYS A CE  1 
ATOM   150  N  NZ  . LYS A 1 27  ? 19.119  46.599  76.069 1.00 28.03 ? 363 LYS A NZ  1 
ATOM   151  N  N   . TYR A 1 28  ? 14.807  40.552  75.791 1.00 21.27 ? 364 TYR A N   1 
ATOM   152  C  CA  . TYR A 1 28  ? 13.480  40.672  75.185 1.00 21.16 ? 364 TYR A CA  1 
ATOM   153  C  C   . TYR A 1 28  ? 12.652  39.397  75.349 1.00 21.12 ? 364 TYR A C   1 
ATOM   154  O  O   . TYR A 1 28  ? 11.762  39.096  74.551 1.00 21.14 ? 364 TYR A O   1 
ATOM   155  C  CB  . TYR A 1 28  ? 13.649  41.036  73.716 1.00 21.34 ? 364 TYR A CB  1 
ATOM   156  C  CG  . TYR A 1 28  ? 14.344  42.378  73.527 1.00 20.86 ? 364 TYR A CG  1 
ATOM   157  C  CD1 . TYR A 1 28  ? 13.660  43.568  73.767 1.00 19.96 ? 364 TYR A CD1 1 
ATOM   158  C  CD2 . TYR A 1 28  ? 15.682  42.457  73.129 1.00 19.15 ? 364 TYR A CD2 1 
ATOM   159  C  CE1 . TYR A 1 28  ? 14.283  44.799  73.628 1.00 18.08 ? 364 TYR A CE1 1 
ATOM   160  C  CE2 . TYR A 1 28  ? 16.317  43.698  72.971 1.00 19.90 ? 364 TYR A CE2 1 
ATOM   161  C  CZ  . TYR A 1 28  ? 15.604  44.867  73.213 1.00 19.68 ? 364 TYR A CZ  1 
ATOM   162  O  OH  . TYR A 1 28  ? 16.211  46.100  73.052 1.00 19.77 ? 364 TYR A OH  1 
ATOM   163  N  N   . ILE A 1 29  ? 12.939  38.644  76.402 1.00 21.21 ? 365 ILE A N   1 
ATOM   164  C  CA  . ILE A 1 29  ? 12.261  37.368  76.617 1.00 21.54 ? 365 ILE A CA  1 
ATOM   165  C  C   . ILE A 1 29  ? 10.774  37.578  76.900 1.00 21.40 ? 365 ILE A C   1 
ATOM   166  O  O   . ILE A 1 29  ? 9.952   36.693  76.660 1.00 21.96 ? 365 ILE A O   1 
ATOM   167  C  CB  . ILE A 1 29  ? 12.922  36.587  77.760 1.00 21.57 ? 365 ILE A CB  1 
ATOM   168  C  CG1 . ILE A 1 29  ? 12.604  35.094  77.621 1.00 22.50 ? 365 ILE A CG1 1 
ATOM   169  C  CG2 . ILE A 1 29  ? 12.513  37.169  79.124 1.00 22.00 ? 365 ILE A CG2 1 
ATOM   170  C  CD1 . ILE A 1 29  ? 13.412  34.186  78.574 1.00 17.64 ? 365 ILE A CD1 1 
ATOM   171  N  N   . VAL A 1 30  ? 10.423  38.758  77.398 1.00 21.61 ? 366 VAL A N   1 
ATOM   172  C  CA  . VAL A 1 30  ? 9.026   39.106  77.578 1.00 21.26 ? 366 VAL A CA  1 
ATOM   173  C  C   . VAL A 1 30  ? 8.653   40.003  76.416 1.00 21.69 ? 366 VAL A C   1 
ATOM   174  O  O   . VAL A 1 30  ? 9.049   41.159  76.376 1.00 21.82 ? 366 VAL A O   1 
ATOM   175  C  CB  . VAL A 1 30  ? 8.757   39.805  78.930 1.00 21.45 ? 366 VAL A CB  1 
ATOM   176  C  CG1 . VAL A 1 30  ? 7.297   40.281  79.000 1.00 21.38 ? 366 VAL A CG1 1 
ATOM   177  C  CG2 . VAL A 1 30  ? 9.111   38.877  80.131 1.00 19.92 ? 366 VAL A CG2 1 
ATOM   178  N  N   . SER A 1 31  ? 7.870   39.464  75.484 1.00 21.87 ? 367 SER A N   1 
ATOM   179  C  CA  . SER A 1 31  ? 7.518   40.173  74.246 1.00 22.77 ? 367 SER A CA  1 
ATOM   180  C  C   . SER A 1 31  ? 6.567   41.328  74.544 1.00 23.01 ? 367 SER A C   1 
ATOM   181  O  O   . SER A 1 31  ? 5.747   41.255  75.485 1.00 21.63 ? 367 SER A O   1 
ATOM   182  C  CB  . SER A 1 31  ? 6.835   39.233  73.246 1.00 22.57 ? 367 SER A CB  1 
ATOM   183  O  OG  . SER A 1 31  ? 5.579   38.805  73.751 1.00 22.65 ? 367 SER A OG  1 
ATOM   184  N  N   . CYS A 1 32  ? 6.671   42.384  73.742 1.00 23.16 ? 368 CYS A N   1 
ATOM   185  C  CA  A CYS A 1 32  ? 5.752   43.515  73.827 0.50 23.87 ? 368 CYS A CA  1 
ATOM   186  C  CA  B CYS A 1 32  ? 5.739   43.489  73.920 0.50 24.23 ? 368 CYS A CA  1 
ATOM   187  C  C   . CYS A 1 32  ? 4.355   43.048  73.429 1.00 23.82 ? 368 CYS A C   1 
ATOM   188  O  O   . CYS A 1 32  ? 4.221   42.277  72.468 1.00 23.65 ? 368 CYS A O   1 
ATOM   189  C  CB  A CYS A 1 32  ? 6.212   44.648  72.903 0.50 23.84 ? 368 CYS A CB  1 
ATOM   190  C  CB  B CYS A 1 32  ? 6.219   44.764  73.235 0.50 24.32 ? 368 CYS A CB  1 
ATOM   191  S  SG  A CYS A 1 32  ? 5.102   46.069  72.891 0.50 24.81 ? 368 CYS A SG  1 
ATOM   192  S  SG  B CYS A 1 32  ? 6.306   44.623  71.492 0.50 27.29 ? 368 CYS A SG  1 
ATOM   193  N  N   . LYS A 1 33  ? 3.339   43.516  74.151 1.00 23.68 ? 369 LYS A N   1 
ATOM   194  C  CA  . LYS A 1 33  ? 1.945   43.111  73.958 1.00 23.29 ? 369 LYS A CA  1 
ATOM   195  C  C   . LYS A 1 33  ? 1.112   44.174  73.254 1.00 23.24 ? 369 LYS A C   1 
ATOM   196  O  O   . LYS A 1 33  ? 1.443   45.358  73.306 1.00 22.24 ? 369 LYS A O   1 
ATOM   197  C  CB  . LYS A 1 33  ? 1.308   42.839  75.324 1.00 23.44 ? 369 LYS A CB  1 
ATOM   198  C  CG  . LYS A 1 33  ? 1.508   41.426  75.806 1.00 24.88 ? 369 LYS A CG  1 
ATOM   199  C  CD  . LYS A 1 33  ? 2.908   41.156  76.256 1.00 24.80 ? 369 LYS A CD  1 
ATOM   200  C  CE  . LYS A 1 33  ? 3.266   39.647  76.128 1.00 23.92 ? 369 LYS A CE  1 
ATOM   201  N  NZ  . LYS A 1 33  ? 4.607   39.447  76.710 1.00 18.09 ? 369 LYS A NZ  1 
ATOM   202  N  N   . GLN A 1 34  ? 0.022   43.721  72.619 1.00 23.05 ? 370 GLN A N   1 
ATOM   203  C  CA  . GLN A 1 34  ? -0.949  44.569  71.920 1.00 23.03 ? 370 GLN A CA  1 
ATOM   204  C  C   . GLN A 1 34  ? -1.524  45.653  72.843 1.00 22.98 ? 370 GLN A C   1 
ATOM   205  O  O   . GLN A 1 34  ? -1.837  46.743  72.389 1.00 23.58 ? 370 GLN A O   1 
ATOM   206  C  CB  . GLN A 1 34  ? -2.084  43.700  71.325 1.00 23.24 ? 370 GLN A CB  1 
ATOM   207  C  CG  . GLN A 1 34  ? -3.265  44.489  70.691 1.00 25.29 ? 370 GLN A CG  1 
ATOM   208  C  CD  . GLN A 1 34  ? -2.830  45.360  69.490 1.00 27.11 ? 370 GLN A CD  1 
ATOM   209  O  OE1 . GLN A 1 34  ? -1.828  45.078  68.855 1.00 24.29 ? 370 GLN A OE1 1 
ATOM   210  N  NE2 . GLN A 1 34  ? -3.615  46.416  69.178 1.00 27.16 ? 370 GLN A NE2 1 
ATOM   211  N  N   . THR A 1 35  ? -1.614  45.377  74.138 1.00 22.10 ? 371 THR A N   1 
ATOM   212  C  CA  . THR A 1 35  ? -2.044  46.397  75.092 1.00 21.91 ? 371 THR A CA  1 
ATOM   213  C  C   . THR A 1 35  ? -1.004  47.504  75.327 1.00 21.68 ? 371 THR A C   1 
ATOM   214  O  O   . THR A 1 35  ? -1.373  48.611  75.733 1.00 21.31 ? 371 THR A O   1 
ATOM   215  C  CB  . THR A 1 35  ? -2.428  45.771  76.455 1.00 22.01 ? 371 THR A CB  1 
ATOM   216  O  OG1 . THR A 1 35  ? -1.278  45.126  77.042 1.00 20.71 ? 371 THR A OG1 1 
ATOM   217  C  CG2 . THR A 1 35  ? -3.575  44.771  76.265 1.00 21.47 ? 371 THR A CG2 1 
ATOM   218  N  N   . GLU A 1 36  ? 0.277   47.214  75.100 1.00 21.15 ? 372 GLU A N   1 
ATOM   219  C  CA  . GLU A 1 36  ? 1.347   48.174  75.428 1.00 21.50 ? 372 GLU A CA  1 
ATOM   220  C  C   . GLU A 1 36  ? 1.668   49.054  74.228 1.00 21.32 ? 372 GLU A C   1 
ATOM   221  O  O   . GLU A 1 36  ? 1.883   50.245  74.361 1.00 20.33 ? 372 GLU A O   1 
ATOM   222  C  CB  . GLU A 1 36  ? 2.606   47.451  75.909 1.00 21.44 ? 372 GLU A CB  1 
ATOM   223  C  CG  . GLU A 1 36  ? 2.365   46.619  77.169 1.00 22.23 ? 372 GLU A CG  1 
ATOM   224  C  CD  . GLU A 1 36  ? 3.517   45.678  77.519 1.00 22.49 ? 372 GLU A CD  1 
ATOM   225  O  OE1 . GLU A 1 36  ? 3.981   44.953  76.620 1.00 19.58 ? 372 GLU A OE1 1 
ATOM   226  O  OE2 . GLU A 1 36  ? 3.935   45.657  78.709 1.00 22.92 ? 372 GLU A OE2 1 
ATOM   227  N  N   . VAL A 1 37  ? 1.646   48.447  73.050 1.00 21.61 ? 373 VAL A N   1 
ATOM   228  C  CA  . VAL A 1 37  ? 2.013   49.110  71.820 1.00 22.16 ? 373 VAL A CA  1 
ATOM   229  C  C   . VAL A 1 37  ? 1.032   48.644  70.738 1.00 22.25 ? 373 VAL A C   1 
ATOM   230  O  O   . VAL A 1 37  ? 0.610   47.487  70.759 1.00 21.60 ? 373 VAL A O   1 
ATOM   231  C  CB  . VAL A 1 37  ? 3.474   48.723  71.492 1.00 22.78 ? 373 VAL A CB  1 
ATOM   232  C  CG1 . VAL A 1 37  ? 3.814   48.938  70.034 1.00 23.41 ? 373 VAL A CG1 1 
ATOM   233  C  CG2 . VAL A 1 37  ? 4.421   49.493  72.446 1.00 22.32 ? 373 VAL A CG2 1 
ATOM   234  N  N   . PRO A 1 38  ? 0.646   49.551  69.811 1.00 22.45 ? 374 PRO A N   1 
ATOM   235  C  CA  . PRO A 1 38  ? -0.330  49.205  68.781 1.00 22.20 ? 374 PRO A CA  1 
ATOM   236  C  C   . PRO A 1 38  ? 0.270   48.354  67.668 1.00 21.49 ? 374 PRO A C   1 
ATOM   237  O  O   . PRO A 1 38  ? 0.361   48.806  66.502 1.00 22.00 ? 374 PRO A O   1 
ATOM   238  C  CB  . PRO A 1 38  ? -0.766  50.570  68.241 1.00 23.03 ? 374 PRO A CB  1 
ATOM   239  C  CG  . PRO A 1 38  ? 0.486   51.405  68.358 1.00 23.63 ? 374 PRO A CG  1 
ATOM   240  C  CD  . PRO A 1 38  ? 1.062   50.967  69.708 1.00 22.81 ? 374 PRO A CD  1 
ATOM   241  N  N   . LEU A 1 39  ? 0.645   47.124  68.005 1.00 20.05 ? 375 LEU A N   1 
ATOM   242  C  CA  . LEU A 1 39  ? 1.285   46.227  67.022 1.00 18.93 ? 375 LEU A CA  1 
ATOM   243  C  C   . LEU A 1 39  ? 0.428   46.112  65.775 1.00 18.73 ? 375 LEU A C   1 
ATOM   244  O  O   . LEU A 1 39  ? 0.962   46.092  64.646 1.00 18.15 ? 375 LEU A O   1 
ATOM   245  C  CB  . LEU A 1 39  ? 1.522   44.853  67.605 1.00 18.84 ? 375 LEU A CB  1 
ATOM   246  C  CG  . LEU A 1 39  ? 2.544   44.827  68.739 1.00 19.56 ? 375 LEU A CG  1 
ATOM   247  C  CD1 . LEU A 1 39  ? 2.602   43.415  69.262 1.00 21.09 ? 375 LEU A CD1 1 
ATOM   248  C  CD2 . LEU A 1 39  ? 3.902   45.313  68.279 1.00 21.12 ? 375 LEU A CD2 1 
ATOM   249  N  N   . SER A 1 40  ? -0.887  46.014  65.983 1.00 17.08 ? 376 SER A N   1 
ATOM   250  C  CA  . SER A 1 40  ? -1.843  46.198  64.921 1.00 18.66 ? 376 SER A CA  1 
ATOM   251  C  C   . SER A 1 40  ? -2.904  47.237  65.298 1.00 18.93 ? 376 SER A C   1 
ATOM   252  O  O   . SER A 1 40  ? -3.132  47.525  66.487 1.00 19.96 ? 376 SER A O   1 
ATOM   253  C  CB  . SER A 1 40  ? -2.469  44.850  64.518 1.00 18.40 ? 376 SER A CB  1 
ATOM   254  O  OG  . SER A 1 40  ? -3.299  44.363  65.543 1.00 21.54 ? 376 SER A OG  1 
ATOM   255  N  N   . VAL A 1 41  ? -3.530  47.828  64.285 1.00 19.21 ? 377 VAL A N   1 
ATOM   256  C  CA  . VAL A 1 41  ? -4.661  48.717  64.494 1.00 18.66 ? 377 VAL A CA  1 
ATOM   257  C  C   . VAL A 1 41  ? -5.817  48.248  63.628 1.00 19.09 ? 377 VAL A C   1 
ATOM   258  O  O   . VAL A 1 41  ? -5.603  47.691  62.555 1.00 18.90 ? 377 VAL A O   1 
ATOM   259  C  CB  . VAL A 1 41  ? -4.329  50.205  64.176 1.00 18.70 ? 377 VAL A CB  1 
ATOM   260  C  CG1 . VAL A 1 41  ? -3.460  50.796  65.281 1.00 18.12 ? 377 VAL A CG1 1 
ATOM   261  C  CG2 . VAL A 1 41  ? -3.648  50.362  62.816 1.00 18.51 ? 377 VAL A CG2 1 
ATOM   262  N  N   . PRO A 1 42  ? -7.052  48.440  64.096 1.00 18.95 ? 378 PRO A N   1 
ATOM   263  C  CA  . PRO A 1 42  ? -8.191  48.069  63.241 1.00 19.33 ? 378 PRO A CA  1 
ATOM   264  C  C   . PRO A 1 42  ? -8.299  48.946  62.006 1.00 18.81 ? 378 PRO A C   1 
ATOM   265  O  O   . PRO A 1 42  ? -8.095  50.163  62.081 1.00 18.22 ? 378 PRO A O   1 
ATOM   266  C  CB  . PRO A 1 42  ? -9.438  48.251  64.151 1.00 19.57 ? 378 PRO A CB  1 
ATOM   267  C  CG  . PRO A 1 42  ? -8.942  48.451  65.513 1.00 19.68 ? 378 PRO A CG  1 
ATOM   268  C  CD  . PRO A 1 42  ? -7.464  48.821  65.454 1.00 19.79 ? 378 PRO A CD  1 
ATOM   269  N  N   . TRP A 1 43  ? -8.569  48.317  60.862 1.00 19.18 ? 379 TRP A N   1 
ATOM   270  C  CA  . TRP A 1 43  ? -8.772  49.048  59.630 1.00 19.54 ? 379 TRP A CA  1 
ATOM   271  C  C   . TRP A 1 43  ? -10.140 49.653  59.723 1.00 20.39 ? 379 TRP A C   1 
ATOM   272  O  O   . TRP A 1 43  ? -11.100 48.956  60.009 1.00 20.86 ? 379 TRP A O   1 
ATOM   273  C  CB  . TRP A 1 43  ? -8.671  48.159  58.364 1.00 19.78 ? 379 TRP A CB  1 
ATOM   274  C  CG  . TRP A 1 43  ? -8.938  48.982  57.138 1.00 18.08 ? 379 TRP A CG  1 
ATOM   275  C  CD1 . TRP A 1 43  ? -10.063 48.958  56.348 1.00 17.60 ? 379 TRP A CD1 1 
ATOM   276  C  CD2 . TRP A 1 43  ? -8.128  50.040  56.652 1.00 15.76 ? 379 TRP A CD2 1 
ATOM   277  N  NE1 . TRP A 1 43  ? -9.960  49.910  55.359 1.00 17.64 ? 379 TRP A NE1 1 
ATOM   278  C  CE2 . TRP A 1 43  ? -8.773  50.578  55.525 1.00 17.81 ? 379 TRP A CE2 1 
ATOM   279  C  CE3 . TRP A 1 43  ? -6.873  50.548  57.026 1.00 16.47 ? 379 TRP A CE3 1 
ATOM   280  C  CZ2 . TRP A 1 43  ? -8.231  51.615  54.791 1.00 17.70 ? 379 TRP A CZ2 1 
ATOM   281  C  CZ3 . TRP A 1 43  ? -6.330  51.557  56.292 1.00 14.57 ? 379 TRP A CZ3 1 
ATOM   282  C  CH2 . TRP A 1 43  ? -7.004  52.088  55.182 1.00 17.38 ? 379 TRP A CH2 1 
ATOM   283  N  N   . ASP A 1 44  ? -10.216 50.961  59.510 1.00 20.85 ? 380 ASP A N   1 
ATOM   284  C  CA  . ASP A 1 44  ? -11.469 51.698  59.550 1.00 22.54 ? 380 ASP A CA  1 
ATOM   285  C  C   . ASP A 1 44  ? -11.517 52.588  58.309 1.00 21.74 ? 380 ASP A C   1 
ATOM   286  O  O   . ASP A 1 44  ? -10.797 53.569  58.229 1.00 22.14 ? 380 ASP A O   1 
ATOM   287  C  CB  . ASP A 1 44  ? -11.562 52.545  60.838 1.00 22.87 ? 380 ASP A CB  1 
ATOM   288  C  CG  . ASP A 1 44  ? -12.899 53.201  60.995 1.00 25.57 ? 380 ASP A CG  1 
ATOM   289  O  OD1 . ASP A 1 44  ? -13.615 53.372  59.988 1.00 30.31 ? 380 ASP A OD1 1 
ATOM   290  O  OD2 . ASP A 1 44  ? -13.244 53.574  62.131 1.00 32.15 ? 380 ASP A OD2 1 
ATOM   291  N  N   . PRO A 1 45  ? -12.345 52.228  57.323 1.00 20.66 ? 381 PRO A N   1 
ATOM   292  C  CA  . PRO A 1 45  ? -12.344 53.016  56.126 1.00 19.80 ? 381 PRO A CA  1 
ATOM   293  C  C   . PRO A 1 45  ? -12.665 54.498  56.367 1.00 19.10 ? 381 PRO A C   1 
ATOM   294  O  O   . PRO A 1 45  ? -12.122 55.324  55.657 1.00 19.33 ? 381 PRO A O   1 
ATOM   295  C  CB  . PRO A 1 45  ? -13.403 52.361  55.230 1.00 20.51 ? 381 PRO A CB  1 
ATOM   296  C  CG  . PRO A 1 45  ? -13.969 51.233  55.981 1.00 20.85 ? 381 PRO A CG  1 
ATOM   297  C  CD  . PRO A 1 45  ? -13.402 51.206  57.356 1.00 21.52 ? 381 PRO A CD  1 
ATOM   298  N  N   . SER A 1 46  ? -13.496 54.846  57.349 1.00 17.88 ? 382 SER A N   1 
ATOM   299  C  CA  . SER A 1 46  ? -13.698 56.280  57.633 1.00 18.22 ? 382 SER A CA  1 
ATOM   300  C  C   . SER A 1 46  ? -12.402 57.001  58.038 1.00 17.70 ? 382 SER A C   1 
ATOM   301  O  O   . SER A 1 46  ? -12.286 58.206  57.845 1.00 16.58 ? 382 SER A O   1 
ATOM   302  C  CB  . SER A 1 46  ? -14.780 56.519  58.684 1.00 17.51 ? 382 SER A CB  1 
ATOM   303  O  OG  . SER A 1 46  ? -14.333 56.113  59.956 1.00 19.63 ? 382 SER A OG  1 
ATOM   304  N  N   . ASN A 1 47  ? -11.449 56.263  58.599 1.00 17.87 ? 383 ASN A N   1 
ATOM   305  C  CA  . ASN A 1 47  ? -10.164 56.831  59.001 1.00 18.78 ? 383 ASN A CA  1 
ATOM   306  C  C   . ASN A 1 47  ? -9.005  56.542  58.056 1.00 18.25 ? 383 ASN A C   1 
ATOM   307  O  O   . ASN A 1 47  ? -7.844  56.758  58.418 1.00 17.52 ? 383 ASN A O   1 
ATOM   308  C  CB  . ASN A 1 47  ? -9.822  56.402  60.434 1.00 18.95 ? 383 ASN A CB  1 
ATOM   309  C  CG  . ASN A 1 47  ? -10.746 57.046  61.440 1.00 23.97 ? 383 ASN A CG  1 
ATOM   310  O  OD1 . ASN A 1 47  ? -10.916 58.263  61.423 1.00 27.97 ? 383 ASN A OD1 1 
ATOM   311  N  ND2 . ASN A 1 47  ? -11.403 56.234  62.278 1.00 26.75 ? 383 ASN A ND2 1 
ATOM   312  N  N   . GLN A 1 48  ? -9.317  56.114  56.840 1.00 17.79 ? 384 GLN A N   1 
ATOM   313  C  CA  . GLN A 1 48  ? -8.265  55.647  55.925 1.00 17.71 ? 384 GLN A CA  1 
ATOM   314  C  C   . GLN A 1 48  ? -7.182  56.710  55.742 1.00 17.52 ? 384 GLN A C   1 
ATOM   315  O  O   . GLN A 1 48  ? -6.007  56.394  55.709 1.00 16.00 ? 384 GLN A O   1 
ATOM   316  C  CB  . GLN A 1 48  ? -8.844  55.231  54.573 1.00 17.77 ? 384 GLN A CB  1 
ATOM   317  C  CG  . GLN A 1 48  ? -9.442  56.359  53.782 1.00 19.22 ? 384 GLN A CG  1 
ATOM   318  C  CD  . GLN A 1 48  ? -10.272 55.887  52.606 1.00 20.44 ? 384 GLN A CD  1 
ATOM   319  O  OE1 . GLN A 1 48  ? -9.904  56.131  51.474 1.00 23.54 ? 384 GLN A OE1 1 
ATOM   320  N  NE2 . GLN A 1 48  ? -11.415 55.249  52.872 1.00 19.11 ? 384 GLN A NE2 1 
ATOM   321  N  N   . VAL A 1 49  ? -7.557  57.990  55.674 1.00 17.29 ? 385 VAL A N   1 
ATOM   322  C  CA  . VAL A 1 49  ? -6.530  59.033  55.446 1.00 17.46 ? 385 VAL A CA  1 
ATOM   323  C  C   . VAL A 1 49  ? -5.510  59.113  56.588 1.00 17.86 ? 385 VAL A C   1 
ATOM   324  O  O   . VAL A 1 49  ? -4.269  59.149  56.357 1.00 16.76 ? 385 VAL A O   1 
ATOM   325  C  CB  . VAL A 1 49  ? -7.170  60.414  55.185 1.00 17.53 ? 385 VAL A CB  1 
ATOM   326  C  CG1 . VAL A 1 49  ? -6.075  61.464  54.974 1.00 17.87 ? 385 VAL A CG1 1 
ATOM   327  C  CG2 . VAL A 1 49  ? -8.037  60.337  53.944 1.00 17.64 ? 385 VAL A CG2 1 
ATOM   328  N  N   . TYR A 1 50  ? -6.012  59.091  57.820 1.00 17.55 ? 386 TYR A N   1 
ATOM   329  C  CA  . TYR A 1 50  ? -5.134  59.187  58.992 1.00 18.11 ? 386 TYR A CA  1 
ATOM   330  C  C   . TYR A 1 50  ? -4.361  57.948  59.281 1.00 16.50 ? 386 TYR A C   1 
ATOM   331  O  O   . TYR A 1 50  ? -3.242  58.051  59.739 1.00 15.45 ? 386 TYR A O   1 
ATOM   332  C  CB  . TYR A 1 50  ? -5.903  59.589  60.244 1.00 18.87 ? 386 TYR A CB  1 
ATOM   333  C  CG  . TYR A 1 50  ? -6.559  60.864  59.957 1.00 23.80 ? 386 TYR A CG  1 
ATOM   334  C  CD1 . TYR A 1 50  ? -5.828  62.068  59.955 1.00 26.57 ? 386 TYR A CD1 1 
ATOM   335  C  CD2 . TYR A 1 50  ? -7.898  60.890  59.569 1.00 29.14 ? 386 TYR A CD2 1 
ATOM   336  C  CE1 . TYR A 1 50  ? -6.444  63.284  59.618 1.00 28.84 ? 386 TYR A CE1 1 
ATOM   337  C  CE2 . TYR A 1 50  ? -8.517  62.087  59.252 1.00 29.29 ? 386 TYR A CE2 1 
ATOM   338  C  CZ  . TYR A 1 50  ? -7.792  63.274  59.258 1.00 28.29 ? 386 TYR A CZ  1 
ATOM   339  O  OH  . TYR A 1 50  ? -8.448  64.435  58.941 1.00 32.19 ? 386 TYR A OH  1 
ATOM   340  N  N   . LEU A 1 51  ? -4.979  56.787  59.053 1.00 15.81 ? 387 LEU A N   1 
ATOM   341  C  CA  . LEU A 1 51  ? -4.291  55.512  59.208 1.00 15.90 ? 387 LEU A CA  1 
ATOM   342  C  C   . LEU A 1 51  ? -3.043  55.477  58.290 1.00 15.69 ? 387 LEU A C   1 
ATOM   343  O  O   . LEU A 1 51  ? -1.951  55.119  58.741 1.00 14.19 ? 387 LEU A O   1 
ATOM   344  C  CB  . LEU A 1 51  ? -5.238  54.333  58.915 1.00 16.51 ? 387 LEU A CB  1 
ATOM   345  C  CG  . LEU A 1 51  ? -6.253  54.036  60.036 1.00 17.61 ? 387 LEU A CG  1 
ATOM   346  C  CD1 . LEU A 1 51  ? -7.363  53.124  59.593 1.00 17.62 ? 387 LEU A CD1 1 
ATOM   347  C  CD2 . LEU A 1 51  ? -5.520  53.456  61.244 1.00 21.97 ? 387 LEU A CD2 1 
ATOM   348  N  N   . SER A 1 52  ? -3.192  55.899  57.040 1.00 15.45 ? 388 SER A N   1 
ATOM   349  C  CA  . SER A 1 52  ? -2.021  55.966  56.101 1.00 16.72 ? 388 SER A CA  1 
ATOM   350  C  C   . SER A 1 52  ? -1.006  57.046  56.457 1.00 16.38 ? 388 SER A C   1 
ATOM   351  O  O   . SER A 1 52  ? 0.222   56.812  56.419 1.00 16.30 ? 388 SER A O   1 
ATOM   352  C  CB  . SER A 1 52  ? -2.486  56.199  54.663 1.00 17.33 ? 388 SER A CB  1 
ATOM   353  O  OG  . SER A 1 52  ? -3.018  55.001  54.144 1.00 22.14 ? 388 SER A OG  1 
ATOM   354  N  N   . TYR A 1 53  ? -1.521  58.226  56.804 1.00 16.92 ? 389 TYR A N   1 
ATOM   355  C  CA  . TYR A 1 53  ? -0.692  59.311  57.331 1.00 17.56 ? 389 TYR A CA  1 
ATOM   356  C  C   . TYR A 1 53  ? 0.181   58.848  58.510 1.00 15.95 ? 389 TYR A C   1 
ATOM   357  O  O   . TYR A 1 53  ? 1.396   59.063  58.543 1.00 16.25 ? 389 TYR A O   1 
ATOM   358  C  CB  . TYR A 1 53  ? -1.574  60.494  57.774 1.00 17.86 ? 389 TYR A CB  1 
ATOM   359  C  CG  . TYR A 1 53  ? -0.729  61.576  58.364 1.00 21.17 ? 389 TYR A CG  1 
ATOM   360  C  CD1 . TYR A 1 53  ? -0.099  62.497  57.548 1.00 25.73 ? 389 TYR A CD1 1 
ATOM   361  C  CD2 . TYR A 1 53  ? -0.463  61.615  59.725 1.00 23.19 ? 389 TYR A CD2 1 
ATOM   362  C  CE1 . TYR A 1 53  ? 0.721   63.484  58.075 1.00 26.60 ? 389 TYR A CE1 1 
ATOM   363  C  CE2 . TYR A 1 53  ? 0.364   62.591  60.261 1.00 26.34 ? 389 TYR A CE2 1 
ATOM   364  C  CZ  . TYR A 1 53  ? 0.954   63.520  59.424 1.00 27.65 ? 389 TYR A CZ  1 
ATOM   365  O  OH  . TYR A 1 53  ? 1.775   64.509  59.937 1.00 32.54 ? 389 TYR A OH  1 
ATOM   366  N  N   . ASN A 1 54  ? -0.448  58.236  59.494 1.00 15.43 ? 390 ASN A N   1 
ATOM   367  C  CA  . ASN A 1 54  ? 0.247   57.745  60.675 1.00 15.24 ? 390 ASN A CA  1 
ATOM   368  C  C   . ASN A 1 54  ? 1.301   56.681  60.371 1.00 13.97 ? 390 ASN A C   1 
ATOM   369  O  O   . ASN A 1 54  ? 2.363   56.641  61.009 1.00 12.67 ? 390 ASN A O   1 
ATOM   370  C  CB  . ASN A 1 54  ? -0.748  57.156  61.679 1.00 16.32 ? 390 ASN A CB  1 
ATOM   371  C  CG  . ASN A 1 54  ? -1.575  58.214  62.359 1.00 21.28 ? 390 ASN A CG  1 
ATOM   372  O  OD1 . ASN A 1 54  ? -1.320  59.410  62.196 1.00 27.82 ? 390 ASN A OD1 1 
ATOM   373  N  ND2 . ASN A 1 54  ? -2.589  57.791  63.134 1.00 28.08 ? 390 ASN A ND2 1 
ATOM   374  N  N   . ASN A 1 55  ? 0.975   55.809  59.417 1.00 13.09 ? 391 ASN A N   1 
ATOM   375  C  CA  . ASN A 1 55  ? 1.871   54.749  58.916 1.00 12.22 ? 391 ASN A CA  1 
ATOM   376  C  C   . ASN A 1 55  ? 3.177   55.382  58.375 1.00 12.73 ? 391 ASN A C   1 
ATOM   377  O  O   . ASN A 1 55  ? 4.288   55.063  58.844 1.00 11.83 ? 391 ASN A O   1 
ATOM   378  C  CB  . ASN A 1 55  ? 1.074   53.941  57.848 1.00 12.56 ? 391 ASN A CB  1 
ATOM   379  C  CG  . ASN A 1 55  ? 1.746   52.650  57.394 1.00 10.34 ? 391 ASN A CG  1 
ATOM   380  O  OD1 . ASN A 1 55  ? 2.674   52.163  58.015 1.00 11.52 ? 391 ASN A OD1 1 
ATOM   381  N  ND2 . ASN A 1 55  ? 1.279   52.112  56.242 1.00 7.64  ? 391 ASN A ND2 1 
ATOM   382  N  N   . VAL A 1 56  ? 3.028   56.354  57.476 1.00 12.66 ? 392 VAL A N   1 
ATOM   383  C  CA  . VAL A 1 56  ? 4.174   57.104  56.909 1.00 12.93 ? 392 VAL A CA  1 
ATOM   384  C  C   . VAL A 1 56  ? 4.947   57.887  57.977 1.00 13.72 ? 392 VAL A C   1 
ATOM   385  O  O   . VAL A 1 56  ? 6.182   57.818  58.036 1.00 13.68 ? 392 VAL A O   1 
ATOM   386  C  CB  . VAL A 1 56  ? 3.712   58.050  55.783 1.00 13.04 ? 392 VAL A CB  1 
ATOM   387  C  CG1 . VAL A 1 56  ? 4.867   58.989  55.254 1.00 12.58 ? 392 VAL A CG1 1 
ATOM   388  C  CG2 . VAL A 1 56  ? 3.142   57.237  54.643 1.00 12.78 ? 392 VAL A CG2 1 
ATOM   389  N  N   . SER A 1 57  ? 4.223   58.628  58.815 1.00 13.72 ? 393 SER A N   1 
ATOM   390  C  CA  . SER A 1 57  ? 4.824   59.498  59.808 1.00 14.60 ? 393 SER A CA  1 
ATOM   391  C  C   . SER A 1 57  ? 5.593   58.684  60.823 1.00 15.07 ? 393 SER A C   1 
ATOM   392  O  O   . SER A 1 57  ? 6.689   59.069  61.227 1.00 15.21 ? 393 SER A O   1 
ATOM   393  C  CB  . SER A 1 57  ? 3.758   60.344  60.529 1.00 14.37 ? 393 SER A CB  1 
ATOM   394  O  OG  . SER A 1 57  ? 4.365   61.036  61.588 1.00 17.93 ? 393 SER A OG  1 
ATOM   395  N  N   . SER A 1 58  ? 5.046   57.526  61.205 1.00 15.31 ? 394 SER A N   1 
ATOM   396  C  CA  . SER A 1 58  ? 5.739   56.625  62.125 1.00 15.42 ? 394 SER A CA  1 
ATOM   397  C  C   . SER A 1 58  ? 7.072   56.161  61.552 1.00 15.28 ? 394 SER A C   1 
ATOM   398  O  O   . SER A 1 58  ? 8.073   56.116  62.261 1.00 13.86 ? 394 SER A O   1 
ATOM   399  C  CB  . SER A 1 58  ? 4.857   55.433  62.486 1.00 16.31 ? 394 SER A CB  1 
ATOM   400  O  OG  . SER A 1 58  ? 3.683   55.873  63.175 1.00 16.51 ? 394 SER A OG  1 
ATOM   401  N  N   . LEU A 1 59  ? 7.114   55.821  60.270 1.00 14.49 ? 395 LEU A N   1 
ATOM   402  C  CA  . LEU A 1 59  ? 8.378   55.336  59.702 1.00 15.10 ? 395 LEU A CA  1 
ATOM   403  C  C   . LEU A 1 59  ? 9.358   56.535  59.640 1.00 14.62 ? 395 LEU A C   1 
ATOM   404  O  O   . LEU A 1 59  ? 10.529  56.398  60.009 1.00 14.93 ? 395 LEU A O   1 
ATOM   405  C  CB  . LEU A 1 59  ? 8.155   54.675  58.336 1.00 14.27 ? 395 LEU A CB  1 
ATOM   406  C  CG  . LEU A 1 59  ? 9.398   54.151  57.593 1.00 16.02 ? 395 LEU A CG  1 
ATOM   407  C  CD1 . LEU A 1 59  ? 10.308  53.308  58.473 1.00 14.40 ? 395 LEU A CD1 1 
ATOM   408  C  CD2 . LEU A 1 59  ? 8.974   53.379  56.339 1.00 13.89 ? 395 LEU A CD2 1 
ATOM   409  N  N   . LYS A 1 60  ? 8.866   57.710  59.244 1.00 14.96 ? 396 LYS A N   1 
ATOM   410  C  CA  . LYS A 1 60  ? 9.725   58.909  59.215 1.00 16.64 ? 396 LYS A CA  1 
ATOM   411  C  C   . LYS A 1 60  ? 10.341  59.162  60.605 1.00 17.38 ? 396 LYS A C   1 
ATOM   412  O  O   . LYS A 1 60  ? 11.517  59.529  60.717 1.00 17.51 ? 396 LYS A O   1 
ATOM   413  C  CB  . LYS A 1 60  ? 8.964   60.147  58.748 1.00 16.83 ? 396 LYS A CB  1 
ATOM   414  C  CG  . LYS A 1 60  ? 8.636   60.247  57.267 1.00 18.31 ? 396 LYS A CG  1 
ATOM   415  C  CD  . LYS A 1 60  ? 7.917   61.592  57.024 1.00 21.33 ? 396 LYS A CD  1 
ATOM   416  C  CE  . LYS A 1 60  ? 7.246   61.669  55.690 1.00 24.56 ? 396 LYS A CE  1 
ATOM   417  N  NZ  . LYS A 1 60  ? 6.326   62.878  55.602 1.00 26.83 ? 396 LYS A NZ  1 
ATOM   418  N  N   . MET A 1 61  ? 9.568   58.943  61.663 1.00 18.02 ? 397 MET A N   1 
ATOM   419  C  CA  . MET A 1 61  ? 10.059  59.179  63.032 1.00 19.68 ? 397 MET A CA  1 
ATOM   420  C  C   . MET A 1 61  ? 11.123  58.158  63.424 1.00 18.69 ? 397 MET A C   1 
ATOM   421  O  O   . MET A 1 61  ? 12.144  58.496  64.038 1.00 18.82 ? 397 MET A O   1 
ATOM   422  C  CB  . MET A 1 61  ? 8.903   59.156  64.045 1.00 20.58 ? 397 MET A CB  1 
ATOM   423  C  CG  . MET A 1 61  ? 7.935   60.330  63.887 1.00 25.72 ? 397 MET A CG  1 
ATOM   424  S  SD  . MET A 1 61  ? 6.523   60.364  65.061 1.00 39.16 ? 397 MET A SD  1 
ATOM   425  C  CE  . MET A 1 61  ? 5.977   58.636  65.173 1.00 34.73 ? 397 MET A CE  1 
ATOM   426  N  N   . LEU A 1 62  ? 10.871  56.911  63.064 1.00 17.92 ? 398 LEU A N   1 
ATOM   427  C  CA  . LEU A 1 62  ? 11.787  55.822  63.303 1.00 17.59 ? 398 LEU A CA  1 
ATOM   428  C  C   . LEU A 1 62  ? 13.138  56.129  62.670 1.00 18.41 ? 398 LEU A C   1 
ATOM   429  O  O   . LEU A 1 62  ? 14.175  56.049  63.346 1.00 17.46 ? 398 LEU A O   1 
ATOM   430  C  CB  . LEU A 1 62  ? 11.207  54.505  62.757 1.00 18.01 ? 398 LEU A CB  1 
ATOM   431  C  CG  . LEU A 1 62  ? 12.023  53.225  63.007 1.00 17.12 ? 398 LEU A CG  1 
ATOM   432  C  CD1 . LEU A 1 62  ? 12.128  52.922  64.519 1.00 15.86 ? 398 LEU A CD1 1 
ATOM   433  C  CD2 . LEU A 1 62  ? 11.393  52.099  62.264 1.00 14.12 ? 398 LEU A CD2 1 
ATOM   434  N  N   . VAL A 1 63  ? 13.125  56.541  61.409 1.00 18.78 ? 399 VAL A N   1 
ATOM   435  C  CA  . VAL A 1 63  ? 14.344  56.966  60.733 1.00 19.40 ? 399 VAL A CA  1 
ATOM   436  C  C   . VAL A 1 63  ? 15.120  58.046  61.534 1.00 21.33 ? 399 VAL A C   1 
ATOM   437  O  O   . VAL A 1 63  ? 16.345  57.959  61.684 1.00 20.32 ? 399 VAL A O   1 
ATOM   438  C  CB  . VAL A 1 63  ? 14.056  57.516  59.317 1.00 19.36 ? 399 VAL A CB  1 
ATOM   439  C  CG1 . VAL A 1 63  ? 15.330  58.128  58.726 1.00 21.01 ? 399 VAL A CG1 1 
ATOM   440  C  CG2 . VAL A 1 63  ? 13.470  56.428  58.382 1.00 19.42 ? 399 VAL A CG2 1 
ATOM   441  N  N   . ALA A 1 64  ? 14.398  59.048  62.048 1.00 22.42 ? 400 ALA A N   1 
ATOM   442  C  CA  . ALA A 1 64  ? 15.019  60.209  62.683 1.00 23.31 ? 400 ALA A CA  1 
ATOM   443  C  C   . ALA A 1 64  ? 15.466  59.940  64.124 1.00 24.44 ? 400 ALA A C   1 
ATOM   444  O  O   . ALA A 1 64  ? 15.990  60.827  64.787 1.00 24.47 ? 400 ALA A O   1 
ATOM   445  C  CB  . ALA A 1 64  ? 14.075  61.415  62.633 1.00 22.76 ? 400 ALA A CB  1 
ATOM   446  N  N   . LYS A 1 65  ? 15.266  58.729  64.616 1.00 26.05 ? 401 LYS A N   1 
ATOM   447  C  CA  . LYS A 1 65  ? 15.715  58.408  65.951 1.00 27.63 ? 401 LYS A CA  1 
ATOM   448  C  C   . LYS A 1 65  ? 17.235  58.553  66.019 1.00 28.56 ? 401 LYS A C   1 
ATOM   449  O  O   . LYS A 1 65  ? 17.927  58.315  65.033 1.00 28.62 ? 401 LYS A O   1 
ATOM   450  C  CB  . LYS A 1 65  ? 15.252  57.015  66.371 1.00 27.79 ? 401 LYS A CB  1 
ATOM   451  C  CG  . LYS A 1 65  ? 13.950  57.069  67.124 1.00 28.53 ? 401 LYS A CG  1 
ATOM   452  C  CD  . LYS A 1 65  ? 13.333  55.717  67.272 1.00 31.32 ? 401 LYS A CD  1 
ATOM   453  C  CE  . LYS A 1 65  ? 12.439  55.674  68.489 1.00 33.31 ? 401 LYS A CE  1 
ATOM   454  N  NZ  . LYS A 1 65  ? 11.364  54.682  68.310 1.00 35.81 ? 401 LYS A NZ  1 
ATOM   455  N  N   . ASP A 1 66  ? 17.736  58.990  67.168 1.00 29.94 ? 402 ASP A N   1 
ATOM   456  C  CA  . ASP A 1 66  ? 19.162  59.339  67.294 1.00 30.82 ? 402 ASP A CA  1 
ATOM   457  C  C   . ASP A 1 66  ? 20.022  58.217  67.894 1.00 30.68 ? 402 ASP A C   1 
ATOM   458  O  O   . ASP A 1 66  ? 21.250  58.339  67.971 1.00 31.71 ? 402 ASP A O   1 
ATOM   459  C  CB  . ASP A 1 66  ? 19.326  60.656  68.085 1.00 31.24 ? 402 ASP A CB  1 
ATOM   460  C  CG  . ASP A 1 66  ? 18.764  60.584  69.512 1.00 32.53 ? 402 ASP A CG  1 
ATOM   461  O  OD1 . ASP A 1 66  ? 18.138  59.570  69.894 1.00 34.32 ? 402 ASP A OD1 1 
ATOM   462  O  OD2 . ASP A 1 66  ? 18.954  61.564  70.258 1.00 35.42 ? 402 ASP A OD2 1 
ATOM   463  N  N   . ASN A 1 67  ? 19.377  57.129  68.305 1.00 29.98 ? 403 ASN A N   1 
ATOM   464  C  CA  . ASN A 1 67  ? 20.024  56.057  69.061 1.00 29.91 ? 403 ASN A CA  1 
ATOM   465  C  C   . ASN A 1 67  ? 20.317  54.778  68.221 1.00 28.81 ? 403 ASN A C   1 
ATOM   466  O  O   . ASN A 1 67  ? 20.608  53.695  68.760 1.00 29.00 ? 403 ASN A O   1 
ATOM   467  C  CB  . ASN A 1 67  ? 19.206  55.745  70.344 1.00 30.27 ? 403 ASN A CB  1 
ATOM   468  C  CG  . ASN A 1 67  ? 17.678  55.900  70.160 1.00 32.41 ? 403 ASN A CG  1 
ATOM   469  O  OD1 . ASN A 1 67  ? 17.194  56.569  69.242 1.00 34.31 ? 403 ASN A OD1 1 
ATOM   470  N  ND2 . ASN A 1 67  ? 16.918  55.286  71.065 1.00 35.71 ? 403 ASN A ND2 1 
ATOM   471  N  N   . TRP A 1 68  ? 20.248  54.903  66.900 1.00 27.14 ? 404 TRP A N   1 
ATOM   472  C  CA  . TRP A 1 68  ? 20.627  53.799  66.015 1.00 25.45 ? 404 TRP A CA  1 
ATOM   473  C  C   . TRP A 1 68  ? 22.120  53.571  66.179 1.00 24.87 ? 404 TRP A C   1 
ATOM   474  O  O   . TRP A 1 68  ? 22.877  54.537  66.139 1.00 24.98 ? 404 TRP A O   1 
ATOM   475  C  CB  . TRP A 1 68  ? 20.330  54.162  64.566 1.00 24.96 ? 404 TRP A CB  1 
ATOM   476  C  CG  . TRP A 1 68  ? 18.894  54.123  64.222 1.00 22.40 ? 404 TRP A CG  1 
ATOM   477  C  CD1 . TRP A 1 68  ? 18.069  55.183  63.989 1.00 21.13 ? 404 TRP A CD1 1 
ATOM   478  C  CD2 . TRP A 1 68  ? 18.097  52.950  64.079 1.00 19.18 ? 404 TRP A CD2 1 
ATOM   479  N  NE1 . TRP A 1 68  ? 16.798  54.735  63.673 1.00 20.37 ? 404 TRP A NE1 1 
ATOM   480  C  CE2 . TRP A 1 68  ? 16.796  53.364  63.729 1.00 19.20 ? 404 TRP A CE2 1 
ATOM   481  C  CE3 . TRP A 1 68  ? 18.365  51.578  64.185 1.00 19.48 ? 404 TRP A CE3 1 
ATOM   482  C  CZ2 . TRP A 1 68  ? 15.762  52.459  63.498 1.00 16.93 ? 404 TRP A CZ2 1 
ATOM   483  C  CZ3 . TRP A 1 68  ? 17.328  50.679  63.941 1.00 17.45 ? 404 TRP A CZ3 1 
ATOM   484  C  CH2 . TRP A 1 68  ? 16.057  51.124  63.607 1.00 15.73 ? 404 TRP A CH2 1 
ATOM   485  N  N   . VAL A 1 69  ? 22.532  52.314  66.353 1.00 23.71 ? 405 VAL A N   1 
ATOM   486  C  CA  . VAL A 1 69  ? 23.944  51.947  66.485 1.00 23.01 ? 405 VAL A CA  1 
ATOM   487  C  C   . VAL A 1 69  ? 24.330  51.017  65.347 1.00 22.63 ? 405 VAL A C   1 
ATOM   488  O  O   . VAL A 1 69  ? 23.566  50.117  65.007 1.00 21.63 ? 405 VAL A O   1 
ATOM   489  C  CB  . VAL A 1 69  ? 24.234  51.236  67.830 1.00 23.08 ? 405 VAL A CB  1 
ATOM   490  C  CG1 . VAL A 1 69  ? 25.709  51.008  67.991 1.00 22.75 ? 405 VAL A CG1 1 
ATOM   491  C  CG2 . VAL A 1 69  ? 23.705  52.059  68.990 1.00 21.89 ? 405 VAL A CG2 1 
ATOM   492  N  N   . LEU A 1 70  ? 25.505  51.240  64.748 1.00 21.93 ? 406 LEU A N   1 
ATOM   493  C  CA  . LEU A 1 70  ? 25.929  50.441  63.596 1.00 22.09 ? 406 LEU A CA  1 
ATOM   494  C  C   . LEU A 1 70  ? 26.475  49.132  64.108 1.00 22.52 ? 406 LEU A C   1 
ATOM   495  O  O   . LEU A 1 70  ? 27.517  49.137  64.744 1.00 23.04 ? 406 LEU A O   1 
ATOM   496  C  CB  . LEU A 1 70  ? 26.988  51.173  62.758 1.00 22.13 ? 406 LEU A CB  1 
ATOM   497  C  CG  . LEU A 1 70  ? 27.604  50.359  61.617 1.00 21.52 ? 406 LEU A CG  1 
ATOM   498  C  CD1 . LEU A 1 70  ? 26.530  49.909  60.665 1.00 19.46 ? 406 LEU A CD1 1 
ATOM   499  C  CD2 . LEU A 1 70  ? 28.697  51.111  60.872 1.00 21.96 ? 406 LEU A CD2 1 
ATOM   500  N  N   . SER A 1 71  ? 25.785  48.017  63.847 1.00 22.86 ? 407 SER A N   1 
ATOM   501  C  CA  . SER A 1 71  ? 26.153  46.711  64.422 1.00 23.40 ? 407 SER A CA  1 
ATOM   502  C  C   . SER A 1 71  ? 27.082  45.842  63.570 1.00 23.52 ? 407 SER A C   1 
ATOM   503  O  O   . SER A 1 71  ? 27.915  45.094  64.105 1.00 22.50 ? 407 SER A O   1 
ATOM   504  C  CB  . SER A 1 71  ? 24.902  45.934  64.812 1.00 23.93 ? 407 SER A CB  1 
ATOM   505  O  OG  . SER A 1 71  ? 24.197  46.650  65.820 1.00 25.55 ? 407 SER A OG  1 
ATOM   506  N  N   . SER A 1 72  ? 26.958  45.953  62.254 1.00 23.43 ? 408 SER A N   1 
ATOM   507  C  CA  . SER A 1 72  ? 27.855  45.247  61.352 1.00 23.66 ? 408 SER A CA  1 
ATOM   508  C  C   . SER A 1 72  ? 27.808  45.849  59.954 1.00 24.07 ? 408 SER A C   1 
ATOM   509  O  O   . SER A 1 72  ? 26.924  46.657  59.650 1.00 24.11 ? 408 SER A O   1 
ATOM   510  C  CB  . SER A 1 72  ? 27.476  43.759  61.300 1.00 23.68 ? 408 SER A CB  1 
ATOM   511  O  OG  . SER A 1 72  ? 26.140  43.582  60.885 1.00 24.45 ? 408 SER A OG  1 
ATOM   512  N  N   . GLU A 1 73  ? 28.748  45.432  59.116 1.00 24.20 ? 409 GLU A N   1 
ATOM   513  C  CA  . GLU A 1 73  ? 28.789  45.814  57.713 1.00 25.23 ? 409 GLU A CA  1 
ATOM   514  C  C   . GLU A 1 73  ? 29.495  44.752  56.879 1.00 25.26 ? 409 GLU A C   1 
ATOM   515  O  O   . GLU A 1 73  ? 30.494  44.208  57.290 1.00 25.29 ? 409 GLU A O   1 
ATOM   516  C  CB  . GLU A 1 73  ? 29.516  47.146  57.525 1.00 25.67 ? 409 GLU A CB  1 
ATOM   517  C  CG  . GLU A 1 73  ? 29.915  47.426  56.055 1.00 27.56 ? 409 GLU A CG  1 
ATOM   518  C  CD  . GLU A 1 73  ? 30.642  48.748  55.853 1.00 29.13 ? 409 GLU A CD  1 
ATOM   519  O  OE1 . GLU A 1 73  ? 31.626  48.762  55.070 1.00 29.13 ? 409 GLU A OE1 1 
ATOM   520  O  OE2 . GLU A 1 73  ? 30.222  49.763  56.460 1.00 31.16 ? 409 GLU A OE2 1 
ATOM   521  N  N   . ILE A 1 74  ? 28.975  44.474  55.693 1.00 25.79 ? 410 ILE A N   1 
ATOM   522  C  CA  . ILE A 1 74  ? 29.605  43.537  54.769 1.00 25.81 ? 410 ILE A CA  1 
ATOM   523  C  C   . ILE A 1 74  ? 29.406  44.128  53.386 1.00 25.43 ? 410 ILE A C   1 
ATOM   524  O  O   . ILE A 1 74  ? 28.290  44.492  53.037 1.00 24.82 ? 410 ILE A O   1 
ATOM   525  C  CB  . ILE A 1 74  ? 28.947  42.138  54.829 1.00 26.13 ? 410 ILE A CB  1 
ATOM   526  C  CG1 . ILE A 1 74  ? 28.913  41.624  56.269 1.00 26.69 ? 410 ILE A CG1 1 
ATOM   527  C  CG2 . ILE A 1 74  ? 29.696  41.163  53.916 1.00 26.80 ? 410 ILE A CG2 1 
ATOM   528  C  CD1 . ILE A 1 74  ? 28.443  40.188  56.413 1.00 29.22 ? 410 ILE A CD1 1 
ATOM   529  N  N   . SER A 1 75  ? 30.475  44.258  52.606 1.00 24.41 ? 411 SER A N   1 
ATOM   530  C  CA  . SER A 1 75  ? 30.360  44.862  51.268 1.00 24.29 ? 411 SER A CA  1 
ATOM   531  C  C   . SER A 1 75  ? 29.628  46.211  51.253 1.00 22.59 ? 411 SER A C   1 
ATOM   532  O  O   . SER A 1 75  ? 28.769  46.446  50.382 1.00 22.53 ? 411 SER A O   1 
ATOM   533  C  CB  . SER A 1 75  ? 29.614  43.916  50.316 1.00 24.83 ? 411 SER A CB  1 
ATOM   534  O  OG  . SER A 1 75  ? 28.221  44.265  50.195 1.00 26.86 ? 411 SER A OG  1 
ATOM   535  N  N   . GLN A 1 76  ? 29.950  47.089  52.204 1.00 20.94 ? 412 GLN A N   1 
ATOM   536  C  CA  . GLN A 1 76  ? 29.305  48.406  52.315 1.00 20.11 ? 412 GLN A CA  1 
ATOM   537  C  C   . GLN A 1 76  ? 27.767  48.288  52.453 1.00 19.57 ? 412 GLN A C   1 
ATOM   538  O  O   . GLN A 1 76  ? 27.052  49.234  52.163 1.00 19.75 ? 412 GLN A O   1 
ATOM   539  C  CB  . GLN A 1 76  ? 29.672  49.326  51.124 1.00 19.80 ? 412 GLN A CB  1 
ATOM   540  C  CG  . GLN A 1 76  ? 31.185  49.503  50.903 1.00 19.04 ? 412 GLN A CG  1 
ATOM   541  C  CD  . GLN A 1 76  ? 31.543  50.594  49.886 1.00 18.90 ? 412 GLN A CD  1 
ATOM   542  O  OE1 . GLN A 1 76  ? 30.685  51.276  49.348 1.00 19.84 ? 412 GLN A OE1 1 
ATOM   543  N  NE2 . GLN A 1 76  ? 32.825  50.756  49.629 1.00 17.23 ? 412 GLN A NE2 1 
ATOM   544  N  N   . VAL A 1 77  ? 27.279  47.122  52.868 1.00 19.15 ? 413 VAL A N   1 
ATOM   545  C  CA  . VAL A 1 77  ? 25.912  46.970  53.351 1.00 18.99 ? 413 VAL A CA  1 
ATOM   546  C  C   . VAL A 1 77  ? 25.958  47.022  54.865 1.00 18.90 ? 413 VAL A C   1 
ATOM   547  O  O   . VAL A 1 77  ? 26.764  46.324  55.490 1.00 18.91 ? 413 VAL A O   1 
ATOM   548  C  CB  . VAL A 1 77  ? 25.295  45.652  52.908 1.00 19.14 ? 413 VAL A CB  1 
ATOM   549  C  CG1 . VAL A 1 77  ? 23.869  45.484  53.501 1.00 19.08 ? 413 VAL A CG1 1 
ATOM   550  C  CG2 . VAL A 1 77  ? 25.298  45.574  51.395 1.00 19.92 ? 413 VAL A CG2 1 
ATOM   551  N  N   . ARG A 1 78  ? 25.095  47.854  55.444 1.00 18.53 ? 414 ARG A N   1 
ATOM   552  C  CA  . ARG A 1 78  ? 25.134  48.176  56.860 1.00 18.37 ? 414 ARG A CA  1 
ATOM   553  C  C   . ARG A 1 78  ? 23.878  47.702  57.601 1.00 18.01 ? 414 ARG A C   1 
ATOM   554  O  O   . ARG A 1 78  ? 22.759  47.755  57.068 1.00 16.77 ? 414 ARG A O   1 
ATOM   555  C  CB  . ARG A 1 78  ? 25.296  49.678  57.028 1.00 18.86 ? 414 ARG A CB  1 
ATOM   556  C  CG  . ARG A 1 78  ? 26.665  50.176  56.598 1.00 21.84 ? 414 ARG A CG  1 
ATOM   557  C  CD  . ARG A 1 78  ? 26.839  51.630  56.940 1.00 26.18 ? 414 ARG A CD  1 
ATOM   558  N  NE  . ARG A 1 78  ? 28.183  52.077  56.602 1.00 30.66 ? 414 ARG A NE  1 
ATOM   559  C  CZ  . ARG A 1 78  ? 28.594  53.345  56.625 1.00 34.63 ? 414 ARG A CZ  1 
ATOM   560  N  NH1 . ARG A 1 78  ? 27.771  54.333  56.983 1.00 36.34 ? 414 ARG A NH1 1 
ATOM   561  N  NH2 . ARG A 1 78  ? 29.849  53.628  56.294 1.00 35.66 ? 414 ARG A NH2 1 
ATOM   562  N  N   . LEU A 1 79  ? 24.096  47.209  58.815 1.00 17.12 ? 415 LEU A N   1 
ATOM   563  C  CA  . LEU A 1 79  ? 23.051  46.710  59.678 1.00 16.69 ? 415 LEU A CA  1 
ATOM   564  C  C   . LEU A 1 79  ? 23.119  47.507  60.965 1.00 16.60 ? 415 LEU A C   1 
ATOM   565  O  O   . LEU A 1 79  ? 24.123  47.452  61.686 1.00 16.26 ? 415 LEU A O   1 
ATOM   566  C  CB  . LEU A 1 79  ? 23.226  45.204  59.940 1.00 15.64 ? 415 LEU A CB  1 
ATOM   567  C  CG  . LEU A 1 79  ? 22.280  44.587  60.984 1.00 17.41 ? 415 LEU A CG  1 
ATOM   568  C  CD1 . LEU A 1 79  ? 20.825  44.802  60.597 1.00 18.25 ? 415 LEU A CD1 1 
ATOM   569  C  CD2 . LEU A 1 79  ? 22.542  43.085  61.178 1.00 20.34 ? 415 LEU A CD2 1 
ATOM   570  N  N   . TYR A 1 80  ? 22.069  48.275  61.234 1.00 17.18 ? 416 TYR A N   1 
ATOM   571  C  CA  . TYR A 1 80  ? 21.974  49.085  62.429 1.00 18.22 ? 416 TYR A CA  1 
ATOM   572  C  C   . TYR A 1 80  ? 20.939  48.499  63.361 1.00 19.27 ? 416 TYR A C   1 
ATOM   573  O  O   . TYR A 1 80  ? 19.954  47.876  62.928 1.00 18.73 ? 416 TYR A O   1 
ATOM   574  C  CB  . TYR A 1 80  ? 21.561  50.512  62.111 1.00 18.77 ? 416 TYR A CB  1 
ATOM   575  C  CG  . TYR A 1 80  ? 22.477  51.271  61.180 1.00 20.59 ? 416 TYR A CG  1 
ATOM   576  C  CD1 . TYR A 1 80  ? 23.335  52.251  61.664 1.00 23.03 ? 416 TYR A CD1 1 
ATOM   577  C  CD2 . TYR A 1 80  ? 22.438  51.049  59.813 1.00 22.86 ? 416 TYR A CD2 1 
ATOM   578  C  CE1 . TYR A 1 80  ? 24.148  52.978  60.800 1.00 25.59 ? 416 TYR A CE1 1 
ATOM   579  C  CE2 . TYR A 1 80  ? 23.238  51.765  58.948 1.00 26.81 ? 416 TYR A CE2 1 
ATOM   580  C  CZ  . TYR A 1 80  ? 24.095  52.719  59.444 1.00 27.09 ? 416 TYR A CZ  1 
ATOM   581  O  OH  . TYR A 1 80  ? 24.892  53.406  58.576 1.00 31.85 ? 416 TYR A OH  1 
ATOM   582  N  N   . THR A 1 81  ? 21.141  48.703  64.654 1.00 19.99 ? 417 THR A N   1 
ATOM   583  C  CA  . THR A 1 81  ? 20.177  48.206  65.618 1.00 20.86 ? 417 THR A CA  1 
ATOM   584  C  C   . THR A 1 81  ? 19.827  49.285  66.600 1.00 21.19 ? 417 THR A C   1 
ATOM   585  O  O   . THR A 1 81  ? 20.578  50.235  66.785 1.00 21.20 ? 417 THR A O   1 
ATOM   586  C  CB  . THR A 1 81  ? 20.687  46.976  66.350 1.00 20.88 ? 417 THR A CB  1 
ATOM   587  O  OG1 . THR A 1 81  ? 21.946  47.273  66.950 1.00 22.51 ? 417 THR A OG1 1 
ATOM   588  C  CG2 . THR A 1 81  ? 20.889  45.843  65.371 1.00 22.16 ? 417 THR A CG2 1 
ATOM   589  N  N   . LEU A 1 82  ? 18.650  49.142  67.195 1.00 21.95 ? 418 LEU A N   1 
ATOM   590  C  CA  . LEU A 1 82  ? 18.207  50.020  68.262 1.00 22.27 ? 418 LEU A CA  1 
ATOM   591  C  C   . LEU A 1 82  ? 17.627  49.095  69.332 1.00 22.44 ? 418 LEU A C   1 
ATOM   592  O  O   . LEU A 1 82  ? 16.583  48.463  69.140 1.00 21.36 ? 418 LEU A O   1 
ATOM   593  C  CB  . LEU A 1 82  ? 17.157  51.013  67.733 1.00 22.76 ? 418 LEU A CB  1 
ATOM   594  C  CG  . LEU A 1 82  ? 17.030  52.338  68.484 1.00 23.48 ? 418 LEU A CG  1 
ATOM   595  C  CD1 . LEU A 1 82  ? 16.309  53.406  67.639 1.00 24.20 ? 418 LEU A CD1 1 
ATOM   596  C  CD2 . LEU A 1 82  ? 16.324  52.113  69.822 1.00 23.66 ? 418 LEU A CD2 1 
ATOM   597  N  N   . GLU A 1 83  ? 18.324  48.985  70.448 1.00 23.00 ? 419 GLU A N   1 
ATOM   598  C  CA  . GLU A 1 83  ? 17.883  48.118  71.539 1.00 24.06 ? 419 GLU A CA  1 
ATOM   599  C  C   . GLU A 1 83  ? 16.965  48.962  72.389 1.00 24.83 ? 419 GLU A C   1 
ATOM   600  O  O   . GLU A 1 83  ? 17.363  49.469  73.446 1.00 24.54 ? 419 GLU A O   1 
ATOM   601  C  CB  . GLU A 1 83  ? 19.066  47.583  72.358 1.00 23.90 ? 419 GLU A CB  1 
ATOM   602  C  CG  . GLU A 1 83  ? 19.903  46.602  71.591 1.00 24.99 ? 419 GLU A CG  1 
ATOM   603  C  CD  . GLU A 1 83  ? 21.059  46.017  72.390 1.00 25.66 ? 419 GLU A CD  1 
ATOM   604  O  OE1 . GLU A 1 83  ? 20.898  45.768  73.606 1.00 24.44 ? 419 GLU A OE1 1 
ATOM   605  O  OE2 . GLU A 1 83  ? 22.132  45.790  71.783 1.00 27.08 ? 419 GLU A OE2 1 
ATOM   606  N  N   . ASP A 1 84  ? 15.737  49.114  71.908 1.00 25.90 ? 420 ASP A N   1 
ATOM   607  C  CA  . ASP A 1 84  ? 14.735  49.922  72.576 1.00 27.14 ? 420 ASP A CA  1 
ATOM   608  C  C   . ASP A 1 84  ? 14.265  49.137  73.789 1.00 27.47 ? 420 ASP A C   1 
ATOM   609  O  O   . ASP A 1 84  ? 14.605  47.967  73.952 1.00 27.14 ? 420 ASP A O   1 
ATOM   610  C  CB  . ASP A 1 84  ? 13.577  50.232  71.618 1.00 27.80 ? 420 ASP A CB  1 
ATOM   611  C  CG  . ASP A 1 84  ? 12.815  51.503  71.987 1.00 29.48 ? 420 ASP A CG  1 
ATOM   612  O  OD1 . ASP A 1 84  ? 12.105  52.059  71.122 1.00 33.56 ? 420 ASP A OD1 1 
ATOM   613  O  OD2 . ASP A 1 84  ? 12.895  51.930  73.147 1.00 33.26 ? 420 ASP A OD2 1 
ATOM   614  N  N   . ASP A 1 85  ? 13.494  49.775  74.652 1.00 28.29 ? 421 ASP A N   1 
ATOM   615  C  CA  . ASP A 1 85  ? 13.121  49.135  75.909 1.00 29.14 ? 421 ASP A CA  1 
ATOM   616  C  C   . ASP A 1 85  ? 12.033  48.089  75.734 1.00 28.88 ? 421 ASP A C   1 
ATOM   617  O  O   . ASP A 1 85  ? 12.098  47.054  76.388 1.00 29.23 ? 421 ASP A O   1 
ATOM   618  C  CB  . ASP A 1 85  ? 12.731  50.175  76.950 1.00 30.04 ? 421 ASP A CB  1 
ATOM   619  C  CG  . ASP A 1 85  ? 13.931  51.014  77.419 1.00 32.02 ? 421 ASP A CG  1 
ATOM   620  O  OD1 . ASP A 1 85  ? 14.893  50.447  78.007 1.00 35.21 ? 421 ASP A OD1 1 
ATOM   621  O  OD2 . ASP A 1 85  ? 13.908  52.247  77.195 1.00 36.11 ? 421 ASP A OD2 1 
ATOM   622  N  N   . LYS A 1 86  ? 11.067  48.324  74.839 1.00 27.78 ? 422 LYS A N   1 
ATOM   623  C  CA  . LYS A 1 86  ? 9.979   47.370  74.610 1.00 27.22 ? 422 LYS A CA  1 
ATOM   624  C  C   . LYS A 1 86  ? 10.292  46.362  73.483 1.00 25.94 ? 422 LYS A C   1 
ATOM   625  O  O   . LYS A 1 86  ? 9.610   45.344  73.376 1.00 25.86 ? 422 LYS A O   1 
ATOM   626  C  CB  . LYS A 1 86  ? 8.665   48.105  74.268 1.00 27.64 ? 422 LYS A CB  1 
ATOM   627  C  CG  . LYS A 1 86  ? 7.962   48.808  75.437 1.00 29.10 ? 422 LYS A CG  1 
ATOM   628  C  CD  . LYS A 1 86  ? 7.357   47.819  76.455 1.00 30.80 ? 422 LYS A CD  1 
ATOM   629  C  CE  . LYS A 1 86  ? 6.270   48.485  77.326 1.00 32.25 ? 422 LYS A CE  1 
ATOM   630  N  NZ  . LYS A 1 86  ? 6.257   48.006  78.752 1.00 32.45 ? 422 LYS A NZ  1 
ATOM   631  N  N   . PHE A 1 87  ? 11.287  46.652  72.639 1.00 24.19 ? 423 PHE A N   1 
ATOM   632  C  CA  . PHE A 1 87  ? 11.577  45.813  71.478 1.00 22.98 ? 423 PHE A CA  1 
ATOM   633  C  C   . PHE A 1 87  ? 12.932  46.140  70.827 1.00 21.94 ? 423 PHE A C   1 
ATOM   634  O  O   . PHE A 1 87  ? 13.537  47.186  71.082 1.00 22.15 ? 423 PHE A O   1 
ATOM   635  C  CB  . PHE A 1 87  ? 10.430  45.890  70.439 1.00 23.40 ? 423 PHE A CB  1 
ATOM   636  C  CG  . PHE A 1 87  ? 9.812   47.264  70.304 1.00 22.68 ? 423 PHE A CG  1 
ATOM   637  C  CD1 . PHE A 1 87  ? 10.573  48.342  69.867 1.00 23.96 ? 423 PHE A CD1 1 
ATOM   638  C  CD2 . PHE A 1 87  ? 8.472   47.478  70.632 1.00 22.40 ? 423 PHE A CD2 1 
ATOM   639  C  CE1 . PHE A 1 87  ? 10.013  49.622  69.764 1.00 23.82 ? 423 PHE A CE1 1 
ATOM   640  C  CE2 . PHE A 1 87  ? 7.895   48.742  70.530 1.00 20.94 ? 423 PHE A CE2 1 
ATOM   641  C  CZ  . PHE A 1 87  ? 8.659   49.814  70.096 1.00 23.83 ? 423 PHE A CZ  1 
ATOM   642  N  N   . LEU A 1 88  ? 13.393  45.222  69.986 1.00 20.19 ? 424 LEU A N   1 
ATOM   643  C  CA  . LEU A 1 88  ? 14.673  45.327  69.280 1.00 19.33 ? 424 LEU A CA  1 
ATOM   644  C  C   . LEU A 1 88  ? 14.379  45.707  67.824 1.00 18.06 ? 424 LEU A C   1 
ATOM   645  O  O   . LEU A 1 88  ? 13.791  44.923  67.071 1.00 17.50 ? 424 LEU A O   1 
ATOM   646  C  CB  . LEU A 1 88  ? 15.378  43.972  69.330 1.00 19.69 ? 424 LEU A CB  1 
ATOM   647  C  CG  . LEU A 1 88  ? 16.713  43.822  68.598 1.00 20.18 ? 424 LEU A CG  1 
ATOM   648  C  CD1 . LEU A 1 88  ? 17.721  44.812  69.128 1.00 17.56 ? 424 LEU A CD1 1 
ATOM   649  C  CD2 . LEU A 1 88  ? 17.227  42.375  68.742 1.00 21.28 ? 424 LEU A CD2 1 
ATOM   650  N  N   . SER A 1 89  ? 14.711  46.932  67.458 1.00 16.92 ? 425 SER A N   1 
ATOM   651  C  CA  . SER A 1 89  ? 14.421  47.450  66.119 1.00 16.73 ? 425 SER A CA  1 
ATOM   652  C  C   . SER A 1 89  ? 15.720  47.306  65.338 1.00 16.55 ? 425 SER A C   1 
ATOM   653  O  O   . SER A 1 89  ? 16.799  47.424  65.926 1.00 16.20 ? 425 SER A O   1 
ATOM   654  C  CB  . SER A 1 89  ? 14.030  48.928  66.196 1.00 15.79 ? 425 SER A CB  1 
ATOM   655  O  OG  . SER A 1 89  ? 13.002  49.189  67.163 1.00 17.32 ? 425 SER A OG  1 
ATOM   656  N  N   . PHE A 1 90  ? 15.634  47.061  64.038 1.00 16.11 ? 426 PHE A N   1 
ATOM   657  C  CA  . PHE A 1 90  ? 16.824  47.026  63.196 1.00 16.86 ? 426 PHE A CA  1 
ATOM   658  C  C   . PHE A 1 90  ? 16.591  47.754  61.889 1.00 17.08 ? 426 PHE A C   1 
ATOM   659  O  O   . PHE A 1 90  ? 15.436  48.022  61.492 1.00 16.24 ? 426 PHE A O   1 
ATOM   660  C  CB  . PHE A 1 90  ? 17.309  45.570  62.933 1.00 16.36 ? 426 PHE A CB  1 
ATOM   661  C  CG  . PHE A 1 90  ? 16.390  44.758  62.047 1.00 17.96 ? 426 PHE A CG  1 
ATOM   662  C  CD1 . PHE A 1 90  ? 16.568  44.719  60.681 1.00 17.12 ? 426 PHE A CD1 1 
ATOM   663  C  CD2 . PHE A 1 90  ? 15.337  44.017  62.602 1.00 16.81 ? 426 PHE A CD2 1 
ATOM   664  C  CE1 . PHE A 1 90  ? 15.719  43.965  59.889 1.00 17.96 ? 426 PHE A CE1 1 
ATOM   665  C  CE2 . PHE A 1 90  ? 14.525  43.267  61.814 1.00 15.96 ? 426 PHE A CE2 1 
ATOM   666  C  CZ  . PHE A 1 90  ? 14.711  43.238  60.460 1.00 17.38 ? 426 PHE A CZ  1 
ATOM   667  N  N   . HIS A 1 91  ? 17.681  48.096  61.209 1.00 17.15 ? 427 HIS A N   1 
ATOM   668  C  CA  . HIS A 1 91  ? 17.554  48.540  59.824 1.00 18.27 ? 427 HIS A CA  1 
ATOM   669  C  C   . HIS A 1 91  ? 18.815  48.290  59.019 1.00 18.88 ? 427 HIS A C   1 
ATOM   670  O  O   . HIS A 1 91  ? 19.928  48.293  59.567 1.00 18.48 ? 427 HIS A O   1 
ATOM   671  C  CB  . HIS A 1 91  ? 17.015  49.981  59.728 1.00 19.35 ? 427 HIS A CB  1 
ATOM   672  C  CG  . HIS A 1 91  ? 18.049  51.048  59.639 1.00 18.78 ? 427 HIS A CG  1 
ATOM   673  N  ND1 . HIS A 1 91  ? 18.459  51.770  60.734 1.00 21.75 ? 427 HIS A ND1 1 
ATOM   674  C  CD2 . HIS A 1 91  ? 18.673  51.596  58.569 1.00 21.33 ? 427 HIS A CD2 1 
ATOM   675  C  CE1 . HIS A 1 91  ? 19.348  52.672  60.351 1.00 21.19 ? 427 HIS A CE1 1 
ATOM   676  N  NE2 . HIS A 1 91  ? 19.504  52.577  59.042 1.00 18.27 ? 427 HIS A NE2 1 
ATOM   677  N  N   . MET A 1 92  ? 18.599  47.984  57.742 1.00 19.08 ? 428 MET A N   1 
ATOM   678  C  CA  . MET A 1 92  ? 19.651  47.650  56.795 1.00 19.65 ? 428 MET A CA  1 
ATOM   679  C  C   . MET A 1 92  ? 19.785  48.805  55.824 1.00 19.78 ? 428 MET A C   1 
ATOM   680  O  O   . MET A 1 92  ? 18.797  49.462  55.491 1.00 17.86 ? 428 MET A O   1 
ATOM   681  C  CB  . MET A 1 92  ? 19.277  46.411  55.974 1.00 19.92 ? 428 MET A CB  1 
ATOM   682  C  CG  . MET A 1 92  ? 19.154  45.096  56.721 1.00 23.37 ? 428 MET A CG  1 
ATOM   683  S  SD  . MET A 1 92  ? 20.696  44.277  56.925 1.00 32.49 ? 428 MET A SD  1 
ATOM   684  C  CE  . MET A 1 92  ? 21.060  43.619  55.285 1.00 27.85 ? 428 MET A CE  1 
ATOM   685  N  N   . GLU A 1 93  ? 20.981  48.996  55.286 1.00 20.10 ? 429 GLU A N   1 
ATOM   686  C  CA  . GLU A 1 93  ? 21.216  50.140  54.420 1.00 20.74 ? 429 GLU A CA  1 
ATOM   687  C  C   . GLU A 1 93  ? 22.327  49.815  53.418 1.00 20.05 ? 429 GLU A C   1 
ATOM   688  O  O   . GLU A 1 93  ? 23.342  49.218  53.783 1.00 20.61 ? 429 GLU A O   1 
ATOM   689  C  CB  . GLU A 1 93  ? 21.499  51.361  55.321 1.00 21.31 ? 429 GLU A CB  1 
ATOM   690  C  CG  . GLU A 1 93  ? 22.204  52.562  54.730 1.00 25.04 ? 429 GLU A CG  1 
ATOM   691  C  CD  . GLU A 1 93  ? 22.475  53.634  55.814 1.00 28.12 ? 429 GLU A CD  1 
ATOM   692  O  OE1 . GLU A 1 93  ? 21.629  53.814  56.730 1.00 30.96 ? 429 GLU A OE1 1 
ATOM   693  O  OE2 . GLU A 1 93  ? 23.540  54.263  55.781 1.00 31.29 ? 429 GLU A OE2 1 
ATOM   694  N  N   . MET A 1 94  ? 22.067  50.134  52.149 1.00 18.90 ? 430 MET A N   1 
ATOM   695  C  CA  . MET A 1 94  ? 22.987  49.951  51.035 1.00 18.27 ? 430 MET A CA  1 
ATOM   696  C  C   . MET A 1 94  ? 22.693  51.027  49.990 1.00 17.71 ? 430 MET A C   1 
ATOM   697  O  O   . MET A 1 94  ? 21.650  51.712  50.055 1.00 16.98 ? 430 MET A O   1 
ATOM   698  C  CB  . MET A 1 94  ? 22.794  48.586  50.375 1.00 18.49 ? 430 MET A CB  1 
ATOM   699  C  CG  . MET A 1 94  ? 21.414  48.386  49.731 1.00 19.59 ? 430 MET A CG  1 
ATOM   700  S  SD  . MET A 1 94  ? 21.325  46.802  48.876 1.00 22.41 ? 430 MET A SD  1 
ATOM   701  C  CE  . MET A 1 94  ? 19.601  46.734  48.429 1.00 18.14 ? 430 MET A CE  1 
ATOM   702  N  N   . VAL A 1 95  ? 23.595  51.171  49.032 1.00 16.53 ? 431 VAL A N   1 
ATOM   703  C  CA  . VAL A 1 95  ? 23.387  52.081  47.922 1.00 16.41 ? 431 VAL A CA  1 
ATOM   704  C  C   . VAL A 1 95  ? 23.401  51.241  46.668 1.00 17.10 ? 431 VAL A C   1 
ATOM   705  O  O   . VAL A 1 95  ? 24.241  50.356  46.496 1.00 16.76 ? 431 VAL A O   1 
ATOM   706  C  CB  . VAL A 1 95  ? 24.451  53.180  47.877 1.00 16.18 ? 431 VAL A CB  1 
ATOM   707  C  CG1 . VAL A 1 95  ? 24.272  54.136  46.635 1.00 14.30 ? 431 VAL A CG1 1 
ATOM   708  C  CG2 . VAL A 1 95  ? 24.417  53.957  49.162 1.00 15.73 ? 431 VAL A CG2 1 
ATOM   709  N  N   . VAL A 1 96  ? 22.468  51.526  45.780 1.00 16.93 ? 432 VAL A N   1 
ATOM   710  C  CA  . VAL A 1 96  ? 22.247  50.675  44.635 1.00 17.10 ? 432 VAL A CA  1 
ATOM   711  C  C   . VAL A 1 96  ? 22.258  51.560  43.425 1.00 17.41 ? 432 VAL A C   1 
ATOM   712  O  O   . VAL A 1 96  ? 21.886  52.728  43.516 1.00 18.04 ? 432 VAL A O   1 
ATOM   713  C  CB  . VAL A 1 96  ? 20.912  49.902  44.773 1.00 17.16 ? 432 VAL A CB  1 
ATOM   714  C  CG1 . VAL A 1 96  ? 20.660  49.076  43.537 1.00 17.97 ? 432 VAL A CG1 1 
ATOM   715  C  CG2 . VAL A 1 96  ? 20.947  49.017  46.015 1.00 14.23 ? 432 VAL A CG2 1 
ATOM   716  N  N   . HIS A 1 97  ? 22.731  51.002  42.311 1.00 17.77 ? 433 HIS A N   1 
ATOM   717  C  CA  . HIS A 1 97  ? 22.875  51.695  41.053 1.00 17.67 ? 433 HIS A CA  1 
ATOM   718  C  C   . HIS A 1 97  ? 21.556  51.620  40.287 1.00 18.15 ? 433 HIS A C   1 
ATOM   719  O  O   . HIS A 1 97  ? 21.462  51.005  39.221 1.00 18.72 ? 433 HIS A O   1 
ATOM   720  C  CB  . HIS A 1 97  ? 24.048  51.063  40.269 1.00 17.89 ? 433 HIS A CB  1 
ATOM   721  C  CG  . HIS A 1 97  ? 24.386  51.759  38.991 1.00 16.78 ? 433 HIS A CG  1 
ATOM   722  N  ND1 . HIS A 1 97  ? 24.017  53.060  38.726 1.00 14.42 ? 433 HIS A ND1 1 
ATOM   723  C  CD2 . HIS A 1 97  ? 25.108  51.345  37.920 1.00 16.23 ? 433 HIS A CD2 1 
ATOM   724  C  CE1 . HIS A 1 97  ? 24.464  53.406  37.534 1.00 13.45 ? 433 HIS A CE1 1 
ATOM   725  N  NE2 . HIS A 1 97  ? 25.129  52.385  37.025 1.00 15.68 ? 433 HIS A NE2 1 
ATOM   726  N  N   . VAL A 1 98  ? 20.539  52.267  40.851 1.00 17.99 ? 434 VAL A N   1 
ATOM   727  C  CA  . VAL A 1 98  ? 19.223  52.388  40.243 1.00 18.14 ? 434 VAL A CA  1 
ATOM   728  C  C   . VAL A 1 98  ? 18.649  53.754  40.572 1.00 17.94 ? 434 VAL A C   1 
ATOM   729  O  O   . VAL A 1 98  ? 19.032  54.349  41.582 1.00 17.46 ? 434 VAL A O   1 
ATOM   730  C  CB  . VAL A 1 98  ? 18.256  51.332  40.770 1.00 17.98 ? 434 VAL A CB  1 
ATOM   731  C  CG1 . VAL A 1 98  ? 18.642  49.966  40.247 1.00 19.60 ? 434 VAL A CG1 1 
ATOM   732  C  CG2 . VAL A 1 98  ? 18.206  51.345  42.301 1.00 19.15 ? 434 VAL A CG2 1 
ATOM   733  N  N   . ASP A 1 99  ? 17.753  54.250  39.712 1.00 17.79 ? 435 ASP A N   1 
ATOM   734  C  CA  . ASP A 1 99  ? 17.019  55.505  39.961 1.00 18.14 ? 435 ASP A CA  1 
ATOM   735  C  C   . ASP A 1 99  ? 16.057  55.305  41.126 1.00 17.07 ? 435 ASP A C   1 
ATOM   736  O  O   . ASP A 1 99  ? 15.325  54.308  41.166 1.00 17.30 ? 435 ASP A O   1 
ATOM   737  C  CB  . ASP A 1 99  ? 16.253  55.943  38.701 1.00 19.06 ? 435 ASP A CB  1 
ATOM   738  C  CG  . ASP A 1 99  ? 15.217  57.051  38.967 1.00 22.47 ? 435 ASP A CG  1 
ATOM   739  O  OD1 . ASP A 1 99  ? 15.594  58.210  39.230 1.00 27.63 ? 435 ASP A OD1 1 
ATOM   740  O  OD2 . ASP A 1 99  ? 14.001  56.758  38.916 1.00 29.17 ? 435 ASP A OD2 1 
ATOM   741  N  N   . ALA A 1 100 ? 16.061  56.254  42.061 1.00 16.25 ? 436 ALA A N   1 
ATOM   742  C  CA  . ALA A 1 100 ? 15.170  56.225  43.230 1.00 16.61 ? 436 ALA A CA  1 
ATOM   743  C  C   . ALA A 1 100 ? 13.702  56.088  42.818 1.00 15.69 ? 436 ALA A C   1 
ATOM   744  O  O   . ALA A 1 100 ? 12.943  55.332  43.420 1.00 16.67 ? 436 ALA A O   1 
ATOM   745  C  CB  . ALA A 1 100 ? 15.369  57.472  44.080 1.00 16.29 ? 436 ALA A CB  1 
ATOM   746  N  N   . ALA A 1 101 ? 13.300  56.806  41.783 1.00 15.18 ? 437 ALA A N   1 
ATOM   747  C  CA  . ALA A 1 101 ? 11.920  56.737  41.330 1.00 14.77 ? 437 ALA A CA  1 
ATOM   748  C  C   . ALA A 1 101 ? 11.549  55.323  40.887 1.00 15.25 ? 437 ALA A C   1 
ATOM   749  O  O   . ALA A 1 101 ? 10.438  54.870  41.141 1.00 15.77 ? 437 ALA A O   1 
ATOM   750  C  CB  . ALA A 1 101 ? 11.651  57.747  40.218 1.00 14.25 ? 437 ALA A CB  1 
ATOM   751  N  N   . GLN A 1 102 ? 12.465  54.624  40.232 1.00 15.82 ? 438 GLN A N   1 
ATOM   752  C  CA  . GLN A 1 102 ? 12.208  53.257  39.799 1.00 16.95 ? 438 GLN A CA  1 
ATOM   753  C  C   . GLN A 1 102 ? 12.264  52.280  40.988 1.00 16.28 ? 438 GLN A C   1 
ATOM   754  O  O   . GLN A 1 102 ? 11.456  51.349  41.079 1.00 17.30 ? 438 GLN A O   1 
ATOM   755  C  CB  . GLN A 1 102 ? 13.185  52.854  38.658 1.00 17.71 ? 438 GLN A CB  1 
ATOM   756  C  CG  . GLN A 1 102 ? 12.891  51.497  37.944 1.00 21.61 ? 438 GLN A CG  1 
ATOM   757  C  CD  . GLN A 1 102 ? 11.505  51.400  37.279 1.00 26.00 ? 438 GLN A CD  1 
ATOM   758  O  OE1 . GLN A 1 102 ? 10.973  52.392  36.753 1.00 30.54 ? 438 GLN A OE1 1 
ATOM   759  N  NE2 . GLN A 1 102 ? 10.907  50.196  37.311 1.00 27.50 ? 438 GLN A NE2 1 
ATOM   760  N  N   . ALA A 1 103 ? 13.211  52.477  41.902 1.00 15.72 ? 439 ALA A N   1 
ATOM   761  C  CA  . ALA A 1 103 ? 13.255  51.661  43.118 1.00 15.37 ? 439 ALA A CA  1 
ATOM   762  C  C   . ALA A 1 103 ? 11.955  51.815  43.919 1.00 14.25 ? 439 ALA A C   1 
ATOM   763  O  O   . ALA A 1 103 ? 11.445  50.863  44.518 1.00 13.79 ? 439 ALA A O   1 
ATOM   764  C  CB  . ALA A 1 103 ? 14.464  52.051  43.971 1.00 14.61 ? 439 ALA A CB  1 
ATOM   765  N  N   . PHE A 1 104 ? 11.425  53.030  43.941 1.00 14.58 ? 440 PHE A N   1 
ATOM   766  C  CA  . PHE A 1 104 ? 10.130  53.299  44.609 1.00 13.34 ? 440 PHE A CA  1 
ATOM   767  C  C   . PHE A 1 104 ? 9.012   52.420  44.057 1.00 14.25 ? 440 PHE A C   1 
ATOM   768  O  O   . PHE A 1 104 ? 8.182   51.890  44.812 1.00 14.54 ? 440 PHE A O   1 
ATOM   769  C  CB  . PHE A 1 104 ? 9.803   54.779  44.419 1.00 13.42 ? 440 PHE A CB  1 
ATOM   770  C  CG  . PHE A 1 104 ? 8.549   55.248  45.103 1.00 11.10 ? 440 PHE A CG  1 
ATOM   771  C  CD1 . PHE A 1 104 ? 8.448   55.218  46.477 1.00 9.52  ? 440 PHE A CD1 1 
ATOM   772  C  CD2 . PHE A 1 104 ? 7.515   55.828  44.376 1.00 13.09 ? 440 PHE A CD2 1 
ATOM   773  C  CE1 . PHE A 1 104 ? 7.317   55.727  47.148 1.00 11.27 ? 440 PHE A CE1 1 
ATOM   774  C  CE2 . PHE A 1 104 ? 6.349   56.308  45.031 1.00 10.72 ? 440 PHE A CE2 1 
ATOM   775  C  CZ  . PHE A 1 104 ? 6.274   56.263  46.415 1.00 11.50 ? 440 PHE A CZ  1 
ATOM   776  N  N   . LEU A 1 105 ? 8.957   52.260  42.744 1.00 15.77 ? 441 LEU A N   1 
ATOM   777  C  CA  . LEU A 1 105 ? 7.860   51.484  42.140 1.00 16.82 ? 441 LEU A CA  1 
ATOM   778  C  C   . LEU A 1 105 ? 8.077   50.007  42.422 1.00 16.88 ? 441 LEU A C   1 
ATOM   779  O  O   . LEU A 1 105 ? 7.159   49.298  42.751 1.00 17.50 ? 441 LEU A O   1 
ATOM   780  C  CB  . LEU A 1 105 ? 7.762   51.702  40.626 1.00 17.70 ? 441 LEU A CB  1 
ATOM   781  C  CG  . LEU A 1 105 ? 7.526   53.108  40.103 1.00 18.03 ? 441 LEU A CG  1 
ATOM   782  C  CD1 . LEU A 1 105 ? 7.672   53.156  38.574 1.00 19.64 ? 441 LEU A CD1 1 
ATOM   783  C  CD2 . LEU A 1 105 ? 6.170   53.609  40.576 1.00 21.57 ? 441 LEU A CD2 1 
ATOM   784  N  N   . LEU A 1 106 ? 9.314   49.562  42.327 1.00 16.73 ? 442 LEU A N   1 
ATOM   785  C  CA  . LEU A 1 106 ? 9.617   48.157  42.523 1.00 16.21 ? 442 LEU A CA  1 
ATOM   786  C  C   . LEU A 1 106 ? 9.444   47.705  43.955 1.00 15.83 ? 442 LEU A C   1 
ATOM   787  O  O   . LEU A 1 106 ? 8.959   46.587  44.203 1.00 16.68 ? 442 LEU A O   1 
ATOM   788  C  CB  . LEU A 1 106 ? 11.033  47.878  42.049 1.00 15.63 ? 442 LEU A CB  1 
ATOM   789  C  CG  . LEU A 1 106 ? 11.242  48.103  40.551 1.00 18.06 ? 442 LEU A CG  1 
ATOM   790  C  CD1 . LEU A 1 106 ? 12.735  48.367  40.232 1.00 19.04 ? 442 LEU A CD1 1 
ATOM   791  C  CD2 . LEU A 1 106 ? 10.750  46.940  39.706 1.00 20.60 ? 442 LEU A CD2 1 
ATOM   792  N  N   . LEU A 1 107 ? 9.811   48.554  44.912 1.00 14.53 ? 443 LEU A N   1 
ATOM   793  C  CA  . LEU A 1 107 ? 9.738   48.153  46.298 1.00 14.46 ? 443 LEU A CA  1 
ATOM   794  C  C   . LEU A 1 107 ? 8.358   48.432  46.889 1.00 14.50 ? 443 LEU A C   1 
ATOM   795  O  O   . LEU A 1 107 ? 8.041   47.872  47.891 1.00 15.40 ? 443 LEU A O   1 
ATOM   796  C  CB  . LEU A 1 107 ? 10.817  48.818  47.145 1.00 14.80 ? 443 LEU A CB  1 
ATOM   797  C  CG  . LEU A 1 107 ? 12.229  48.389  46.748 1.00 14.30 ? 443 LEU A CG  1 
ATOM   798  C  CD1 . LEU A 1 107 ? 13.329  49.120  47.515 1.00 16.49 ? 443 LEU A CD1 1 
ATOM   799  C  CD2 . LEU A 1 107 ? 12.399  46.819  46.917 1.00 12.64 ? 443 LEU A CD2 1 
ATOM   800  N  N   . SER A 1 108 ? 7.554   49.287  46.278 1.00 14.41 ? 444 SER A N   1 
ATOM   801  C  CA  . SER A 1 108 ? 6.163   49.485  46.761 1.00 15.73 ? 444 SER A CA  1 
ATOM   802  C  C   . SER A 1 108 ? 5.224   48.374  46.264 1.00 17.07 ? 444 SER A C   1 
ATOM   803  O  O   . SER A 1 108 ? 4.104   48.215  46.760 1.00 19.67 ? 444 SER A O   1 
ATOM   804  C  CB  . SER A 1 108 ? 5.665   50.874  46.390 1.00 15.24 ? 444 SER A CB  1 
ATOM   805  O  OG  . SER A 1 108 ? 5.680   51.088  45.010 1.00 16.95 ? 444 SER A OG  1 
ATOM   806  N  N   . ASP A 1 109 ? 5.698   47.562  45.324 1.00 17.93 ? 445 ASP A N   1 
ATOM   807  C  CA  . ASP A 1 109 ? 4.883   46.508  44.731 1.00 18.58 ? 445 ASP A CA  1 
ATOM   808  C  C   . ASP A 1 109 ? 5.096   45.249  45.548 1.00 17.56 ? 445 ASP A C   1 
ATOM   809  O  O   . ASP A 1 109 ? 5.878   44.394  45.188 1.00 16.94 ? 445 ASP A O   1 
ATOM   810  C  CB  . ASP A 1 109 ? 5.242   46.325  43.242 1.00 19.37 ? 445 ASP A CB  1 
ATOM   811  C  CG  . ASP A 1 109 ? 4.249   45.424  42.501 1.00 22.79 ? 445 ASP A CG  1 
ATOM   812  O  OD1 . ASP A 1 109 ? 3.389   44.786  43.146 1.00 25.38 ? 445 ASP A OD1 1 
ATOM   813  O  OD2 . ASP A 1 109 ? 4.371   45.331  41.268 1.00 27.11 ? 445 ASP A OD2 1 
ATOM   814  N  N   . LEU A 1 110 ? 4.333   45.135  46.643 1.00 16.40 ? 446 LEU A N   1 
ATOM   815  C  CA  . LEU A 1 110 ? 4.491   44.024  47.549 1.00 16.66 ? 446 LEU A CA  1 
ATOM   816  C  C   . LEU A 1 110 ? 4.209   42.703  46.882 1.00 15.64 ? 446 LEU A C   1 
ATOM   817  O  O   . LEU A 1 110 ? 4.783   41.715  47.278 1.00 14.45 ? 446 LEU A O   1 
ATOM   818  C  CB  . LEU A 1 110 ? 3.615   44.168  48.787 1.00 16.92 ? 446 LEU A CB  1 
ATOM   819  C  CG  . LEU A 1 110 ? 4.299   44.847  49.955 1.00 20.81 ? 446 LEU A CG  1 
ATOM   820  C  CD1 . LEU A 1 110 ? 3.476   44.611  51.222 1.00 22.44 ? 446 LEU A CD1 1 
ATOM   821  C  CD2 . LEU A 1 110 ? 5.680   44.309  50.133 1.00 24.57 ? 446 LEU A CD2 1 
ATOM   822  N  N   . ARG A 1 111 ? 3.334   42.688  45.871 1.00 14.84 ? 447 ARG A N   1 
ATOM   823  C  CA  . ARG A 1 111 ? 3.042   41.451  45.155 1.00 15.23 ? 447 ARG A CA  1 
ATOM   824  C  C   . ARG A 1 111 ? 4.270   40.889  44.439 1.00 15.89 ? 447 ARG A C   1 
ATOM   825  O  O   . ARG A 1 111 ? 4.321   39.706  44.117 1.00 15.20 ? 447 ARG A O   1 
ATOM   826  C  CB  . ARG A 1 111 ? 1.890   41.642  44.165 1.00 15.70 ? 447 ARG A CB  1 
ATOM   827  C  CG  . ARG A 1 111 ? 0.501   41.489  44.815 1.00 12.38 ? 447 ARG A CG  1 
ATOM   828  C  CD  . ARG A 1 111 ? -0.573  41.765  43.798 1.00 14.32 ? 447 ARG A CD  1 
ATOM   829  N  NE  . ARG A 1 111 ? -0.650  43.183  43.492 1.00 14.04 ? 447 ARG A NE  1 
ATOM   830  C  CZ  . ARG A 1 111 ? -1.471  43.727  42.599 1.00 15.88 ? 447 ARG A CZ  1 
ATOM   831  N  NH1 . ARG A 1 111 ? -2.305  42.986  41.886 1.00 18.73 ? 447 ARG A NH1 1 
ATOM   832  N  NH2 . ARG A 1 111 ? -1.449  45.032  42.420 1.00 17.33 ? 447 ARG A NH2 1 
ATOM   833  N  N   . GLN A 1 112 ? 5.260   41.738  44.200 1.00 15.92 ? 448 GLN A N   1 
ATOM   834  C  CA  . GLN A 1 112 ? 6.520   41.269  43.601 1.00 16.74 ? 448 GLN A CA  1 
ATOM   835  C  C   . GLN A 1 112 ? 7.567   40.881  44.654 1.00 16.21 ? 448 GLN A C   1 
ATOM   836  O  O   . GLN A 1 112 ? 8.595   40.285  44.321 1.00 15.24 ? 448 GLN A O   1 
ATOM   837  C  CB  . GLN A 1 112 ? 7.084   42.365  42.737 1.00 17.12 ? 448 GLN A CB  1 
ATOM   838  C  CG  . GLN A 1 112 ? 6.357   42.536  41.416 1.00 21.10 ? 448 GLN A CG  1 
ATOM   839  C  CD  . GLN A 1 112 ? 7.277   43.227  40.431 1.00 26.28 ? 448 GLN A CD  1 
ATOM   840  O  OE1 . GLN A 1 112 ? 7.533   44.430  40.554 1.00 32.09 ? 448 GLN A OE1 1 
ATOM   841  N  NE2 . GLN A 1 112 ? 7.773   42.486  39.463 1.00 26.38 ? 448 GLN A NE2 1 
ATOM   842  N  N   . ARG A 1 113 ? 7.318   41.217  45.920 1.00 16.57 ? 449 ARG A N   1 
ATOM   843  C  CA  . ARG A 1 113 ? 8.331   40.954  46.953 1.00 17.50 ? 449 ARG A CA  1 
ATOM   844  C  C   . ARG A 1 113 ? 8.705   39.471  47.121 1.00 17.61 ? 449 ARG A C   1 
ATOM   845  O  O   . ARG A 1 113 ? 9.869   39.180  47.395 1.00 19.81 ? 449 ARG A O   1 
ATOM   846  C  CB  . ARG A 1 113 ? 7.972   41.620  48.289 1.00 17.84 ? 449 ARG A CB  1 
ATOM   847  C  CG  . ARG A 1 113 ? 9.070   41.522  49.350 1.00 18.79 ? 449 ARG A CG  1 
ATOM   848  C  CD  . ARG A 1 113 ? 8.852   42.540  50.471 1.00 22.63 ? 449 ARG A CD  1 
ATOM   849  N  NE  . ARG A 1 113 ? 9.702   42.274  51.626 1.00 24.25 ? 449 ARG A NE  1 
ATOM   850  C  CZ  . ARG A 1 113 ? 9.578   42.850  52.821 1.00 26.96 ? 449 ARG A CZ  1 
ATOM   851  N  NH1 . ARG A 1 113 ? 8.617   43.735  53.078 1.00 26.59 ? 449 ARG A NH1 1 
ATOM   852  N  NH2 . ARG A 1 113 ? 10.423  42.512  53.782 1.00 26.09 ? 449 ARG A NH2 1 
ATOM   853  N  N   . PRO A 1 114 ? 7.771   38.519  46.919 1.00 17.86 ? 450 PRO A N   1 
ATOM   854  C  CA  . PRO A 1 114 ? 8.199   37.105  46.955 1.00 18.17 ? 450 PRO A CA  1 
ATOM   855  C  C   . PRO A 1 114 ? 9.278   36.712  45.958 1.00 18.23 ? 450 PRO A C   1 
ATOM   856  O  O   . PRO A 1 114 ? 9.928   35.676  46.149 1.00 18.04 ? 450 PRO A O   1 
ATOM   857  C  CB  . PRO A 1 114 ? 6.917   36.347  46.608 1.00 18.84 ? 450 PRO A CB  1 
ATOM   858  C  CG  . PRO A 1 114 ? 5.837   37.226  47.166 1.00 18.24 ? 450 PRO A CG  1 
ATOM   859  C  CD  . PRO A 1 114 ? 6.306   38.619  46.832 1.00 18.35 ? 450 PRO A CD  1 
ATOM   860  N  N   . GLU A 1 115 ? 9.451   37.499  44.899 1.00 19.01 ? 451 GLU A N   1 
ATOM   861  C  CA  . GLU A 1 115 ? 10.455  37.192  43.871 1.00 19.90 ? 451 GLU A CA  1 
ATOM   862  C  C   . GLU A 1 115 ? 11.861  37.376  44.411 1.00 19.84 ? 451 GLU A C   1 
ATOM   863  O  O   . GLU A 1 115 ? 12.786  36.690  43.971 1.00 20.49 ? 451 GLU A O   1 
ATOM   864  C  CB  . GLU A 1 115 ? 10.240  38.027  42.615 1.00 20.42 ? 451 GLU A CB  1 
ATOM   865  C  CG  . GLU A 1 115 ? 8.894   37.733  41.937 1.00 23.16 ? 451 GLU A CG  1 
ATOM   866  C  CD  . GLU A 1 115 ? 8.634   38.619  40.752 1.00 26.53 ? 451 GLU A CD  1 
ATOM   867  O  OE1 . GLU A 1 115 ? 9.626   39.018  40.104 1.00 28.18 ? 451 GLU A OE1 1 
ATOM   868  O  OE2 . GLU A 1 115 ? 7.445   38.936  40.472 1.00 30.25 ? 451 GLU A OE2 1 
ATOM   869  N  N   . TRP A 1 116 ? 12.033  38.255  45.395 1.00 19.86 ? 452 TRP A N   1 
ATOM   870  C  CA  . TRP A 1 116 ? 13.373  38.538  45.921 1.00 19.14 ? 452 TRP A CA  1 
ATOM   871  C  C   . TRP A 1 116 ? 13.551  38.293  47.405 1.00 19.71 ? 452 TRP A C   1 
ATOM   872  O  O   . TRP A 1 116 ? 14.696  38.230  47.869 1.00 19.28 ? 452 TRP A O   1 
ATOM   873  C  CB  . TRP A 1 116 ? 13.799  39.965  45.583 1.00 19.17 ? 452 TRP A CB  1 
ATOM   874  C  CG  . TRP A 1 116 ? 12.984  41.037  46.183 1.00 18.05 ? 452 TRP A CG  1 
ATOM   875  C  CD1 . TRP A 1 116 ? 11.936  41.698  45.583 1.00 18.44 ? 452 TRP A CD1 1 
ATOM   876  C  CD2 . TRP A 1 116 ? 13.135  41.622  47.475 1.00 17.19 ? 452 TRP A CD2 1 
ATOM   877  N  NE1 . TRP A 1 116 ? 11.429  42.645  46.430 1.00 17.39 ? 452 TRP A NE1 1 
ATOM   878  C  CE2 . TRP A 1 116 ? 12.124  42.610  47.606 1.00 19.08 ? 452 TRP A CE2 1 
ATOM   879  C  CE3 . TRP A 1 116 ? 13.986  41.391  48.554 1.00 17.45 ? 452 TRP A CE3 1 
ATOM   880  C  CZ2 . TRP A 1 116 ? 11.955  43.365  48.781 1.00 19.36 ? 452 TRP A CZ2 1 
ATOM   881  C  CZ3 . TRP A 1 116 ? 13.827  42.153  49.719 1.00 17.92 ? 452 TRP A CZ3 1 
ATOM   882  C  CH2 . TRP A 1 116 ? 12.824  43.142  49.809 1.00 18.46 ? 452 TRP A CH2 1 
ATOM   883  N  N   . ASP A 1 117 ? 12.437  38.169  48.137 1.00 19.55 ? 453 ASP A N   1 
ATOM   884  C  CA  . ASP A 1 117 ? 12.457  37.995  49.579 1.00 19.94 ? 453 ASP A CA  1 
ATOM   885  C  C   . ASP A 1 117 ? 11.819  36.670  49.951 1.00 20.16 ? 453 ASP A C   1 
ATOM   886  O  O   . ASP A 1 117 ? 10.601  36.489  49.907 1.00 19.95 ? 453 ASP A O   1 
ATOM   887  C  CB  . ASP A 1 117 ? 11.723  39.149  50.267 1.00 20.17 ? 453 ASP A CB  1 
ATOM   888  C  CG  . ASP A 1 117 ? 11.894  39.150  51.782 1.00 20.05 ? 453 ASP A CG  1 
ATOM   889  O  OD1 . ASP A 1 117 ? 12.478  38.187  52.354 1.00 20.91 ? 453 ASP A OD1 1 
ATOM   890  O  OD2 . ASP A 1 117 ? 11.423  40.118  52.411 1.00 21.44 ? 453 ASP A OD2 1 
ATOM   891  N  N   . LYS A 1 118 ? 12.667  35.756  50.381 1.00 21.16 ? 454 LYS A N   1 
ATOM   892  C  CA  . LYS A 1 118 ? 12.231  34.447  50.788 1.00 22.20 ? 454 LYS A CA  1 
ATOM   893  C  C   . LYS A 1 118 ? 11.278  34.512  51.988 1.00 21.68 ? 454 LYS A C   1 
ATOM   894  O  O   . LYS A 1 118 ? 10.495  33.607  52.177 1.00 22.94 ? 454 LYS A O   1 
ATOM   895  C  CB  . LYS A 1 118 ? 13.449  33.559  51.097 1.00 22.86 ? 454 LYS A CB  1 
ATOM   896  C  CG  . LYS A 1 118 ? 14.252  33.997  52.294 1.00 23.88 ? 454 LYS A CG  1 
ATOM   897  C  CD  . LYS A 1 118 ? 13.554  33.620  53.573 1.00 28.85 ? 454 LYS A CD  1 
ATOM   898  N  N   . HIS A 1 119 ? 11.317  35.594  52.759 1.00 22.18 ? 455 HIS A N   1 
ATOM   899  C  CA  . HIS A 1 119 ? 10.392  35.771  53.894 1.00 22.71 ? 455 HIS A CA  1 
ATOM   900  C  C   . HIS A 1 119 ? 8.959   36.037  53.464 1.00 22.28 ? 455 HIS A C   1 
ATOM   901  O  O   . HIS A 1 119 ? 8.023   35.785  54.239 1.00 22.04 ? 455 HIS A O   1 
ATOM   902  C  CB  . HIS A 1 119 ? 10.883  36.897  54.792 1.00 23.67 ? 455 HIS A CB  1 
ATOM   903  C  CG  . HIS A 1 119 ? 12.311  36.741  55.199 1.00 26.05 ? 455 HIS A CG  1 
ATOM   904  N  ND1 . HIS A 1 119 ? 13.324  37.520  54.676 1.00 26.93 ? 455 HIS A ND1 1 
ATOM   905  C  CD2 . HIS A 1 119 ? 12.905  35.860  56.038 1.00 28.55 ? 455 HIS A CD2 1 
ATOM   906  C  CE1 . HIS A 1 119 ? 14.478  37.134  55.188 1.00 27.25 ? 455 HIS A CE1 1 
ATOM   907  N  NE2 . HIS A 1 119 ? 14.251  36.133  56.023 1.00 27.65 ? 455 HIS A NE2 1 
ATOM   908  N  N   . TYR A 1 120 ? 8.785   36.524  52.235 1.00 20.99 ? 456 TYR A N   1 
ATOM   909  C  CA  . TYR A 1 120 ? 7.467   36.667  51.644 1.00 21.75 ? 456 TYR A CA  1 
ATOM   910  C  C   . TYR A 1 120 ? 7.113   35.440  50.805 1.00 21.19 ? 456 TYR A C   1 
ATOM   911  O  O   . TYR A 1 120 ? 7.468   35.337  49.629 1.00 21.67 ? 456 TYR A O   1 
ATOM   912  C  CB  . TYR A 1 120 ? 7.395   37.940  50.803 1.00 21.47 ? 456 TYR A CB  1 
ATOM   913  C  CG  . TYR A 1 120 ? 6.974   39.167  51.580 1.00 22.13 ? 456 TYR A CG  1 
ATOM   914  C  CD1 . TYR A 1 120 ? 7.613   39.547  52.751 1.00 23.01 ? 456 TYR A CD1 1 
ATOM   915  C  CD2 . TYR A 1 120 ? 5.954   39.958  51.113 1.00 22.93 ? 456 TYR A CD2 1 
ATOM   916  C  CE1 . TYR A 1 120 ? 7.213   40.660  53.447 1.00 23.67 ? 456 TYR A CE1 1 
ATOM   917  C  CE2 . TYR A 1 120 ? 5.563   41.077  51.772 1.00 23.46 ? 456 TYR A CE2 1 
ATOM   918  C  CZ  . TYR A 1 120 ? 6.197   41.435  52.942 1.00 23.83 ? 456 TYR A CZ  1 
ATOM   919  O  OH  . TYR A 1 120 ? 5.760   42.588  53.553 1.00 25.33 ? 456 TYR A OH  1 
ATOM   920  N  N   . ARG A 1 121 ? 6.394   34.509  51.407 1.00 21.40 ? 457 ARG A N   1 
ATOM   921  C  CA  . ARG A 1 121 ? 6.032   33.293  50.712 1.00 21.82 ? 457 ARG A CA  1 
ATOM   922  C  C   . ARG A 1 121 ? 4.978   33.614  49.694 1.00 21.12 ? 457 ARG A C   1 
ATOM   923  O  O   . ARG A 1 121 ? 5.051   33.148  48.570 1.00 21.89 ? 457 ARG A O   1 
ATOM   924  C  CB  . ARG A 1 121 ? 5.528   32.212  51.690 1.00 22.21 ? 457 ARG A CB  1 
ATOM   925  C  CG  . ARG A 1 121 ? 5.079   30.956  51.011 1.00 25.10 ? 457 ARG A CG  1 
ATOM   926  C  CD  . ARG A 1 121 ? 4.550   29.977  52.027 1.00 30.03 ? 457 ARG A CD  1 
ATOM   927  N  NE  . ARG A 1 121 ? 3.144   30.263  52.273 1.00 33.74 ? 457 ARG A NE  1 
ATOM   928  C  CZ  . ARG A 1 121 ? 2.215   29.369  52.579 1.00 35.36 ? 457 ARG A CZ  1 
ATOM   929  N  NH1 . ARG A 1 121 ? 2.507   28.085  52.700 1.00 36.95 ? 457 ARG A NH1 1 
ATOM   930  N  NH2 . ARG A 1 121 ? 0.968   29.777  52.754 1.00 37.68 ? 457 ARG A NH2 1 
ATOM   931  N  N   . SER A 1 122 ? 3.969   34.384  50.086 1.00 20.08 ? 458 SER A N   1 
ATOM   932  C  CA  . SER A 1 122 ? 2.905   34.777  49.161 1.00 19.71 ? 458 SER A CA  1 
ATOM   933  C  C   . SER A 1 122 ? 2.342   36.129  49.562 1.00 19.01 ? 458 SER A C   1 
ATOM   934  O  O   . SER A 1 122 ? 2.429   36.529  50.732 1.00 18.40 ? 458 SER A O   1 
ATOM   935  C  CB  . SER A 1 122 ? 1.766   33.751  49.116 1.00 20.15 ? 458 SER A CB  1 
ATOM   936  O  OG  . SER A 1 122 ? 1.094   33.653  50.381 1.00 20.74 ? 458 SER A OG  1 
ATOM   937  N  N   . VAL A 1 123 ? 1.753   36.809  48.589 1.00 18.69 ? 459 VAL A N   1 
ATOM   938  C  CA  . VAL A 1 123 ? 1.119   38.099  48.804 1.00 17.81 ? 459 VAL A CA  1 
ATOM   939  C  C   . VAL A 1 123 ? -0.179  38.189  48.015 1.00 18.49 ? 459 VAL A C   1 
ATOM   940  O  O   . VAL A 1 123 ? -0.216  37.891  46.821 1.00 17.71 ? 459 VAL A O   1 
ATOM   941  C  CB  . VAL A 1 123 ? 2.038   39.247  48.385 1.00 18.09 ? 459 VAL A CB  1 
ATOM   942  C  CG1 . VAL A 1 123 ? 1.353   40.612  48.629 1.00 17.56 ? 459 VAL A CG1 1 
ATOM   943  C  CG2 . VAL A 1 123 ? 3.355   39.180  49.124 1.00 15.97 ? 459 VAL A CG2 1 
ATOM   944  N  N   . GLU A 1 124 ? -1.252  38.574  48.693 1.00 18.09 ? 460 GLU A N   1 
ATOM   945  C  CA  . GLU A 1 124 ? -2.536  38.775  48.042 1.00 18.95 ? 460 GLU A CA  1 
ATOM   946  C  C   . GLU A 1 124 ? -2.905  40.251  48.309 1.00 17.61 ? 460 GLU A C   1 
ATOM   947  O  O   . GLU A 1 124 ? -2.807  40.724  49.430 1.00 16.00 ? 460 GLU A O   1 
ATOM   948  C  CB  . GLU A 1 124 ? -3.561  37.783  48.633 1.00 20.69 ? 460 GLU A CB  1 
ATOM   949  C  CG  . GLU A 1 124 ? -5.021  38.007  48.258 1.00 25.79 ? 460 GLU A CG  1 
ATOM   950  C  CD  . GLU A 1 124 ? -6.037  37.406  49.260 1.00 34.35 ? 460 GLU A CD  1 
ATOM   951  O  OE1 . GLU A 1 124 ? -5.678  36.476  50.047 1.00 37.96 ? 460 GLU A OE1 1 
ATOM   952  O  OE2 . GLU A 1 124 ? -7.217  37.867  49.237 1.00 38.82 ? 460 GLU A OE2 1 
ATOM   953  N  N   . LEU A 1 125 ? -3.274  40.986  47.266 1.00 17.09 ? 461 LEU A N   1 
ATOM   954  C  CA  . LEU A 1 125 ? -3.806  42.324  47.419 1.00 17.09 ? 461 LEU A CA  1 
ATOM   955  C  C   . LEU A 1 125 ? -5.220  42.190  47.957 1.00 17.78 ? 461 LEU A C   1 
ATOM   956  O  O   . LEU A 1 125 ? -6.096  41.630  47.281 1.00 17.86 ? 461 LEU A O   1 
ATOM   957  C  CB  . LEU A 1 125 ? -3.834  43.068  46.084 1.00 17.94 ? 461 LEU A CB  1 
ATOM   958  C  CG  . LEU A 1 125 ? -4.576  44.419  46.040 1.00 18.83 ? 461 LEU A CG  1 
ATOM   959  C  CD1 . LEU A 1 125 ? -3.975  45.413  47.001 1.00 15.84 ? 461 LEU A CD1 1 
ATOM   960  C  CD2 . LEU A 1 125 ? -4.578  45.001  44.606 1.00 19.53 ? 461 LEU A CD2 1 
ATOM   961  N  N   . VAL A 1 126 ? -5.463  42.706  49.152 1.00 17.13 ? 462 VAL A N   1 
ATOM   962  C  CA  . VAL A 1 126 ? -6.810  42.634  49.753 1.00 18.47 ? 462 VAL A CA  1 
ATOM   963  C  C   . VAL A 1 126 ? -7.650  43.856  49.386 1.00 18.18 ? 462 VAL A C   1 
ATOM   964  O  O   . VAL A 1 126 ? -8.804  43.726  49.022 1.00 17.85 ? 462 VAL A O   1 
ATOM   965  C  CB  . VAL A 1 126 ? -6.735  42.556  51.285 1.00 18.75 ? 462 VAL A CB  1 
ATOM   966  C  CG1 . VAL A 1 126 ? -8.142  42.663  51.878 1.00 19.25 ? 462 VAL A CG1 1 
ATOM   967  C  CG2 . VAL A 1 126 ? -6.059  41.309  51.691 1.00 20.43 ? 462 VAL A CG2 1 
ATOM   968  N  N   . GLN A 1 127 ? -7.073  45.050  49.483 1.00 18.73 ? 463 GLN A N   1 
ATOM   969  C  CA  . GLN A 1 127 ? -7.788  46.247  49.021 1.00 19.59 ? 463 GLN A CA  1 
ATOM   970  C  C   . GLN A 1 127 ? -6.821  47.310  48.595 1.00 18.43 ? 463 GLN A C   1 
ATOM   971  O  O   . GLN A 1 127 ? -5.854  47.615  49.327 1.00 16.38 ? 463 GLN A O   1 
ATOM   972  C  CB  . GLN A 1 127 ? -8.660  46.838  50.125 1.00 20.85 ? 463 GLN A CB  1 
ATOM   973  C  CG  . GLN A 1 127 ? -9.896  47.543  49.550 1.00 26.78 ? 463 GLN A CG  1 
ATOM   974  C  CD  . GLN A 1 127 ? -10.426 48.592  50.458 1.00 32.55 ? 463 GLN A CD  1 
ATOM   975  O  OE1 . GLN A 1 127 ? -10.932 49.637  50.006 1.00 36.61 ? 463 GLN A OE1 1 
ATOM   976  N  NE2 . GLN A 1 127 ? -10.287 48.357  51.764 1.00 34.64 ? 463 GLN A NE2 1 
ATOM   977  N  N   . GLN A 1 128 ? -7.088  47.887  47.424 1.00 18.31 ? 464 GLN A N   1 
ATOM   978  C  CA  . GLN A 1 128 ? -6.385  49.081  46.985 1.00 19.63 ? 464 GLN A CA  1 
ATOM   979  C  C   . GLN A 1 128 ? -7.195  50.253  47.512 1.00 18.61 ? 464 GLN A C   1 
ATOM   980  O  O   . GLN A 1 128 ? -8.248  50.590  46.962 1.00 19.09 ? 464 GLN A O   1 
ATOM   981  C  CB  . GLN A 1 128 ? -6.232  49.133  45.450 1.00 21.06 ? 464 GLN A CB  1 
ATOM   982  C  CG  . GLN A 1 128 ? -5.269  50.194  44.928 1.00 21.81 ? 464 GLN A CG  1 
ATOM   983  C  CD  . GLN A 1 128 ? -3.810  49.813  45.040 1.00 23.38 ? 464 GLN A CD  1 
ATOM   984  O  OE1 . GLN A 1 128 ? -3.421  48.681  44.733 1.00 24.14 ? 464 GLN A OE1 1 
ATOM   985  N  NE2 . GLN A 1 128 ? -2.975  50.770  45.478 1.00 21.16 ? 464 GLN A NE2 1 
ATOM   986  N  N   . VAL A 1 129 ? -6.696  50.870  48.579 1.00 16.74 ? 465 VAL A N   1 
ATOM   987  C  CA  . VAL A 1 129 ? -7.381  52.005  49.225 1.00 15.89 ? 465 VAL A CA  1 
ATOM   988  C  C   . VAL A 1 129 ? -7.378  53.236  48.327 1.00 14.84 ? 465 VAL A C   1 
ATOM   989  O  O   . VAL A 1 129 ? -8.414  53.802  48.052 1.00 13.02 ? 465 VAL A O   1 
ATOM   990  C  CB  . VAL A 1 129 ? -6.733  52.334  50.582 1.00 15.88 ? 465 VAL A CB  1 
ATOM   991  C  CG1 . VAL A 1 129 ? -7.437  53.523  51.240 1.00 16.13 ? 465 VAL A CG1 1 
ATOM   992  C  CG2 . VAL A 1 129 ? -6.767  51.106  51.453 1.00 15.74 ? 465 VAL A CG2 1 
ATOM   993  N  N   . ASP A 1 130 ? -6.209  53.612  47.833 1.00 13.66 ? 466 ASP A N   1 
ATOM   994  C  CA  . ASP A 1 130 ? -6.088  54.669  46.856 1.00 13.83 ? 466 ASP A CA  1 
ATOM   995  C  C   . ASP A 1 130 ? -4.811  54.393  46.072 1.00 13.69 ? 466 ASP A C   1 
ATOM   996  O  O   . ASP A 1 130 ? -4.207  53.341  46.247 1.00 11.98 ? 466 ASP A O   1 
ATOM   997  C  CB  . ASP A 1 130 ? -6.064  56.035  47.547 1.00 15.03 ? 466 ASP A CB  1 
ATOM   998  C  CG  . ASP A 1 130 ? -4.980  56.137  48.627 1.00 16.76 ? 466 ASP A CG  1 
ATOM   999  O  OD1 . ASP A 1 130 ? -3.824  55.748  48.342 1.00 16.18 ? 466 ASP A OD1 1 
ATOM   1000 O  OD2 . ASP A 1 130 ? -5.293  56.561  49.756 1.00 19.69 ? 466 ASP A OD2 1 
ATOM   1001 N  N   . GLU A 1 131 ? -4.401  55.306  45.202 1.00 14.01 ? 467 GLU A N   1 
ATOM   1002 C  CA  . GLU A 1 131 ? -3.222  55.050  44.366 1.00 16.09 ? 467 GLU A CA  1 
ATOM   1003 C  C   . GLU A 1 131 ? -1.975  54.645  45.130 1.00 15.25 ? 467 GLU A C   1 
ATOM   1004 O  O   . GLU A 1 131 ? -1.119  53.956  44.599 1.00 16.04 ? 467 GLU A O   1 
ATOM   1005 C  CB  . GLU A 1 131 ? -2.859  56.277  43.530 1.00 16.45 ? 467 GLU A CB  1 
ATOM   1006 C  CG  . GLU A 1 131 ? -3.719  56.451  42.346 1.00 21.45 ? 467 GLU A CG  1 
ATOM   1007 C  CD  . GLU A 1 131 ? -3.682  57.903  41.882 1.00 28.80 ? 467 GLU A CD  1 
ATOM   1008 O  OE1 . GLU A 1 131 ? -2.853  58.213  40.985 1.00 29.14 ? 467 GLU A OE1 1 
ATOM   1009 O  OE2 . GLU A 1 131 ? -4.447  58.726  42.463 1.00 30.71 ? 467 GLU A OE2 1 
ATOM   1010 N  N   . ASP A 1 132 ? -1.849  55.133  46.347 1.00 14.86 ? 468 ASP A N   1 
ATOM   1011 C  CA  . ASP A 1 132 ? -0.594  55.034  47.064 1.00 16.46 ? 468 ASP A CA  1 
ATOM   1012 C  C   . ASP A 1 132 ? -0.708  54.250  48.374 1.00 15.77 ? 468 ASP A C   1 
ATOM   1013 O  O   . ASP A 1 132 ? 0.251   54.202  49.141 1.00 14.75 ? 468 ASP A O   1 
ATOM   1014 C  CB  . ASP A 1 132 ? -0.107  56.445  47.332 1.00 16.14 ? 468 ASP A CB  1 
ATOM   1015 C  CG  . ASP A 1 132 ? 0.295   57.137  46.054 1.00 20.41 ? 468 ASP A CG  1 
ATOM   1016 O  OD1 . ASP A 1 132 ? 1.055   56.519  45.233 1.00 20.85 ? 468 ASP A OD1 1 
ATOM   1017 O  OD2 . ASP A 1 132 ? -0.144  58.289  45.886 1.00 20.77 ? 468 ASP A OD2 1 
ATOM   1018 N  N   . ASP A 1 133 ? -1.863  53.638  48.605 1.00 14.28 ? 469 ASP A N   1 
ATOM   1019 C  CA  . ASP A 1 133 ? -2.094  52.863  49.817 1.00 14.96 ? 469 ASP A CA  1 
ATOM   1020 C  C   . ASP A 1 133 ? -2.892  51.597  49.509 1.00 14.33 ? 469 ASP A C   1 
ATOM   1021 O  O   . ASP A 1 133 ? -3.883  51.635  48.786 1.00 14.29 ? 469 ASP A O   1 
ATOM   1022 C  CB  . ASP A 1 133 ? -2.806  53.722  50.898 1.00 15.48 ? 469 ASP A CB  1 
ATOM   1023 C  CG  . ASP A 1 133 ? -2.103  55.065  51.135 1.00 18.25 ? 469 ASP A CG  1 
ATOM   1024 O  OD1 . ASP A 1 133 ? -1.250  55.157  52.026 1.00 22.61 ? 469 ASP A OD1 1 
ATOM   1025 O  OD2 . ASP A 1 133 ? -2.364  56.030  50.417 1.00 21.26 ? 469 ASP A OD2 1 
ATOM   1026 N  N   . ALA A 1 134 ? -2.442  50.473  50.055 1.00 13.95 ? 470 ALA A N   1 
ATOM   1027 C  CA  . ALA A 1 134 ? -3.087  49.199  49.786 1.00 15.18 ? 470 ALA A CA  1 
ATOM   1028 C  C   . ALA A 1 134 ? -2.867  48.285  50.971 1.00 14.61 ? 470 ALA A C   1 
ATOM   1029 O  O   . ALA A 1 134 ? -1.855  48.401  51.684 1.00 14.67 ? 470 ALA A O   1 
ATOM   1030 C  CB  . ALA A 1 134 ? -2.542  48.537  48.504 1.00 15.46 ? 470 ALA A CB  1 
ATOM   1031 N  N   . ILE A 1 135 ? -3.823  47.387  51.176 1.00 14.22 ? 471 ILE A N   1 
ATOM   1032 C  CA  . ILE A 1 135 ? -3.750  46.380  52.225 1.00 13.96 ? 471 ILE A CA  1 
ATOM   1033 C  C   . ILE A 1 135 ? -3.494  45.015  51.608 1.00 13.30 ? 471 ILE A C   1 
ATOM   1034 O  O   . ILE A 1 135 ? -4.144  44.643  50.625 1.00 11.15 ? 471 ILE A O   1 
ATOM   1035 C  CB  . ILE A 1 135 ? -5.069  46.315  53.030 1.00 14.44 ? 471 ILE A CB  1 
ATOM   1036 C  CG1 . ILE A 1 135 ? -5.354  47.669  53.663 1.00 15.50 ? 471 ILE A CG1 1 
ATOM   1037 C  CG2 . ILE A 1 135 ? -4.960  45.220  54.136 1.00 14.91 ? 471 ILE A CG2 1 
ATOM   1038 C  CD1 . ILE A 1 135 ? -6.749  47.825  54.259 1.00 15.80 ? 471 ILE A CD1 1 
ATOM   1039 N  N   . TYR A 1 136 ? -2.537  44.290  52.172 1.00 12.68 ? 472 TYR A N   1 
ATOM   1040 C  CA  . TYR A 1 136 ? -2.126  43.037  51.677 1.00 13.33 ? 472 TYR A CA  1 
ATOM   1041 C  C   . TYR A 1 136 ? -2.213  41.953  52.739 1.00 13.79 ? 472 TYR A C   1 
ATOM   1042 O  O   . TYR A 1 136 ? -1.989  42.241  53.914 1.00 15.02 ? 472 TYR A O   1 
ATOM   1043 C  CB  . TYR A 1 136 ? -0.659  43.081  51.234 1.00 13.56 ? 472 TYR A CB  1 
ATOM   1044 C  CG  . TYR A 1 136 ? -0.362  44.002  50.102 1.00 14.31 ? 472 TYR A CG  1 
ATOM   1045 C  CD1 . TYR A 1 136 ? -0.550  43.603  48.793 1.00 15.60 ? 472 TYR A CD1 1 
ATOM   1046 C  CD2 . TYR A 1 136 ? 0.131   45.274  50.346 1.00 15.38 ? 472 TYR A CD2 1 
ATOM   1047 C  CE1 . TYR A 1 136 ? -0.276  44.461  47.751 1.00 16.35 ? 472 TYR A CE1 1 
ATOM   1048 C  CE2 . TYR A 1 136 ? 0.416   46.133  49.343 1.00 17.26 ? 472 TYR A CE2 1 
ATOM   1049 C  CZ  . TYR A 1 136 ? 0.197   45.750  48.041 1.00 18.00 ? 472 TYR A CZ  1 
ATOM   1050 O  OH  . TYR A 1 136 ? 0.512   46.619  47.040 1.00 18.39 ? 472 TYR A OH  1 
ATOM   1051 N  N   . HIS A 1 137 ? -2.440  40.712  52.290 1.00 13.38 ? 473 HIS A N   1 
ATOM   1052 C  CA  . HIS A 1 137 ? -2.300  39.502  53.122 1.00 14.63 ? 473 HIS A CA  1 
ATOM   1053 C  C   . HIS A 1 137 ? -1.037  38.781  52.703 1.00 14.01 ? 473 HIS A C   1 
ATOM   1054 O  O   . HIS A 1 137 ? -0.907  38.415  51.545 1.00 15.47 ? 473 HIS A O   1 
ATOM   1055 C  CB  . HIS A 1 137 ? -3.479  38.558  52.932 1.00 14.78 ? 473 HIS A CB  1 
ATOM   1056 C  CG  . HIS A 1 137 ? -3.441  37.383  53.854 1.00 20.68 ? 473 HIS A CG  1 
ATOM   1057 N  ND1 . HIS A 1 137 ? -3.362  36.084  53.403 1.00 27.62 ? 473 HIS A ND1 1 
ATOM   1058 C  CD2 . HIS A 1 137 ? -3.420  37.311  55.208 1.00 23.57 ? 473 HIS A CD2 1 
ATOM   1059 C  CE1 . HIS A 1 137 ? -3.334  35.257  54.436 1.00 27.20 ? 473 HIS A CE1 1 
ATOM   1060 N  NE2 . HIS A 1 137 ? -3.369  35.976  55.543 1.00 26.74 ? 473 HIS A NE2 1 
ATOM   1061 N  N   . VAL A 1 138 ? -0.092  38.651  53.619 1.00 13.31 ? 474 VAL A N   1 
ATOM   1062 C  CA  . VAL A 1 138 ? 1.211   38.114  53.338 1.00 14.39 ? 474 VAL A CA  1 
ATOM   1063 C  C   . VAL A 1 138 ? 1.314   36.824  54.139 1.00 15.40 ? 474 VAL A C   1 
ATOM   1064 O  O   . VAL A 1 138 ? 0.845   36.780  55.292 1.00 15.48 ? 474 VAL A O   1 
ATOM   1065 C  CB  . VAL A 1 138 ? 2.328   39.086  53.763 1.00 14.70 ? 474 VAL A CB  1 
ATOM   1066 C  CG1 . VAL A 1 138 ? 3.793   38.452  53.571 1.00 17.06 ? 474 VAL A CG1 1 
ATOM   1067 C  CG2 . VAL A 1 138 ? 2.192   40.453  53.038 1.00 12.81 ? 474 VAL A CG2 1 
ATOM   1068 N  N   . THR A 1 139 ? 1.871   35.776  53.538 1.00 15.50 ? 475 THR A N   1 
ATOM   1069 C  CA  . THR A 1 139 ? 2.270   34.596  54.298 1.00 16.90 ? 475 THR A CA  1 
ATOM   1070 C  C   . THR A 1 139 ? 3.806   34.495  54.270 1.00 18.47 ? 475 THR A C   1 
ATOM   1071 O  O   . THR A 1 139 ? 4.477   34.963  53.326 1.00 19.06 ? 475 THR A O   1 
ATOM   1072 C  CB  . THR A 1 139 ? 1.641   33.291  53.791 1.00 16.95 ? 475 THR A CB  1 
ATOM   1073 O  OG1 . THR A 1 139 ? 2.260   32.916  52.547 1.00 18.02 ? 475 THR A OG1 1 
ATOM   1074 C  CG2 . THR A 1 139 ? 0.158   33.418  53.622 1.00 15.43 ? 475 THR A CG2 1 
ATOM   1075 N  N   . SER A 1 140 ? 4.357   33.890  55.316 1.00 18.83 ? 476 SER A N   1 
ATOM   1076 C  CA  . SER A 1 140 ? 5.802   33.817  55.509 1.00 19.70 ? 476 SER A CA  1 
ATOM   1077 C  C   . SER A 1 140 ? 6.130   32.394  55.952 1.00 19.96 ? 476 SER A C   1 
ATOM   1078 O  O   . SER A 1 140 ? 5.374   31.821  56.731 1.00 19.86 ? 476 SER A O   1 
ATOM   1079 C  CB  . SER A 1 140 ? 6.243   34.828  56.562 1.00 19.79 ? 476 SER A CB  1 
ATOM   1080 O  OG  . SER A 1 140 ? 7.649   34.988  56.588 1.00 22.80 ? 476 SER A OG  1 
ATOM   1081 N  N   . PRO A 1 141 ? 7.236   31.810  55.446 1.00 19.95 ? 477 PRO A N   1 
ATOM   1082 C  CA  . PRO A 1 141 ? 7.584   30.434  55.804 1.00 20.08 ? 477 PRO A CA  1 
ATOM   1083 C  C   . PRO A 1 141 ? 7.913   30.268  57.288 1.00 19.06 ? 477 PRO A C   1 
ATOM   1084 O  O   . PRO A 1 141 ? 8.424   31.198  57.907 1.00 19.03 ? 477 PRO A O   1 
ATOM   1085 C  CB  . PRO A 1 141 ? 8.860   30.155  54.968 1.00 20.31 ? 477 PRO A CB  1 
ATOM   1086 C  CG  . PRO A 1 141 ? 8.942   31.237  53.989 1.00 20.76 ? 477 PRO A CG  1 
ATOM   1087 C  CD  . PRO A 1 141 ? 8.317   32.428  54.668 1.00 20.00 ? 477 PRO A CD  1 
ATOM   1088 N  N   . ALA A 1 142 ? 7.614   29.093  57.848 1.00 18.36 ? 478 ALA A N   1 
ATOM   1089 C  CA  . ALA A 1 142 ? 7.927   28.805  59.248 1.00 17.48 ? 478 ALA A CA  1 
ATOM   1090 C  C   . ALA A 1 142 ? 9.403   29.038  59.508 1.00 17.70 ? 478 ALA A C   1 
ATOM   1091 O  O   . ALA A 1 142 ? 10.254  28.520  58.818 1.00 17.78 ? 478 ALA A O   1 
ATOM   1092 C  CB  . ALA A 1 142 ? 7.545   27.381  59.628 1.00 17.12 ? 478 ALA A CB  1 
ATOM   1093 N  N   . LEU A 1 143 ? 9.706   29.817  60.519 1.00 17.34 ? 479 LEU A N   1 
ATOM   1094 C  CA  . LEU A 1 143 ? 11.077  29.929  60.950 1.00 17.82 ? 479 LEU A CA  1 
ATOM   1095 C  C   . LEU A 1 143 ? 11.398  28.749  61.886 1.00 17.67 ? 479 LEU A C   1 
ATOM   1096 O  O   . LEU A 1 143 ? 10.507  27.964  62.232 1.00 17.03 ? 479 LEU A O   1 
ATOM   1097 C  CB  . LEU A 1 143 ? 11.272  31.265  61.659 1.00 17.96 ? 479 LEU A CB  1 
ATOM   1098 C  CG  . LEU A 1 143 ? 11.078  32.487  60.736 1.00 18.36 ? 479 LEU A CG  1 
ATOM   1099 C  CD1 . LEU A 1 143 ? 11.135  33.734  61.545 1.00 19.90 ? 479 LEU A CD1 1 
ATOM   1100 C  CD2 . LEU A 1 143 ? 12.133  32.522  59.633 1.00 20.86 ? 479 LEU A CD2 1 
ATOM   1101 N  N   . GLY A 1 144 ? 12.664  28.643  62.290 1.00 16.82 ? 480 GLY A N   1 
ATOM   1102 C  CA  . GLY A 1 144 ? 13.107  27.580  63.194 1.00 16.90 ? 480 GLY A CA  1 
ATOM   1103 C  C   . GLY A 1 144 ? 12.189  27.460  64.395 1.00 16.99 ? 480 GLY A C   1 
ATOM   1104 O  O   . GLY A 1 144 ? 11.802  28.489  64.999 1.00 16.78 ? 480 GLY A O   1 
ATOM   1105 N  N   . GLY A 1 145 ? 11.830  26.217  64.729 1.00 15.56 ? 481 GLY A N   1 
ATOM   1106 C  CA  . GLY A 1 145 ? 10.991  25.934  65.886 1.00 16.18 ? 481 GLY A CA  1 
ATOM   1107 C  C   . GLY A 1 145 ? 9.489   25.952  65.609 1.00 16.05 ? 481 GLY A C   1 
ATOM   1108 O  O   . GLY A 1 145 ? 8.695   25.768  66.522 1.00 16.18 ? 481 GLY A O   1 
ATOM   1109 N  N   . HIS A 1 146 ? 9.098   26.194  64.363 1.00 16.14 ? 482 HIS A N   1 
ATOM   1110 C  CA  . HIS A 1 146 ? 7.697   26.207  63.988 1.00 16.62 ? 482 HIS A CA  1 
ATOM   1111 C  C   . HIS A 1 146 ? 7.430   25.288  62.794 1.00 17.30 ? 482 HIS A C   1 
ATOM   1112 O  O   . HIS A 1 146 ? 8.337   24.967  62.001 1.00 16.15 ? 482 HIS A O   1 
ATOM   1113 C  CB  . HIS A 1 146 ? 7.251   27.641  63.697 1.00 16.76 ? 482 HIS A CB  1 
ATOM   1114 C  CG  . HIS A 1 146 ? 7.264   28.526  64.907 1.00 17.01 ? 482 HIS A CG  1 
ATOM   1115 N  ND1 . HIS A 1 146 ? 6.302   28.449  65.888 1.00 16.47 ? 482 HIS A ND1 1 
ATOM   1116 C  CD2 . HIS A 1 146 ? 8.154   29.467  65.321 1.00 19.01 ? 482 HIS A CD2 1 
ATOM   1117 C  CE1 . HIS A 1 146 ? 6.583   29.317  66.845 1.00 20.05 ? 482 HIS A CE1 1 
ATOM   1118 N  NE2 . HIS A 1 146 ? 7.699   29.953  66.522 1.00 20.22 ? 482 HIS A NE2 1 
ATOM   1119 N  N   . THR A 1 147 ? 6.179   24.837  62.720 1.00 17.81 ? 483 THR A N   1 
ATOM   1120 C  CA  . THR A 1 147 ? 5.710   23.926  61.694 1.00 18.68 ? 483 THR A CA  1 
ATOM   1121 C  C   . THR A 1 147 ? 4.606   24.554  60.856 1.00 19.78 ? 483 THR A C   1 
ATOM   1122 O  O   . THR A 1 147 ? 4.185   23.967  59.859 1.00 20.84 ? 483 THR A O   1 
ATOM   1123 C  CB  . THR A 1 147 ? 5.134   22.645  62.339 1.00 19.17 ? 483 THR A CB  1 
ATOM   1124 O  OG1 . THR A 1 147 ? 4.205   23.009  63.372 1.00 19.39 ? 483 THR A OG1 1 
ATOM   1125 C  CG2 . THR A 1 147 ? 6.253   21.795  62.983 1.00 16.60 ? 483 THR A CG2 1 
ATOM   1126 N  N   . LYS A 1 148 ? 4.099   25.702  61.282 1.00 20.12 ? 484 LYS A N   1 
ATOM   1127 C  CA  . LYS A 1 148 ? 3.034   26.417  60.575 1.00 20.94 ? 484 LYS A CA  1 
ATOM   1128 C  C   . LYS A 1 148 ? 3.648   27.682  60.039 1.00 20.02 ? 484 LYS A C   1 
ATOM   1129 O  O   . LYS A 1 148 ? 4.406   28.324  60.750 1.00 19.16 ? 484 LYS A O   1 
ATOM   1130 C  CB  . LYS A 1 148 ? 1.951   26.850  61.555 1.00 21.56 ? 484 LYS A CB  1 
ATOM   1131 C  CG  . LYS A 1 148 ? 0.862   25.891  61.703 1.00 26.01 ? 484 LYS A CG  1 
ATOM   1132 C  CD  . LYS A 1 148 ? -0.183  26.488  62.611 1.00 30.37 ? 484 LYS A CD  1 
ATOM   1133 C  CE  . LYS A 1 148 ? -1.100  25.434  63.139 1.00 31.17 ? 484 LYS A CE  1 
ATOM   1134 N  NZ  . LYS A 1 148 ? -1.997  26.062  64.134 1.00 33.93 ? 484 LYS A NZ  1 
ATOM   1135 N  N   . PRO A 1 149 ? 3.312   28.067  58.803 1.00 19.61 ? 485 PRO A N   1 
ATOM   1136 C  CA  . PRO A 1 149 ? 3.802   29.375  58.376 1.00 19.72 ? 485 PRO A CA  1 
ATOM   1137 C  C   . PRO A 1 149 ? 3.106   30.510  59.155 1.00 18.87 ? 485 PRO A C   1 
ATOM   1138 O  O   . PRO A 1 149 ? 2.125   30.265  59.895 1.00 18.40 ? 485 PRO A O   1 
ATOM   1139 C  CB  . PRO A 1 149 ? 3.475   29.427  56.876 1.00 20.01 ? 485 PRO A CB  1 
ATOM   1140 C  CG  . PRO A 1 149 ? 2.674   28.186  56.577 1.00 20.74 ? 485 PRO A CG  1 
ATOM   1141 C  CD  . PRO A 1 149 ? 2.438   27.419  57.813 1.00 20.01 ? 485 PRO A CD  1 
ATOM   1142 N  N   . GLN A 1 150 ? 3.645   31.716  59.028 1.00 18.35 ? 486 GLN A N   1 
ATOM   1143 C  CA  . GLN A 1 150 ? 3.052   32.907  59.642 1.00 18.78 ? 486 GLN A CA  1 
ATOM   1144 C  C   . GLN A 1 150 ? 2.272   33.626  58.556 1.00 18.46 ? 486 GLN A C   1 
ATOM   1145 O  O   . GLN A 1 150 ? 2.573   33.442  57.367 1.00 17.83 ? 486 GLN A O   1 
ATOM   1146 C  CB  . GLN A 1 150 ? 4.112   33.870  60.150 1.00 19.94 ? 486 GLN A CB  1 
ATOM   1147 C  CG  . GLN A 1 150 ? 4.507   33.703  61.581 1.00 24.95 ? 486 GLN A CG  1 
ATOM   1148 C  CD  . GLN A 1 150 ? 5.423   34.797  62.042 1.00 25.42 ? 486 GLN A CD  1 
ATOM   1149 O  OE1 . GLN A 1 150 ? 6.517   34.977  61.496 1.00 27.90 ? 486 GLN A OE1 1 
ATOM   1150 N  NE2 . GLN A 1 150 ? 4.990   35.542  63.042 1.00 25.86 ? 486 GLN A NE2 1 
ATOM   1151 N  N   . ASP A 1 151 ? 1.263   34.414  58.954 1.00 16.98 ? 487 ASP A N   1 
ATOM   1152 C  CA  . ASP A 1 151 ? 0.659   35.380  58.061 1.00 16.14 ? 487 ASP A CA  1 
ATOM   1153 C  C   . ASP A 1 151 ? 0.541   36.731  58.760 1.00 15.97 ? 487 ASP A C   1 
ATOM   1154 O  O   . ASP A 1 151 ? 0.672   36.845  60.002 1.00 15.73 ? 487 ASP A O   1 
ATOM   1155 C  CB  . ASP A 1 151 ? -0.678  34.915  57.473 1.00 15.96 ? 487 ASP A CB  1 
ATOM   1156 C  CG  . ASP A 1 151 ? -1.817  34.951  58.479 1.00 16.32 ? 487 ASP A CG  1 
ATOM   1157 O  OD1 . ASP A 1 151 ? -1.538  34.892  59.703 1.00 15.27 ? 487 ASP A OD1 1 
ATOM   1158 O  OD2 . ASP A 1 151 ? -2.990  35.039  58.041 1.00 17.60 ? 487 ASP A OD2 1 
ATOM   1159 N  N   . PHE A 1 152 ? 0.336   37.735  57.923 1.00 15.81 ? 488 PHE A N   1 
ATOM   1160 C  CA  . PHE A 1 152 ? 0.232   39.137  58.294 1.00 15.56 ? 488 PHE A CA  1 
ATOM   1161 C  C   . PHE A 1 152 ? -0.819  39.840  57.382 1.00 15.29 ? 488 PHE A C   1 
ATOM   1162 O  O   . PHE A 1 152 ? -1.032  39.446  56.235 1.00 14.65 ? 488 PHE A O   1 
ATOM   1163 C  CB  . PHE A 1 152 ? 1.559   39.872  58.095 1.00 15.80 ? 488 PHE A CB  1 
ATOM   1164 C  CG  . PHE A 1 152 ? 2.749   39.295  58.864 1.00 16.12 ? 488 PHE A CG  1 
ATOM   1165 C  CD1 . PHE A 1 152 ? 3.184   39.889  60.027 1.00 16.86 ? 488 PHE A CD1 1 
ATOM   1166 C  CD2 . PHE A 1 152 ? 3.437   38.179  58.391 1.00 18.17 ? 488 PHE A CD2 1 
ATOM   1167 C  CE1 . PHE A 1 152 ? 4.296   39.364  60.738 1.00 15.81 ? 488 PHE A CE1 1 
ATOM   1168 C  CE2 . PHE A 1 152 ? 4.524   37.656  59.082 1.00 17.46 ? 488 PHE A CE2 1 
ATOM   1169 C  CZ  . PHE A 1 152 ? 4.929   38.244  60.279 1.00 15.23 ? 488 PHE A CZ  1 
ATOM   1170 N  N   . VAL A 1 153 ? -1.432  40.899  57.923 1.00 14.11 ? 489 VAL A N   1 
ATOM   1171 C  CA  . VAL A 1 153 ? -2.319  41.762  57.222 1.00 14.31 ? 489 VAL A CA  1 
ATOM   1172 C  C   . VAL A 1 153 ? -1.726  43.150  57.368 1.00 15.13 ? 489 VAL A C   1 
ATOM   1173 O  O   . VAL A 1 153 ? -1.632  43.687  58.487 1.00 14.81 ? 489 VAL A O   1 
ATOM   1174 C  CB  . VAL A 1 153 ? -3.710  41.709  57.775 1.00 14.80 ? 489 VAL A CB  1 
ATOM   1175 C  CG1 . VAL A 1 153 ? -4.613  42.718  56.982 1.00 15.28 ? 489 VAL A CG1 1 
ATOM   1176 C  CG2 . VAL A 1 153 ? -4.235  40.274  57.658 1.00 16.13 ? 489 VAL A CG2 1 
ATOM   1177 N  N   . ILE A 1 154 ? -1.291  43.713  56.236 1.00 15.01 ? 490 ILE A N   1 
ATOM   1178 C  CA  . ILE A 1 154 ? -0.407  44.880  56.243 1.00 15.58 ? 490 ILE A CA  1 
ATOM   1179 C  C   . ILE A 1 154 ? -0.971  46.025  55.374 1.00 14.73 ? 490 ILE A C   1 
ATOM   1180 O  O   . ILE A 1 154 ? -1.402  45.818  54.222 1.00 14.22 ? 490 ILE A O   1 
ATOM   1181 C  CB  . ILE A 1 154 ? 0.993   44.449  55.770 1.00 17.00 ? 490 ILE A CB  1 
ATOM   1182 C  CG1 . ILE A 1 154 ? 1.678   43.611  56.871 1.00 19.97 ? 490 ILE A CG1 1 
ATOM   1183 C  CG2 . ILE A 1 154 ? 1.900   45.655  55.437 1.00 17.59 ? 490 ILE A CG2 1 
ATOM   1184 C  CD1 . ILE A 1 154 ? 2.706   42.765  56.314 1.00 20.08 ? 490 ILE A CD1 1 
ATOM   1185 N  N   . LEU A 1 155 ? -0.978  47.219  55.955 1.00 13.75 ? 491 LEU A N   1 
ATOM   1186 C  CA  . LEU A 1 155 ? -1.238  48.441  55.226 1.00 13.65 ? 491 LEU A CA  1 
ATOM   1187 C  C   . LEU A 1 155 ? 0.117   48.925  54.676 1.00 12.84 ? 491 LEU A C   1 
ATOM   1188 O  O   . LEU A 1 155 ? 1.051   49.125  55.434 1.00 13.84 ? 491 LEU A O   1 
ATOM   1189 C  CB  . LEU A 1 155 ? -1.829  49.499  56.149 1.00 12.43 ? 491 LEU A CB  1 
ATOM   1190 C  CG  . LEU A 1 155 ? -2.064  50.895  55.560 1.00 13.65 ? 491 LEU A CG  1 
ATOM   1191 C  CD1 . LEU A 1 155 ? -3.052  50.879  54.364 1.00 8.35  ? 491 LEU A CD1 1 
ATOM   1192 C  CD2 . LEU A 1 155 ? -2.542  51.839  56.643 1.00 14.07 ? 491 LEU A CD2 1 
ATOM   1193 N  N   . ALA A 1 156 ? 0.205   49.146  53.385 1.00 11.81 ? 492 ALA A N   1 
ATOM   1194 C  CA  . ALA A 1 156 ? 1.432   49.708  52.778 1.00 12.53 ? 492 ALA A CA  1 
ATOM   1195 C  C   . ALA A 1 156 ? 1.034   51.096  52.255 1.00 12.85 ? 492 ALA A C   1 
ATOM   1196 O  O   . ALA A 1 156 ? 0.036   51.243  51.523 1.00 14.18 ? 492 ALA A O   1 
ATOM   1197 C  CB  . ALA A 1 156 ? 1.975   48.800  51.622 1.00 9.86  ? 492 ALA A CB  1 
ATOM   1198 N  N   . SER A 1 157 ? 1.769   52.114  52.673 1.00 12.24 ? 493 SER A N   1 
ATOM   1199 C  CA  . SER A 1 157 ? 1.511   53.499  52.291 1.00 11.36 ? 493 SER A CA  1 
ATOM   1200 C  C   . SER A 1 157 ? 2.773   54.055  51.670 1.00 11.81 ? 493 SER A C   1 
ATOM   1201 O  O   . SER A 1 157 ? 3.839   54.043  52.316 1.00 11.33 ? 493 SER A O   1 
ATOM   1202 C  CB  . SER A 1 157 ? 1.124   54.286  53.529 1.00 11.92 ? 493 SER A CB  1 
ATOM   1203 O  OG  . SER A 1 157 ? -0.019  53.680  54.147 1.00 11.54 ? 493 SER A OG  1 
ATOM   1204 N  N   . ARG A 1 158 ? 2.705   54.491  50.418 1.00 11.62 ? 494 ARG A N   1 
ATOM   1205 C  CA  . ARG A 1 158 ? 3.927   54.997  49.766 1.00 12.74 ? 494 ARG A CA  1 
ATOM   1206 C  C   . ARG A 1 158 ? 3.775   56.480  49.524 1.00 12.93 ? 494 ARG A C   1 
ATOM   1207 O  O   . ARG A 1 158 ? 2.680   56.955  49.129 1.00 12.58 ? 494 ARG A O   1 
ATOM   1208 C  CB  . ARG A 1 158 ? 4.209   54.254  48.456 1.00 11.83 ? 494 ARG A CB  1 
ATOM   1209 C  CG  . ARG A 1 158 ? 3.200   54.552  47.325 1.00 12.08 ? 494 ARG A CG  1 
ATOM   1210 C  CD  . ARG A 1 158 ? 3.513   53.775  46.116 1.00 12.46 ? 494 ARG A CD  1 
ATOM   1211 N  NE  . ARG A 1 158 ? 2.685   54.176  45.005 1.00 15.42 ? 494 ARG A NE  1 
ATOM   1212 C  CZ  . ARG A 1 158 ? 2.720   53.619  43.791 1.00 16.00 ? 494 ARG A CZ  1 
ATOM   1213 N  NH1 . ARG A 1 158 ? 3.484   52.574  43.548 1.00 15.65 ? 494 ARG A NH1 1 
ATOM   1214 N  NH2 . ARG A 1 158 ? 1.930   54.082  42.837 1.00 16.19 ? 494 ARG A NH2 1 
ATOM   1215 N  N   . ARG A 1 159 ? 4.867   57.201  49.728 1.00 12.80 ? 495 ARG A N   1 
ATOM   1216 C  CA  . ARG A 1 159 ? 4.933   58.653  49.460 1.00 13.69 ? 495 ARG A CA  1 
ATOM   1217 C  C   . ARG A 1 159 ? 6.241   59.073  48.814 1.00 14.73 ? 495 ARG A C   1 
ATOM   1218 O  O   . ARG A 1 159 ? 7.345   58.620  49.180 1.00 13.18 ? 495 ARG A O   1 
ATOM   1219 C  CB  . ARG A 1 159 ? 4.778   59.478  50.741 1.00 13.91 ? 495 ARG A CB  1 
ATOM   1220 C  CG  . ARG A 1 159 ? 3.529   59.222  51.527 1.00 15.07 ? 495 ARG A CG  1 
ATOM   1221 C  CD  . ARG A 1 159 ? 2.315   59.765  50.850 1.00 17.38 ? 495 ARG A CD  1 
ATOM   1222 N  NE  . ARG A 1 159 ? 1.099   59.531  51.652 1.00 17.48 ? 495 ARG A NE  1 
ATOM   1223 C  CZ  . ARG A 1 159 ? 0.380   58.410  51.670 1.00 21.07 ? 495 ARG A CZ  1 
ATOM   1224 N  NH1 . ARG A 1 159 ? 0.699   57.345  50.923 1.00 19.23 ? 495 ARG A NH1 1 
ATOM   1225 N  NH2 . ARG A 1 159 ? -0.689  58.351  52.461 1.00 23.50 ? 495 ARG A NH2 1 
ATOM   1226 N  N   . LYS A 1 160 ? 6.097   60.006  47.893 1.00 15.24 ? 496 LYS A N   1 
ATOM   1227 C  CA  . LYS A 1 160 ? 7.198   60.681  47.279 1.00 16.97 ? 496 LYS A CA  1 
ATOM   1228 C  C   . LYS A 1 160 ? 7.726   61.784  48.188 1.00 18.53 ? 496 LYS A C   1 
ATOM   1229 O  O   . LYS A 1 160 ? 7.039   62.244  49.088 1.00 18.33 ? 496 LYS A O   1 
ATOM   1230 C  CB  . LYS A 1 160 ? 6.771   61.272  45.935 1.00 17.36 ? 496 LYS A CB  1 
ATOM   1231 C  CG  . LYS A 1 160 ? 6.341   60.222  44.908 1.00 18.61 ? 496 LYS A CG  1 
ATOM   1232 C  CD  . LYS A 1 160 ? 5.881   60.923  43.661 1.00 23.20 ? 496 LYS A CD  1 
ATOM   1233 C  CE  . LYS A 1 160 ? 5.714   59.966  42.523 1.00 25.57 ? 496 LYS A CE  1 
ATOM   1234 N  NZ  . LYS A 1 160 ? 5.482   60.721  41.269 1.00 27.17 ? 496 LYS A NZ  1 
ATOM   1235 N  N   . PRO A 1 161 ? 8.964   62.219  47.946 1.00 19.61 ? 497 PRO A N   1 
ATOM   1236 C  CA  . PRO A 1 161 ? 9.561   63.240  48.799 1.00 21.62 ? 497 PRO A CA  1 
ATOM   1237 C  C   . PRO A 1 161 ? 8.877   64.602  48.682 1.00 23.79 ? 497 PRO A C   1 
ATOM   1238 O  O   . PRO A 1 161 ? 8.527   65.010  47.587 1.00 23.14 ? 497 PRO A O   1 
ATOM   1239 C  CB  . PRO A 1 161 ? 11.017  63.300  48.313 1.00 21.06 ? 497 PRO A CB  1 
ATOM   1240 C  CG  . PRO A 1 161 ? 11.017  62.724  46.968 1.00 20.14 ? 497 PRO A CG  1 
ATOM   1241 C  CD  . PRO A 1 161 ? 9.915   61.694  46.954 1.00 20.12 ? 497 PRO A CD  1 
ATOM   1242 N  N   . CYS A 1 162 ? 8.652   65.261  49.823 1.00 27.34 ? 498 CYS A N   1 
ATOM   1243 C  CA  . CYS A 1 162 ? 8.019   66.584  49.847 1.00 30.41 ? 498 CYS A CA  1 
ATOM   1244 C  C   . CYS A 1 162 ? 8.995   67.627  49.289 1.00 30.70 ? 498 CYS A C   1 
ATOM   1245 O  O   . CYS A 1 162 ? 8.603   68.438  48.462 1.00 32.31 ? 498 CYS A O   1 
ATOM   1246 C  CB  . CYS A 1 162 ? 7.555   66.971  51.264 1.00 30.66 ? 498 CYS A CB  1 
ATOM   1247 S  SG  . CYS A 1 162 ? 6.406   65.800  52.098 1.00 39.69 ? 498 CYS A SG  1 
ATOM   1248 N  N   . ASP A 1 163 ? 10.257  67.594  49.719 1.00 31.42 ? 499 ASP A N   1 
ATOM   1249 C  CA  . ASP A 1 163 ? 11.308  68.489  49.169 1.00 31.67 ? 499 ASP A CA  1 
ATOM   1250 C  C   . ASP A 1 163 ? 12.525  67.711  48.692 1.00 31.31 ? 499 ASP A C   1 
ATOM   1251 O  O   . ASP A 1 163 ? 12.592  66.499  48.825 1.00 31.01 ? 499 ASP A O   1 
ATOM   1252 C  CB  . ASP A 1 163 ? 11.829  69.489  50.217 1.00 32.07 ? 499 ASP A CB  1 
ATOM   1253 C  CG  . ASP A 1 163 ? 10.808  69.829  51.279 1.00 34.25 ? 499 ASP A CG  1 
ATOM   1254 O  OD1 . ASP A 1 163 ? 9.896   70.652  50.990 1.00 35.80 ? 499 ASP A OD1 1 
ATOM   1255 O  OD2 . ASP A 1 163 ? 10.945  69.283  52.409 1.00 37.59 ? 499 ASP A OD2 1 
ATOM   1256 N  N   . ASN A 1 164 ? 13.520  68.422  48.178 1.00 30.78 ? 500 ASN A N   1 
ATOM   1257 C  CA  . ASN A 1 164 ? 14.794  67.788  47.874 1.00 30.49 ? 500 ASN A CA  1 
ATOM   1258 C  C   . ASN A 1 164 ? 15.548  67.424  49.141 1.00 29.68 ? 500 ASN A C   1 
ATOM   1259 O  O   . ASN A 1 164 ? 15.437  68.097  50.157 1.00 29.92 ? 500 ASN A O   1 
ATOM   1260 C  CB  . ASN A 1 164 ? 15.610  68.680  46.934 1.00 31.55 ? 500 ASN A CB  1 
ATOM   1261 C  CG  . ASN A 1 164 ? 14.964  68.773  45.571 1.00 32.95 ? 500 ASN A CG  1 
ATOM   1262 O  OD1 . ASN A 1 164 ? 14.311  67.818  45.126 1.00 36.59 ? 500 ASN A OD1 1 
ATOM   1263 N  ND2 . ASN A 1 164 ? 15.091  69.914  44.923 1.00 36.31 ? 500 ASN A ND2 1 
ATOM   1264 N  N   . GLY A 1 165 ? 16.288  66.325  49.084 1.00 28.51 ? 501 GLY A N   1 
ATOM   1265 C  CA  . GLY A 1 165 ? 16.889  65.739  50.270 1.00 27.72 ? 501 GLY A CA  1 
ATOM   1266 C  C   . GLY A 1 165 ? 16.000  64.714  50.975 1.00 26.72 ? 501 GLY A C   1 
ATOM   1267 O  O   . GLY A 1 165 ? 16.524  63.821  51.613 1.00 27.43 ? 501 GLY A O   1 
ATOM   1268 N  N   . ASP A 1 166 ? 14.677  64.844  50.863 1.00 25.39 ? 502 ASP A N   1 
ATOM   1269 C  CA  . ASP A 1 166 ? 13.717  63.943  51.539 1.00 24.29 ? 502 ASP A CA  1 
ATOM   1270 C  C   . ASP A 1 166 ? 13.650  62.564  50.905 1.00 22.58 ? 502 ASP A C   1 
ATOM   1271 O  O   . ASP A 1 166 ? 13.793  62.425  49.697 1.00 21.90 ? 502 ASP A O   1 
ATOM   1272 C  CB  . ASP A 1 166 ? 12.287  64.492  51.477 1.00 24.36 ? 502 ASP A CB  1 
ATOM   1273 C  CG  . ASP A 1 166 ? 12.068  65.716  52.344 1.00 25.38 ? 502 ASP A CG  1 
ATOM   1274 O  OD1 . ASP A 1 166 ? 12.837  65.956  53.293 1.00 25.25 ? 502 ASP A OD1 1 
ATOM   1275 O  OD2 . ASP A 1 166 ? 11.074  66.422  52.071 1.00 28.04 ? 502 ASP A OD2 1 
ATOM   1276 N  N   . PRO A 1 167 ? 13.369  61.542  51.712 1.00 21.18 ? 503 PRO A N   1 
ATOM   1277 C  CA  . PRO A 1 167 ? 13.270  60.229  51.099 1.00 19.99 ? 503 PRO A CA  1 
ATOM   1278 C  C   . PRO A 1 167 ? 11.925  59.954  50.473 1.00 18.53 ? 503 PRO A C   1 
ATOM   1279 O  O   . PRO A 1 167 ? 10.916  60.591  50.817 1.00 18.46 ? 503 PRO A O   1 
ATOM   1280 C  CB  . PRO A 1 167 ? 13.506  59.278  52.270 1.00 19.93 ? 503 PRO A CB  1 
ATOM   1281 C  CG  . PRO A 1 167 ? 13.027  60.029  53.457 1.00 20.63 ? 503 PRO A CG  1 
ATOM   1282 C  CD  . PRO A 1 167 ? 13.323  61.475  53.183 1.00 21.15 ? 503 PRO A CD  1 
ATOM   1283 N  N   . TYR A 1 168 ? 11.928  59.005  49.542 1.00 16.72 ? 504 TYR A N   1 
ATOM   1284 C  CA  . TYR A 1 168 ? 10.726  58.264  49.201 1.00 15.50 ? 504 TYR A CA  1 
ATOM   1285 C  C   . TYR A 1 168 ? 10.462  57.309  50.367 1.00 14.15 ? 504 TYR A C   1 
ATOM   1286 O  O   . TYR A 1 168 ? 11.410  56.663  50.881 1.00 13.29 ? 504 TYR A O   1 
ATOM   1287 C  CB  . TYR A 1 168 ? 10.951  57.396  47.962 1.00 15.69 ? 504 TYR A CB  1 
ATOM   1288 C  CG  . TYR A 1 168 ? 11.077  58.095  46.650 1.00 14.54 ? 504 TYR A CG  1 
ATOM   1289 C  CD1 . TYR A 1 168 ? 9.985   58.187  45.782 1.00 15.12 ? 504 TYR A CD1 1 
ATOM   1290 C  CD2 . TYR A 1 168 ? 12.285  58.600  46.228 1.00 15.65 ? 504 TYR A CD2 1 
ATOM   1291 C  CE1 . TYR A 1 168 ? 10.092  58.819  44.570 1.00 14.50 ? 504 TYR A CE1 1 
ATOM   1292 C  CE2 . TYR A 1 168 ? 12.408  59.212  45.011 1.00 15.77 ? 504 TYR A CE2 1 
ATOM   1293 C  CZ  . TYR A 1 168 ? 11.299  59.332  44.189 1.00 19.00 ? 504 TYR A CZ  1 
ATOM   1294 O  OH  . TYR A 1 168 ? 11.383  59.941  42.959 1.00 22.34 ? 504 TYR A OH  1 
ATOM   1295 N  N   . VAL A 1 169 ? 9.212   57.176  50.761 1.00 12.57 ? 505 VAL A N   1 
ATOM   1296 C  CA  . VAL A 1 169 ? 8.851   56.344  51.907 1.00 12.95 ? 505 VAL A CA  1 
ATOM   1297 C  C   . VAL A 1 169 ? 7.820   55.284  51.522 1.00 13.15 ? 505 VAL A C   1 
ATOM   1298 O  O   . VAL A 1 169 ? 6.817   55.596  50.890 1.00 11.49 ? 505 VAL A O   1 
ATOM   1299 C  CB  . VAL A 1 169 ? 8.234   57.205  53.039 1.00 13.56 ? 505 VAL A CB  1 
ATOM   1300 C  CG1 . VAL A 1 169 ? 7.902   56.333  54.239 1.00 12.57 ? 505 VAL A CG1 1 
ATOM   1301 C  CG2 . VAL A 1 169 ? 9.220   58.357  53.419 1.00 13.97 ? 505 VAL A CG2 1 
ATOM   1302 N  N   . ILE A 1 170 ? 8.094   54.036  51.889 1.00 13.16 ? 506 ILE A N   1 
ATOM   1303 C  CA  . ILE A 1 170 ? 7.162   52.936  51.736 1.00 13.27 ? 506 ILE A CA  1 
ATOM   1304 C  C   . ILE A 1 170 ? 6.940   52.355  53.146 1.00 13.72 ? 506 ILE A C   1 
ATOM   1305 O  O   . ILE A 1 170 ? 7.750   51.597  53.654 1.00 13.06 ? 506 ILE A O   1 
ATOM   1306 C  CB  . ILE A 1 170 ? 7.719   51.867  50.738 1.00 12.53 ? 506 ILE A CB  1 
ATOM   1307 C  CG1 . ILE A 1 170 ? 8.081   52.532  49.413 1.00 13.35 ? 506 ILE A CG1 1 
ATOM   1308 C  CG2 . ILE A 1 170 ? 6.708   50.735  50.549 1.00 14.12 ? 506 ILE A CG2 1 
ATOM   1309 C  CD1 . ILE A 1 170 ? 8.747   51.669  48.396 1.00 14.04 ? 506 ILE A CD1 1 
ATOM   1310 N  N   . ALA A 1 171 ? 5.852   52.762  53.780 1.00 13.73 ? 507 ALA A N   1 
ATOM   1311 C  CA  . ALA A 1 171 ? 5.589   52.415  55.170 1.00 13.58 ? 507 ALA A CA  1 
ATOM   1312 C  C   . ALA A 1 171 ? 4.670   51.192  55.260 1.00 13.70 ? 507 ALA A C   1 
ATOM   1313 O  O   . ALA A 1 171 ? 3.663   51.100  54.530 1.00 13.00 ? 507 ALA A O   1 
ATOM   1314 C  CB  . ALA A 1 171 ? 4.957   53.607  55.893 1.00 12.60 ? 507 ALA A CB  1 
ATOM   1315 N  N   . LEU A 1 172 ? 5.015   50.268  56.158 1.00 13.54 ? 508 LEU A N   1 
ATOM   1316 C  CA  . LEU A 1 172 ? 4.212   49.084  56.398 1.00 14.88 ? 508 LEU A CA  1 
ATOM   1317 C  C   . LEU A 1 172 ? 3.857   49.018  57.863 1.00 15.38 ? 508 LEU A C   1 
ATOM   1318 O  O   . LEU A 1 172 ? 4.711   49.305  58.732 1.00 16.09 ? 508 LEU A O   1 
ATOM   1319 C  CB  . LEU A 1 172 ? 4.953   47.825  56.020 1.00 14.60 ? 508 LEU A CB  1 
ATOM   1320 C  CG  . LEU A 1 172 ? 5.630   47.806  54.660 1.00 16.06 ? 508 LEU A CG  1 
ATOM   1321 C  CD1 . LEU A 1 172 ? 6.525   46.567  54.583 1.00 16.46 ? 508 LEU A CD1 1 
ATOM   1322 C  CD2 . LEU A 1 172 ? 4.558   47.898  53.532 1.00 11.42 ? 508 LEU A CD2 1 
ATOM   1323 N  N   . ARG A 1 173 ? 2.607   48.681  58.139 1.00 14.69 ? 509 ARG A N   1 
ATOM   1324 C  CA  . ARG A 1 173 ? 2.161   48.440  59.516 1.00 15.16 ? 509 ARG A CA  1 
ATOM   1325 C  C   . ARG A 1 173 ? 0.975   47.486  59.500 1.00 15.09 ? 509 ARG A C   1 
ATOM   1326 O  O   . ARG A 1 173 ? 0.165   47.499  58.599 1.00 15.06 ? 509 ARG A O   1 
ATOM   1327 C  CB  . ARG A 1 173 ? 1.833   49.761  60.258 1.00 15.76 ? 509 ARG A CB  1 
ATOM   1328 C  CG  . ARG A 1 173 ? 0.529   50.502  59.870 1.00 15.31 ? 509 ARG A CG  1 
ATOM   1329 C  CD  . ARG A 1 173 ? -0.609  50.214  60.879 1.00 16.95 ? 509 ARG A CD  1 
ATOM   1330 N  NE  . ARG A 1 173 ? -0.268  50.782  62.191 1.00 16.84 ? 509 ARG A NE  1 
ATOM   1331 C  CZ  . ARG A 1 173 ? 0.111   50.116  63.279 1.00 17.67 ? 509 ARG A CZ  1 
ATOM   1332 N  NH1 . ARG A 1 173 ? 0.143   48.783  63.330 1.00 16.73 ? 509 ARG A NH1 1 
ATOM   1333 N  NH2 . ARG A 1 173 ? 0.438   50.810  64.361 1.00 15.63 ? 509 ARG A NH2 1 
ATOM   1334 N  N   . SER A 1 174 ? 0.880   46.656  60.523 1.00 15.04 ? 510 SER A N   1 
ATOM   1335 C  CA  . SER A 1 174 ? -0.178  45.658  60.582 1.00 14.54 ? 510 SER A CA  1 
ATOM   1336 C  C   . SER A 1 174 ? -1.522  46.272  60.900 1.00 13.33 ? 510 SER A C   1 
ATOM   1337 O  O   . SER A 1 174 ? -1.640  47.141  61.781 1.00 13.79 ? 510 SER A O   1 
ATOM   1338 C  CB  . SER A 1 174 ? 0.151   44.627  61.649 1.00 14.46 ? 510 SER A CB  1 
ATOM   1339 O  OG  . SER A 1 174 ? 1.112   43.750  61.141 1.00 12.82 ? 510 SER A OG  1 
ATOM   1340 N  N   . VAL A 1 175 ? -2.538  45.802  60.203 1.00 13.14 ? 511 VAL A N   1 
ATOM   1341 C  CA  . VAL A 1 175 ? -3.908  46.190  60.465 1.00 13.28 ? 511 VAL A CA  1 
ATOM   1342 C  C   . VAL A 1 175 ? -4.775  44.914  60.612 1.00 14.80 ? 511 VAL A C   1 
ATOM   1343 O  O   . VAL A 1 175 ? -4.348  43.813  60.259 1.00 14.50 ? 511 VAL A O   1 
ATOM   1344 C  CB  . VAL A 1 175 ? -4.428  47.106  59.343 1.00 13.84 ? 511 VAL A CB  1 
ATOM   1345 C  CG1 . VAL A 1 175 ? -3.613  48.378  59.286 1.00 12.99 ? 511 VAL A CG1 1 
ATOM   1346 C  CG2 . VAL A 1 175 ? -4.391  46.386  57.986 1.00 11.42 ? 511 VAL A CG2 1 
ATOM   1347 N  N   . THR A 1 176 ? -5.954  45.051  61.204 1.00 15.31 ? 512 THR A N   1 
ATOM   1348 C  CA  . THR A 1 176 ? -6.887  43.941  61.287 1.00 17.31 ? 512 THR A CA  1 
ATOM   1349 C  C   . THR A 1 176 ? -8.165  44.266  60.488 1.00 18.23 ? 512 THR A C   1 
ATOM   1350 O  O   . THR A 1 176 ? -8.549  45.417  60.383 1.00 18.27 ? 512 THR A O   1 
ATOM   1351 C  CB  . THR A 1 176 ? -7.183  43.568  62.762 1.00 17.22 ? 512 THR A CB  1 
ATOM   1352 O  OG1 . THR A 1 176 ? -7.800  44.675  63.422 1.00 18.89 ? 512 THR A OG1 1 
ATOM   1353 C  CG2 . THR A 1 176 ? -5.889  43.230  63.473 1.00 18.26 ? 512 THR A CG2 1 
ATOM   1354 N  N   . LEU A 1 177 ? -8.790  43.231  59.937 1.00 20.20 ? 513 LEU A N   1 
ATOM   1355 C  CA  . LEU A 1 177 ? -9.950  43.333  59.030 1.00 21.62 ? 513 LEU A CA  1 
ATOM   1356 C  C   . LEU A 1 177 ? -10.899 42.175  59.316 1.00 22.81 ? 513 LEU A C   1 
ATOM   1357 O  O   . LEU A 1 177 ? -10.419 41.047  59.535 1.00 22.74 ? 513 LEU A O   1 
ATOM   1358 C  CB  . LEU A 1 177 ? -9.484  43.155  57.569 1.00 22.52 ? 513 LEU A CB  1 
ATOM   1359 C  CG  . LEU A 1 177 ? -8.715  44.228  56.815 1.00 23.47 ? 513 LEU A CG  1 
ATOM   1360 C  CD1 . LEU A 1 177 ? -8.331  43.686  55.478 1.00 25.23 ? 513 LEU A CD1 1 
ATOM   1361 C  CD2 . LEU A 1 177 ? -9.597  45.437  56.638 1.00 27.24 ? 513 LEU A CD2 1 
ATOM   1362 N  N   . PRO A 1 178 ? -12.230 42.405  59.234 1.00 23.25 ? 514 PRO A N   1 
ATOM   1363 C  CA  . PRO A 1 178 ? -13.161 41.318  59.531 1.00 24.59 ? 514 PRO A CA  1 
ATOM   1364 C  C   . PRO A 1 178 ? -13.118 40.171  58.526 1.00 25.50 ? 514 PRO A C   1 
ATOM   1365 O  O   . PRO A 1 178 ? -13.549 39.079  58.850 1.00 26.73 ? 514 PRO A O   1 
ATOM   1366 C  CB  . PRO A 1 178 ? -14.536 42.000  59.505 1.00 24.09 ? 514 PRO A CB  1 
ATOM   1367 C  CG  . PRO A 1 178 ? -14.390 43.150  58.643 1.00 24.62 ? 514 PRO A CG  1 
ATOM   1368 C  CD  . PRO A 1 178 ? -12.919 43.567  58.662 1.00 23.83 ? 514 PRO A CD  1 
ATOM   1369 N  N   . THR A 1 179 ? -12.574 40.400  57.338 1.00 26.70 ? 515 THR A N   1 
ATOM   1370 C  CA  . THR A 1 179 ? -12.496 39.361  56.318 1.00 27.40 ? 515 THR A CA  1 
ATOM   1371 C  C   . THR A 1 179 ? -11.216 38.576  56.366 1.00 27.38 ? 515 THR A C   1 
ATOM   1372 O  O   . THR A 1 179 ? -11.095 37.593  55.652 1.00 28.12 ? 515 THR A O   1 
ATOM   1373 C  CB  . THR A 1 179 ? -12.552 39.978  54.913 1.00 27.88 ? 515 THR A CB  1 
ATOM   1374 O  OG1 . THR A 1 179 ? -11.569 41.013  54.838 1.00 29.01 ? 515 THR A OG1 1 
ATOM   1375 C  CG2 . THR A 1 179 ? -13.928 40.559  54.636 1.00 28.33 ? 515 THR A CG2 1 
ATOM   1376 N  N   . HIS A 1 180 ? -10.239 39.002  57.167 1.00 27.02 ? 516 HIS A N   1 
ATOM   1377 C  CA  . HIS A 1 180 ? -8.985  38.295  57.248 1.00 26.79 ? 516 HIS A CA  1 
ATOM   1378 C  C   . HIS A 1 180 ? -8.557  38.099  58.678 1.00 26.27 ? 516 HIS A C   1 
ATOM   1379 O  O   . HIS A 1 180 ? -7.453  38.474  59.074 1.00 24.40 ? 516 HIS A O   1 
ATOM   1380 C  CB  . HIS A 1 180 ? -7.902  39.045  56.461 1.00 27.60 ? 516 HIS A CB  1 
ATOM   1381 C  CG  . HIS A 1 180 ? -8.073  38.924  54.987 1.00 28.34 ? 516 HIS A CG  1 
ATOM   1382 N  ND1 . HIS A 1 180 ? -9.035  39.628  54.294 1.00 27.47 ? 516 HIS A ND1 1 
ATOM   1383 C  CD2 . HIS A 1 180 ? -7.445  38.138  54.078 1.00 29.30 ? 516 HIS A CD2 1 
ATOM   1384 C  CE1 . HIS A 1 180 ? -8.989  39.288  53.019 1.00 27.40 ? 516 HIS A CE1 1 
ATOM   1385 N  NE2 . HIS A 1 180 ? -8.026  38.394  52.859 1.00 30.24 ? 516 HIS A NE2 1 
ATOM   1386 N  N   . ARG A 1 181 ? -9.440  37.478  59.443 1.00 25.96 ? 517 ARG A N   1 
ATOM   1387 C  CA  . ARG A 1 181 ? -9.163  37.167  60.832 1.00 26.54 ? 517 ARG A CA  1 
ATOM   1388 C  C   . ARG A 1 181 ? -8.224  35.978  60.879 1.00 26.11 ? 517 ARG A C   1 
ATOM   1389 O  O   . ARG A 1 181 ? -8.077  35.274  59.900 1.00 26.41 ? 517 ARG A O   1 
ATOM   1390 C  CB  . ARG A 1 181 ? -10.467 36.889  61.587 1.00 26.69 ? 517 ARG A CB  1 
ATOM   1391 C  CG  . ARG A 1 181 ? -11.213 38.170  61.923 1.00 29.25 ? 517 ARG A CG  1 
ATOM   1392 C  CD  . ARG A 1 181 ? -12.677 37.905  62.275 1.00 33.61 ? 517 ARG A CD  1 
ATOM   1393 N  NE  . ARG A 1 181 ? -13.425 39.156  62.459 1.00 36.80 ? 517 ARG A NE  1 
ATOM   1394 C  CZ  . ARG A 1 181 ? -14.758 39.261  62.469 1.00 37.44 ? 517 ARG A CZ  1 
ATOM   1395 N  NH1 . ARG A 1 181 ? -15.534 38.196  62.281 1.00 36.88 ? 517 ARG A NH1 1 
ATOM   1396 N  NH2 . ARG A 1 181 ? -15.323 40.455  62.647 1.00 39.29 ? 517 ARG A NH2 1 
ATOM   1397 N  N   . GLU A 1 182 ? -7.579  35.776  62.017 1.00 26.04 ? 518 GLU A N   1 
ATOM   1398 C  CA  . GLU A 1 182 ? -6.639  34.675  62.203 1.00 26.01 ? 518 GLU A CA  1 
ATOM   1399 C  C   . GLU A 1 182 ? -7.309  33.328  61.916 1.00 25.31 ? 518 GLU A C   1 
ATOM   1400 O  O   . GLU A 1 182 ? -8.509  33.145  62.186 1.00 23.90 ? 518 GLU A O   1 
ATOM   1401 C  CB  . GLU A 1 182 ? -6.104  34.678  63.638 1.00 26.43 ? 518 GLU A CB  1 
ATOM   1402 C  CG  . GLU A 1 182 ? -5.536  36.024  64.072 1.00 29.09 ? 518 GLU A CG  1 
ATOM   1403 C  CD  . GLU A 1 182 ? -4.787  36.004  65.418 1.00 31.59 ? 518 GLU A CD  1 
ATOM   1404 O  OE1 . GLU A 1 182 ? -4.461  34.905  65.938 1.00 31.76 ? 518 GLU A OE1 1 
ATOM   1405 O  OE2 . GLU A 1 182 ? -4.507  37.118  65.931 1.00 32.34 ? 518 GLU A OE2 1 
ATOM   1406 N  N   . THR A 1 183 ? -6.539  32.387  61.371 1.00 24.54 ? 519 THR A N   1 
ATOM   1407 C  CA  . THR A 1 183 ? -7.051  31.051  61.069 1.00 24.75 ? 519 THR A CA  1 
ATOM   1408 C  C   . THR A 1 183 ? -6.053  30.045  61.556 1.00 24.73 ? 519 THR A C   1 
ATOM   1409 O  O   . THR A 1 183 ? -4.890  30.376  61.689 1.00 24.26 ? 519 THR A O   1 
ATOM   1410 C  CB  . THR A 1 183 ? -7.270  30.795  59.572 1.00 24.98 ? 519 THR A CB  1 
ATOM   1411 O  OG1 . THR A 1 183 ? -6.006  30.774  58.900 1.00 26.23 ? 519 THR A OG1 1 
ATOM   1412 C  CG2 . THR A 1 183 ? -8.198  31.849  58.966 1.00 25.00 ? 519 THR A CG2 1 
ATOM   1413 N  N   . PRO A 1 184 ? -6.508  28.806  61.837 1.00 24.74 ? 520 PRO A N   1 
ATOM   1414 C  CA  . PRO A 1 184 ? -5.597  27.804  62.391 1.00 24.50 ? 520 PRO A CA  1 
ATOM   1415 C  C   . PRO A 1 184 ? -4.449  27.438  61.452 1.00 24.59 ? 520 PRO A C   1 
ATOM   1416 O  O   . PRO A 1 184 ? -3.400  27.026  61.921 1.00 24.82 ? 520 PRO A O   1 
ATOM   1417 C  CB  . PRO A 1 184 ? -6.502  26.596  62.646 1.00 24.93 ? 520 PRO A CB  1 
ATOM   1418 C  CG  . PRO A 1 184 ? -7.937  27.137  62.578 1.00 24.76 ? 520 PRO A CG  1 
ATOM   1419 C  CD  . PRO A 1 184 ? -7.874  28.290  61.646 1.00 24.21 ? 520 PRO A CD  1 
ATOM   1420 N  N   . GLU A 1 185 ? -4.666  27.612  60.149 1.00 24.68 ? 521 GLU A N   1 
ATOM   1421 C  CA  . GLU A 1 185 ? -3.682  27.414  59.092 1.00 24.78 ? 521 GLU A CA  1 
ATOM   1422 C  C   . GLU A 1 185 ? -2.366  28.213  59.257 1.00 23.83 ? 521 GLU A C   1 
ATOM   1423 O  O   . GLU A 1 185 ? -1.311  27.761  58.803 1.00 22.84 ? 521 GLU A O   1 
ATOM   1424 C  CB  . GLU A 1 185 ? -4.328  27.819  57.759 1.00 25.93 ? 521 GLU A CB  1 
ATOM   1425 C  CG  . GLU A 1 185 ? -3.425  27.722  56.526 1.00 29.45 ? 521 GLU A CG  1 
ATOM   1426 C  CD  . GLU A 1 185 ? -4.180  27.938  55.201 1.00 33.48 ? 521 GLU A CD  1 
ATOM   1427 O  OE1 . GLU A 1 185 ? -3.815  27.269  54.202 1.00 36.56 ? 521 GLU A OE1 1 
ATOM   1428 O  OE2 . GLU A 1 185 ? -5.126  28.769  55.149 1.00 37.68 ? 521 GLU A OE2 1 
ATOM   1429 N  N   . TYR A 1 186 ? -2.438  29.398  59.873 1.00 22.52 ? 522 TYR A N   1 
ATOM   1430 C  CA  . TYR A 1 186 ? -1.269  30.278  59.996 1.00 21.94 ? 522 TYR A CA  1 
ATOM   1431 C  C   . TYR A 1 186 ? -1.199  30.906  61.359 1.00 20.43 ? 522 TYR A C   1 
ATOM   1432 O  O   . TYR A 1 186 ? -2.217  31.269  61.927 1.00 21.35 ? 522 TYR A O   1 
ATOM   1433 C  CB  . TYR A 1 186 ? -1.302  31.425  58.968 1.00 22.65 ? 522 TYR A CB  1 
ATOM   1434 C  CG  . TYR A 1 186 ? -1.352  31.026  57.520 1.00 23.84 ? 522 TYR A CG  1 
ATOM   1435 C  CD1 . TYR A 1 186 ? -0.253  30.442  56.897 1.00 26.06 ? 522 TYR A CD1 1 
ATOM   1436 C  CD2 . TYR A 1 186 ? -2.497  31.250  56.763 1.00 27.15 ? 522 TYR A CD2 1 
ATOM   1437 C  CE1 . TYR A 1 186 ? -0.298  30.072  55.563 1.00 27.49 ? 522 TYR A CE1 1 
ATOM   1438 C  CE2 . TYR A 1 186 ? -2.555  30.900  55.432 1.00 27.72 ? 522 TYR A CE2 1 
ATOM   1439 C  CZ  . TYR A 1 186 ? -1.451  30.303  54.835 1.00 27.85 ? 522 TYR A CZ  1 
ATOM   1440 O  OH  . TYR A 1 186 ? -1.500  29.959  53.510 1.00 29.93 ? 522 TYR A OH  1 
ATOM   1441 N  N   . ARG A 1 187 ? 0.008   31.034  61.878 1.00 18.72 ? 523 ARG A N   1 
ATOM   1442 C  CA  . ARG A 1 187 ? 0.283   31.864  63.033 1.00 18.16 ? 523 ARG A CA  1 
ATOM   1443 C  C   . ARG A 1 187 ? 0.290   33.338  62.625 1.00 16.91 ? 523 ARG A C   1 
ATOM   1444 O  O   . ARG A 1 187 ? 1.103   33.778  61.821 1.00 16.03 ? 523 ARG A O   1 
ATOM   1445 C  CB  . ARG A 1 187 ? 1.647   31.501  63.634 1.00 17.97 ? 523 ARG A CB  1 
ATOM   1446 C  CG  . ARG A 1 187 ? 1.721   30.067  64.177 1.00 20.34 ? 523 ARG A CG  1 
ATOM   1447 C  CD  . ARG A 1 187 ? 3.151   29.718  64.689 1.00 23.82 ? 523 ARG A CD  1 
ATOM   1448 N  NE  . ARG A 1 187 ? 4.070   29.688  63.541 1.00 24.80 ? 523 ARG A NE  1 
ATOM   1449 C  CZ  . ARG A 1 187 ? 5.083   30.532  63.330 1.00 26.23 ? 523 ARG A CZ  1 
ATOM   1450 N  NH1 . ARG A 1 187 ? 5.406   31.484  64.238 1.00 27.96 ? 523 ARG A NH1 1 
ATOM   1451 N  NH2 . ARG A 1 187 ? 5.808   30.398  62.215 1.00 23.33 ? 523 ARG A NH2 1 
ATOM   1452 N  N   . ARG A 1 188 ? -0.616  34.108  63.189 1.00 16.59 ? 524 ARG A N   1 
ATOM   1453 C  CA  . ARG A 1 188 ? -0.719  35.527  62.864 1.00 16.78 ? 524 ARG A CA  1 
ATOM   1454 C  C   . ARG A 1 188 ? 0.372   36.300  63.546 1.00 16.28 ? 524 ARG A C   1 
ATOM   1455 O  O   . ARG A 1 188 ? 0.511   36.245  64.767 1.00 16.46 ? 524 ARG A O   1 
ATOM   1456 C  CB  . ARG A 1 188 ? -2.064  36.088  63.329 1.00 16.84 ? 524 ARG A CB  1 
ATOM   1457 C  CG  . ARG A 1 188 ? -2.225  37.610  63.117 1.00 17.27 ? 524 ARG A CG  1 
ATOM   1458 C  CD  . ARG A 1 188 ? -2.089  38.064  61.626 1.00 16.55 ? 524 ARG A CD  1 
ATOM   1459 N  NE  . ARG A 1 188 ? -2.923  37.320  60.681 1.00 16.50 ? 524 ARG A NE  1 
ATOM   1460 C  CZ  . ARG A 1 188 ? -4.185  37.603  60.354 1.00 20.72 ? 524 ARG A CZ  1 
ATOM   1461 N  NH1 . ARG A 1 188 ? -4.828  38.627  60.892 1.00 23.62 ? 524 ARG A NH1 1 
ATOM   1462 N  NH2 . ARG A 1 188 ? -4.813  36.860  59.454 1.00 20.30 ? 524 ARG A NH2 1 
ATOM   1463 N  N   . GLY A 1 189 ? 1.145   37.003  62.748 1.00 16.12 ? 525 GLY A N   1 
ATOM   1464 C  CA  . GLY A 1 189 ? 2.130   37.943  63.214 1.00 16.64 ? 525 GLY A CA  1 
ATOM   1465 C  C   . GLY A 1 189 ? 1.657   39.371  63.009 1.00 16.98 ? 525 GLY A C   1 
ATOM   1466 O  O   . GLY A 1 189 ? 0.604   39.608  62.390 1.00 15.40 ? 525 GLY A O   1 
ATOM   1467 N  N   . GLU A 1 190 ? 2.416   40.300  63.603 1.00 16.70 ? 526 GLU A N   1 
ATOM   1468 C  CA  . GLU A 1 190 ? 2.197   41.719  63.489 1.00 17.01 ? 526 GLU A CA  1 
ATOM   1469 C  C   . GLU A 1 190 ? 3.505   42.440  63.353 1.00 17.00 ? 526 GLU A C   1 
ATOM   1470 O  O   . GLU A 1 190 ? 4.512   42.085  64.011 1.00 16.23 ? 526 GLU A O   1 
ATOM   1471 C  CB  . GLU A 1 190 ? 1.531   42.302  64.734 1.00 17.78 ? 526 GLU A CB  1 
ATOM   1472 C  CG  . GLU A 1 190 ? 0.044   41.959  64.860 1.00 20.72 ? 526 GLU A CG  1 
ATOM   1473 C  CD  . GLU A 1 190 ? -0.190  40.664  65.575 1.00 24.77 ? 526 GLU A CD  1 
ATOM   1474 O  OE1 . GLU A 1 190 ? 0.691   40.242  66.349 1.00 24.42 ? 526 GLU A OE1 1 
ATOM   1475 O  OE2 . GLU A 1 190 ? -1.261  40.052  65.359 1.00 30.64 ? 526 GLU A OE2 1 
ATOM   1476 N  N   . THR A 1 191 ? 3.482   43.489  62.537 1.00 16.04 ? 527 THR A N   1 
ATOM   1477 C  CA  . THR A 1 191 ? 4.589   44.412  62.485 1.00 15.59 ? 527 THR A CA  1 
ATOM   1478 C  C   . THR A 1 191 ? 4.070   45.822  62.811 1.00 15.02 ? 527 THR A C   1 
ATOM   1479 O  O   . THR A 1 191 ? 3.075   46.274  62.274 1.00 14.32 ? 527 THR A O   1 
ATOM   1480 C  CB  . THR A 1 191 ? 5.357   44.303  61.151 1.00 16.79 ? 527 THR A CB  1 
ATOM   1481 O  OG1 . THR A 1 191 ? 6.685   44.835  61.295 1.00 18.37 ? 527 THR A OG1 1 
ATOM   1482 C  CG2 . THR A 1 191 ? 4.654   45.045  60.011 1.00 14.09 ? 527 THR A CG2 1 
ATOM   1483 N  N   . LEU A 1 192 ? 4.773   46.483  63.722 1.00 14.67 ? 528 LEU A N   1 
ATOM   1484 C  CA  . LEU A 1 192 ? 4.426   47.777  64.256 1.00 14.72 ? 528 LEU A CA  1 
ATOM   1485 C  C   . LEU A 1 192 ? 4.711   48.892  63.256 1.00 15.12 ? 528 LEU A C   1 
ATOM   1486 O  O   . LEU A 1 192 ? 3.892   49.775  63.070 1.00 14.69 ? 528 LEU A O   1 
ATOM   1487 C  CB  . LEU A 1 192 ? 5.241   48.057  65.528 1.00 14.76 ? 528 LEU A CB  1 
ATOM   1488 C  CG  . LEU A 1 192 ? 5.094   49.414  66.216 1.00 13.80 ? 528 LEU A CG  1 
ATOM   1489 C  CD1 . LEU A 1 192 ? 3.649   49.645  66.656 1.00 14.46 ? 528 LEU A CD1 1 
ATOM   1490 C  CD2 . LEU A 1 192 ? 6.027   49.543  67.429 1.00 13.93 ? 528 LEU A CD2 1 
ATOM   1491 N  N   . CYS A 1 193 ? 5.888   48.841  62.632 1.00 15.22 ? 529 CYS A N   1 
ATOM   1492 C  CA  . CYS A 1 193 ? 6.373   49.934  61.811 1.00 14.86 ? 529 CYS A CA  1 
ATOM   1493 C  C   . CYS A 1 193 ? 7.601   49.445  61.069 1.00 14.82 ? 529 CYS A C   1 
ATOM   1494 O  O   . CYS A 1 193 ? 8.659   49.274  61.680 1.00 13.76 ? 529 CYS A O   1 
ATOM   1495 C  CB  . CYS A 1 193 ? 6.794   51.088  62.686 1.00 14.90 ? 529 CYS A CB  1 
ATOM   1496 S  SG  . CYS A 1 193 ? 7.411   52.495  61.737 1.00 17.26 ? 529 CYS A SG  1 
ATOM   1497 N  N   . SER A 1 194 ? 7.429   49.147  59.794 1.00 14.05 ? 530 SER A N   1 
ATOM   1498 C  CA  . SER A 1 194 ? 8.524   48.670  58.959 1.00 15.42 ? 530 SER A CA  1 
ATOM   1499 C  C   . SER A 1 194 ? 8.450   49.359  57.597 1.00 14.97 ? 530 SER A C   1 
ATOM   1500 O  O   . SER A 1 194 ? 7.473   50.074  57.292 1.00 14.60 ? 530 SER A O   1 
ATOM   1501 C  CB  . SER A 1 194 ? 8.353   47.159  58.771 1.00 16.27 ? 530 SER A CB  1 
ATOM   1502 O  OG  . SER A 1 194 ? 8.510   46.478  60.004 1.00 18.64 ? 530 SER A OG  1 
ATOM   1503 N  N   . GLY A 1 195 ? 9.452   49.132  56.772 1.00 14.84 ? 531 GLY A N   1 
ATOM   1504 C  CA  . GLY A 1 195 ? 9.353   49.452  55.372 1.00 14.44 ? 531 GLY A CA  1 
ATOM   1505 C  C   . GLY A 1 195 ? 10.615  50.074  54.848 1.00 14.64 ? 531 GLY A C   1 
ATOM   1506 O  O   . GLY A 1 195 ? 11.678  49.937  55.465 1.00 14.84 ? 531 GLY A O   1 
ATOM   1507 N  N   . PHE A 1 196 ? 10.516  50.785  53.728 1.00 14.08 ? 532 PHE A N   1 
ATOM   1508 C  CA  . PHE A 1 196 ? 11.714  51.300  53.073 1.00 14.94 ? 532 PHE A CA  1 
ATOM   1509 C  C   . PHE A 1 196 ? 11.739  52.811  53.042 1.00 14.53 ? 532 PHE A C   1 
ATOM   1510 O  O   . PHE A 1 196 ? 10.705  53.468  52.946 1.00 14.39 ? 532 PHE A O   1 
ATOM   1511 C  CB  . PHE A 1 196 ? 11.819  50.813  51.648 1.00 15.26 ? 532 PHE A CB  1 
ATOM   1512 C  CG  . PHE A 1 196 ? 11.855  49.333  51.506 1.00 18.01 ? 532 PHE A CG  1 
ATOM   1513 C  CD1 . PHE A 1 196 ? 13.055  48.665  51.365 1.00 21.41 ? 532 PHE A CD1 1 
ATOM   1514 C  CD2 . PHE A 1 196 ? 10.697  48.610  51.433 1.00 18.82 ? 532 PHE A CD2 1 
ATOM   1515 C  CE1 . PHE A 1 196 ? 13.083  47.297  51.177 1.00 22.33 ? 532 PHE A CE1 1 
ATOM   1516 C  CE2 . PHE A 1 196 ? 10.740  47.237  51.265 1.00 20.83 ? 532 PHE A CE2 1 
ATOM   1517 C  CZ  . PHE A 1 196 ? 11.915  46.594  51.131 1.00 21.34 ? 532 PHE A CZ  1 
ATOM   1518 N  N   . CYS A 1 197 ? 12.940  53.351  53.139 1.00 15.15 ? 533 CYS A N   1 
ATOM   1519 C  CA  . CYS A 1 197 ? 13.186  54.721  52.803 1.00 16.17 ? 533 CYS A CA  1 
ATOM   1520 C  C   . CYS A 1 197 ? 14.231  54.753  51.696 1.00 15.25 ? 533 CYS A C   1 
ATOM   1521 O  O   . CYS A 1 197 ? 15.228  54.045  51.777 1.00 14.19 ? 533 CYS A O   1 
ATOM   1522 C  CB  . CYS A 1 197 ? 13.638  55.494  54.029 1.00 16.50 ? 533 CYS A CB  1 
ATOM   1523 S  SG  . CYS A 1 197 ? 12.230  55.744  55.156 1.00 26.62 ? 533 CYS A SG  1 
ATOM   1524 N  N   . LEU A 1 198 ? 13.980  55.559  50.667 1.00 14.06 ? 534 LEU A N   1 
ATOM   1525 C  CA  . LEU A 1 198 ? 14.861  55.646  49.501 1.00 14.49 ? 534 LEU A CA  1 
ATOM   1526 C  C   . LEU A 1 198 ? 15.275  57.096  49.304 1.00 14.32 ? 534 LEU A C   1 
ATOM   1527 O  O   . LEU A 1 198 ? 14.423  57.972  49.116 1.00 12.84 ? 534 LEU A O   1 
ATOM   1528 C  CB  . LEU A 1 198 ? 14.166  55.115  48.236 1.00 14.18 ? 534 LEU A CB  1 
ATOM   1529 C  CG  . LEU A 1 198 ? 13.359  53.826  48.419 1.00 14.64 ? 534 LEU A CG  1 
ATOM   1530 C  CD1 . LEU A 1 198 ? 12.342  53.611  47.262 1.00 10.62 ? 534 LEU A CD1 1 
ATOM   1531 C  CD2 . LEU A 1 198 ? 14.407  52.704  48.560 1.00 13.07 ? 534 LEU A CD2 1 
ATOM   1532 N  N   . TRP A 1 199 ? 16.575  57.336  49.355 1.00 15.06 ? 535 TRP A N   1 
ATOM   1533 C  CA  . TRP A 1 199 ? 17.150  58.665  49.103 1.00 16.00 ? 535 TRP A CA  1 
ATOM   1534 C  C   . TRP A 1 199 ? 17.884  58.714  47.769 1.00 16.76 ? 535 TRP A C   1 
ATOM   1535 O  O   . TRP A 1 199 ? 18.643  57.815  47.439 1.00 15.69 ? 535 TRP A O   1 
ATOM   1536 C  CB  . TRP A 1 199 ? 18.166  59.007  50.194 1.00 16.48 ? 535 TRP A CB  1 
ATOM   1537 C  CG  . TRP A 1 199 ? 17.562  59.360  51.529 1.00 17.81 ? 535 TRP A CG  1 
ATOM   1538 C  CD1 . TRP A 1 199 ? 17.216  60.609  51.959 1.00 19.18 ? 535 TRP A CD1 1 
ATOM   1539 C  CD2 . TRP A 1 199 ? 17.281  58.473  52.613 1.00 16.92 ? 535 TRP A CD2 1 
ATOM   1540 N  NE1 . TRP A 1 199 ? 16.732  60.553  53.237 1.00 20.78 ? 535 TRP A NE1 1 
ATOM   1541 C  CE2 . TRP A 1 199 ? 16.751  59.255  53.665 1.00 16.12 ? 535 TRP A CE2 1 
ATOM   1542 C  CE3 . TRP A 1 199 ? 17.434  57.101  52.807 1.00 18.21 ? 535 TRP A CE3 1 
ATOM   1543 C  CZ2 . TRP A 1 199 ? 16.367  58.714  54.882 1.00 17.38 ? 535 TRP A CZ2 1 
ATOM   1544 C  CZ3 . TRP A 1 199 ? 17.012  56.547  54.034 1.00 18.99 ? 535 TRP A CZ3 1 
ATOM   1545 C  CH2 . TRP A 1 199 ? 16.487  57.356  55.045 1.00 17.66 ? 535 TRP A CH2 1 
ATOM   1546 N  N   . ARG A 1 200 ? 17.691  59.801  47.026 1.00 17.92 ? 536 ARG A N   1 
ATOM   1547 C  CA  . ARG A 1 200 ? 18.421  60.022  45.789 1.00 18.87 ? 536 ARG A CA  1 
ATOM   1548 C  C   . ARG A 1 200 ? 19.858  60.364  46.135 1.00 18.98 ? 536 ARG A C   1 
ATOM   1549 O  O   . ARG A 1 200 ? 20.109  61.264  46.914 1.00 18.18 ? 536 ARG A O   1 
ATOM   1550 C  CB  . ARG A 1 200 ? 17.772  61.152  44.999 1.00 19.75 ? 536 ARG A CB  1 
ATOM   1551 C  CG  . ARG A 1 200 ? 16.294  60.904  44.734 1.00 22.74 ? 536 ARG A CG  1 
ATOM   1552 C  CD  . ARG A 1 200 ? 15.632  62.072  44.045 1.00 27.80 ? 536 ARG A CD  1 
ATOM   1553 N  NE  . ARG A 1 200 ? 14.436  61.636  43.321 1.00 29.88 ? 536 ARG A NE  1 
ATOM   1554 C  CZ  . ARG A 1 200 ? 14.445  60.976  42.160 1.00 31.33 ? 536 ARG A CZ  1 
ATOM   1555 N  NH1 . ARG A 1 200 ? 15.587  60.657  41.546 1.00 32.18 ? 536 ARG A NH1 1 
ATOM   1556 N  NH2 . ARG A 1 200 ? 13.303  60.640  41.600 1.00 31.70 ? 536 ARG A NH2 1 
ATOM   1557 N  N   . GLU A 1 201 ? 20.799  59.602  45.610 1.00 20.20 ? 537 GLU A N   1 
ATOM   1558 C  CA  . GLU A 1 201 ? 22.204  59.881  45.867 1.00 21.13 ? 537 GLU A CA  1 
ATOM   1559 C  C   . GLU A 1 201 ? 22.913  60.321  44.596 1.00 21.44 ? 537 GLU A C   1 
ATOM   1560 O  O   . GLU A 1 201 ? 24.122  60.429  44.591 1.00 21.95 ? 537 GLU A O   1 
ATOM   1561 C  CB  . GLU A 1 201 ? 22.886  58.650  46.467 1.00 22.08 ? 537 GLU A CB  1 
ATOM   1562 C  CG  . GLU A 1 201 ? 22.394  58.255  47.844 1.00 23.61 ? 537 GLU A CG  1 
ATOM   1563 C  CD  . GLU A 1 201 ? 22.837  59.186  48.984 1.00 27.50 ? 537 GLU A CD  1 
ATOM   1564 O  OE1 . GLU A 1 201 ? 23.445  60.253  48.724 1.00 30.15 ? 537 GLU A OE1 1 
ATOM   1565 O  OE2 . GLU A 1 201 ? 22.568  58.830  50.165 1.00 30.86 ? 537 GLU A OE2 1 
ATOM   1566 N  N   . GLY A 1 202 ? 22.159  60.600  43.537 1.00 21.45 ? 538 GLY A N   1 
ATOM   1567 C  CA  . GLY A 1 202 ? 22.724  60.941  42.233 1.00 22.19 ? 538 GLY A CA  1 
ATOM   1568 C  C   . GLY A 1 202 ? 21.860  60.386  41.111 1.00 22.59 ? 538 GLY A C   1 
ATOM   1569 O  O   . GLY A 1 202 ? 20.741  59.864  41.344 1.00 22.14 ? 538 GLY A O   1 
ATOM   1570 N  N   . ASP A 1 203 ? 22.367  60.539  39.895 1.00 22.62 ? 539 ASP A N   1 
ATOM   1571 C  CA  . ASP A 1 203 ? 21.825  59.892  38.702 1.00 23.32 ? 539 ASP A CA  1 
ATOM   1572 C  C   . ASP A 1 203 ? 21.971  58.386  38.848 1.00 22.88 ? 539 ASP A C   1 
ATOM   1573 O  O   . ASP A 1 203 ? 23.088  57.865  38.855 1.00 23.54 ? 539 ASP A O   1 
ATOM   1574 C  CB  . ASP A 1 203 ? 22.591  60.331  37.420 1.00 23.85 ? 539 ASP A CB  1 
ATOM   1575 C  CG  . ASP A 1 203 ? 21.993  61.563  36.746 1.00 25.48 ? 539 ASP A CG  1 
ATOM   1576 O  OD1 . ASP A 1 203 ? 20.904  62.020  37.171 1.00 27.78 ? 539 ASP A OD1 1 
ATOM   1577 O  OD2 . ASP A 1 203 ? 22.616  62.069  35.770 1.00 26.86 ? 539 ASP A OD2 1 
ATOM   1578 N  N   . GLN A 1 204 ? 20.835  57.701  38.936 1.00 22.87 ? 540 GLN A N   1 
ATOM   1579 C  CA  . GLN A 1 204 ? 20.798  56.251  39.054 1.00 22.20 ? 540 GLN A CA  1 
ATOM   1580 C  C   . GLN A 1 204 ? 21.648  55.738  40.240 1.00 20.86 ? 540 GLN A C   1 
ATOM   1581 O  O   . GLN A 1 204 ? 22.186  54.638  40.163 1.00 20.58 ? 540 GLN A O   1 
ATOM   1582 C  CB  . GLN A 1 204 ? 21.202  55.593  37.710 1.00 23.00 ? 540 GLN A CB  1 
ATOM   1583 C  CG  . GLN A 1 204 ? 20.535  54.220  37.433 1.00 24.65 ? 540 GLN A CG  1 
ATOM   1584 C  CD  . GLN A 1 204 ? 20.686  53.717  35.970 1.00 26.95 ? 540 GLN A CD  1 
ATOM   1585 O  OE1 . GLN A 1 204 ? 21.586  54.119  35.235 1.00 25.00 ? 540 GLN A OE1 1 
ATOM   1586 N  NE2 . GLN A 1 204 ? 19.779  52.828  35.560 1.00 28.64 ? 540 GLN A NE2 1 
ATOM   1587 N  N   . LEU A 1 205 ? 21.758  56.543  41.310 1.00 19.30 ? 541 LEU A N   1 
ATOM   1588 C  CA  . LEU A 1 205 ? 22.182  56.077  42.649 1.00 18.26 ? 541 LEU A CA  1 
ATOM   1589 C  C   . LEU A 1 205 ? 21.067  56.299  43.698 1.00 17.31 ? 541 LEU A C   1 
ATOM   1590 O  O   . LEU A 1 205 ? 20.534  57.390  43.829 1.00 17.03 ? 541 LEU A O   1 
ATOM   1591 C  CB  . LEU A 1 205 ? 23.439  56.816  43.125 1.00 18.76 ? 541 LEU A CB  1 
ATOM   1592 C  CG  . LEU A 1 205 ? 24.820  56.338  42.696 1.00 17.88 ? 541 LEU A CG  1 
ATOM   1593 C  CD1 . LEU A 1 205 ? 25.881  57.296  43.219 1.00 17.31 ? 541 LEU A CD1 1 
ATOM   1594 C  CD2 . LEU A 1 205 ? 25.077  54.930  43.180 1.00 17.97 ? 541 LEU A CD2 1 
ATOM   1595 N  N   . THR A 1 206 ? 20.735  55.262  44.454 1.00 15.92 ? 542 THR A N   1 
ATOM   1596 C  CA  . THR A 1 206 ? 19.714  55.347  45.492 1.00 15.18 ? 542 THR A CA  1 
ATOM   1597 C  C   . THR A 1 206 ? 20.183  54.688  46.782 1.00 15.66 ? 542 THR A C   1 
ATOM   1598 O  O   . THR A 1 206 ? 20.659  53.553  46.752 1.00 14.54 ? 542 THR A O   1 
ATOM   1599 C  CB  . THR A 1 206 ? 18.461  54.629  45.036 1.00 14.65 ? 542 THR A CB  1 
ATOM   1600 O  OG1 . THR A 1 206 ? 18.008  55.228  43.820 1.00 13.74 ? 542 THR A OG1 1 
ATOM   1601 C  CG2 . THR A 1 206 ? 17.325  54.673  46.136 1.00 15.79 ? 542 THR A CG2 1 
ATOM   1602 N  N   . LYS A 1 207 ? 20.057  55.403  47.898 1.00 16.11 ? 543 LYS A N   1 
ATOM   1603 C  CA  . LYS A 1 207 ? 20.302  54.808  49.200 1.00 16.90 ? 543 LYS A CA  1 
ATOM   1604 C  C   . LYS A 1 207 ? 19.042  54.091  49.569 1.00 16.96 ? 543 LYS A C   1 
ATOM   1605 O  O   . LYS A 1 207 ? 17.981  54.747  49.725 1.00 17.11 ? 543 LYS A O   1 
ATOM   1606 C  CB  . LYS A 1 207 ? 20.653  55.858  50.262 1.00 17.77 ? 543 LYS A CB  1 
ATOM   1607 C  CG  . LYS A 1 207 ? 21.131  55.243  51.606 1.00 20.10 ? 543 LYS A CG  1 
ATOM   1608 C  CD  . LYS A 1 207 ? 21.328  56.309  52.688 1.00 22.74 ? 543 LYS A CD  1 
ATOM   1609 C  CE  . LYS A 1 207 ? 22.774  56.595  52.987 1.00 25.92 ? 543 LYS A CE  1 
ATOM   1610 N  NZ  . LYS A 1 207 ? 23.031  58.008  53.460 1.00 28.47 ? 543 LYS A NZ  1 
ATOM   1611 N  N   . VAL A 1 208 ? 19.134  52.758  49.654 1.00 15.65 ? 544 VAL A N   1 
ATOM   1612 C  CA  . VAL A 1 208 ? 17.998  51.897  49.952 1.00 15.48 ? 544 VAL A CA  1 
ATOM   1613 C  C   . VAL A 1 208 ? 18.117  51.414  51.399 1.00 15.92 ? 544 VAL A C   1 
ATOM   1614 O  O   . VAL A 1 208 ? 19.079  50.717  51.745 1.00 15.86 ? 544 VAL A O   1 
ATOM   1615 C  CB  . VAL A 1 208 ? 17.987  50.623  49.062 1.00 15.63 ? 544 VAL A CB  1 
ATOM   1616 C  CG1 . VAL A 1 208 ? 16.831  49.669  49.461 1.00 14.49 ? 544 VAL A CG1 1 
ATOM   1617 C  CG2 . VAL A 1 208 ? 17.955  50.954  47.574 1.00 15.10 ? 544 VAL A CG2 1 
ATOM   1618 N  N   . SER A 1 209 ? 17.168  51.795  52.247 1.00 15.65 ? 545 SER A N   1 
ATOM   1619 C  CA  . SER A 1 209 ? 17.131  51.318  53.619 1.00 16.06 ? 545 SER A CA  1 
ATOM   1620 C  C   . SER A 1 209 ? 15.828  50.629  53.924 1.00 16.13 ? 545 SER A C   1 
ATOM   1621 O  O   . SER A 1 209 ? 14.761  51.157  53.594 1.00 15.74 ? 545 SER A O   1 
ATOM   1622 C  CB  . SER A 1 209 ? 17.239  52.473  54.596 1.00 16.99 ? 545 SER A CB  1 
ATOM   1623 O  OG  . SER A 1 209 ? 18.426  53.172  54.404 1.00 18.10 ? 545 SER A OG  1 
ATOM   1624 N  N   . TYR A 1 210 ? 15.929  49.486  54.595 1.00 16.08 ? 546 TYR A N   1 
ATOM   1625 C  CA  . TYR A 1 210 ? 14.784  48.776  55.125 1.00 15.32 ? 546 TYR A CA  1 
ATOM   1626 C  C   . TYR A 1 210 ? 14.810  48.836  56.659 1.00 15.62 ? 546 TYR A C   1 
ATOM   1627 O  O   . TYR A 1 210 ? 15.856  48.584  57.280 1.00 14.96 ? 546 TYR A O   1 
ATOM   1628 C  CB  . TYR A 1 210 ? 14.759  47.324  54.649 1.00 16.03 ? 546 TYR A CB  1 
ATOM   1629 C  CG  . TYR A 1 210 ? 13.728  46.512  55.389 1.00 16.12 ? 546 TYR A CG  1 
ATOM   1630 C  CD1 . TYR A 1 210 ? 12.393  46.539  54.993 1.00 20.93 ? 546 TYR A CD1 1 
ATOM   1631 C  CD2 . TYR A 1 210 ? 14.070  45.726  56.494 1.00 17.39 ? 546 TYR A CD2 1 
ATOM   1632 C  CE1 . TYR A 1 210 ? 11.400  45.792  55.684 1.00 19.54 ? 546 TYR A CE1 1 
ATOM   1633 C  CE2 . TYR A 1 210 ? 13.072  44.994  57.195 1.00 17.34 ? 546 TYR A CE2 1 
ATOM   1634 C  CZ  . TYR A 1 210 ? 11.753  45.029  56.767 1.00 20.46 ? 546 TYR A CZ  1 
ATOM   1635 O  OH  . TYR A 1 210 ? 10.763  44.328  57.453 1.00 20.23 ? 546 TYR A OH  1 
ATOM   1636 N  N   . TYR A 1 211 ? 13.669  49.171  57.249 1.00 13.77 ? 547 TYR A N   1 
ATOM   1637 C  CA  . TYR A 1 211 ? 13.507  49.317  58.694 1.00 14.36 ? 547 TYR A CA  1 
ATOM   1638 C  C   . TYR A 1 211 ? 12.474  48.321  59.217 1.00 13.99 ? 547 TYR A C   1 
ATOM   1639 O  O   . TYR A 1 211 ? 11.471  48.049  58.537 1.00 10.43 ? 547 TYR A O   1 
ATOM   1640 C  CB  . TYR A 1 211 ? 12.976  50.714  59.021 1.00 14.85 ? 547 TYR A CB  1 
ATOM   1641 C  CG  . TYR A 1 211 ? 13.965  51.827  58.846 1.00 17.22 ? 547 TYR A CG  1 
ATOM   1642 C  CD1 . TYR A 1 211 ? 14.593  52.366  59.942 1.00 18.97 ? 547 TYR A CD1 1 
ATOM   1643 C  CD2 . TYR A 1 211 ? 14.284  52.331  57.579 1.00 18.64 ? 547 TYR A CD2 1 
ATOM   1644 C  CE1 . TYR A 1 211 ? 15.505  53.379  59.815 1.00 20.34 ? 547 TYR A CE1 1 
ATOM   1645 C  CE2 . TYR A 1 211 ? 15.229  53.366  57.431 1.00 19.68 ? 547 TYR A CE2 1 
ATOM   1646 C  CZ  . TYR A 1 211 ? 15.820  53.882  58.565 1.00 21.63 ? 547 TYR A CZ  1 
ATOM   1647 O  OH  . TYR A 1 211 ? 16.744  54.890  58.505 1.00 21.01 ? 547 TYR A OH  1 
ATOM   1648 N  N   . ASN A 1 212 ? 12.715  47.828  60.431 1.00 14.47 ? 548 ASN A N   1 
ATOM   1649 C  CA  . ASN A 1 212 ? 11.764  46.986  61.152 1.00 14.61 ? 548 ASN A CA  1 
ATOM   1650 C  C   . ASN A 1 212 ? 11.830  47.299  62.658 1.00 14.87 ? 548 ASN A C   1 
ATOM   1651 O  O   . ASN A 1 212 ? 12.794  46.921  63.358 1.00 12.33 ? 548 ASN A O   1 
ATOM   1652 C  CB  . ASN A 1 212 ? 12.062  45.525  60.880 1.00 15.64 ? 548 ASN A CB  1 
ATOM   1653 C  CG  . ASN A 1 212 ? 10.944  44.606  61.337 1.00 17.90 ? 548 ASN A CG  1 
ATOM   1654 O  OD1 . ASN A 1 212 ? 10.639  44.495  62.544 1.00 15.72 ? 548 ASN A OD1 1 
ATOM   1655 N  ND2 . ASN A 1 212 ? 10.333  43.931  60.383 1.00 19.20 ? 548 ASN A ND2 1 
ATOM   1656 N  N   . GLN A 1 213 ? 10.817  48.010  63.145 1.00 14.59 ? 549 GLN A N   1 
ATOM   1657 C  CA  . GLN A 1 213 ? 10.824  48.510  64.510 1.00 15.99 ? 549 GLN A CA  1 
ATOM   1658 C  C   . GLN A 1 213 ? 10.553  47.394  65.548 1.00 16.33 ? 549 GLN A C   1 
ATOM   1659 O  O   . GLN A 1 213 ? 11.255  47.289  66.562 1.00 16.57 ? 549 GLN A O   1 
ATOM   1660 C  CB  . GLN A 1 213 ? 9.822   49.660  64.688 1.00 16.15 ? 549 GLN A CB  1 
ATOM   1661 C  CG  . GLN A 1 213 ? 9.819   50.236  66.129 1.00 16.73 ? 549 GLN A CG  1 
ATOM   1662 C  CD  . GLN A 1 213 ? 9.052   51.523  66.294 1.00 17.41 ? 549 GLN A CD  1 
ATOM   1663 O  OE1 . GLN A 1 213 ? 8.103   51.791  65.564 1.00 18.79 ? 549 GLN A OE1 1 
ATOM   1664 N  NE2 . GLN A 1 213 ? 9.460   52.329  67.280 1.00 15.91 ? 549 GLN A NE2 1 
ATOM   1665 N  N   . ALA A 1 214 ? 9.571   46.554  65.239 1.00 17.05 ? 550 ALA A N   1 
ATOM   1666 C  CA  . ALA A 1 214 ? 9.038   45.544  66.159 1.00 17.12 ? 550 ALA A CA  1 
ATOM   1667 C  C   . ALA A 1 214 ? 8.159   44.509  65.420 1.00 18.15 ? 550 ALA A C   1 
ATOM   1668 O  O   . ALA A 1 214 ? 7.015   44.795  64.998 1.00 18.76 ? 550 ALA A O   1 
ATOM   1669 C  CB  . ALA A 1 214 ? 8.236   46.193  67.298 1.00 15.83 ? 550 ALA A CB  1 
ATOM   1670 N  N   . THR A 1 215 ? 8.678   43.291  65.314 1.00 18.67 ? 551 THR A N   1 
ATOM   1671 C  CA  . THR A 1 215 ? 7.921   42.144  64.785 1.00 19.01 ? 551 THR A CA  1 
ATOM   1672 C  C   . THR A 1 215 ? 8.150   41.049  65.818 1.00 19.16 ? 551 THR A C   1 
ATOM   1673 O  O   . THR A 1 215 ? 9.021   40.183  65.664 1.00 18.32 ? 551 THR A O   1 
ATOM   1674 C  CB  . THR A 1 215 ? 8.355   41.744  63.354 1.00 18.82 ? 551 THR A CB  1 
ATOM   1675 O  OG1 . THR A 1 215 ? 8.577   42.929  62.565 1.00 20.00 ? 551 THR A OG1 1 
ATOM   1676 C  CG2 . THR A 1 215 ? 7.270   40.832  62.664 1.00 17.26 ? 551 THR A CG2 1 
ATOM   1677 N  N   . PRO A 1 216 ? 7.377   41.096  66.916 1.00 19.65 ? 552 PRO A N   1 
ATOM   1678 C  CA  . PRO A 1 216 ? 7.726   40.237  68.070 1.00 18.95 ? 552 PRO A CA  1 
ATOM   1679 C  C   . PRO A 1 216 ? 7.751   38.748  67.739 1.00 18.85 ? 552 PRO A C   1 
ATOM   1680 O  O   . PRO A 1 216 ? 8.550   38.005  68.318 1.00 18.72 ? 552 PRO A O   1 
ATOM   1681 C  CB  . PRO A 1 216 ? 6.628   40.545  69.092 1.00 19.86 ? 552 PRO A CB  1 
ATOM   1682 C  CG  . PRO A 1 216 ? 6.090   41.915  68.675 1.00 19.96 ? 552 PRO A CG  1 
ATOM   1683 C  CD  . PRO A 1 216 ? 6.223   41.968  67.182 1.00 19.34 ? 552 PRO A CD  1 
ATOM   1684 N  N   . GLY A 1 217 ? 6.906   38.305  66.812 1.00 18.26 ? 553 GLY A N   1 
ATOM   1685 C  CA  . GLY A 1 217 ? 6.922   36.905  66.406 1.00 19.05 ? 553 GLY A CA  1 
ATOM   1686 C  C   . GLY A 1 217 ? 8.226   36.403  65.806 1.00 20.00 ? 553 GLY A C   1 
ATOM   1687 O  O   . GLY A 1 217 ? 8.434   35.193  65.706 1.00 20.25 ? 553 GLY A O   1 
ATOM   1688 N  N   . VAL A 1 218 ? 9.116   37.294  65.368 1.00 19.36 ? 554 VAL A N   1 
ATOM   1689 C  CA  . VAL A 1 218 ? 10.340  36.839  64.717 1.00 19.49 ? 554 VAL A CA  1 
ATOM   1690 C  C   . VAL A 1 218 ? 11.603  37.238  65.497 1.00 18.60 ? 554 VAL A C   1 
ATOM   1691 O  O   . VAL A 1 218 ? 12.724  37.240  64.945 1.00 18.00 ? 554 VAL A O   1 
ATOM   1692 C  CB  . VAL A 1 218 ? 10.428  37.329  63.263 1.00 19.56 ? 554 VAL A CB  1 
ATOM   1693 C  CG1 . VAL A 1 218 ? 9.181   36.824  62.417 1.00 22.83 ? 554 VAL A CG1 1 
ATOM   1694 C  CG2 . VAL A 1 218 ? 10.590  38.836  63.209 1.00 20.06 ? 554 VAL A CG2 1 
ATOM   1695 N  N   . LEU A 1 219 ? 11.430  37.503  66.786 1.00 18.35 ? 555 LEU A N   1 
ATOM   1696 C  CA  . LEU A 1 219 ? 12.539  37.919  67.657 1.00 17.57 ? 555 LEU A CA  1 
ATOM   1697 C  C   . LEU A 1 219 ? 13.789  37.023  67.579 1.00 17.71 ? 555 LEU A C   1 
ATOM   1698 O  O   . LEU A 1 219 ? 14.903  37.521  67.460 1.00 17.19 ? 555 LEU A O   1 
ATOM   1699 C  CB  . LEU A 1 219 ? 12.075  37.984  69.103 1.00 18.04 ? 555 LEU A CB  1 
ATOM   1700 C  CG  . LEU A 1 219 ? 13.201  38.396  70.078 1.00 18.76 ? 555 LEU A CG  1 
ATOM   1701 C  CD1 . LEU A 1 219 ? 13.561  39.850  69.862 1.00 17.80 ? 555 LEU A CD1 1 
ATOM   1702 C  CD2 . LEU A 1 219 ? 12.847  38.124  71.547 1.00 20.47 ? 555 LEU A CD2 1 
ATOM   1703 N  N   . ASN A 1 220 ? 13.614  35.704  67.679 1.00 17.62 ? 556 ASN A N   1 
ATOM   1704 C  CA  . ASN A 1 220 ? 14.763  34.785  67.672 1.00 17.30 ? 556 ASN A CA  1 
ATOM   1705 C  C   . ASN A 1 220 ? 15.610  34.921  66.402 1.00 16.84 ? 556 ASN A C   1 
ATOM   1706 O  O   . ASN A 1 220 ? 16.815  34.837  66.447 1.00 16.27 ? 556 ASN A O   1 
ATOM   1707 C  CB  . ASN A 1 220 ? 14.304  33.335  67.798 1.00 17.45 ? 556 ASN A CB  1 
ATOM   1708 C  CG  . ASN A 1 220 ? 15.466  32.377  67.878 1.00 16.91 ? 556 ASN A CG  1 
ATOM   1709 O  OD1 . ASN A 1 220 ? 16.146  32.312  68.899 1.00 15.97 ? 556 ASN A OD1 1 
ATOM   1710 N  ND2 . ASN A 1 220 ? 15.721  31.649  66.789 1.00 14.85 ? 556 ASN A ND2 1 
ATOM   1711 N  N   . TYR A 1 221 ? 14.935  35.147  65.285 1.00 16.42 ? 557 TYR A N   1 
ATOM   1712 C  CA  . TYR A 1 221 ? 15.557  35.268  63.983 1.00 17.17 ? 557 TYR A CA  1 
ATOM   1713 C  C   . TYR A 1 221 ? 16.344  36.567  63.890 1.00 16.70 ? 557 TYR A C   1 
ATOM   1714 O  O   . TYR A 1 221 ? 17.487  36.586  63.412 1.00 16.35 ? 557 TYR A O   1 
ATOM   1715 C  CB  . TYR A 1 221 ? 14.454  35.226  62.915 1.00 16.93 ? 557 TYR A CB  1 
ATOM   1716 C  CG  . TYR A 1 221 ? 14.917  35.242  61.476 1.00 19.03 ? 557 TYR A CG  1 
ATOM   1717 C  CD1 . TYR A 1 221 ? 15.581  34.157  60.932 1.00 22.02 ? 557 TYR A CD1 1 
ATOM   1718 C  CD2 . TYR A 1 221 ? 14.611  36.306  60.636 1.00 20.68 ? 557 TYR A CD2 1 
ATOM   1719 C  CE1 . TYR A 1 221 ? 15.982  34.155  59.604 1.00 23.18 ? 557 TYR A CE1 1 
ATOM   1720 C  CE2 . TYR A 1 221 ? 14.997  36.306  59.300 1.00 21.54 ? 557 TYR A CE2 1 
ATOM   1721 C  CZ  . TYR A 1 221 ? 15.686  35.234  58.799 1.00 23.61 ? 557 TYR A CZ  1 
ATOM   1722 O  OH  . TYR A 1 221 ? 16.068  35.223  57.481 1.00 23.36 ? 557 TYR A OH  1 
ATOM   1723 N  N   . VAL A 1 222 ? 15.716  37.643  64.366 1.00 16.19 ? 558 VAL A N   1 
ATOM   1724 C  CA  . VAL A 1 222 ? 16.350  38.954  64.480 1.00 15.97 ? 558 VAL A CA  1 
ATOM   1725 C  C   . VAL A 1 222 ? 17.582  38.929  65.387 1.00 15.63 ? 558 VAL A C   1 
ATOM   1726 O  O   . VAL A 1 222 ? 18.622  39.446  65.006 1.00 15.84 ? 558 VAL A O   1 
ATOM   1727 C  CB  . VAL A 1 222 ? 15.345  40.027  64.998 1.00 14.72 ? 558 VAL A CB  1 
ATOM   1728 C  CG1 . VAL A 1 222 ? 16.052  41.353  65.238 1.00 17.10 ? 558 VAL A CG1 1 
ATOM   1729 C  CG2 . VAL A 1 222 ? 14.251  40.185  64.009 1.00 15.15 ? 558 VAL A CG2 1 
ATOM   1730 N  N   . THR A 1 223 ? 17.496  38.309  66.564 1.00 15.86 ? 559 THR A N   1 
ATOM   1731 C  CA  . THR A 1 223 ? 18.665  38.257  67.437 1.00 15.18 ? 559 THR A CA  1 
ATOM   1732 C  C   . THR A 1 223 ? 19.815  37.451  66.817 1.00 14.60 ? 559 THR A C   1 
ATOM   1733 O  O   . THR A 1 223 ? 20.969  37.830  66.975 1.00 14.08 ? 559 THR A O   1 
ATOM   1734 C  CB  . THR A 1 223 ? 18.335  37.775  68.883 1.00 16.57 ? 559 THR A CB  1 
ATOM   1735 O  OG1 . THR A 1 223 ? 17.910  36.403  68.876 1.00 16.43 ? 559 THR A OG1 1 
ATOM   1736 C  CG2 . THR A 1 223 ? 17.218  38.654  69.508 1.00 14.05 ? 559 THR A CG2 1 
ATOM   1737 N  N   . THR A 1 224 ? 19.503  36.353  66.129 1.00 13.95 ? 560 THR A N   1 
ATOM   1738 C  CA  . THR A 1 224 ? 20.515  35.508  65.463 1.00 13.34 ? 560 THR A CA  1 
ATOM   1739 C  C   . THR A 1 224 ? 21.265  36.325  64.400 1.00 13.63 ? 560 THR A C   1 
ATOM   1740 O  O   . THR A 1 224 ? 22.496  36.333  64.356 1.00 13.63 ? 560 THR A O   1 
ATOM   1741 C  CB  . THR A 1 224 ? 19.854  34.246  64.817 1.00 13.79 ? 560 THR A CB  1 
ATOM   1742 O  OG1 . THR A 1 224 ? 19.074  33.541  65.799 1.00 15.24 ? 560 THR A OG1 1 
ATOM   1743 C  CG2 . THR A 1 224 ? 20.851  33.292  64.249 1.00 11.03 ? 560 THR A CG2 1 
ATOM   1744 N  N   . ASN A 1 225 ? 20.519  37.064  63.594 1.00 14.00 ? 561 ASN A N   1 
ATOM   1745 C  CA  . ASN A 1 225 ? 21.096  37.911  62.566 1.00 14.66 ? 561 ASN A CA  1 
ATOM   1746 C  C   . ASN A 1 225 ? 21.857  39.079  63.157 1.00 14.78 ? 561 ASN A C   1 
ATOM   1747 O  O   . ASN A 1 225 ? 23.003  39.312  62.802 1.00 15.22 ? 561 ASN A O   1 
ATOM   1748 C  CB  . ASN A 1 225 ? 20.015  38.388  61.578 1.00 14.88 ? 561 ASN A CB  1 
ATOM   1749 C  CG  . ASN A 1 225 ? 19.684  37.342  60.566 1.00 16.10 ? 561 ASN A CG  1 
ATOM   1750 O  OD1 . ASN A 1 225 ? 20.354  37.238  59.529 1.00 19.41 ? 561 ASN A OD1 1 
ATOM   1751 N  ND2 . ASN A 1 225 ? 18.700  36.515  60.868 1.00 13.70 ? 561 ASN A ND2 1 
ATOM   1752 N  N   . VAL A 1 226 ? 21.236  39.776  64.087 1.00 15.57 ? 562 VAL A N   1 
ATOM   1753 C  CA  . VAL A 1 226 ? 21.850  40.943  64.725 1.00 16.59 ? 562 VAL A CA  1 
ATOM   1754 C  C   . VAL A 1 226 ? 23.134  40.596  65.471 1.00 16.74 ? 562 VAL A C   1 
ATOM   1755 O  O   . VAL A 1 226 ? 24.131  41.321  65.409 1.00 16.91 ? 562 VAL A O   1 
ATOM   1756 C  CB  . VAL A 1 226 ? 20.793  41.648  65.621 1.00 16.85 ? 562 VAL A CB  1 
ATOM   1757 C  CG1 . VAL A 1 226 ? 21.451  42.552  66.641 1.00 18.73 ? 562 VAL A CG1 1 
ATOM   1758 C  CG2 . VAL A 1 226 ? 19.847  42.383  64.707 1.00 16.27 ? 562 VAL A CG2 1 
ATOM   1759 N  N   . ALA A 1 227 ? 23.126  39.438  66.119 1.00 16.21 ? 563 ALA A N   1 
ATOM   1760 C  CA  . ALA A 1 227 ? 24.293  38.936  66.814 1.00 15.81 ? 563 ALA A CA  1 
ATOM   1761 C  C   . ALA A 1 227 ? 25.404  38.545  65.841 1.00 15.33 ? 563 ALA A C   1 
ATOM   1762 O  O   . ALA A 1 227 ? 26.528  38.385  66.261 1.00 16.05 ? 563 ALA A O   1 
ATOM   1763 C  CB  . ALA A 1 227 ? 23.916  37.725  67.706 1.00 14.18 ? 563 ALA A CB  1 
ATOM   1764 N  N   . GLY A 1 228 ? 25.076  38.343  64.566 1.00 15.41 ? 564 GLY A N   1 
ATOM   1765 C  CA  . GLY A 1 228 ? 26.055  37.933  63.554 1.00 16.27 ? 564 GLY A CA  1 
ATOM   1766 C  C   . GLY A 1 228 ? 26.213  36.423  63.394 1.00 17.18 ? 564 GLY A C   1 
ATOM   1767 O  O   . GLY A 1 228 ? 27.142  35.966  62.724 1.00 16.21 ? 564 GLY A O   1 
ATOM   1768 N  N   . LEU A 1 229 ? 25.315  35.628  63.981 1.00 17.41 ? 565 LEU A N   1 
ATOM   1769 C  CA  . LEU A 1 229 ? 25.437  34.160  63.858 1.00 18.24 ? 565 LEU A CA  1 
ATOM   1770 C  C   . LEU A 1 229 ? 24.815  33.678  62.555 1.00 19.48 ? 565 LEU A C   1 
ATOM   1771 O  O   . LEU A 1 229 ? 25.033  32.547  62.125 1.00 19.60 ? 565 LEU A O   1 
ATOM   1772 C  CB  . LEU A 1 229 ? 24.741  33.459  65.019 1.00 17.75 ? 565 LEU A CB  1 
ATOM   1773 C  CG  . LEU A 1 229 ? 25.427  33.647  66.350 1.00 17.64 ? 565 LEU A CG  1 
ATOM   1774 C  CD1 . LEU A 1 229 ? 24.522  33.212  67.474 1.00 19.21 ? 565 LEU A CD1 1 
ATOM   1775 C  CD2 . LEU A 1 229 ? 26.748  32.851  66.350 1.00 17.18 ? 565 LEU A CD2 1 
ATOM   1776 N  N   . SER A 1 230 ? 23.985  34.529  61.979 1.00 19.49 ? 566 SER A N   1 
ATOM   1777 C  CA  . SER A 1 230 ? 23.407  34.308  60.675 1.00 21.18 ? 566 SER A CA  1 
ATOM   1778 C  C   . SER A 1 230 ? 23.572  35.552  59.810 1.00 21.31 ? 566 SER A C   1 
ATOM   1779 O  O   . SER A 1 230 ? 23.677  36.668  60.319 1.00 20.23 ? 566 SER A O   1 
ATOM   1780 C  CB  . SER A 1 230 ? 21.927  33.997  60.808 1.00 21.22 ? 566 SER A CB  1 
ATOM   1781 O  OG  . SER A 1 230 ? 21.338  33.959  59.531 1.00 25.45 ? 566 SER A OG  1 
ATOM   1782 N  N   . SER A 1 231 ? 23.581  35.339  58.498 1.00 22.66 ? 567 SER A N   1 
ATOM   1783 C  CA  . SER A 1 231 ? 23.698  36.426  57.524 1.00 23.24 ? 567 SER A CA  1 
ATOM   1784 C  C   . SER A 1 231 ? 22.506  36.508  56.561 1.00 23.00 ? 567 SER A C   1 
ATOM   1785 O  O   . SER A 1 231 ? 22.633  37.043  55.458 1.00 22.93 ? 567 SER A O   1 
ATOM   1786 C  CB  . SER A 1 231 ? 24.996  36.259  56.737 1.00 23.62 ? 567 SER A CB  1 
ATOM   1787 O  OG  . SER A 1 231 ? 24.916  35.124  55.892 1.00 25.62 ? 567 SER A OG  1 
ATOM   1788 N  N   . GLU A 1 232 ? 21.339  36.039  56.989 1.00 22.71 ? 568 GLU A N   1 
ATOM   1789 C  CA  . GLU A 1 232 ? 20.167  36.032  56.115 1.00 22.72 ? 568 GLU A CA  1 
ATOM   1790 C  C   . GLU A 1 232 ? 19.627  37.412  55.786 1.00 21.45 ? 568 GLU A C   1 
ATOM   1791 O  O   . GLU A 1 232 ? 19.160  37.646  54.680 1.00 20.82 ? 568 GLU A O   1 
ATOM   1792 C  CB  . GLU A 1 232 ? 19.056  35.191  56.703 1.00 23.28 ? 568 GLU A CB  1 
ATOM   1793 C  CG  . GLU A 1 232 ? 19.498  33.753  56.818 1.00 27.57 ? 568 GLU A CG  1 
ATOM   1794 C  CD  . GLU A 1 232 ? 18.669  32.998  57.786 1.00 32.81 ? 568 GLU A CD  1 
ATOM   1795 O  OE1 . GLU A 1 232 ? 18.941  33.097  59.019 1.00 35.10 ? 568 GLU A OE1 1 
ATOM   1796 O  OE2 . GLU A 1 232 ? 17.738  32.315  57.303 1.00 37.16 ? 568 GLU A OE2 1 
ATOM   1797 N  N   . PHE A 1 233 ? 19.687  38.321  56.741 1.00 20.02 ? 569 PHE A N   1 
ATOM   1798 C  CA  . PHE A 1 233 ? 19.386  39.689  56.435 1.00 19.50 ? 569 PHE A CA  1 
ATOM   1799 C  C   . PHE A 1 233 ? 20.250  40.162  55.249 1.00 18.58 ? 569 PHE A C   1 
ATOM   1800 O  O   . PHE A 1 233 ? 19.708  40.672  54.283 1.00 17.38 ? 569 PHE A O   1 
ATOM   1801 C  CB  . PHE A 1 233 ? 19.553  40.597  57.666 1.00 19.20 ? 569 PHE A CB  1 
ATOM   1802 C  CG  . PHE A 1 233 ? 18.504  40.400  58.745 1.00 19.95 ? 569 PHE A CG  1 
ATOM   1803 C  CD1 . PHE A 1 233 ? 17.430  39.532  58.589 1.00 20.00 ? 569 PHE A CD1 1 
ATOM   1804 C  CD2 . PHE A 1 233 ? 18.574  41.152  59.903 1.00 21.81 ? 569 PHE A CD2 1 
ATOM   1805 C  CE1 . PHE A 1 233 ? 16.499  39.391  59.577 1.00 23.44 ? 569 PHE A CE1 1 
ATOM   1806 C  CE2 . PHE A 1 233 ? 17.618  41.019  60.905 1.00 22.74 ? 569 PHE A CE2 1 
ATOM   1807 C  CZ  . PHE A 1 233 ? 16.592  40.152  60.746 1.00 22.64 ? 569 PHE A CZ  1 
ATOM   1808 N  N   . TYR A 1 234 ? 21.572  39.952  55.303 1.00 17.82 ? 570 TYR A N   1 
ATOM   1809 C  CA  . TYR A 1 234 ? 22.453  40.313  54.168 1.00 18.30 ? 570 TYR A CA  1 
ATOM   1810 C  C   . TYR A 1 234 ? 22.144  39.598  52.867 1.00 17.49 ? 570 TYR A C   1 
ATOM   1811 O  O   . TYR A 1 234 ? 22.251  40.186  51.818 1.00 17.17 ? 570 TYR A O   1 
ATOM   1812 C  CB  . TYR A 1 234 ? 23.940  40.098  54.516 1.00 18.16 ? 570 TYR A CB  1 
ATOM   1813 C  CG  . TYR A 1 234 ? 24.439  41.151  55.461 1.00 20.06 ? 570 TYR A CG  1 
ATOM   1814 C  CD1 . TYR A 1 234 ? 24.452  40.943  56.835 1.00 21.51 ? 570 TYR A CD1 1 
ATOM   1815 C  CD2 . TYR A 1 234 ? 24.887  42.368  54.980 1.00 22.77 ? 570 TYR A CD2 1 
ATOM   1816 C  CE1 . TYR A 1 234 ? 24.923  41.909  57.694 1.00 21.57 ? 570 TYR A CE1 1 
ATOM   1817 C  CE2 . TYR A 1 234 ? 25.357  43.348  55.835 1.00 21.95 ? 570 TYR A CE2 1 
ATOM   1818 C  CZ  . TYR A 1 234 ? 25.366  43.120  57.186 1.00 21.48 ? 570 TYR A CZ  1 
ATOM   1819 O  OH  . TYR A 1 234 ? 25.840  44.100  58.027 1.00 19.54 ? 570 TYR A OH  1 
ATOM   1820 N  N   . THR A 1 235 ? 21.802  38.320  52.927 1.00 17.55 ? 571 THR A N   1 
ATOM   1821 C  CA  . THR A 1 235 ? 21.479  37.557  51.714 1.00 17.42 ? 571 THR A CA  1 
ATOM   1822 C  C   . THR A 1 235 ? 20.195  38.132  51.052 1.00 17.54 ? 571 THR A C   1 
ATOM   1823 O  O   . THR A 1 235 ? 20.112  38.315  49.824 1.00 15.94 ? 571 THR A O   1 
ATOM   1824 C  CB  . THR A 1 235 ? 21.271  36.055  52.049 1.00 17.49 ? 571 THR A CB  1 
ATOM   1825 O  OG1 . THR A 1 235 ? 22.493  35.525  52.540 1.00 18.10 ? 571 THR A OG1 1 
ATOM   1826 C  CG2 . THR A 1 235 ? 20.775  35.223  50.827 1.00 16.70 ? 571 THR A CG2 1 
ATOM   1827 N  N   . THR A 1 236 ? 19.200  38.435  51.875 1.00 17.40 ? 572 THR A N   1 
ATOM   1828 C  CA  . THR A 1 236 ? 17.951  38.989  51.349 1.00 17.15 ? 572 THR A CA  1 
ATOM   1829 C  C   . THR A 1 236 ? 18.140  40.380  50.779 1.00 17.03 ? 572 THR A C   1 
ATOM   1830 O  O   . THR A 1 236 ? 17.589  40.704  49.725 1.00 16.64 ? 572 THR A O   1 
ATOM   1831 C  CB  . THR A 1 236 ? 16.914  39.047  52.400 1.00 17.42 ? 572 THR A CB  1 
ATOM   1832 O  OG1 . THR A 1 236 ? 16.777  37.743  52.935 1.00 19.04 ? 572 THR A OG1 1 
ATOM   1833 C  CG2 . THR A 1 236 ? 15.531  39.560  51.805 1.00 17.69 ? 572 THR A CG2 1 
ATOM   1834 N  N   . PHE A 1 237 ? 18.938  41.193  51.460 1.00 17.12 ? 573 PHE A N   1 
ATOM   1835 C  CA  . PHE A 1 237 ? 19.222  42.534  50.986 1.00 17.77 ? 573 PHE A CA  1 
ATOM   1836 C  C   . PHE A 1 237 ? 20.034  42.500  49.697 1.00 18.34 ? 573 PHE A C   1 
ATOM   1837 O  O   . PHE A 1 237 ? 19.811  43.346  48.811 1.00 18.09 ? 573 PHE A O   1 
ATOM   1838 C  CB  . PHE A 1 237 ? 19.900  43.387  52.066 1.00 18.32 ? 573 PHE A CB  1 
ATOM   1839 C  CG  . PHE A 1 237 ? 19.322  44.773  52.203 1.00 18.26 ? 573 PHE A CG  1 
ATOM   1840 C  CD1 . PHE A 1 237 ? 17.949  44.987  52.136 1.00 17.83 ? 573 PHE A CD1 1 
ATOM   1841 C  CD2 . PHE A 1 237 ? 20.138  45.863  52.444 1.00 16.93 ? 573 PHE A CD2 1 
ATOM   1842 C  CE1 . PHE A 1 237 ? 17.435  46.252  52.261 1.00 18.96 ? 573 PHE A CE1 1 
ATOM   1843 C  CE2 . PHE A 1 237 ? 19.598  47.144  52.577 1.00 17.34 ? 573 PHE A CE2 1 
ATOM   1844 C  CZ  . PHE A 1 237 ? 18.264  47.327  52.494 1.00 19.31 ? 573 PHE A CZ  1 
ATOM   1845 N  N   . LYS A 1 238 ? 20.947  41.530  49.577 1.00 17.81 ? 574 LYS A N   1 
ATOM   1846 C  CA  . LYS A 1 238 ? 21.620  41.280  48.306 1.00 18.00 ? 574 LYS A CA  1 
ATOM   1847 C  C   . LYS A 1 238 ? 20.662  40.907  47.166 1.00 17.59 ? 574 LYS A C   1 
ATOM   1848 O  O   . LYS A 1 238 ? 20.788  41.419  46.069 1.00 17.69 ? 574 LYS A O   1 
ATOM   1849 C  CB  . LYS A 1 238 ? 22.695  40.199  48.450 1.00 17.57 ? 574 LYS A CB  1 
ATOM   1850 C  CG  . LYS A 1 238 ? 23.616  40.137  47.261 1.00 19.64 ? 574 LYS A CG  1 
ATOM   1851 N  N   . ALA A 1 239 ? 19.754  39.969  47.420 1.00 17.78 ? 575 ALA A N   1 
ATOM   1852 C  CA  . ALA A 1 239 ? 18.680  39.630  46.476 1.00 18.00 ? 575 ALA A CA  1 
ATOM   1853 C  C   . ALA A 1 239 ? 17.831  40.875  46.164 1.00 17.00 ? 575 ALA A C   1 
ATOM   1854 O  O   . ALA A 1 239 ? 17.429  41.072  45.039 1.00 17.11 ? 575 ALA A O   1 
ATOM   1855 C  CB  . ALA A 1 239 ? 17.785  38.490  47.043 1.00 17.16 ? 575 ALA A CB  1 
ATOM   1856 N  N   . CYS A 1 240 ? 17.590  41.724  47.151 1.00 17.47 ? 576 CYS A N   1 
ATOM   1857 C  CA  . CYS A 1 240 ? 16.844  42.960  46.908 1.00 17.60 ? 576 CYS A CA  1 
ATOM   1858 C  C   . CYS A 1 240 ? 17.596  43.758  45.841 1.00 17.56 ? 576 CYS A C   1 
ATOM   1859 O  O   . CYS A 1 240 ? 17.028  44.189  44.857 1.00 15.39 ? 576 CYS A O   1 
ATOM   1860 C  CB  . CYS A 1 240 ? 16.725  43.778  48.168 1.00 17.70 ? 576 CYS A CB  1 
ATOM   1861 S  SG  . CYS A 1 240 ? 15.639  45.154  47.986 1.00 17.60 ? 576 CYS A SG  1 
ATOM   1862 N  N   . GLU A 1 241 ? 18.905  43.881  46.021 1.00 18.23 ? 577 GLU A N   1 
ATOM   1863 C  CA  . GLU A 1 241 ? 19.726  44.627  45.088 1.00 18.20 ? 577 GLU A CA  1 
ATOM   1864 C  C   . GLU A 1 241 ? 19.629  44.072  43.666 1.00 18.41 ? 577 GLU A C   1 
ATOM   1865 O  O   . GLU A 1 241 ? 19.564  44.837  42.698 1.00 17.76 ? 577 GLU A O   1 
ATOM   1866 C  CB  . GLU A 1 241 ? 21.183  44.598  45.530 1.00 18.69 ? 577 GLU A CB  1 
ATOM   1867 C  CG  . GLU A 1 241 ? 22.071  45.351  44.569 1.00 19.48 ? 577 GLU A CG  1 
ATOM   1868 C  CD  . GLU A 1 241 ? 23.500  45.155  44.843 1.00 22.94 ? 577 GLU A CD  1 
ATOM   1869 O  OE1 . GLU A 1 241 ? 23.895  43.986  45.097 1.00 22.16 ? 577 GLU A OE1 1 
ATOM   1870 O  OE2 . GLU A 1 241 ? 24.235  46.168  44.756 1.00 28.05 ? 577 GLU A OE2 1 
ATOM   1871 N  N   . GLN A 1 242 ? 19.654  42.746  43.556 1.00 18.53 ? 578 GLN A N   1 
ATOM   1872 C  CA  . GLN A 1 242 ? 19.734  42.074  42.260 1.00 19.39 ? 578 GLN A CA  1 
ATOM   1873 C  C   . GLN A 1 242 ? 18.375  42.164  41.589 1.00 19.19 ? 578 GLN A C   1 
ATOM   1874 O  O   . GLN A 1 242 ? 18.295  42.195  40.369 1.00 19.31 ? 578 GLN A O   1 
ATOM   1875 C  CB  . GLN A 1 242 ? 20.140  40.608  42.442 1.00 19.76 ? 578 GLN A CB  1 
ATOM   1876 C  CG  . GLN A 1 242 ? 20.386  39.836  41.164 1.00 22.42 ? 578 GLN A CG  1 
ATOM   1877 C  CD  . GLN A 1 242 ? 21.821  39.952  40.650 1.00 23.89 ? 578 GLN A CD  1 
ATOM   1878 O  OE1 . GLN A 1 242 ? 22.639  40.734  41.162 1.00 23.09 ? 578 GLN A OE1 1 
ATOM   1879 N  NE2 . GLN A 1 242 ? 22.133  39.154  39.638 1.00 26.79 ? 578 GLN A NE2 1 
ATOM   1880 N  N   . PHE A 1 243 ? 17.315  42.213  42.398 1.00 18.52 ? 579 PHE A N   1 
ATOM   1881 C  CA  . PHE A 1 243 ? 15.960  42.456  41.902 1.00 18.70 ? 579 PHE A CA  1 
ATOM   1882 C  C   . PHE A 1 243 ? 15.846  43.843  41.281 1.00 17.87 ? 579 PHE A C   1 
ATOM   1883 O  O   . PHE A 1 243 ? 15.328  43.992  40.164 1.00 17.67 ? 579 PHE A O   1 
ATOM   1884 C  CB  . PHE A 1 243 ? 14.974  42.293  43.052 1.00 19.24 ? 579 PHE A CB  1 
ATOM   1885 C  CG  . PHE A 1 243 ? 13.569  42.694  42.741 1.00 20.42 ? 579 PHE A CG  1 
ATOM   1886 C  CD1 . PHE A 1 243 ? 12.772  41.916  41.917 1.00 21.86 ? 579 PHE A CD1 1 
ATOM   1887 C  CD2 . PHE A 1 243 ? 13.018  43.821  43.338 1.00 23.01 ? 579 PHE A CD2 1 
ATOM   1888 C  CE1 . PHE A 1 243 ? 11.441  42.287  41.660 1.00 21.64 ? 579 PHE A CE1 1 
ATOM   1889 C  CE2 . PHE A 1 243 ? 11.692  44.198  43.097 1.00 22.52 ? 579 PHE A CE2 1 
ATOM   1890 C  CZ  . PHE A 1 243 ? 10.911  43.424  42.256 1.00 23.03 ? 579 PHE A CZ  1 
ATOM   1891 N  N   . LEU A 1 244 ? 16.344  44.846  42.000 1.00 16.90 ? 580 LEU A N   1 
ATOM   1892 C  CA  . LEU A 1 244 ? 16.342  46.211  41.507 1.00 16.70 ? 580 LEU A CA  1 
ATOM   1893 C  C   . LEU A 1 244 ? 17.206  46.339  40.229 1.00 17.89 ? 580 LEU A C   1 
ATOM   1894 O  O   . LEU A 1 244 ? 16.787  46.940  39.251 1.00 17.24 ? 580 LEU A O   1 
ATOM   1895 C  CB  . LEU A 1 244 ? 16.847  47.156  42.594 1.00 16.24 ? 580 LEU A CB  1 
ATOM   1896 C  CG  . LEU A 1 244 ? 15.990  47.275  43.865 1.00 15.58 ? 580 LEU A CG  1 
ATOM   1897 C  CD1 . LEU A 1 244 ? 16.619  48.250  44.861 1.00 10.55 ? 580 LEU A CD1 1 
ATOM   1898 C  CD2 . LEU A 1 244 ? 14.557  47.704  43.554 1.00 12.70 ? 580 LEU A CD2 1 
ATOM   1899 N  N   . LEU A 1 245 ? 18.392  45.740  40.228 1.00 18.62 ? 581 LEU A N   1 
ATOM   1900 C  CA  . LEU A 1 245 ? 19.247  45.795  39.031 1.00 20.13 ? 581 LEU A CA  1 
ATOM   1901 C  C   . LEU A 1 245 ? 18.638  45.056  37.834 1.00 21.69 ? 581 LEU A C   1 
ATOM   1902 O  O   . LEU A 1 245 ? 18.656  45.578  36.716 1.00 21.42 ? 581 LEU A O   1 
ATOM   1903 C  CB  . LEU A 1 245 ? 20.652  45.304  39.326 1.00 19.38 ? 581 LEU A CB  1 
ATOM   1904 C  CG  . LEU A 1 245 ? 21.410  46.191  40.314 1.00 19.15 ? 581 LEU A CG  1 
ATOM   1905 C  CD1 . LEU A 1 245 ? 22.674  45.496  40.778 1.00 18.95 ? 581 LEU A CD1 1 
ATOM   1906 C  CD2 . LEU A 1 245 ? 21.743  47.532  39.738 1.00 17.61 ? 581 LEU A CD2 1 
ATOM   1907 N  N   . ASP A 1 246 ? 18.070  43.874  38.069 1.00 23.59 ? 582 ASP A N   1 
ATOM   1908 C  CA  . ASP A 1 246 ? 17.377  43.127  37.014 1.00 25.40 ? 582 ASP A CA  1 
ATOM   1909 C  C   . ASP A 1 246 ? 16.185  43.866  36.395 1.00 26.67 ? 582 ASP A C   1 
ATOM   1910 O  O   . ASP A 1 246 ? 15.831  43.568  35.262 1.00 26.72 ? 582 ASP A O   1 
ATOM   1911 C  CB  . ASP A 1 246 ? 16.855  41.779  37.528 1.00 25.62 ? 582 ASP A CB  1 
ATOM   1912 C  CG  . ASP A 1 246 ? 17.958  40.793  37.875 1.00 27.08 ? 582 ASP A CG  1 
ATOM   1913 O  OD1 . ASP A 1 246 ? 19.156  41.041  37.600 1.00 28.86 ? 582 ASP A OD1 1 
ATOM   1914 O  OD2 . ASP A 1 246 ? 17.602  39.739  38.442 1.00 29.51 ? 582 ASP A OD2 1 
ATOM   1915 N  N   . ASN A 1 247 ? 15.590  44.818  37.117 1.00 28.23 ? 583 ASN A N   1 
ATOM   1916 C  CA  . ASN A 1 247 ? 14.325  45.451  36.714 1.00 29.99 ? 583 ASN A CA  1 
ATOM   1917 C  C   . ASN A 1 247 ? 14.413  46.928  36.309 1.00 31.37 ? 583 ASN A C   1 
ATOM   1918 O  O   . ASN A 1 247 ? 13.399  47.683  36.399 1.00 32.63 ? 583 ASN A O   1 
ATOM   1919 C  CB  . ASN A 1 247 ? 13.314  45.372  37.857 1.00 29.49 ? 583 ASN A CB  1 
ATOM   1920 C  CG  . ASN A 1 247 ? 12.622  44.032  37.947 1.00 31.34 ? 583 ASN A CG  1 
ATOM   1921 O  OD1 . ASN A 1 247 ? 11.570  43.821  37.324 1.00 33.41 ? 583 ASN A OD1 1 
ATOM   1922 N  ND2 . ASN A 1 247 ? 13.162  43.139  38.778 1.00 29.37 ? 583 ASN A ND2 1 
ATOM   1923 N  N   . ARG A 1 248 ? 15.592  47.358  35.898 1.00 32.05 ? 584 ARG A N   1 
ATOM   1924 C  CA  . ARG A 1 248 ? 15.761  48.720  35.404 1.00 32.88 ? 584 ARG A CA  1 
ATOM   1925 C  C   . ARG A 1 248 ? 15.156  48.882  34.004 1.00 33.17 ? 584 ARG A C   1 
ATOM   1926 O  O   . ARG A 1 248 ? 14.382  49.816  33.754 1.00 33.41 ? 584 ARG A O   1 
ATOM   1927 C  CB  . ARG A 1 248 ? 17.241  49.094  35.384 1.00 32.84 ? 584 ARG A CB  1 
ATOM   1928 C  CG  . ARG A 1 248 ? 17.880  49.055  36.761 1.00 33.53 ? 584 ARG A CG  1 
ATOM   1929 C  CD  . ARG A 1 248 ? 19.332  49.439  36.723 1.00 34.60 ? 584 ARG A CD  1 
ATOM   1930 N  NE  . ARG A 1 248 ? 20.115  48.494  35.929 1.00 35.16 ? 584 ARG A NE  1 
ATOM   1931 C  CZ  . ARG A 1 248 ? 21.437  48.378  35.976 1.00 34.28 ? 584 ARG A CZ  1 
ATOM   1932 N  NH1 . ARG A 1 248 ? 22.157  49.146  36.779 1.00 35.20 ? 584 ARG A NH1 1 
ATOM   1933 N  NH2 . ARG A 1 248 ? 22.042  47.475  35.214 1.00 35.84 ? 584 ARG A NH2 1 
ATOM   1934 N  N   . ALA B 1 16  ? 2.648   -4.146  52.638 1.00 33.88 ? 352 ALA B N   1 
ATOM   1935 C  CA  . ALA B 1 16  ? 3.369   -2.850  52.704 1.00 33.89 ? 352 ALA B CA  1 
ATOM   1936 C  C   . ALA B 1 16  ? 4.459   -2.877  53.768 1.00 33.91 ? 352 ALA B C   1 
ATOM   1937 O  O   . ALA B 1 16  ? 5.560   -2.366  53.545 1.00 34.66 ? 352 ALA B O   1 
ATOM   1938 C  CB  . ALA B 1 16  ? 2.389   -1.698  53.003 1.00 33.93 ? 352 ALA B CB  1 
ATOM   1939 N  N   . SER B 1 17  ? 4.153   -3.443  54.932 1.00 33.12 ? 353 SER B N   1 
ATOM   1940 C  CA  . SER B 1 17  ? 5.009   -3.263  56.105 1.00 32.50 ? 353 SER B CA  1 
ATOM   1941 C  C   . SER B 1 17  ? 6.404   -3.844  55.939 1.00 31.37 ? 353 SER B C   1 
ATOM   1942 O  O   . SER B 1 17  ? 7.391   -3.111  56.008 1.00 30.54 ? 353 SER B O   1 
ATOM   1943 C  CB  . SER B 1 17  ? 4.355   -3.842  57.347 1.00 32.45 ? 353 SER B CB  1 
ATOM   1944 O  OG  . SER B 1 17  ? 3.550   -2.860  57.938 1.00 34.01 ? 353 SER B OG  1 
ATOM   1945 N  N   . ALA B 1 18  ? 6.467   -5.153  55.730 1.00 30.53 ? 354 ALA B N   1 
ATOM   1946 C  CA  . ALA B 1 18  ? 7.729   -5.863  55.549 1.00 30.08 ? 354 ALA B CA  1 
ATOM   1947 C  C   . ALA B 1 18  ? 8.520   -5.261  54.403 1.00 29.77 ? 354 ALA B C   1 
ATOM   1948 O  O   . ALA B 1 18  ? 9.727   -5.033  54.516 1.00 29.19 ? 354 ALA B O   1 
ATOM   1949 C  CB  . ALA B 1 18  ? 7.465   -7.341  55.285 1.00 30.23 ? 354 ALA B CB  1 
ATOM   1950 N  N   . ARG B 1 19  ? 7.817   -4.966  53.317 1.00 29.45 ? 355 ARG B N   1 
ATOM   1951 C  CA  . ARG B 1 19  ? 8.441   -4.439  52.108 1.00 29.15 ? 355 ARG B CA  1 
ATOM   1952 C  C   . ARG B 1 19  ? 8.953   -3.020  52.354 1.00 28.00 ? 355 ARG B C   1 
ATOM   1953 O  O   . ARG B 1 19  ? 10.084  -2.682  52.000 1.00 27.72 ? 355 ARG B O   1 
ATOM   1954 C  CB  . ARG B 1 19  ? 7.450   -4.451  50.935 1.00 29.61 ? 355 ARG B CB  1 
ATOM   1955 C  CG  . ARG B 1 19  ? 6.548   -5.676  50.882 1.00 31.27 ? 355 ARG B CG  1 
ATOM   1956 C  CD  . ARG B 1 19  ? 5.717   -5.705  49.622 1.00 33.31 ? 355 ARG B CD  1 
ATOM   1957 N  NE  . ARG B 1 19  ? 6.512   -6.063  48.456 1.00 35.71 ? 355 ARG B NE  1 
ATOM   1958 C  CZ  . ARG B 1 19  ? 6.943   -7.295  48.171 1.00 38.02 ? 355 ARG B CZ  1 
ATOM   1959 N  NH1 . ARG B 1 19  ? 6.671   -8.327  48.969 1.00 38.93 ? 355 ARG B NH1 1 
ATOM   1960 N  NH2 . ARG B 1 19  ? 7.657   -7.501  47.073 1.00 39.10 ? 355 ARG B NH2 1 
ATOM   1961 N  N   . LYS B 1 20  ? 8.121   -2.189  52.970 1.00 26.56 ? 356 LYS B N   1 
ATOM   1962 C  CA  . LYS B 1 20  ? 8.521   -0.837  53.283 1.00 25.86 ? 356 LYS B CA  1 
ATOM   1963 C  C   . LYS B 1 20  ? 9.761   -0.853  54.183 1.00 24.29 ? 356 LYS B C   1 
ATOM   1964 O  O   . LYS B 1 20  ? 10.674  -0.056  53.988 1.00 23.92 ? 356 LYS B O   1 
ATOM   1965 C  CB  . LYS B 1 20  ? 7.391   -0.064  53.961 1.00 26.16 ? 356 LYS B CB  1 
ATOM   1966 C  CG  . LYS B 1 20  ? 7.748   1.364   54.372 1.00 28.72 ? 356 LYS B CG  1 
ATOM   1967 C  CD  . LYS B 1 20  ? 6.639   2.019   55.215 1.00 31.97 ? 356 LYS B CD  1 
ATOM   1968 C  CE  . LYS B 1 20  ? 7.018   3.424   55.672 1.00 32.82 ? 356 LYS B CE  1 
ATOM   1969 N  NZ  . LYS B 1 20  ? 6.335   3.839   56.963 1.00 35.86 ? 356 LYS B NZ  1 
ATOM   1970 N  N   . LYS B 1 21  ? 9.789   -1.752  55.159 1.00 22.45 ? 357 LYS B N   1 
ATOM   1971 C  CA  . LYS B 1 21  ? 10.940  -1.839  56.045 1.00 21.71 ? 357 LYS B CA  1 
ATOM   1972 C  C   . LYS B 1 21  ? 12.217  -2.179  55.282 1.00 20.43 ? 357 LYS B C   1 
ATOM   1973 O  O   . LYS B 1 21  ? 13.256  -1.599  55.531 1.00 20.23 ? 357 LYS B O   1 
ATOM   1974 C  CB  . LYS B 1 21  ? 10.736  -2.893  57.117 1.00 21.58 ? 357 LYS B CB  1 
ATOM   1975 C  CG  . LYS B 1 21  ? 11.863  -2.865  58.125 1.00 22.22 ? 357 LYS B CG  1 
ATOM   1976 C  CD  . LYS B 1 21  ? 11.973  -4.129  58.890 1.00 23.30 ? 357 LYS B CD  1 
ATOM   1977 C  CE  . LYS B 1 21  ? 13.118  -4.039  59.859 1.00 22.96 ? 357 LYS B CE  1 
ATOM   1978 N  NZ  . LYS B 1 21  ? 14.400  -3.956  59.157 1.00 20.88 ? 357 LYS B NZ  1 
ATOM   1979 N  N   . ILE B 1 22  ? 12.128  -3.122  54.362 1.00 19.40 ? 358 ILE B N   1 
ATOM   1980 C  CA  . ILE B 1 22  ? 13.308  -3.584  53.634 1.00 19.14 ? 358 ILE B CA  1 
ATOM   1981 C  C   . ILE B 1 22  ? 13.792  -2.495  52.675 1.00 19.28 ? 358 ILE B C   1 
ATOM   1982 O  O   . ILE B 1 22  ? 14.998  -2.275  52.537 1.00 18.25 ? 358 ILE B O   1 
ATOM   1983 C  CB  . ILE B 1 22  ? 13.031  -4.944  52.961 1.00 19.25 ? 358 ILE B CB  1 
ATOM   1984 C  CG1 . ILE B 1 22  ? 12.915  -6.013  54.054 1.00 19.09 ? 358 ILE B CG1 1 
ATOM   1985 C  CG2 . ILE B 1 22  ? 14.136  -5.330  51.978 1.00 16.79 ? 358 ILE B CG2 1 
ATOM   1986 C  CD1 . ILE B 1 22  ? 12.180  -7.265  53.644 1.00 17.31 ? 358 ILE B CD1 1 
ATOM   1987 N  N   . ARG B 1 23  ? 12.855  -1.765  52.067 1.00 19.26 ? 359 ARG B N   1 
ATOM   1988 C  CA  . ARG B 1 23  ? 13.221  -0.636  51.209 1.00 19.64 ? 359 ARG B CA  1 
ATOM   1989 C  C   . ARG B 1 23  ? 13.964  0.448   51.989 1.00 18.59 ? 359 ARG B C   1 
ATOM   1990 O  O   . ARG B 1 23  ? 14.999  0.939   51.535 1.00 17.42 ? 359 ARG B O   1 
ATOM   1991 C  CB  . ARG B 1 23  ? 11.982  -0.047  50.538 1.00 20.57 ? 359 ARG B CB  1 
ATOM   1992 C  CG  . ARG B 1 23  ? 12.252  1.068   49.512 1.00 23.89 ? 359 ARG B CG  1 
ATOM   1993 C  CD  . ARG B 1 23  ? 10.926  1.663   48.943 1.00 27.36 ? 359 ARG B CD  1 
ATOM   1994 N  NE  . ARG B 1 23  ? 10.015  2.134   50.000 1.00 29.50 ? 359 ARG B NE  1 
ATOM   1995 C  CZ  . ARG B 1 23  ? 10.151  3.258   50.706 1.00 32.62 ? 359 ARG B CZ  1 
ATOM   1996 N  NH1 . ARG B 1 23  ? 11.176  4.085   50.508 1.00 34.17 ? 359 ARG B NH1 1 
ATOM   1997 N  NH2 . ARG B 1 23  ? 9.256   3.557   51.646 1.00 34.41 ? 359 ARG B NH2 1 
ATOM   1998 N  N   . LEU B 1 24  ? 13.429  0.825   53.150 1.00 18.07 ? 360 LEU B N   1 
ATOM   1999 C  CA  . LEU B 1 24  ? 14.060  1.830   53.996 1.00 18.34 ? 360 LEU B CA  1 
ATOM   2000 C  C   . LEU B 1 24  ? 15.444  1.358   54.450 1.00 17.89 ? 360 LEU B C   1 
ATOM   2001 O  O   . LEU B 1 24  ? 16.415  2.123   54.412 1.00 18.27 ? 360 LEU B O   1 
ATOM   2002 C  CB  . LEU B 1 24  ? 13.185  2.170   55.222 1.00 18.41 ? 360 LEU B CB  1 
ATOM   2003 C  CG  . LEU B 1 24  ? 11.862  2.931   54.991 1.00 19.50 ? 360 LEU B CG  1 
ATOM   2004 C  CD1 . LEU B 1 24  ? 10.999  2.929   56.271 1.00 18.69 ? 360 LEU B CD1 1 
ATOM   2005 C  CD2 . LEU B 1 24  ? 12.123  4.359   54.506 1.00 19.87 ? 360 LEU B CD2 1 
ATOM   2006 N  N   . ASP B 1 25  ? 15.538  0.101   54.874 1.00 17.65 ? 361 ASP B N   1 
ATOM   2007 C  CA  . ASP B 1 25  ? 16.844  -0.487  55.223 1.00 17.57 ? 361 ASP B CA  1 
ATOM   2008 C  C   . ASP B 1 25  ? 17.841  -0.357  54.073 1.00 17.75 ? 361 ASP B C   1 
ATOM   2009 O  O   . ASP B 1 25  ? 18.960  0.131   54.266 1.00 16.51 ? 361 ASP B O   1 
ATOM   2010 C  CB  . ASP B 1 25  ? 16.714  -1.973  55.583 1.00 17.73 ? 361 ASP B CB  1 
ATOM   2011 C  CG  . ASP B 1 25  ? 15.911  -2.206  56.845 1.00 17.03 ? 361 ASP B CG  1 
ATOM   2012 O  OD1 . ASP B 1 25  ? 15.819  -1.287  57.663 1.00 16.18 ? 361 ASP B OD1 1 
ATOM   2013 O  OD2 . ASP B 1 25  ? 15.365  -3.312  57.010 1.00 19.37 ? 361 ASP B OD2 1 
ATOM   2014 N  N   . ARG B 1 26  ? 17.425  -0.787  52.885 1.00 18.06 ? 362 ARG B N   1 
ATOM   2015 C  CA  . ARG B 1 26  ? 18.310  -0.751  51.725 1.00 19.77 ? 362 ARG B CA  1 
ATOM   2016 C  C   . ARG B 1 26  ? 18.695  0.684   51.401 1.00 20.66 ? 362 ARG B C   1 
ATOM   2017 O  O   . ARG B 1 26  ? 19.820  0.945   51.010 1.00 20.57 ? 362 ARG B O   1 
ATOM   2018 C  CB  . ARG B 1 26  ? 17.677  -1.431  50.523 1.00 19.59 ? 362 ARG B CB  1 
ATOM   2019 C  CG  . ARG B 1 26  ? 17.537  -2.925  50.734 1.00 20.64 ? 362 ARG B CG  1 
ATOM   2020 C  CD  . ARG B 1 26  ? 17.380  -3.711  49.469 1.00 21.58 ? 362 ARG B CD  1 
ATOM   2021 N  NE  . ARG B 1 26  ? 17.287  -5.141  49.785 1.00 23.23 ? 362 ARG B NE  1 
ATOM   2022 C  CZ  . ARG B 1 26  ? 18.326  -5.954  50.000 1.00 23.81 ? 362 ARG B CZ  1 
ATOM   2023 N  NH1 . ARG B 1 26  ? 19.573  -5.496  49.917 1.00 25.31 ? 362 ARG B NH1 1 
ATOM   2024 N  NH2 . ARG B 1 26  ? 18.122  -7.242  50.305 1.00 22.90 ? 362 ARG B NH2 1 
ATOM   2025 N  N   . LYS B 1 27  ? 17.764  1.609   51.600 1.00 21.98 ? 363 LYS B N   1 
ATOM   2026 C  CA  . LYS B 1 27  ? 18.026  2.996   51.281 1.00 23.27 ? 363 LYS B CA  1 
ATOM   2027 C  C   . LYS B 1 27  ? 19.007  3.618   52.256 1.00 23.66 ? 363 LYS B C   1 
ATOM   2028 O  O   . LYS B 1 27  ? 19.853  4.397   51.846 1.00 23.10 ? 363 LYS B O   1 
ATOM   2029 C  CB  . LYS B 1 27  ? 16.733  3.804   51.242 1.00 23.51 ? 363 LYS B CB  1 
ATOM   2030 C  CG  . LYS B 1 27  ? 16.894  5.123   50.511 1.00 25.50 ? 363 LYS B CG  1 
ATOM   2031 C  CD  . LYS B 1 27  ? 15.737  6.037   50.756 1.00 27.91 ? 363 LYS B CD  1 
ATOM   2032 C  CE  . LYS B 1 27  ? 16.031  7.443   50.271 1.00 28.54 ? 363 LYS B CE  1 
ATOM   2033 N  NZ  . LYS B 1 27  ? 14.735  8.124   50.016 1.00 29.55 ? 363 LYS B NZ  1 
ATOM   2034 N  N   . TYR B 1 28  ? 18.918  3.258   53.534 1.00 24.52 ? 364 TYR B N   1 
ATOM   2035 C  CA  . TYR B 1 28  ? 19.591  4.040   54.579 1.00 26.05 ? 364 TYR B CA  1 
ATOM   2036 C  C   . TYR B 1 28  ? 20.724  3.352   55.331 1.00 27.52 ? 364 TYR B C   1 
ATOM   2037 O  O   . TYR B 1 28  ? 21.352  3.960   56.201 1.00 28.06 ? 364 TYR B O   1 
ATOM   2038 C  CB  . TYR B 1 28  ? 18.552  4.554   55.564 1.00 26.30 ? 364 TYR B CB  1 
ATOM   2039 C  CG  . TYR B 1 28  ? 17.720  5.659   54.973 1.00 27.23 ? 364 TYR B CG  1 
ATOM   2040 C  CD1 . TYR B 1 28  ? 18.298  6.898   54.688 1.00 29.60 ? 364 TYR B CD1 1 
ATOM   2041 C  CD2 . TYR B 1 28  ? 16.383  5.475   54.689 1.00 27.37 ? 364 TYR B CD2 1 
ATOM   2042 C  CE1 . TYR B 1 28  ? 17.564  7.922   54.151 1.00 29.73 ? 364 TYR B CE1 1 
ATOM   2043 C  CE2 . TYR B 1 28  ? 15.629  6.499   54.160 1.00 29.24 ? 364 TYR B CE2 1 
ATOM   2044 C  CZ  . TYR B 1 28  ? 16.230  7.719   53.894 1.00 30.91 ? 364 TYR B CZ  1 
ATOM   2045 O  OH  . TYR B 1 28  ? 15.509  8.731   53.337 1.00 33.09 ? 364 TYR B OH  1 
ATOM   2046 N  N   . ILE B 1 29  ? 20.991  2.100   54.987 1.00 28.55 ? 365 ILE B N   1 
ATOM   2047 C  CA  . ILE B 1 29  ? 22.086  1.365   55.578 1.00 29.76 ? 365 ILE B CA  1 
ATOM   2048 C  C   . ILE B 1 29  ? 23.453  1.950   55.143 1.00 30.90 ? 365 ILE B C   1 
ATOM   2049 O  O   . ILE B 1 29  ? 23.650  2.375   53.994 1.00 30.94 ? 365 ILE B O   1 
ATOM   2050 C  CB  . ILE B 1 29  ? 22.001  -0.128  55.192 1.00 29.81 ? 365 ILE B CB  1 
ATOM   2051 C  CG1 . ILE B 1 29  ? 22.893  -0.983  56.094 1.00 30.72 ? 365 ILE B CG1 1 
ATOM   2052 C  CG2 . ILE B 1 29  ? 22.310  -0.310  53.718 1.00 27.16 ? 365 ILE B CG2 1 
ATOM   2053 C  CD1 . ILE B 1 29  ? 22.346  -1.179  57.489 1.00 29.20 ? 365 ILE B CD1 1 
ATOM   2054 N  N   . VAL B 1 30  ? 24.382  1.912   56.095 1.00 32.05 ? 366 VAL B N   1 
ATOM   2055 C  CA  . VAL B 1 30  ? 25.714  2.520   56.022 1.00 32.57 ? 366 VAL B CA  1 
ATOM   2056 C  C   . VAL B 1 30  ? 25.673  3.994   55.681 1.00 33.28 ? 366 VAL B C   1 
ATOM   2057 O  O   . VAL B 1 30  ? 25.321  4.803   56.553 1.00 35.37 ? 366 VAL B O   1 
ATOM   2058 C  CB  . VAL B 1 30  ? 26.724  1.747   55.127 1.00 32.26 ? 366 VAL B CB  1 
ATOM   2059 C  CG1 . VAL B 1 30  ? 27.863  1.289   55.982 1.00 32.23 ? 366 VAL B CG1 1 
ATOM   2060 C  CG2 . VAL B 1 30  ? 26.085  0.581   54.404 1.00 32.30 ? 366 VAL B CG2 1 
ATOM   2061 N  N   . LEU B 1 39  ? 29.330  12.842  62.909 1.00 33.06 ? 375 LEU B N   1 
ATOM   2062 C  CA  . LEU B 1 39  ? 28.114  13.305  63.556 1.00 33.25 ? 375 LEU B CA  1 
ATOM   2063 C  C   . LEU B 1 39  ? 28.414  14.002  64.881 1.00 33.08 ? 375 LEU B C   1 
ATOM   2064 O  O   . LEU B 1 39  ? 27.598  14.799  65.345 1.00 34.42 ? 375 LEU B O   1 
ATOM   2065 C  CB  . LEU B 1 39  ? 27.125  12.154  63.790 1.00 33.31 ? 375 LEU B CB  1 
ATOM   2066 C  CG  . LEU B 1 39  ? 26.422  11.534  62.569 1.00 34.35 ? 375 LEU B CG  1 
ATOM   2067 C  CD1 . LEU B 1 39  ? 27.243  10.419  61.992 1.00 35.77 ? 375 LEU B CD1 1 
ATOM   2068 C  CD2 . LEU B 1 39  ? 25.056  10.984  62.933 1.00 35.11 ? 375 LEU B CD2 1 
ATOM   2069 N  N   . SER B 1 40  ? 29.568  13.707  65.485 1.00 32.16 ? 376 SER B N   1 
ATOM   2070 C  CA  . SER B 1 40  ? 29.969  14.322  66.748 1.00 31.58 ? 376 SER B CA  1 
ATOM   2071 C  C   . SER B 1 40  ? 30.860  15.514  66.464 1.00 30.49 ? 376 SER B C   1 
ATOM   2072 O  O   . SER B 1 40  ? 31.494  15.574  65.416 1.00 30.93 ? 376 SER B O   1 
ATOM   2073 C  CB  . SER B 1 40  ? 30.707  13.323  67.646 1.00 31.64 ? 376 SER B CB  1 
ATOM   2074 O  OG  . SER B 1 40  ? 32.098  13.306  67.351 1.00 33.63 ? 376 SER B OG  1 
ATOM   2075 N  N   . VAL B 1 41  ? 30.893  16.468  67.385 1.00 28.98 ? 377 VAL B N   1 
ATOM   2076 C  CA  . VAL B 1 41  ? 31.800  17.595  67.272 1.00 27.97 ? 377 VAL B CA  1 
ATOM   2077 C  C   . VAL B 1 41  ? 32.683  17.659  68.508 1.00 27.54 ? 377 VAL B C   1 
ATOM   2078 O  O   . VAL B 1 41  ? 32.229  17.366  69.612 1.00 26.07 ? 377 VAL B O   1 
ATOM   2079 C  CB  . VAL B 1 41  ? 31.088  18.967  67.089 1.00 27.83 ? 377 VAL B CB  1 
ATOM   2080 C  CG1 . VAL B 1 41  ? 30.547  19.108  65.668 1.00 27.58 ? 377 VAL B CG1 1 
ATOM   2081 C  CG2 . VAL B 1 41  ? 29.998  19.178  68.132 1.00 28.00 ? 377 VAL B CG2 1 
ATOM   2082 N  N   . PRO B 1 42  ? 33.950  18.055  68.317 1.00 27.32 ? 378 PRO B N   1 
ATOM   2083 C  CA  . PRO B 1 42  ? 34.820  18.192  69.457 1.00 27.65 ? 378 PRO B CA  1 
ATOM   2084 C  C   . PRO B 1 42  ? 34.319  19.297  70.356 1.00 27.59 ? 378 PRO B C   1 
ATOM   2085 O  O   . PRO B 1 42  ? 33.966  20.375  69.889 1.00 27.11 ? 378 PRO B O   1 
ATOM   2086 C  CB  . PRO B 1 42  ? 36.178  18.557  68.847 1.00 27.48 ? 378 PRO B CB  1 
ATOM   2087 C  CG  . PRO B 1 42  ? 36.044  18.411  67.383 1.00 27.60 ? 378 PRO B CG  1 
ATOM   2088 C  CD  . PRO B 1 42  ? 34.602  18.467  67.063 1.00 27.60 ? 378 PRO B CD  1 
ATOM   2089 N  N   . TRP B 1 43  ? 34.258  18.994  71.637 1.00 28.06 ? 379 TRP B N   1 
ATOM   2090 C  CA  . TRP B 1 43  ? 33.911  19.970  72.635 1.00 28.61 ? 379 TRP B CA  1 
ATOM   2091 C  C   . TRP B 1 43  ? 35.178  20.698  73.114 1.00 28.77 ? 379 TRP B C   1 
ATOM   2092 O  O   . TRP B 1 43  ? 36.223  20.087  73.258 1.00 27.96 ? 379 TRP B O   1 
ATOM   2093 C  CB  . TRP B 1 43  ? 33.252  19.260  73.798 1.00 28.77 ? 379 TRP B CB  1 
ATOM   2094 C  CG  . TRP B 1 43  ? 33.180  20.111  74.982 1.00 29.77 ? 379 TRP B CG  1 
ATOM   2095 C  CD1 . TRP B 1 43  ? 34.129  20.249  75.981 1.00 29.84 ? 379 TRP B CD1 1 
ATOM   2096 C  CD2 . TRP B 1 43  ? 32.120  20.982  75.302 1.00 28.62 ? 379 TRP B CD2 1 
ATOM   2097 N  NE1 . TRP B 1 43  ? 33.688  21.163  76.908 1.00 30.67 ? 379 TRP B NE1 1 
ATOM   2098 C  CE2 . TRP B 1 43  ? 32.451  21.617  76.518 1.00 28.83 ? 379 TRP B CE2 1 
ATOM   2099 C  CE3 . TRP B 1 43  ? 30.891  21.272  74.689 1.00 29.68 ? 379 TRP B CE3 1 
ATOM   2100 C  CZ2 . TRP B 1 43  ? 31.614  22.537  77.119 1.00 28.97 ? 379 TRP B CZ2 1 
ATOM   2101 C  CZ3 . TRP B 1 43  ? 30.066  22.175  75.282 1.00 29.79 ? 379 TRP B CZ3 1 
ATOM   2102 C  CH2 . TRP B 1 43  ? 30.424  22.798  76.498 1.00 29.99 ? 379 TRP B CH2 1 
ATOM   2103 N  N   . ASP B 1 44  ? 35.042  21.997  73.383 1.00 29.41 ? 380 ASP B N   1 
ATOM   2104 C  CA  . ASP B 1 44  ? 36.138  22.861  73.836 1.00 30.50 ? 380 ASP B CA  1 
ATOM   2105 C  C   . ASP B 1 44  ? 35.541  23.959  74.717 1.00 30.25 ? 380 ASP B C   1 
ATOM   2106 O  O   . ASP B 1 44  ? 34.613  24.659  74.282 1.00 30.67 ? 380 ASP B O   1 
ATOM   2107 C  CB  . ASP B 1 44  ? 36.815  23.487  72.613 1.00 31.12 ? 380 ASP B CB  1 
ATOM   2108 C  CG  . ASP B 1 44  ? 38.151  24.155  72.923 1.00 33.63 ? 380 ASP B CG  1 
ATOM   2109 O  OD1 . ASP B 1 44  ? 38.670  24.063  74.059 1.00 36.39 ? 380 ASP B OD1 1 
ATOM   2110 O  OD2 . ASP B 1 44  ? 38.690  24.799  71.993 1.00 37.35 ? 380 ASP B OD2 1 
ATOM   2111 N  N   . PRO B 1 45  ? 36.047  24.122  75.954 1.00 30.15 ? 381 PRO B N   1 
ATOM   2112 C  CA  . PRO B 1 45  ? 35.538  25.187  76.821 1.00 29.94 ? 381 PRO B CA  1 
ATOM   2113 C  C   . PRO B 1 45  ? 35.484  26.550  76.139 1.00 29.98 ? 381 PRO B C   1 
ATOM   2114 O  O   . PRO B 1 45  ? 34.558  27.324  76.386 1.00 30.35 ? 381 PRO B O   1 
ATOM   2115 C  CB  . PRO B 1 45  ? 36.543  25.211  77.980 1.00 30.45 ? 381 PRO B CB  1 
ATOM   2116 C  CG  . PRO B 1 45  ? 37.675  24.291  77.576 1.00 29.97 ? 381 PRO B CG  1 
ATOM   2117 C  CD  . PRO B 1 45  ? 37.066  23.318  76.648 1.00 30.04 ? 381 PRO B CD  1 
ATOM   2118 N  N   . SER B 1 46  ? 36.451  26.816  75.265 1.00 29.62 ? 382 SER B N   1 
ATOM   2119 C  CA  . SER B 1 46  ? 36.526  28.070  74.515 1.00 29.43 ? 382 SER B CA  1 
ATOM   2120 C  C   . SER B 1 46  ? 35.464  28.231  73.414 1.00 29.62 ? 382 SER B C   1 
ATOM   2121 O  O   . SER B 1 46  ? 35.419  29.263  72.744 1.00 29.59 ? 382 SER B O   1 
ATOM   2122 C  CB  . SER B 1 46  ? 37.903  28.199  73.874 1.00 29.53 ? 382 SER B CB  1 
ATOM   2123 O  OG  . SER B 1 46  ? 38.071  27.226  72.856 1.00 29.69 ? 382 SER B OG  1 
ATOM   2124 N  N   . ASN B 1 47  ? 34.637  27.218  73.196 1.00 29.39 ? 383 ASN B N   1 
ATOM   2125 C  CA  . ASN B 1 47  ? 33.517  27.371  72.278 1.00 29.54 ? 383 ASN B CA  1 
ATOM   2126 C  C   . ASN B 1 47  ? 32.201  26.831  72.801 1.00 28.65 ? 383 ASN B C   1 
ATOM   2127 O  O   . ASN B 1 47  ? 31.288  26.549  72.021 1.00 29.18 ? 383 ASN B O   1 
ATOM   2128 C  CB  . ASN B 1 47  ? 33.870  26.824  70.888 1.00 29.95 ? 383 ASN B CB  1 
ATOM   2129 C  CG  . ASN B 1 47  ? 34.623  27.852  70.051 1.00 31.66 ? 383 ASN B CG  1 
ATOM   2130 O  OD1 . ASN B 1 47  ? 35.834  27.740  69.875 1.00 33.64 ? 383 ASN B OD1 1 
ATOM   2131 N  ND2 . ASN B 1 47  ? 33.909  28.897  69.574 1.00 33.27 ? 383 ASN B ND2 1 
ATOM   2132 N  N   . GLN B 1 48  ? 32.073  26.775  74.123 1.00 27.58 ? 384 GLN B N   1 
ATOM   2133 C  CA  . GLN B 1 48  ? 30.874  26.229  74.755 1.00 27.12 ? 384 GLN B CA  1 
ATOM   2134 C  C   . GLN B 1 48  ? 29.624  27.034  74.412 1.00 25.65 ? 384 GLN B C   1 
ATOM   2135 O  O   . GLN B 1 48  ? 28.549  26.473  74.256 1.00 25.24 ? 384 GLN B O   1 
ATOM   2136 C  CB  . GLN B 1 48  ? 31.029  26.144  76.279 1.00 27.30 ? 384 GLN B CB  1 
ATOM   2137 C  CG  . GLN B 1 48  ? 30.804  27.440  77.044 1.00 28.56 ? 384 GLN B CG  1 
ATOM   2138 C  CD  . GLN B 1 48  ? 31.396  27.392  78.437 1.00 30.47 ? 384 GLN B CD  1 
ATOM   2139 O  OE1 . GLN B 1 48  ? 32.555  27.049  78.602 1.00 34.14 ? 384 GLN B OE1 1 
ATOM   2140 N  NE2 . GLN B 1 48  ? 30.606  27.738  79.445 1.00 31.77 ? 384 GLN B NE2 1 
ATOM   2141 N  N   . VAL B 1 49  ? 29.763  28.347  74.298 1.00 24.46 ? 385 VAL B N   1 
ATOM   2142 C  CA  . VAL B 1 49  ? 28.593  29.192  74.047 1.00 23.72 ? 385 VAL B CA  1 
ATOM   2143 C  C   . VAL B 1 49  ? 28.105  28.977  72.617 1.00 22.90 ? 385 VAL B C   1 
ATOM   2144 O  O   . VAL B 1 49  ? 26.928  28.837  72.401 1.00 23.76 ? 385 VAL B O   1 
ATOM   2145 C  CB  . VAL B 1 49  ? 28.874  30.667  74.299 1.00 23.35 ? 385 VAL B CB  1 
ATOM   2146 C  CG1 . VAL B 1 49  ? 27.576  31.477  74.185 1.00 22.76 ? 385 VAL B CG1 1 
ATOM   2147 C  CG2 . VAL B 1 49  ? 29.532  30.857  75.686 1.00 22.95 ? 385 VAL B CG2 1 
ATOM   2148 N  N   . TYR B 1 50  ? 29.022  28.940  71.657 1.00 22.61 ? 386 TYR B N   1 
ATOM   2149 C  CA  . TYR B 1 50  ? 28.667  28.695  70.271 1.00 22.57 ? 386 TYR B CA  1 
ATOM   2150 C  C   . TYR B 1 50  ? 28.086  27.272  70.081 1.00 22.30 ? 386 TYR B C   1 
ATOM   2151 O  O   . TYR B 1 50  ? 26.985  27.103  69.503 1.00 21.66 ? 386 TYR B O   1 
ATOM   2152 C  CB  . TYR B 1 50  ? 29.854  28.951  69.312 1.00 22.71 ? 386 TYR B CB  1 
ATOM   2153 C  CG  . TYR B 1 50  ? 29.439  28.594  67.909 1.00 23.98 ? 386 TYR B CG  1 
ATOM   2154 C  CD1 . TYR B 1 50  ? 28.575  29.422  67.187 1.00 26.24 ? 386 TYR B CD1 1 
ATOM   2155 C  CD2 . TYR B 1 50  ? 29.805  27.371  67.354 1.00 24.77 ? 386 TYR B CD2 1 
ATOM   2156 C  CE1 . TYR B 1 50  ? 28.129  29.054  65.917 1.00 28.90 ? 386 TYR B CE1 1 
ATOM   2157 C  CE2 . TYR B 1 50  ? 29.372  26.989  66.109 1.00 27.29 ? 386 TYR B CE2 1 
ATOM   2158 C  CZ  . TYR B 1 50  ? 28.540  27.824  65.392 1.00 29.56 ? 386 TYR B CZ  1 
ATOM   2159 O  OH  . TYR B 1 50  ? 28.137  27.422  64.154 1.00 33.20 ? 386 TYR B OH  1 
ATOM   2160 N  N   . LEU B 1 51  ? 28.794  26.262  70.575 1.00 21.66 ? 387 LEU B N   1 
ATOM   2161 C  CA  . LEU B 1 51  ? 28.338  24.853  70.448 1.00 22.31 ? 387 LEU B CA  1 
ATOM   2162 C  C   . LEU B 1 51  ? 26.926  24.662  70.986 1.00 22.10 ? 387 LEU B C   1 
ATOM   2163 O  O   . LEU B 1 51  ? 26.098  23.998  70.374 1.00 22.00 ? 387 LEU B O   1 
ATOM   2164 C  CB  . LEU B 1 51  ? 29.317  23.898  71.148 1.00 22.47 ? 387 LEU B CB  1 
ATOM   2165 C  CG  . LEU B 1 51  ? 30.646  23.824  70.385 1.00 23.86 ? 387 LEU B CG  1 
ATOM   2166 C  CD1 . LEU B 1 51  ? 31.703  22.970  71.123 1.00 25.31 ? 387 LEU B CD1 1 
ATOM   2167 C  CD2 . LEU B 1 51  ? 30.404  23.321  68.944 1.00 23.28 ? 387 LEU B CD2 1 
ATOM   2168 N  N   . SER B 1 52  ? 26.651  25.289  72.121 1.00 22.37 ? 388 SER B N   1 
ATOM   2169 C  CA  . SER B 1 52  ? 25.315  25.309  72.695 1.00 22.51 ? 388 SER B CA  1 
ATOM   2170 C  C   . SER B 1 52  ? 24.266  25.982  71.772 1.00 22.31 ? 388 SER B C   1 
ATOM   2171 O  O   . SER B 1 52  ? 23.152  25.448  71.591 1.00 21.31 ? 388 SER B O   1 
ATOM   2172 C  CB  . SER B 1 52  ? 25.379  25.995  74.061 1.00 23.26 ? 388 SER B CB  1 
ATOM   2173 O  OG  . SER B 1 52  ? 24.096  26.369  74.533 1.00 27.08 ? 388 SER B OG  1 
ATOM   2174 N  N   . TYR B 1 53  ? 24.622  27.142  71.206 1.00 21.81 ? 389 TYR B N   1 
ATOM   2175 C  CA  . TYR B 1 53  ? 23.740  27.838  70.253 1.00 21.54 ? 389 TYR B CA  1 
ATOM   2176 C  C   . TYR B 1 53  ? 23.431  26.941  69.060 1.00 21.09 ? 389 TYR B C   1 
ATOM   2177 O  O   . TYR B 1 53  ? 22.304  26.831  68.645 1.00 20.39 ? 389 TYR B O   1 
ATOM   2178 C  CB  . TYR B 1 53  ? 24.358  29.141  69.722 1.00 21.57 ? 389 TYR B CB  1 
ATOM   2179 C  CG  . TYR B 1 53  ? 23.806  29.518  68.342 1.00 21.31 ? 389 TYR B CG  1 
ATOM   2180 C  CD1 . TYR B 1 53  ? 22.536  30.077  68.208 1.00 21.32 ? 389 TYR B CD1 1 
ATOM   2181 C  CD2 . TYR B 1 53  ? 24.538  29.272  67.191 1.00 20.99 ? 389 TYR B CD2 1 
ATOM   2182 C  CE1 . TYR B 1 53  ? 22.012  30.373  66.970 1.00 20.73 ? 389 TYR B CE1 1 
ATOM   2183 C  CE2 . TYR B 1 53  ? 24.036  29.580  65.946 1.00 22.11 ? 389 TYR B CE2 1 
ATOM   2184 C  CZ  . TYR B 1 53  ? 22.762  30.121  65.848 1.00 23.30 ? 389 TYR B CZ  1 
ATOM   2185 O  OH  . TYR B 1 53  ? 22.269  30.419  64.618 1.00 24.92 ? 389 TYR B OH  1 
ATOM   2186 N  N   . ASN B 1 54  ? 24.470  26.337  68.509 1.00 20.72 ? 390 ASN B N   1 
ATOM   2187 C  CA  . ASN B 1 54  ? 24.346  25.497  67.337 1.00 21.27 ? 390 ASN B CA  1 
ATOM   2188 C  C   . ASN B 1 54  ? 23.515  24.239  67.649 1.00 20.53 ? 390 ASN B C   1 
ATOM   2189 O  O   . ASN B 1 54  ? 22.684  23.826  66.853 1.00 19.24 ? 390 ASN B O   1 
ATOM   2190 C  CB  . ASN B 1 54  ? 25.748  25.163  66.806 1.00 21.55 ? 390 ASN B CB  1 
ATOM   2191 C  CG  . ASN B 1 54  ? 25.716  24.413  65.494 1.00 23.82 ? 390 ASN B CG  1 
ATOM   2192 O  OD1 . ASN B 1 54  ? 25.359  23.246  65.450 1.00 27.97 ? 390 ASN B OD1 1 
ATOM   2193 N  ND2 . ASN B 1 54  ? 26.079  25.084  64.422 1.00 27.95 ? 390 ASN B ND2 1 
ATOM   2194 N  N   . ASN B 1 55  ? 23.714  23.664  68.837 1.00 20.22 ? 391 ASN B N   1 
ATOM   2195 C  CA  . ASN B 1 55  ? 22.893  22.532  69.304 1.00 19.61 ? 391 ASN B CA  1 
ATOM   2196 C  C   . ASN B 1 55  ? 21.399  22.902  69.199 1.00 19.64 ? 391 ASN B C   1 
ATOM   2197 O  O   . ASN B 1 55  ? 20.574  22.204  68.562 1.00 19.42 ? 391 ASN B O   1 
ATOM   2198 C  CB  . ASN B 1 55  ? 23.292  22.215  70.758 1.00 19.66 ? 391 ASN B CB  1 
ATOM   2199 C  CG  . ASN B 1 55  ? 22.815  20.869  71.255 1.00 17.84 ? 391 ASN B CG  1 
ATOM   2200 O  OD1 . ASN B 1 55  ? 22.210  20.084  70.531 1.00 18.46 ? 391 ASN B OD1 1 
ATOM   2201 N  ND2 . ASN B 1 55  ? 23.118  20.586  72.537 1.00 16.50 ? 391 ASN B ND2 1 
ATOM   2202 N  N   . VAL B 1 56  ? 21.064  24.034  69.808 1.00 19.07 ? 392 VAL B N   1 
ATOM   2203 C  CA  . VAL B 1 56  ? 19.675  24.469  69.900 1.00 18.80 ? 392 VAL B CA  1 
ATOM   2204 C  C   . VAL B 1 56  ? 19.119  24.871  68.543 1.00 18.70 ? 392 VAL B C   1 
ATOM   2205 O  O   . VAL B 1 56  ? 18.030  24.472  68.138 1.00 18.16 ? 392 VAL B O   1 
ATOM   2206 C  CB  . VAL B 1 56  ? 19.558  25.650  70.880 1.00 18.95 ? 392 VAL B CB  1 
ATOM   2207 C  CG1 . VAL B 1 56  ? 18.144  26.285  70.814 1.00 17.12 ? 392 VAL B CG1 1 
ATOM   2208 C  CG2 . VAL B 1 56  ? 19.925  25.195  72.283 1.00 19.64 ? 392 VAL B CG2 1 
ATOM   2209 N  N   . SER B 1 57  ? 19.890  25.689  67.848 1.00 19.00 ? 393 SER B N   1 
ATOM   2210 C  CA  . SER B 1 57  ? 19.538  26.160  66.539 1.00 19.92 ? 393 SER B CA  1 
ATOM   2211 C  C   . SER B 1 57  ? 19.287  25.015  65.539 1.00 20.06 ? 393 SER B C   1 
ATOM   2212 O  O   . SER B 1 57  ? 18.368  25.082  64.708 1.00 19.56 ? 393 SER B O   1 
ATOM   2213 C  CB  . SER B 1 57  ? 20.689  27.028  66.025 1.00 20.06 ? 393 SER B CB  1 
ATOM   2214 O  OG  . SER B 1 57  ? 20.316  27.555  64.792 1.00 25.23 ? 393 SER B OG  1 
ATOM   2215 N  N   . SER B 1 58  ? 20.127  23.981  65.589 1.00 19.71 ? 394 SER B N   1 
ATOM   2216 C  CA  . SER B 1 58  ? 19.949  22.800  64.733 1.00 19.46 ? 394 SER B CA  1 
ATOM   2217 C  C   . SER B 1 58  ? 18.592  22.092  64.932 1.00 19.29 ? 394 SER B C   1 
ATOM   2218 O  O   . SER B 1 58  ? 17.929  21.738  63.966 1.00 17.77 ? 394 SER B O   1 
ATOM   2219 C  CB  . SER B 1 58  ? 21.091  21.827  64.945 1.00 19.11 ? 394 SER B CB  1 
ATOM   2220 O  OG  . SER B 1 58  ? 22.319  22.404  64.527 1.00 19.61 ? 394 SER B OG  1 
ATOM   2221 N  N   . LEU B 1 59  ? 18.193  21.902  66.183 1.00 18.85 ? 395 LEU B N   1 
ATOM   2222 C  CA  . LEU B 1 59  ? 16.893  21.333  66.501 1.00 19.36 ? 395 LEU B CA  1 
ATOM   2223 C  C   . LEU B 1 59  ? 15.754  22.208  65.972 1.00 19.12 ? 395 LEU B C   1 
ATOM   2224 O  O   . LEU B 1 59  ? 14.882  21.706  65.277 1.00 18.92 ? 395 LEU B O   1 
ATOM   2225 C  CB  . LEU B 1 59  ? 16.755  21.016  68.014 1.00 19.24 ? 395 LEU B CB  1 
ATOM   2226 C  CG  . LEU B 1 59  ? 15.523  20.213  68.431 1.00 20.02 ? 395 LEU B CG  1 
ATOM   2227 C  CD1 . LEU B 1 59  ? 15.235  19.018  67.489 1.00 19.38 ? 395 LEU B CD1 1 
ATOM   2228 C  CD2 . LEU B 1 59  ? 15.589  19.719  69.878 1.00 19.40 ? 395 LEU B CD2 1 
ATOM   2229 N  N   . LYS B 1 60  ? 15.805  23.514  66.216 1.00 19.13 ? 396 LYS B N   1 
ATOM   2230 C  CA  . LYS B 1 60  ? 14.795  24.428  65.715 1.00 18.79 ? 396 LYS B CA  1 
ATOM   2231 C  C   . LYS B 1 60  ? 14.679  24.322  64.185 1.00 19.13 ? 396 LYS B C   1 
ATOM   2232 O  O   . LYS B 1 60  ? 13.586  24.297  63.666 1.00 18.37 ? 396 LYS B O   1 
ATOM   2233 C  CB  . LYS B 1 60  ? 15.114  25.884  66.105 1.00 18.33 ? 396 LYS B CB  1 
ATOM   2234 C  CG  . LYS B 1 60  ? 14.993  26.176  67.612 1.00 19.68 ? 396 LYS B CG  1 
ATOM   2235 C  CD  . LYS B 1 60  ? 14.904  27.640  67.867 1.00 19.86 ? 396 LYS B CD  1 
ATOM   2236 C  CE  . LYS B 1 60  ? 15.002  28.001  69.319 1.00 20.16 ? 396 LYS B CE  1 
ATOM   2237 N  NZ  . LYS B 1 60  ? 15.431  29.446  69.474 1.00 19.76 ? 396 LYS B NZ  1 
ATOM   2238 N  N   . MET B 1 61  ? 15.811  24.263  63.488 1.00 19.16 ? 397 MET B N   1 
ATOM   2239 C  CA  . MET B 1 61  ? 15.820  24.165  62.028 1.00 20.15 ? 397 MET B CA  1 
ATOM   2240 C  C   . MET B 1 61  ? 15.246  22.829  61.556 1.00 19.76 ? 397 MET B C   1 
ATOM   2241 O  O   . MET B 1 61  ? 14.500  22.780  60.566 1.00 19.25 ? 397 MET B O   1 
ATOM   2242 C  CB  . MET B 1 61  ? 17.246  24.332  61.487 1.00 20.89 ? 397 MET B CB  1 
ATOM   2243 C  CG  . MET B 1 61  ? 17.797  25.771  61.624 1.00 25.19 ? 397 MET B CG  1 
ATOM   2244 S  SD  . MET B 1 61  ? 16.665  27.119  61.128 1.00 34.62 ? 397 MET B SD  1 
ATOM   2245 C  CE  . MET B 1 61  ? 16.492  26.800  59.351 1.00 35.27 ? 397 MET B CE  1 
ATOM   2246 N  N   . LEU B 1 62  ? 15.578  21.757  62.268 1.00 18.56 ? 398 LEU B N   1 
ATOM   2247 C  CA  . LEU B 1 62  ? 15.020  20.447  61.948 1.00 19.14 ? 398 LEU B CA  1 
ATOM   2248 C  C   . LEU B 1 62  ? 13.495  20.481  62.030 1.00 19.24 ? 398 LEU B C   1 
ATOM   2249 O  O   . LEU B 1 62  ? 12.831  19.893  61.189 1.00 19.68 ? 398 LEU B O   1 
ATOM   2250 C  CB  . LEU B 1 62  ? 15.597  19.365  62.873 1.00 18.98 ? 398 LEU B CB  1 
ATOM   2251 C  CG  . LEU B 1 62  ? 15.100  17.922  62.702 1.00 17.95 ? 398 LEU B CG  1 
ATOM   2252 C  CD1 . LEU B 1 62  ? 15.504  17.355  61.319 1.00 17.58 ? 398 LEU B CD1 1 
ATOM   2253 C  CD2 . LEU B 1 62  ? 15.588  17.021  63.863 1.00 15.94 ? 398 LEU B CD2 1 
ATOM   2254 N  N   . VAL B 1 63  ? 12.950  21.149  63.046 1.00 19.60 ? 399 VAL B N   1 
ATOM   2255 C  CA  . VAL B 1 63  ? 11.483  21.241  63.243 1.00 19.43 ? 399 VAL B CA  1 
ATOM   2256 C  C   . VAL B 1 63  ? 10.840  21.885  62.006 1.00 19.88 ? 399 VAL B C   1 
ATOM   2257 O  O   . VAL B 1 63  ? 9.784   21.449  61.539 1.00 19.10 ? 399 VAL B O   1 
ATOM   2258 C  CB  . VAL B 1 63  ? 11.109  22.102  64.501 1.00 19.66 ? 399 VAL B CB  1 
ATOM   2259 C  CG1 . VAL B 1 63  ? 9.602   22.361  64.583 1.00 19.39 ? 399 VAL B CG1 1 
ATOM   2260 C  CG2 . VAL B 1 63  ? 11.640  21.496  65.832 1.00 19.67 ? 399 VAL B CG2 1 
ATOM   2261 N  N   . ALA B 1 64  ? 11.517  22.897  61.464 1.00 20.66 ? 400 ALA B N   1 
ATOM   2262 C  CA  . ALA B 1 64  ? 10.988  23.704  60.359 1.00 21.17 ? 400 ALA B CA  1 
ATOM   2263 C  C   . ALA B 1 64  ? 11.221  23.145  58.943 1.00 22.38 ? 400 ALA B C   1 
ATOM   2264 O  O   . ALA B 1 64  ? 10.754  23.743  57.974 1.00 22.21 ? 400 ALA B O   1 
ATOM   2265 C  CB  . ALA B 1 64  ? 11.557  25.135  60.451 1.00 20.79 ? 400 ALA B CB  1 
ATOM   2266 N  N   . LYS B 1 65  ? 11.933  22.025  58.809 1.00 24.12 ? 401 LYS B N   1 
ATOM   2267 C  CA  . LYS B 1 65  ? 12.175  21.406  57.494 1.00 25.19 ? 401 LYS B CA  1 
ATOM   2268 C  C   . LYS B 1 65  ? 10.855  21.109  56.775 1.00 25.76 ? 401 LYS B C   1 
ATOM   2269 O  O   . LYS B 1 65  ? 9.865   20.784  57.409 1.00 25.48 ? 401 LYS B O   1 
ATOM   2270 C  CB  . LYS B 1 65  ? 13.010  20.128  57.639 1.00 25.85 ? 401 LYS B CB  1 
ATOM   2271 C  CG  . LYS B 1 65  ? 14.499  20.367  57.783 1.00 28.18 ? 401 LYS B CG  1 
ATOM   2272 C  CD  . LYS B 1 65  ? 15.305  19.099  57.528 1.00 33.96 ? 401 LYS B CD  1 
ATOM   2273 C  CE  . LYS B 1 65  ? 16.800  19.403  57.308 1.00 36.75 ? 401 LYS B CE  1 
ATOM   2274 N  NZ  . LYS B 1 65  ? 17.496  18.392  56.422 1.00 38.90 ? 401 LYS B NZ  1 
ATOM   2275 N  N   . ASP B 1 66  ? 10.834  21.241  55.453 1.00 27.51 ? 402 ASP B N   1 
ATOM   2276 C  CA  . ASP B 1 66  ? 9.551   21.204  54.702 1.00 28.94 ? 402 ASP B CA  1 
ATOM   2277 C  C   . ASP B 1 66  ? 9.042   19.832  54.258 1.00 28.82 ? 402 ASP B C   1 
ATOM   2278 O  O   . ASP B 1 66  ? 7.955   19.748  53.699 1.00 29.26 ? 402 ASP B O   1 
ATOM   2279 C  CB  . ASP B 1 66  ? 9.586   22.130  53.463 1.00 29.73 ? 402 ASP B CB  1 
ATOM   2280 C  CG  . ASP B 1 66  ? 10.723  21.805  52.498 1.00 32.96 ? 402 ASP B CG  1 
ATOM   2281 O  OD1 . ASP B 1 66  ? 11.217  20.648  52.465 1.00 37.06 ? 402 ASP B OD1 1 
ATOM   2282 O  OD2 . ASP B 1 66  ? 11.123  22.728  51.748 1.00 38.11 ? 402 ASP B OD2 1 
ATOM   2283 N  N   . ASN B 1 67  ? 9.805   18.774  54.487 1.00 28.53 ? 403 ASN B N   1 
ATOM   2284 C  CA  . ASN B 1 67  ? 9.503   17.461  53.906 1.00 28.91 ? 403 ASN B CA  1 
ATOM   2285 C  C   . ASN B 1 67  ? 9.184   16.377  54.980 1.00 28.21 ? 403 ASN B C   1 
ATOM   2286 O  O   . ASN B 1 67  ? 9.417   15.176  54.769 1.00 28.25 ? 403 ASN B O   1 
ATOM   2287 C  CB  . ASN B 1 67  ? 10.687  17.043  53.017 1.00 29.73 ? 403 ASN B CB  1 
ATOM   2288 C  CG  . ASN B 1 67  ? 12.055  17.344  53.674 1.00 33.16 ? 403 ASN B CG  1 
ATOM   2289 O  OD1 . ASN B 1 67  ? 12.179  18.272  54.493 1.00 33.75 ? 403 ASN B OD1 1 
ATOM   2290 N  ND2 . ASN B 1 67  ? 13.079  16.558  53.313 1.00 36.13 ? 403 ASN B ND2 1 
ATOM   2291 N  N   . TRP B 1 68  ? 8.663   16.812  56.131 1.00 26.34 ? 404 TRP B N   1 
ATOM   2292 C  CA  . TRP B 1 68  ? 8.122   15.887  57.118 1.00 25.20 ? 404 TRP B CA  1 
ATOM   2293 C  C   . TRP B 1 68  ? 6.819   15.283  56.603 1.00 24.98 ? 404 TRP B C   1 
ATOM   2294 O  O   . TRP B 1 68  ? 5.942   16.004  56.109 1.00 25.95 ? 404 TRP B O   1 
ATOM   2295 C  CB  . TRP B 1 68  ? 7.854   16.579  58.450 1.00 24.47 ? 404 TRP B CB  1 
ATOM   2296 C  CG  . TRP B 1 68  ? 9.053   16.902  59.242 1.00 21.79 ? 404 TRP B CG  1 
ATOM   2297 C  CD1 . TRP B 1 68  ? 9.573   18.138  59.479 1.00 21.09 ? 404 TRP B CD1 1 
ATOM   2298 C  CD2 . TRP B 1 68  ? 9.897   15.970  59.945 1.00 20.34 ? 404 TRP B CD2 1 
ATOM   2299 N  NE1 . TRP B 1 68  ? 10.685  18.034  60.271 1.00 19.87 ? 404 TRP B NE1 1 
ATOM   2300 C  CE2 . TRP B 1 68  ? 10.898  16.715  60.582 1.00 19.25 ? 404 TRP B CE2 1 
ATOM   2301 C  CE3 . TRP B 1 68  ? 9.890   14.586  60.094 1.00 19.12 ? 404 TRP B CE3 1 
ATOM   2302 C  CZ2 . TRP B 1 68  ? 11.897  16.117  61.355 1.00 20.14 ? 404 TRP B CZ2 1 
ATOM   2303 C  CZ3 . TRP B 1 68  ? 10.890  13.991  60.854 1.00 22.10 ? 404 TRP B CZ3 1 
ATOM   2304 C  CH2 . TRP B 1 68  ? 11.868  14.756  61.484 1.00 20.26 ? 404 TRP B CH2 1 
ATOM   2305 N  N   . VAL B 1 69  ? 6.689   13.967  56.734 1.00 24.24 ? 405 VAL B N   1 
ATOM   2306 C  CA  . VAL B 1 69  ? 5.526   13.231  56.261 1.00 24.00 ? 405 VAL B CA  1 
ATOM   2307 C  C   . VAL B 1 69  ? 4.954   12.386  57.409 1.00 24.24 ? 405 VAL B C   1 
ATOM   2308 O  O   . VAL B 1 69  ? 5.703   11.727  58.120 1.00 23.90 ? 405 VAL B O   1 
ATOM   2309 C  CB  . VAL B 1 69  ? 5.939   12.305  55.089 1.00 24.17 ? 405 VAL B CB  1 
ATOM   2310 C  CG1 . VAL B 1 69  ? 4.752   11.429  54.626 1.00 23.86 ? 405 VAL B CG1 1 
ATOM   2311 C  CG2 . VAL B 1 69  ? 6.517   13.144  53.918 1.00 23.54 ? 405 VAL B CG2 1 
ATOM   2312 N  N   . LEU B 1 70  ? 3.635   12.408  57.601 1.00 24.09 ? 406 LEU B N   1 
ATOM   2313 C  CA  . LEU B 1 70  ? 2.990   11.548  58.598 1.00 24.08 ? 406 LEU B CA  1 
ATOM   2314 C  C   . LEU B 1 70  ? 3.049   10.083  58.174 1.00 24.69 ? 406 LEU B C   1 
ATOM   2315 O  O   . LEU B 1 70  ? 2.569   9.738   57.099 1.00 24.30 ? 406 LEU B O   1 
ATOM   2316 C  CB  . LEU B 1 70  ? 1.528   11.969  58.800 1.00 24.29 ? 406 LEU B CB  1 
ATOM   2317 C  CG  . LEU B 1 70  ? 0.660   11.183  59.796 1.00 23.38 ? 406 LEU B CG  1 
ATOM   2318 C  CD1 . LEU B 1 70  ? 1.135   11.331  61.202 1.00 22.53 ? 406 LEU B CD1 1 
ATOM   2319 C  CD2 . LEU B 1 70  ? -0.784  11.645  59.685 1.00 23.62 ? 406 LEU B CD2 1 
ATOM   2320 N  N   . SER B 1 71  ? 3.647   9.233   59.013 1.00 25.57 ? 407 SER B N   1 
ATOM   2321 C  CA  . SER B 1 71  ? 3.754   7.789   58.749 1.00 26.63 ? 407 SER B CA  1 
ATOM   2322 C  C   . SER B 1 71  ? 2.601   7.023   59.387 1.00 26.98 ? 407 SER B C   1 
ATOM   2323 O  O   . SER B 1 71  ? 2.065   6.105   58.801 1.00 26.08 ? 407 SER B O   1 
ATOM   2324 C  CB  . SER B 1 71  ? 5.054   7.219   59.294 1.00 26.83 ? 407 SER B CB  1 
ATOM   2325 O  OG  . SER B 1 71  ? 6.169   7.720   58.585 1.00 30.33 ? 407 SER B OG  1 
ATOM   2326 N  N   . SER B 1 72  ? 2.243   7.402   60.607 1.00 27.37 ? 408 SER B N   1 
ATOM   2327 C  CA  . SER B 1 72  ? 1.221   6.696   61.343 1.00 27.83 ? 408 SER B CA  1 
ATOM   2328 C  C   . SER B 1 72  ? 0.683   7.565   62.466 1.00 28.34 ? 408 SER B C   1 
ATOM   2329 O  O   . SER B 1 72  ? 1.323   8.537   62.883 1.00 28.19 ? 408 SER B O   1 
ATOM   2330 C  CB  . SER B 1 72  ? 1.787   5.387   61.909 1.00 27.93 ? 408 SER B CB  1 
ATOM   2331 O  OG  . SER B 1 72  ? 2.884   5.633   62.776 1.00 26.80 ? 408 SER B OG  1 
ATOM   2332 N  N   . GLU B 1 73  ? -0.507  7.213   62.920 1.00 29.30 ? 409 GLU B N   1 
ATOM   2333 C  CA  . GLU B 1 73  ? -1.125  7.810   64.097 1.00 30.64 ? 409 GLU B CA  1 
ATOM   2334 C  C   . GLU B 1 73  ? -1.733  6.671   64.916 1.00 31.05 ? 409 GLU B C   1 
ATOM   2335 O  O   . GLU B 1 73  ? -2.269  5.715   64.352 1.00 32.01 ? 409 GLU B O   1 
ATOM   2336 C  CB  . GLU B 1 73  ? -2.198  8.828   63.691 1.00 30.74 ? 409 GLU B CB  1 
ATOM   2337 C  CG  . GLU B 1 73  ? -2.777  9.638   64.871 1.00 33.38 ? 409 GLU B CG  1 
ATOM   2338 C  CD  . GLU B 1 73  ? -3.297  11.037  64.474 1.00 36.66 ? 409 GLU B CD  1 
ATOM   2339 O  OE1 . GLU B 1 73  ? -3.344  11.357  63.256 1.00 37.35 ? 409 GLU B OE1 1 
ATOM   2340 O  OE2 . GLU B 1 73  ? -3.638  11.827  65.390 1.00 38.35 ? 409 GLU B OE2 1 
ATOM   2341 N  N   . ILE B 1 74  ? -1.607  6.749   66.232 1.00 31.42 ? 410 ILE B N   1 
ATOM   2342 C  CA  . ILE B 1 74  ? -2.187  5.776   67.152 1.00 31.88 ? 410 ILE B CA  1 
ATOM   2343 C  C   . ILE B 1 74  ? -2.542  6.568   68.396 1.00 32.35 ? 410 ILE B C   1 
ATOM   2344 O  O   . ILE B 1 74  ? -1.657  7.165   68.993 1.00 31.95 ? 410 ILE B O   1 
ATOM   2345 C  CB  . ILE B 1 74  ? -1.165  4.659   67.545 1.00 32.22 ? 410 ILE B CB  1 
ATOM   2346 C  CG1 . ILE B 1 74  ? -0.757  3.818   66.333 1.00 32.61 ? 410 ILE B CG1 1 
ATOM   2347 C  CG2 . ILE B 1 74  ? -1.736  3.751   68.630 1.00 32.05 ? 410 ILE B CG2 1 
ATOM   2348 C  CD1 . ILE B 1 74  ? 0.286   2.727   66.645 1.00 33.58 ? 410 ILE B CD1 1 
ATOM   2349 N  N   . SER B 1 75  ? -3.819  6.565   68.786 1.00 32.63 ? 411 SER B N   1 
ATOM   2350 C  CA  . SER B 1 75  ? -4.304  7.315   69.969 1.00 33.36 ? 411 SER B CA  1 
ATOM   2351 C  C   . SER B 1 75  ? -3.835  8.765   69.981 1.00 32.83 ? 411 SER B C   1 
ATOM   2352 O  O   . SER B 1 75  ? -3.203  9.211   70.943 1.00 33.94 ? 411 SER B O   1 
ATOM   2353 C  CB  . SER B 1 75  ? -3.872  6.641   71.290 1.00 33.59 ? 411 SER B CB  1 
ATOM   2354 O  OG  . SER B 1 75  ? -4.265  5.276   71.335 1.00 34.23 ? 411 SER B OG  1 
ATOM   2355 N  N   . GLN B 1 76  ? -4.123  9.497   68.906 1.00 32.08 ? 412 GLN B N   1 
ATOM   2356 C  CA  . GLN B 1 76  ? -3.811  10.937  68.829 1.00 31.11 ? 412 GLN B CA  1 
ATOM   2357 C  C   . GLN B 1 76  ? -2.313  11.232  68.950 1.00 29.36 ? 412 GLN B C   1 
ATOM   2358 O  O   . GLN B 1 76  ? -1.924  12.369  69.178 1.00 28.34 ? 412 GLN B O   1 
ATOM   2359 C  CB  . GLN B 1 76  ? -4.569  11.702  69.922 1.00 31.41 ? 412 GLN B CB  1 
ATOM   2360 C  CG  . GLN B 1 76  ? -6.040  11.253  70.122 1.00 33.62 ? 412 GLN B CG  1 
ATOM   2361 C  CD  . GLN B 1 76  ? -6.733  11.969  71.285 1.00 36.83 ? 412 GLN B CD  1 
ATOM   2362 O  OE1 . GLN B 1 76  ? -6.086  12.511  72.198 1.00 38.33 ? 412 GLN B OE1 1 
ATOM   2363 N  NE2 . GLN B 1 76  ? -8.063  11.971  71.256 1.00 38.90 ? 412 GLN B NE2 1 
ATOM   2364 N  N   . VAL B 1 77  ? -1.488  10.196  68.823 1.00 27.77 ? 413 VAL B N   1 
ATOM   2365 C  CA  . VAL B 1 77  ? -0.044  10.320  68.847 1.00 26.81 ? 413 VAL B CA  1 
ATOM   2366 C  C   . VAL B 1 77  ? 0.426   10.074  67.425 1.00 26.32 ? 413 VAL B C   1 
ATOM   2367 O  O   . VAL B 1 77  ? -0.012  9.109   66.793 1.00 25.96 ? 413 VAL B O   1 
ATOM   2368 C  CB  . VAL B 1 77  ? 0.576   9.274   69.774 1.00 26.92 ? 413 VAL B CB  1 
ATOM   2369 C  CG1 . VAL B 1 77  ? 2.086   9.419   69.810 1.00 26.50 ? 413 VAL B CG1 1 
ATOM   2370 C  CG2 . VAL B 1 77  ? -0.025  9.385   71.161 1.00 26.33 ? 413 VAL B CG2 1 
ATOM   2371 N  N   . ARG B 1 78  ? 1.302   10.942  66.923 1.00 25.09 ? 414 ARG B N   1 
ATOM   2372 C  CA  . ARG B 1 78  ? 1.677   10.936  65.524 1.00 24.48 ? 414 ARG B CA  1 
ATOM   2373 C  C   . ARG B 1 78  ? 3.156   10.721  65.350 1.00 23.21 ? 414 ARG B C   1 
ATOM   2374 O  O   . ARG B 1 78  ? 3.968   11.309  66.067 1.00 22.52 ? 414 ARG B O   1 
ATOM   2375 C  CB  . ARG B 1 78  ? 1.322   12.265  64.885 1.00 25.34 ? 414 ARG B CB  1 
ATOM   2376 C  CG  . ARG B 1 78  ? -0.123  12.481  64.643 1.00 28.03 ? 414 ARG B CG  1 
ATOM   2377 C  CD  . ARG B 1 78  ? -0.320  13.938  64.381 1.00 32.86 ? 414 ARG B CD  1 
ATOM   2378 N  NE  . ARG B 1 78  ? -1.565  14.216  63.686 1.00 37.25 ? 414 ARG B NE  1 
ATOM   2379 C  CZ  . ARG B 1 78  ? -2.011  15.446  63.429 1.00 41.30 ? 414 ARG B CZ  1 
ATOM   2380 N  NH1 . ARG B 1 78  ? -1.298  16.507  63.809 1.00 42.47 ? 414 ARG B NH1 1 
ATOM   2381 N  NH2 . ARG B 1 78  ? -3.176  15.620  62.798 1.00 42.51 ? 414 ARG B NH2 1 
ATOM   2382 N  N   . LEU B 1 79  ? 3.493   9.872   64.393 1.00 21.94 ? 415 LEU B N   1 
ATOM   2383 C  CA  . LEU B 1 79  ? 4.874   9.562   64.049 1.00 21.61 ? 415 LEU B CA  1 
ATOM   2384 C  C   . LEU B 1 79  ? 5.132   10.084  62.631 1.00 21.44 ? 415 LEU B C   1 
ATOM   2385 O  O   . LEU B 1 79  ? 4.417   9.742   61.690 1.00 21.06 ? 415 LEU B O   1 
ATOM   2386 C  CB  . LEU B 1 79  ? 5.121   8.048   64.122 1.00 21.68 ? 415 LEU B CB  1 
ATOM   2387 C  CG  . LEU B 1 79  ? 6.510   7.539   63.682 1.00 21.65 ? 415 LEU B CG  1 
ATOM   2388 C  CD1 . LEU B 1 79  ? 7.526   8.076   64.619 1.00 21.00 ? 415 LEU B CD1 1 
ATOM   2389 C  CD2 . LEU B 1 79  ? 6.561   5.998   63.664 1.00 22.09 ? 415 LEU B CD2 1 
ATOM   2390 N  N   . TYR B 1 80  ? 6.142   10.935  62.502 1.00 21.78 ? 416 TYR B N   1 
ATOM   2391 C  CA  . TYR B 1 80  ? 6.520   11.551  61.231 1.00 21.70 ? 416 TYR B CA  1 
ATOM   2392 C  C   . TYR B 1 80  ? 7.895   11.118  60.846 1.00 20.92 ? 416 TYR B C   1 
ATOM   2393 O  O   . TYR B 1 80  ? 8.734   10.888  61.704 1.00 20.53 ? 416 TYR B O   1 
ATOM   2394 C  CB  . TYR B 1 80  ? 6.617   13.062  61.385 1.00 22.04 ? 416 TYR B CB  1 
ATOM   2395 C  CG  . TYR B 1 80  ? 5.305   13.717  61.589 1.00 23.04 ? 416 TYR B CG  1 
ATOM   2396 C  CD1 . TYR B 1 80  ? 4.625   14.287  60.523 1.00 25.03 ? 416 TYR B CD1 1 
ATOM   2397 C  CD2 . TYR B 1 80  ? 4.726   13.740  62.837 1.00 24.40 ? 416 TYR B CD2 1 
ATOM   2398 C  CE1 . TYR B 1 80  ? 3.398   14.896  60.705 1.00 26.61 ? 416 TYR B CE1 1 
ATOM   2399 C  CE2 . TYR B 1 80  ? 3.498   14.334  63.032 1.00 27.43 ? 416 TYR B CE2 1 
ATOM   2400 C  CZ  . TYR B 1 80  ? 2.849   14.914  61.966 1.00 27.85 ? 416 TYR B CZ  1 
ATOM   2401 O  OH  . TYR B 1 80  ? 1.638   15.497  62.169 1.00 30.75 ? 416 TYR B OH  1 
ATOM   2402 N  N   . THR B 1 81  ? 8.145   11.092  59.556 1.00 20.90 ? 417 THR B N   1 
ATOM   2403 C  CA  . THR B 1 81  ? 9.485   10.883  59.058 1.00 22.27 ? 417 THR B CA  1 
ATOM   2404 C  C   . THR B 1 81  ? 9.862   11.907  58.008 1.00 23.21 ? 417 THR B C   1 
ATOM   2405 O  O   . THR B 1 81  ? 9.029   12.571  57.390 1.00 22.60 ? 417 THR B O   1 
ATOM   2406 C  CB  . THR B 1 81  ? 9.678   9.462   58.472 1.00 22.13 ? 417 THR B CB  1 
ATOM   2407 O  OG1 . THR B 1 81  ? 8.969   9.345   57.229 1.00 21.38 ? 417 THR B OG1 1 
ATOM   2408 C  CG2 . THR B 1 81  ? 9.207   8.388   59.449 1.00 22.16 ? 417 THR B CG2 1 
ATOM   2409 N  N   . LEU B 1 82  ? 11.160  12.002  57.833 1.00 26.31 ? 418 LEU B N   1 
ATOM   2410 C  CA  . LEU B 1 82  ? 11.798  12.879  56.889 1.00 28.80 ? 418 LEU B CA  1 
ATOM   2411 C  C   . LEU B 1 82  ? 12.855  11.996  56.261 1.00 30.58 ? 418 LEU B C   1 
ATOM   2412 O  O   . LEU B 1 82  ? 13.809  11.577  56.941 1.00 30.98 ? 418 LEU B O   1 
ATOM   2413 C  CB  . LEU B 1 82  ? 12.467  14.002  57.655 1.00 29.43 ? 418 LEU B CB  1 
ATOM   2414 C  CG  . LEU B 1 82  ? 13.053  15.228  56.974 1.00 31.83 ? 418 LEU B CG  1 
ATOM   2415 C  CD1 . LEU B 1 82  ? 12.019  16.324  56.905 1.00 31.58 ? 418 LEU B CD1 1 
ATOM   2416 C  CD2 . LEU B 1 82  ? 14.210  15.712  57.818 1.00 33.05 ? 418 LEU B CD2 1 
ATOM   2417 N  N   . GLU B 1 83  ? 12.660  11.662  54.996 1.00 32.63 ? 419 GLU B N   1 
ATOM   2418 C  CA  . GLU B 1 83  ? 13.617  10.826  54.268 1.00 35.02 ? 419 GLU B CA  1 
ATOM   2419 C  C   . GLU B 1 83  ? 14.589  11.721  53.499 1.00 36.13 ? 419 GLU B C   1 
ATOM   2420 O  O   . GLU B 1 83  ? 14.411  11.961  52.310 1.00 36.44 ? 419 GLU B O   1 
ATOM   2421 C  CB  . GLU B 1 83  ? 12.854  9.874   53.330 1.00 35.48 ? 419 GLU B CB  1 
ATOM   2422 C  CG  . GLU B 1 83  ? 11.872  8.948   54.069 1.00 37.00 ? 419 GLU B CG  1 
ATOM   2423 C  CD  . GLU B 1 83  ? 11.268  7.858   53.188 1.00 39.00 ? 419 GLU B CD  1 
ATOM   2424 O  OE1 . GLU B 1 83  ? 11.975  7.322   52.297 1.00 40.13 ? 419 GLU B OE1 1 
ATOM   2425 O  OE2 . GLU B 1 83  ? 10.078  7.520   53.411 1.00 41.00 ? 419 GLU B OE2 1 
ATOM   2426 N  N   . ASP B 1 84  ? 15.584  12.261  54.204 1.00 38.02 ? 420 ASP B N   1 
ATOM   2427 C  CA  . ASP B 1 84  ? 16.670  13.036  53.565 1.00 39.18 ? 420 ASP B CA  1 
ATOM   2428 C  C   . ASP B 1 84  ? 17.563  12.106  52.752 1.00 39.31 ? 420 ASP B C   1 
ATOM   2429 O  O   . ASP B 1 84  ? 17.493  10.896  52.885 1.00 38.84 ? 420 ASP B O   1 
ATOM   2430 C  CB  . ASP B 1 84  ? 17.554  13.747  54.609 1.00 39.90 ? 420 ASP B CB  1 
ATOM   2431 C  CG  . ASP B 1 84  ? 17.083  15.139  54.943 1.00 42.08 ? 420 ASP B CG  1 
ATOM   2432 O  OD1 . ASP B 1 84  ? 16.033  15.574  54.433 1.00 47.07 ? 420 ASP B OD1 1 
ATOM   2433 O  OD2 . ASP B 1 84  ? 17.766  15.812  55.746 1.00 46.16 ? 420 ASP B OD2 1 
ATOM   2434 N  N   . ASP B 1 85  ? 18.411  12.693  51.913 1.00 40.04 ? 421 ASP B N   1 
ATOM   2435 C  CA  . ASP B 1 85  ? 19.355  11.919  51.082 1.00 40.49 ? 421 ASP B CA  1 
ATOM   2436 C  C   . ASP B 1 85  ? 20.382  11.186  51.956 1.00 39.83 ? 421 ASP B C   1 
ATOM   2437 O  O   . ASP B 1 85  ? 20.915  10.156  51.547 1.00 40.11 ? 421 ASP B O   1 
ATOM   2438 C  CB  . ASP B 1 85  ? 20.075  12.821  50.059 1.00 40.88 ? 421 ASP B CB  1 
ATOM   2439 C  CG  . ASP B 1 85  ? 19.304  12.968  48.744 1.00 42.70 ? 421 ASP B CG  1 
ATOM   2440 O  OD1 . ASP B 1 85  ? 19.458  12.093  47.860 1.00 44.74 ? 421 ASP B OD1 1 
ATOM   2441 O  OD2 . ASP B 1 85  ? 18.566  13.969  48.582 1.00 45.91 ? 421 ASP B OD2 1 
ATOM   2442 N  N   . LYS B 1 86  ? 20.646  11.717  53.152 1.00 38.83 ? 422 LYS B N   1 
ATOM   2443 C  CA  . LYS B 1 86  ? 21.591  11.088  54.073 1.00 38.03 ? 422 LYS B CA  1 
ATOM   2444 C  C   . LYS B 1 86  ? 20.887  10.309  55.179 1.00 36.45 ? 422 LYS B C   1 
ATOM   2445 O  O   . LYS B 1 86  ? 21.362  9.242   55.563 1.00 36.76 ? 422 LYS B O   1 
ATOM   2446 C  CB  . LYS B 1 86  ? 22.542  12.125  54.694 1.00 38.41 ? 422 LYS B CB  1 
ATOM   2447 C  CG  . LYS B 1 86  ? 23.788  12.406  53.859 1.00 39.33 ? 422 LYS B CG  1 
ATOM   2448 C  CD  . LYS B 1 86  ? 24.775  13.360  54.572 1.00 40.32 ? 422 LYS B CD  1 
ATOM   2449 C  CE  . LYS B 1 86  ? 25.800  12.607  55.449 1.00 40.58 ? 422 LYS B CE  1 
ATOM   2450 N  NZ  . LYS B 1 86  ? 26.636  11.600  54.708 1.00 41.07 ? 422 LYS B NZ  1 
ATOM   2451 N  N   . PHE B 1 87  ? 19.761  10.823  55.677 1.00 34.32 ? 423 PHE B N   1 
ATOM   2452 C  CA  . PHE B 1 87  ? 19.210  10.337  56.933 1.00 32.38 ? 423 PHE B CA  1 
ATOM   2453 C  C   . PHE B 1 87  ? 17.725  10.067  56.896 1.00 30.28 ? 423 PHE B C   1 
ATOM   2454 O  O   . PHE B 1 87  ? 16.976  10.767  56.218 1.00 29.73 ? 423 PHE B O   1 
ATOM   2455 C  CB  . PHE B 1 87  ? 19.485  11.360  58.037 1.00 32.75 ? 423 PHE B CB  1 
ATOM   2456 C  CG  . PHE B 1 87  ? 20.928  11.742  58.163 1.00 33.08 ? 423 PHE B CG  1 
ATOM   2457 C  CD1 . PHE B 1 87  ? 21.322  13.070  58.027 1.00 34.59 ? 423 PHE B CD1 1 
ATOM   2458 C  CD2 . PHE B 1 87  ? 21.886  10.778  58.409 1.00 34.27 ? 423 PHE B CD2 1 
ATOM   2459 C  CE1 . PHE B 1 87  ? 22.646  13.427  58.148 1.00 35.05 ? 423 PHE B CE1 1 
ATOM   2460 C  CE2 . PHE B 1 87  ? 23.222  11.124  58.534 1.00 35.18 ? 423 PHE B CE2 1 
ATOM   2461 C  CZ  . PHE B 1 87  ? 23.602  12.454  58.400 1.00 35.68 ? 423 PHE B CZ  1 
ATOM   2462 N  N   . LEU B 1 88  ? 17.324  9.041   57.645 1.00 27.78 ? 424 LEU B N   1 
ATOM   2463 C  CA  . LEU B 1 88  ? 15.929  8.759   57.935 1.00 26.51 ? 424 LEU B CA  1 
ATOM   2464 C  C   . LEU B 1 88  ? 15.597  9.393   59.269 1.00 25.18 ? 424 LEU B C   1 
ATOM   2465 O  O   . LEU B 1 88  ? 15.782  8.792   60.318 1.00 27.02 ? 424 LEU B O   1 
ATOM   2466 C  CB  . LEU B 1 88  ? 15.689  7.251   58.007 1.00 25.89 ? 424 LEU B CB  1 
ATOM   2467 C  CG  . LEU B 1 88  ? 14.293  6.769   58.402 1.00 26.08 ? 424 LEU B CG  1 
ATOM   2468 C  CD1 . LEU B 1 88  ? 13.184  7.299   57.459 1.00 24.40 ? 424 LEU B CD1 1 
ATOM   2469 C  CD2 . LEU B 1 88  ? 14.298  5.234   58.463 1.00 22.02 ? 424 LEU B CD2 1 
ATOM   2470 N  N   . SER B 1 89  ? 15.134  10.621  59.254 1.00 23.62 ? 425 SER B N   1 
ATOM   2471 C  CA  . SER B 1 89  ? 14.823  11.306  60.501 1.00 21.75 ? 425 SER B CA  1 
ATOM   2472 C  C   . SER B 1 89  ? 13.388  11.020  60.885 1.00 21.33 ? 425 SER B C   1 
ATOM   2473 O  O   . SER B 1 89  ? 12.539  10.816  60.019 1.00 20.73 ? 425 SER B O   1 
ATOM   2474 C  CB  . SER B 1 89  ? 15.016  12.792  60.324 1.00 21.75 ? 425 SER B CB  1 
ATOM   2475 O  OG  . SER B 1 89  ? 16.279  13.027  59.767 1.00 20.86 ? 425 SER B OG  1 
ATOM   2476 N  N   . PHE B 1 90  ? 13.120  10.995  62.184 1.00 20.18 ? 426 PHE B N   1 
ATOM   2477 C  CA  . PHE B 1 90  ? 11.750  10.851  62.655 1.00 20.48 ? 426 PHE B CA  1 
ATOM   2478 C  C   . PHE B 1 90  ? 11.420  11.805  63.809 1.00 19.64 ? 426 PHE B C   1 
ATOM   2479 O  O   . PHE B 1 90  ? 12.312  12.348  64.480 1.00 20.39 ? 426 PHE B O   1 
ATOM   2480 C  CB  . PHE B 1 90  ? 11.449  9.415   63.080 1.00 19.95 ? 426 PHE B CB  1 
ATOM   2481 C  CG  . PHE B 1 90  ? 12.071  8.998   64.373 1.00 20.36 ? 426 PHE B CG  1 
ATOM   2482 C  CD1 . PHE B 1 90  ? 11.367  9.099   65.559 1.00 20.56 ? 426 PHE B CD1 1 
ATOM   2483 C  CD2 . PHE B 1 90  ? 13.346  8.439   64.397 1.00 21.16 ? 426 PHE B CD2 1 
ATOM   2484 C  CE1 . PHE B 1 90  ? 11.924  8.692   66.760 1.00 21.35 ? 426 PHE B CE1 1 
ATOM   2485 C  CE2 . PHE B 1 90  ? 13.906  8.023   65.590 1.00 21.78 ? 426 PHE B CE2 1 
ATOM   2486 C  CZ  . PHE B 1 90  ? 13.196  8.167   66.780 1.00 22.24 ? 426 PHE B CZ  1 
ATOM   2487 N  N   . HIS B 1 91  ? 10.141  11.997  64.036 1.00 19.27 ? 427 HIS B N   1 
ATOM   2488 C  CA  . HIS B 1 91  ? 9.705   12.646  65.246 1.00 20.54 ? 427 HIS B CA  1 
ATOM   2489 C  C   . HIS B 1 91  ? 8.288   12.242  65.611 1.00 21.03 ? 427 HIS B C   1 
ATOM   2490 O  O   . HIS B 1 91  ? 7.469   11.876  64.752 1.00 20.68 ? 427 HIS B O   1 
ATOM   2491 C  CB  . HIS B 1 91  ? 9.870   14.170  65.147 1.00 21.25 ? 427 HIS B CB  1 
ATOM   2492 C  CG  . HIS B 1 91  ? 8.688   14.896  64.587 1.00 22.75 ? 427 HIS B CG  1 
ATOM   2493 N  ND1 . HIS B 1 91  ? 8.558   15.172  63.247 1.00 24.87 ? 427 HIS B ND1 1 
ATOM   2494 C  CD2 . HIS B 1 91  ? 7.613   15.457  65.197 1.00 23.97 ? 427 HIS B CD2 1 
ATOM   2495 C  CE1 . HIS B 1 91  ? 7.443   15.854  63.046 1.00 25.57 ? 427 HIS B CE1 1 
ATOM   2496 N  NE2 . HIS B 1 91  ? 6.844   16.030  64.212 1.00 25.68 ? 427 HIS B NE2 1 
ATOM   2497 N  N   . MET B 1 92  ? 8.033   12.276  66.904 1.00 21.34 ? 428 MET B N   1 
ATOM   2498 C  CA  . MET B 1 92  ? 6.733   11.967  67.437 1.00 22.74 ? 428 MET B CA  1 
ATOM   2499 C  C   . MET B 1 92  ? 6.097   13.183  68.078 1.00 22.64 ? 428 MET B C   1 
ATOM   2500 O  O   . MET B 1 92  ? 6.815   14.000  68.657 1.00 23.47 ? 428 MET B O   1 
ATOM   2501 C  CB  . MET B 1 92  ? 6.890   10.860  68.452 1.00 23.27 ? 428 MET B CB  1 
ATOM   2502 C  CG  . MET B 1 92  ? 7.199   9.525   67.792 1.00 27.03 ? 428 MET B CG  1 
ATOM   2503 S  SD  . MET B 1 92  ? 6.813   8.194   68.891 1.00 34.53 ? 428 MET B SD  1 
ATOM   2504 C  CE  . MET B 1 92  ? 5.032   8.103   68.744 1.00 32.55 ? 428 MET B CE  1 
ATOM   2505 N  N   . GLU B 1 93  ? 4.769   13.293  67.968 1.00 23.06 ? 429 GLU B N   1 
ATOM   2506 C  CA  . GLU B 1 93  ? 3.985   14.393  68.563 1.00 23.82 ? 429 GLU B CA  1 
ATOM   2507 C  C   . GLU B 1 93  ? 2.790   13.885  69.328 1.00 22.84 ? 429 GLU B C   1 
ATOM   2508 O  O   . GLU B 1 93  ? 2.087   13.000  68.861 1.00 22.97 ? 429 GLU B O   1 
ATOM   2509 C  CB  . GLU B 1 93  ? 3.397   15.341  67.514 1.00 24.40 ? 429 GLU B CB  1 
ATOM   2510 C  CG  . GLU B 1 93  ? 4.254   15.652  66.342 1.00 28.41 ? 429 GLU B CG  1 
ATOM   2511 C  CD  . GLU B 1 93  ? 3.656   16.739  65.442 1.00 31.50 ? 429 GLU B CD  1 
ATOM   2512 O  OE1 . GLU B 1 93  ? 2.474   17.103  65.609 1.00 31.96 ? 429 GLU B OE1 1 
ATOM   2513 O  OE2 . GLU B 1 93  ? 4.403   17.222  64.562 1.00 36.68 ? 429 GLU B OE2 1 
ATOM   2514 N  N   . MET B 1 94  ? 2.545   14.505  70.474 1.00 22.20 ? 430 MET B N   1 
ATOM   2515 C  CA  . MET B 1 94  ? 1.351   14.273  71.270 1.00 22.04 ? 430 MET B CA  1 
ATOM   2516 C  C   . MET B 1 94  ? 1.030   15.578  72.010 1.00 21.68 ? 430 MET B C   1 
ATOM   2517 O  O   . MET B 1 94  ? 1.879   16.477  72.108 1.00 22.11 ? 430 MET B O   1 
ATOM   2518 C  CB  . MET B 1 94  ? 1.586   13.137  72.265 1.00 21.64 ? 430 MET B CB  1 
ATOM   2519 C  CG  . MET B 1 94  ? 2.601   13.466  73.383 1.00 22.05 ? 430 MET B CG  1 
ATOM   2520 S  SD  . MET B 1 94  ? 2.899   12.081  74.508 1.00 24.43 ? 430 MET B SD  1 
ATOM   2521 C  CE  . MET B 1 94  ? 4.389   12.629  75.329 1.00 22.31 ? 430 MET B CE  1 
ATOM   2522 N  N   . VAL B 1 95  ? -0.193  15.671  72.509 1.00 21.74 ? 431 VAL B N   1 
ATOM   2523 C  CA  . VAL B 1 95  ? -0.638  16.769  73.364 1.00 21.89 ? 431 VAL B CA  1 
ATOM   2524 C  C   . VAL B 1 95  ? -0.859  16.212  74.767 1.00 21.86 ? 431 VAL B C   1 
ATOM   2525 O  O   . VAL B 1 95  ? -1.652  15.300  74.930 1.00 21.27 ? 431 VAL B O   1 
ATOM   2526 C  CB  . VAL B 1 95  ? -1.979  17.368  72.851 1.00 22.34 ? 431 VAL B CB  1 
ATOM   2527 C  CG1 . VAL B 1 95  ? -2.496  18.426  73.826 1.00 21.78 ? 431 VAL B CG1 1 
ATOM   2528 C  CG2 . VAL B 1 95  ? -1.804  17.957  71.447 1.00 21.83 ? 431 VAL B CG2 1 
ATOM   2529 N  N   . VAL B 1 96  ? -0.152  16.758  75.758 1.00 21.80 ? 432 VAL B N   1 
ATOM   2530 C  CA  . VAL B 1 96  ? -0.208  16.284  77.144 1.00 21.90 ? 432 VAL B CA  1 
ATOM   2531 C  C   . VAL B 1 96  ? -0.834  17.366  78.055 1.00 22.59 ? 432 VAL B C   1 
ATOM   2532 O  O   . VAL B 1 96  ? -0.604  18.571  77.860 1.00 23.36 ? 432 VAL B O   1 
ATOM   2533 C  CB  . VAL B 1 96  ? 1.203   15.919  77.669 1.00 21.84 ? 432 VAL B CB  1 
ATOM   2534 C  CG1 . VAL B 1 96  ? 1.135   15.400  79.100 1.00 22.80 ? 432 VAL B CG1 1 
ATOM   2535 C  CG2 . VAL B 1 96  ? 1.869   14.855  76.763 1.00 20.87 ? 432 VAL B CG2 1 
ATOM   2536 N  N   . HIS B 1 97  ? -1.624  16.936  79.041 1.00 22.65 ? 433 HIS B N   1 
ATOM   2537 C  CA  . HIS B 1 97  ? -2.257  17.860  79.973 1.00 23.08 ? 433 HIS B CA  1 
ATOM   2538 C  C   . HIS B 1 97  ? -1.298  18.172  81.126 1.00 23.04 ? 433 HIS B C   1 
ATOM   2539 O  O   . HIS B 1 97  ? -1.474  17.719  82.254 1.00 22.48 ? 433 HIS B O   1 
ATOM   2540 C  CB  . HIS B 1 97  ? -3.581  17.311  80.501 1.00 22.94 ? 433 HIS B CB  1 
ATOM   2541 C  CG  . HIS B 1 97  ? -4.678  17.248  79.480 1.00 24.99 ? 433 HIS B CG  1 
ATOM   2542 N  ND1 . HIS B 1 97  ? -4.632  16.420  78.379 1.00 27.63 ? 433 HIS B ND1 1 
ATOM   2543 C  CD2 . HIS B 1 97  ? -5.885  17.865  79.430 1.00 27.43 ? 433 HIS B CD2 1 
ATOM   2544 C  CE1 . HIS B 1 97  ? -5.750  16.543  77.683 1.00 27.16 ? 433 HIS B CE1 1 
ATOM   2545 N  NE2 . HIS B 1 97  ? -6.529  17.414  78.300 1.00 27.98 ? 433 HIS B NE2 1 
ATOM   2546 N  N   . VAL B 1 98  ? -0.269  18.939  80.794 1.00 23.25 ? 434 VAL B N   1 
ATOM   2547 C  CA  . VAL B 1 98  ? 0.734   19.406  81.729 1.00 23.89 ? 434 VAL B CA  1 
ATOM   2548 C  C   . VAL B 1 98  ? 1.189   20.775  81.238 1.00 23.71 ? 434 VAL B C   1 
ATOM   2549 O  O   . VAL B 1 98  ? 1.138   21.072  80.031 1.00 23.59 ? 434 VAL B O   1 
ATOM   2550 C  CB  . VAL B 1 98  ? 1.968   18.462  81.812 1.00 23.92 ? 434 VAL B CB  1 
ATOM   2551 C  CG1 . VAL B 1 98  ? 1.545   17.058  82.270 1.00 27.18 ? 434 VAL B CG1 1 
ATOM   2552 C  CG2 . VAL B 1 98  ? 2.705   18.391  80.469 1.00 24.76 ? 434 VAL B CG2 1 
ATOM   2553 N  N   . ASP B 1 99  ? 1.647   21.598  82.166 1.00 23.89 ? 435 ASP B N   1 
ATOM   2554 C  CA  . ASP B 1 99  ? 2.124   22.924  81.825 1.00 24.47 ? 435 ASP B CA  1 
ATOM   2555 C  C   . ASP B 1 99  ? 3.481   22.807  81.099 1.00 23.77 ? 435 ASP B C   1 
ATOM   2556 O  O   . ASP B 1 99  ? 4.319   21.990  81.493 1.00 23.10 ? 435 ASP B O   1 
ATOM   2557 C  CB  . ASP B 1 99  ? 2.246   23.761  83.100 1.00 25.30 ? 435 ASP B CB  1 
ATOM   2558 C  CG  . ASP B 1 99  ? 2.791   25.136  82.827 1.00 27.69 ? 435 ASP B CG  1 
ATOM   2559 O  OD1 . ASP B 1 99  ? 2.012   25.990  82.340 1.00 32.39 ? 435 ASP B OD1 1 
ATOM   2560 O  OD2 . ASP B 1 99  ? 4.001   25.357  83.085 1.00 31.44 ? 435 ASP B OD2 1 
ATOM   2561 N  N   . ALA B 1 100 ? 3.686   23.602  80.044 1.00 23.14 ? 436 ALA B N   1 
ATOM   2562 C  CA  . ALA B 1 100 ? 4.921   23.506  79.241 1.00 23.22 ? 436 ALA B CA  1 
ATOM   2563 C  C   . ALA B 1 100 ? 6.200   23.746  80.068 1.00 23.09 ? 436 ALA B C   1 
ATOM   2564 O  O   . ALA B 1 100 ? 7.175   23.020  79.897 1.00 22.55 ? 436 ALA B O   1 
ATOM   2565 C  CB  . ALA B 1 100 ? 4.882   24.453  78.024 1.00 23.03 ? 436 ALA B CB  1 
ATOM   2566 N  N   . ALA B 1 101 ? 6.190   24.756  80.941 1.00 22.75 ? 437 ALA B N   1 
ATOM   2567 C  CA  . ALA B 1 101 ? 7.332   25.050  81.820 1.00 22.91 ? 437 ALA B CA  1 
ATOM   2568 C  C   . ALA B 1 101 ? 7.707   23.844  82.697 1.00 23.18 ? 437 ALA B C   1 
ATOM   2569 O  O   . ALA B 1 101 ? 8.897   23.546  82.884 1.00 23.29 ? 437 ALA B O   1 
ATOM   2570 C  CB  . ALA B 1 101 ? 7.032   26.271  82.718 1.00 23.14 ? 437 ALA B CB  1 
ATOM   2571 N  N   . GLN B 1 102 ? 6.693   23.165  83.236 1.00 22.73 ? 438 GLN B N   1 
ATOM   2572 C  CA  . GLN B 1 102 ? 6.909   21.976  84.047 1.00 23.19 ? 438 GLN B CA  1 
ATOM   2573 C  C   . GLN B 1 102 ? 7.431   20.808  83.194 1.00 23.27 ? 438 GLN B C   1 
ATOM   2574 O  O   . GLN B 1 102 ? 8.367   20.114  83.604 1.00 23.46 ? 438 GLN B O   1 
ATOM   2575 C  CB  . GLN B 1 102 ? 5.621   21.585  84.783 1.00 23.02 ? 438 GLN B CB  1 
ATOM   2576 C  CG  . GLN B 1 102 ? 5.764   20.418  85.751 1.00 23.48 ? 438 GLN B CG  1 
ATOM   2577 C  CD  . GLN B 1 102 ? 6.608   20.727  86.970 1.00 25.27 ? 438 GLN B CD  1 
ATOM   2578 O  OE1 . GLN B 1 102 ? 7.043   21.872  87.178 1.00 25.88 ? 438 GLN B OE1 1 
ATOM   2579 N  NE2 . GLN B 1 102 ? 6.823   19.713  87.804 1.00 25.25 ? 438 GLN B NE2 1 
ATOM   2580 N  N   . ALA B 1 103 ? 6.837   20.605  82.015 1.00 23.23 ? 439 ALA B N   1 
ATOM   2581 C  CA  . ALA B 1 103 ? 7.311   19.594  81.063 1.00 23.08 ? 439 ALA B CA  1 
ATOM   2582 C  C   . ALA B 1 103 ? 8.779   19.848  80.661 1.00 22.92 ? 439 ALA B C   1 
ATOM   2583 O  O   . ALA B 1 103 ? 9.561   18.909  80.492 1.00 23.26 ? 439 ALA B O   1 
ATOM   2584 C  CB  . ALA B 1 103 ? 6.413   19.548  79.815 1.00 22.37 ? 439 ALA B CB  1 
ATOM   2585 N  N   . PHE B 1 104 ? 9.141   21.118  80.547 1.00 22.89 ? 440 PHE B N   1 
ATOM   2586 C  CA  . PHE B 1 104 ? 10.511  21.550  80.223 1.00 22.88 ? 440 PHE B CA  1 
ATOM   2587 C  C   . PHE B 1 104 ? 11.536  21.154  81.296 1.00 22.61 ? 440 PHE B C   1 
ATOM   2588 O  O   . PHE B 1 104 ? 12.585  20.606  80.967 1.00 22.45 ? 440 PHE B O   1 
ATOM   2589 C  CB  . PHE B 1 104 ? 10.490  23.064  80.017 1.00 22.85 ? 440 PHE B CB  1 
ATOM   2590 C  CG  . PHE B 1 104 ? 11.817  23.682  79.747 1.00 23.40 ? 440 PHE B CG  1 
ATOM   2591 C  CD1 . PHE B 1 104 ? 12.521  23.369  78.600 1.00 23.97 ? 440 PHE B CD1 1 
ATOM   2592 C  CD2 . PHE B 1 104 ? 12.324  24.648  80.609 1.00 24.53 ? 440 PHE B CD2 1 
ATOM   2593 C  CE1 . PHE B 1 104 ? 13.722  23.992  78.316 1.00 26.03 ? 440 PHE B CE1 1 
ATOM   2594 C  CE2 . PHE B 1 104 ? 13.527  25.282  80.346 1.00 24.81 ? 440 PHE B CE2 1 
ATOM   2595 C  CZ  . PHE B 1 104 ? 14.232  24.961  79.194 1.00 26.95 ? 440 PHE B CZ  1 
ATOM   2596 N  N   . LEU B 1 105 ? 11.237  21.421  82.566 1.00 22.91 ? 441 LEU B N   1 
ATOM   2597 C  CA  . LEU B 1 105 ? 12.132  21.016  83.660 1.00 23.03 ? 441 LEU B CA  1 
ATOM   2598 C  C   . LEU B 1 105 ? 12.204  19.466  83.788 1.00 23.07 ? 441 LEU B C   1 
ATOM   2599 O  O   . LEU B 1 105 ? 13.272  18.894  83.996 1.00 22.70 ? 441 LEU B O   1 
ATOM   2600 C  CB  . LEU B 1 105 ? 11.697  21.635  84.992 1.00 22.85 ? 441 LEU B CB  1 
ATOM   2601 C  CG  . LEU B 1 105 ? 11.653  23.168  85.108 1.00 23.88 ? 441 LEU B CG  1 
ATOM   2602 C  CD1 . LEU B 1 105 ? 11.042  23.569  86.436 1.00 23.78 ? 441 LEU B CD1 1 
ATOM   2603 C  CD2 . LEU B 1 105 ? 13.037  23.832  84.941 1.00 24.94 ? 441 LEU B CD2 1 
ATOM   2604 N  N   . LEU B 1 106 ? 11.063  18.793  83.641 1.00 23.24 ? 442 LEU B N   1 
ATOM   2605 C  CA  . LEU B 1 106 ? 11.021  17.335  83.752 1.00 23.26 ? 442 LEU B CA  1 
ATOM   2606 C  C   . LEU B 1 106 ? 11.835  16.650  82.663 1.00 23.29 ? 442 LEU B C   1 
ATOM   2607 O  O   . LEU B 1 106 ? 12.548  15.682  82.922 1.00 23.81 ? 442 LEU B O   1 
ATOM   2608 C  CB  . LEU B 1 106 ? 9.568   16.833  83.716 1.00 23.13 ? 442 LEU B CB  1 
ATOM   2609 C  CG  . LEU B 1 106 ? 8.741   17.212  84.955 1.00 22.45 ? 442 LEU B CG  1 
ATOM   2610 C  CD1 . LEU B 1 106 ? 7.275   16.955  84.714 1.00 21.87 ? 442 LEU B CD1 1 
ATOM   2611 C  CD2 . LEU B 1 106 ? 9.238   16.470  86.196 1.00 21.67 ? 442 LEU B CD2 1 
ATOM   2612 N  N   . LEU B 1 107 ? 11.711  17.143  81.440 1.00 23.32 ? 443 LEU B N   1 
ATOM   2613 C  CA  . LEU B 1 107 ? 12.384  16.530  80.310 1.00 23.22 ? 443 LEU B CA  1 
ATOM   2614 C  C   . LEU B 1 107 ? 13.818  17.011  80.114 1.00 24.05 ? 443 LEU B C   1 
ATOM   2615 O  O   . LEU B 1 107 ? 14.605  16.315  79.474 1.00 23.91 ? 443 LEU B O   1 
ATOM   2616 C  CB  . LEU B 1 107 ? 11.576  16.734  79.035 1.00 22.83 ? 443 LEU B CB  1 
ATOM   2617 C  CG  . LEU B 1 107 ? 10.195  16.063  79.029 1.00 21.89 ? 443 LEU B CG  1 
ATOM   2618 C  CD1 . LEU B 1 107 ? 9.411   16.519  77.815 1.00 20.28 ? 443 LEU B CD1 1 
ATOM   2619 C  CD2 . LEU B 1 107 ? 10.284  14.510  79.094 1.00 21.92 ? 443 LEU B CD2 1 
ATOM   2620 N  N   . SER B 1 108 ? 14.170  18.189  80.635 1.00 24.73 ? 444 SER B N   1 
ATOM   2621 C  CA  . SER B 1 108 ? 15.531  18.693  80.449 1.00 25.32 ? 444 SER B CA  1 
ATOM   2622 C  C   . SER B 1 108 ? 16.520  18.027  81.407 1.00 26.57 ? 444 SER B C   1 
ATOM   2623 O  O   . SER B 1 108 ? 17.717  18.058  81.164 1.00 26.96 ? 444 SER B O   1 
ATOM   2624 C  CB  . SER B 1 108 ? 15.598  20.220  80.543 1.00 25.38 ? 444 SER B CB  1 
ATOM   2625 O  OG  . SER B 1 108 ? 15.040  20.710  81.752 1.00 24.13 ? 444 SER B OG  1 
ATOM   2626 N  N   . ASP B 1 109 ? 16.028  17.413  82.481 1.00 27.82 ? 445 ASP B N   1 
ATOM   2627 C  CA  . ASP B 1 109 ? 16.890  16.620  83.364 1.00 28.66 ? 445 ASP B CA  1 
ATOM   2628 C  C   . ASP B 1 109 ? 17.033  15.188  82.824 1.00 28.81 ? 445 ASP B C   1 
ATOM   2629 O  O   . ASP B 1 109 ? 16.249  14.298  83.161 1.00 28.38 ? 445 ASP B O   1 
ATOM   2630 C  CB  . ASP B 1 109 ? 16.352  16.640  84.800 1.00 29.18 ? 445 ASP B CB  1 
ATOM   2631 C  CG  . ASP B 1 109 ? 17.340  16.070  85.815 1.00 30.83 ? 445 ASP B CG  1 
ATOM   2632 O  OD1 . ASP B 1 109 ? 18.429  15.594  85.408 1.00 31.59 ? 445 ASP B OD1 1 
ATOM   2633 O  OD2 . ASP B 1 109 ? 17.015  16.102  87.028 1.00 32.87 ? 445 ASP B OD2 1 
ATOM   2634 N  N   . LEU B 1 110 ? 18.043  14.979  81.981 1.00 29.10 ? 446 LEU B N   1 
ATOM   2635 C  CA  . LEU B 1 110 ? 18.244  13.684  81.332 1.00 30.50 ? 446 LEU B CA  1 
ATOM   2636 C  C   . LEU B 1 110 ? 18.547  12.540  82.325 1.00 30.79 ? 446 LEU B C   1 
ATOM   2637 O  O   . LEU B 1 110 ? 18.395  11.356  81.972 1.00 30.85 ? 446 LEU B O   1 
ATOM   2638 C  CB  . LEU B 1 110 ? 19.352  13.760  80.264 1.00 30.68 ? 446 LEU B CB  1 
ATOM   2639 C  CG  . LEU B 1 110 ? 18.948  14.120  78.828 1.00 33.36 ? 446 LEU B CG  1 
ATOM   2640 C  CD1 . LEU B 1 110 ? 20.186  14.232  77.946 1.00 35.40 ? 446 LEU B CD1 1 
ATOM   2641 C  CD2 . LEU B 1 110 ? 17.984  13.087  78.229 1.00 34.62 ? 446 LEU B CD2 1 
ATOM   2642 N  N   . ARG B 1 111 ? 18.968  12.895  83.541 1.00 31.23 ? 447 ARG B N   1 
ATOM   2643 C  CA  . ARG B 1 111 ? 19.180  11.914  84.616 1.00 32.26 ? 447 ARG B CA  1 
ATOM   2644 C  C   . ARG B 1 111 ? 17.902  11.128  84.880 1.00 32.13 ? 447 ARG B C   1 
ATOM   2645 O  O   . ARG B 1 111 ? 17.950  9.960   85.220 1.00 32.41 ? 447 ARG B O   1 
ATOM   2646 C  CB  . ARG B 1 111 ? 19.624  12.589  85.923 1.00 32.59 ? 447 ARG B CB  1 
ATOM   2647 C  CG  . ARG B 1 111 ? 20.922  13.406  85.845 1.00 34.09 ? 447 ARG B CG  1 
ATOM   2648 C  CD  . ARG B 1 111 ? 21.387  13.887  87.220 1.00 36.26 ? 447 ARG B CD  1 
ATOM   2649 N  NE  . ARG B 1 111 ? 20.804  15.172  87.623 1.00 37.66 ? 447 ARG B NE  1 
ATOM   2650 C  CZ  . ARG B 1 111 ? 20.933  15.726  88.835 1.00 40.39 ? 447 ARG B CZ  1 
ATOM   2651 N  NH1 . ARG B 1 111 ? 21.624  15.120  89.800 1.00 40.67 ? 447 ARG B NH1 1 
ATOM   2652 N  NH2 . ARG B 1 111 ? 20.363  16.905  89.096 1.00 41.20 ? 447 ARG B NH2 1 
ATOM   2653 N  N   . GLN B 1 112 ? 16.764  11.786  84.713 1.00 32.38 ? 448 GLN B N   1 
ATOM   2654 C  CA  . GLN B 1 112 ? 15.453  11.199  84.981 1.00 32.74 ? 448 GLN B CA  1 
ATOM   2655 C  C   . GLN B 1 112 ? 14.857  10.438  83.809 1.00 31.81 ? 448 GLN B C   1 
ATOM   2656 O  O   . GLN B 1 112 ? 13.840  9.766   83.971 1.00 31.93 ? 448 GLN B O   1 
ATOM   2657 C  CB  . GLN B 1 112 ? 14.475  12.307  85.360 1.00 33.17 ? 448 GLN B CB  1 
ATOM   2658 C  CG  . GLN B 1 112 ? 14.838  13.015  86.625 1.00 35.47 ? 448 GLN B CG  1 
ATOM   2659 C  CD  . GLN B 1 112 ? 13.909  12.670  87.740 1.00 37.41 ? 448 GLN B CD  1 
ATOM   2660 O  OE1 . GLN B 1 112 ? 14.176  11.762  88.544 1.00 39.90 ? 448 GLN B OE1 1 
ATOM   2661 N  NE2 . GLN B 1 112 ? 12.786  13.381  87.796 1.00 38.29 ? 448 GLN B NE2 1 
ATOM   2662 N  N   . ARG B 1 113 ? 15.464  10.554  82.632 1.00 31.02 ? 449 ARG B N   1 
ATOM   2663 C  CA  . ARG B 1 113 ? 14.934  9.909   81.437 1.00 30.25 ? 449 ARG B CA  1 
ATOM   2664 C  C   . ARG B 1 113 ? 14.928  8.354   81.494 1.00 29.98 ? 449 ARG B C   1 
ATOM   2665 O  O   . ARG B 1 113 ? 14.012  7.731   80.946 1.00 29.24 ? 449 ARG B O   1 
ATOM   2666 C  CB  . ARG B 1 113 ? 15.652  10.424  80.178 1.00 30.18 ? 449 ARG B CB  1 
ATOM   2667 C  CG  . ARG B 1 113 ? 15.130  9.826   78.885 1.00 30.64 ? 449 ARG B CG  1 
ATOM   2668 C  CD  . ARG B 1 113 ? 15.511  10.651  77.662 1.00 32.03 ? 449 ARG B CD  1 
ATOM   2669 N  NE  . ARG B 1 113 ? 15.242  9.931   76.417 1.00 34.27 ? 449 ARG B NE  1 
ATOM   2670 C  CZ  . ARG B 1 113 ? 15.506  10.394  75.191 1.00 35.01 ? 449 ARG B CZ  1 
ATOM   2671 N  NH1 . ARG B 1 113 ? 16.083  11.573  75.022 1.00 37.00 ? 449 ARG B NH1 1 
ATOM   2672 N  NH2 . ARG B 1 113 ? 15.228  9.655   74.126 1.00 35.41 ? 449 ARG B NH2 1 
ATOM   2673 N  N   . PRO B 1 114 ? 15.938  7.722   82.139 1.00 29.58 ? 450 PRO B N   1 
ATOM   2674 C  CA  . PRO B 1 114 ? 15.884  6.262   82.329 1.00 29.86 ? 450 PRO B CA  1 
ATOM   2675 C  C   . PRO B 1 114 ? 14.603  5.767   83.012 1.00 30.14 ? 450 PRO B C   1 
ATOM   2676 O  O   . PRO B 1 114 ? 14.172  4.648   82.757 1.00 30.34 ? 450 PRO B O   1 
ATOM   2677 C  CB  . PRO B 1 114 ? 17.100  5.973   83.211 1.00 29.63 ? 450 PRO B CB  1 
ATOM   2678 C  CG  . PRO B 1 114 ? 18.070  7.044   82.877 1.00 29.65 ? 450 PRO B CG  1 
ATOM   2679 C  CD  . PRO B 1 114 ? 17.266  8.265   82.474 1.00 29.69 ? 450 PRO B CD  1 
ATOM   2680 N  N   . GLU B 1 115 ? 13.985  6.611   83.835 1.00 30.62 ? 451 GLU B N   1 
ATOM   2681 C  CA  . GLU B 1 115 ? 12.742  6.250   84.517 1.00 30.82 ? 451 GLU B CA  1 
ATOM   2682 C  C   . GLU B 1 115 ? 11.565  5.976   83.592 1.00 30.67 ? 451 GLU B C   1 
ATOM   2683 O  O   . GLU B 1 115 ? 10.746  5.117   83.907 1.00 30.25 ? 451 GLU B O   1 
ATOM   2684 C  CB  . GLU B 1 115 ? 12.340  7.355   85.465 1.00 31.27 ? 451 GLU B CB  1 
ATOM   2685 C  CG  . GLU B 1 115 ? 13.403  7.671   86.473 1.00 33.39 ? 451 GLU B CG  1 
ATOM   2686 C  CD  . GLU B 1 115 ? 12.816  7.982   87.814 1.00 36.07 ? 451 GLU B CD  1 
ATOM   2687 O  OE1 . GLU B 1 115 ? 12.485  9.164   88.058 1.00 38.82 ? 451 GLU B OE1 1 
ATOM   2688 O  OE2 . GLU B 1 115 ? 12.683  7.033   88.616 1.00 37.96 ? 451 GLU B OE2 1 
ATOM   2689 N  N   . TRP B 1 116 ? 11.469  6.712   82.474 1.00 30.19 ? 452 TRP B N   1 
ATOM   2690 C  CA  . TRP B 1 116 ? 10.356  6.533   81.517 1.00 29.71 ? 452 TRP B CA  1 
ATOM   2691 C  C   . TRP B 1 116 ? 10.767  5.978   80.162 1.00 29.55 ? 452 TRP B C   1 
ATOM   2692 O  O   . TRP B 1 116 ? 9.921   5.540   79.406 1.00 29.91 ? 452 TRP B O   1 
ATOM   2693 C  CB  . TRP B 1 116 ? 9.581   7.836   81.316 1.00 29.51 ? 452 TRP B CB  1 
ATOM   2694 C  CG  . TRP B 1 116 ? 10.383  8.983   80.767 1.00 28.58 ? 452 TRP B CG  1 
ATOM   2695 C  CD1 . TRP B 1 116 ? 11.055  9.936   81.488 1.00 27.23 ? 452 TRP B CD1 1 
ATOM   2696 C  CD2 . TRP B 1 116 ? 10.578  9.314   79.391 1.00 27.21 ? 452 TRP B CD2 1 
ATOM   2697 N  NE1 . TRP B 1 116 ? 11.658  10.836  80.639 1.00 27.12 ? 452 TRP B NE1 1 
ATOM   2698 C  CE2 . TRP B 1 116 ? 11.380  10.479  79.347 1.00 26.24 ? 452 TRP B CE2 1 
ATOM   2699 C  CE3 . TRP B 1 116 ? 10.146  8.749   78.189 1.00 26.78 ? 452 TRP B CE3 1 
ATOM   2700 C  CZ2 . TRP B 1 116 ? 11.765  11.071  78.157 1.00 23.93 ? 452 TRP B CZ2 1 
ATOM   2701 C  CZ3 . TRP B 1 116 ? 10.535  9.344   76.996 1.00 25.54 ? 452 TRP B CZ3 1 
ATOM   2702 C  CH2 . TRP B 1 116 ? 11.341  10.485  76.992 1.00 25.69 ? 452 TRP B CH2 1 
ATOM   2703 N  N   . ASP B 1 117 ? 12.056  5.984   79.846 1.00 29.66 ? 453 ASP B N   1 
ATOM   2704 C  CA  . ASP B 1 117 ? 12.515  5.592   78.512 1.00 29.49 ? 453 ASP B CA  1 
ATOM   2705 C  C   . ASP B 1 117 ? 13.477  4.405   78.555 1.00 29.34 ? 453 ASP B C   1 
ATOM   2706 O  O   . ASP B 1 117 ? 14.645  4.543   78.932 1.00 28.60 ? 453 ASP B O   1 
ATOM   2707 C  CB  . ASP B 1 117 ? 13.180  6.793   77.835 1.00 29.66 ? 453 ASP B CB  1 
ATOM   2708 C  CG  . ASP B 1 117 ? 13.567  6.522   76.400 1.00 29.58 ? 453 ASP B CG  1 
ATOM   2709 O  OD1 . ASP B 1 117 ? 13.311  5.401   75.903 1.00 29.29 ? 453 ASP B OD1 1 
ATOM   2710 O  OD2 . ASP B 1 117 ? 14.127  7.450   75.765 1.00 30.74 ? 453 ASP B OD2 1 
ATOM   2711 N  N   . LYS B 1 118 ? 12.989  3.253   78.109 1.00 29.43 ? 454 LYS B N   1 
ATOM   2712 C  CA  . LYS B 1 118 ? 13.777  2.027   78.130 1.00 29.87 ? 454 LYS B CA  1 
ATOM   2713 C  C   . LYS B 1 118 ? 15.064  2.145   77.321 1.00 29.81 ? 454 LYS B C   1 
ATOM   2714 O  O   . LYS B 1 118 ? 16.028  1.441   77.568 1.00 29.72 ? 454 LYS B O   1 
ATOM   2715 C  CB  . LYS B 1 118 ? 12.938  0.822   77.654 1.00 30.21 ? 454 LYS B CB  1 
ATOM   2716 C  CG  . LYS B 1 118 ? 12.512  0.872   76.175 1.00 31.31 ? 454 LYS B CG  1 
ATOM   2717 C  CD  . LYS B 1 118 ? 11.981  -0.477  75.659 1.00 33.18 ? 454 LYS B CD  1 
ATOM   2718 C  CE  . LYS B 1 118 ? 10.546  -0.805  76.127 1.00 33.40 ? 454 LYS B CE  1 
ATOM   2719 N  NZ  . LYS B 1 118 ? 9.874   -1.816  75.226 1.00 33.22 ? 454 LYS B NZ  1 
ATOM   2720 N  N   . HIS B 1 119 ? 15.084  3.061   76.365 1.00 29.95 ? 455 HIS B N   1 
ATOM   2721 C  CA  . HIS B 1 119 ? 16.242  3.226   75.494 1.00 30.01 ? 455 HIS B CA  1 
ATOM   2722 C  C   . HIS B 1 119 ? 17.382  3.949   76.189 1.00 29.05 ? 455 HIS B C   1 
ATOM   2723 O  O   . HIS B 1 119 ? 18.492  3.986   75.666 1.00 29.00 ? 455 HIS B O   1 
ATOM   2724 C  CB  . HIS B 1 119 ? 15.829  3.985   74.242 1.00 30.11 ? 455 HIS B CB  1 
ATOM   2725 C  CG  . HIS B 1 119 ? 14.661  3.368   73.541 1.00 31.93 ? 455 HIS B CG  1 
ATOM   2726 N  ND1 . HIS B 1 119 ? 13.403  3.934   73.555 1.00 32.60 ? 455 HIS B ND1 1 
ATOM   2727 C  CD2 . HIS B 1 119 ? 14.550  2.212   72.848 1.00 33.06 ? 455 HIS B CD2 1 
ATOM   2728 C  CE1 . HIS B 1 119 ? 12.572  3.163   72.879 1.00 33.70 ? 455 HIS B CE1 1 
ATOM   2729 N  NE2 . HIS B 1 119 ? 13.244  2.115   72.433 1.00 34.39 ? 455 HIS B NE2 1 
ATOM   2730 N  N   . TYR B 1 120 ? 17.078  4.557   77.335 1.00 28.12 ? 456 TYR B N   1 
ATOM   2731 C  CA  . TYR B 1 120 ? 18.072  5.160   78.211 1.00 27.61 ? 456 TYR B CA  1 
ATOM   2732 C  C   . TYR B 1 120 ? 18.339  4.189   79.375 1.00 26.75 ? 456 TYR B C   1 
ATOM   2733 O  O   . TYR B 1 120 ? 17.628  4.185   80.371 1.00 25.90 ? 456 TYR B O   1 
ATOM   2734 C  CB  . TYR B 1 120 ? 17.583  6.522   78.726 1.00 28.16 ? 456 TYR B CB  1 
ATOM   2735 C  CG  . TYR B 1 120 ? 18.010  7.693   77.862 1.00 28.83 ? 456 TYR B CG  1 
ATOM   2736 C  CD1 . TYR B 1 120 ? 17.689  7.750   76.514 1.00 30.55 ? 456 TYR B CD1 1 
ATOM   2737 C  CD2 . TYR B 1 120 ? 18.724  8.746   78.410 1.00 30.54 ? 456 TYR B CD2 1 
ATOM   2738 C  CE1 . TYR B 1 120 ? 18.092  8.820   75.734 1.00 32.40 ? 456 TYR B CE1 1 
ATOM   2739 C  CE2 . TYR B 1 120 ? 19.118  9.812   77.651 1.00 31.87 ? 456 TYR B CE2 1 
ATOM   2740 C  CZ  . TYR B 1 120 ? 18.806  9.848   76.315 1.00 33.18 ? 456 TYR B CZ  1 
ATOM   2741 O  OH  . TYR B 1 120 ? 19.215  10.932  75.575 1.00 36.01 ? 456 TYR B OH  1 
ATOM   2742 N  N   . ARG B 1 121 ? 19.355  3.354   79.213 1.00 26.32 ? 457 ARG B N   1 
ATOM   2743 C  CA  . ARG B 1 121 ? 19.715  2.376   80.236 1.00 26.05 ? 457 ARG B CA  1 
ATOM   2744 C  C   . ARG B 1 121 ? 20.269  3.099   81.438 1.00 25.66 ? 457 ARG B C   1 
ATOM   2745 O  O   . ARG B 1 121 ? 19.848  2.833   82.566 1.00 25.37 ? 457 ARG B O   1 
ATOM   2746 C  CB  . ARG B 1 121 ? 20.751  1.403   79.715 1.00 26.51 ? 457 ARG B CB  1 
ATOM   2747 C  CG  . ARG B 1 121 ? 20.818  0.119   80.541 1.00 28.89 ? 457 ARG B CG  1 
ATOM   2748 C  CD  . ARG B 1 121 ? 22.027  -0.702  80.185 1.00 31.55 ? 457 ARG B CD  1 
ATOM   2749 N  NE  . ARG B 1 121 ? 23.239  -0.011  80.611 1.00 33.97 ? 457 ARG B NE  1 
ATOM   2750 C  CZ  . ARG B 1 121 ? 24.453  -0.554  80.635 1.00 33.73 ? 457 ARG B CZ  1 
ATOM   2751 N  NH1 . ARG B 1 121 ? 24.650  -1.812  80.258 1.00 32.28 ? 457 ARG B NH1 1 
ATOM   2752 N  NH2 . ARG B 1 121 ? 25.476  0.187   81.040 1.00 34.43 ? 457 ARG B NH2 1 
ATOM   2753 N  N   . SER B 1 122 ? 21.211  4.017   81.193 1.00 24.86 ? 458 SER B N   1 
ATOM   2754 C  CA  . SER B 1 122 ? 21.793  4.834   82.262 1.00 24.97 ? 458 SER B CA  1 
ATOM   2755 C  C   . SER B 1 122 ? 22.205  6.202   81.765 1.00 24.69 ? 458 SER B C   1 
ATOM   2756 O  O   . SER B 1 122 ? 22.445  6.405   80.568 1.00 24.05 ? 458 SER B O   1 
ATOM   2757 C  CB  . SER B 1 122 ? 23.008  4.147   82.922 1.00 25.01 ? 458 SER B CB  1 
ATOM   2758 O  OG  . SER B 1 122 ? 24.123  4.048   82.043 1.00 24.85 ? 458 SER B OG  1 
ATOM   2759 N  N   . VAL B 1 123 ? 22.297  7.130   82.710 1.00 24.95 ? 459 VAL B N   1 
ATOM   2760 C  CA  . VAL B 1 123 ? 22.707  8.506   82.419 1.00 24.68 ? 459 VAL B CA  1 
ATOM   2761 C  C   . VAL B 1 123 ? 23.606  9.009   83.527 1.00 24.56 ? 459 VAL B C   1 
ATOM   2762 O  O   . VAL B 1 123 ? 23.282  8.918   84.710 1.00 24.47 ? 459 VAL B O   1 
ATOM   2763 C  CB  . VAL B 1 123 ? 21.503  9.443   82.246 1.00 24.97 ? 459 VAL B CB  1 
ATOM   2764 C  CG1 . VAL B 1 123 ? 21.963  10.926  82.173 1.00 25.45 ? 459 VAL B CG1 1 
ATOM   2765 C  CG2 . VAL B 1 123 ? 20.737  9.070   80.987 1.00 23.66 ? 459 VAL B CG2 1 
ATOM   2766 N  N   . GLU B 1 124 ? 24.745  9.538   83.114 1.00 24.52 ? 460 GLU B N   1 
ATOM   2767 C  CA  . GLU B 1 124 ? 25.734  10.090  84.005 1.00 24.72 ? 460 GLU B CA  1 
ATOM   2768 C  C   . GLU B 1 124 ? 26.083  11.510  83.559 1.00 24.28 ? 460 GLU B C   1 
ATOM   2769 O  O   . GLU B 1 124 ? 26.363  11.740  82.370 1.00 24.34 ? 460 GLU B O   1 
ATOM   2770 C  CB  . GLU B 1 124 ? 26.951  9.215   83.882 1.00 25.12 ? 460 GLU B CB  1 
ATOM   2771 C  CG  . GLU B 1 124 ? 27.902  9.284   84.969 1.00 26.62 ? 460 GLU B CG  1 
ATOM   2772 C  CD  . GLU B 1 124 ? 28.938  8.229   84.778 1.00 28.80 ? 460 GLU B CD  1 
ATOM   2773 O  OE1 . GLU B 1 124 ? 29.175  7.866   83.602 1.00 31.17 ? 460 GLU B OE1 1 
ATOM   2774 O  OE2 . GLU B 1 124 ? 29.488  7.743   85.776 1.00 30.48 ? 460 GLU B OE2 1 
ATOM   2775 N  N   . LEU B 1 125 ? 26.043  12.453  84.495 1.00 24.10 ? 461 LEU B N   1 
ATOM   2776 C  CA  . LEU B 1 125 ? 26.445  13.846  84.227 1.00 24.31 ? 461 LEU B CA  1 
ATOM   2777 C  C   . LEU B 1 125 ? 27.956  13.920  84.218 1.00 24.04 ? 461 LEU B C   1 
ATOM   2778 O  O   . LEU B 1 125 ? 28.592  13.665  85.222 1.00 24.25 ? 461 LEU B O   1 
ATOM   2779 C  CB  . LEU B 1 125 ? 25.893  14.810  85.289 1.00 24.29 ? 461 LEU B CB  1 
ATOM   2780 C  CG  . LEU B 1 125 ? 26.221  16.307  85.100 1.00 25.26 ? 461 LEU B CG  1 
ATOM   2781 C  CD1 . LEU B 1 125 ? 25.839  16.790  83.731 1.00 21.85 ? 461 LEU B CD1 1 
ATOM   2782 C  CD2 . LEU B 1 125 ? 25.556  17.182  86.155 1.00 25.47 ? 461 LEU B CD2 1 
ATOM   2783 N  N   . VAL B 1 126 ? 28.534  14.239  83.077 1.00 23.92 ? 462 VAL B N   1 
ATOM   2784 C  CA  . VAL B 1 126 ? 29.976  14.403  82.981 1.00 24.23 ? 462 VAL B CA  1 
ATOM   2785 C  C   . VAL B 1 126 ? 30.362  15.803  83.466 1.00 24.05 ? 462 VAL B C   1 
ATOM   2786 O  O   . VAL B 1 126 ? 31.206  15.974  84.334 1.00 23.29 ? 462 VAL B O   1 
ATOM   2787 C  CB  . VAL B 1 126 ? 30.443  14.227  81.515 1.00 24.36 ? 462 VAL B CB  1 
ATOM   2788 C  CG1 . VAL B 1 126 ? 31.923  14.601  81.370 1.00 26.13 ? 462 VAL B CG1 1 
ATOM   2789 C  CG2 . VAL B 1 126 ? 30.164  12.816  81.036 1.00 24.26 ? 462 VAL B CG2 1 
ATOM   2790 N  N   . GLN B 1 127 ? 29.697  16.812  82.925 1.00 24.11 ? 463 GLN B N   1 
ATOM   2791 C  CA  . GLN B 1 127 ? 30.140  18.180  83.109 1.00 24.55 ? 463 GLN B CA  1 
ATOM   2792 C  C   . GLN B 1 127 ? 28.934  19.103  83.048 1.00 24.45 ? 463 GLN B C   1 
ATOM   2793 O  O   . GLN B 1 127 ? 28.227  19.154  82.031 1.00 23.99 ? 463 GLN B O   1 
ATOM   2794 C  CB  . GLN B 1 127 ? 31.136  18.503  81.999 1.00 24.79 ? 463 GLN B CB  1 
ATOM   2795 C  CG  . GLN B 1 127 ? 32.099  19.621  82.281 1.00 27.84 ? 463 GLN B CG  1 
ATOM   2796 C  CD  . GLN B 1 127 ? 33.211  19.654  81.245 1.00 30.82 ? 463 GLN B CD  1 
ATOM   2797 O  OE1 . GLN B 1 127 ? 34.242  18.976  81.381 1.00 33.69 ? 463 GLN B OE1 1 
ATOM   2798 N  NE2 . GLN B 1 127 ? 32.998  20.431  80.190 1.00 33.20 ? 463 GLN B NE2 1 
ATOM   2799 N  N   . GLN B 1 128 ? 28.644  19.768  84.162 1.00 24.35 ? 464 GLN B N   1 
ATOM   2800 C  CA  . GLN B 1 128 ? 27.648  20.818  84.172 1.00 24.65 ? 464 GLN B CA  1 
ATOM   2801 C  C   . GLN B 1 128 ? 28.346  22.011  83.531 1.00 24.62 ? 464 GLN B C   1 
ATOM   2802 O  O   . GLN B 1 128 ? 29.298  22.531  84.099 1.00 24.35 ? 464 GLN B O   1 
ATOM   2803 C  CB  . GLN B 1 128 ? 27.185  21.177  85.590 1.00 24.77 ? 464 GLN B CB  1 
ATOM   2804 C  CG  . GLN B 1 128 ? 26.005  22.148  85.614 1.00 25.42 ? 464 GLN B CG  1 
ATOM   2805 C  CD  . GLN B 1 128 ? 24.728  21.503  85.147 1.00 27.12 ? 464 GLN B CD  1 
ATOM   2806 O  OE1 . GLN B 1 128 ? 24.401  20.389  85.574 1.00 27.33 ? 464 GLN B OE1 1 
ATOM   2807 N  NE2 . GLN B 1 128 ? 23.989  22.190  84.262 1.00 25.96 ? 464 GLN B NE2 1 
ATOM   2808 N  N   . VAL B 1 129 ? 27.889  22.418  82.346 1.00 23.98 ? 465 VAL B N   1 
ATOM   2809 C  CA  . VAL B 1 129 ? 28.529  23.513  81.616 1.00 23.81 ? 465 VAL B CA  1 
ATOM   2810 C  C   . VAL B 1 129 ? 28.002  24.868  82.116 1.00 23.55 ? 465 VAL B C   1 
ATOM   2811 O  O   . VAL B 1 129 ? 28.782  25.774  82.416 1.00 23.90 ? 465 VAL B O   1 
ATOM   2812 C  CB  . VAL B 1 129 ? 28.351  23.341  80.092 1.00 23.84 ? 465 VAL B CB  1 
ATOM   2813 C  CG1 . VAL B 1 129 ? 29.026  24.487  79.322 1.00 23.30 ? 465 VAL B CG1 1 
ATOM   2814 C  CG2 . VAL B 1 129 ? 28.913  21.978  79.654 1.00 24.05 ? 465 VAL B CG2 1 
ATOM   2815 N  N   . ASP B 1 130 ? 26.686  24.993  82.236 1.00 23.20 ? 466 ASP B N   1 
ATOM   2816 C  CA  . ASP B 1 130 ? 26.087  26.165  82.875 1.00 23.32 ? 466 ASP B CA  1 
ATOM   2817 C  C   . ASP B 1 130 ? 24.663  25.828  83.291 1.00 22.97 ? 466 ASP B C   1 
ATOM   2818 O  O   . ASP B 1 130 ? 24.266  24.683  83.226 1.00 22.59 ? 466 ASP B O   1 
ATOM   2819 C  CB  . ASP B 1 130 ? 26.183  27.397  81.957 1.00 23.26 ? 466 ASP B CB  1 
ATOM   2820 C  CG  . ASP B 1 130 ? 25.631  27.138  80.575 1.00 24.54 ? 466 ASP B CG  1 
ATOM   2821 O  OD1 . ASP B 1 130 ? 24.595  26.452  80.482 1.00 25.26 ? 466 ASP B OD1 1 
ATOM   2822 O  OD2 . ASP B 1 130 ? 26.213  27.622  79.580 1.00 25.70 ? 466 ASP B OD2 1 
ATOM   2823 N  N   . GLU B 1 131 ? 23.900  26.808  83.747 1.00 23.62 ? 467 GLU B N   1 
ATOM   2824 C  CA  . GLU B 1 131 ? 22.489  26.577  84.129 1.00 24.37 ? 467 GLU B CA  1 
ATOM   2825 C  C   . GLU B 1 131 ? 21.669  25.746  83.110 1.00 24.04 ? 467 GLU B C   1 
ATOM   2826 O  O   . GLU B 1 131 ? 20.871  24.911  83.501 1.00 23.39 ? 467 GLU B O   1 
ATOM   2827 C  CB  . GLU B 1 131 ? 21.800  27.924  84.346 1.00 25.55 ? 467 GLU B CB  1 
ATOM   2828 C  CG  . GLU B 1 131 ? 20.551  27.904  85.205 1.00 29.06 ? 467 GLU B CG  1 
ATOM   2829 C  CD  . GLU B 1 131 ? 20.079  29.321  85.570 1.00 33.52 ? 467 GLU B CD  1 
ATOM   2830 O  OE1 . GLU B 1 131 ? 19.789  30.128  84.649 1.00 37.30 ? 467 GLU B OE1 1 
ATOM   2831 O  OE2 . GLU B 1 131 ? 20.010  29.635  86.782 1.00 36.82 ? 467 GLU B OE2 1 
ATOM   2832 N  N   . ASP B 1 132 ? 21.867  25.981  81.814 1.00 23.52 ? 468 ASP B N   1 
ATOM   2833 C  CA  . ASP B 1 132 ? 21.076  25.320  80.771 1.00 22.97 ? 468 ASP B CA  1 
ATOM   2834 C  C   . ASP B 1 132 ? 21.851  24.406  79.820 1.00 22.43 ? 468 ASP B C   1 
ATOM   2835 O  O   . ASP B 1 132 ? 21.344  24.080  78.755 1.00 22.70 ? 468 ASP B O   1 
ATOM   2836 C  CB  . ASP B 1 132 ? 20.361  26.383  79.926 1.00 23.17 ? 468 ASP B CB  1 
ATOM   2837 C  CG  . ASP B 1 132 ? 19.331  27.168  80.729 1.00 25.12 ? 468 ASP B CG  1 
ATOM   2838 O  OD1 . ASP B 1 132 ? 18.579  26.572  81.550 1.00 27.56 ? 468 ASP B OD1 1 
ATOM   2839 O  OD2 . ASP B 1 132 ? 19.270  28.380  80.531 1.00 26.64 ? 468 ASP B OD2 1 
ATOM   2840 N  N   . ASP B 1 133 ? 23.069  24.010  80.170 1.00 21.38 ? 469 ASP B N   1 
ATOM   2841 C  CA  . ASP B 1 133 ? 23.871  23.168  79.279 1.00 20.91 ? 469 ASP B CA  1 
ATOM   2842 C  C   . ASP B 1 133 ? 24.650  22.156  80.107 1.00 20.59 ? 469 ASP B C   1 
ATOM   2843 O  O   . ASP B 1 133 ? 25.260  22.501  81.146 1.00 20.61 ? 469 ASP B O   1 
ATOM   2844 C  CB  . ASP B 1 133 ? 24.856  24.000  78.424 1.00 20.72 ? 469 ASP B CB  1 
ATOM   2845 C  CG  . ASP B 1 133 ? 24.165  25.062  77.569 1.00 21.99 ? 469 ASP B CG  1 
ATOM   2846 O  OD1 . ASP B 1 133 ? 23.648  24.746  76.479 1.00 24.49 ? 469 ASP B OD1 1 
ATOM   2847 O  OD2 . ASP B 1 133 ? 24.139  26.229  77.986 1.00 23.63 ? 469 ASP B OD2 1 
ATOM   2848 N  N   . ALA B 1 134 ? 24.648  20.914  79.638 1.00 20.08 ? 470 ALA B N   1 
ATOM   2849 C  CA  . ALA B 1 134 ? 25.355  19.854  80.320 1.00 19.56 ? 470 ALA B CA  1 
ATOM   2850 C  C   . ALA B 1 134 ? 25.838  18.763  79.346 1.00 19.40 ? 470 ALA B C   1 
ATOM   2851 O  O   . ALA B 1 134 ? 25.217  18.524  78.308 1.00 18.47 ? 470 ALA B O   1 
ATOM   2852 C  CB  . ALA B 1 134 ? 24.468  19.266  81.406 1.00 19.83 ? 470 ALA B CB  1 
ATOM   2853 N  N   . ILE B 1 135 ? 26.960  18.122  79.687 1.00 18.33 ? 471 ILE B N   1 
ATOM   2854 C  CA  . ILE B 1 135 ? 27.446  16.972  78.937 1.00 18.32 ? 471 ILE B CA  1 
ATOM   2855 C  C   . ILE B 1 135 ? 27.108  15.742  79.772 1.00 18.34 ? 471 ILE B C   1 
ATOM   2856 O  O   . ILE B 1 135 ? 27.357  15.719  80.986 1.00 17.91 ? 471 ILE B O   1 
ATOM   2857 C  CB  . ILE B 1 135 ? 28.951  17.059  78.638 1.00 18.03 ? 471 ILE B CB  1 
ATOM   2858 C  CG1 . ILE B 1 135 ? 29.260  18.346  77.860 1.00 19.68 ? 471 ILE B CG1 1 
ATOM   2859 C  CG2 . ILE B 1 135 ? 29.407  15.895  77.831 1.00 17.67 ? 471 ILE B CG2 1 
ATOM   2860 C  CD1 . ILE B 1 135 ? 30.722  18.669  77.798 1.00 19.79 ? 471 ILE B CD1 1 
ATOM   2861 N  N   . TYR B 1 136 ? 26.518  14.747  79.116 1.00 18.53 ? 472 TYR B N   1 
ATOM   2862 C  CA  . TYR B 1 136 ? 26.095  13.513  79.734 1.00 19.19 ? 472 TYR B CA  1 
ATOM   2863 C  C   . TYR B 1 136 ? 26.743  12.343  79.045 1.00 19.94 ? 472 TYR B C   1 
ATOM   2864 O  O   . TYR B 1 136 ? 26.940  12.373  77.836 1.00 20.71 ? 472 TYR B O   1 
ATOM   2865 C  CB  . TYR B 1 136 ? 24.592  13.308  79.614 1.00 18.73 ? 472 TYR B CB  1 
ATOM   2866 C  CG  . TYR B 1 136 ? 23.757  14.279  80.391 1.00 20.52 ? 472 TYR B CG  1 
ATOM   2867 C  CD1 . TYR B 1 136 ? 23.396  14.024  81.704 1.00 21.80 ? 472 TYR B CD1 1 
ATOM   2868 C  CD2 . TYR B 1 136 ? 23.295  15.459  79.793 1.00 21.03 ? 472 TYR B CD2 1 
ATOM   2869 C  CE1 . TYR B 1 136 ? 22.615  14.916  82.411 1.00 23.72 ? 472 TYR B CE1 1 
ATOM   2870 C  CE2 . TYR B 1 136 ? 22.531  16.346  80.484 1.00 21.79 ? 472 TYR B CE2 1 
ATOM   2871 C  CZ  . TYR B 1 136 ? 22.180  16.070  81.788 1.00 23.92 ? 472 TYR B CZ  1 
ATOM   2872 O  OH  . TYR B 1 136 ? 21.416  16.980  82.467 1.00 24.83 ? 472 TYR B OH  1 
ATOM   2873 N  N   . HIS B 1 137 ? 27.061  11.316  79.826 1.00 20.57 ? 473 HIS B N   1 
ATOM   2874 C  CA  . HIS B 1 137 ? 27.389  9.999   79.299 1.00 21.09 ? 473 HIS B CA  1 
ATOM   2875 C  C   . HIS B 1 137 ? 26.121  9.137   79.395 1.00 21.28 ? 473 HIS B C   1 
ATOM   2876 O  O   . HIS B 1 137 ? 25.579  8.924   80.475 1.00 21.23 ? 473 HIS B O   1 
ATOM   2877 C  CB  . HIS B 1 137 ? 28.553  9.367   80.073 1.00 21.18 ? 473 HIS B CB  1 
ATOM   2878 C  CG  . HIS B 1 137 ? 29.028  8.070   79.494 1.00 21.89 ? 473 HIS B CG  1 
ATOM   2879 N  ND1 . HIS B 1 137 ? 29.338  6.980   80.274 1.00 23.56 ? 473 HIS B ND1 1 
ATOM   2880 C  CD2 . HIS B 1 137 ? 29.219  7.678   78.212 1.00 22.00 ? 473 HIS B CD2 1 
ATOM   2881 C  CE1 . HIS B 1 137 ? 29.707  5.975   79.499 1.00 22.73 ? 473 HIS B CE1 1 
ATOM   2882 N  NE2 . HIS B 1 137 ? 29.652  6.375   78.244 1.00 22.47 ? 473 HIS B NE2 1 
ATOM   2883 N  N   . VAL B 1 138 ? 25.637  8.678   78.251 1.00 21.33 ? 474 VAL B N   1 
ATOM   2884 C  CA  . VAL B 1 138 ? 24.417  7.883   78.192 1.00 22.12 ? 474 VAL B CA  1 
ATOM   2885 C  C   . VAL B 1 138 ? 24.735  6.491   77.682 1.00 22.99 ? 474 VAL B C   1 
ATOM   2886 O  O   . VAL B 1 138 ? 25.482  6.338   76.710 1.00 22.93 ? 474 VAL B O   1 
ATOM   2887 C  CB  . VAL B 1 138 ? 23.397  8.518   77.231 1.00 22.25 ? 474 VAL B CB  1 
ATOM   2888 C  CG1 . VAL B 1 138 ? 22.090  7.676   77.190 1.00 22.16 ? 474 VAL B CG1 1 
ATOM   2889 C  CG2 . VAL B 1 138 ? 23.140  9.963   77.654 1.00 21.81 ? 474 VAL B CG2 1 
ATOM   2890 N  N   . THR B 1 139 ? 24.167  5.481   78.326 1.00 23.85 ? 475 THR B N   1 
ATOM   2891 C  CA  . THR B 1 139 ? 24.287  4.131   77.818 1.00 25.25 ? 475 THR B CA  1 
ATOM   2892 C  C   . THR B 1 139 ? 22.904  3.648   77.406 1.00 26.58 ? 475 THR B C   1 
ATOM   2893 O  O   . THR B 1 139 ? 21.884  4.100   77.938 1.00 26.10 ? 475 THR B O   1 
ATOM   2894 C  CB  . THR B 1 139 ? 24.934  3.166   78.823 1.00 24.97 ? 475 THR B CB  1 
ATOM   2895 O  OG1 . THR B 1 139 ? 24.029  2.916   79.902 1.00 25.20 ? 475 THR B OG1 1 
ATOM   2896 C  CG2 . THR B 1 139 ? 26.238  3.748   79.380 1.00 24.30 ? 475 THR B CG2 1 
ATOM   2897 N  N   . SER B 1 140 ? 22.895  2.727   76.450 1.00 27.95 ? 476 SER B N   1 
ATOM   2898 C  CA  . SER B 1 140 ? 21.668  2.279   75.811 1.00 29.64 ? 476 SER B CA  1 
ATOM   2899 C  C   . SER B 1 140 ? 21.731  0.770   75.582 1.00 30.83 ? 476 SER B C   1 
ATOM   2900 O  O   . SER B 1 140 ? 22.785  0.267   75.188 1.00 29.89 ? 476 SER B O   1 
ATOM   2901 C  CB  . SER B 1 140 ? 21.493  3.016   74.479 1.00 29.66 ? 476 SER B CB  1 
ATOM   2902 O  OG  . SER B 1 140 ? 20.259  2.695   73.889 1.00 30.75 ? 476 SER B OG  1 
ATOM   2903 N  N   . PRO B 1 141 ? 20.609  0.052   75.832 1.00 32.86 ? 477 PRO B N   1 
ATOM   2904 C  CA  . PRO B 1 141 ? 20.626  -1.381  75.593 1.00 34.51 ? 477 PRO B CA  1 
ATOM   2905 C  C   . PRO B 1 141 ? 20.905  -1.671  74.133 1.00 36.01 ? 477 PRO B C   1 
ATOM   2906 O  O   . PRO B 1 141 ? 20.461  -0.918  73.258 1.00 36.02 ? 477 PRO B O   1 
ATOM   2907 C  CB  . PRO B 1 141 ? 19.213  -1.841  75.985 1.00 34.34 ? 477 PRO B CB  1 
ATOM   2908 C  CG  . PRO B 1 141 ? 18.602  -0.706  76.725 1.00 33.90 ? 477 PRO B CG  1 
ATOM   2909 C  CD  . PRO B 1 141 ? 19.267  0.519   76.228 1.00 32.97 ? 477 PRO B CD  1 
ATOM   2910 N  N   . ALA B 1 142 ? 21.682  -2.722  73.892 1.00 37.80 ? 478 ALA B N   1 
ATOM   2911 C  CA  . ALA B 1 142 ? 21.916  -3.222  72.543 1.00 39.54 ? 478 ALA B CA  1 
ATOM   2912 C  C   . ALA B 1 142 ? 20.598  -3.691  71.928 1.00 41.01 ? 478 ALA B C   1 
ATOM   2913 O  O   . ALA B 1 142 ? 19.763  -4.304  72.603 1.00 41.25 ? 478 ALA B O   1 
ATOM   2914 C  CB  . ALA B 1 142 ? 22.918  -4.376  72.561 1.00 39.49 ? 478 ALA B CB  1 
ATOM   2915 N  N   . LEU B 1 143 ? 20.411  -3.377  70.651 1.00 42.72 ? 479 LEU B N   1 
ATOM   2916 C  CA  . LEU B 1 143 ? 19.233  -3.826  69.911 1.00 43.91 ? 479 LEU B CA  1 
ATOM   2917 C  C   . LEU B 1 143 ? 19.566  -4.025  68.428 1.00 44.57 ? 479 LEU B C   1 
ATOM   2918 O  O   . LEU B 1 143 ? 20.229  -3.184  67.807 1.00 44.83 ? 479 LEU B O   1 
ATOM   2919 C  CB  . LEU B 1 143 ? 18.029  -2.876  70.122 1.00 43.73 ? 479 LEU B CB  1 
ATOM   2920 C  CG  . LEU B 1 143 ? 18.199  -1.427  70.591 1.00 44.21 ? 479 LEU B CG  1 
ATOM   2921 C  CD1 . LEU B 1 143 ? 18.340  -0.479  69.404 1.00 44.48 ? 479 LEU B CD1 1 
ATOM   2922 C  CD2 . LEU B 1 143 ? 17.010  -1.005  71.490 1.00 43.60 ? 479 LEU B CD2 1 
ATOM   2923 N  N   . GLY B 1 144 ? 19.114  -5.155  67.883 1.00 45.34 ? 480 GLY B N   1 
ATOM   2924 C  CA  . GLY B 1 144 ? 19.464  -5.568  66.532 1.00 45.69 ? 480 GLY B CA  1 
ATOM   2925 C  C   . GLY B 1 144 ? 20.709  -6.442  66.509 1.00 46.08 ? 480 GLY B C   1 
ATOM   2926 O  O   . GLY B 1 144 ? 21.666  -6.150  65.789 1.00 46.57 ? 480 GLY B O   1 
ATOM   2927 N  N   . GLY B 1 145 ? 20.706  -7.503  67.312 1.00 46.21 ? 481 GLY B N   1 
ATOM   2928 C  CA  . GLY B 1 145 ? 21.728  -8.552  67.225 1.00 46.25 ? 481 GLY B CA  1 
ATOM   2929 C  C   . GLY B 1 145 ? 23.031  -8.355  67.986 1.00 46.38 ? 481 GLY B C   1 
ATOM   2930 O  O   . GLY B 1 145 ? 23.836  -9.287  68.080 1.00 46.46 ? 481 GLY B O   1 
ATOM   2931 N  N   . HIS B 1 146 ? 23.241  -7.165  68.551 1.00 46.43 ? 482 HIS B N   1 
ATOM   2932 C  CA  . HIS B 1 146 ? 24.519  -6.842  69.194 1.00 46.25 ? 482 HIS B CA  1 
ATOM   2933 C  C   . HIS B 1 146 ? 24.642  -7.496  70.572 1.00 45.72 ? 482 HIS B C   1 
ATOM   2934 O  O   . HIS B 1 146 ? 23.655  -7.604  71.306 1.00 45.81 ? 482 HIS B O   1 
ATOM   2935 C  CB  . HIS B 1 146 ? 24.682  -5.329  69.336 1.00 46.55 ? 482 HIS B CB  1 
ATOM   2936 C  CG  . HIS B 1 146 ? 24.381  -4.564  68.083 1.00 47.58 ? 482 HIS B CG  1 
ATOM   2937 N  ND1 . HIS B 1 146 ? 23.352  -3.648  68.001 1.00 48.14 ? 482 HIS B ND1 1 
ATOM   2938 C  CD2 . HIS B 1 146 ? 24.980  -4.571  66.867 1.00 48.18 ? 482 HIS B CD2 1 
ATOM   2939 C  CE1 . HIS B 1 146 ? 23.330  -3.124  66.787 1.00 49.00 ? 482 HIS B CE1 1 
ATOM   2940 N  NE2 . HIS B 1 146 ? 24.308  -3.666  66.081 1.00 48.53 ? 482 HIS B NE2 1 
ATOM   2941 N  N   . THR B 1 147 ? 25.852  -7.936  70.918 1.00 44.85 ? 483 THR B N   1 
ATOM   2942 C  CA  . THR B 1 147 ? 26.127  -8.429  72.270 1.00 44.12 ? 483 THR B CA  1 
ATOM   2943 C  C   . THR B 1 147 ? 26.902  -7.385  73.109 1.00 43.01 ? 483 THR B C   1 
ATOM   2944 O  O   . THR B 1 147 ? 27.695  -7.750  73.981 1.00 43.45 ? 483 THR B O   1 
ATOM   2945 C  CB  . THR B 1 147 ? 26.888  -9.790  72.254 1.00 44.32 ? 483 THR B CB  1 
ATOM   2946 O  OG1 . THR B 1 147 ? 28.275  -9.575  71.966 1.00 44.98 ? 483 THR B OG1 1 
ATOM   2947 C  CG2 . THR B 1 147 ? 26.281  -10.765 71.221 1.00 44.05 ? 483 THR B CG2 1 
ATOM   2948 N  N   . LYS B 1 148 ? 26.676  -6.100  72.833 1.00 41.30 ? 484 LYS B N   1 
ATOM   2949 C  CA  . LYS B 1 148 ? 27.202  -5.009  73.661 1.00 39.95 ? 484 LYS B CA  1 
ATOM   2950 C  C   . LYS B 1 148 ? 26.205  -3.851  73.677 1.00 37.91 ? 484 LYS B C   1 
ATOM   2951 O  O   . LYS B 1 148 ? 25.551  -3.587  72.671 1.00 37.65 ? 484 LYS B O   1 
ATOM   2952 C  CB  . LYS B 1 148 ? 28.550  -4.492  73.135 1.00 40.17 ? 484 LYS B CB  1 
ATOM   2953 C  CG  . LYS B 1 148 ? 29.722  -5.433  73.362 1.00 41.34 ? 484 LYS B CG  1 
ATOM   2954 C  CD  . LYS B 1 148 ? 31.070  -4.728  73.239 1.00 42.51 ? 484 LYS B CD  1 
ATOM   2955 C  CE  . LYS B 1 148 ? 31.399  -4.358  71.803 1.00 43.30 ? 484 LYS B CE  1 
ATOM   2956 N  NZ  . LYS B 1 148 ? 32.387  -3.249  71.761 1.00 44.97 ? 484 LYS B NZ  1 
ATOM   2957 N  N   . PRO B 1 149 ? 26.092  -3.144  74.813 1.00 35.69 ? 485 PRO B N   1 
ATOM   2958 C  CA  . PRO B 1 149 ? 25.249  -1.945  74.804 1.00 34.15 ? 485 PRO B CA  1 
ATOM   2959 C  C   . PRO B 1 149 ? 25.970  -0.798  74.101 1.00 32.35 ? 485 PRO B C   1 
ATOM   2960 O  O   . PRO B 1 149 ? 27.192  -0.852  73.920 1.00 31.58 ? 485 PRO B O   1 
ATOM   2961 C  CB  . PRO B 1 149 ? 25.054  -1.631  76.295 1.00 34.15 ? 485 PRO B CB  1 
ATOM   2962 C  CG  . PRO B 1 149 ? 25.801  -2.731  77.068 1.00 35.18 ? 485 PRO B CG  1 
ATOM   2963 C  CD  . PRO B 1 149 ? 26.766  -3.330  76.110 1.00 35.71 ? 485 PRO B CD  1 
ATOM   2964 N  N   . GLN B 1 150 ? 25.228  0.235   73.721 1.00 31.00 ? 486 GLN B N   1 
ATOM   2965 C  CA  . GLN B 1 150 ? 25.836  1.418   73.113 1.00 29.80 ? 486 GLN B CA  1 
ATOM   2966 C  C   . GLN B 1 150 ? 26.046  2.470   74.174 1.00 28.48 ? 486 GLN B C   1 
ATOM   2967 O  O   . GLN B 1 150 ? 25.350  2.490   75.177 1.00 28.07 ? 486 GLN B O   1 
ATOM   2968 C  CB  . GLN B 1 150 ? 24.958  1.982   72.005 1.00 30.18 ? 486 GLN B CB  1 
ATOM   2969 C  CG  . GLN B 1 150 ? 24.775  1.034   70.857 1.00 31.42 ? 486 GLN B CG  1 
ATOM   2970 C  CD  . GLN B 1 150 ? 23.827  1.546   69.799 1.00 32.63 ? 486 GLN B CD  1 
ATOM   2971 O  OE1 . GLN B 1 150 ? 23.134  0.763   69.145 1.00 36.34 ? 486 GLN B OE1 1 
ATOM   2972 N  NE2 . GLN B 1 150 ? 23.810  2.842   69.600 1.00 31.55 ? 486 GLN B NE2 1 
ATOM   2973 N  N   . ASP B 1 151 ? 27.025  3.337   73.971 1.00 27.40 ? 487 ASP B N   1 
ATOM   2974 C  CA  . ASP B 1 151 ? 27.107  4.532   74.801 1.00 26.41 ? 487 ASP B CA  1 
ATOM   2975 C  C   . ASP B 1 151 ? 27.252  5.772   73.934 1.00 25.71 ? 487 ASP B C   1 
ATOM   2976 O  O   . ASP B 1 151 ? 27.626  5.683   72.756 1.00 25.18 ? 487 ASP B O   1 
ATOM   2977 C  CB  . ASP B 1 151 ? 28.196  4.409   75.903 1.00 25.96 ? 487 ASP B CB  1 
ATOM   2978 C  CG  . ASP B 1 151 ? 29.600  4.565   75.372 1.00 25.32 ? 487 ASP B CG  1 
ATOM   2979 O  OD1 . ASP B 1 151 ? 29.787  4.383   74.156 1.00 25.61 ? 487 ASP B OD1 1 
ATOM   2980 O  OD2 . ASP B 1 151 ? 30.520  4.888   76.161 1.00 21.75 ? 487 ASP B OD2 1 
ATOM   2981 N  N   . PHE B 1 152 ? 26.894  6.914   74.520 1.00 25.32 ? 488 PHE B N   1 
ATOM   2982 C  CA  . PHE B 1 152 ? 26.913  8.221   73.844 1.00 24.81 ? 488 PHE B CA  1 
ATOM   2983 C  C   . PHE B 1 152 ? 27.433  9.262   74.819 1.00 24.21 ? 488 PHE B C   1 
ATOM   2984 O  O   . PHE B 1 152 ? 27.181  9.168   76.029 1.00 23.63 ? 488 PHE B O   1 
ATOM   2985 C  CB  . PHE B 1 152 ? 25.511  8.649   73.422 1.00 25.37 ? 488 PHE B CB  1 
ATOM   2986 C  CG  . PHE B 1 152 ? 24.801  7.649   72.585 1.00 24.67 ? 488 PHE B CG  1 
ATOM   2987 C  CD1 . PHE B 1 152 ? 24.695  7.830   71.215 1.00 26.57 ? 488 PHE B CD1 1 
ATOM   2988 C  CD2 . PHE B 1 152 ? 24.220  6.539   73.166 1.00 25.47 ? 488 PHE B CD2 1 
ATOM   2989 C  CE1 . PHE B 1 152 ? 24.030  6.900   70.420 1.00 27.08 ? 488 PHE B CE1 1 
ATOM   2990 C  CE2 . PHE B 1 152 ? 23.557  5.585   72.379 1.00 26.47 ? 488 PHE B CE2 1 
ATOM   2991 C  CZ  . PHE B 1 152 ? 23.469  5.770   71.000 1.00 26.07 ? 488 PHE B CZ  1 
ATOM   2992 N  N   . VAL B 1 153 ? 28.172  10.232  74.292 1.00 23.56 ? 489 VAL B N   1 
ATOM   2993 C  CA  . VAL B 1 153 ? 28.567  11.417  75.048 1.00 22.96 ? 489 VAL B CA  1 
ATOM   2994 C  C   . VAL B 1 153 ? 27.794  12.584  74.408 1.00 22.80 ? 489 VAL B C   1 
ATOM   2995 O  O   . VAL B 1 153 ? 28.018  12.932  73.253 1.00 22.76 ? 489 VAL B O   1 
ATOM   2996 C  CB  . VAL B 1 153 ? 30.093  11.649  75.008 1.00 23.15 ? 489 VAL B CB  1 
ATOM   2997 C  CG1 . VAL B 1 153 ? 30.480  12.957  75.722 1.00 22.08 ? 489 VAL B CG1 1 
ATOM   2998 C  CG2 . VAL B 1 153 ? 30.859  10.438  75.625 1.00 20.91 ? 489 VAL B CG2 1 
ATOM   2999 N  N   . ILE B 1 154 ? 26.857  13.146  75.159 1.00 22.62 ? 490 ILE B N   1 
ATOM   3000 C  CA  . ILE B 1 154 ? 25.855  14.054  74.600 1.00 22.72 ? 490 ILE B CA  1 
ATOM   3001 C  C   . ILE B 1 154 ? 25.877  15.417  75.293 1.00 21.96 ? 490 ILE B C   1 
ATOM   3002 O  O   . ILE B 1 154 ? 25.874  15.497  76.525 1.00 22.13 ? 490 ILE B O   1 
ATOM   3003 C  CB  . ILE B 1 154 ? 24.457  13.436  74.727 1.00 22.78 ? 490 ILE B CB  1 
ATOM   3004 C  CG1 . ILE B 1 154 ? 24.324  12.281  73.731 1.00 24.81 ? 490 ILE B CG1 1 
ATOM   3005 C  CG2 . ILE B 1 154 ? 23.383  14.461  74.458 1.00 23.18 ? 490 ILE B CG2 1 
ATOM   3006 C  CD1 . ILE B 1 154 ? 23.077  11.456  73.953 1.00 26.59 ? 490 ILE B CD1 1 
ATOM   3007 N  N   . LEU B 1 155 ? 25.906  16.471  74.483 1.00 21.71 ? 491 LEU B N   1 
ATOM   3008 C  CA  . LEU B 1 155 ? 25.711  17.842  74.950 1.00 21.02 ? 491 LEU B CA  1 
ATOM   3009 C  C   . LEU B 1 155 ? 24.237  18.152  74.927 1.00 20.81 ? 491 LEU B C   1 
ATOM   3010 O  O   . LEU B 1 155 ? 23.605  18.088  73.866 1.00 20.92 ? 491 LEU B O   1 
ATOM   3011 C  CB  . LEU B 1 155 ? 26.419  18.841  74.038 1.00 20.93 ? 491 LEU B CB  1 
ATOM   3012 C  CG  . LEU B 1 155 ? 26.186  20.320  74.362 1.00 20.68 ? 491 LEU B CG  1 
ATOM   3013 C  CD1 . LEU B 1 155 ? 26.902  20.716  75.681 1.00 20.46 ? 491 LEU B CD1 1 
ATOM   3014 C  CD2 . LEU B 1 155 ? 26.670  21.193  73.199 1.00 21.95 ? 491 LEU B CD2 1 
ATOM   3015 N  N   . ALA B 1 156 ? 23.688  18.484  76.088 1.00 20.07 ? 492 ALA B N   1 
ATOM   3016 C  CA  . ALA B 1 156 ? 22.286  18.847  76.184 1.00 20.37 ? 492 ALA B CA  1 
ATOM   3017 C  C   . ALA B 1 156 ? 22.230  20.335  76.468 1.00 19.93 ? 492 ALA B C   1 
ATOM   3018 O  O   . ALA B 1 156 ? 22.894  20.807  77.403 1.00 19.84 ? 492 ALA B O   1 
ATOM   3019 C  CB  . ALA B 1 156 ? 21.576  18.035  77.274 1.00 19.37 ? 492 ALA B CB  1 
ATOM   3020 N  N   . SER B 1 157 ? 21.459  21.043  75.646 1.00 20.06 ? 493 SER B N   1 
ATOM   3021 C  CA  . SER B 1 157 ? 21.289  22.485  75.701 1.00 20.56 ? 493 SER B CA  1 
ATOM   3022 C  C   . SER B 1 157 ? 19.814  22.810  75.695 1.00 20.92 ? 493 SER B C   1 
ATOM   3023 O  O   . SER B 1 157 ? 19.087  22.432  74.758 1.00 21.77 ? 493 SER B O   1 
ATOM   3024 C  CB  . SER B 1 157 ? 21.930  23.136  74.475 1.00 20.12 ? 493 SER B CB  1 
ATOM   3025 O  OG  . SER B 1 157 ? 23.334  22.918  74.464 1.00 19.85 ? 493 SER B OG  1 
ATOM   3026 N  N   . ARG B 1 158 ? 19.359  23.514  76.722 1.00 20.59 ? 494 ARG B N   1 
ATOM   3027 C  CA  . ARG B 1 158 ? 17.942  23.778  76.869 1.00 20.75 ? 494 ARG B CA  1 
ATOM   3028 C  C   . ARG B 1 158 ? 17.703  25.291  76.822 1.00 21.36 ? 494 ARG B C   1 
ATOM   3029 O  O   . ARG B 1 158 ? 18.557  26.075  77.278 1.00 21.30 ? 494 ARG B O   1 
ATOM   3030 C  CB  . ARG B 1 158 ? 17.416  23.165  78.163 1.00 20.04 ? 494 ARG B CB  1 
ATOM   3031 C  CG  . ARG B 1 158 ? 17.837  23.886  79.430 1.00 20.66 ? 494 ARG B CG  1 
ATOM   3032 C  CD  . ARG B 1 158 ? 17.225  23.280  80.677 1.00 20.52 ? 494 ARG B CD  1 
ATOM   3033 N  NE  . ARG B 1 158 ? 17.537  24.103  81.857 1.00 23.10 ? 494 ARG B NE  1 
ATOM   3034 C  CZ  . ARG B 1 158 ? 17.240  23.801  83.114 1.00 22.22 ? 494 ARG B CZ  1 
ATOM   3035 N  NH1 . ARG B 1 158 ? 16.607  22.689  83.422 1.00 20.14 ? 494 ARG B NH1 1 
ATOM   3036 N  NH2 . ARG B 1 158 ? 17.591  24.628  84.084 1.00 24.93 ? 494 ARG B NH2 1 
ATOM   3037 N  N   . ARG B 1 159 ? 16.567  25.701  76.254 1.00 21.88 ? 495 ARG B N   1 
ATOM   3038 C  CA  . ARG B 1 159 ? 16.202  27.120  76.198 1.00 22.83 ? 495 ARG B CA  1 
ATOM   3039 C  C   . ARG B 1 159 ? 14.739  27.326  76.422 1.00 22.69 ? 495 ARG B C   1 
ATOM   3040 O  O   . ARG B 1 159 ? 13.899  26.684  75.786 1.00 22.18 ? 495 ARG B O   1 
ATOM   3041 C  CB  . ARG B 1 159 ? 16.543  27.764  74.843 1.00 23.33 ? 495 ARG B CB  1 
ATOM   3042 C  CG  . ARG B 1 159 ? 17.997  27.761  74.486 1.00 25.59 ? 495 ARG B CG  1 
ATOM   3043 C  CD  . ARG B 1 159 ? 18.820  28.730  75.301 1.00 26.50 ? 495 ARG B CD  1 
ATOM   3044 N  NE  . ARG B 1 159 ? 20.173  28.799  74.766 1.00 26.99 ? 495 ARG B NE  1 
ATOM   3045 C  CZ  . ARG B 1 159 ? 21.175  27.979  75.084 1.00 30.49 ? 495 ARG B CZ  1 
ATOM   3046 N  NH1 . ARG B 1 159 ? 21.033  26.978  75.964 1.00 29.54 ? 495 ARG B NH1 1 
ATOM   3047 N  NH2 . ARG B 1 159 ? 22.352  28.163  74.503 1.00 32.76 ? 495 ARG B NH2 1 
ATOM   3048 N  N   . LYS B 1 160 ? 14.462  28.253  77.315 1.00 22.58 ? 496 LYS B N   1 
ATOM   3049 C  CA  . LYS B 1 160 ? 13.128  28.792  77.541 1.00 24.27 ? 496 LYS B CA  1 
ATOM   3050 C  C   . LYS B 1 160 ? 12.855  29.814  76.417 1.00 24.03 ? 496 LYS B C   1 
ATOM   3051 O  O   . LYS B 1 160 ? 13.748  30.567  76.042 1.00 24.21 ? 496 LYS B O   1 
ATOM   3052 C  CB  . LYS B 1 160 ? 13.111  29.456  78.939 1.00 24.96 ? 496 LYS B CB  1 
ATOM   3053 C  CG  . LYS B 1 160 ? 11.771  30.027  79.403 1.00 29.01 ? 496 LYS B CG  1 
ATOM   3054 C  CD  . LYS B 1 160 ? 11.787  30.387  80.893 1.00 31.03 ? 496 LYS B CD  1 
ATOM   3055 C  CE  . LYS B 1 160 ? 10.354  30.493  81.479 1.00 32.85 ? 496 LYS B CE  1 
ATOM   3056 N  NZ  . LYS B 1 160 ? 9.681   29.150  81.778 1.00 30.41 ? 496 LYS B NZ  1 
ATOM   3057 N  N   . PRO B 1 161 ? 11.633  29.843  75.862 1.00 23.77 ? 497 PRO B N   1 
ATOM   3058 C  CA  . PRO B 1 161 ? 11.413  30.751  74.760 1.00 23.25 ? 497 PRO B CA  1 
ATOM   3059 C  C   . PRO B 1 161 ? 10.990  32.138  75.193 1.00 23.63 ? 497 PRO B C   1 
ATOM   3060 O  O   . PRO B 1 161 ? 10.516  32.341  76.307 1.00 23.78 ? 497 PRO B O   1 
ATOM   3061 C  CB  . PRO B 1 161 ? 10.251  30.095  74.032 1.00 23.59 ? 497 PRO B CB  1 
ATOM   3062 C  CG  . PRO B 1 161 ? 9.403   29.556  75.162 1.00 23.26 ? 497 PRO B CG  1 
ATOM   3063 C  CD  . PRO B 1 161 ? 10.409  29.089  76.193 1.00 24.06 ? 497 PRO B CD  1 
ATOM   3064 N  N   . CYS B 1 162 ? 11.117  33.084  74.279 1.00 23.48 ? 498 CYS B N   1 
ATOM   3065 C  CA  . CYS B 1 162 ? 10.295  34.275  74.315 1.00 23.60 ? 498 CYS B CA  1 
ATOM   3066 C  C   . CYS B 1 162 ? 8.811   33.833  74.411 1.00 23.06 ? 498 CYS B C   1 
ATOM   3067 O  O   . CYS B 1 162 ? 8.452   32.768  73.922 1.00 23.57 ? 498 CYS B O   1 
ATOM   3068 C  CB  . CYS B 1 162 ? 10.545  35.086  73.040 1.00 23.11 ? 498 CYS B CB  1 
ATOM   3069 S  SG  . CYS B 1 162 ? 9.614   36.593  72.933 1.00 28.20 ? 498 CYS B SG  1 
ATOM   3070 N  N   . ASP B 1 163 ? 7.949   34.634  75.027 1.00 22.27 ? 499 ASP B N   1 
ATOM   3071 C  CA  . ASP B 1 163 ? 6.526   34.242  75.186 1.00 21.83 ? 499 ASP B CA  1 
ATOM   3072 C  C   . ASP B 1 163 ? 5.677   34.637  73.964 1.00 21.14 ? 499 ASP B C   1 
ATOM   3073 O  O   . ASP B 1 163 ? 4.606   35.240  74.115 1.00 20.29 ? 499 ASP B O   1 
ATOM   3074 C  CB  . ASP B 1 163 ? 5.935   34.861  76.466 1.00 21.78 ? 499 ASP B CB  1 
ATOM   3075 C  CG  . ASP B 1 163 ? 5.983   36.375  76.465 1.00 22.23 ? 499 ASP B CG  1 
ATOM   3076 O  OD1 . ASP B 1 163 ? 5.335   36.973  77.337 1.00 24.61 ? 499 ASP B OD1 1 
ATOM   3077 O  OD2 . ASP B 1 163 ? 6.655   36.971  75.589 1.00 22.37 ? 499 ASP B OD2 1 
ATOM   3078 N  N   . ASN B 1 164 ? 6.168   34.322  72.761 1.00 19.82 ? 500 ASN B N   1 
ATOM   3079 C  CA  . ASN B 1 164 ? 5.506   34.749  71.527 1.00 19.97 ? 500 ASN B CA  1 
ATOM   3080 C  C   . ASN B 1 164 ? 4.975   33.545  70.766 1.00 19.88 ? 500 ASN B C   1 
ATOM   3081 O  O   . ASN B 1 164 ? 4.572   33.663  69.615 1.00 19.50 ? 500 ASN B O   1 
ATOM   3082 C  CB  . ASN B 1 164 ? 6.477   35.553  70.635 1.00 20.11 ? 500 ASN B CB  1 
ATOM   3083 C  CG  . ASN B 1 164 ? 7.682   34.735  70.225 1.00 17.05 ? 500 ASN B CG  1 
ATOM   3084 O  OD1 . ASN B 1 164 ? 7.805   33.583  70.629 1.00 19.98 ? 500 ASN B OD1 1 
ATOM   3085 N  ND2 . ASN B 1 164 ? 8.580   35.319  69.421 1.00 16.16 ? 500 ASN B ND2 1 
ATOM   3086 N  N   . GLY B 1 165 ? 4.976   32.386  71.415 1.00 19.42 ? 501 GLY B N   1 
ATOM   3087 C  CA  . GLY B 1 165 ? 4.545   31.159  70.765 1.00 19.60 ? 501 GLY B CA  1 
ATOM   3088 C  C   . GLY B 1 165 ? 5.692   30.250  70.370 1.00 19.68 ? 501 GLY B C   1 
ATOM   3089 O  O   . GLY B 1 165 ? 5.440   29.133  69.947 1.00 20.53 ? 501 GLY B O   1 
ATOM   3090 N  N   . ASP B 1 166 ? 6.943   30.726  70.474 1.00 19.55 ? 502 ASP B N   1 
ATOM   3091 C  CA  . ASP B 1 166 ? 8.116   29.855  70.302 1.00 19.87 ? 502 ASP B CA  1 
ATOM   3092 C  C   . ASP B 1 166 ? 8.074   28.685  71.282 1.00 19.40 ? 502 ASP B C   1 
ATOM   3093 O  O   . ASP B 1 166 ? 7.544   28.814  72.379 1.00 18.28 ? 502 ASP B O   1 
ATOM   3094 C  CB  . ASP B 1 166 ? 9.445   30.607  70.549 1.00 19.35 ? 502 ASP B CB  1 
ATOM   3095 C  CG  . ASP B 1 166 ? 9.872   31.466  69.361 1.00 22.40 ? 502 ASP B CG  1 
ATOM   3096 O  OD1 . ASP B 1 166 ? 9.063   31.616  68.413 1.00 21.26 ? 502 ASP B OD1 1 
ATOM   3097 O  OD2 . ASP B 1 166 ? 11.002  32.013  69.399 1.00 21.84 ? 502 ASP B OD2 1 
ATOM   3098 N  N   . PRO B 1 167 ? 8.675   27.559  70.905 1.00 19.25 ? 503 PRO B N   1 
ATOM   3099 C  CA  . PRO B 1 167 ? 8.698   26.412  71.815 1.00 19.81 ? 503 PRO B CA  1 
ATOM   3100 C  C   . PRO B 1 167 ? 9.822   26.472  72.823 1.00 20.41 ? 503 PRO B C   1 
ATOM   3101 O  O   . PRO B 1 167 ? 10.836  27.120  72.573 1.00 20.11 ? 503 PRO B O   1 
ATOM   3102 C  CB  . PRO B 1 167 ? 8.964   25.224  70.885 1.00 20.49 ? 503 PRO B CB  1 
ATOM   3103 C  CG  . PRO B 1 167 ? 9.725   25.815  69.698 1.00 19.64 ? 503 PRO B CG  1 
ATOM   3104 C  CD  . PRO B 1 167 ? 9.329   27.282  69.617 1.00 19.60 ? 503 PRO B CD  1 
ATOM   3105 N  N   . TYR B 1 168 ? 9.645   25.750  73.929 1.00 20.88 ? 504 TYR B N   1 
ATOM   3106 C  CA  . TYR B 1 168 ? 10.755  25.349  74.790 1.00 21.46 ? 504 TYR B CA  1 
ATOM   3107 C  C   . TYR B 1 168 ? 11.581  24.322  74.001 1.00 21.63 ? 504 TYR B C   1 
ATOM   3108 O  O   . TYR B 1 168 ? 11.014  23.489  73.295 1.00 21.30 ? 504 TYR B O   1 
ATOM   3109 C  CB  . TYR B 1 168 ? 10.232  24.674  76.064 1.00 21.68 ? 504 TYR B CB  1 
ATOM   3110 C  CG  . TYR B 1 168 ? 9.565   25.605  77.027 1.00 22.28 ? 504 TYR B CG  1 
ATOM   3111 C  CD1 . TYR B 1 168 ? 10.257  26.122  78.114 1.00 23.09 ? 504 TYR B CD1 1 
ATOM   3112 C  CD2 . TYR B 1 168 ? 8.230   25.962  76.863 1.00 24.84 ? 504 TYR B CD2 1 
ATOM   3113 C  CE1 . TYR B 1 168 ? 9.634   26.976  79.000 1.00 24.07 ? 504 TYR B CE1 1 
ATOM   3114 C  CE2 . TYR B 1 168 ? 7.608   26.815  77.738 1.00 24.82 ? 504 TYR B CE2 1 
ATOM   3115 C  CZ  . TYR B 1 168 ? 8.313   27.328  78.792 1.00 24.92 ? 504 TYR B CZ  1 
ATOM   3116 O  OH  . TYR B 1 168 ? 7.667   28.184  79.657 1.00 27.61 ? 504 TYR B OH  1 
ATOM   3117 N  N   . VAL B 1 169 ? 12.900  24.357  74.123 1.00 21.44 ? 505 VAL B N   1 
ATOM   3118 C  CA  . VAL B 1 169 ? 13.726  23.454  73.336 1.00 21.34 ? 505 VAL B CA  1 
ATOM   3119 C  C   . VAL B 1 169 ? 14.731  22.736  74.237 1.00 21.59 ? 505 VAL B C   1 
ATOM   3120 O  O   . VAL B 1 169 ? 15.411  23.367  75.053 1.00 21.93 ? 505 VAL B O   1 
ATOM   3121 C  CB  . VAL B 1 169 ? 14.482  24.221  72.228 1.00 21.51 ? 505 VAL B CB  1 
ATOM   3122 C  CG1 . VAL B 1 169 ? 15.363  23.288  71.461 1.00 19.42 ? 505 VAL B CG1 1 
ATOM   3123 C  CG2 . VAL B 1 169 ? 13.489  24.902  71.280 1.00 21.79 ? 505 VAL B CG2 1 
ATOM   3124 N  N   . ILE B 1 170 ? 14.836  21.425  74.072 1.00 20.36 ? 506 ILE B N   1 
ATOM   3125 C  CA  . ILE B 1 170 ? 15.860  20.640  74.734 1.00 20.06 ? 506 ILE B CA  1 
ATOM   3126 C  C   . ILE B 1 170 ? 16.618  19.862  73.650 1.00 19.92 ? 506 ILE B C   1 
ATOM   3127 O  O   . ILE B 1 170 ? 16.122  18.850  73.138 1.00 20.66 ? 506 ILE B O   1 
ATOM   3128 C  CB  . ILE B 1 170 ? 15.234  19.672  75.768 1.00 20.39 ? 506 ILE B CB  1 
ATOM   3129 C  CG1 . ILE B 1 170 ? 14.304  20.425  76.752 1.00 20.22 ? 506 ILE B CG1 1 
ATOM   3130 C  CG2 . ILE B 1 170 ? 16.334  18.933  76.514 1.00 18.51 ? 506 ILE B CG2 1 
ATOM   3131 C  CD1 . ILE B 1 170 ? 13.275  19.527  77.463 1.00 19.30 ? 506 ILE B CD1 1 
ATOM   3132 N  N   . ALA B 1 171 ? 17.796  20.346  73.293 1.00 19.34 ? 507 ALA B N   1 
ATOM   3133 C  CA  . ALA B 1 171 ? 18.521  19.864  72.128 1.00 19.56 ? 507 ALA B CA  1 
ATOM   3134 C  C   . ALA B 1 171 ? 19.695  19.001  72.564 1.00 19.45 ? 507 ALA B C   1 
ATOM   3135 O  O   . ALA B 1 171 ? 20.424  19.349  73.505 1.00 20.17 ? 507 ALA B O   1 
ATOM   3136 C  CB  . ALA B 1 171 ? 19.016  21.035  71.279 1.00 19.45 ? 507 ALA B CB  1 
ATOM   3137 N  N   . LEU B 1 172 ? 19.861  17.886  71.882 1.00 18.99 ? 508 LEU B N   1 
ATOM   3138 C  CA  . LEU B 1 172 ? 20.915  16.918  72.167 1.00 18.65 ? 508 LEU B CA  1 
ATOM   3139 C  C   . LEU B 1 172 ? 21.755  16.660  70.922 1.00 19.11 ? 508 LEU B C   1 
ATOM   3140 O  O   . LEU B 1 172 ? 21.213  16.461  69.829 1.00 18.49 ? 508 LEU B O   1 
ATOM   3141 C  CB  . LEU B 1 172 ? 20.290  15.620  72.613 1.00 18.22 ? 508 LEU B CB  1 
ATOM   3142 C  CG  . LEU B 1 172 ? 19.168  15.695  73.635 1.00 19.20 ? 508 LEU B CG  1 
ATOM   3143 C  CD1 . LEU B 1 172 ? 18.500  14.309  73.748 1.00 18.31 ? 508 LEU B CD1 1 
ATOM   3144 C  CD2 . LEU B 1 172 ? 19.764  16.151  74.976 1.00 17.48 ? 508 LEU B CD2 1 
ATOM   3145 N  N   . ARG B 1 173 ? 23.074  16.683  71.075 1.00 19.00 ? 509 ARG B N   1 
ATOM   3146 C  CA  . ARG B 1 173 ? 23.996  16.339  69.987 1.00 19.63 ? 509 ARG B CA  1 
ATOM   3147 C  C   . ARG B 1 173 ? 25.265  15.761  70.587 1.00 20.21 ? 509 ARG B C   1 
ATOM   3148 O  O   . ARG B 1 173 ? 25.640  16.131  71.696 1.00 20.11 ? 509 ARG B O   1 
ATOM   3149 C  CB  . ARG B 1 173 ? 24.274  17.560  69.080 1.00 19.87 ? 509 ARG B CB  1 
ATOM   3150 C  CG  . ARG B 1 173 ? 25.137  18.693  69.672 1.00 20.23 ? 509 ARG B CG  1 
ATOM   3151 C  CD  . ARG B 1 173 ? 26.574  18.701  69.126 1.00 20.92 ? 509 ARG B CD  1 
ATOM   3152 N  NE  . ARG B 1 173 ? 26.568  18.997  67.692 1.00 21.54 ? 509 ARG B NE  1 
ATOM   3153 C  CZ  . ARG B 1 173 ? 26.761  18.128  66.700 1.00 20.76 ? 509 ARG B CZ  1 
ATOM   3154 N  NH1 . ARG B 1 173 ? 27.038  16.845  66.914 1.00 21.84 ? 509 ARG B NH1 1 
ATOM   3155 N  NH2 . ARG B 1 173 ? 26.690  18.561  65.456 1.00 18.77 ? 509 ARG B NH2 1 
ATOM   3156 N  N   . SER B 1 174 ? 25.894  14.818  69.880 1.00 21.07 ? 510 SER B N   1 
ATOM   3157 C  CA  . SER B 1 174 ? 27.079  14.150  70.374 1.00 21.03 ? 510 SER B CA  1 
ATOM   3158 C  C   . SER B 1 174 ? 28.307  15.055  70.311 1.00 21.62 ? 510 SER B C   1 
ATOM   3159 O  O   . SER B 1 174 ? 28.516  15.802  69.336 1.00 21.03 ? 510 SER B O   1 
ATOM   3160 C  CB  . SER B 1 174 ? 27.342  12.864  69.585 1.00 21.04 ? 510 SER B CB  1 
ATOM   3161 O  OG  . SER B 1 174 ? 26.513  11.822  70.054 1.00 21.67 ? 510 SER B OG  1 
ATOM   3162 N  N   . VAL B 1 175 ? 29.114  14.992  71.362 1.00 22.49 ? 511 VAL B N   1 
ATOM   3163 C  CA  . VAL B 1 175 ? 30.389  15.694  71.405 1.00 22.97 ? 511 VAL B CA  1 
ATOM   3164 C  C   . VAL B 1 175 ? 31.515  14.744  71.810 1.00 23.57 ? 511 VAL B C   1 
ATOM   3165 O  O   . VAL B 1 175 ? 31.270  13.770  72.501 1.00 24.15 ? 511 VAL B O   1 
ATOM   3166 C  CB  . VAL B 1 175 ? 30.332  16.884  72.374 1.00 23.43 ? 511 VAL B CB  1 
ATOM   3167 C  CG1 . VAL B 1 175 ? 29.263  17.874  71.921 1.00 21.97 ? 511 VAL B CG1 1 
ATOM   3168 C  CG2 . VAL B 1 175 ? 30.071  16.415  73.784 1.00 23.10 ? 511 VAL B CG2 1 
ATOM   3169 N  N   . THR B 1 176 ? 32.743  15.018  71.372 1.00 24.52 ? 512 THR B N   1 
ATOM   3170 C  CA  . THR B 1 176 ? 33.911  14.233  71.805 1.00 25.06 ? 512 THR B CA  1 
ATOM   3171 C  C   . THR B 1 176 ? 34.748  15.012  72.804 1.00 25.64 ? 512 THR B C   1 
ATOM   3172 O  O   . THR B 1 176 ? 34.912  16.217  72.661 1.00 25.95 ? 512 THR B O   1 
ATOM   3173 C  CB  . THR B 1 176 ? 34.786  13.787  70.610 1.00 25.36 ? 512 THR B CB  1 
ATOM   3174 O  OG1 . THR B 1 176 ? 35.267  14.931  69.883 1.00 25.46 ? 512 THR B OG1 1 
ATOM   3175 C  CG2 . THR B 1 176 ? 33.975  12.881  69.684 1.00 24.56 ? 512 THR B CG2 1 
ATOM   3176 N  N   . LEU B 1 177 ? 35.224  14.318  73.834 1.00 26.21 ? 513 LEU B N   1 
ATOM   3177 C  CA  . LEU B 1 177 ? 36.102  14.869  74.868 1.00 27.23 ? 513 LEU B CA  1 
ATOM   3178 C  C   . LEU B 1 177 ? 37.355  13.976  74.954 1.00 27.91 ? 513 LEU B C   1 
ATOM   3179 O  O   . LEU B 1 177 ? 37.239  12.757  74.899 1.00 27.07 ? 513 LEU B O   1 
ATOM   3180 C  CB  . LEU B 1 177 ? 35.414  14.830  76.238 1.00 27.40 ? 513 LEU B CB  1 
ATOM   3181 C  CG  . LEU B 1 177 ? 34.127  15.598  76.557 1.00 27.78 ? 513 LEU B CG  1 
ATOM   3182 C  CD1 . LEU B 1 177 ? 33.532  15.127  77.879 1.00 26.05 ? 513 LEU B CD1 1 
ATOM   3183 C  CD2 . LEU B 1 177 ? 34.389  17.072  76.622 1.00 28.47 ? 513 LEU B CD2 1 
ATOM   3184 N  N   . PRO B 1 178 ? 38.551  14.571  75.108 1.00 29.61 ? 514 PRO B N   1 
ATOM   3185 C  CA  . PRO B 1 178 ? 39.767  13.750  75.231 1.00 30.66 ? 514 PRO B CA  1 
ATOM   3186 C  C   . PRO B 1 178 ? 39.720  12.671  76.317 1.00 31.75 ? 514 PRO B C   1 
ATOM   3187 O  O   . PRO B 1 178 ? 40.391  11.649  76.175 1.00 32.13 ? 514 PRO B O   1 
ATOM   3188 C  CB  . PRO B 1 178 ? 40.855  14.781  75.555 1.00 30.72 ? 514 PRO B CB  1 
ATOM   3189 C  CG  . PRO B 1 178 ? 40.372  16.037  74.919 1.00 30.08 ? 514 PRO B CG  1 
ATOM   3190 C  CD  . PRO B 1 178 ? 38.868  16.005  74.998 1.00 29.84 ? 514 PRO B CD  1 
ATOM   3191 N  N   . THR B 1 179 ? 38.949  12.890  77.385 1.00 32.95 ? 515 THR B N   1 
ATOM   3192 C  CA  . THR B 1 179 ? 38.900  11.939  78.504 1.00 34.18 ? 515 THR B CA  1 
ATOM   3193 C  C   . THR B 1 179 ? 37.867  10.825  78.334 1.00 34.93 ? 515 THR B C   1 
ATOM   3194 O  O   . THR B 1 179 ? 38.021  9.760   78.930 1.00 35.31 ? 515 THR B O   1 
ATOM   3195 C  CB  . THR B 1 179 ? 38.581  12.644  79.830 1.00 34.20 ? 515 THR B CB  1 
ATOM   3196 O  OG1 . THR B 1 179 ? 37.313  13.300  79.716 1.00 35.77 ? 515 THR B OG1 1 
ATOM   3197 C  CG2 . THR B 1 179 ? 39.659  13.652  80.175 1.00 34.11 ? 515 THR B CG2 1 
ATOM   3198 N  N   . HIS B 1 180 ? 36.833  11.067  77.529 1.00 35.90 ? 516 HIS B N   1 
ATOM   3199 C  CA  . HIS B 1 180 ? 35.697  10.150  77.408 1.00 36.51 ? 516 HIS B CA  1 
ATOM   3200 C  C   . HIS B 1 180 ? 35.615  9.471   76.036 1.00 36.68 ? 516 HIS B C   1 
ATOM   3201 O  O   . HIS B 1 180 ? 34.542  9.409   75.420 1.00 36.33 ? 516 HIS B O   1 
ATOM   3202 C  CB  . HIS B 1 180 ? 34.391  10.903  77.715 1.00 36.71 ? 516 HIS B CB  1 
ATOM   3203 C  CG  . HIS B 1 180 ? 34.169  11.139  79.177 1.00 38.31 ? 516 HIS B CG  1 
ATOM   3204 N  ND1 . HIS B 1 180 ? 34.849  12.109  79.887 1.00 40.02 ? 516 HIS B ND1 1 
ATOM   3205 C  CD2 . HIS B 1 180 ? 33.365  10.512  80.070 1.00 38.70 ? 516 HIS B CD2 1 
ATOM   3206 C  CE1 . HIS B 1 180 ? 34.465  12.077  81.151 1.00 40.08 ? 516 HIS B CE1 1 
ATOM   3207 N  NE2 . HIS B 1 180 ? 33.564  11.120  81.288 1.00 39.97 ? 516 HIS B NE2 1 
ATOM   3208 N  N   . ARG B 1 181 ? 36.742  8.943   75.563 1.00 36.63 ? 517 ARG B N   1 
ATOM   3209 C  CA  . ARG B 1 181 ? 36.738  8.168   74.317 1.00 36.69 ? 517 ARG B CA  1 
ATOM   3210 C  C   . ARG B 1 181 ? 36.151  6.771   74.572 1.00 35.99 ? 517 ARG B C   1 
ATOM   3211 O  O   . ARG B 1 181 ? 35.923  6.387   75.726 1.00 35.65 ? 517 ARG B O   1 
ATOM   3212 C  CB  . ARG B 1 181 ? 38.144  8.062   73.731 1.00 36.94 ? 517 ARG B CB  1 
ATOM   3213 C  CG  . ARG B 1 181 ? 38.761  9.397   73.333 1.00 38.59 ? 517 ARG B CG  1 
ATOM   3214 C  CD  . ARG B 1 181 ? 40.157  9.189   72.730 1.00 40.32 ? 517 ARG B CD  1 
ATOM   3215 N  NE  . ARG B 1 181 ? 41.024  10.357  72.902 1.00 42.09 ? 517 ARG B NE  1 
ATOM   3216 C  CZ  . ARG B 1 181 ? 42.135  10.404  73.643 1.00 42.59 ? 517 ARG B CZ  1 
ATOM   3217 N  NH1 . ARG B 1 181 ? 42.574  9.340   74.313 1.00 44.11 ? 517 ARG B NH1 1 
ATOM   3218 N  NH2 . ARG B 1 181 ? 42.823  11.539  73.716 1.00 42.54 ? 517 ARG B NH2 1 
ATOM   3219 N  N   . GLU B 1 182 ? 35.900  6.019   73.500 1.00 35.18 ? 518 GLU B N   1 
ATOM   3220 C  CA  . GLU B 1 182 ? 35.246  4.722   73.634 1.00 34.74 ? 518 GLU B CA  1 
ATOM   3221 C  C   . GLU B 1 182 ? 36.174  3.699   74.287 1.00 34.21 ? 518 GLU B C   1 
ATOM   3222 O  O   . GLU B 1 182 ? 37.397  3.803   74.197 1.00 33.84 ? 518 GLU B O   1 
ATOM   3223 C  CB  . GLU B 1 182 ? 34.649  4.229   72.292 1.00 34.92 ? 518 GLU B CB  1 
ATOM   3224 C  CG  . GLU B 1 182 ? 35.533  3.484   71.305 1.00 34.67 ? 518 GLU B CG  1 
ATOM   3225 C  CD  . GLU B 1 182 ? 34.741  3.047   70.058 1.00 35.27 ? 518 GLU B CD  1 
ATOM   3226 O  OE1 . GLU B 1 182 ? 33.807  2.211   70.164 1.00 32.71 ? 518 GLU B OE1 1 
ATOM   3227 O  OE2 . GLU B 1 182 ? 35.043  3.554   68.958 1.00 36.94 ? 518 GLU B OE2 1 
ATOM   3228 N  N   . THR B 1 183 ? 35.560  2.759   74.996 1.00 33.63 ? 519 THR B N   1 
ATOM   3229 C  CA  . THR B 1 183 ? 36.255  1.658   75.658 1.00 33.57 ? 519 THR B CA  1 
ATOM   3230 C  C   . THR B 1 183 ? 35.532  0.368   75.245 1.00 32.89 ? 519 THR B C   1 
ATOM   3231 O  O   . THR B 1 183 ? 34.380  0.429   74.817 1.00 32.98 ? 519 THR B O   1 
ATOM   3232 C  CB  . THR B 1 183 ? 36.225  1.858   77.189 1.00 33.67 ? 519 THR B CB  1 
ATOM   3233 O  OG1 . THR B 1 183 ? 34.863  1.923   77.633 1.00 33.82 ? 519 THR B OG1 1 
ATOM   3234 C  CG2 . THR B 1 183 ? 36.942  3.165   77.576 1.00 33.58 ? 519 THR B CG2 1 
ATOM   3235 N  N   . PRO B 1 184 ? 36.187  -0.801  75.376 1.00 32.55 ? 520 PRO B N   1 
ATOM   3236 C  CA  . PRO B 1 184 ? 35.567  -2.028  74.836 1.00 31.98 ? 520 PRO B CA  1 
ATOM   3237 C  C   . PRO B 1 184 ? 34.201  -2.391  75.427 1.00 31.35 ? 520 PRO B C   1 
ATOM   3238 O  O   . PRO B 1 184 ? 33.449  -3.133  74.802 1.00 31.38 ? 520 PRO B O   1 
ATOM   3239 C  CB  . PRO B 1 184 ? 36.604  -3.123  75.146 1.00 32.14 ? 520 PRO B CB  1 
ATOM   3240 C  CG  . PRO B 1 184 ? 37.485  -2.546  76.211 1.00 32.45 ? 520 PRO B CG  1 
ATOM   3241 C  CD  . PRO B 1 184 ? 37.506  -1.069  75.984 1.00 32.25 ? 520 PRO B CD  1 
ATOM   3242 N  N   . GLU B 1 185 ? 33.891  -1.864  76.609 1.00 30.79 ? 521 GLU B N   1 
ATOM   3243 C  CA  . GLU B 1 185 ? 32.606  -2.090  77.288 1.00 30.42 ? 521 GLU B CA  1 
ATOM   3244 C  C   . GLU B 1 185 ? 31.369  -1.665  76.476 1.00 29.66 ? 521 GLU B C   1 
ATOM   3245 O  O   . GLU B 1 185 ? 30.290  -2.249  76.621 1.00 29.16 ? 521 GLU B O   1 
ATOM   3246 C  CB  . GLU B 1 185 ? 32.607  -1.333  78.619 1.00 30.77 ? 521 GLU B CB  1 
ATOM   3247 C  CG  . GLU B 1 185 ? 31.520  -1.757  79.607 1.00 32.18 ? 521 GLU B CG  1 
ATOM   3248 C  CD  . GLU B 1 185 ? 31.488  -0.892  80.871 1.00 33.22 ? 521 GLU B CD  1 
ATOM   3249 O  OE1 . GLU B 1 185 ? 30.705  -1.232  81.786 1.00 33.75 ? 521 GLU B OE1 1 
ATOM   3250 O  OE2 . GLU B 1 185 ? 32.236  0.116   80.951 1.00 32.82 ? 521 GLU B OE2 1 
ATOM   3251 N  N   . TYR B 1 186 ? 31.513  -0.639  75.640 1.00 28.92 ? 522 TYR B N   1 
ATOM   3252 C  CA  . TYR B 1 186 ? 30.378  -0.138  74.868 1.00 28.66 ? 522 TYR B CA  1 
ATOM   3253 C  C   . TYR B 1 186 ? 30.724  0.142   73.429 1.00 27.96 ? 522 TYR B C   1 
ATOM   3254 O  O   . TYR B 1 186 ? 31.828  0.570   73.125 1.00 28.37 ? 522 TYR B O   1 
ATOM   3255 C  CB  . TYR B 1 186 ? 29.864  1.164   75.477 1.00 28.85 ? 522 TYR B CB  1 
ATOM   3256 C  CG  . TYR B 1 186 ? 29.341  1.007   76.878 1.00 29.39 ? 522 TYR B CG  1 
ATOM   3257 C  CD1 . TYR B 1 186 ? 28.141  0.344   77.126 1.00 30.02 ? 522 TYR B CD1 1 
ATOM   3258 C  CD2 . TYR B 1 186 ? 30.048  1.526   77.960 1.00 29.77 ? 522 TYR B CD2 1 
ATOM   3259 C  CE1 . TYR B 1 186 ? 27.659  0.203   78.428 1.00 31.17 ? 522 TYR B CE1 1 
ATOM   3260 C  CE2 . TYR B 1 186 ? 29.576  1.399   79.252 1.00 29.62 ? 522 TYR B CE2 1 
ATOM   3261 C  CZ  . TYR B 1 186 ? 28.386  0.733   79.485 1.00 30.15 ? 522 TYR B CZ  1 
ATOM   3262 O  OH  . TYR B 1 186 ? 27.936  0.607   80.782 1.00 29.72 ? 522 TYR B OH  1 
ATOM   3263 N  N   . ARG B 1 187 ? 29.762  -0.085  72.548 1.00 27.32 ? 523 ARG B N   1 
ATOM   3264 C  CA  . ARG B 1 187 ? 29.832  0.452   71.207 1.00 27.16 ? 523 ARG B CA  1 
ATOM   3265 C  C   . ARG B 1 187 ? 29.551  1.946   71.305 1.00 26.03 ? 523 ARG B C   1 
ATOM   3266 O  O   . ARG B 1 187 ? 28.451  2.343   71.679 1.00 25.30 ? 523 ARG B O   1 
ATOM   3267 C  CB  . ARG B 1 187 ? 28.776  -0.186  70.310 1.00 27.77 ? 523 ARG B CB  1 
ATOM   3268 C  CG  . ARG B 1 187 ? 29.165  -1.509  69.734 1.00 30.50 ? 523 ARG B CG  1 
ATOM   3269 C  CD  . ARG B 1 187 ? 27.981  -2.150  69.017 1.00 34.18 ? 523 ARG B CD  1 
ATOM   3270 N  NE  . ARG B 1 187 ? 26.878  -2.456  69.939 1.00 36.71 ? 523 ARG B NE  1 
ATOM   3271 C  CZ  . ARG B 1 187 ? 25.604  -2.070  69.802 1.00 39.16 ? 523 ARG B CZ  1 
ATOM   3272 N  NH1 . ARG B 1 187 ? 25.187  -1.349  68.757 1.00 40.22 ? 523 ARG B NH1 1 
ATOM   3273 N  NH2 . ARG B 1 187 ? 24.720  -2.431  70.726 1.00 40.55 ? 523 ARG B NH2 1 
ATOM   3274 N  N   . ARG B 1 188 ? 30.541  2.767   70.978 1.00 25.21 ? 524 ARG B N   1 
ATOM   3275 C  CA  . ARG B 1 188 ? 30.357  4.212   70.987 1.00 24.80 ? 524 ARG B CA  1 
ATOM   3276 C  C   . ARG B 1 188 ? 29.534  4.611   69.786 1.00 24.57 ? 524 ARG B C   1 
ATOM   3277 O  O   . ARG B 1 188 ? 29.942  4.377   68.646 1.00 24.75 ? 524 ARG B O   1 
ATOM   3278 C  CB  . ARG B 1 188 ? 31.694  4.940   70.991 1.00 24.91 ? 524 ARG B CB  1 
ATOM   3279 C  CG  . ARG B 1 188 ? 31.622  6.461   70.860 1.00 24.88 ? 524 ARG B CG  1 
ATOM   3280 C  CD  . ARG B 1 188 ? 30.688  7.134   71.869 1.00 24.19 ? 524 ARG B CD  1 
ATOM   3281 N  NE  . ARG B 1 188 ? 30.997  6.789   73.248 1.00 24.73 ? 524 ARG B NE  1 
ATOM   3282 C  CZ  . ARG B 1 188 ? 32.039  7.255   73.948 1.00 26.35 ? 524 ARG B CZ  1 
ATOM   3283 N  NH1 . ARG B 1 188 ? 32.919  8.105   73.421 1.00 26.51 ? 524 ARG B NH1 1 
ATOM   3284 N  NH2 . ARG B 1 188 ? 32.216  6.858   75.198 1.00 27.12 ? 524 ARG B NH2 1 
ATOM   3285 N  N   . GLY B 1 189 ? 28.360  5.175   70.059 1.00 23.90 ? 525 GLY B N   1 
ATOM   3286 C  CA  . GLY B 1 189 ? 27.461  5.681   69.018 1.00 23.65 ? 525 GLY B CA  1 
ATOM   3287 C  C   . GLY B 1 189 ? 27.508  7.196   68.986 1.00 23.62 ? 525 GLY B C   1 
ATOM   3288 O  O   . GLY B 1 189 ? 28.167  7.819   69.822 1.00 22.46 ? 525 GLY B O   1 
ATOM   3289 N  N   . GLU B 1 190 ? 26.832  7.781   68.002 1.00 23.94 ? 526 GLU B N   1 
ATOM   3290 C  CA  . GLU B 1 190 ? 26.710  9.235   67.903 1.00 24.62 ? 526 GLU B CA  1 
ATOM   3291 C  C   . GLU B 1 190 ? 25.286  9.586   67.528 1.00 24.29 ? 526 GLU B C   1 
ATOM   3292 O  O   . GLU B 1 190 ? 24.612  8.817   66.838 1.00 24.27 ? 526 GLU B O   1 
ATOM   3293 C  CB  . GLU B 1 190 ? 27.637  9.805   66.830 1.00 25.18 ? 526 GLU B CB  1 
ATOM   3294 C  CG  . GLU B 1 190 ? 29.119  9.640   67.087 1.00 28.18 ? 526 GLU B CG  1 
ATOM   3295 C  CD  . GLU B 1 190 ? 29.961  9.837   65.820 1.00 32.12 ? 526 GLU B CD  1 
ATOM   3296 O  OE1 . GLU B 1 190 ? 31.147  10.190  65.965 1.00 33.78 ? 526 GLU B OE1 1 
ATOM   3297 O  OE2 . GLU B 1 190 ? 29.442  9.642   64.679 1.00 35.28 ? 526 GLU B OE2 1 
ATOM   3298 N  N   . THR B 1 191 ? 24.836  10.743  67.996 1.00 23.59 ? 527 THR B N   1 
ATOM   3299 C  CA  . THR B 1 191 ? 23.569  11.298  67.585 1.00 23.25 ? 527 THR B CA  1 
ATOM   3300 C  C   . THR B 1 191 ? 23.865  12.718  67.080 1.00 22.71 ? 527 THR B C   1 
ATOM   3301 O  O   . THR B 1 191 ? 24.697  13.439  67.662 1.00 21.90 ? 527 THR B O   1 
ATOM   3302 C  CB  . THR B 1 191 ? 22.523  11.226  68.731 1.00 23.26 ? 527 THR B CB  1 
ATOM   3303 O  OG1 . THR B 1 191 ? 21.202  11.301  68.182 1.00 24.51 ? 527 THR B OG1 1 
ATOM   3304 C  CG2 . THR B 1 191 ? 22.721  12.310  69.750 1.00 22.83 ? 527 THR B CG2 1 
ATOM   3305 N  N   . LEU B 1 192 ? 23.256  13.063  65.953 1.00 21.68 ? 528 LEU B N   1 
ATOM   3306 C  CA  . LEU B 1 192 ? 23.563  14.295  65.232 1.00 21.91 ? 528 LEU B CA  1 
ATOM   3307 C  C   . LEU B 1 192 ? 22.768  15.470  65.783 1.00 21.89 ? 528 LEU B C   1 
ATOM   3308 O  O   . LEU B 1 192 ? 23.314  16.533  66.018 1.00 21.29 ? 528 LEU B O   1 
ATOM   3309 C  CB  . LEU B 1 192 ? 23.192  14.150  63.759 1.00 21.70 ? 528 LEU B CB  1 
ATOM   3310 C  CG  . LEU B 1 192 ? 23.304  15.402  62.881 1.00 22.90 ? 528 LEU B CG  1 
ATOM   3311 C  CD1 . LEU B 1 192 ? 24.659  16.060  63.018 1.00 21.71 ? 528 LEU B CD1 1 
ATOM   3312 C  CD2 . LEU B 1 192 ? 22.997  15.039  61.434 1.00 23.50 ? 528 LEU B CD2 1 
ATOM   3313 N  N   . CYS B 1 193 ? 21.465  15.260  65.944 1.00 21.73 ? 529 CYS B N   1 
ATOM   3314 C  CA  . CYS B 1 193 ? 20.546  16.306  66.349 1.00 21.61 ? 529 CYS B CA  1 
ATOM   3315 C  C   . CYS B 1 193 ? 19.262  15.653  66.816 1.00 21.59 ? 529 CYS B C   1 
ATOM   3316 O  O   . CYS B 1 193 ? 18.501  15.111  66.014 1.00 21.94 ? 529 CYS B O   1 
ATOM   3317 C  CB  . CYS B 1 193 ? 20.258  17.246  65.187 1.00 21.27 ? 529 CYS B CB  1 
ATOM   3318 S  SG  . CYS B 1 193 ? 19.008  18.478  65.594 1.00 23.37 ? 529 CYS B SG  1 
ATOM   3319 N  N   . SER B 1 194 ? 19.042  15.661  68.117 1.00 21.05 ? 530 SER B N   1 
ATOM   3320 C  CA  . SER B 1 194 ? 17.845  15.077  68.706 1.00 21.71 ? 530 SER B CA  1 
ATOM   3321 C  C   . SER B 1 194 ? 17.271  15.937  69.815 1.00 21.70 ? 530 SER B C   1 
ATOM   3322 O  O   . SER B 1 194 ? 17.900  16.903  70.244 1.00 22.71 ? 530 SER B O   1 
ATOM   3323 C  CB  . SER B 1 194 ? 18.188  13.715  69.293 1.00 21.25 ? 530 SER B CB  1 
ATOM   3324 O  OG  . SER B 1 194 ? 18.617  12.860  68.272 1.00 24.97 ? 530 SER B OG  1 
ATOM   3325 N  N   . GLY B 1 195 ? 16.088  15.563  70.309 1.00 22.01 ? 531 GLY B N   1 
ATOM   3326 C  CA  . GLY B 1 195 ? 15.546  16.179  71.520 1.00 21.77 ? 531 GLY B CA  1 
ATOM   3327 C  C   . GLY B 1 195 ? 14.091  16.575  71.482 1.00 21.67 ? 531 GLY B C   1 
ATOM   3328 O  O   . GLY B 1 195 ? 13.330  16.118  70.626 1.00 21.79 ? 531 GLY B O   1 
ATOM   3329 N  N   . PHE B 1 196 ? 13.698  17.430  72.422 1.00 21.14 ? 532 PHE B N   1 
ATOM   3330 C  CA  . PHE B 1 196 ? 12.290  17.779  72.609 1.00 21.56 ? 532 PHE B CA  1 
ATOM   3331 C  C   . PHE B 1 196 ? 12.025  19.241  72.270 1.00 22.00 ? 532 PHE B C   1 
ATOM   3332 O  O   . PHE B 1 196 ? 12.840  20.131  72.586 1.00 21.87 ? 532 PHE B O   1 
ATOM   3333 C  CB  . PHE B 1 196 ? 11.844  17.518  74.064 1.00 21.78 ? 532 PHE B CB  1 
ATOM   3334 C  CG  . PHE B 1 196 ? 12.095  16.095  74.551 1.00 23.29 ? 532 PHE B CG  1 
ATOM   3335 C  CD1 . PHE B 1 196 ? 11.117  15.135  74.461 1.00 24.53 ? 532 PHE B CD1 1 
ATOM   3336 C  CD2 . PHE B 1 196 ? 13.300  15.754  75.151 1.00 25.99 ? 532 PHE B CD2 1 
ATOM   3337 C  CE1 . PHE B 1 196 ? 11.337  13.841  74.924 1.00 25.33 ? 532 PHE B CE1 1 
ATOM   3338 C  CE2 . PHE B 1 196 ? 13.537  14.458  75.617 1.00 27.61 ? 532 PHE B CE2 1 
ATOM   3339 C  CZ  . PHE B 1 196 ? 12.558  13.501  75.510 1.00 25.84 ? 532 PHE B CZ  1 
ATOM   3340 N  N   . CYS B 1 197 ? 10.900  19.491  71.604 1.00 22.39 ? 533 CYS B N   1 
ATOM   3341 C  CA  . CYS B 1 197 ? 10.287  20.817  71.594 1.00 23.74 ? 533 CYS B CA  1 
ATOM   3342 C  C   . CYS B 1 197 ? 8.903   20.740  72.248 1.00 23.12 ? 533 CYS B C   1 
ATOM   3343 O  O   . CYS B 1 197 ? 8.180   19.783  72.027 1.00 22.84 ? 533 CYS B O   1 
ATOM   3344 C  CB  . CYS B 1 197 ? 10.097  21.339  70.176 1.00 24.43 ? 533 CYS B CB  1 
ATOM   3345 S  SG  . CYS B 1 197 ? 11.615  21.568  69.377 1.00 30.59 ? 533 CYS B SG  1 
ATOM   3346 N  N   . LEU B 1 198 ? 8.544   21.786  72.992 1.00 22.19 ? 534 LEU B N   1 
ATOM   3347 C  CA  . LEU B 1 198 ? 7.303   21.859  73.718 1.00 22.16 ? 534 LEU B CA  1 
ATOM   3348 C  C   . LEU B 1 198 ? 6.663   23.221  73.468 1.00 22.26 ? 534 LEU B C   1 
ATOM   3349 O  O   . LEU B 1 198 ? 7.288   24.255  73.715 1.00 22.40 ? 534 LEU B O   1 
ATOM   3350 C  CB  . LEU B 1 198 ? 7.557   21.667  75.219 1.00 21.96 ? 534 LEU B CB  1 
ATOM   3351 C  CG  . LEU B 1 198 ? 8.595   20.617  75.620 1.00 23.80 ? 534 LEU B CG  1 
ATOM   3352 C  CD1 . LEU B 1 198 ? 9.101   20.833  77.060 1.00 22.36 ? 534 LEU B CD1 1 
ATOM   3353 C  CD2 . LEU B 1 198 ? 8.005   19.215  75.399 1.00 24.31 ? 534 LEU B CD2 1 
ATOM   3354 N  N   . TRP B 1 199 ? 5.439   23.210  72.963 1.00 22.14 ? 535 TRP B N   1 
ATOM   3355 C  CA  . TRP B 1 199 ? 4.708   24.424  72.661 1.00 22.59 ? 535 TRP B CA  1 
ATOM   3356 C  C   . TRP B 1 199 ? 3.569   24.463  73.632 1.00 22.88 ? 535 TRP B C   1 
ATOM   3357 O  O   . TRP B 1 199 ? 2.889   23.463  73.805 1.00 22.25 ? 535 TRP B O   1 
ATOM   3358 C  CB  . TRP B 1 199 ? 4.118   24.443  71.247 1.00 21.94 ? 535 TRP B CB  1 
ATOM   3359 C  CG  . TRP B 1 199 ? 5.127   24.472  70.140 1.00 22.15 ? 535 TRP B CG  1 
ATOM   3360 C  CD1 . TRP B 1 199 ? 5.589   25.563  69.485 1.00 21.56 ? 535 TRP B CD1 1 
ATOM   3361 C  CD2 . TRP B 1 199 ? 5.760   23.341  69.537 1.00 21.88 ? 535 TRP B CD2 1 
ATOM   3362 N  NE1 . TRP B 1 199 ? 6.485   25.187  68.507 1.00 23.51 ? 535 TRP B NE1 1 
ATOM   3363 C  CE2 . TRP B 1 199 ? 6.609   23.825  68.527 1.00 22.28 ? 535 TRP B CE2 1 
ATOM   3364 C  CE3 . TRP B 1 199 ? 5.702   21.966  69.769 1.00 22.73 ? 535 TRP B CE3 1 
ATOM   3365 C  CZ2 . TRP B 1 199 ? 7.392   22.989  67.756 1.00 22.53 ? 535 TRP B CZ2 1 
ATOM   3366 C  CZ3 . TRP B 1 199 ? 6.459   21.141  69.009 1.00 20.62 ? 535 TRP B CZ3 1 
ATOM   3367 C  CH2 . TRP B 1 199 ? 7.289   21.648  68.001 1.00 21.64 ? 535 TRP B CH2 1 
ATOM   3368 N  N   . ARG B 1 200 ? 3.399   25.609  74.280 1.00 23.21 ? 536 ARG B N   1 
ATOM   3369 C  CA  . ARG B 1 200 ? 2.254   25.849  75.145 1.00 24.43 ? 536 ARG B CA  1 
ATOM   3370 C  C   . ARG B 1 200 ? 1.024   25.930  74.253 1.00 24.51 ? 536 ARG B C   1 
ATOM   3371 O  O   . ARG B 1 200 ? 1.032   26.629  73.246 1.00 23.79 ? 536 ARG B O   1 
ATOM   3372 C  CB  . ARG B 1 200 ? 2.474   27.146  75.931 1.00 24.58 ? 536 ARG B CB  1 
ATOM   3373 C  CG  . ARG B 1 200 ? 1.236   27.771  76.528 1.00 27.47 ? 536 ARG B CG  1 
ATOM   3374 C  CD  . ARG B 1 200 ? 1.560   28.849  77.583 1.00 30.97 ? 536 ARG B CD  1 
ATOM   3375 N  NE  . ARG B 1 200 ? 1.866   28.218  78.871 1.00 34.86 ? 536 ARG B NE  1 
ATOM   3376 C  CZ  . ARG B 1 200 ? 3.088   28.091  79.405 1.00 36.24 ? 536 ARG B CZ  1 
ATOM   3377 N  NH1 . ARG B 1 200 ? 4.179   28.606  78.808 1.00 36.05 ? 536 ARG B NH1 1 
ATOM   3378 N  NH2 . ARG B 1 200 ? 3.214   27.452  80.565 1.00 34.46 ? 536 ARG B NH2 1 
ATOM   3379 N  N   . GLU B 1 201 ? -0.008  25.162  74.573 1.00 25.03 ? 537 GLU B N   1 
ATOM   3380 C  CA  . GLU B 1 201 ? -1.239  25.183  73.782 1.00 26.74 ? 537 GLU B CA  1 
ATOM   3381 C  C   . GLU B 1 201 ? -2.450  25.698  74.569 1.00 26.84 ? 537 GLU B C   1 
ATOM   3382 O  O   . GLU B 1 201 ? -3.554  25.754  74.038 1.00 27.97 ? 537 GLU B O   1 
ATOM   3383 C  CB  . GLU B 1 201 ? -1.542  23.781  73.260 1.00 27.40 ? 537 GLU B CB  1 
ATOM   3384 C  CG  . GLU B 1 201 ? -0.356  23.138  72.564 1.00 31.13 ? 537 GLU B CG  1 
ATOM   3385 C  CD  . GLU B 1 201 ? -0.541  22.972  71.086 1.00 36.46 ? 537 GLU B CD  1 
ATOM   3386 O  OE1 . GLU B 1 201 ? -1.541  22.331  70.701 1.00 40.53 ? 537 GLU B OE1 1 
ATOM   3387 O  OE2 . GLU B 1 201 ? 0.342   23.431  70.317 1.00 40.59 ? 537 GLU B OE2 1 
ATOM   3388 N  N   . GLY B 1 202 ? -2.244  26.076  75.825 1.00 26.36 ? 538 GLY B N   1 
ATOM   3389 C  CA  . GLY B 1 202 ? -3.339  26.462  76.701 1.00 26.00 ? 538 GLY B CA  1 
ATOM   3390 C  C   . GLY B 1 202 ? -2.901  26.253  78.137 1.00 26.09 ? 538 GLY B C   1 
ATOM   3391 O  O   . GLY B 1 202 ? -1.758  25.835  78.384 1.00 25.23 ? 538 GLY B O   1 
ATOM   3392 N  N   . ASP B 1 203 ? -3.785  26.564  79.084 1.00 25.75 ? 539 ASP B N   1 
ATOM   3393 C  CA  . ASP B 1 203 ? -3.491  26.302  80.482 1.00 26.25 ? 539 ASP B CA  1 
ATOM   3394 C  C   . ASP B 1 203 ? -3.442  24.786  80.639 1.00 25.87 ? 539 ASP B C   1 
ATOM   3395 O  O   . ASP B 1 203 ? -4.360  24.081  80.209 1.00 25.20 ? 539 ASP B O   1 
ATOM   3396 C  CB  . ASP B 1 203 ? -4.530  26.927  81.447 1.00 26.69 ? 539 ASP B CB  1 
ATOM   3397 C  CG  . ASP B 1 203 ? -4.345  28.443  81.633 1.00 28.90 ? 539 ASP B CG  1 
ATOM   3398 O  OD1 . ASP B 1 203 ? -3.289  29.005  81.238 1.00 33.45 ? 539 ASP B OD1 1 
ATOM   3399 O  OD2 . ASP B 1 203 ? -5.267  29.086  82.181 1.00 32.08 ? 539 ASP B OD2 1 
ATOM   3400 N  N   . GLN B 1 204 ? -2.341  24.313  81.224 1.00 25.56 ? 540 GLN B N   1 
ATOM   3401 C  CA  . GLN B 1 204 ? -2.120  22.893  81.505 1.00 25.86 ? 540 GLN B CA  1 
ATOM   3402 C  C   . GLN B 1 204 ? -2.250  22.021  80.242 1.00 25.31 ? 540 GLN B C   1 
ATOM   3403 O  O   . GLN B 1 204 ? -2.754  20.905  80.305 1.00 24.83 ? 540 GLN B O   1 
ATOM   3404 C  CB  . GLN B 1 204 ? -3.065  22.419  82.623 1.00 25.80 ? 540 GLN B CB  1 
ATOM   3405 C  CG  . GLN B 1 204 ? -3.104  23.331  83.881 1.00 28.23 ? 540 GLN B CG  1 
ATOM   3406 C  CD  . GLN B 1 204 ? -1.821  23.290  84.728 1.00 29.97 ? 540 GLN B CD  1 
ATOM   3407 O  OE1 . GLN B 1 204 ? -1.208  22.229  84.903 1.00 33.75 ? 540 GLN B OE1 1 
ATOM   3408 N  NE2 . GLN B 1 204 ? -1.425  24.440  85.263 1.00 29.36 ? 540 GLN B NE2 1 
ATOM   3409 N  N   . LEU B 1 205 ? -1.806  22.551  79.100 1.00 25.19 ? 541 LEU B N   1 
ATOM   3410 C  CA  . LEU B 1 205 ? -1.795  21.803  77.838 1.00 25.41 ? 541 LEU B CA  1 
ATOM   3411 C  C   . LEU B 1 205 ? -0.503  22.101  77.109 1.00 24.96 ? 541 LEU B C   1 
ATOM   3412 O  O   . LEU B 1 205 ? -0.175  23.263  76.876 1.00 24.65 ? 541 LEU B O   1 
ATOM   3413 C  CB  . LEU B 1 205 ? -2.980  22.166  76.927 1.00 25.63 ? 541 LEU B CB  1 
ATOM   3414 C  CG  . LEU B 1 205 ? -4.237  21.281  76.869 1.00 27.33 ? 541 LEU B CG  1 
ATOM   3415 C  CD1 . LEU B 1 205 ? -4.942  21.521  75.536 1.00 28.42 ? 541 LEU B CD1 1 
ATOM   3416 C  CD2 . LEU B 1 205 ? -3.968  19.795  77.044 1.00 27.46 ? 541 LEU B CD2 1 
ATOM   3417 N  N   . THR B 1 206 ? 0.213   21.050  76.732 1.00 24.30 ? 542 THR B N   1 
ATOM   3418 C  CA  . THR B 1 206 ? 1.446   21.203  75.989 1.00 24.46 ? 542 THR B CA  1 
ATOM   3419 C  C   . THR B 1 206 ? 1.500   20.245  74.812 1.00 24.26 ? 542 THR B C   1 
ATOM   3420 O  O   . THR B 1 206 ? 1.111   19.070  74.948 1.00 24.34 ? 542 THR B O   1 
ATOM   3421 C  CB  . THR B 1 206 ? 2.651   20.920  76.875 1.00 24.48 ? 542 THR B CB  1 
ATOM   3422 O  OG1 . THR B 1 206 ? 2.642   21.829  77.982 1.00 25.52 ? 542 THR B OG1 1 
ATOM   3423 C  CG2 . THR B 1 206 ? 3.938   21.110  76.086 1.00 26.00 ? 542 THR B CG2 1 
ATOM   3424 N  N   . LYS B 1 207 ? 1.973   20.740  73.669 1.00 23.22 ? 543 LYS B N   1 
ATOM   3425 C  CA  . LYS B 1 207 ? 2.350   19.862  72.570 1.00 23.58 ? 543 LYS B CA  1 
ATOM   3426 C  C   . LYS B 1 207 ? 3.803   19.465  72.800 1.00 22.64 ? 543 LYS B C   1 
ATOM   3427 O  O   . LYS B 1 207 ? 4.689   20.326  72.902 1.00 22.91 ? 543 LYS B O   1 
ATOM   3428 C  CB  . LYS B 1 207 ? 2.161   20.554  71.215 1.00 24.19 ? 543 LYS B CB  1 
ATOM   3429 C  CG  . LYS B 1 207 ? 2.589   19.710  70.006 1.00 26.13 ? 543 LYS B CG  1 
ATOM   3430 C  CD  . LYS B 1 207 ? 2.210   20.387  68.692 1.00 29.64 ? 543 LYS B CD  1 
ATOM   3431 C  CE  . LYS B 1 207 ? 2.418   19.454  67.524 1.00 31.99 ? 543 LYS B CE  1 
ATOM   3432 N  NZ  . LYS B 1 207 ? 2.236   20.145  66.210 1.00 35.85 ? 543 LYS B NZ  1 
ATOM   3433 N  N   . VAL B 1 208 ? 4.029   18.163  72.942 1.00 22.28 ? 544 VAL B N   1 
ATOM   3434 C  CA  . VAL B 1 208 ? 5.328   17.595  73.214 1.00 21.64 ? 544 VAL B CA  1 
ATOM   3435 C  C   . VAL B 1 208 ? 5.767   16.814  71.995 1.00 22.58 ? 544 VAL B C   1 
ATOM   3436 O  O   . VAL B 1 208 ? 5.063   15.894  71.538 1.00 22.87 ? 544 VAL B O   1 
ATOM   3437 C  CB  . VAL B 1 208 ? 5.270   16.614  74.377 1.00 22.44 ? 544 VAL B CB  1 
ATOM   3438 C  CG1 . VAL B 1 208 ? 6.648   15.958  74.608 1.00 21.10 ? 544 VAL B CG1 1 
ATOM   3439 C  CG2 . VAL B 1 208 ? 4.733   17.306  75.654 1.00 21.75 ? 544 VAL B CG2 1 
ATOM   3440 N  N   . SER B 1 209 ? 6.937   17.160  71.468 1.00 22.59 ? 545 SER B N   1 
ATOM   3441 C  CA  . SER B 1 209 ? 7.499   16.467  70.319 1.00 22.78 ? 545 SER B CA  1 
ATOM   3442 C  C   . SER B 1 209 ? 8.923   16.006  70.641 1.00 22.64 ? 545 SER B C   1 
ATOM   3443 O  O   . SER B 1 209 ? 9.679   16.726  71.280 1.00 22.45 ? 545 SER B O   1 
ATOM   3444 C  CB  . SER B 1 209 ? 7.511   17.385  69.097 1.00 23.37 ? 545 SER B CB  1 
ATOM   3445 O  OG  . SER B 1 209 ? 6.212   17.546  68.550 1.00 24.58 ? 545 SER B OG  1 
ATOM   3446 N  N   . TYR B 1 210 ? 9.262   14.791  70.213 1.00 22.76 ? 546 TYR B N   1 
ATOM   3447 C  CA  . TYR B 1 210 ? 10.623  14.276  70.296 1.00 21.83 ? 546 TYR B CA  1 
ATOM   3448 C  C   . TYR B 1 210 ? 11.131  14.088  68.867 1.00 21.50 ? 546 TYR B C   1 
ATOM   3449 O  O   . TYR B 1 210 ? 10.431  13.524  68.050 1.00 20.55 ? 546 TYR B O   1 
ATOM   3450 C  CB  . TYR B 1 210 ? 10.678  12.955  71.061 1.00 22.07 ? 546 TYR B CB  1 
ATOM   3451 C  CG  . TYR B 1 210 ? 12.049  12.303  70.937 1.00 22.30 ? 546 TYR B CG  1 
ATOM   3452 C  CD1 . TYR B 1 210 ? 13.105  12.707  71.725 1.00 22.39 ? 546 TYR B CD1 1 
ATOM   3453 C  CD2 . TYR B 1 210 ? 12.286  11.342  69.972 1.00 22.70 ? 546 TYR B CD2 1 
ATOM   3454 C  CE1 . TYR B 1 210 ? 14.365  12.145  71.574 1.00 23.82 ? 546 TYR B CE1 1 
ATOM   3455 C  CE2 . TYR B 1 210 ? 13.527  10.773  69.815 1.00 23.96 ? 546 TYR B CE2 1 
ATOM   3456 C  CZ  . TYR B 1 210 ? 14.560  11.170  70.614 1.00 24.15 ? 546 TYR B CZ  1 
ATOM   3457 O  OH  . TYR B 1 210 ? 15.781  10.586  70.436 1.00 26.16 ? 546 TYR B OH  1 
ATOM   3458 N  N   . TYR B 1 211 ? 12.335  14.579  68.583 1.00 20.77 ? 547 TYR B N   1 
ATOM   3459 C  CA  . TYR B 1 211 ? 12.956  14.498  67.258 1.00 21.07 ? 547 TYR B CA  1 
ATOM   3460 C  C   . TYR B 1 211 ? 14.243  13.714  67.341 1.00 21.29 ? 547 TYR B C   1 
ATOM   3461 O  O   . TYR B 1 211 ? 14.965  13.798  68.345 1.00 19.91 ? 547 TYR B O   1 
ATOM   3462 C  CB  . TYR B 1 211 ? 13.336  15.896  66.750 1.00 21.28 ? 547 TYR B CB  1 
ATOM   3463 C  CG  . TYR B 1 211 ? 12.167  16.721  66.341 1.00 20.85 ? 547 TYR B CG  1 
ATOM   3464 C  CD1 . TYR B 1 211 ? 11.832  16.851  65.016 1.00 21.08 ? 547 TYR B CD1 1 
ATOM   3465 C  CD2 . TYR B 1 211 ? 11.370  17.361  67.293 1.00 20.18 ? 547 TYR B CD2 1 
ATOM   3466 C  CE1 . TYR B 1 211 ? 10.722  17.604  64.621 1.00 19.67 ? 547 TYR B CE1 1 
ATOM   3467 C  CE2 . TYR B 1 211 ? 10.276  18.111  66.913 1.00 20.74 ? 547 TYR B CE2 1 
ATOM   3468 C  CZ  . TYR B 1 211 ? 9.951   18.221  65.579 1.00 21.48 ? 547 TYR B CZ  1 
ATOM   3469 O  OH  . TYR B 1 211 ? 8.853   18.940  65.180 1.00 20.71 ? 547 TYR B OH  1 
ATOM   3470 N  N   . ASN B 1 212 ? 14.539  12.982  66.265 1.00 21.48 ? 548 ASN B N   1 
ATOM   3471 C  CA  . ASN B 1 212 ? 15.832  12.327  66.109 1.00 21.78 ? 548 ASN B CA  1 
ATOM   3472 C  C   . ASN B 1 212 ? 16.218  12.369  64.641 1.00 21.91 ? 548 ASN B C   1 
ATOM   3473 O  O   . ASN B 1 212 ? 15.606  11.693  63.816 1.00 21.29 ? 548 ASN B O   1 
ATOM   3474 C  CB  . ASN B 1 212 ? 15.783  10.889  66.655 1.00 22.60 ? 548 ASN B CB  1 
ATOM   3475 C  CG  . ASN B 1 212 ? 17.154  10.254  66.770 1.00 22.74 ? 548 ASN B CG  1 
ATOM   3476 O  OD1 . ASN B 1 212 ? 17.850  10.075  65.777 1.00 23.66 ? 548 ASN B OD1 1 
ATOM   3477 N  ND2 . ASN B 1 212 ? 17.533  9.880   67.977 1.00 25.16 ? 548 ASN B ND2 1 
ATOM   3478 N  N   . GLN B 1 213 ? 17.186  13.226  64.314 1.00 21.80 ? 549 GLN B N   1 
ATOM   3479 C  CA  . GLN B 1 213 ? 17.630  13.416  62.941 1.00 21.50 ? 549 GLN B CA  1 
ATOM   3480 C  C   . GLN B 1 213 ? 18.426  12.233  62.420 1.00 21.71 ? 549 GLN B C   1 
ATOM   3481 O  O   . GLN B 1 213 ? 18.136  11.730  61.338 1.00 20.10 ? 549 GLN B O   1 
ATOM   3482 C  CB  . GLN B 1 213 ? 18.471  14.686  62.793 1.00 21.63 ? 549 GLN B CB  1 
ATOM   3483 C  CG  . GLN B 1 213 ? 18.717  15.024  61.309 1.00 22.51 ? 549 GLN B CG  1 
ATOM   3484 C  CD  . GLN B 1 213 ? 19.423  16.353  61.082 1.00 24.35 ? 549 GLN B CD  1 
ATOM   3485 O  OE1 . GLN B 1 213 ? 20.013  16.948  61.999 1.00 25.34 ? 549 GLN B OE1 1 
ATOM   3486 N  NE2 . GLN B 1 213 ? 19.373  16.820  59.841 1.00 23.88 ? 549 GLN B NE2 1 
ATOM   3487 N  N   . ALA B 1 214 ? 19.446  11.816  63.176 1.00 22.31 ? 550 ALA B N   1 
ATOM   3488 C  CA  . ALA B 1 214 ? 20.269  10.689  62.776 1.00 22.85 ? 550 ALA B CA  1 
ATOM   3489 C  C   . ALA B 1 214 ? 21.039  10.083  63.957 1.00 23.69 ? 550 ALA B C   1 
ATOM   3490 O  O   . ALA B 1 214 ? 21.813  10.769  64.635 1.00 23.86 ? 550 ALA B O   1 
ATOM   3491 C  CB  . ALA B 1 214 ? 21.220  11.085  61.661 1.00 22.75 ? 550 ALA B CB  1 
ATOM   3492 N  N   . THR B 1 215 ? 20.813  8.782   64.163 1.00 24.34 ? 551 THR B N   1 
ATOM   3493 C  CA  . THR B 1 215 ? 21.497  7.977   65.158 1.00 24.74 ? 551 THR B CA  1 
ATOM   3494 C  C   . THR B 1 215 ? 21.792  6.627   64.468 1.00 25.53 ? 551 THR B C   1 
ATOM   3495 O  O   . THR B 1 215 ? 21.079  5.656   64.678 1.00 25.36 ? 551 THR B O   1 
ATOM   3496 C  CB  . THR B 1 215 ? 20.623  7.761   66.417 1.00 24.29 ? 551 THR B CB  1 
ATOM   3497 O  OG1 . THR B 1 215 ? 20.099  9.015   66.868 1.00 24.85 ? 551 THR B OG1 1 
ATOM   3498 C  CG2 . THR B 1 215 ? 21.439  7.091   67.535 1.00 24.27 ? 551 THR B CG2 1 
ATOM   3499 N  N   . PRO B 1 216 ? 22.848  6.580   63.637 1.00 26.60 ? 552 PRO B N   1 
ATOM   3500 C  CA  . PRO B 1 216 ? 23.179  5.475   62.749 1.00 27.40 ? 552 PRO B CA  1 
ATOM   3501 C  C   . PRO B 1 216 ? 22.996  4.106   63.379 1.00 27.85 ? 552 PRO B C   1 
ATOM   3502 O  O   . PRO B 1 216 ? 22.390  3.211   62.764 1.00 28.46 ? 552 PRO B O   1 
ATOM   3503 C  CB  . PRO B 1 216 ? 24.673  5.689   62.469 1.00 27.49 ? 552 PRO B CB  1 
ATOM   3504 C  CG  . PRO B 1 216 ? 24.847  7.131   62.539 1.00 28.26 ? 552 PRO B CG  1 
ATOM   3505 C  CD  . PRO B 1 216 ? 23.901  7.606   63.623 1.00 26.89 ? 552 PRO B CD  1 
ATOM   3506 N  N   . GLY B 1 217 ? 23.499  3.967   64.605 1.00 27.71 ? 553 GLY B N   1 
ATOM   3507 C  CA  . GLY B 1 217 ? 23.572  2.677   65.265 1.00 28.10 ? 553 GLY B CA  1 
ATOM   3508 C  C   . GLY B 1 217 ? 22.259  2.031   65.655 1.00 28.02 ? 553 GLY B C   1 
ATOM   3509 O  O   . GLY B 1 217 ? 22.273  0.933   66.187 1.00 28.54 ? 553 GLY B O   1 
ATOM   3510 N  N   . VAL B 1 218 ? 21.133  2.700   65.414 1.00 27.44 ? 554 VAL B N   1 
ATOM   3511 C  CA  . VAL B 1 218 ? 19.833  2.139   65.739 1.00 27.01 ? 554 VAL B CA  1 
ATOM   3512 C  C   . VAL B 1 218 ? 18.875  2.139   64.518 1.00 26.24 ? 554 VAL B C   1 
ATOM   3513 O  O   . VAL B 1 218 ? 17.658  2.094   64.669 1.00 26.17 ? 554 VAL B O   1 
ATOM   3514 C  CB  . VAL B 1 218 ? 19.215  2.926   66.917 1.00 27.55 ? 554 VAL B CB  1 
ATOM   3515 C  CG1 . VAL B 1 218 ? 20.179  2.910   68.120 1.00 29.23 ? 554 VAL B CG1 1 
ATOM   3516 C  CG2 . VAL B 1 218 ? 18.914  4.343   66.521 1.00 25.40 ? 554 VAL B CG2 1 
ATOM   3517 N  N   . LEU B 1 219 ? 19.423  2.169   63.311 1.00 25.14 ? 555 LEU B N   1 
ATOM   3518 C  CA  . LEU B 1 219 ? 18.587  2.286   62.118 1.00 24.39 ? 555 LEU B CA  1 
ATOM   3519 C  C   . LEU B 1 219 ? 17.609  1.131   61.982 1.00 23.97 ? 555 LEU B C   1 
ATOM   3520 O  O   . LEU B 1 219 ? 16.462  1.348   61.616 1.00 22.39 ? 555 LEU B O   1 
ATOM   3521 C  CB  . LEU B 1 219 ? 19.441  2.389   60.855 1.00 24.69 ? 555 LEU B CB  1 
ATOM   3522 C  CG  . LEU B 1 219 ? 18.689  2.519   59.539 1.00 24.48 ? 555 LEU B CG  1 
ATOM   3523 C  CD1 . LEU B 1 219 ? 17.991  3.875   59.448 1.00 24.00 ? 555 LEU B CD1 1 
ATOM   3524 C  CD2 . LEU B 1 219 ? 19.632  2.297   58.341 1.00 26.87 ? 555 LEU B CD2 1 
ATOM   3525 N  N   . ASN B 1 220 ? 18.070  -0.084  62.262 1.00 23.50 ? 556 ASN B N   1 
ATOM   3526 C  CA  . ASN B 1 220 ? 17.212  -1.276  62.212 1.00 24.65 ? 556 ASN B CA  1 
ATOM   3527 C  C   . ASN B 1 220 ? 15.981  -1.096  63.084 1.00 24.40 ? 556 ASN B C   1 
ATOM   3528 O  O   . ASN B 1 220 ? 14.854  -1.368  62.678 1.00 24.82 ? 556 ASN B O   1 
ATOM   3529 C  CB  . ASN B 1 220 ? 18.013  -2.530  62.636 1.00 24.88 ? 556 ASN B CB  1 
ATOM   3530 C  CG  . ASN B 1 220 ? 17.276  -3.844  62.365 1.00 27.63 ? 556 ASN B CG  1 
ATOM   3531 O  OD1 . ASN B 1 220 ? 16.263  -3.892  61.649 1.00 32.48 ? 556 ASN B OD1 1 
ATOM   3532 N  ND2 . ASN B 1 220 ? 17.795  -4.928  62.935 1.00 29.23 ? 556 ASN B ND2 1 
ATOM   3533 N  N   . TYR B 1 221 ? 16.216  -0.560  64.268 1.00 24.28 ? 557 TYR B N   1 
ATOM   3534 C  CA  . TYR B 1 221 ? 15.179  -0.271  65.225 1.00 24.43 ? 557 TYR B CA  1 
ATOM   3535 C  C   . TYR B 1 221 ? 14.204  0.822   64.751 1.00 22.88 ? 557 TYR B C   1 
ATOM   3536 O  O   . TYR B 1 221 ? 12.985  0.692   64.908 1.00 22.11 ? 557 TYR B O   1 
ATOM   3537 C  CB  . TYR B 1 221 ? 15.860  0.155   66.529 1.00 25.58 ? 557 TYR B CB  1 
ATOM   3538 C  CG  . TYR B 1 221 ? 14.972  0.149   67.713 1.00 27.52 ? 557 TYR B CG  1 
ATOM   3539 C  CD1 . TYR B 1 221 ? 14.444  -1.043  68.179 1.00 30.88 ? 557 TYR B CD1 1 
ATOM   3540 C  CD2 . TYR B 1 221 ? 14.680  1.319   68.389 1.00 31.38 ? 557 TYR B CD2 1 
ATOM   3541 C  CE1 . TYR B 1 221 ? 13.635  -1.075  69.273 1.00 33.41 ? 557 TYR B CE1 1 
ATOM   3542 C  CE2 . TYR B 1 221 ? 13.860  1.303   69.507 1.00 33.97 ? 557 TYR B CE2 1 
ATOM   3543 C  CZ  . TYR B 1 221 ? 13.343  0.094   69.943 1.00 33.77 ? 557 TYR B CZ  1 
ATOM   3544 O  OH  . TYR B 1 221 ? 12.525  0.037   71.042 1.00 37.87 ? 557 TYR B OH  1 
ATOM   3545 N  N   . VAL B 1 222 ? 14.744  1.876   64.148 1.00 21.84 ? 558 VAL B N   1 
ATOM   3546 C  CA  . VAL B 1 222 ? 13.926  2.944   63.586 1.00 20.78 ? 558 VAL B CA  1 
ATOM   3547 C  C   . VAL B 1 222 ? 13.024  2.474   62.455 1.00 20.42 ? 558 VAL B C   1 
ATOM   3548 O  O   . VAL B 1 222 ? 11.817  2.777   62.423 1.00 19.53 ? 558 VAL B O   1 
ATOM   3549 C  CB  . VAL B 1 222 ? 14.789  4.114   63.041 1.00 21.26 ? 558 VAL B CB  1 
ATOM   3550 C  CG1 . VAL B 1 222 ? 13.921  5.083   62.275 1.00 18.67 ? 558 VAL B CG1 1 
ATOM   3551 C  CG2 . VAL B 1 222 ? 15.505  4.850   64.178 1.00 20.28 ? 558 VAL B CG2 1 
ATOM   3552 N  N   . THR B 1 223 ? 13.607  1.734   61.512 1.00 19.51 ? 559 THR B N   1 
ATOM   3553 C  CA  . THR B 1 223 ? 12.843  1.294   60.352 1.00 18.97 ? 559 THR B CA  1 
ATOM   3554 C  C   . THR B 1 223 ? 11.777  0.292   60.766 1.00 19.20 ? 559 THR B C   1 
ATOM   3555 O  O   . THR B 1 223 ? 10.682  0.302   60.215 1.00 19.00 ? 559 THR B O   1 
ATOM   3556 C  CB  . THR B 1 223 ? 13.725  0.675   59.260 1.00 19.16 ? 559 THR B CB  1 
ATOM   3557 O  OG1 . THR B 1 223 ? 14.297  -0.552  59.736 1.00 17.52 ? 559 THR B OG1 1 
ATOM   3558 C  CG2 . THR B 1 223 ? 14.815  1.655   58.836 1.00 18.07 ? 559 THR B CG2 1 
ATOM   3559 N  N   . THR B 1 224 ? 12.076  -0.561  61.740 1.00 19.22 ? 560 THR B N   1 
ATOM   3560 C  CA  . THR B 1 224 ? 11.055  -1.474  62.234 1.00 20.24 ? 560 THR B CA  1 
ATOM   3561 C  C   . THR B 1 224 ? 9.875   -0.692  62.754 1.00 20.21 ? 560 THR B C   1 
ATOM   3562 O  O   . THR B 1 224 ? 8.746   -1.043  62.473 1.00 20.36 ? 560 THR B O   1 
ATOM   3563 C  CB  . THR B 1 224 ? 11.548  -2.372  63.365 1.00 19.87 ? 560 THR B CB  1 
ATOM   3564 O  OG1 . THR B 1 224 ? 12.663  -3.115  62.897 1.00 20.80 ? 560 THR B OG1 1 
ATOM   3565 C  CG2 . THR B 1 224 ? 10.451  -3.347  63.804 1.00 19.95 ? 560 THR B CG2 1 
ATOM   3566 N  N   . ASN B 1 225 ? 10.148  0.372   63.509 1.00 21.65 ? 561 ASN B N   1 
ATOM   3567 C  CA  . ASN B 1 225 ? 9.076   1.203   64.088 1.00 22.82 ? 561 ASN B CA  1 
ATOM   3568 C  C   . ASN B 1 225 ? 8.336   2.014   63.031 1.00 23.83 ? 561 ASN B C   1 
ATOM   3569 O  O   . ASN B 1 225 ? 7.107   2.025   62.987 1.00 24.56 ? 561 ASN B O   1 
ATOM   3570 C  CB  . ASN B 1 225 ? 9.617   2.126   65.194 1.00 22.48 ? 561 ASN B CB  1 
ATOM   3571 C  CG  . ASN B 1 225 ? 9.754   1.417   66.510 1.00 23.10 ? 561 ASN B CG  1 
ATOM   3572 O  OD1 . ASN B 1 225 ? 8.887   1.544   67.376 1.00 22.73 ? 561 ASN B OD1 1 
ATOM   3573 N  ND2 . ASN B 1 225 ? 10.817  0.621   66.662 1.00 21.30 ? 561 ASN B ND2 1 
ATOM   3574 N  N   . VAL B 1 226 ? 9.100   2.659   62.160 1.00 25.27 ? 562 VAL B N   1 
ATOM   3575 C  CA  . VAL B 1 226 ? 8.550   3.477   61.092 1.00 26.18 ? 562 VAL B CA  1 
ATOM   3576 C  C   . VAL B 1 226 ? 7.700   2.680   60.107 1.00 26.83 ? 562 VAL B C   1 
ATOM   3577 O  O   . VAL B 1 226 ? 6.751   3.210   59.548 1.00 27.90 ? 562 VAL B O   1 
ATOM   3578 C  CB  . VAL B 1 226 ? 9.698   4.235   60.354 1.00 26.54 ? 562 VAL B CB  1 
ATOM   3579 C  CG1 . VAL B 1 226 ? 9.219   4.834   59.044 1.00 27.12 ? 562 VAL B CG1 1 
ATOM   3580 C  CG2 . VAL B 1 226 ? 10.262  5.322   61.271 1.00 25.12 ? 562 VAL B CG2 1 
ATOM   3581 N  N   . ALA B 1 227 ? 8.037   1.412   59.892 1.00 27.14 ? 563 ALA B N   1 
ATOM   3582 C  CA  . ALA B 1 227 ? 7.283   0.566   58.986 1.00 27.19 ? 563 ALA B CA  1 
ATOM   3583 C  C   . ALA B 1 227 ? 6.024   -0.003  59.647 1.00 27.77 ? 563 ALA B C   1 
ATOM   3584 O  O   . ALA B 1 227 ? 5.082   -0.414  58.959 1.00 27.61 ? 563 ALA B O   1 
ATOM   3585 C  CB  . ALA B 1 227 ? 8.163   -0.560  58.471 1.00 27.13 ? 563 ALA B CB  1 
ATOM   3586 N  N   . GLY B 1 228 ? 6.018   -0.039  60.976 1.00 27.89 ? 564 GLY B N   1 
ATOM   3587 C  CA  . GLY B 1 228 ? 4.871   -0.534  61.733 1.00 27.98 ? 564 GLY B CA  1 
ATOM   3588 C  C   . GLY B 1 228 ? 4.976   -1.981  62.163 1.00 27.91 ? 564 GLY B C   1 
ATOM   3589 O  O   . GLY B 1 228 ? 3.976   -2.588  62.518 1.00 28.22 ? 564 GLY B O   1 
ATOM   3590 N  N   . LEU B 1 229 ? 6.181   -2.538  62.125 1.00 28.04 ? 565 LEU B N   1 
ATOM   3591 C  CA  . LEU B 1 229 ? 6.432   -3.900  62.600 1.00 27.70 ? 565 LEU B CA  1 
ATOM   3592 C  C   . LEU B 1 229 ? 6.569   -3.931  64.114 1.00 27.68 ? 565 LEU B C   1 
ATOM   3593 O  O   . LEU B 1 229 ? 6.454   -4.991  64.742 1.00 27.62 ? 565 LEU B O   1 
ATOM   3594 C  CB  . LEU B 1 229 ? 7.709   -4.469  61.982 1.00 27.76 ? 565 LEU B CB  1 
ATOM   3595 C  CG  . LEU B 1 229 ? 7.586   -5.019  60.568 1.00 28.23 ? 565 LEU B CG  1 
ATOM   3596 C  CD1 . LEU B 1 229 ? 7.254   -3.881  59.627 1.00 30.54 ? 565 LEU B CD1 1 
ATOM   3597 C  CD2 . LEU B 1 229 ? 8.877   -5.736  60.123 1.00 28.61 ? 565 LEU B CD2 1 
ATOM   3598 N  N   . SER B 1 230 ? 6.858   -2.770  64.688 1.00 27.25 ? 566 SER B N   1 
ATOM   3599 C  CA  . SER B 1 230 ? 6.934   -2.608  66.114 1.00 27.26 ? 566 SER B CA  1 
ATOM   3600 C  C   . SER B 1 230 ? 6.298   -1.271  66.488 1.00 27.12 ? 566 SER B C   1 
ATOM   3601 O  O   . SER B 1 230 ? 6.113   -0.387  65.635 1.00 27.24 ? 566 SER B O   1 
ATOM   3602 C  CB  . SER B 1 230 ? 8.392   -2.643  66.560 1.00 27.21 ? 566 SER B CB  1 
ATOM   3603 O  OG  . SER B 1 230 ? 8.531   -2.032  67.823 1.00 29.02 ? 566 SER B OG  1 
ATOM   3604 N  N   . SER B 1 231 ? 5.935   -1.138  67.756 1.00 26.79 ? 567 SER B N   1 
ATOM   3605 C  CA  . SER B 1 231 ? 5.341   0.087   68.241 1.00 26.59 ? 567 SER B CA  1 
ATOM   3606 C  C   . SER B 1 231 ? 6.038   0.549   69.509 1.00 25.95 ? 567 SER B C   1 
ATOM   3607 O  O   . SER B 1 231 ? 5.456   1.271   70.308 1.00 25.00 ? 567 SER B O   1 
ATOM   3608 C  CB  . SER B 1 231 ? 3.852   -0.120  68.488 1.00 27.03 ? 567 SER B CB  1 
ATOM   3609 O  OG  . SER B 1 231 ? 3.655   -1.275  69.288 1.00 29.39 ? 567 SER B OG  1 
ATOM   3610 N  N   . GLU B 1 232 ? 7.293   0.154   69.684 1.00 25.42 ? 568 GLU B N   1 
ATOM   3611 C  CA  . GLU B 1 232 ? 8.053   0.587   70.848 1.00 25.73 ? 568 GLU B CA  1 
ATOM   3612 C  C   . GLU B 1 232 ? 8.141   2.121   70.954 1.00 24.53 ? 568 GLU B C   1 
ATOM   3613 O  O   . GLU B 1 232 ? 8.195   2.648   72.065 1.00 23.44 ? 568 GLU B O   1 
ATOM   3614 C  CB  . GLU B 1 232 ? 9.451   -0.049  70.875 1.00 25.96 ? 568 GLU B CB  1 
ATOM   3615 C  CG  . GLU B 1 232 ? 9.460   -1.530  71.354 1.00 29.84 ? 568 GLU B CG  1 
ATOM   3616 C  CD  . GLU B 1 232 ? 10.274  -2.478  70.449 1.00 34.28 ? 568 GLU B CD  1 
ATOM   3617 O  OE1 . GLU B 1 232 ? 10.940  -1.980  69.508 1.00 37.42 ? 568 GLU B OE1 1 
ATOM   3618 O  OE2 . GLU B 1 232 ? 10.233  -3.727  70.657 1.00 36.76 ? 568 GLU B OE2 1 
ATOM   3619 N  N   . PHE B 1 233 ? 8.160   2.833   69.822 1.00 24.06 ? 569 PHE B N   1 
ATOM   3620 C  CA  . PHE B 1 233 ? 8.185   4.308   69.868 1.00 23.40 ? 569 PHE B CA  1 
ATOM   3621 C  C   . PHE B 1 233 ? 6.899   4.800   70.517 1.00 22.39 ? 569 PHE B C   1 
ATOM   3622 O  O   . PHE B 1 233 ? 6.928   5.645   71.423 1.00 21.46 ? 569 PHE B O   1 
ATOM   3623 C  CB  . PHE B 1 233 ? 8.302   4.950   68.480 1.00 23.78 ? 569 PHE B CB  1 
ATOM   3624 C  CG  . PHE B 1 233 ? 9.679   4.878   67.851 1.00 25.27 ? 569 PHE B CG  1 
ATOM   3625 C  CD1 . PHE B 1 233 ? 10.698  4.080   68.375 1.00 27.76 ? 569 PHE B CD1 1 
ATOM   3626 C  CD2 . PHE B 1 233 ? 9.931   5.588   66.680 1.00 26.69 ? 569 PHE B CD2 1 
ATOM   3627 C  CE1 . PHE B 1 233 ? 11.942  4.013   67.748 1.00 27.41 ? 569 PHE B CE1 1 
ATOM   3628 C  CE2 . PHE B 1 233 ? 11.158  5.524   66.052 1.00 26.53 ? 569 PHE B CE2 1 
ATOM   3629 C  CZ  . PHE B 1 233 ? 12.165  4.734   66.584 1.00 27.83 ? 569 PHE B CZ  1 
ATOM   3630 N  N   . TYR B 1 234 ? 5.765   4.297   70.051 1.00 21.70 ? 570 TYR B N   1 
ATOM   3631 C  CA  . TYR B 1 234 ? 4.502   4.676   70.659 1.00 21.84 ? 570 TYR B CA  1 
ATOM   3632 C  C   . TYR B 1 234 ? 4.486   4.357   72.155 1.00 21.38 ? 570 TYR B C   1 
ATOM   3633 O  O   . TYR B 1 234 ? 4.039   5.186   72.967 1.00 20.77 ? 570 TYR B O   1 
ATOM   3634 C  CB  . TYR B 1 234 ? 3.327   4.012   69.956 1.00 22.53 ? 570 TYR B CB  1 
ATOM   3635 C  CG  . TYR B 1 234 ? 3.020   4.694   68.656 1.00 24.31 ? 570 TYR B CG  1 
ATOM   3636 C  CD1 . TYR B 1 234 ? 3.431   4.154   67.439 1.00 25.40 ? 570 TYR B CD1 1 
ATOM   3637 C  CD2 . TYR B 1 234 ? 2.372   5.923   68.643 1.00 26.40 ? 570 TYR B CD2 1 
ATOM   3638 C  CE1 . TYR B 1 234 ? 3.179   4.807   66.244 1.00 25.22 ? 570 TYR B CE1 1 
ATOM   3639 C  CE2 . TYR B 1 234 ? 2.097   6.574   67.449 1.00 27.95 ? 570 TYR B CE2 1 
ATOM   3640 C  CZ  . TYR B 1 234 ? 2.505   6.008   66.253 1.00 27.13 ? 570 TYR B CZ  1 
ATOM   3641 O  OH  . TYR B 1 234 ? 2.222   6.663   65.084 1.00 29.37 ? 570 TYR B OH  1 
ATOM   3642 N  N   . THR B 1 235 ? 4.997   3.183   72.514 1.00 20.58 ? 571 THR B N   1 
ATOM   3643 C  CA  . THR B 1 235 ? 4.943   2.715   73.905 1.00 20.53 ? 571 THR B CA  1 
ATOM   3644 C  C   . THR B 1 235 ? 5.773   3.651   74.769 1.00 19.89 ? 571 THR B C   1 
ATOM   3645 O  O   . THR B 1 235 ? 5.309   4.095   75.820 1.00 19.50 ? 571 THR B O   1 
ATOM   3646 C  CB  . THR B 1 235 ? 5.404   1.235   74.048 1.00 20.30 ? 571 THR B CB  1 
ATOM   3647 O  OG1 . THR B 1 235 ? 4.547   0.420   73.247 1.00 20.64 ? 571 THR B OG1 1 
ATOM   3648 C  CG2 . THR B 1 235 ? 5.336   0.743   75.527 1.00 19.70 ? 571 THR B CG2 1 
ATOM   3649 N  N   . THR B 1 236 ? 6.977   3.969   74.304 1.00 19.39 ? 572 THR B N   1 
ATOM   3650 C  CA  . THR B 1 236 ? 7.866   4.882   75.042 1.00 19.11 ? 572 THR B CA  1 
ATOM   3651 C  C   . THR B 1 236 ? 7.279   6.291   75.181 1.00 18.71 ? 572 THR B C   1 
ATOM   3652 O  O   . THR B 1 236 ? 7.424   6.919   76.231 1.00 17.86 ? 572 THR B O   1 
ATOM   3653 C  CB  . THR B 1 236 ? 9.270   4.958   74.406 1.00 19.57 ? 572 THR B CB  1 
ATOM   3654 O  OG1 . THR B 1 236 ? 9.952   3.717   74.629 1.00 20.84 ? 572 THR B OG1 1 
ATOM   3655 C  CG2 . THR B 1 236 ? 10.095  6.097   75.019 1.00 18.97 ? 572 THR B CG2 1 
ATOM   3656 N  N   . PHE B 1 237 ? 6.593   6.761   74.139 1.00 18.23 ? 573 PHE B N   1 
ATOM   3657 C  CA  . PHE B 1 237 ? 6.018   8.090   74.144 1.00 18.95 ? 573 PHE B CA  1 
ATOM   3658 C  C   . PHE B 1 237 ? 4.823   8.098   75.080 1.00 18.80 ? 573 PHE B C   1 
ATOM   3659 O  O   . PHE B 1 237 ? 4.512   9.127   75.673 1.00 19.00 ? 573 PHE B O   1 
ATOM   3660 C  CB  . PHE B 1 237 ? 5.641   8.555   72.720 1.00 18.77 ? 573 PHE B CB  1 
ATOM   3661 C  CG  . PHE B 1 237 ? 5.951   10.012  72.451 1.00 20.74 ? 573 PHE B CG  1 
ATOM   3662 C  CD1 . PHE B 1 237 ? 7.171   10.558  72.809 1.00 22.61 ? 573 PHE B CD1 1 
ATOM   3663 C  CD2 . PHE B 1 237 ? 5.008   10.838  71.841 1.00 22.44 ? 573 PHE B CD2 1 
ATOM   3664 C  CE1 . PHE B 1 237 ? 7.445   11.903  72.553 1.00 25.35 ? 573 PHE B CE1 1 
ATOM   3665 C  CE2 . PHE B 1 237 ? 5.281   12.168  71.573 1.00 22.97 ? 573 PHE B CE2 1 
ATOM   3666 C  CZ  . PHE B 1 237 ? 6.484   12.704  71.933 1.00 24.48 ? 573 PHE B CZ  1 
ATOM   3667 N  N   . LYS B 1 238 ? 4.176   6.943   75.242 1.00 18.22 ? 574 LYS B N   1 
ATOM   3668 C  CA  . LYS B 1 238 ? 3.104   6.807   76.235 1.00 18.29 ? 574 LYS B CA  1 
ATOM   3669 C  C   . LYS B 1 238 ? 3.656   6.876   77.656 1.00 17.81 ? 574 LYS B C   1 
ATOM   3670 O  O   . LYS B 1 238 ? 3.095   7.559   78.510 1.00 16.89 ? 574 LYS B O   1 
ATOM   3671 C  CB  . LYS B 1 238 ? 2.315   5.524   76.035 1.00 18.15 ? 574 LYS B CB  1 
ATOM   3672 N  N   . ALA B 1 239 ? 4.767   6.191   77.897 1.00 17.63 ? 575 ALA B N   1 
ATOM   3673 C  CA  . ALA B 1 239 ? 5.446   6.274   79.188 1.00 17.79 ? 575 ALA B CA  1 
ATOM   3674 C  C   . ALA B 1 239 ? 6.026   7.682   79.449 1.00 18.21 ? 575 ALA B C   1 
ATOM   3675 O  O   . ALA B 1 239 ? 6.094   8.141   80.597 1.00 17.48 ? 575 ALA B O   1 
ATOM   3676 C  CB  . ALA B 1 239 ? 6.533   5.194   79.300 1.00 17.02 ? 575 ALA B CB  1 
ATOM   3677 N  N   . CYS B 1 240 ? 6.415   8.384   78.389 1.00 19.62 ? 576 CYS B N   1 
ATOM   3678 C  CA  . CYS B 1 240 ? 6.780   9.796   78.525 1.00 20.55 ? 576 CYS B CA  1 
ATOM   3679 C  C   . CYS B 1 240 ? 5.594   10.597  79.087 1.00 21.15 ? 576 CYS B C   1 
ATOM   3680 O  O   . CYS B 1 240 ? 5.736   11.336  80.076 1.00 20.57 ? 576 CYS B O   1 
ATOM   3681 C  CB  . CYS B 1 240 ? 7.208   10.382  77.193 1.00 20.56 ? 576 CYS B CB  1 
ATOM   3682 S  SG  . CYS B 1 240 ? 7.854   12.036  77.380 1.00 23.58 ? 576 CYS B SG  1 
ATOM   3683 N  N   . GLU B 1 241 ? 4.421   10.433  78.475 1.00 21.77 ? 577 GLU B N   1 
ATOM   3684 C  CA  . GLU B 1 241 ? 3.235   11.174  78.914 1.00 22.26 ? 577 GLU B CA  1 
ATOM   3685 C  C   . GLU B 1 241 ? 2.904   10.897  80.372 1.00 22.21 ? 577 GLU B C   1 
ATOM   3686 O  O   . GLU B 1 241 ? 2.491   11.800  81.121 1.00 22.69 ? 577 GLU B O   1 
ATOM   3687 C  CB  . GLU B 1 241 ? 2.016   10.845  78.052 1.00 22.12 ? 577 GLU B CB  1 
ATOM   3688 C  CG  . GLU B 1 241 ? 0.714   11.352  78.666 1.00 24.26 ? 577 GLU B CG  1 
ATOM   3689 C  CD  . GLU B 1 241 ? -0.495  11.111  77.795 1.00 26.81 ? 577 GLU B CD  1 
ATOM   3690 O  OE1 . GLU B 1 241 ? -0.597  9.998   77.242 1.00 29.35 ? 577 GLU B OE1 1 
ATOM   3691 O  OE2 . GLU B 1 241 ? -1.351  12.024  77.684 1.00 29.21 ? 577 GLU B OE2 1 
ATOM   3692 N  N   . GLN B 1 242 ? 3.052   9.637   80.765 1.00 21.85 ? 578 GLN B N   1 
ATOM   3693 C  CA  . GLN B 1 242 ? 2.688   9.209   82.102 1.00 22.19 ? 578 GLN B CA  1 
ATOM   3694 C  C   . GLN B 1 242 ? 3.637   9.785   83.140 1.00 21.31 ? 578 GLN B C   1 
ATOM   3695 O  O   . GLN B 1 242 ? 3.207   10.215  84.216 1.00 21.27 ? 578 GLN B O   1 
ATOM   3696 C  CB  . GLN B 1 242 ? 2.693   7.685   82.171 1.00 22.58 ? 578 GLN B CB  1 
ATOM   3697 C  CG  . GLN B 1 242 ? 2.179   7.146   83.460 1.00 25.22 ? 578 GLN B CG  1 
ATOM   3698 C  CD  . GLN B 1 242 ? 0.707   7.436   83.652 1.00 27.92 ? 578 GLN B CD  1 
ATOM   3699 O  OE1 . GLN B 1 242 ? -0.104  7.205   82.752 1.00 30.04 ? 578 GLN B OE1 1 
ATOM   3700 N  NE2 . GLN B 1 242 ? 0.353   7.934   84.828 1.00 29.26 ? 578 GLN B NE2 1 
ATOM   3701 N  N   . PHE B 1 243 ? 4.920   9.783   82.803 1.00 20.65 ? 579 PHE B N   1 
ATOM   3702 C  CA  . PHE B 1 243 ? 5.961   10.449  83.589 1.00 20.86 ? 579 PHE B CA  1 
ATOM   3703 C  C   . PHE B 1 243 ? 5.643   11.937  83.807 1.00 21.01 ? 579 PHE B C   1 
ATOM   3704 O  O   . PHE B 1 243 ? 5.737   12.440  84.930 1.00 20.63 ? 579 PHE B O   1 
ATOM   3705 C  CB  . PHE B 1 243 ? 7.308   10.276  82.880 1.00 20.96 ? 579 PHE B CB  1 
ATOM   3706 C  CG  . PHE B 1 243 ? 8.453   11.041  83.507 1.00 22.09 ? 579 PHE B CG  1 
ATOM   3707 C  CD1 . PHE B 1 243 ? 9.093   10.560  84.640 1.00 24.25 ? 579 PHE B CD1 1 
ATOM   3708 C  CD2 . PHE B 1 243 ? 8.916   12.205  82.936 1.00 24.58 ? 579 PHE B CD2 1 
ATOM   3709 C  CE1 . PHE B 1 243 ? 10.161  11.248  85.206 1.00 25.12 ? 579 PHE B CE1 1 
ATOM   3710 C  CE2 . PHE B 1 243 ? 9.998   12.913  83.510 1.00 26.88 ? 579 PHE B CE2 1 
ATOM   3711 C  CZ  . PHE B 1 243 ? 10.610  12.428  84.648 1.00 24.98 ? 579 PHE B CZ  1 
ATOM   3712 N  N   . LEU B 1 244 ? 5.274   12.640  82.736 1.00 20.96 ? 580 LEU B N   1 
ATOM   3713 C  CA  . LEU B 1 244 ? 4.903   14.058  82.844 1.00 21.13 ? 580 LEU B CA  1 
ATOM   3714 C  C   . LEU B 1 244 ? 3.680   14.278  83.752 1.00 21.37 ? 580 LEU B C   1 
ATOM   3715 O  O   . LEU B 1 244 ? 3.677   15.183  84.612 1.00 21.38 ? 580 LEU B O   1 
ATOM   3716 C  CB  . LEU B 1 244 ? 4.626   14.633  81.452 1.00 21.28 ? 580 LEU B CB  1 
ATOM   3717 C  CG  . LEU B 1 244 ? 5.842   14.765  80.542 1.00 21.57 ? 580 LEU B CG  1 
ATOM   3718 C  CD1 . LEU B 1 244 ? 5.408   15.288  79.196 1.00 21.57 ? 580 LEU B CD1 1 
ATOM   3719 C  CD2 . LEU B 1 244 ? 6.875   15.690  81.224 1.00 21.73 ? 580 LEU B CD2 1 
ATOM   3720 N  N   . LEU B 1 245 ? 2.652   13.451  83.546 1.00 21.16 ? 581 LEU B N   1 
ATOM   3721 C  CA  . LEU B 1 245 ? 1.413   13.531  84.325 1.00 21.74 ? 581 LEU B CA  1 
ATOM   3722 C  C   . LEU B 1 245 ? 1.644   13.168  85.769 1.00 21.84 ? 581 LEU B C   1 
ATOM   3723 O  O   . LEU B 1 245 ? 1.158   13.852  86.646 1.00 22.50 ? 581 LEU B O   1 
ATOM   3724 C  CB  . LEU B 1 245 ? 0.331   12.614  83.750 1.00 21.59 ? 581 LEU B CB  1 
ATOM   3725 C  CG  . LEU B 1 245 ? -0.258  13.014  82.397 1.00 22.37 ? 581 LEU B CG  1 
ATOM   3726 C  CD1 . LEU B 1 245 ? -1.057  11.852  81.797 1.00 24.40 ? 581 LEU B CD1 1 
ATOM   3727 C  CD2 . LEU B 1 245 ? -1.125  14.251  82.545 1.00 22.81 ? 581 LEU B CD2 1 
ATOM   3728 N  N   . ASP B 1 246 ? 2.398   12.102  86.016 1.00 22.33 ? 582 ASP B N   1 
ATOM   3729 C  CA  . ASP B 1 246 ? 2.704   11.665  87.386 1.00 22.96 ? 582 ASP B CA  1 
ATOM   3730 C  C   . ASP B 1 246 ? 3.481   12.737  88.169 1.00 23.15 ? 582 ASP B C   1 
ATOM   3731 O  O   . ASP B 1 246 ? 3.389   12.826  89.392 1.00 22.82 ? 582 ASP B O   1 
ATOM   3732 C  CB  . ASP B 1 246 ? 3.520   10.370  87.380 1.00 22.63 ? 582 ASP B CB  1 
ATOM   3733 C  CG  . ASP B 1 246 ? 2.711   9.145   86.941 1.00 24.41 ? 582 ASP B CG  1 
ATOM   3734 O  OD1 . ASP B 1 246 ? 1.477   9.235   86.741 1.00 26.20 ? 582 ASP B OD1 1 
ATOM   3735 O  OD2 . ASP B 1 246 ? 3.330   8.068   86.806 1.00 26.08 ? 582 ASP B OD2 1 
ATOM   3736 N  N   . ASN B 1 247 ? 4.266   13.532  87.466 1.00 23.76 ? 583 ASN B N   1 
ATOM   3737 C  CA  . ASN B 1 247 ? 5.098   14.544  88.107 1.00 24.20 ? 583 ASN B CA  1 
ATOM   3738 C  C   . ASN B 1 247 ? 4.625   15.948  87.767 1.00 25.07 ? 583 ASN B C   1 
ATOM   3739 O  O   . ASN B 1 247 ? 5.366   16.914  87.900 1.00 24.66 ? 583 ASN B O   1 
ATOM   3740 C  CB  . ASN B 1 247 ? 6.543   14.322  87.666 1.00 24.33 ? 583 ASN B CB  1 
ATOM   3741 C  CG  . ASN B 1 247 ? 7.073   12.977  88.108 1.00 23.34 ? 583 ASN B CG  1 
ATOM   3742 O  OD1 . ASN B 1 247 ? 7.425   12.800  89.270 1.00 24.80 ? 583 ASN B OD1 1 
ATOM   3743 N  ND2 . ASN B 1 247 ? 7.100   12.015  87.195 1.00 21.38 ? 583 ASN B ND2 1 
ATOM   3744 N  N   . ARG B 1 248 ? 3.377   16.032  87.316 1.00 26.86 ? 584 ARG B N   1 
ATOM   3745 C  CA  . ARG B 1 248 ? 2.722   17.267  86.826 1.00 28.56 ? 584 ARG B CA  1 
ATOM   3746 C  C   . ARG B 1 248 ? 2.956   18.511  87.686 1.00 29.47 ? 584 ARG B C   1 
ATOM   3747 O  O   . ARG B 1 248 ? 3.134   19.625  87.172 1.00 30.05 ? 584 ARG B O   1 
ATOM   3748 C  CB  . ARG B 1 248 ? 1.214   16.989  86.820 1.00 29.20 ? 584 ARG B CB  1 
ATOM   3749 C  CG  . ARG B 1 248 ? 0.326   17.888  86.003 1.00 29.70 ? 584 ARG B CG  1 
ATOM   3750 C  CD  . ARG B 1 248 ? -1.139  17.501  86.278 1.00 31.41 ? 584 ARG B CD  1 
ATOM   3751 N  NE  . ARG B 1 248 ? -1.334  16.065  86.116 1.00 33.02 ? 584 ARG B NE  1 
ATOM   3752 C  CZ  . ARG B 1 248 ? -1.749  15.202  87.047 1.00 35.43 ? 584 ARG B CZ  1 
ATOM   3753 N  NH1 . ARG B 1 248 ? -2.087  15.585  88.282 1.00 36.86 ? 584 ARG B NH1 1 
ATOM   3754 N  NH2 . ARG B 1 248 ? -1.859  13.918  86.724 1.00 36.33 ? 584 ARG B NH2 1 
ATOM   3755 N  N   . ASN B 1 249 ? 2.930   18.308  88.995 1.00 30.28 ? 585 ASN B N   1 
ATOM   3756 C  CA  . ASN B 1 249 ? 2.916   19.396  89.955 1.00 31.29 ? 585 ASN B CA  1 
ATOM   3757 C  C   . ASN B 1 249 ? 4.034   19.283  90.996 1.00 32.23 ? 585 ASN B C   1 
ATOM   3758 O  O   . ASN B 1 249 ? 3.907   19.801  92.098 1.00 32.32 ? 585 ASN B O   1 
ATOM   3759 C  CB  . ASN B 1 249 ? 1.524   19.463  90.624 1.00 31.14 ? 585 ASN B CB  1 
ATOM   3760 C  CG  . ASN B 1 249 ? 0.429   19.916  89.649 1.00 30.34 ? 585 ASN B CG  1 
ATOM   3761 O  OD1 . ASN B 1 249 ? 0.659   20.776  88.799 1.00 29.99 ? 585 ASN B OD1 1 
ATOM   3762 N  ND2 . ASN B 1 249 ? -0.749  19.330  89.762 1.00 28.07 ? 585 ASN B ND2 1 
ATOM   3763 N  N   . ASP B 1 250 ? 5.137   18.629  90.627 1.00 33.34 ? 586 ASP B N   1 
ATOM   3764 C  CA  . ASP B 1 250 ? 6.304   18.515  91.511 1.00 33.97 ? 586 ASP B CA  1 
ATOM   3765 C  C   . ASP B 1 250 ? 7.071   19.839  91.504 1.00 34.17 ? 586 ASP B C   1 
ATOM   3766 O  O   . ASP B 1 250 ? 7.288   20.406  90.450 1.00 33.97 ? 586 ASP B O   1 
ATOM   3767 C  CB  . ASP B 1 250 ? 7.231   17.388  91.043 1.00 34.04 ? 586 ASP B CB  1 
ATOM   3768 C  CG  . ASP B 1 250 ? 8.223   16.950  92.117 1.00 34.96 ? 586 ASP B CG  1 
ATOM   3769 O  OD1 . ASP B 1 250 ? 8.439   17.685  93.105 1.00 34.12 ? 586 ASP B OD1 1 
ATOM   3770 O  OD2 . ASP B 1 250 ? 8.790   15.847  91.969 1.00 37.08 ? 586 ASP B OD2 1 
ATOM   3771 N  N   . LEU B 1 251 ? 7.472   20.310  92.685 1.00 34.78 ? 587 LEU B N   1 
ATOM   3772 C  CA  . LEU B 1 251 ? 8.220   21.569  92.825 1.00 35.38 ? 587 LEU B CA  1 
ATOM   3773 C  C   . LEU B 1 251 ? 9.729   21.351  92.693 1.00 36.05 ? 587 LEU B C   1 
ATOM   3774 O  O   . LEU B 1 251 ? 10.453  22.257  92.277 1.00 35.64 ? 587 LEU B O   1 
ATOM   3775 C  CB  . LEU B 1 251 ? 7.911   22.233  94.183 1.00 35.14 ? 587 LEU B CB  1 
ATOM   3776 C  CG  . LEU B 1 251 ? 8.580   23.586  94.484 1.00 34.70 ? 587 LEU B CG  1 
ATOM   3777 C  CD1 . LEU B 1 251 ? 8.137   24.647  93.502 1.00 33.40 ? 587 LEU B CD1 1 
ATOM   3778 C  CD2 . LEU B 1 251 ? 8.292   24.037  95.921 1.00 34.41 ? 587 LEU B CD2 1 
ATOM   3779 N  N   . ALA B 1 252 ? 10.189  20.158  93.076 1.00 36.87 ? 588 ALA B N   1 
ATOM   3780 C  CA  . ALA B 1 252 ? 11.610  19.782  93.030 1.00 37.80 ? 588 ALA B CA  1 
ATOM   3781 C  C   . ALA B 1 252 ? 12.347  20.282  91.775 1.00 38.45 ? 588 ALA B C   1 
ATOM   3782 O  O   . ALA B 1 252 ? 13.413  20.884  91.890 1.00 38.54 ? 588 ALA B O   1 
ATOM   3783 C  CB  . ALA B 1 252 ? 11.764  18.259  93.159 1.00 37.73 ? 588 ALA B CB  1 
ATOM   3784 N  N   . PRO B 1 253 ? 11.791  20.023  90.574 1.00 39.51 ? 589 PRO B N   1 
ATOM   3785 C  CA  . PRO B 1 253 ? 12.482  20.535  89.368 1.00 40.13 ? 589 PRO B CA  1 
ATOM   3786 C  C   . PRO B 1 253 ? 12.829  22.040  89.429 1.00 40.87 ? 589 PRO B C   1 
ATOM   3787 O  O   . PRO B 1 253 ? 13.972  22.429  89.156 1.00 41.01 ? 589 PRO B O   1 
ATOM   3788 C  CB  . PRO B 1 253 ? 11.494  20.241  88.219 1.00 40.07 ? 589 PRO B CB  1 
ATOM   3789 C  CG  . PRO B 1 253 ? 10.468  19.247  88.781 1.00 40.17 ? 589 PRO B CG  1 
ATOM   3790 C  CD  . PRO B 1 253 ? 10.742  19.031  90.249 1.00 39.34 ? 589 PRO B CD  1 
ATOM   3791 N  N   . SER B 1 254 ? 11.865  22.870  89.811 1.00 41.23 ? 590 SER B N   1 
ATOM   3792 C  CA  . SER B 1 254 ? 12.050  24.310  89.751 1.00 41.88 ? 590 SER B CA  1 
ATOM   3793 C  C   . SER B 1 254 ? 12.961  24.864  90.863 1.00 42.69 ? 590 SER B C   1 
ATOM   3794 O  O   . SER B 1 254 ? 13.378  26.022  90.794 1.00 42.54 ? 590 SER B O   1 
ATOM   3795 C  CB  . SER B 1 254 ? 10.689  25.011  89.757 1.00 41.74 ? 590 SER B CB  1 
ATOM   3796 O  OG  . SER B 1 254 ? 9.894   24.538  90.825 1.00 42.03 ? 590 SER B OG  1 
ATOM   3797 N  N   . LEU B 1 255 ? 13.277  24.042  91.869 1.00 43.65 ? 591 LEU B N   1 
ATOM   3798 C  CA  . LEU B 1 255 ? 14.152  24.462  92.966 1.00 44.37 ? 591 LEU B CA  1 
ATOM   3799 C  C   . LEU B 1 255 ? 15.587  23.928  92.871 1.00 45.01 ? 591 LEU B C   1 
ATOM   3800 O  O   . LEU B 1 255 ? 16.424  24.284  93.698 1.00 45.51 ? 591 LEU B O   1 
ATOM   3801 C  CB  . LEU B 1 255 ? 13.537  24.093  94.327 1.00 44.43 ? 591 LEU B CB  1 
ATOM   3802 C  CG  . LEU B 1 255 ? 13.118  22.649  94.609 1.00 44.55 ? 591 LEU B CG  1 
ATOM   3803 C  CD1 . LEU B 1 255 ? 14.304  21.671  94.630 1.00 44.43 ? 591 LEU B CD1 1 
ATOM   3804 C  CD2 . LEU B 1 255 ? 12.361  22.613  95.933 1.00 43.83 ? 591 LEU B CD2 1 
ATOM   3805 N  N   . GLN B 1 256 ? 15.879  23.087  91.880 1.00 45.81 ? 592 GLN B N   1 
ATOM   3806 C  CA  . GLN B 1 256 ? 17.247  22.580  91.679 1.00 46.30 ? 592 GLN B CA  1 
ATOM   3807 C  C   . GLN B 1 256 ? 18.254  23.715  91.471 1.00 46.16 ? 592 GLN B C   1 
ATOM   3808 O  O   . GLN B 1 256 ? 18.203  24.420  90.466 1.00 46.25 ? 592 GLN B O   1 
ATOM   3809 C  CB  . GLN B 1 256 ? 17.314  21.644  90.473 1.00 46.42 ? 592 GLN B CB  1 
ATOM   3810 C  CG  . GLN B 1 256 ? 16.549  20.338  90.623 1.00 47.56 ? 592 GLN B CG  1 
ATOM   3811 C  CD  . GLN B 1 256 ? 17.161  19.221  89.801 1.00 49.67 ? 592 GLN B CD  1 
ATOM   3812 O  OE1 . GLN B 1 256 ? 16.610  18.793  88.772 1.00 51.39 ? 592 GLN B OE1 1 
ATOM   3813 N  NE2 . GLN B 1 256 ? 18.324  18.751  90.240 1.00 51.07 ? 592 GLN B NE2 1 
HETATM 3814 O  OH2 . 1PE C 2 .   ? 14.695  42.777  54.289 1.00 58.90 ? 2   1PE A OH2 1 
HETATM 3815 C  C12 . 1PE C 2 .   ? 13.964  41.784  55.043 1.00 59.89 ? 2   1PE A C12 1 
HETATM 3816 C  C22 . 1PE C 2 .   ? 14.715  41.393  56.323 1.00 60.41 ? 2   1PE A C22 1 
HETATM 3817 O  OH3 . 1PE C 2 .   ? 14.041  40.373  57.082 1.00 59.71 ? 2   1PE A OH3 1 
HETATM 3818 C  C13 . 1PE C 2 .   ? 12.614  40.105  59.025 1.00 58.74 ? 2   1PE A C13 1 
HETATM 3819 C  C23 . 1PE C 2 .   ? 12.806  40.791  57.676 1.00 59.26 ? 2   1PE A C23 1 
HETATM 3820 O  OH4 . 1PE C 2 .   ? 11.826  38.928  58.847 1.00 58.95 ? 2   1PE A OH4 1 
HETATM 3821 C  C14 . 1PE C 2 .   ? 9.509   38.403  58.268 1.00 56.69 ? 2   1PE A C14 1 
HETATM 3822 C  C24 . 1PE C 2 .   ? 10.464  39.019  59.298 1.00 57.99 ? 2   1PE A C24 1 
HETATM 3823 O  OH5 . 1PE C 2 .   ? 8.146   38.828  58.454 1.00 54.66 ? 2   1PE A OH5 1 
HETATM 3824 C  C15 . 1PE C 2 .   ? 6.662   40.603  57.648 1.00 50.06 ? 2   1PE A C15 1 
HETATM 3825 C  C25 . 1PE C 2 .   ? 7.974   40.246  58.326 1.00 52.78 ? 2   1PE A C25 1 
HETATM 3826 O  OH6 . 1PE C 2 .   ? 6.277   41.935  58.017 1.00 48.79 ? 2   1PE A OH6 1 
HETATM 3827 C  C16 . 1PE C 2 .   ? 7.286   43.410  56.248 1.00 37.33 ? 2   1PE A C16 1 
HETATM 3828 C  C26 . 1PE C 2 .   ? 7.185   43.034  57.735 1.00 42.39 ? 2   1PE A C26 1 
HETATM 3829 O  OH7 . 1PE C 2 .   ? 8.663   43.816  56.018 1.00 33.85 ? 2   1PE A OH7 1 
HETATM 3830 CL CL  . CL  D 3 .   ? 4.227   26.195  64.831 1.00 46.43 ? 1   CL  A CL  1 
HETATM 3831 C  C1  . GOL E 4 .   ? 11.920  42.647  65.462 1.00 52.32 ? 595 GOL A C1  1 
HETATM 3832 O  O1  . GOL E 4 .   ? 12.240  43.993  65.138 1.00 49.38 ? 595 GOL A O1  1 
HETATM 3833 C  C2  . GOL E 4 .   ? 12.022  42.277  66.957 1.00 53.32 ? 595 GOL A C2  1 
HETATM 3834 O  O2  . GOL E 4 .   ? 11.561  40.953  67.139 1.00 54.33 ? 595 GOL A O2  1 
HETATM 3835 C  C3  . GOL E 4 .   ? 11.248  43.190  67.916 1.00 53.16 ? 595 GOL A C3  1 
HETATM 3836 O  O3  . GOL E 4 .   ? 11.732  43.025  69.234 1.00 53.00 ? 595 GOL A O3  1 
HETATM 3837 O  O16 A TCE F 5 .   ? 29.679  39.982  65.778 0.50 49.18 ? 596 TCE A O16 1 
HETATM 3838 O  O16 B TCE F 5 .   ? 29.445  39.654  65.593 0.50 51.39 ? 596 TCE A O16 1 
HETATM 3839 C  C14 A TCE F 5 .   ? 29.656  40.175  67.014 0.50 50.19 ? 596 TCE A C14 1 
HETATM 3840 C  C14 B TCE F 5 .   ? 29.606  39.929  66.802 0.50 52.41 ? 596 TCE A C14 1 
HETATM 3841 O  O15 A TCE F 5 .   ? 28.751  39.786  67.794 0.50 49.46 ? 596 TCE A O15 1 
HETATM 3842 O  O15 B TCE F 5 .   ? 28.788  39.691  67.724 0.50 51.80 ? 596 TCE A O15 1 
HETATM 3843 C  C5  A TCE F 5 .   ? 30.855  40.926  67.642 0.50 50.37 ? 596 TCE A C5  1 
HETATM 3844 C  C5  B TCE F 5 .   ? 30.926  40.616  67.190 0.50 52.81 ? 596 TCE A C5  1 
HETATM 3845 C  C2  A TCE F 5 .   ? 31.302  42.162  66.829 0.50 50.52 ? 596 TCE A C2  1 
HETATM 3846 C  C2  B TCE F 5 .   ? 31.238  41.799  66.262 0.50 52.86 ? 596 TCE A C2  1 
HETATM 3847 P  P   A TCE F 5 .   ? 31.463  43.685  67.853 0.50 50.42 ? 596 TCE A P   1 
HETATM 3848 P  P   B TCE F 5 .   ? 31.130  43.404  67.124 0.50 54.46 ? 596 TCE A P   1 
HETATM 3849 C  C3  A TCE F 5 .   ? 31.487  44.878  66.468 0.50 51.48 ? 596 TCE A C3  1 
HETATM 3850 C  C3  B TCE F 5 .   ? 31.031  44.493  65.706 0.50 53.26 ? 596 TCE A C3  1 
HETATM 3851 C  C6  A TCE F 5 .   ? 32.052  44.184  65.219 0.50 51.95 ? 596 TCE A C6  1 
HETATM 3852 C  C6  B TCE F 5 .   ? 32.320  44.315  64.916 0.50 53.69 ? 596 TCE A C6  1 
HETATM 3853 C  C8  A TCE F 5 .   ? 32.607  45.166  64.165 0.50 53.96 ? 596 TCE A C8  1 
HETATM 3854 C  C8  B TCE F 5 .   ? 32.844  45.673  64.452 0.50 54.47 ? 596 TCE A C8  1 
HETATM 3855 O  O10 A TCE F 5 .   ? 33.797  45.553  64.301 0.50 54.02 ? 596 TCE A O10 1 
HETATM 3856 O  O10 B TCE F 5 .   ? 34.091  45.825  64.389 0.50 53.15 ? 596 TCE A O10 1 
HETATM 3857 O  O9  A TCE F 5 .   ? 31.838  45.483  63.229 0.50 53.66 ? 596 TCE A O9  1 
HETATM 3858 O  O9  B TCE F 5 .   ? 31.971  46.527  64.184 0.50 53.83 ? 596 TCE A O9  1 
HETATM 3859 C  C1  A TCE F 5 .   ? 29.833  43.766  68.654 0.50 46.72 ? 596 TCE A C1  1 
HETATM 3860 C  C1  B TCE F 5 .   ? 29.481  43.461  67.932 0.50 51.01 ? 596 TCE A C1  1 
HETATM 3861 C  C4  A TCE F 5 .   ? 29.931  43.781  70.190 0.50 44.10 ? 596 TCE A C4  1 
HETATM 3862 C  C4  B TCE F 5 .   ? 29.576  43.869  69.410 0.50 48.17 ? 596 TCE A C4  1 
HETATM 3863 C  C11 A TCE F 5 .   ? 29.606  42.423  70.833 0.50 41.27 ? 596 TCE A C11 1 
HETATM 3864 C  C11 B TCE F 5 .   ? 28.565  44.973  69.763 0.50 45.92 ? 596 TCE A C11 1 
HETATM 3865 O  O12 A TCE F 5 .   ? 29.540  42.388  72.083 0.50 39.67 ? 596 TCE A O12 1 
HETATM 3866 O  O12 B TCE F 5 .   ? 27.467  44.604  70.233 0.50 42.82 ? 596 TCE A O12 1 
HETATM 3867 O  O13 A TCE F 5 .   ? 29.461  41.447  70.070 0.50 38.06 ? 596 TCE A O13 1 
HETATM 3868 O  O13 B TCE F 5 .   ? 28.912  46.156  69.540 0.50 43.42 ? 596 TCE A O13 1 
HETATM 3869 O  OH2 . 1PE G 2 .   ? 18.064  10.979  72.762 1.00 46.09 ? 1   1PE B OH2 1 
HETATM 3870 C  C12 . 1PE G 2 .   ? 18.464  10.517  71.469 1.00 51.42 ? 1   1PE B C12 1 
HETATM 3871 C  C22 . 1PE G 2 .   ? 19.941  10.113  71.414 1.00 54.30 ? 1   1PE B C22 1 
HETATM 3872 O  OH3 . 1PE G 2 .   ? 20.162  8.924   72.193 1.00 58.52 ? 1   1PE B OH3 1 
HETATM 3873 C  C13 . 1PE G 2 .   ? 19.877  6.520   72.176 1.00 59.90 ? 1   1PE B C13 1 
HETATM 3874 C  C23 . 1PE G 2 .   ? 20.491  7.733   71.474 1.00 59.71 ? 1   1PE B C23 1 
HETATM 3875 O  OH4 . 1PE G 2 .   ? 18.994  5.816   71.291 1.00 61.23 ? 1   1PE B OH4 1 
HETATM 3876 C  C14 . 1PE G 2 .   ? 16.747  5.146   70.675 1.00 60.23 ? 1   1PE B C14 1 
HETATM 3877 C  C24 . 1PE G 2 .   ? 17.607  6.061   71.544 1.00 60.59 ? 1   1PE B C24 1 
HETATM 3878 O  OH5 . 1PE G 2 .   ? 15.873  5.929   69.861 1.00 59.96 ? 1   1PE B OH5 1 
HETATM 3879 C  C15 . 1PE G 2 .   ? 14.037  6.727   71.209 1.00 60.48 ? 1   1PE B C15 1 
HETATM 3880 C  C25 . 1PE G 2 .   ? 14.478  5.764   70.120 1.00 60.33 ? 1   1PE B C25 1 
HETATM 3881 O  OH6 . 1PE G 2 .   ? 12.738  7.208   70.866 1.00 61.47 ? 1   1PE B OH6 1 
HETATM 3882 C  C16 . 1PE G 2 .   ? 11.878  8.701   72.605 1.00 60.57 ? 1   1PE B C16 1 
HETATM 3883 C  C26 . 1PE G 2 .   ? 11.806  7.320   71.952 1.00 61.13 ? 1   1PE B C26 1 
HETATM 3884 O  OH7 . 1PE G 2 .   ? 10.594  9.356   72.577 1.00 59.38 ? 1   1PE B OH7 1 
HETATM 3885 O  O   . HOH H 6 .   ? -2.841  54.475  63.278 1.00 16.83 ? 3   HOH A O   1 
HETATM 3886 O  O   . HOH H 6 .   ? -1.538  53.746  61.064 1.00 17.78 ? 4   HOH A O   1 
HETATM 3887 O  O   . HOH H 6 .   ? 7.931   46.662  62.827 1.00 17.94 ? 5   HOH A O   1 
HETATM 3888 O  O   . HOH H 6 .   ? 1.507   45.005  44.753 1.00 16.67 ? 6   HOH A O   1 
HETATM 3889 O  O   . HOH H 6 .   ? 3.303   52.241  62.231 1.00 16.18 ? 12  HOH A O   1 
HETATM 3890 O  O   . HOH H 6 .   ? -7.261  40.701  60.566 1.00 22.14 ? 13  HOH A O   1 
HETATM 3891 O  O   . HOH H 6 .   ? -3.653  39.620  44.617 1.00 14.05 ? 14  HOH A O   1 
HETATM 3892 O  O   . HOH H 6 .   ? 14.624  31.762  63.817 1.00 16.73 ? 17  HOH A O   1 
HETATM 3893 O  O   . HOH H 6 .   ? 2.320   35.781  45.914 1.00 23.74 ? 20  HOH A O   1 
HETATM 3894 O  O   . HOH H 6 .   ? 17.053  38.805  43.502 1.00 19.19 ? 22  HOH A O   1 
HETATM 3895 O  O   . HOH H 6 .   ? 9.586   34.099  48.218 1.00 20.91 ? 23  HOH A O   1 
HETATM 3896 O  O   . HOH H 6 .   ? -3.867  33.360  60.965 1.00 14.11 ? 24  HOH A O   1 
HETATM 3897 O  O   . HOH H 6 .   ? 8.907   45.342  48.308 1.00 22.84 ? 25  HOH A O   1 
HETATM 3898 O  O   . HOH H 6 .   ? 15.705  36.664  49.956 1.00 23.72 ? 27  HOH A O   1 
HETATM 3899 O  O   . HOH H 6 .   ? 4.696   52.559  59.911 1.00 18.67 ? 28  HOH A O   1 
HETATM 3900 O  O   . HOH H 6 .   ? -5.264  33.065  58.435 1.00 38.29 ? 29  HOH A O   1 
HETATM 3901 O  O   . HOH H 6 .   ? 26.846  42.315  72.766 1.00 29.25 ? 31  HOH A O   1 
HETATM 3902 O  O   . HOH H 6 .   ? 17.807  55.985  60.589 1.00 24.44 ? 34  HOH A O   1 
HETATM 3903 O  O   . HOH H 6 .   ? -5.661  57.753  44.496 1.00 31.72 ? 36  HOH A O   1 
HETATM 3904 O  O   . HOH H 6 .   ? 1.547   51.319  48.550 1.00 23.56 ? 37  HOH A O   1 
HETATM 3905 O  O   . HOH H 6 .   ? 8.882   44.344  45.706 1.00 20.51 ? 38  HOH A O   1 
HETATM 3906 O  O   . HOH H 6 .   ? 8.131   32.930  63.939 1.00 23.48 ? 41  HOH A O   1 
HETATM 3907 O  O   . HOH H 6 .   ? -15.640 53.316  58.873 1.00 26.34 ? 43  HOH A O   1 
HETATM 3908 O  O   . HOH H 6 .   ? -0.912  56.797  40.357 1.00 25.30 ? 46  HOH A O   1 
HETATM 3909 O  O   . HOH H 6 .   ? 0.826   53.538  62.038 1.00 17.68 ? 47  HOH A O   1 
HETATM 3910 O  O   . HOH H 6 .   ? -8.132  39.993  63.169 1.00 19.13 ? 48  HOH A O   1 
HETATM 3911 O  O   . HOH H 6 .   ? 4.826   39.598  65.494 1.00 24.42 ? 49  HOH A O   1 
HETATM 3912 O  O   . HOH H 6 .   ? -1.698  52.510  42.218 1.00 21.60 ? 50  HOH A O   1 
HETATM 3913 O  O   . HOH H 6 .   ? 8.213   56.710  40.802 1.00 19.30 ? 51  HOH A O   1 
HETATM 3914 O  O   . HOH H 6 .   ? -0.864  35.738  50.726 1.00 18.84 ? 52  HOH A O   1 
HETATM 3915 O  O   . HOH H 6 .   ? 12.699  30.843  65.231 1.00 26.94 ? 55  HOH A O   1 
HETATM 3916 O  O   . HOH H 6 .   ? 22.238  38.979  58.650 1.00 34.37 ? 60  HOH A O   1 
HETATM 3917 O  O   . HOH H 6 .   ? -2.796  42.274  61.701 1.00 16.54 ? 62  HOH A O   1 
HETATM 3918 O  O   . HOH H 6 .   ? 20.989  36.662  47.833 1.00 17.79 ? 66  HOH A O   1 
HETATM 3919 O  O   . HOH H 6 .   ? 6.213   53.369  65.814 1.00 22.07 ? 67  HOH A O   1 
HETATM 3920 O  O   . HOH H 6 .   ? 12.287  51.597  68.149 1.00 26.00 ? 72  HOH A O   1 
HETATM 3921 O  O   . HOH H 6 .   ? 7.956   31.582  61.586 1.00 23.87 ? 74  HOH A O   1 
HETATM 3922 O  O   . HOH H 6 .   ? -2.976  59.686  54.073 1.00 21.70 ? 76  HOH A O   1 
HETATM 3923 O  O   . HOH H 6 .   ? 15.922  61.839  48.113 1.00 21.97 ? 77  HOH A O   1 
HETATM 3924 O  O   . HOH H 6 .   ? 8.632   35.283  78.767 1.00 34.25 ? 78  HOH A O   1 
HETATM 3925 O  O   . HOH H 6 .   ? 10.006  35.518  81.448 1.00 25.26 ? 82  HOH A O   1 
HETATM 3926 O  O   . HOH H 6 .   ? 23.580  37.927  79.141 1.00 24.99 ? 85  HOH A O   1 
HETATM 3927 O  O   . HOH H 6 .   ? -11.278 50.349  52.854 1.00 30.67 ? 88  HOH A O   1 
HETATM 3928 O  O   . HOH H 6 .   ? -1.073  47.327  44.776 1.00 28.67 ? 89  HOH A O   1 
HETATM 3929 O  O   . HOH H 6 .   ? 16.907  52.872  37.347 1.00 24.93 ? 95  HOH A O   1 
HETATM 3930 O  O   . HOH H 6 .   ? 1.653   48.957  47.800 1.00 26.31 ? 96  HOH A O   1 
HETATM 3931 O  O   . HOH H 6 .   ? 0.206   51.790  45.939 1.00 39.25 ? 97  HOH A O   1 
HETATM 3932 O  O   . HOH H 6 .   ? 3.180   61.269  47.454 1.00 23.16 ? 99  HOH A O   1 
HETATM 3933 O  O   . HOH H 6 .   ? 20.117  45.820  33.692 1.00 34.43 ? 101 HOH A O   1 
HETATM 3934 O  O   . HOH H 6 .   ? -11.673 46.340  60.218 1.00 31.60 ? 111 HOH A O   1 
HETATM 3935 O  O   . HOH H 6 .   ? 5.492   27.658  53.631 1.00 39.78 ? 115 HOH A O   1 
HETATM 3936 O  O   . HOH H 6 .   ? 6.627   26.839  56.118 1.00 25.18 ? 116 HOH A O   1 
HETATM 3937 O  O   . HOH H 6 .   ? 9.668   31.615  50.574 1.00 33.61 ? 117 HOH A O   1 
HETATM 3938 O  O   . HOH H 6 .   ? 8.956   59.950  41.279 1.00 32.39 ? 118 HOH A O   1 
HETATM 3939 O  O   . HOH H 6 .   ? -0.418  59.386  43.522 1.00 28.96 ? 119 HOH A O   1 
HETATM 3940 O  O   . HOH H 6 .   ? 3.614   23.768  66.751 1.00 30.39 ? 122 HOH A O   1 
HETATM 3941 O  O   . HOH H 6 .   ? 4.900   62.976  57.832 1.00 26.33 ? 124 HOH A O   1 
HETATM 3942 O  O   . HOH H 6 .   ? -8.837  37.227  64.478 1.00 28.21 ? 125 HOH A O   1 
HETATM 3943 O  O   . HOH H 6 .   ? -10.688 44.549  62.853 1.00 39.81 ? 126 HOH A O   1 
HETATM 3944 O  O   . HOH H 6 .   ? 15.019  30.350  61.643 1.00 33.68 ? 129 HOH A O   1 
HETATM 3945 O  O   . HOH H 6 .   ? 15.533  30.142  59.046 1.00 35.02 ? 130 HOH A O   1 
HETATM 3946 O  O   . HOH H 6 .   ? 26.464  33.798  58.856 1.00 29.83 ? 131 HOH A O   1 
HETATM 3947 O  O   . HOH H 6 .   ? 3.864   62.831  52.353 1.00 41.86 ? 133 HOH A O   1 
HETATM 3948 O  O   . HOH H 6 .   ? -2.552  32.936  64.996 1.00 13.97 ? 136 HOH A O   1 
HETATM 3949 O  O   . HOH H 6 .   ? -2.958  40.353  42.028 1.00 17.05 ? 137 HOH A O   1 
HETATM 3950 O  O   . HOH H 6 .   ? -0.231  61.350  53.925 1.00 20.19 ? 138 HOH A O   1 
HETATM 3951 O  O   . HOH H 6 .   ? 5.851   61.964  53.346 1.00 37.22 ? 140 HOH A O   1 
HETATM 3952 O  O   . HOH H 6 .   ? 26.519  42.128  51.640 1.00 35.32 ? 142 HOH A O   1 
HETATM 3953 O  O   . HOH H 6 .   ? -5.694  39.617  64.774 1.00 32.95 ? 147 HOH A O   1 
HETATM 3954 O  O   . HOH H 6 .   ? 24.544  39.308  60.432 1.00 24.81 ? 148 HOH A O   1 
HETATM 3955 O  O   . HOH H 6 .   ? -4.515  49.334  68.362 1.00 38.21 ? 149 HOH A O   1 
HETATM 3956 O  O   . HOH H 6 .   ? 21.194  43.696  77.925 1.00 22.36 ? 150 HOH A O   1 
HETATM 3957 O  O   . HOH H 6 .   ? 5.442   38.171  41.753 1.00 52.36 ? 151 HOH A O   1 
HETATM 3958 O  O   . HOH H 6 .   ? -8.638  52.279  63.465 1.00 39.43 ? 153 HOH A O   1 
HETATM 3959 O  O   . HOH H 6 .   ? -0.811  53.741  65.358 1.00 31.31 ? 154 HOH A O   1 
HETATM 3960 O  O   . HOH H 6 .   ? 15.041  59.234  69.885 1.00 27.09 ? 155 HOH A O   1 
HETATM 3961 O  O   . HOH H 6 .   ? 23.842  56.535  57.011 1.00 48.88 ? 159 HOH A O   1 
HETATM 3962 O  O   . HOH H 6 .   ? 11.941  40.910  78.498 1.00 24.78 ? 160 HOH A O   1 
HETATM 3963 O  O   . HOH H 6 .   ? -3.654  59.826  63.699 1.00 39.00 ? 161 HOH A O   1 
HETATM 3964 O  O   . HOH H 6 .   ? 4.003   32.890  46.049 1.00 38.64 ? 167 HOH A O   1 
HETATM 3965 O  O   . HOH H 6 .   ? 15.838  62.006  55.512 1.00 35.08 ? 171 HOH A O   1 
HETATM 3966 O  O   . HOH H 6 .   ? 3.894   53.286  64.939 1.00 26.59 ? 172 HOH A O   1 
HETATM 3967 O  O   . HOH H 6 .   ? 11.897  33.595  64.952 1.00 24.90 ? 174 HOH A O   1 
HETATM 3968 O  O   . HOH H 6 .   ? 24.042  31.704  71.888 1.00 19.89 ? 176 HOH A O   1 
HETATM 3969 O  O   . HOH H 6 .   ? -5.262  55.759  52.706 1.00 45.01 ? 179 HOH A O   1 
HETATM 3970 O  O   . HOH H 6 .   ? 19.400  32.410  73.483 1.00 21.80 ? 181 HOH A O   1 
HETATM 3971 O  O   . HOH H 6 .   ? 7.687   33.508  59.548 1.00 35.66 ? 182 HOH A O   1 
HETATM 3972 O  O   . HOH H 6 .   ? 20.290  40.454  78.728 1.00 22.62 ? 183 HOH A O   1 
HETATM 3973 O  O   . HOH H 6 .   ? 6.850   47.003  39.890 1.00 37.40 ? 184 HOH A O   1 
HETATM 3974 O  O   . HOH H 6 .   ? -6.608  39.691  44.858 1.00 34.89 ? 186 HOH A O   1 
HETATM 3975 O  O   . HOH H 6 .   ? 22.994  45.203  68.619 1.00 30.04 ? 187 HOH A O   1 
HETATM 3976 O  O   . HOH H 6 .   ? 16.849  49.136  76.306 1.00 35.42 ? 188 HOH A O   1 
HETATM 3977 O  O   . HOH H 6 .   ? -9.447  47.329  46.036 1.00 36.71 ? 189 HOH A O   1 
HETATM 3978 O  O   . HOH H 6 .   ? -5.973  45.781  65.755 1.00 36.64 ? 194 HOH A O   1 
HETATM 3979 O  O   . HOH H 6 .   ? -2.287  49.166  71.326 1.00 38.16 ? 195 HOH A O   1 
HETATM 3980 O  O   . HOH H 6 .   ? 9.698   53.698  70.932 1.00 33.44 ? 197 HOH A O   1 
HETATM 3981 O  O   . HOH H 6 .   ? 5.243   25.253  57.566 1.00 28.98 ? 198 HOH A O   1 
HETATM 3982 O  O   . HOH H 6 .   ? -5.154  36.660  44.838 1.00 64.41 ? 201 HOH A O   1 
HETATM 3983 O  O   . HOH H 6 .   ? -5.037  52.649  67.837 1.00 36.14 ? 202 HOH A O   1 
HETATM 3984 O  O   . HOH H 6 .   ? -5.963  41.275  67.588 1.00 52.90 ? 203 HOH A O   1 
HETATM 3985 O  O   . HOH H 6 .   ? 9.513   62.475  52.736 1.00 24.17 ? 204 HOH A O   1 
HETATM 3986 O  O   . HOH H 6 .   ? -1.483  36.664  67.859 1.00 34.02 ? 205 HOH A O   1 
HETATM 3987 O  O   . HOH H 6 .   ? 31.304  48.075  62.991 1.00 17.91 ? 207 HOH A O   1 
HETATM 3988 O  O   . HOH H 6 .   ? -0.409  41.481  60.748 1.00 18.22 ? 597 HOH A O   1 
HETATM 3989 O  O   . HOH I 6 .   ? 16.716  8.667   63.148 1.00 21.86 ? 8   HOH B O   1 
HETATM 3990 O  O   . HOH I 6 .   ? 10.851  34.443  67.711 1.00 16.32 ? 9   HOH B O   1 
HETATM 3991 O  O   . HOH I 6 .   ? 18.069  29.510  68.332 1.00 15.81 ? 11  HOH B O   1 
HETATM 3992 O  O   . HOH I 6 .   ? 8.376   19.236  62.690 1.00 12.64 ? 15  HOH B O   1 
HETATM 3993 O  O   . HOH I 6 .   ? 8.271   21.711  59.258 1.00 14.98 ? 19  HOH B O   1 
HETATM 3994 O  O   . HOH I 6 .   ? 19.872  12.667  65.892 1.00 25.33 ? 26  HOH B O   1 
HETATM 3995 O  O   . HOH I 6 .   ? 24.601  29.639  73.553 1.00 13.58 ? 30  HOH B O   1 
HETATM 3996 O  O   . HOH I 6 .   ? 21.221  30.717  72.157 1.00 11.97 ? 32  HOH B O   1 
HETATM 3997 O  O   . HOH I 6 .   ? 22.921  19.193  66.336 1.00 19.29 ? 39  HOH B O   1 
HETATM 3998 O  O   . HOH I 6 .   ? 20.988  19.571  67.957 1.00 18.59 ? 40  HOH B O   1 
HETATM 3999 O  O   . HOH I 6 .   ? 28.059  10.114  71.293 1.00 17.93 ? 42  HOH B O   1 
HETATM 4000 O  O   . HOH I 6 .   ? 14.721  24.227  58.425 1.00 23.17 ? 54  HOH B O   1 
HETATM 4001 O  O   . HOH I 6 .   ? -4.968  13.078  80.345 1.00 25.71 ? 57  HOH B O   1 
HETATM 4002 O  O   . HOH I 6 .   ? -2.333  14.175  79.092 1.00 20.81 ? 58  HOH B O   1 
HETATM 4003 O  O   . HOH I 6 .   ? 12.945  30.480  68.373 1.00 26.96 ? 61  HOH B O   1 
HETATM 4004 O  O   . HOH I 6 .   ? 24.963  21.178  67.011 1.00 23.65 ? 63  HOH B O   1 
HETATM 4005 O  O   . HOH I 6 .   ? 26.900  21.999  68.660 1.00 23.73 ? 65  HOH B O   1 
HETATM 4006 O  O   . HOH I 6 .   ? 1.921   13.820  55.645 1.00 25.47 ? 68  HOH B O   1 
HETATM 4007 O  O   . HOH I 6 .   ? 1.278   24.735  78.694 1.00 21.70 ? 71  HOH B O   1 
HETATM 4008 O  O   . HOH I 6 .   ? 12.092  32.267  71.728 1.00 19.52 ? 73  HOH B O   1 
HETATM 4009 O  O   . HOH I 6 .   ? 19.255  20.916  61.742 1.00 29.86 ? 79  HOH B O   1 
HETATM 4010 O  O   . HOH I 6 .   ? 26.502  27.201  76.935 1.00 30.86 ? 80  HOH B O   1 
HETATM 4011 O  O   . HOH I 6 .   ? 6.292   18.865  66.079 1.00 36.22 ? 81  HOH B O   1 
HETATM 4012 O  O   . HOH I 6 .   ? 32.608  2.990   74.305 1.00 18.84 ? 83  HOH B O   1 
HETATM 4013 O  O   . HOH I 6 .   ? 19.659  7.391   60.475 1.00 37.91 ? 87  HOH B O   1 
HETATM 4014 O  O   . HOH I 6 .   ? 4.301   32.353  66.923 1.00 27.00 ? 90  HOH B O   1 
HETATM 4015 O  O   . HOH I 6 .   ? 28.585  22.567  66.374 1.00 25.06 ? 102 HOH B O   1 
HETATM 4016 O  O   . HOH I 6 .   ? 13.407  22.367  54.228 1.00 29.60 ? 103 HOH B O   1 
HETATM 4017 O  O   . HOH I 6 .   ? 18.704  7.119   62.617 1.00 31.01 ? 104 HOH B O   1 
HETATM 4018 O  O   . HOH I 6 .   ? 0.703   19.513  62.724 1.00 49.58 ? 120 HOH B O   1 
HETATM 4019 O  O   . HOH I 6 .   ? -0.235  20.264  65.919 1.00 43.87 ? 121 HOH B O   1 
HETATM 4020 O  O   . HOH I 6 .   ? 15.438  1.233   49.068 1.00 22.31 ? 132 HOH B O   1 
HETATM 4021 O  O   . HOH I 6 .   ? 16.171  -5.729  56.073 1.00 10.76 ? 139 HOH B O   1 
HETATM 4022 O  O   . HOH I 6 .   ? 10.445  12.774  53.877 1.00 25.13 ? 141 HOH B O   1 
HETATM 4023 O  O   . HOH I 6 .   ? 16.510  29.404  79.037 1.00 35.03 ? 144 HOH B O   1 
HETATM 4024 O  O   . HOH I 6 .   ? 21.290  19.114  61.766 1.00 33.95 ? 145 HOH B O   1 
HETATM 4025 O  O   . HOH I 6 .   ? 22.983  19.469  63.408 1.00 34.77 ? 146 HOH B O   1 
HETATM 4026 O  O   . HOH I 6 .   ? 25.099  5.811   66.199 1.00 33.41 ? 152 HOH B O   1 
HETATM 4027 O  O   . HOH I 6 .   ? 23.379  0.760   60.984 1.00 34.74 ? 156 HOH B O   1 
HETATM 4028 O  O   . HOH I 6 .   ? 32.413  4.519   65.900 1.00 49.40 ? 157 HOH B O   1 
HETATM 4029 O  O   . HOH I 6 .   ? 10.324  3.227   77.450 1.00 35.77 ? 158 HOH B O   1 
HETATM 4030 O  O   . HOH I 6 .   ? 28.107  17.346  63.210 1.00 33.00 ? 162 HOH B O   1 
HETATM 4031 O  O   . HOH I 6 .   ? 5.237   17.129  53.734 1.00 48.71 ? 163 HOH B O   1 
HETATM 4032 O  O   . HOH I 6 .   ? 5.098   2.103   64.793 1.00 25.67 ? 164 HOH B O   1 
HETATM 4033 O  O   . HOH I 6 .   ? 22.054  25.779  62.681 1.00 42.14 ? 165 HOH B O   1 
HETATM 4034 O  O   . HOH I 6 .   ? 6.351   -3.385  69.718 1.00 27.40 ? 166 HOH B O   1 
HETATM 4035 O  O   . HOH I 6 .   ? 5.315   27.833  73.539 1.00 32.27 ? 173 HOH B O   1 
HETATM 4036 O  O   . HOH I 6 .   ? -2.684  11.115  73.069 1.00 48.82 ? 175 HOH B O   1 
HETATM 4037 O  O   . HOH I 6 .   ? 21.109  23.921  60.825 1.00 44.27 ? 177 HOH B O   1 
HETATM 4038 O  O   . HOH I 6 .   ? -3.329  16.686  84.171 1.00 39.71 ? 178 HOH B O   1 
HETATM 4039 O  O   . HOH I 6 .   ? 6.503   19.056  94.991 1.00 22.78 ? 180 HOH B O   1 
HETATM 4040 O  O   . HOH I 6 .   ? 25.946  29.118  84.751 1.00 41.11 ? 185 HOH B O   1 
HETATM 4041 O  O   . HOH I 6 .   ? -1.945  5.179   61.045 1.00 29.52 ? 190 HOH B O   1 
HETATM 4042 O  O   . HOH I 6 .   ? 15.321  2.946   81.065 1.00 26.05 ? 191 HOH B O   1 
HETATM 4043 O  O   . HOH I 6 .   ? 17.777  15.213  58.124 1.00 36.10 ? 192 HOH B O   1 
HETATM 4044 O  O   . HOH I 6 .   ? 2.013   9.034   74.010 1.00 29.28 ? 193 HOH B O   1 
HETATM 4045 O  O   . HOH I 6 .   ? 13.166  13.237  81.693 1.00 32.70 ? 196 HOH B O   1 
HETATM 4046 O  O   . HOH I 6 .   ? 37.031  31.109  71.706 1.00 29.92 ? 200 HOH B O   1 
HETATM 4047 O  O   . HOH I 6 .   ? 1.978   30.642  73.775 1.00 34.27 ? 208 HOH B O   1 
HETATM 4048 O  O   . HOH I 6 .   ? 2.927   27.999  69.521 1.00 46.96 ? 209 HOH B O   1 
HETATM 4049 O  O   . HOH I 6 .   ? 7.532   19.304  56.614 1.00 27.10 ? 210 HOH B O   1 
HETATM 4050 O  O   . HOH I 6 .   ? 6.113   18.455  61.564 1.00 28.16 ? 211 HOH B O   1 
HETATM 4051 O  O   . HOH I 6 .   ? 4.107   2.887   77.957 1.00 18.79 ? 212 HOH B O   1 
HETATM 4052 O  O   . HOH I 6 .   ? 25.314  29.605  76.023 1.00 32.37 ? 213 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   337 ?   ?   ?   A . n 
A 1 2   MET 2   338 ?   ?   ?   A . n 
A 1 3   ARG 3   339 ?   ?   ?   A . n 
A 1 4   PRO 4   340 ?   ?   ?   A . n 
A 1 5   GLN 5   341 ?   ?   ?   A . n 
A 1 6   PRO 6   342 ?   ?   ?   A . n 
A 1 7   GLY 7   343 ?   ?   ?   A . n 
A 1 8   ASP 8   344 ?   ?   ?   A . n 
A 1 9   GLY 9   345 ?   ?   ?   A . n 
A 1 10  GLU 10  346 346 GLU GLU A . n 
A 1 11  ARG 11  347 347 ARG ARG A . n 
A 1 12  ARG 12  348 348 ARG ARG A . n 
A 1 13  TYR 13  349 349 TYR TYR A . n 
A 1 14  ARG 14  350 350 ARG ARG A . n 
A 1 15  GLU 15  351 351 GLU GLU A . n 
A 1 16  ALA 16  352 352 ALA ALA A . n 
A 1 17  SER 17  353 353 SER SER A . n 
A 1 18  ALA 18  354 354 ALA ALA A . n 
A 1 19  ARG 19  355 355 ARG ARG A . n 
A 1 20  LYS 20  356 356 LYS LYS A . n 
A 1 21  LYS 21  357 357 LYS LYS A . n 
A 1 22  ILE 22  358 358 ILE ILE A . n 
A 1 23  ARG 23  359 359 ARG ARG A . n 
A 1 24  LEU 24  360 360 LEU LEU A . n 
A 1 25  ASP 25  361 361 ASP ASP A . n 
A 1 26  ARG 26  362 362 ARG ARG A . n 
A 1 27  LYS 27  363 363 LYS LYS A . n 
A 1 28  TYR 28  364 364 TYR TYR A . n 
A 1 29  ILE 29  365 365 ILE ILE A . n 
A 1 30  VAL 30  366 366 VAL VAL A . n 
A 1 31  SER 31  367 367 SER SER A . n 
A 1 32  CYS 32  368 368 CYS CYS A . n 
A 1 33  LYS 33  369 369 LYS LYS A . n 
A 1 34  GLN 34  370 370 GLN GLN A . n 
A 1 35  THR 35  371 371 THR THR A . n 
A 1 36  GLU 36  372 372 GLU GLU A . n 
A 1 37  VAL 37  373 373 VAL VAL A . n 
A 1 38  PRO 38  374 374 PRO PRO A . n 
A 1 39  LEU 39  375 375 LEU LEU A . n 
A 1 40  SER 40  376 376 SER SER A . n 
A 1 41  VAL 41  377 377 VAL VAL A . n 
A 1 42  PRO 42  378 378 PRO PRO A . n 
A 1 43  TRP 43  379 379 TRP TRP A . n 
A 1 44  ASP 44  380 380 ASP ASP A . n 
A 1 45  PRO 45  381 381 PRO PRO A . n 
A 1 46  SER 46  382 382 SER SER A . n 
A 1 47  ASN 47  383 383 ASN ASN A . n 
A 1 48  GLN 48  384 384 GLN GLN A . n 
A 1 49  VAL 49  385 385 VAL VAL A . n 
A 1 50  TYR 50  386 386 TYR TYR A . n 
A 1 51  LEU 51  387 387 LEU LEU A . n 
A 1 52  SER 52  388 388 SER SER A . n 
A 1 53  TYR 53  389 389 TYR TYR A . n 
A 1 54  ASN 54  390 390 ASN ASN A . n 
A 1 55  ASN 55  391 391 ASN ASN A . n 
A 1 56  VAL 56  392 392 VAL VAL A . n 
A 1 57  SER 57  393 393 SER SER A . n 
A 1 58  SER 58  394 394 SER SER A . n 
A 1 59  LEU 59  395 395 LEU LEU A . n 
A 1 60  LYS 60  396 396 LYS LYS A . n 
A 1 61  MET 61  397 397 MET MET A . n 
A 1 62  LEU 62  398 398 LEU LEU A . n 
A 1 63  VAL 63  399 399 VAL VAL A . n 
A 1 64  ALA 64  400 400 ALA ALA A . n 
A 1 65  LYS 65  401 401 LYS LYS A . n 
A 1 66  ASP 66  402 402 ASP ASP A . n 
A 1 67  ASN 67  403 403 ASN ASN A . n 
A 1 68  TRP 68  404 404 TRP TRP A . n 
A 1 69  VAL 69  405 405 VAL VAL A . n 
A 1 70  LEU 70  406 406 LEU LEU A . n 
A 1 71  SER 71  407 407 SER SER A . n 
A 1 72  SER 72  408 408 SER SER A . n 
A 1 73  GLU 73  409 409 GLU GLU A . n 
A 1 74  ILE 74  410 410 ILE ILE A . n 
A 1 75  SER 75  411 411 SER SER A . n 
A 1 76  GLN 76  412 412 GLN GLN A . n 
A 1 77  VAL 77  413 413 VAL VAL A . n 
A 1 78  ARG 78  414 414 ARG ARG A . n 
A 1 79  LEU 79  415 415 LEU LEU A . n 
A 1 80  TYR 80  416 416 TYR TYR A . n 
A 1 81  THR 81  417 417 THR THR A . n 
A 1 82  LEU 82  418 418 LEU LEU A . n 
A 1 83  GLU 83  419 419 GLU GLU A . n 
A 1 84  ASP 84  420 420 ASP ASP A . n 
A 1 85  ASP 85  421 421 ASP ASP A . n 
A 1 86  LYS 86  422 422 LYS LYS A . n 
A 1 87  PHE 87  423 423 PHE PHE A . n 
A 1 88  LEU 88  424 424 LEU LEU A . n 
A 1 89  SER 89  425 425 SER SER A . n 
A 1 90  PHE 90  426 426 PHE PHE A . n 
A 1 91  HIS 91  427 427 HIS HIS A . n 
A 1 92  MET 92  428 428 MET MET A . n 
A 1 93  GLU 93  429 429 GLU GLU A . n 
A 1 94  MET 94  430 430 MET MET A . n 
A 1 95  VAL 95  431 431 VAL VAL A . n 
A 1 96  VAL 96  432 432 VAL VAL A . n 
A 1 97  HIS 97  433 433 HIS HIS A . n 
A 1 98  VAL 98  434 434 VAL VAL A . n 
A 1 99  ASP 99  435 435 ASP ASP A . n 
A 1 100 ALA 100 436 436 ALA ALA A . n 
A 1 101 ALA 101 437 437 ALA ALA A . n 
A 1 102 GLN 102 438 438 GLN GLN A . n 
A 1 103 ALA 103 439 439 ALA ALA A . n 
A 1 104 PHE 104 440 440 PHE PHE A . n 
A 1 105 LEU 105 441 441 LEU LEU A . n 
A 1 106 LEU 106 442 442 LEU LEU A . n 
A 1 107 LEU 107 443 443 LEU LEU A . n 
A 1 108 SER 108 444 444 SER SER A . n 
A 1 109 ASP 109 445 445 ASP ASP A . n 
A 1 110 LEU 110 446 446 LEU LEU A . n 
A 1 111 ARG 111 447 447 ARG ARG A . n 
A 1 112 GLN 112 448 448 GLN GLN A . n 
A 1 113 ARG 113 449 449 ARG ARG A . n 
A 1 114 PRO 114 450 450 PRO PRO A . n 
A 1 115 GLU 115 451 451 GLU GLU A . n 
A 1 116 TRP 116 452 452 TRP TRP A . n 
A 1 117 ASP 117 453 453 ASP ASP A . n 
A 1 118 LYS 118 454 454 LYS LYS A . n 
A 1 119 HIS 119 455 455 HIS HIS A . n 
A 1 120 TYR 120 456 456 TYR TYR A . n 
A 1 121 ARG 121 457 457 ARG ARG A . n 
A 1 122 SER 122 458 458 SER SER A . n 
A 1 123 VAL 123 459 459 VAL VAL A . n 
A 1 124 GLU 124 460 460 GLU GLU A . n 
A 1 125 LEU 125 461 461 LEU LEU A . n 
A 1 126 VAL 126 462 462 VAL VAL A . n 
A 1 127 GLN 127 463 463 GLN GLN A . n 
A 1 128 GLN 128 464 464 GLN GLN A . n 
A 1 129 VAL 129 465 465 VAL VAL A . n 
A 1 130 ASP 130 466 466 ASP ASP A . n 
A 1 131 GLU 131 467 467 GLU GLU A . n 
A 1 132 ASP 132 468 468 ASP ASP A . n 
A 1 133 ASP 133 469 469 ASP ASP A . n 
A 1 134 ALA 134 470 470 ALA ALA A . n 
A 1 135 ILE 135 471 471 ILE ILE A . n 
A 1 136 TYR 136 472 472 TYR TYR A . n 
A 1 137 HIS 137 473 473 HIS HIS A . n 
A 1 138 VAL 138 474 474 VAL VAL A . n 
A 1 139 THR 139 475 475 THR THR A . n 
A 1 140 SER 140 476 476 SER SER A . n 
A 1 141 PRO 141 477 477 PRO PRO A . n 
A 1 142 ALA 142 478 478 ALA ALA A . n 
A 1 143 LEU 143 479 479 LEU LEU A . n 
A 1 144 GLY 144 480 480 GLY GLY A . n 
A 1 145 GLY 145 481 481 GLY GLY A . n 
A 1 146 HIS 146 482 482 HIS HIS A . n 
A 1 147 THR 147 483 483 THR THR A . n 
A 1 148 LYS 148 484 484 LYS LYS A . n 
A 1 149 PRO 149 485 485 PRO PRO A . n 
A 1 150 GLN 150 486 486 GLN GLN A . n 
A 1 151 ASP 151 487 487 ASP ASP A . n 
A 1 152 PHE 152 488 488 PHE PHE A . n 
A 1 153 VAL 153 489 489 VAL VAL A . n 
A 1 154 ILE 154 490 490 ILE ILE A . n 
A 1 155 LEU 155 491 491 LEU LEU A . n 
A 1 156 ALA 156 492 492 ALA ALA A . n 
A 1 157 SER 157 493 493 SER SER A . n 
A 1 158 ARG 158 494 494 ARG ARG A . n 
A 1 159 ARG 159 495 495 ARG ARG A . n 
A 1 160 LYS 160 496 496 LYS LYS A . n 
A 1 161 PRO 161 497 497 PRO PRO A . n 
A 1 162 CYS 162 498 498 CYS CYS A . n 
A 1 163 ASP 163 499 499 ASP ASP A . n 
A 1 164 ASN 164 500 500 ASN ASN A . n 
A 1 165 GLY 165 501 501 GLY GLY A . n 
A 1 166 ASP 166 502 502 ASP ASP A . n 
A 1 167 PRO 167 503 503 PRO PRO A . n 
A 1 168 TYR 168 504 504 TYR TYR A . n 
A 1 169 VAL 169 505 505 VAL VAL A . n 
A 1 170 ILE 170 506 506 ILE ILE A . n 
A 1 171 ALA 171 507 507 ALA ALA A . n 
A 1 172 LEU 172 508 508 LEU LEU A . n 
A 1 173 ARG 173 509 509 ARG ARG A . n 
A 1 174 SER 174 510 510 SER SER A . n 
A 1 175 VAL 175 511 511 VAL VAL A . n 
A 1 176 THR 176 512 512 THR THR A . n 
A 1 177 LEU 177 513 513 LEU LEU A . n 
A 1 178 PRO 178 514 514 PRO PRO A . n 
A 1 179 THR 179 515 515 THR THR A . n 
A 1 180 HIS 180 516 516 HIS HIS A . n 
A 1 181 ARG 181 517 517 ARG ARG A . n 
A 1 182 GLU 182 518 518 GLU GLU A . n 
A 1 183 THR 183 519 519 THR THR A . n 
A 1 184 PRO 184 520 520 PRO PRO A . n 
A 1 185 GLU 185 521 521 GLU GLU A . n 
A 1 186 TYR 186 522 522 TYR TYR A . n 
A 1 187 ARG 187 523 523 ARG ARG A . n 
A 1 188 ARG 188 524 524 ARG ARG A . n 
A 1 189 GLY 189 525 525 GLY GLY A . n 
A 1 190 GLU 190 526 526 GLU GLU A . n 
A 1 191 THR 191 527 527 THR THR A . n 
A 1 192 LEU 192 528 528 LEU LEU A . n 
A 1 193 CYS 193 529 529 CYS CYS A . n 
A 1 194 SER 194 530 530 SER SER A . n 
A 1 195 GLY 195 531 531 GLY GLY A . n 
A 1 196 PHE 196 532 532 PHE PHE A . n 
A 1 197 CYS 197 533 533 CYS CYS A . n 
A 1 198 LEU 198 534 534 LEU LEU A . n 
A 1 199 TRP 199 535 535 TRP TRP A . n 
A 1 200 ARG 200 536 536 ARG ARG A . n 
A 1 201 GLU 201 537 537 GLU GLU A . n 
A 1 202 GLY 202 538 538 GLY GLY A . n 
A 1 203 ASP 203 539 539 ASP ASP A . n 
A 1 204 GLN 204 540 540 GLN GLN A . n 
A 1 205 LEU 205 541 541 LEU LEU A . n 
A 1 206 THR 206 542 542 THR THR A . n 
A 1 207 LYS 207 543 543 LYS LYS A . n 
A 1 208 VAL 208 544 544 VAL VAL A . n 
A 1 209 SER 209 545 545 SER SER A . n 
A 1 210 TYR 210 546 546 TYR TYR A . n 
A 1 211 TYR 211 547 547 TYR TYR A . n 
A 1 212 ASN 212 548 548 ASN ASN A . n 
A 1 213 GLN 213 549 549 GLN GLN A . n 
A 1 214 ALA 214 550 550 ALA ALA A . n 
A 1 215 THR 215 551 551 THR THR A . n 
A 1 216 PRO 216 552 552 PRO PRO A . n 
A 1 217 GLY 217 553 553 GLY GLY A . n 
A 1 218 VAL 218 554 554 VAL VAL A . n 
A 1 219 LEU 219 555 555 LEU LEU A . n 
A 1 220 ASN 220 556 556 ASN ASN A . n 
A 1 221 TYR 221 557 557 TYR TYR A . n 
A 1 222 VAL 222 558 558 VAL VAL A . n 
A 1 223 THR 223 559 559 THR THR A . n 
A 1 224 THR 224 560 560 THR THR A . n 
A 1 225 ASN 225 561 561 ASN ASN A . n 
A 1 226 VAL 226 562 562 VAL VAL A . n 
A 1 227 ALA 227 563 563 ALA ALA A . n 
A 1 228 GLY 228 564 564 GLY GLY A . n 
A 1 229 LEU 229 565 565 LEU LEU A . n 
A 1 230 SER 230 566 566 SER SER A . n 
A 1 231 SER 231 567 567 SER SER A . n 
A 1 232 GLU 232 568 568 GLU GLU A . n 
A 1 233 PHE 233 569 569 PHE PHE A . n 
A 1 234 TYR 234 570 570 TYR TYR A . n 
A 1 235 THR 235 571 571 THR THR A . n 
A 1 236 THR 236 572 572 THR THR A . n 
A 1 237 PHE 237 573 573 PHE PHE A . n 
A 1 238 LYS 238 574 574 LYS LYS A . n 
A 1 239 ALA 239 575 575 ALA ALA A . n 
A 1 240 CYS 240 576 576 CYS CYS A . n 
A 1 241 GLU 241 577 577 GLU GLU A . n 
A 1 242 GLN 242 578 578 GLN GLN A . n 
A 1 243 PHE 243 579 579 PHE PHE A . n 
A 1 244 LEU 244 580 580 LEU LEU A . n 
A 1 245 LEU 245 581 581 LEU LEU A . n 
A 1 246 ASP 246 582 582 ASP ASP A . n 
A 1 247 ASN 247 583 583 ASN ASN A . n 
A 1 248 ARG 248 584 584 ARG ARG A . n 
A 1 249 ASN 249 585 ?   ?   ?   A . n 
A 1 250 ASP 250 586 ?   ?   ?   A . n 
A 1 251 LEU 251 587 ?   ?   ?   A . n 
A 1 252 ALA 252 588 ?   ?   ?   A . n 
A 1 253 PRO 253 589 ?   ?   ?   A . n 
A 1 254 SER 254 590 ?   ?   ?   A . n 
A 1 255 LEU 255 591 ?   ?   ?   A . n 
A 1 256 GLN 256 592 ?   ?   ?   A . n 
A 1 257 THR 257 593 ?   ?   ?   A . n 
A 1 258 LEU 258 594 ?   ?   ?   A . n 
B 1 1   SER 1   337 ?   ?   ?   B . n 
B 1 2   MET 2   338 ?   ?   ?   B . n 
B 1 3   ARG 3   339 ?   ?   ?   B . n 
B 1 4   PRO 4   340 ?   ?   ?   B . n 
B 1 5   GLN 5   341 ?   ?   ?   B . n 
B 1 6   PRO 6   342 ?   ?   ?   B . n 
B 1 7   GLY 7   343 ?   ?   ?   B . n 
B 1 8   ASP 8   344 ?   ?   ?   B . n 
B 1 9   GLY 9   345 ?   ?   ?   B . n 
B 1 10  GLU 10  346 ?   ?   ?   B . n 
B 1 11  ARG 11  347 ?   ?   ?   B . n 
B 1 12  ARG 12  348 ?   ?   ?   B . n 
B 1 13  TYR 13  349 ?   ?   ?   B . n 
B 1 14  ARG 14  350 ?   ?   ?   B . n 
B 1 15  GLU 15  351 ?   ?   ?   B . n 
B 1 16  ALA 16  352 352 ALA ALA B . n 
B 1 17  SER 17  353 353 SER SER B . n 
B 1 18  ALA 18  354 354 ALA ALA B . n 
B 1 19  ARG 19  355 355 ARG ARG B . n 
B 1 20  LYS 20  356 356 LYS LYS B . n 
B 1 21  LYS 21  357 357 LYS LYS B . n 
B 1 22  ILE 22  358 358 ILE ILE B . n 
B 1 23  ARG 23  359 359 ARG ARG B . n 
B 1 24  LEU 24  360 360 LEU LEU B . n 
B 1 25  ASP 25  361 361 ASP ASP B . n 
B 1 26  ARG 26  362 362 ARG ARG B . n 
B 1 27  LYS 27  363 363 LYS LYS B . n 
B 1 28  TYR 28  364 364 TYR TYR B . n 
B 1 29  ILE 29  365 365 ILE ILE B . n 
B 1 30  VAL 30  366 366 VAL VAL B . n 
B 1 31  SER 31  367 ?   ?   ?   B . n 
B 1 32  CYS 32  368 ?   ?   ?   B . n 
B 1 33  LYS 33  369 ?   ?   ?   B . n 
B 1 34  GLN 34  370 ?   ?   ?   B . n 
B 1 35  THR 35  371 ?   ?   ?   B . n 
B 1 36  GLU 36  372 ?   ?   ?   B . n 
B 1 37  VAL 37  373 ?   ?   ?   B . n 
B 1 38  PRO 38  374 ?   ?   ?   B . n 
B 1 39  LEU 39  375 375 LEU LEU B . n 
B 1 40  SER 40  376 376 SER SER B . n 
B 1 41  VAL 41  377 377 VAL VAL B . n 
B 1 42  PRO 42  378 378 PRO PRO B . n 
B 1 43  TRP 43  379 379 TRP TRP B . n 
B 1 44  ASP 44  380 380 ASP ASP B . n 
B 1 45  PRO 45  381 381 PRO PRO B . n 
B 1 46  SER 46  382 382 SER SER B . n 
B 1 47  ASN 47  383 383 ASN ASN B . n 
B 1 48  GLN 48  384 384 GLN GLN B . n 
B 1 49  VAL 49  385 385 VAL VAL B . n 
B 1 50  TYR 50  386 386 TYR TYR B . n 
B 1 51  LEU 51  387 387 LEU LEU B . n 
B 1 52  SER 52  388 388 SER SER B . n 
B 1 53  TYR 53  389 389 TYR TYR B . n 
B 1 54  ASN 54  390 390 ASN ASN B . n 
B 1 55  ASN 55  391 391 ASN ASN B . n 
B 1 56  VAL 56  392 392 VAL VAL B . n 
B 1 57  SER 57  393 393 SER SER B . n 
B 1 58  SER 58  394 394 SER SER B . n 
B 1 59  LEU 59  395 395 LEU LEU B . n 
B 1 60  LYS 60  396 396 LYS LYS B . n 
B 1 61  MET 61  397 397 MET MET B . n 
B 1 62  LEU 62  398 398 LEU LEU B . n 
B 1 63  VAL 63  399 399 VAL VAL B . n 
B 1 64  ALA 64  400 400 ALA ALA B . n 
B 1 65  LYS 65  401 401 LYS LYS B . n 
B 1 66  ASP 66  402 402 ASP ASP B . n 
B 1 67  ASN 67  403 403 ASN ASN B . n 
B 1 68  TRP 68  404 404 TRP TRP B . n 
B 1 69  VAL 69  405 405 VAL VAL B . n 
B 1 70  LEU 70  406 406 LEU LEU B . n 
B 1 71  SER 71  407 407 SER SER B . n 
B 1 72  SER 72  408 408 SER SER B . n 
B 1 73  GLU 73  409 409 GLU GLU B . n 
B 1 74  ILE 74  410 410 ILE ILE B . n 
B 1 75  SER 75  411 411 SER SER B . n 
B 1 76  GLN 76  412 412 GLN GLN B . n 
B 1 77  VAL 77  413 413 VAL VAL B . n 
B 1 78  ARG 78  414 414 ARG ARG B . n 
B 1 79  LEU 79  415 415 LEU LEU B . n 
B 1 80  TYR 80  416 416 TYR TYR B . n 
B 1 81  THR 81  417 417 THR THR B . n 
B 1 82  LEU 82  418 418 LEU LEU B . n 
B 1 83  GLU 83  419 419 GLU GLU B . n 
B 1 84  ASP 84  420 420 ASP ASP B . n 
B 1 85  ASP 85  421 421 ASP ASP B . n 
B 1 86  LYS 86  422 422 LYS LYS B . n 
B 1 87  PHE 87  423 423 PHE PHE B . n 
B 1 88  LEU 88  424 424 LEU LEU B . n 
B 1 89  SER 89  425 425 SER SER B . n 
B 1 90  PHE 90  426 426 PHE PHE B . n 
B 1 91  HIS 91  427 427 HIS HIS B . n 
B 1 92  MET 92  428 428 MET MET B . n 
B 1 93  GLU 93  429 429 GLU GLU B . n 
B 1 94  MET 94  430 430 MET MET B . n 
B 1 95  VAL 95  431 431 VAL VAL B . n 
B 1 96  VAL 96  432 432 VAL VAL B . n 
B 1 97  HIS 97  433 433 HIS HIS B . n 
B 1 98  VAL 98  434 434 VAL VAL B . n 
B 1 99  ASP 99  435 435 ASP ASP B . n 
B 1 100 ALA 100 436 436 ALA ALA B . n 
B 1 101 ALA 101 437 437 ALA ALA B . n 
B 1 102 GLN 102 438 438 GLN GLN B . n 
B 1 103 ALA 103 439 439 ALA ALA B . n 
B 1 104 PHE 104 440 440 PHE PHE B . n 
B 1 105 LEU 105 441 441 LEU LEU B . n 
B 1 106 LEU 106 442 442 LEU LEU B . n 
B 1 107 LEU 107 443 443 LEU LEU B . n 
B 1 108 SER 108 444 444 SER SER B . n 
B 1 109 ASP 109 445 445 ASP ASP B . n 
B 1 110 LEU 110 446 446 LEU LEU B . n 
B 1 111 ARG 111 447 447 ARG ARG B . n 
B 1 112 GLN 112 448 448 GLN GLN B . n 
B 1 113 ARG 113 449 449 ARG ARG B . n 
B 1 114 PRO 114 450 450 PRO PRO B . n 
B 1 115 GLU 115 451 451 GLU GLU B . n 
B 1 116 TRP 116 452 452 TRP TRP B . n 
B 1 117 ASP 117 453 453 ASP ASP B . n 
B 1 118 LYS 118 454 454 LYS LYS B . n 
B 1 119 HIS 119 455 455 HIS HIS B . n 
B 1 120 TYR 120 456 456 TYR TYR B . n 
B 1 121 ARG 121 457 457 ARG ARG B . n 
B 1 122 SER 122 458 458 SER SER B . n 
B 1 123 VAL 123 459 459 VAL VAL B . n 
B 1 124 GLU 124 460 460 GLU GLU B . n 
B 1 125 LEU 125 461 461 LEU LEU B . n 
B 1 126 VAL 126 462 462 VAL VAL B . n 
B 1 127 GLN 127 463 463 GLN GLN B . n 
B 1 128 GLN 128 464 464 GLN GLN B . n 
B 1 129 VAL 129 465 465 VAL VAL B . n 
B 1 130 ASP 130 466 466 ASP ASP B . n 
B 1 131 GLU 131 467 467 GLU GLU B . n 
B 1 132 ASP 132 468 468 ASP ASP B . n 
B 1 133 ASP 133 469 469 ASP ASP B . n 
B 1 134 ALA 134 470 470 ALA ALA B . n 
B 1 135 ILE 135 471 471 ILE ILE B . n 
B 1 136 TYR 136 472 472 TYR TYR B . n 
B 1 137 HIS 137 473 473 HIS HIS B . n 
B 1 138 VAL 138 474 474 VAL VAL B . n 
B 1 139 THR 139 475 475 THR THR B . n 
B 1 140 SER 140 476 476 SER SER B . n 
B 1 141 PRO 141 477 477 PRO PRO B . n 
B 1 142 ALA 142 478 478 ALA ALA B . n 
B 1 143 LEU 143 479 479 LEU LEU B . n 
B 1 144 GLY 144 480 480 GLY GLY B . n 
B 1 145 GLY 145 481 481 GLY GLY B . n 
B 1 146 HIS 146 482 482 HIS HIS B . n 
B 1 147 THR 147 483 483 THR THR B . n 
B 1 148 LYS 148 484 484 LYS LYS B . n 
B 1 149 PRO 149 485 485 PRO PRO B . n 
B 1 150 GLN 150 486 486 GLN GLN B . n 
B 1 151 ASP 151 487 487 ASP ASP B . n 
B 1 152 PHE 152 488 488 PHE PHE B . n 
B 1 153 VAL 153 489 489 VAL VAL B . n 
B 1 154 ILE 154 490 490 ILE ILE B . n 
B 1 155 LEU 155 491 491 LEU LEU B . n 
B 1 156 ALA 156 492 492 ALA ALA B . n 
B 1 157 SER 157 493 493 SER SER B . n 
B 1 158 ARG 158 494 494 ARG ARG B . n 
B 1 159 ARG 159 495 495 ARG ARG B . n 
B 1 160 LYS 160 496 496 LYS LYS B . n 
B 1 161 PRO 161 497 497 PRO PRO B . n 
B 1 162 CYS 162 498 498 CYS CYS B . n 
B 1 163 ASP 163 499 499 ASP ASP B . n 
B 1 164 ASN 164 500 500 ASN ASN B . n 
B 1 165 GLY 165 501 501 GLY GLY B . n 
B 1 166 ASP 166 502 502 ASP ASP B . n 
B 1 167 PRO 167 503 503 PRO PRO B . n 
B 1 168 TYR 168 504 504 TYR TYR B . n 
B 1 169 VAL 169 505 505 VAL VAL B . n 
B 1 170 ILE 170 506 506 ILE ILE B . n 
B 1 171 ALA 171 507 507 ALA ALA B . n 
B 1 172 LEU 172 508 508 LEU LEU B . n 
B 1 173 ARG 173 509 509 ARG ARG B . n 
B 1 174 SER 174 510 510 SER SER B . n 
B 1 175 VAL 175 511 511 VAL VAL B . n 
B 1 176 THR 176 512 512 THR THR B . n 
B 1 177 LEU 177 513 513 LEU LEU B . n 
B 1 178 PRO 178 514 514 PRO PRO B . n 
B 1 179 THR 179 515 515 THR THR B . n 
B 1 180 HIS 180 516 516 HIS HIS B . n 
B 1 181 ARG 181 517 517 ARG ARG B . n 
B 1 182 GLU 182 518 518 GLU GLU B . n 
B 1 183 THR 183 519 519 THR THR B . n 
B 1 184 PRO 184 520 520 PRO PRO B . n 
B 1 185 GLU 185 521 521 GLU GLU B . n 
B 1 186 TYR 186 522 522 TYR TYR B . n 
B 1 187 ARG 187 523 523 ARG ARG B . n 
B 1 188 ARG 188 524 524 ARG ARG B . n 
B 1 189 GLY 189 525 525 GLY GLY B . n 
B 1 190 GLU 190 526 526 GLU GLU B . n 
B 1 191 THR 191 527 527 THR THR B . n 
B 1 192 LEU 192 528 528 LEU LEU B . n 
B 1 193 CYS 193 529 529 CYS CYS B . n 
B 1 194 SER 194 530 530 SER SER B . n 
B 1 195 GLY 195 531 531 GLY GLY B . n 
B 1 196 PHE 196 532 532 PHE PHE B . n 
B 1 197 CYS 197 533 533 CYS CYS B . n 
B 1 198 LEU 198 534 534 LEU LEU B . n 
B 1 199 TRP 199 535 535 TRP TRP B . n 
B 1 200 ARG 200 536 536 ARG ARG B . n 
B 1 201 GLU 201 537 537 GLU GLU B . n 
B 1 202 GLY 202 538 538 GLY GLY B . n 
B 1 203 ASP 203 539 539 ASP ASP B . n 
B 1 204 GLN 204 540 540 GLN GLN B . n 
B 1 205 LEU 205 541 541 LEU LEU B . n 
B 1 206 THR 206 542 542 THR THR B . n 
B 1 207 LYS 207 543 543 LYS LYS B . n 
B 1 208 VAL 208 544 544 VAL VAL B . n 
B 1 209 SER 209 545 545 SER SER B . n 
B 1 210 TYR 210 546 546 TYR TYR B . n 
B 1 211 TYR 211 547 547 TYR TYR B . n 
B 1 212 ASN 212 548 548 ASN ASN B . n 
B 1 213 GLN 213 549 549 GLN GLN B . n 
B 1 214 ALA 214 550 550 ALA ALA B . n 
B 1 215 THR 215 551 551 THR THR B . n 
B 1 216 PRO 216 552 552 PRO PRO B . n 
B 1 217 GLY 217 553 553 GLY GLY B . n 
B 1 218 VAL 218 554 554 VAL VAL B . n 
B 1 219 LEU 219 555 555 LEU LEU B . n 
B 1 220 ASN 220 556 556 ASN ASN B . n 
B 1 221 TYR 221 557 557 TYR TYR B . n 
B 1 222 VAL 222 558 558 VAL VAL B . n 
B 1 223 THR 223 559 559 THR THR B . n 
B 1 224 THR 224 560 560 THR THR B . n 
B 1 225 ASN 225 561 561 ASN ASN B . n 
B 1 226 VAL 226 562 562 VAL VAL B . n 
B 1 227 ALA 227 563 563 ALA ALA B . n 
B 1 228 GLY 228 564 564 GLY GLY B . n 
B 1 229 LEU 229 565 565 LEU LEU B . n 
B 1 230 SER 230 566 566 SER SER B . n 
B 1 231 SER 231 567 567 SER SER B . n 
B 1 232 GLU 232 568 568 GLU GLU B . n 
B 1 233 PHE 233 569 569 PHE PHE B . n 
B 1 234 TYR 234 570 570 TYR TYR B . n 
B 1 235 THR 235 571 571 THR THR B . n 
B 1 236 THR 236 572 572 THR THR B . n 
B 1 237 PHE 237 573 573 PHE PHE B . n 
B 1 238 LYS 238 574 574 LYS LYS B . n 
B 1 239 ALA 239 575 575 ALA ALA B . n 
B 1 240 CYS 240 576 576 CYS CYS B . n 
B 1 241 GLU 241 577 577 GLU GLU B . n 
B 1 242 GLN 242 578 578 GLN GLN B . n 
B 1 243 PHE 243 579 579 PHE PHE B . n 
B 1 244 LEU 244 580 580 LEU LEU B . n 
B 1 245 LEU 245 581 581 LEU LEU B . n 
B 1 246 ASP 246 582 582 ASP ASP B . n 
B 1 247 ASN 247 583 583 ASN ASN B . n 
B 1 248 ARG 248 584 584 ARG ARG B . n 
B 1 249 ASN 249 585 585 ASN ASN B . n 
B 1 250 ASP 250 586 586 ASP ASP B . n 
B 1 251 LEU 251 587 587 LEU LEU B . n 
B 1 252 ALA 252 588 588 ALA ALA B . n 
B 1 253 PRO 253 589 589 PRO PRO B . n 
B 1 254 SER 254 590 590 SER SER B . n 
B 1 255 LEU 255 591 591 LEU LEU B . n 
B 1 256 GLN 256 592 592 GLN GLN B . n 
B 1 257 THR 257 593 ?   ?   ?   B . n 
B 1 258 LEU 258 594 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3670  ? 
1 MORE         -29   ? 
1 'SSA (A^2)'  21810 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-02-24 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-09-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 10.1980 45.5900 57.4710 0.0283 0.1339 0.0888 -0.0025 0.0044  0.0138 1.5754 2.1844 1.5430 -0.8370 1.0724  -0.9240 
0.0248  0.1328 0.1690  0.1619 -0.1670 -0.2566 0.0328 0.1989 0.1422 'X-RAY DIFFRACTION' 
2 ? refined 15.8950 13.0760 71.5940 0.1972 0.0404 0.0834 0.0306  -0.0425 0.0137 1.5971 2.9757 1.4035 -0.0021 -0.2078 0.5390  
-0.0097 0.0675 -0.1559 0.4715 -0.1082 -0.1287 0.2630 0.0549 0.1179 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.pdbx_refine_id 
1 1 A 346 ? ? A 584 ? ? ? ? 'X-RAY DIFFRACTION' 
2 2 B 352 ? ? B 592 ? ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum  ? 1 
PHASER phasing           .        ? 2 
REFMAC refinement        5.5.0044 ? 3 
XDS    'data reduction'  .        ? 4 
XSCALE 'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O9 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   TCE 
_pdbx_validate_close_contact.auth_seq_id_1    596 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   B 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    207 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.07 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 529 ? ? -170.05 103.44 
2 1 ALA A 550 ? ? -166.21 109.58 
3 1 ASP B 499 ? ? -86.53  47.77  
4 1 CYS B 529 ? ? -163.84 106.86 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 346 ? CG  ? A GLU 10  CG  
2  1 Y 1 A GLU 346 ? CD  ? A GLU 10  CD  
3  1 Y 1 A GLU 346 ? OE1 ? A GLU 10  OE1 
4  1 Y 1 A GLU 346 ? OE2 ? A GLU 10  OE2 
5  1 Y 1 A ARG 347 ? NE  ? A ARG 11  NE  
6  1 Y 1 A ARG 347 ? CZ  ? A ARG 11  CZ  
7  1 Y 1 A ARG 347 ? NH1 ? A ARG 11  NH1 
8  1 Y 1 A ARG 347 ? NH2 ? A ARG 11  NH2 
9  1 Y 1 A ARG 348 ? CD  ? A ARG 12  CD  
10 1 Y 1 A ARG 348 ? NE  ? A ARG 12  NE  
11 1 Y 1 A ARG 348 ? CZ  ? A ARG 12  CZ  
12 1 Y 1 A ARG 348 ? NH1 ? A ARG 12  NH1 
13 1 Y 1 A ARG 348 ? NH2 ? A ARG 12  NH2 
14 1 Y 1 A LYS 454 ? CE  ? A LYS 118 CE  
15 1 Y 1 A LYS 454 ? NZ  ? A LYS 118 NZ  
16 1 Y 1 A LYS 574 ? CD  ? A LYS 238 CD  
17 1 Y 1 A LYS 574 ? CE  ? A LYS 238 CE  
18 1 Y 1 A LYS 574 ? NZ  ? A LYS 238 NZ  
19 1 Y 1 B LYS 574 ? CG  ? B LYS 238 CG  
20 1 Y 1 B LYS 574 ? CD  ? B LYS 238 CD  
21 1 Y 1 B LYS 574 ? CE  ? B LYS 238 CE  
22 1 Y 1 B LYS 574 ? NZ  ? B LYS 238 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 337 ? A SER 1   
2  1 Y 1 A MET 338 ? A MET 2   
3  1 Y 1 A ARG 339 ? A ARG 3   
4  1 Y 1 A PRO 340 ? A PRO 4   
5  1 Y 1 A GLN 341 ? A GLN 5   
6  1 Y 1 A PRO 342 ? A PRO 6   
7  1 Y 1 A GLY 343 ? A GLY 7   
8  1 Y 1 A ASP 344 ? A ASP 8   
9  1 Y 1 A GLY 345 ? A GLY 9   
10 1 Y 1 A ASN 585 ? A ASN 249 
11 1 Y 1 A ASP 586 ? A ASP 250 
12 1 Y 1 A LEU 587 ? A LEU 251 
13 1 Y 1 A ALA 588 ? A ALA 252 
14 1 Y 1 A PRO 589 ? A PRO 253 
15 1 Y 1 A SER 590 ? A SER 254 
16 1 Y 1 A LEU 591 ? A LEU 255 
17 1 Y 1 A GLN 592 ? A GLN 256 
18 1 Y 1 A THR 593 ? A THR 257 
19 1 Y 1 A LEU 594 ? A LEU 258 
20 1 Y 1 B SER 337 ? B SER 1   
21 1 Y 1 B MET 338 ? B MET 2   
22 1 Y 1 B ARG 339 ? B ARG 3   
23 1 Y 1 B PRO 340 ? B PRO 4   
24 1 Y 1 B GLN 341 ? B GLN 5   
25 1 Y 1 B PRO 342 ? B PRO 6   
26 1 Y 1 B GLY 343 ? B GLY 7   
27 1 Y 1 B ASP 344 ? B ASP 8   
28 1 Y 1 B GLY 345 ? B GLY 9   
29 1 Y 1 B GLU 346 ? B GLU 10  
30 1 Y 1 B ARG 347 ? B ARG 11  
31 1 Y 1 B ARG 348 ? B ARG 12  
32 1 Y 1 B TYR 349 ? B TYR 13  
33 1 Y 1 B ARG 350 ? B ARG 14  
34 1 Y 1 B GLU 351 ? B GLU 15  
35 1 Y 1 B SER 367 ? B SER 31  
36 1 Y 1 B CYS 368 ? B CYS 32  
37 1 Y 1 B LYS 369 ? B LYS 33  
38 1 Y 1 B GLN 370 ? B GLN 34  
39 1 Y 1 B THR 371 ? B THR 35  
40 1 Y 1 B GLU 372 ? B GLU 36  
41 1 Y 1 B VAL 373 ? B VAL 37  
42 1 Y 1 B PRO 374 ? B PRO 38  
43 1 Y 1 B THR 593 ? B THR 257 
44 1 Y 1 B LEU 594 ? B LEU 258 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PENTAETHYLENE GLYCOL'                     1PE 
3 'CHLORIDE ION'                             CL  
4 GLYCEROL                                   GOL 
5 
;3,3',3''-phosphanetriyltripropanoic acid
;
TCE 
6 water                                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 1PE 1   2   2   1PE 1PE A . 
D 3 CL  1   1   1   CL  CL  A . 
E 4 GOL 1   595 1   GOL GOL A . 
F 5 TCE 1   596 1   TCE DRG A . 
G 2 1PE 1   1   1   1PE 1PE B . 
H 6 HOH 1   3   3   HOH HOH A . 
H 6 HOH 2   4   4   HOH HOH A . 
H 6 HOH 3   5   5   HOH HOH A . 
H 6 HOH 4   6   6   HOH HOH A . 
H 6 HOH 5   12  12  HOH HOH A . 
H 6 HOH 6   13  13  HOH HOH A . 
H 6 HOH 7   14  14  HOH HOH A . 
H 6 HOH 8   17  17  HOH HOH A . 
H 6 HOH 9   20  20  HOH HOH A . 
H 6 HOH 10  22  22  HOH HOH A . 
H 6 HOH 11  23  23  HOH HOH A . 
H 6 HOH 12  24  24  HOH HOH A . 
H 6 HOH 13  25  25  HOH HOH A . 
H 6 HOH 14  27  27  HOH HOH A . 
H 6 HOH 15  28  28  HOH HOH A . 
H 6 HOH 16  29  29  HOH HOH A . 
H 6 HOH 17  31  31  HOH HOH A . 
H 6 HOH 18  34  34  HOH HOH A . 
H 6 HOH 19  36  36  HOH HOH A . 
H 6 HOH 20  37  37  HOH HOH A . 
H 6 HOH 21  38  38  HOH HOH A . 
H 6 HOH 22  41  41  HOH HOH A . 
H 6 HOH 23  43  43  HOH HOH A . 
H 6 HOH 24  46  46  HOH HOH A . 
H 6 HOH 25  47  47  HOH HOH A . 
H 6 HOH 26  48  48  HOH HOH A . 
H 6 HOH 27  49  49  HOH HOH A . 
H 6 HOH 28  50  50  HOH HOH A . 
H 6 HOH 29  51  51  HOH HOH A . 
H 6 HOH 30  52  52  HOH HOH A . 
H 6 HOH 31  55  55  HOH HOH A . 
H 6 HOH 32  60  60  HOH HOH A . 
H 6 HOH 33  62  62  HOH HOH A . 
H 6 HOH 34  66  66  HOH HOH A . 
H 6 HOH 35  67  67  HOH HOH A . 
H 6 HOH 36  72  72  HOH HOH A . 
H 6 HOH 37  74  74  HOH HOH A . 
H 6 HOH 38  76  76  HOH HOH A . 
H 6 HOH 39  77  77  HOH HOH A . 
H 6 HOH 40  78  78  HOH HOH A . 
H 6 HOH 41  82  82  HOH HOH A . 
H 6 HOH 42  85  85  HOH HOH A . 
H 6 HOH 43  88  88  HOH HOH A . 
H 6 HOH 44  89  89  HOH HOH A . 
H 6 HOH 45  95  95  HOH HOH A . 
H 6 HOH 46  96  96  HOH HOH A . 
H 6 HOH 47  97  97  HOH HOH A . 
H 6 HOH 48  99  99  HOH HOH A . 
H 6 HOH 49  101 101 HOH HOH A . 
H 6 HOH 50  111 111 HOH HOH A . 
H 6 HOH 51  115 115 HOH HOH A . 
H 6 HOH 52  116 116 HOH HOH A . 
H 6 HOH 53  117 117 HOH HOH A . 
H 6 HOH 54  118 118 HOH HOH A . 
H 6 HOH 55  119 119 HOH HOH A . 
H 6 HOH 56  122 122 HOH HOH A . 
H 6 HOH 57  124 124 HOH HOH A . 
H 6 HOH 58  125 125 HOH HOH A . 
H 6 HOH 59  126 126 HOH HOH A . 
H 6 HOH 60  129 129 HOH HOH A . 
H 6 HOH 61  130 130 HOH HOH A . 
H 6 HOH 62  131 131 HOH HOH A . 
H 6 HOH 63  133 133 HOH HOH A . 
H 6 HOH 64  136 136 HOH HOH A . 
H 6 HOH 65  137 137 HOH HOH A . 
H 6 HOH 66  138 138 HOH HOH A . 
H 6 HOH 67  140 140 HOH HOH A . 
H 6 HOH 68  142 142 HOH HOH A . 
H 6 HOH 69  147 147 HOH HOH A . 
H 6 HOH 70  148 148 HOH HOH A . 
H 6 HOH 71  149 149 HOH HOH A . 
H 6 HOH 72  150 150 HOH HOH A . 
H 6 HOH 73  151 151 HOH HOH A . 
H 6 HOH 74  153 153 HOH HOH A . 
H 6 HOH 75  154 154 HOH HOH A . 
H 6 HOH 76  155 155 HOH HOH A . 
H 6 HOH 77  159 159 HOH HOH A . 
H 6 HOH 78  160 160 HOH HOH A . 
H 6 HOH 79  161 161 HOH HOH A . 
H 6 HOH 80  167 167 HOH HOH A . 
H 6 HOH 81  171 171 HOH HOH A . 
H 6 HOH 82  172 172 HOH HOH A . 
H 6 HOH 83  174 174 HOH HOH A . 
H 6 HOH 84  176 176 HOH HOH A . 
H 6 HOH 85  179 179 HOH HOH A . 
H 6 HOH 86  181 181 HOH HOH A . 
H 6 HOH 87  182 182 HOH HOH A . 
H 6 HOH 88  183 183 HOH HOH A . 
H 6 HOH 89  184 184 HOH HOH A . 
H 6 HOH 90  186 186 HOH HOH A . 
H 6 HOH 91  187 187 HOH HOH A . 
H 6 HOH 92  188 188 HOH HOH A . 
H 6 HOH 93  189 189 HOH HOH A . 
H 6 HOH 94  194 194 HOH HOH A . 
H 6 HOH 95  195 195 HOH HOH A . 
H 6 HOH 96  197 197 HOH HOH A . 
H 6 HOH 97  198 198 HOH HOH A . 
H 6 HOH 98  201 201 HOH HOH A . 
H 6 HOH 99  202 202 HOH HOH A . 
H 6 HOH 100 203 203 HOH HOH A . 
H 6 HOH 101 204 204 HOH HOH A . 
H 6 HOH 102 205 205 HOH HOH A . 
H 6 HOH 103 207 207 HOH HOH A . 
H 6 HOH 104 597 1   HOH HOH A . 
I 6 HOH 1   8   8   HOH HOH B . 
I 6 HOH 2   9   9   HOH HOH B . 
I 6 HOH 3   11  11  HOH HOH B . 
I 6 HOH 4   15  15  HOH HOH B . 
I 6 HOH 5   19  19  HOH HOH B . 
I 6 HOH 6   26  26  HOH HOH B . 
I 6 HOH 7   30  30  HOH HOH B . 
I 6 HOH 8   32  32  HOH HOH B . 
I 6 HOH 9   39  39  HOH HOH B . 
I 6 HOH 10  40  40  HOH HOH B . 
I 6 HOH 11  42  42  HOH HOH B . 
I 6 HOH 12  54  54  HOH HOH B . 
I 6 HOH 13  57  57  HOH HOH B . 
I 6 HOH 14  58  58  HOH HOH B . 
I 6 HOH 15  61  61  HOH HOH B . 
I 6 HOH 16  63  63  HOH HOH B . 
I 6 HOH 17  65  65  HOH HOH B . 
I 6 HOH 18  68  68  HOH HOH B . 
I 6 HOH 19  71  71  HOH HOH B . 
I 6 HOH 20  73  73  HOH HOH B . 
I 6 HOH 21  79  79  HOH HOH B . 
I 6 HOH 22  80  80  HOH HOH B . 
I 6 HOH 23  81  81  HOH HOH B . 
I 6 HOH 24  83  83  HOH HOH B . 
I 6 HOH 25  87  87  HOH HOH B . 
I 6 HOH 26  90  90  HOH HOH B . 
I 6 HOH 27  102 102 HOH HOH B . 
I 6 HOH 28  103 103 HOH HOH B . 
I 6 HOH 29  104 104 HOH HOH B . 
I 6 HOH 30  120 120 HOH HOH B . 
I 6 HOH 31  121 121 HOH HOH B . 
I 6 HOH 32  132 132 HOH HOH B . 
I 6 HOH 33  139 139 HOH HOH B . 
I 6 HOH 34  141 141 HOH HOH B . 
I 6 HOH 35  144 144 HOH HOH B . 
I 6 HOH 36  145 145 HOH HOH B . 
I 6 HOH 37  146 146 HOH HOH B . 
I 6 HOH 38  152 152 HOH HOH B . 
I 6 HOH 39  156 156 HOH HOH B . 
I 6 HOH 40  157 157 HOH HOH B . 
I 6 HOH 41  158 158 HOH HOH B . 
I 6 HOH 42  162 162 HOH HOH B . 
I 6 HOH 43  163 163 HOH HOH B . 
I 6 HOH 44  164 164 HOH HOH B . 
I 6 HOH 45  165 165 HOH HOH B . 
I 6 HOH 46  166 166 HOH HOH B . 
I 6 HOH 47  173 173 HOH HOH B . 
I 6 HOH 48  175 175 HOH HOH B . 
I 6 HOH 49  177 177 HOH HOH B . 
I 6 HOH 50  178 178 HOH HOH B . 
I 6 HOH 51  180 180 HOH HOH B . 
I 6 HOH 52  185 185 HOH HOH B . 
I 6 HOH 53  190 190 HOH HOH B . 
I 6 HOH 54  191 191 HOH HOH B . 
I 6 HOH 55  192 192 HOH HOH B . 
I 6 HOH 56  193 193 HOH HOH B . 
I 6 HOH 57  196 196 HOH HOH B . 
I 6 HOH 58  200 200 HOH HOH B . 
I 6 HOH 59  208 208 HOH HOH B . 
I 6 HOH 60  209 209 HOH HOH B . 
I 6 HOH 61  210 210 HOH HOH B . 
I 6 HOH 62  211 211 HOH HOH B . 
I 6 HOH 63  212 212 HOH HOH B . 
I 6 HOH 64  213 213 HOH HOH B . 
#