data_3GG0
# 
_entry.id   3GG0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GG0         
RCSB  RCSB051812   
WWPDB D_1000051812 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3GFX 'Klebsiella pneumoniae BlrP1 pH 4.5 calcium/cy-diGMP complex'          unspecified 
PDB 3GFY 'Klebsiella pneumoniae BlrP1 with FMN and cyclic diGMP, no metal ions' unspecified 
PDB 3GFZ 'Klebsiella pneumoniae BlrP1 pH 6 manganese/cy-diGMP complex'          unspecified 
PDB 3GG1 'Klebsiella pneumoniae BlrP1 pH 8.0 calcium/cy-diGMP complex'          unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GG0 
_pdbx_database_status.recvd_initial_deposition_date   2009-02-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Barends, T.'     1  
'Hartmann, E.'    2  
'Griese, J.'      3  
'Beitlich, T.'    4  
'Kirienko, N.'    5  
'Ryjenkov, D.'    6  
'Reinstein, J.'   7  
'Shoeman, R.'     8  
'Gomelsky, M.'    9  
'Schlichting, I.' 10 
# 
_citation.id                        primary 
_citation.title                     'Structure and mechanism of a bacterial light-regulated cyclic nucleotide phosphodiesterase.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            459 
_citation.page_first                1015 
_citation.page_last                 1018 
_citation.year                      2009 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19536266 
_citation.pdbx_database_id_DOI      10.1038/nature07966 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Barends, T.R.'   1  
primary 'Hartmann, E.'    2  
primary 'Griese, J.J.'    3  
primary 'Beitlich, T.'    4  
primary 'Kirienko, N.V.'  5  
primary 'Ryjenkov, D.A.'  6  
primary 'Reinstein, J.'   7  
primary 'Shoeman, R.L.'   8  
primary 'Gomelsky, M.'    9  
primary 'Schlichting, I.' 10 
# 
_cell.entry_id           3GG0 
_cell.length_a           69.020 
_cell.length_b           96.890 
_cell.length_c           126.870 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3GG0 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Klebsiella pneumoniae BlrP1' 45934.836 2   ? ? ? ? 
2 non-polymer syn 
;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one)
;
690.411   2   ? ? ? ? 
3 non-polymer syn 'MANGANESE (II) ION' 54.938    4   ? ? ? ? 
4 non-polymer syn 'FLAVIN MONONUCLEOTIDE' 456.344   2   ? ? ? ? 
5 water       nat water 18.015    130 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ISEFGSSRMLTTLIYRSQVHPDRPPVDLDALVHRASSKNLPLGITGILLFNGLQFFQVLEGTEEALESLFSEIQSDPRHR
DVVELMRDYSAYRRFHGTGMRILDLRLFETDGALEEILRFSTFGVTEPVNDRMFRLLSAFIADGGRYCLPEPLQPSRWMM
MPASGTAAPQHLPGQPCQFALQAIVEPAKKRVSSFEALIRSPTGGSPVEMFAAIAAEDRYRFDLESKAYAFALAGQLPLG
KHQLAINLLPGSLYHHPDAVGWLMDSLLAAGLRPDQVLIEVTETEVITCFDQFRKVLKALRVAGMKLAIDDFGAGYSGLS
LLTRFQPDKIKVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVETLEEWCWLQSVGIRLFQGFLFSRPCLNGIG
EICWPVARQAMDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ISEFGSSRMLTTLIYRSQVHPDRPPVDLDALVHRASSKNLPLGITGILLFNGLQFFQVLEGTEEALESLFSEIQSDPRHR
DVVELMRDYSAYRRFHGTGMRILDLRLFETDGALEEILRFSTFGVTEPVNDRMFRLLSAFIADGGRYCLPEPLQPSRWMM
MPASGTAAPQHLPGQPCQFALQAIVEPAKKRVSSFEALIRSPTGGSPVEMFAAIAAEDRYRFDLESKAYAFALAGQLPLG
KHQLAINLLPGSLYHHPDAVGWLMDSLLAAGLRPDQVLIEVTETEVITCFDQFRKVLKALRVAGMKLAIDDFGAGYSGLS
LLTRFQPDKIKVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVETLEEWCWLQSVGIRLFQGFLFSRPCLNGIG
EICWPVARQAMDL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   SER n 
1 3   GLU n 
1 4   PHE n 
1 5   GLY n 
1 6   SER n 
1 7   SER n 
1 8   ARG n 
1 9   MET n 
1 10  LEU n 
1 11  THR n 
1 12  THR n 
1 13  LEU n 
1 14  ILE n 
1 15  TYR n 
1 16  ARG n 
1 17  SER n 
1 18  GLN n 
1 19  VAL n 
1 20  HIS n 
1 21  PRO n 
1 22  ASP n 
1 23  ARG n 
1 24  PRO n 
1 25  PRO n 
1 26  VAL n 
1 27  ASP n 
1 28  LEU n 
1 29  ASP n 
1 30  ALA n 
1 31  LEU n 
1 32  VAL n 
1 33  HIS n 
1 34  ARG n 
1 35  ALA n 
1 36  SER n 
1 37  SER n 
1 38  LYS n 
1 39  ASN n 
1 40  LEU n 
1 41  PRO n 
1 42  LEU n 
1 43  GLY n 
1 44  ILE n 
1 45  THR n 
1 46  GLY n 
1 47  ILE n 
1 48  LEU n 
1 49  LEU n 
1 50  PHE n 
1 51  ASN n 
1 52  GLY n 
1 53  LEU n 
1 54  GLN n 
1 55  PHE n 
1 56  PHE n 
1 57  GLN n 
1 58  VAL n 
1 59  LEU n 
1 60  GLU n 
1 61  GLY n 
1 62  THR n 
1 63  GLU n 
1 64  GLU n 
1 65  ALA n 
1 66  LEU n 
1 67  GLU n 
1 68  SER n 
1 69  LEU n 
1 70  PHE n 
1 71  SER n 
1 72  GLU n 
1 73  ILE n 
1 74  GLN n 
1 75  SER n 
1 76  ASP n 
1 77  PRO n 
1 78  ARG n 
1 79  HIS n 
1 80  ARG n 
1 81  ASP n 
1 82  VAL n 
1 83  VAL n 
1 84  GLU n 
1 85  LEU n 
1 86  MET n 
1 87  ARG n 
1 88  ASP n 
1 89  TYR n 
1 90  SER n 
1 91  ALA n 
1 92  TYR n 
1 93  ARG n 
1 94  ARG n 
1 95  PHE n 
1 96  HIS n 
1 97  GLY n 
1 98  THR n 
1 99  GLY n 
1 100 MET n 
1 101 ARG n 
1 102 ILE n 
1 103 LEU n 
1 104 ASP n 
1 105 LEU n 
1 106 ARG n 
1 107 LEU n 
1 108 PHE n 
1 109 GLU n 
1 110 THR n 
1 111 ASP n 
1 112 GLY n 
1 113 ALA n 
1 114 LEU n 
1 115 GLU n 
1 116 GLU n 
1 117 ILE n 
1 118 LEU n 
1 119 ARG n 
1 120 PHE n 
1 121 SER n 
1 122 THR n 
1 123 PHE n 
1 124 GLY n 
1 125 VAL n 
1 126 THR n 
1 127 GLU n 
1 128 PRO n 
1 129 VAL n 
1 130 ASN n 
1 131 ASP n 
1 132 ARG n 
1 133 MET n 
1 134 PHE n 
1 135 ARG n 
1 136 LEU n 
1 137 LEU n 
1 138 SER n 
1 139 ALA n 
1 140 PHE n 
1 141 ILE n 
1 142 ALA n 
1 143 ASP n 
1 144 GLY n 
1 145 GLY n 
1 146 ARG n 
1 147 TYR n 
1 148 CYS n 
1 149 LEU n 
1 150 PRO n 
1 151 GLU n 
1 152 PRO n 
1 153 LEU n 
1 154 GLN n 
1 155 PRO n 
1 156 SER n 
1 157 ARG n 
1 158 TRP n 
1 159 MET n 
1 160 MET n 
1 161 MET n 
1 162 PRO n 
1 163 ALA n 
1 164 SER n 
1 165 GLY n 
1 166 THR n 
1 167 ALA n 
1 168 ALA n 
1 169 PRO n 
1 170 GLN n 
1 171 HIS n 
1 172 LEU n 
1 173 PRO n 
1 174 GLY n 
1 175 GLN n 
1 176 PRO n 
1 177 CYS n 
1 178 GLN n 
1 179 PHE n 
1 180 ALA n 
1 181 LEU n 
1 182 GLN n 
1 183 ALA n 
1 184 ILE n 
1 185 VAL n 
1 186 GLU n 
1 187 PRO n 
1 188 ALA n 
1 189 LYS n 
1 190 LYS n 
1 191 ARG n 
1 192 VAL n 
1 193 SER n 
1 194 SER n 
1 195 PHE n 
1 196 GLU n 
1 197 ALA n 
1 198 LEU n 
1 199 ILE n 
1 200 ARG n 
1 201 SER n 
1 202 PRO n 
1 203 THR n 
1 204 GLY n 
1 205 GLY n 
1 206 SER n 
1 207 PRO n 
1 208 VAL n 
1 209 GLU n 
1 210 MET n 
1 211 PHE n 
1 212 ALA n 
1 213 ALA n 
1 214 ILE n 
1 215 ALA n 
1 216 ALA n 
1 217 GLU n 
1 218 ASP n 
1 219 ARG n 
1 220 TYR n 
1 221 ARG n 
1 222 PHE n 
1 223 ASP n 
1 224 LEU n 
1 225 GLU n 
1 226 SER n 
1 227 LYS n 
1 228 ALA n 
1 229 TYR n 
1 230 ALA n 
1 231 PHE n 
1 232 ALA n 
1 233 LEU n 
1 234 ALA n 
1 235 GLY n 
1 236 GLN n 
1 237 LEU n 
1 238 PRO n 
1 239 LEU n 
1 240 GLY n 
1 241 LYS n 
1 242 HIS n 
1 243 GLN n 
1 244 LEU n 
1 245 ALA n 
1 246 ILE n 
1 247 ASN n 
1 248 LEU n 
1 249 LEU n 
1 250 PRO n 
1 251 GLY n 
1 252 SER n 
1 253 LEU n 
1 254 TYR n 
1 255 HIS n 
1 256 HIS n 
1 257 PRO n 
1 258 ASP n 
1 259 ALA n 
1 260 VAL n 
1 261 GLY n 
1 262 TRP n 
1 263 LEU n 
1 264 MET n 
1 265 ASP n 
1 266 SER n 
1 267 LEU n 
1 268 LEU n 
1 269 ALA n 
1 270 ALA n 
1 271 GLY n 
1 272 LEU n 
1 273 ARG n 
1 274 PRO n 
1 275 ASP n 
1 276 GLN n 
1 277 VAL n 
1 278 LEU n 
1 279 ILE n 
1 280 GLU n 
1 281 VAL n 
1 282 THR n 
1 283 GLU n 
1 284 THR n 
1 285 GLU n 
1 286 VAL n 
1 287 ILE n 
1 288 THR n 
1 289 CYS n 
1 290 PHE n 
1 291 ASP n 
1 292 GLN n 
1 293 PHE n 
1 294 ARG n 
1 295 LYS n 
1 296 VAL n 
1 297 LEU n 
1 298 LYS n 
1 299 ALA n 
1 300 LEU n 
1 301 ARG n 
1 302 VAL n 
1 303 ALA n 
1 304 GLY n 
1 305 MET n 
1 306 LYS n 
1 307 LEU n 
1 308 ALA n 
1 309 ILE n 
1 310 ASP n 
1 311 ASP n 
1 312 PHE n 
1 313 GLY n 
1 314 ALA n 
1 315 GLY n 
1 316 TYR n 
1 317 SER n 
1 318 GLY n 
1 319 LEU n 
1 320 SER n 
1 321 LEU n 
1 322 LEU n 
1 323 THR n 
1 324 ARG n 
1 325 PHE n 
1 326 GLN n 
1 327 PRO n 
1 328 ASP n 
1 329 LYS n 
1 330 ILE n 
1 331 LYS n 
1 332 VAL n 
1 333 ASP n 
1 334 ALA n 
1 335 GLU n 
1 336 LEU n 
1 337 VAL n 
1 338 ARG n 
1 339 ASP n 
1 340 ILE n 
1 341 HIS n 
1 342 ILE n 
1 343 SER n 
1 344 GLY n 
1 345 THR n 
1 346 LYS n 
1 347 GLN n 
1 348 ALA n 
1 349 ILE n 
1 350 VAL n 
1 351 ALA n 
1 352 SER n 
1 353 VAL n 
1 354 VAL n 
1 355 ARG n 
1 356 CYS n 
1 357 CYS n 
1 358 GLU n 
1 359 ASP n 
1 360 LEU n 
1 361 GLY n 
1 362 ILE n 
1 363 THR n 
1 364 VAL n 
1 365 VAL n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 VAL n 
1 370 GLU n 
1 371 THR n 
1 372 LEU n 
1 373 GLU n 
1 374 GLU n 
1 375 TRP n 
1 376 CYS n 
1 377 TRP n 
1 378 LEU n 
1 379 GLN n 
1 380 SER n 
1 381 VAL n 
1 382 GLY n 
1 383 ILE n 
1 384 ARG n 
1 385 LEU n 
1 386 PHE n 
1 387 GLN n 
1 388 GLY n 
1 389 PHE n 
1 390 LEU n 
1 391 PHE n 
1 392 SER n 
1 393 ARG n 
1 394 PRO n 
1 395 CYS n 
1 396 LEU n 
1 397 ASN n 
1 398 GLY n 
1 399 ILE n 
1 400 GLY n 
1 401 GLU n 
1 402 ILE n 
1 403 CYS n 
1 404 TRP n 
1 405 PRO n 
1 406 VAL n 
1 407 ALA n 
1 408 ARG n 
1 409 GLN n 
1 410 ALA n 
1 411 MET n 
1 412 ASP n 
1 413 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'blrp, KPN78578_15680, KPN_01598' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Klebsiella pneumoniae subsp. pneumoniae MGH 78578' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     272620 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta 2 (DE-3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pET28-derived 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A6T8V8_KLEP7 
_struct_ref.pdbx_db_accession          A6T8V8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MLTTLIYRSQVHPDRPPVDLDALVHRASSKNLPLGITGILLFNGLQFFQVLEGTEEALESLFSEIQSDPRHRDVVELMRD
YSAYRRFHGTGMRILDLRLFETDGALEEILRFSTFGVTEPVNDRMFRLLSAFIADGGRYCLPEPLQPSRWMMMPASGTAA
PQHLPGQPCQFALQAIVEPAKKRVSSFEALIRSPTGGSPVEMFAAIAAEDRYRFDLESKAYAFALAGQLPLGKHQLAINL
LPGSLYHHPDAVGWLMDSLLAAGLRPDQVLIEVTETEVITCFDQFRKVLKALRVAGMKLAIDDFGAGYSGLSLLTRFQPD
KIKVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVETLEEWCWLQSVGIRLFQGFLFSRPCLNGIGEICWPVAR
QAMDL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GG0 A 9 ? 413 ? A6T8V8 1 ? 405 ? 1 405 
2 1 3GG0 B 9 ? 413 ? A6T8V8 1 ? 405 ? 1 405 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3GG0 ILE A 1 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -7 1  
1 3GG0 SER A 2 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -6 2  
1 3GG0 GLU A 3 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -5 3  
1 3GG0 PHE A 4 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -4 4  
1 3GG0 GLY A 5 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -3 5  
1 3GG0 SER A 6 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -2 6  
1 3GG0 SER A 7 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -1 7  
1 3GG0 ARG A 8 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' 0  8  
2 3GG0 ILE B 1 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -7 9  
2 3GG0 SER B 2 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -6 10 
2 3GG0 GLU B 3 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -5 11 
2 3GG0 PHE B 4 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -4 12 
2 3GG0 GLY B 5 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -3 13 
2 3GG0 SER B 6 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -2 14 
2 3GG0 SER B 7 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' -1 15 
2 3GG0 ARG B 8 ? UNP A6T8V8 ? ? 'EXPRESSION TAG' 0  16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                            'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ?                                            'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                                            'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                            'C4 H7 N O4'         133.103 
C2E non-polymer         . 
;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one)
;
'c-di-GMP, Cyclic diguanosine monophosphate' 'C20 H24 N10 O14 P2' 690.411 
CYS 'L-peptide linking' y CYSTEINE ?                                            'C3 H7 N O2 S'       121.158 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE' 'RIBOFLAVIN MONOPHOSPHATE'                   'C17 H21 N4 O9 P'    456.344 
GLN 'L-peptide linking' y GLUTAMINE ?                                            'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                            'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ?                                            'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ?                                            'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ?                                            'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                                            'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ?                                            'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ?                                            'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ?                                            'C5 H11 N O2 S'      149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ?                                            'Mn 2'               54.938  
PHE 'L-peptide linking' y PHENYLALANINE ?                                            'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ?                                            'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ?                                            'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ?                                            'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                                            'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ?                                            'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ?                                            'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          3GG0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.35 
_exptl_crystal.density_percent_sol   47.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    
;protein in 5 mM cy-diGMP, 5 mM CaCl2, 25 mM Tris-HCl pH 8.0, 40 mM NaCl, 5 mM MgCl2, 2 mM EDTA, 2 mM DTE, 5% glycerol, reservoir 0.1 M Na-Ac buffer pH 4.5, 0.2 M Ca-acetate, 17-20%PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si111 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.2838 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.2838 
# 
_reflns.entry_id                     3GG0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             48.45 
_reflns.d_resolution_high            2.55 
_reflns.number_obs                   26293 
_reflns.number_all                   26293 
_reflns.percent_possible_obs         92.4 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.65 
_reflns_shell.percent_possible_all   84.7 
_reflns_shell.Rmerge_I_obs           0.333 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3GG0 
_refine.ls_number_reflns_obs                     26293 
_refine.ls_number_reflns_all                     26293 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.45 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    97.39 
_refine.ls_R_factor_obs                          0.24245 
_refine.ls_R_factor_all                          0.24245 
_refine.ls_R_factor_R_work                       0.23964 
_refine.ls_R_factor_R_free                       0.29512 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1392 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.902 
_refine.correlation_coeff_Fo_to_Fc_free          0.859 
_refine.B_iso_mean                               30.994 
_refine.aniso_B[1][1]                            -0.04 
_refine.aniso_B[2][2]                            -4.03 
_refine.aniso_B[3][3]                            4.06 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       2.337 
_refine.pdbx_overall_ESU_R_Free                  0.383 
_refine.overall_SU_ML                            0.311 
_refine.overall_SU_B                             14.756 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6169 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         158 
_refine_hist.number_atoms_solvent             130 
_refine_hist.number_atoms_total               6457 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        48.45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 6476 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.986  2.006  ? 8820 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.655  5.000  ? 781  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.772 22.943 ? 282  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.183 15.000 ? 1066 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.688 15.000 ? 56   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.044  0.200  ? 974  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 4859 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.168  0.300  ? 2975 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.311  0.500  ? 4421 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.186  0.500  ? 410  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.134  0.300  ? 52   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.184  0.500  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.385  1.500  ? 4012 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.688  2.000  ? 6298 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.621  3.000  ? 2868 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.120  4.500  ? 2520 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 3135 0.66 5.00  'loose positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
1 A 3135 2.08 10.00 'loose thermal'    1 2 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.550 
_refine_ls_shell.d_res_low                        2.616 
_refine_ls_shell.number_reflns_R_work             1870 
_refine_ls_shell.R_factor_R_work                  0.332 
_refine_ls_shell.percent_reflns_obs               96.58 
_refine_ls_shell.R_factor_R_free                  0.395 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 1 A 504 1 6 ? ? ? ? ? ? ? ? 1 ? 
2 B 1 B 504 1 6 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3GG0 
_struct.title                     'Klebsiella pneumoniae BlrP1 pH 9.0 manganese/cy-diGMP complex' 
_struct.pdbx_descriptor           'Klebsiella pneumoniae BlrP1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GG0 
_struct_keywords.pdbx_keywords   'HYDROLASE, SIGNALING PROTEIN' 
_struct_keywords.text            'TIM-barrel, EAL domain, BLUF domain, HYDROLASE, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 27  ? LEU A 40  ? ASP A 19  LEU A 32  1 ? 14 
HELX_P HELX_P2  2  GLU A 63  ? SER A 75  ? GLU A 55  SER A 67  1 ? 13 
HELX_P HELX_P3  3  ARG A 106 ? PHE A 108 ? ARG A 98  PHE A 100 5 ? 3  
HELX_P HELX_P4  4  ASP A 111 ? SER A 121 ? ASP A 103 SER A 113 1 ? 11 
HELX_P HELX_P5  5  ASP A 131 ? GLY A 144 ? ASP A 123 GLY A 136 1 ? 14 
HELX_P HELX_P6  6  PRO A 150 ? SER A 156 ? PRO A 142 SER A 148 5 ? 7  
HELX_P HELX_P7  7  PRO A 187 ? LYS A 190 ? PRO A 179 LYS A 182 5 ? 4  
HELX_P HELX_P8  8  SER A 206 ? ILE A 214 ? SER A 198 ILE A 206 1 ? 9  
HELX_P HELX_P9  9  ALA A 215 ? GLU A 217 ? ALA A 207 GLU A 209 5 ? 3  
HELX_P HELX_P10 10 ASP A 218 ? GLN A 236 ? ASP A 210 GLN A 228 1 ? 19 
HELX_P HELX_P11 11 LEU A 249 ? TYR A 254 ? LEU A 241 TYR A 246 1 ? 6  
HELX_P HELX_P12 12 ASP A 258 ? ALA A 270 ? ASP A 250 ALA A 262 1 ? 13 
HELX_P HELX_P13 13 ARG A 273 ? ASP A 275 ? ARG A 265 ASP A 267 5 ? 3  
HELX_P HELX_P14 14 GLU A 283 ? ILE A 287 ? GLU A 275 ILE A 279 1 ? 5  
HELX_P HELX_P15 15 CYS A 289 ? GLY A 304 ? CYS A 281 GLY A 296 1 ? 16 
HELX_P HELX_P16 16 GLY A 318 ? ARG A 324 ? GLY A 310 ARG A 316 5 ? 7  
HELX_P HELX_P17 17 ASP A 333 ? ARG A 338 ? ASP A 325 ARG A 330 1 ? 6  
HELX_P HELX_P18 18 SER A 343 ? GLY A 361 ? SER A 335 GLY A 353 1 ? 19 
HELX_P HELX_P19 19 THR A 371 ? VAL A 381 ? THR A 363 VAL A 373 1 ? 11 
HELX_P HELX_P20 20 ASP B 27  ? GLY B 43  ? ASP B 19  GLY B 35  1 ? 17 
HELX_P HELX_P21 21 GLU B 63  ? ASP B 76  ? GLU B 55  ASP B 68  1 ? 14 
HELX_P HELX_P22 22 ARG B 106 ? PHE B 108 ? ARG B 98  PHE B 100 5 ? 3  
HELX_P HELX_P23 23 ASP B 111 ? ARG B 119 ? ASP B 103 ARG B 111 1 ? 9  
HELX_P HELX_P24 24 GLU B 127 ? ASN B 130 ? GLU B 119 ASN B 122 5 ? 4  
HELX_P HELX_P25 25 ASP B 131 ? GLY B 144 ? ASP B 123 GLY B 136 1 ? 14 
HELX_P HELX_P26 26 GLY B 145 ? CYS B 148 ? GLY B 137 CYS B 140 5 ? 4  
HELX_P HELX_P27 27 PRO B 150 ? SER B 156 ? PRO B 142 SER B 148 5 ? 7  
HELX_P HELX_P28 28 PRO B 187 ? LYS B 190 ? PRO B 179 LYS B 182 5 ? 4  
HELX_P HELX_P29 29 SER B 206 ? ILE B 214 ? SER B 198 ILE B 206 1 ? 9  
HELX_P HELX_P30 30 ALA B 215 ? GLU B 217 ? ALA B 207 GLU B 209 5 ? 3  
HELX_P HELX_P31 31 ASP B 218 ? SER B 226 ? ASP B 210 SER B 218 1 ? 9  
HELX_P HELX_P32 32 SER B 226 ? LEU B 237 ? SER B 218 LEU B 229 1 ? 12 
HELX_P HELX_P33 33 LEU B 249 ? HIS B 255 ? LEU B 241 HIS B 247 1 ? 7  
HELX_P HELX_P34 34 ASP B 258 ? ALA B 270 ? ASP B 250 ALA B 262 1 ? 13 
HELX_P HELX_P35 35 ARG B 273 ? ASP B 275 ? ARG B 265 ASP B 267 5 ? 3  
HELX_P HELX_P36 36 GLU B 283 ? THR B 288 ? GLU B 275 THR B 280 1 ? 6  
HELX_P HELX_P37 37 CYS B 289 ? GLY B 304 ? CYS B 281 GLY B 296 1 ? 16 
HELX_P HELX_P38 38 SER B 320 ? PHE B 325 ? SER B 312 PHE B 317 1 ? 6  
HELX_P HELX_P39 39 ASP B 333 ? ARG B 338 ? ASP B 325 ARG B 330 1 ? 6  
HELX_P HELX_P40 40 SER B 343 ? GLY B 361 ? SER B 335 GLY B 353 1 ? 19 
HELX_P HELX_P41 41 THR B 371 ? VAL B 381 ? THR B 363 VAL B 373 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 196 OE2 ? ? ? 1_555 D MN  . MN ? ? A GLU 188 A MN  502 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc2  metalc ? ? A ASN 247 OD1 ? ? ? 1_555 D MN  . MN ? ? A ASN 239 A MN  502 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc3  metalc ? ? A GLU 280 OE2 ? ? ? 1_555 D MN  . MN ? ? A GLU 272 A MN  502 1_555 ? ? ? ? ? ? ? 1.985 ? 
metalc4  metalc ? ? A ASP 310 OD1 ? ? ? 1_555 E MN  . MN ? ? A ASP 302 A MN  503 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc5  metalc ? ? A ASP 310 OD2 ? ? ? 1_555 D MN  . MN ? ? A ASP 302 A MN  502 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc6  metalc ? ? A ASP 311 OD1 ? ? ? 1_555 E MN  . MN ? ? A ASP 303 A MN  503 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc7  metalc ? ? A GLU 367 OE1 ? ? ? 1_555 E MN  . MN ? ? A GLU 359 A MN  503 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc8  metalc ? ? B GLU 196 OE2 ? ? ? 1_555 H MN  . MN ? ? B GLU 188 B MN  502 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc9  metalc ? ? B ASN 247 OD1 ? ? ? 1_555 H MN  . MN ? ? B ASN 239 B MN  502 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc10 metalc ? ? B GLU 280 OE2 ? ? ? 1_555 H MN  . MN ? ? B GLU 272 B MN  502 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc11 metalc ? ? B ASP 310 OD1 ? ? ? 1_555 H MN  . MN ? ? B ASP 302 B MN  502 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc12 metalc ? ? B ASP 310 OD2 ? ? ? 1_555 I MN  . MN ? ? B ASP 302 B MN  503 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc13 metalc ? ? B ASP 311 OD1 ? ? ? 1_555 I MN  . MN ? ? B ASP 303 B MN  503 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc14 metalc ? ? B GLU 367 OE1 ? ? ? 1_555 I MN  . MN ? ? B GLU 359 B MN  503 1_555 ? ? ? ? ? ? ? 2.112 ? 
metalc15 metalc ? ? B GLU 367 OE2 ? ? ? 1_555 I MN  . MN ? ? B GLU 359 B MN  503 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc16 metalc ? ? D MN  .   MN  ? ? ? 1_555 K HOH . O  ? ? A MN  502 A HOH 409 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc17 metalc ? ? E MN  .   MN  ? ? ? 1_555 K HOH . O  ? ? A MN  503 A HOH 409 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc18 metalc ? ? H MN  .   MN  ? ? ? 1_555 L HOH . O  ? ? B MN  502 B HOH 407 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc19 metalc ? ? I MN  .   MN  ? ? ? 1_555 L HOH . O  ? ? B MN  503 B HOH 407 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc20 metalc ? ? C C2E .   O2P ? ? ? 1_555 D MN  . MN ? ? A C2E 501 A MN  502 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc21 metalc ? ? C C2E .   O1P ? ? ? 1_555 E MN  . MN ? ? A C2E 501 A MN  503 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc22 metalc ? ? G C2E .   O2P ? ? ? 1_555 H MN  . MN ? ? B C2E 501 B MN  502 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc23 metalc ? ? G C2E .   O1P ? ? ? 1_555 I MN  . MN ? ? B C2E 501 B MN  503 1_555 ? ? ? ? ? ? ? 1.906 ? 
metalc24 metalc ? ? A GLU 367 OE2 ? ? ? 1_555 E MN  . MN ? ? A GLU 359 A MN  503 1_555 ? ? ? ? ? ? ? 2.679 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           237 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            229 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    238 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     230 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.85 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5  ? 
B ? 2  ? 
C ? 10 ? 
D ? 5  ? 
E ? 2  ? 
F ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? anti-parallel 
A 3 4  ? anti-parallel 
A 4 5  ? parallel      
B 1 2  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
C 3 4  ? parallel      
C 4 5  ? parallel      
C 5 6  ? parallel      
C 6 7  ? parallel      
C 7 8  ? parallel      
C 8 9  ? parallel      
C 9 10 ? anti-parallel 
D 1 2  ? anti-parallel 
D 2 3  ? anti-parallel 
D 3 4  ? anti-parallel 
D 4 5  ? parallel      
E 1 2  ? anti-parallel 
F 1 2  ? anti-parallel 
F 2 3  ? anti-parallel 
F 3 4  ? parallel      
F 4 5  ? parallel      
F 5 6  ? parallel      
F 6 7  ? parallel      
F 7 8  ? parallel      
F 8 9  ? parallel      
F 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ARG A 80  ? TYR A 89  ? ARG A 72  TYR A 81  
A 2  LEU A 10  ? GLN A 18  ? LEU A 2   GLN A 10  
A 3  GLN A 54  ? THR A 62  ? GLN A 46  THR A 54  
A 4  LEU A 48  ? PHE A 50  ? LEU A 40  PHE A 42  
A 5  ILE A 102 ? ASP A 104 ? ILE A 94  ASP A 96  
B 1  TRP A 158 ? MET A 161 ? TRP A 150 MET A 153 
B 2  TRP A 404 ? ALA A 407 ? TRP A 396 ALA A 399 
C 1  CYS A 395 ? LEU A 396 ? CYS A 387 LEU A 388 
C 2  GLN A 178 ? GLU A 186 ? GLN A 170 GLU A 178 
C 3  LEU A 385 ? PHE A 386 ? LEU A 377 PHE A 378 
C 4  THR A 363 ? ALA A 366 ? THR A 355 ALA A 358 
C 5  LYS A 329 ? VAL A 332 ? LYS A 321 VAL A 324 
C 6  LYS A 306 ? PHE A 312 ? LYS A 298 PHE A 304 
C 7  VAL A 277 ? THR A 282 ? VAL A 269 THR A 274 
C 8  GLN A 243 ? ASN A 247 ? GLN A 235 ASN A 239 
C 9  ARG A 191 ? ARG A 200 ? ARG A 183 ARG A 192 
C 10 GLN A 178 ? GLU A 186 ? GLN A 170 GLU A 178 
D 1  ARG B 80  ? TYR B 89  ? ARG B 72  TYR B 81  
D 2  LEU B 10  ? GLN B 18  ? LEU B 2   GLN B 10  
D 3  GLN B 54  ? THR B 62  ? GLN B 46  THR B 54  
D 4  THR B 45  ? PHE B 50  ? THR B 37  PHE B 42  
D 5  ARG B 101 ? ASP B 104 ? ARG B 93  ASP B 96  
E 1  TRP B 158 ? MET B 160 ? TRP B 150 MET B 152 
E 2  PRO B 405 ? ALA B 407 ? PRO B 397 ALA B 399 
F 1  CYS B 395 ? LEU B 396 ? CYS B 387 LEU B 388 
F 2  GLN B 178 ? GLU B 186 ? GLN B 170 GLU B 178 
F 3  LEU B 385 ? GLN B 387 ? LEU B 377 GLN B 379 
F 4  THR B 363 ? GLU B 367 ? THR B 355 GLU B 359 
F 5  LYS B 329 ? VAL B 332 ? LYS B 321 VAL B 324 
F 6  LYS B 306 ? PHE B 312 ? LYS B 298 PHE B 304 
F 7  VAL B 277 ? THR B 282 ? VAL B 269 THR B 274 
F 8  GLN B 243 ? ASN B 247 ? GLN B 235 ASN B 239 
F 9  ARG B 191 ? ARG B 200 ? ARG B 183 ARG B 192 
F 10 GLN B 178 ? GLU B 186 ? GLN B 170 GLU B 178 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O ASP A 88  ? O ASP A 80  N THR A 12  ? N THR A 4   
A 2 3  N LEU A 13  ? N LEU A 5   O LEU A 59  ? O LEU A 51  
A 3 4  O PHE A 56  ? O PHE A 48  N LEU A 49  ? N LEU A 41  
A 4 5  N PHE A 50  ? N PHE A 42  O LEU A 103 ? O LEU A 95  
B 1 2  N MET A 159 ? N MET A 151 O VAL A 406 ? O VAL A 398 
C 1 2  O CYS A 395 ? O CYS A 387 N LEU A 181 ? N LEU A 173 
C 2 3  N VAL A 185 ? N VAL A 177 O PHE A 386 ? O PHE A 378 
C 3 4  O LEU A 385 ? O LEU A 377 N ALA A 366 ? N ALA A 358 
C 4 5  O THR A 363 ? O THR A 355 N ILE A 330 ? N ILE A 322 
C 5 6  O LYS A 331 ? O LYS A 323 N PHE A 312 ? N PHE A 304 
C 6 7  O ALA A 308 ? O ALA A 300 N ILE A 279 ? N ILE A 271 
C 7 8  O GLU A 280 ? O GLU A 272 N ILE A 246 ? N ILE A 238 
C 8 9  O ALA A 245 ? O ALA A 237 N PHE A 195 ? N PHE A 187 
C 9 10 O ARG A 200 ? O ARG A 192 N GLN A 178 ? N GLN A 170 
D 1 2  O VAL B 83  ? O VAL B 75  N ARG B 16  ? N ARG B 8   
D 2 3  N THR B 11  ? N THR B 3   O GLY B 61  ? O GLY B 53  
D 3 4  O PHE B 56  ? O PHE B 48  N LEU B 49  ? N LEU B 41  
D 4 5  N LEU B 48  ? N LEU B 40  O LEU B 103 ? O LEU B 95  
E 1 2  N MET B 159 ? N MET B 151 O VAL B 406 ? O VAL B 398 
F 1 2  O CYS B 395 ? O CYS B 387 N LEU B 181 ? N LEU B 173 
F 2 3  N VAL B 185 ? N VAL B 177 O PHE B 386 ? O PHE B 378 
F 3 4  O LEU B 385 ? O LEU B 377 N ALA B 366 ? N ALA B 358 
F 4 5  O THR B 363 ? O THR B 355 N ILE B 330 ? N ILE B 322 
F 5 6  O LYS B 331 ? O LYS B 323 N PHE B 312 ? N PHE B 304 
F 6 7  O ALA B 308 ? O ALA B 300 N ILE B 279 ? N ILE B 271 
F 7 8  O GLU B 280 ? O GLU B 272 N ILE B 246 ? N ILE B 238 
F 8 9  O ALA B 245 ? O ALA B 237 N PHE B 195 ? N PHE B 187 
F 9 10 O SER B 194 ? O SER B 186 N ILE B 184 ? N ILE B 176 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE C2E A 501' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 503'  
AC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE FMN A 504' 
AC5 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE C2E B 501' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 502'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 503'  
AC8 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE FMN B 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 29 GLN A 182 ? GLN A 174 . ? 1_555 ? 
2   AC1 29 GLU A 196 ? GLU A 188 . ? 1_555 ? 
3   AC1 29 LEU A 198 ? LEU A 190 . ? 1_555 ? 
4   AC1 29 ILE A 199 ? ILE A 191 . ? 1_555 ? 
5   AC1 29 ARG A 200 ? ARG A 192 . ? 1_555 ? 
6   AC1 29 PRO A 207 ? PRO A 199 . ? 1_555 ? 
7   AC1 29 ASP A 223 ? ASP A 215 . ? 1_555 ? 
8   AC1 29 LYS A 227 ? LYS A 219 . ? 1_555 ? 
9   AC1 29 ASN A 247 ? ASN A 239 . ? 1_555 ? 
10  AC1 29 LEU A 249 ? LEU A 241 . ? 1_555 ? 
11  AC1 29 ASP A 310 ? ASP A 302 . ? 1_555 ? 
12  AC1 29 ASP A 311 ? ASP A 303 . ? 1_555 ? 
13  AC1 29 ARG A 338 ? ARG A 330 . ? 1_555 ? 
14  AC1 29 GLU A 367 ? GLU A 359 . ? 1_555 ? 
15  AC1 29 GLY A 368 ? GLY A 360 . ? 1_555 ? 
16  AC1 29 GLU A 370 ? GLU A 362 . ? 1_555 ? 
17  AC1 29 GLY A 388 ? GLY A 380 . ? 1_555 ? 
18  AC1 29 PHE A 389 ? PHE A 381 . ? 1_555 ? 
19  AC1 29 PRO A 394 ? PRO A 386 . ? 1_555 ? 
20  AC1 29 HOH K .   ? HOH A 408 . ? 1_555 ? 
21  AC1 29 HOH K .   ? HOH A 419 . ? 1_555 ? 
22  AC1 29 HOH K .   ? HOH A 439 . ? 1_555 ? 
23  AC1 29 HOH K .   ? HOH A 443 . ? 1_555 ? 
24  AC1 29 MN  D .   ? MN  A 502 . ? 1_555 ? 
25  AC1 29 MN  E .   ? MN  A 503 . ? 1_555 ? 
26  AC1 29 GLN B 170 ? GLN B 162 . ? 4_455 ? 
27  AC1 29 HIS B 171 ? HIS B 163 . ? 4_455 ? 
28  AC1 29 PRO B 173 ? PRO B 165 . ? 4_455 ? 
29  AC1 29 HOH L .   ? HOH B 441 . ? 4_455 ? 
30  AC2 6  GLU A 196 ? GLU A 188 . ? 1_555 ? 
31  AC2 6  ASN A 247 ? ASN A 239 . ? 1_555 ? 
32  AC2 6  GLU A 280 ? GLU A 272 . ? 1_555 ? 
33  AC2 6  ASP A 310 ? ASP A 302 . ? 1_555 ? 
34  AC2 6  HOH K .   ? HOH A 409 . ? 1_555 ? 
35  AC2 6  C2E C .   ? C2E A 501 . ? 1_555 ? 
36  AC3 5  ASP A 310 ? ASP A 302 . ? 1_555 ? 
37  AC3 5  ASP A 311 ? ASP A 303 . ? 1_555 ? 
38  AC3 5  GLU A 367 ? GLU A 359 . ? 1_555 ? 
39  AC3 5  HOH K .   ? HOH A 409 . ? 1_555 ? 
40  AC3 5  C2E C .   ? C2E A 501 . ? 1_555 ? 
41  AC4 15 TYR A 15  ? TYR A 7   . ? 1_555 ? 
42  AC4 15 ARG A 34  ? ARG A 26  . ? 1_555 ? 
43  AC4 15 ALA A 35  ? ALA A 27  . ? 1_555 ? 
44  AC4 15 LYS A 38  ? LYS A 30  . ? 1_555 ? 
45  AC4 15 ASN A 39  ? ASN A 31  . ? 1_555 ? 
46  AC4 15 GLN A 57  ? GLN A 49  . ? 1_555 ? 
47  AC4 15 LEU A 69  ? LEU A 61  . ? 1_555 ? 
48  AC4 15 GLU A 72  ? GLU A 64  . ? 1_555 ? 
49  AC4 15 ILE A 73  ? ILE A 65  . ? 1_555 ? 
50  AC4 15 ASP A 76  ? ASP A 68  . ? 1_555 ? 
51  AC4 15 ARG A 78  ? ARG A 70  . ? 1_555 ? 
52  AC4 15 HIS A 79  ? HIS A 71  . ? 1_555 ? 
53  AC4 15 MET A 100 ? MET A 92  . ? 1_555 ? 
54  AC4 15 HOH K .   ? HOH A 416 . ? 1_555 ? 
55  AC4 15 HOH K .   ? HOH A 474 . ? 1_555 ? 
56  AC5 25 GLN B 182 ? GLN B 174 . ? 1_555 ? 
57  AC5 25 GLU B 196 ? GLU B 188 . ? 1_555 ? 
58  AC5 25 LEU B 198 ? LEU B 190 . ? 1_555 ? 
59  AC5 25 ILE B 199 ? ILE B 191 . ? 1_555 ? 
60  AC5 25 ARG B 200 ? ARG B 192 . ? 1_555 ? 
61  AC5 25 PRO B 207 ? PRO B 199 . ? 1_555 ? 
62  AC5 25 ASP B 223 ? ASP B 215 . ? 1_555 ? 
63  AC5 25 LYS B 227 ? LYS B 219 . ? 1_555 ? 
64  AC5 25 ASN B 247 ? ASN B 239 . ? 1_555 ? 
65  AC5 25 LEU B 249 ? LEU B 241 . ? 1_555 ? 
66  AC5 25 GLN B 292 ? GLN B 284 . ? 4_555 ? 
67  AC5 25 ASP B 310 ? ASP B 302 . ? 1_555 ? 
68  AC5 25 ASP B 311 ? ASP B 303 . ? 1_555 ? 
69  AC5 25 GLU B 367 ? GLU B 359 . ? 1_555 ? 
70  AC5 25 GLY B 368 ? GLY B 360 . ? 1_555 ? 
71  AC5 25 GLU B 370 ? GLU B 362 . ? 1_555 ? 
72  AC5 25 GLY B 388 ? GLY B 380 . ? 1_555 ? 
73  AC5 25 PHE B 389 ? PHE B 381 . ? 1_555 ? 
74  AC5 25 PRO B 394 ? PRO B 386 . ? 1_555 ? 
75  AC5 25 HOH L .   ? HOH B 407 . ? 1_555 ? 
76  AC5 25 HOH L .   ? HOH B 427 . ? 1_555 ? 
77  AC5 25 HOH L .   ? HOH B 430 . ? 1_555 ? 
78  AC5 25 HOH L .   ? HOH B 431 . ? 1_555 ? 
79  AC5 25 MN  H .   ? MN  B 502 . ? 1_555 ? 
80  AC5 25 MN  I .   ? MN  B 503 . ? 1_555 ? 
81  AC6 6  GLU B 196 ? GLU B 188 . ? 1_555 ? 
82  AC6 6  ASN B 247 ? ASN B 239 . ? 1_555 ? 
83  AC6 6  GLU B 280 ? GLU B 272 . ? 1_555 ? 
84  AC6 6  ASP B 310 ? ASP B 302 . ? 1_555 ? 
85  AC6 6  HOH L .   ? HOH B 407 . ? 1_555 ? 
86  AC6 6  C2E G .   ? C2E B 501 . ? 1_555 ? 
87  AC7 6  ASP B 310 ? ASP B 302 . ? 1_555 ? 
88  AC7 6  ASP B 311 ? ASP B 303 . ? 1_555 ? 
89  AC7 6  GLU B 367 ? GLU B 359 . ? 1_555 ? 
90  AC7 6  HOH L .   ? HOH B 407 . ? 1_555 ? 
91  AC7 6  HOH L .   ? HOH B 430 . ? 1_555 ? 
92  AC7 6  C2E G .   ? C2E B 501 . ? 1_555 ? 
93  AC8 15 TYR B 15  ? TYR B 7   . ? 1_555 ? 
94  AC8 15 LEU B 31  ? LEU B 23  . ? 1_555 ? 
95  AC8 15 ALA B 35  ? ALA B 27  . ? 1_555 ? 
96  AC8 15 LYS B 38  ? LYS B 30  . ? 1_555 ? 
97  AC8 15 ASN B 39  ? ASN B 31  . ? 1_555 ? 
98  AC8 15 PHE B 55  ? PHE B 47  . ? 1_555 ? 
99  AC8 15 GLN B 57  ? GLN B 49  . ? 1_555 ? 
100 AC8 15 LEU B 59  ? LEU B 51  . ? 1_555 ? 
101 AC8 15 LEU B 69  ? LEU B 61  . ? 1_555 ? 
102 AC8 15 GLU B 72  ? GLU B 64  . ? 1_555 ? 
103 AC8 15 ILE B 73  ? ILE B 65  . ? 1_555 ? 
104 AC8 15 ASP B 76  ? ASP B 68  . ? 1_555 ? 
105 AC8 15 ARG B 78  ? ARG B 70  . ? 1_555 ? 
106 AC8 15 HIS B 79  ? HIS B 71  . ? 1_555 ? 
107 AC8 15 HOH L .   ? HOH B 412 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3GG0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GG0 
_atom_sites.fract_transf_matrix[1][1]   0.014489 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010321 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007882 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 9   ? -35.004 33.499  -16.985 1.00 35.28 ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 9   ? -33.774 32.697  -16.717 1.00 35.43 ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 9   ? -33.352 31.905  -17.957 1.00 34.77 ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 9   ? -34.038 30.966  -18.369 1.00 34.77 ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 9   ? -33.998 31.745  -15.533 1.00 35.79 ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 9   ? -34.120 32.438  -14.164 1.00 37.78 ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 9   ? -32.551 33.117  -13.534 1.00 41.72 ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 9   ? -31.489 31.676  -13.618 1.00 40.99 ? 1   MET A CE    1 
ATOM   9    N  N     . LEU A 1 10  ? -32.219 32.284  -18.540 1.00 33.95 ? 2   LEU A N     1 
ATOM   10   C  CA    . LEU A 1 10  ? -31.704 31.605  -19.725 1.00 33.27 ? 2   LEU A CA    1 
ATOM   11   C  C     . LEU A 1 10  ? -31.004 30.294  -19.363 1.00 32.81 ? 2   LEU A C     1 
ATOM   12   O  O     . LEU A 1 10  ? -30.357 30.188  -18.323 1.00 32.72 ? 2   LEU A O     1 
ATOM   13   C  CB    . LEU A 1 10  ? -30.757 32.523  -20.506 1.00 33.28 ? 2   LEU A CB    1 
ATOM   14   C  CG    . LEU A 1 10  ? -30.273 32.023  -21.872 1.00 33.29 ? 2   LEU A CG    1 
ATOM   15   C  CD1   . LEU A 1 10  ? -31.409 32.007  -22.889 1.00 33.16 ? 2   LEU A CD1   1 
ATOM   16   C  CD2   . LEU A 1 10  ? -29.120 32.863  -22.369 1.00 33.05 ? 2   LEU A CD2   1 
ATOM   17   N  N     . THR A 1 11  ? -31.132 29.304  -20.241 1.00 32.33 ? 3   THR A N     1 
ATOM   18   C  CA    . THR A 1 11  ? -30.664 27.951  -19.968 1.00 31.88 ? 3   THR A CA    1 
ATOM   19   C  C     . THR A 1 11  ? -30.085 27.330  -21.243 1.00 31.46 ? 3   THR A C     1 
ATOM   20   O  O     . THR A 1 11  ? -30.526 27.643  -22.350 1.00 31.34 ? 3   THR A O     1 
ATOM   21   C  CB    . THR A 1 11  ? -31.827 27.071  -19.419 1.00 31.95 ? 3   THR A CB    1 
ATOM   22   O  OG1   . THR A 1 11  ? -32.308 27.629  -18.189 1.00 32.10 ? 3   THR A OG1   1 
ATOM   23   C  CG2   . THR A 1 11  ? -31.376 25.637  -19.175 1.00 32.29 ? 3   THR A CG2   1 
ATOM   24   N  N     . THR A 1 12  ? -29.076 26.477  -21.082 1.00 30.92 ? 4   THR A N     1 
ATOM   25   C  CA    . THR A 1 12  ? -28.470 25.782  -22.210 1.00 30.31 ? 4   THR A CA    1 
ATOM   26   C  C     . THR A 1 12  ? -28.627 24.268  -22.088 1.00 30.00 ? 4   THR A C     1 
ATOM   27   O  O     . THR A 1 12  ? -28.265 23.677  -21.068 1.00 29.88 ? 4   THR A O     1 
ATOM   28   C  CB    . THR A 1 12  ? -26.973 26.132  -22.353 1.00 30.34 ? 4   THR A CB    1 
ATOM   29   O  OG1   . THR A 1 12  ? -26.833 27.514  -22.701 1.00 30.40 ? 4   THR A OG1   1 
ATOM   30   C  CG2   . THR A 1 12  ? -26.320 25.276  -23.437 1.00 30.35 ? 4   THR A CG2   1 
ATOM   31   N  N     . LEU A 1 13  ? -29.171 23.647  -23.135 1.00 29.52 ? 5   LEU A N     1 
ATOM   32   C  CA    . LEU A 1 13  ? -29.246 22.191  -23.218 1.00 29.01 ? 5   LEU A CA    1 
ATOM   33   C  C     . LEU A 1 13  ? -28.447 21.670  -24.405 1.00 28.54 ? 5   LEU A C     1 
ATOM   34   O  O     . LEU A 1 13  ? -28.570 22.178  -25.520 1.00 28.64 ? 5   LEU A O     1 
ATOM   35   C  CB    . LEU A 1 13  ? -30.705 21.726  -23.315 1.00 29.14 ? 5   LEU A CB    1 
ATOM   36   C  CG    . LEU A 1 13  ? -30.946 20.210  -23.270 1.00 29.22 ? 5   LEU A CG    1 
ATOM   37   C  CD1   . LEU A 1 13  ? -32.149 19.886  -22.416 1.00 29.99 ? 5   LEU A CD1   1 
ATOM   38   C  CD2   . LEU A 1 13  ? -31.108 19.630  -24.671 1.00 30.00 ? 5   LEU A CD2   1 
ATOM   39   N  N     . ILE A 1 14  ? -27.624 20.655  -24.153 1.00 27.88 ? 6   ILE A N     1 
ATOM   40   C  CA    . ILE A 1 14  ? -26.839 20.011  -25.198 1.00 27.09 ? 6   ILE A CA    1 
ATOM   41   C  C     . ILE A 1 14  ? -27.017 18.492  -25.125 1.00 26.96 ? 6   ILE A C     1 
ATOM   42   O  O     . ILE A 1 14  ? -26.959 17.904  -24.042 1.00 26.82 ? 6   ILE A O     1 
ATOM   43   C  CB    . ILE A 1 14  ? -25.328 20.363  -25.074 1.00 27.11 ? 6   ILE A CB    1 
ATOM   44   C  CG1   . ILE A 1 14  ? -25.116 21.880  -25.152 1.00 26.96 ? 6   ILE A CG1   1 
ATOM   45   C  CG2   . ILE A 1 14  ? -24.519 19.658  -26.152 1.00 26.55 ? 6   ILE A CG2   1 
ATOM   46   C  CD1   . ILE A 1 14  ? -23.663 22.308  -25.044 1.00 26.78 ? 6   ILE A CD1   1 
ATOM   47   N  N     . TYR A 1 15  ? -27.255 17.866  -26.275 1.00 26.68 ? 7   TYR A N     1 
ATOM   48   C  CA    . TYR A 1 15  ? -27.321 16.408  -26.355 1.00 26.65 ? 7   TYR A CA    1 
ATOM   49   C  C     . TYR A 1 15  ? -26.652 15.890  -27.621 1.00 26.79 ? 7   TYR A C     1 
ATOM   50   O  O     . TYR A 1 15  ? -26.425 16.645  -28.568 1.00 26.89 ? 7   TYR A O     1 
ATOM   51   C  CB    . TYR A 1 15  ? -28.781 15.916  -26.291 1.00 26.38 ? 7   TYR A CB    1 
ATOM   52   C  CG    . TYR A 1 15  ? -29.586 16.206  -27.542 1.00 26.03 ? 7   TYR A CG    1 
ATOM   53   C  CD1   . TYR A 1 15  ? -29.521 15.359  -28.652 1.00 25.83 ? 7   TYR A CD1   1 
ATOM   54   C  CD2   . TYR A 1 15  ? -30.408 17.323  -27.617 1.00 25.84 ? 7   TYR A CD2   1 
ATOM   55   C  CE1   . TYR A 1 15  ? -30.240 15.629  -29.803 1.00 25.19 ? 7   TYR A CE1   1 
ATOM   56   C  CE2   . TYR A 1 15  ? -31.141 17.596  -28.759 1.00 25.50 ? 7   TYR A CE2   1 
ATOM   57   C  CZ    . TYR A 1 15  ? -31.049 16.747  -29.852 1.00 25.57 ? 7   TYR A CZ    1 
ATOM   58   O  OH    . TYR A 1 15  ? -31.771 17.020  -30.991 1.00 25.08 ? 7   TYR A OH    1 
ATOM   59   N  N     . ARG A 1 16  ? -26.350 14.597  -27.637 1.00 27.02 ? 8   ARG A N     1 
ATOM   60   C  CA    . ARG A 1 16  ? -25.986 13.917  -28.867 1.00 27.48 ? 8   ARG A CA    1 
ATOM   61   C  C     . ARG A 1 16  ? -26.921 12.729  -29.119 1.00 27.79 ? 8   ARG A C     1 
ATOM   62   O  O     . ARG A 1 16  ? -27.477 12.157  -28.183 1.00 27.69 ? 8   ARG A O     1 
ATOM   63   C  CB    . ARG A 1 16  ? -24.516 13.473  -28.836 1.00 27.23 ? 8   ARG A CB    1 
ATOM   64   C  CG    . ARG A 1 16  ? -24.245 12.221  -28.020 1.00 27.84 ? 8   ARG A CG    1 
ATOM   65   C  CD    . ARG A 1 16  ? -22.852 11.650  -28.306 1.00 27.95 ? 8   ARG A CD    1 
ATOM   66   N  NE    . ARG A 1 16  ? -21.824 12.273  -27.476 1.00 28.86 ? 8   ARG A NE    1 
ATOM   67   C  CZ    . ARG A 1 16  ? -21.562 11.924  -26.218 1.00 28.91 ? 8   ARG A CZ    1 
ATOM   68   N  NH1   . ARG A 1 16  ? -22.255 10.955  -25.635 1.00 28.50 ? 8   ARG A NH1   1 
ATOM   69   N  NH2   . ARG A 1 16  ? -20.612 12.553  -25.536 1.00 29.50 ? 8   ARG A NH2   1 
ATOM   70   N  N     . SER A 1 17  ? -27.116 12.391  -30.390 1.00 28.38 ? 9   SER A N     1 
ATOM   71   C  CA    . SER A 1 17  ? -27.963 11.259  -30.769 1.00 28.96 ? 9   SER A CA    1 
ATOM   72   C  C     . SER A 1 17  ? -27.446 10.603  -32.043 1.00 29.60 ? 9   SER A C     1 
ATOM   73   O  O     . SER A 1 17  ? -26.518 11.104  -32.669 1.00 29.70 ? 9   SER A O     1 
ATOM   74   C  CB    . SER A 1 17  ? -29.408 11.714  -30.965 1.00 28.86 ? 9   SER A CB    1 
ATOM   75   O  OG    . SER A 1 17  ? -29.506 12.639  -32.031 1.00 28.40 ? 9   SER A OG    1 
ATOM   76   N  N     . GLN A 1 18  ? -28.056 9.483   -32.424 1.00 30.41 ? 10  GLN A N     1 
ATOM   77   C  CA    . GLN A 1 18  ? -27.639 8.746   -33.619 1.00 31.22 ? 10  GLN A CA    1 
ATOM   78   C  C     . GLN A 1 18  ? -28.770 8.622   -34.620 1.00 31.46 ? 10  GLN A C     1 
ATOM   79   O  O     . GLN A 1 18  ? -29.935 8.576   -34.241 1.00 31.50 ? 10  GLN A O     1 
ATOM   80   C  CB    . GLN A 1 18  ? -27.157 7.346   -33.243 1.00 31.34 ? 10  GLN A CB    1 
ATOM   81   C  CG    . GLN A 1 18  ? -26.008 7.316   -32.267 1.00 32.59 ? 10  GLN A CG    1 
ATOM   82   C  CD    . GLN A 1 18  ? -25.630 5.907   -31.876 1.00 33.97 ? 10  GLN A CD    1 
ATOM   83   O  OE1   . GLN A 1 18  ? -25.470 5.035   -32.735 1.00 34.63 ? 10  GLN A OE1   1 
ATOM   84   N  NE2   . GLN A 1 18  ? -25.481 5.672   -30.574 1.00 33.97 ? 10  GLN A NE2   1 
ATOM   85   N  N     . VAL A 1 19  ? -28.416 8.533   -35.900 1.00 31.97 ? 11  VAL A N     1 
ATOM   86   C  CA    . VAL A 1 19  ? -29.377 8.161   -36.943 1.00 32.33 ? 11  VAL A CA    1 
ATOM   87   C  C     . VAL A 1 19  ? -29.676 6.662   -36.901 1.00 32.62 ? 11  VAL A C     1 
ATOM   88   O  O     . VAL A 1 19  ? -28.875 5.874   -36.389 1.00 32.53 ? 11  VAL A O     1 
ATOM   89   C  CB    . VAL A 1 19  ? -28.854 8.516   -38.358 1.00 32.29 ? 11  VAL A CB    1 
ATOM   90   C  CG1   . VAL A 1 19  ? -28.635 9.998   -38.487 1.00 32.46 ? 11  VAL A CG1   1 
ATOM   91   C  CG2   . VAL A 1 19  ? -27.565 7.748   -38.669 1.00 32.19 ? 11  VAL A CG2   1 
ATOM   92   N  N     . HIS A 1 20  ? -30.832 6.277   -37.433 1.00 33.07 ? 12  HIS A N     1 
ATOM   93   C  CA    . HIS A 1 20  ? -31.102 4.877   -37.747 1.00 33.69 ? 12  HIS A CA    1 
ATOM   94   C  C     . HIS A 1 20  ? -30.434 4.514   -39.076 1.00 34.27 ? 12  HIS A C     1 
ATOM   95   O  O     . HIS A 1 20  ? -30.871 4.967   -40.135 1.00 34.29 ? 12  HIS A O     1 
ATOM   96   C  CB    . HIS A 1 20  ? -32.605 4.630   -37.834 1.00 33.65 ? 12  HIS A CB    1 
ATOM   97   C  CG    . HIS A 1 20  ? -33.315 4.746   -36.522 1.00 33.65 ? 12  HIS A CG    1 
ATOM   98   N  ND1   . HIS A 1 20  ? -33.506 3.671   -35.681 1.00 33.55 ? 12  HIS A ND1   1 
ATOM   99   C  CD2   . HIS A 1 20  ? -33.891 5.808   -35.912 1.00 33.51 ? 12  HIS A CD2   1 
ATOM   100  C  CE1   . HIS A 1 20  ? -34.166 4.067   -34.607 1.00 33.07 ? 12  HIS A CE1   1 
ATOM   101  N  NE2   . HIS A 1 20  ? -34.414 5.358   -34.723 1.00 33.03 ? 12  HIS A NE2   1 
ATOM   102  N  N     . PRO A 1 21  ? -29.379 3.680   -39.020 1.00 34.89 ? 13  PRO A N     1 
ATOM   103  C  CA    . PRO A 1 21  ? -28.431 3.516   -40.125 1.00 35.43 ? 13  PRO A CA    1 
ATOM   104  C  C     . PRO A 1 21  ? -28.950 2.638   -41.270 1.00 36.11 ? 13  PRO A C     1 
ATOM   105  O  O     . PRO A 1 21  ? -28.418 2.695   -42.378 1.00 36.30 ? 13  PRO A O     1 
ATOM   106  C  CB    . PRO A 1 21  ? -27.234 2.854   -39.452 1.00 35.26 ? 13  PRO A CB    1 
ATOM   107  C  CG    . PRO A 1 21  ? -27.828 2.056   -38.353 1.00 35.20 ? 13  PRO A CG    1 
ATOM   108  C  CD    . PRO A 1 21  ? -29.039 2.818   -37.872 1.00 34.91 ? 13  PRO A CD    1 
ATOM   109  N  N     . ASP A 1 22  ? -29.971 1.832   -40.999 1.00 36.91 ? 14  ASP A N     1 
ATOM   110  C  CA    . ASP A 1 22  ? -30.543 0.948   -42.020 1.00 37.58 ? 14  ASP A CA    1 
ATOM   111  C  C     . ASP A 1 22  ? -31.882 1.471   -42.544 1.00 37.70 ? 14  ASP A C     1 
ATOM   112  O  O     . ASP A 1 22  ? -32.578 0.783   -43.290 1.00 37.82 ? 14  ASP A O     1 
ATOM   113  C  CB    . ASP A 1 22  ? -30.697 -0.480  -41.478 1.00 37.75 ? 14  ASP A CB    1 
ATOM   114  C  CG    . ASP A 1 22  ? -31.142 -0.515  -40.010 1.00 38.84 ? 14  ASP A CG    1 
ATOM   115  O  OD1   . ASP A 1 22  ? -31.978 0.331   -39.604 1.00 39.64 ? 14  ASP A OD1   1 
ATOM   116  O  OD2   . ASP A 1 22  ? -30.659 -1.399  -39.269 1.00 39.84 ? 14  ASP A OD2   1 
ATOM   117  N  N     . ARG A 1 23  ? -32.229 2.694   -42.149 1.00 37.88 ? 15  ARG A N     1 
ATOM   118  C  CA    . ARG A 1 23  ? -33.468 3.337   -42.589 1.00 37.94 ? 15  ARG A CA    1 
ATOM   119  C  C     . ARG A 1 23  ? -33.168 4.430   -43.619 1.00 37.95 ? 15  ARG A C     1 
ATOM   120  O  O     . ARG A 1 23  ? -32.032 4.909   -43.700 1.00 37.96 ? 15  ARG A O     1 
ATOM   121  C  CB    . ARG A 1 23  ? -34.212 3.929   -41.386 1.00 37.90 ? 15  ARG A CB    1 
ATOM   122  C  CG    . ARG A 1 23  ? -34.744 2.887   -40.422 1.00 38.31 ? 15  ARG A CG    1 
ATOM   123  C  CD    . ARG A 1 23  ? -35.693 3.495   -39.416 1.00 38.84 ? 15  ARG A CD    1 
ATOM   124  N  NE    . ARG A 1 23  ? -36.000 2.565   -38.334 1.00 39.27 ? 15  ARG A NE    1 
ATOM   125  C  CZ    . ARG A 1 23  ? -36.658 2.893   -37.227 1.00 39.41 ? 15  ARG A CZ    1 
ATOM   126  N  NH1   . ARG A 1 23  ? -37.082 4.138   -37.046 1.00 39.39 ? 15  ARG A NH1   1 
ATOM   127  N  NH2   . ARG A 1 23  ? -36.892 1.977   -36.298 1.00 39.52 ? 15  ARG A NH2   1 
ATOM   128  N  N     . PRO A 1 24  ? -34.187 4.821   -44.423 1.00 37.93 ? 16  PRO A N     1 
ATOM   129  C  CA    . PRO A 1 24  ? -34.027 5.916   -45.390 1.00 37.76 ? 16  PRO A CA    1 
ATOM   130  C  C     . PRO A 1 24  ? -33.547 7.199   -44.717 1.00 37.58 ? 16  PRO A C     1 
ATOM   131  O  O     . PRO A 1 24  ? -33.948 7.484   -43.587 1.00 37.56 ? 16  PRO A O     1 
ATOM   132  C  CB    . PRO A 1 24  ? -35.451 6.108   -45.950 1.00 37.77 ? 16  PRO A CB    1 
ATOM   133  C  CG    . PRO A 1 24  ? -36.357 5.377   -44.992 1.00 37.92 ? 16  PRO A CG    1 
ATOM   134  C  CD    . PRO A 1 24  ? -35.545 4.250   -44.470 1.00 37.95 ? 16  PRO A CD    1 
ATOM   135  N  N     . PRO A 1 25  ? -32.671 7.961   -45.401 1.00 37.43 ? 17  PRO A N     1 
ATOM   136  C  CA    . PRO A 1 25  ? -32.094 9.181   -44.835 1.00 37.18 ? 17  PRO A CA    1 
ATOM   137  C  C     . PRO A 1 25  ? -33.155 10.228  -44.523 1.00 37.00 ? 17  PRO A C     1 
ATOM   138  O  O     . PRO A 1 25  ? -34.122 10.378  -45.272 1.00 37.00 ? 17  PRO A O     1 
ATOM   139  C  CB    . PRO A 1 25  ? -31.162 9.683   -45.948 1.00 37.18 ? 17  PRO A CB    1 
ATOM   140  C  CG    . PRO A 1 25  ? -31.659 9.028   -47.196 1.00 37.37 ? 17  PRO A CG    1 
ATOM   141  C  CD    . PRO A 1 25  ? -32.182 7.700   -46.767 1.00 37.47 ? 17  PRO A CD    1 
ATOM   142  N  N     . VAL A 1 26  ? -32.977 10.927  -43.407 1.00 36.82 ? 18  VAL A N     1 
ATOM   143  C  CA    . VAL A 1 26  ? -33.887 11.992  -43.006 1.00 36.45 ? 18  VAL A CA    1 
ATOM   144  C  C     . VAL A 1 26  ? -33.590 13.270  -43.791 1.00 36.29 ? 18  VAL A C     1 
ATOM   145  O  O     . VAL A 1 26  ? -32.431 13.665  -43.941 1.00 36.37 ? 18  VAL A O     1 
ATOM   146  C  CB    . VAL A 1 26  ? -33.787 12.270  -41.484 1.00 36.50 ? 18  VAL A CB    1 
ATOM   147  C  CG1   . VAL A 1 26  ? -34.697 13.424  -41.081 1.00 36.46 ? 18  VAL A CG1   1 
ATOM   148  C  CG2   . VAL A 1 26  ? -34.129 11.014  -40.694 1.00 36.30 ? 18  VAL A CG2   1 
ATOM   149  N  N     . ASP A 1 27  ? -34.641 13.890  -44.318 1.00 36.00 ? 19  ASP A N     1 
ATOM   150  C  CA    . ASP A 1 27  ? -34.520 15.176  -44.989 1.00 35.72 ? 19  ASP A CA    1 
ATOM   151  C  C     . ASP A 1 27  ? -34.223 16.269  -43.964 1.00 35.34 ? 19  ASP A C     1 
ATOM   152  O  O     . ASP A 1 27  ? -35.133 16.790  -43.313 1.00 35.56 ? 19  ASP A O     1 
ATOM   153  C  CB    . ASP A 1 27  ? -35.810 15.494  -45.752 1.00 35.87 ? 19  ASP A CB    1 
ATOM   154  C  CG    . ASP A 1 27  ? -35.667 16.694  -46.672 1.00 36.61 ? 19  ASP A CG    1 
ATOM   155  O  OD1   . ASP A 1 27  ? -34.520 17.112  -46.948 1.00 37.58 ? 19  ASP A OD1   1 
ATOM   156  O  OD2   . ASP A 1 27  ? -36.708 17.218  -47.125 1.00 37.65 ? 19  ASP A OD2   1 
ATOM   157  N  N     . LEU A 1 28  ? -32.943 16.606  -43.819 1.00 34.65 ? 20  LEU A N     1 
ATOM   158  C  CA    . LEU A 1 28  ? -32.496 17.480  -42.737 1.00 33.92 ? 20  LEU A CA    1 
ATOM   159  C  C     . LEU A 1 28  ? -32.684 18.949  -43.051 1.00 33.58 ? 20  LEU A C     1 
ATOM   160  O  O     . LEU A 1 28  ? -32.866 19.760  -42.143 1.00 33.64 ? 20  LEU A O     1 
ATOM   161  C  CB    . LEU A 1 28  ? -31.036 17.202  -42.385 1.00 33.87 ? 20  LEU A CB    1 
ATOM   162  C  CG    . LEU A 1 28  ? -30.797 16.007  -41.475 1.00 33.70 ? 20  LEU A CG    1 
ATOM   163  C  CD1   . LEU A 1 28  ? -29.314 15.744  -41.331 1.00 33.80 ? 20  LEU A CD1   1 
ATOM   164  C  CD2   . LEU A 1 28  ? -31.449 16.233  -40.112 1.00 33.89 ? 20  LEU A CD2   1 
ATOM   165  N  N     . ASP A 1 29  ? -32.623 19.297  -44.335 1.00 33.02 ? 21  ASP A N     1 
ATOM   166  C  CA    . ASP A 1 29  ? -32.903 20.661  -44.770 1.00 32.46 ? 21  ASP A CA    1 
ATOM   167  C  C     . ASP A 1 29  ? -34.305 21.079  -44.346 1.00 31.83 ? 21  ASP A C     1 
ATOM   168  O  O     . ASP A 1 29  ? -34.510 22.191  -43.858 1.00 31.68 ? 21  ASP A O     1 
ATOM   169  C  CB    . ASP A 1 29  ? -32.747 20.787  -46.289 1.00 32.70 ? 21  ASP A CB    1 
ATOM   170  C  CG    . ASP A 1 29  ? -31.289 20.889  -46.723 1.00 33.34 ? 21  ASP A CG    1 
ATOM   171  O  OD1   . ASP A 1 29  ? -30.552 21.731  -46.161 1.00 34.48 ? 21  ASP A OD1   1 
ATOM   172  O  OD2   . ASP A 1 29  ? -30.884 20.135  -47.633 1.00 33.87 ? 21  ASP A OD2   1 
ATOM   173  N  N     . ALA A 1 30  ? -35.260 20.168  -44.512 1.00 31.12 ? 22  ALA A N     1 
ATOM   174  C  CA    . ALA A 1 30  ? -36.632 20.393  -44.080 1.00 30.64 ? 22  ALA A CA    1 
ATOM   175  C  C     . ALA A 1 30  ? -36.731 20.437  -42.559 1.00 30.35 ? 22  ALA A C     1 
ATOM   176  O  O     . ALA A 1 30  ? -37.441 21.274  -42.004 1.00 30.15 ? 22  ALA A O     1 
ATOM   177  C  CB    . ALA A 1 30  ? -37.551 19.316  -44.642 1.00 30.53 ? 22  ALA A CB    1 
ATOM   178  N  N     . LEU A 1 31  ? -36.013 19.531  -41.894 1.00 30.00 ? 23  LEU A N     1 
ATOM   179  C  CA    . LEU A 1 31  ? -35.998 19.467  -40.433 1.00 29.81 ? 23  LEU A CA    1 
ATOM   180  C  C     . LEU A 1 31  ? -35.495 20.768  -39.837 1.00 29.67 ? 23  LEU A C     1 
ATOM   181  O  O     . LEU A 1 31  ? -36.110 21.318  -38.927 1.00 29.42 ? 23  LEU A O     1 
ATOM   182  C  CB    . LEU A 1 31  ? -35.122 18.298  -39.950 1.00 29.96 ? 23  LEU A CB    1 
ATOM   183  C  CG    . LEU A 1 31  ? -35.282 17.808  -38.496 1.00 30.09 ? 23  LEU A CG    1 
ATOM   184  C  CD1   . LEU A 1 31  ? -34.866 16.349  -38.379 1.00 29.56 ? 23  LEU A CD1   1 
ATOM   185  C  CD2   . LEU A 1 31  ? -34.497 18.669  -37.499 1.00 29.71 ? 23  LEU A CD2   1 
ATOM   186  N  N     . VAL A 1 32  ? -34.376 21.258  -40.362 1.00 29.57 ? 24  VAL A N     1 
ATOM   187  C  CA    . VAL A 1 32  ? -33.698 22.413  -39.788 1.00 29.67 ? 24  VAL A CA    1 
ATOM   188  C  C     . VAL A 1 32  ? -34.467 23.704  -40.030 1.00 29.68 ? 24  VAL A C     1 
ATOM   189  O  O     . VAL A 1 32  ? -34.582 24.542  -39.131 1.00 29.78 ? 24  VAL A O     1 
ATOM   190  C  CB    . VAL A 1 32  ? -32.247 22.538  -40.311 1.00 29.67 ? 24  VAL A CB    1 
ATOM   191  C  CG1   . VAL A 1 32  ? -31.648 23.889  -39.940 1.00 29.48 ? 24  VAL A CG1   1 
ATOM   192  C  CG2   . VAL A 1 32  ? -31.397 21.410  -39.758 1.00 29.75 ? 24  VAL A CG2   1 
ATOM   193  N  N     . HIS A 1 33  ? -35.011 23.854  -41.234 1.00 29.70 ? 25  HIS A N     1 
ATOM   194  C  CA    . HIS A 1 33  ? -35.795 25.038  -41.563 1.00 29.91 ? 25  HIS A CA    1 
ATOM   195  C  C     . HIS A 1 33  ? -37.072 25.106  -40.734 1.00 29.68 ? 25  HIS A C     1 
ATOM   196  O  O     . HIS A 1 33  ? -37.417 26.157  -40.199 1.00 29.67 ? 25  HIS A O     1 
ATOM   197  C  CB    . HIS A 1 33  ? -36.139 25.082  -43.050 1.00 30.06 ? 25  HIS A CB    1 
ATOM   198  C  CG    . HIS A 1 33  ? -37.174 26.107  -43.389 1.00 31.06 ? 25  HIS A CG    1 
ATOM   199  N  ND1   . HIS A 1 33  ? -36.887 27.453  -43.476 1.00 32.08 ? 25  HIS A ND1   1 
ATOM   200  C  CD2   . HIS A 1 33  ? -38.506 25.991  -43.608 1.00 31.99 ? 25  HIS A CD2   1 
ATOM   201  C  CE1   . HIS A 1 33  ? -37.992 28.119  -43.759 1.00 32.79 ? 25  HIS A CE1   1 
ATOM   202  N  NE2   . HIS A 1 33  ? -38.990 27.256  -43.842 1.00 32.68 ? 25  HIS A NE2   1 
ATOM   203  N  N     . ARG A 1 34  ? -37.772 23.978  -40.646 1.00 29.45 ? 26  ARG A N     1 
ATOM   204  C  CA    . ARG A 1 34  ? -38.970 23.865  -39.820 1.00 29.41 ? 26  ARG A CA    1 
ATOM   205  C  C     . ARG A 1 34  ? -38.646 24.129  -38.342 1.00 29.05 ? 26  ARG A C     1 
ATOM   206  O  O     . ARG A 1 34  ? -39.441 24.745  -37.621 1.00 28.88 ? 26  ARG A O     1 
ATOM   207  C  CB    . ARG A 1 34  ? -39.597 22.477  -39.990 1.00 29.57 ? 26  ARG A CB    1 
ATOM   208  C  CG    . ARG A 1 34  ? -41.030 22.372  -39.517 1.00 30.97 ? 26  ARG A CG    1 
ATOM   209  C  CD    . ARG A 1 34  ? -41.662 21.050  -39.942 1.00 33.33 ? 26  ARG A CD    1 
ATOM   210  N  NE    . ARG A 1 34  ? -42.910 20.787  -39.224 1.00 35.09 ? 26  ARG A NE    1 
ATOM   211  C  CZ    . ARG A 1 34  ? -44.110 21.195  -39.632 1.00 36.66 ? 26  ARG A CZ    1 
ATOM   212  N  NH1   . ARG A 1 34  ? -44.232 21.883  -40.764 1.00 37.51 ? 26  ARG A NH1   1 
ATOM   213  N  NH2   . ARG A 1 34  ? -45.191 20.912  -38.912 1.00 37.09 ? 26  ARG A NH2   1 
ATOM   214  N  N     . ALA A 1 35  ? -37.466 23.679  -37.911 1.00 28.55 ? 27  ALA A N     1 
ATOM   215  C  CA    . ALA A 1 35  ? -37.012 23.878  -36.540 1.00 28.13 ? 27  ALA A CA    1 
ATOM   216  C  C     . ALA A 1 35  ? -36.699 25.337  -36.262 1.00 27.81 ? 27  ALA A C     1 
ATOM   217  O  O     . ALA A 1 35  ? -37.119 25.882  -35.244 1.00 27.66 ? 27  ALA A O     1 
ATOM   218  C  CB    . ALA A 1 35  ? -35.794 23.008  -36.249 1.00 28.18 ? 27  ALA A CB    1 
ATOM   219  N  N     . SER A 1 36  ? -35.967 25.970  -37.177 1.00 27.40 ? 28  SER A N     1 
ATOM   220  C  CA    . SER A 1 36  ? -35.578 27.370  -37.021 1.00 27.03 ? 28  SER A CA    1 
ATOM   221  C  C     . SER A 1 36  ? -36.810 28.264  -37.005 1.00 26.79 ? 28  SER A C     1 
ATOM   222  O  O     . SER A 1 36  ? -36.886 29.231  -36.237 1.00 26.76 ? 28  SER A O     1 
ATOM   223  C  CB    . SER A 1 36  ? -34.634 27.792  -38.148 1.00 27.12 ? 28  SER A CB    1 
ATOM   224  O  OG    . SER A 1 36  ? -33.870 28.929  -37.781 1.00 26.82 ? 28  SER A OG    1 
ATOM   225  N  N     . SER A 1 37  ? -37.784 27.912  -37.836 1.00 26.38 ? 29  SER A N     1 
ATOM   226  C  CA    . SER A 1 37  ? -39.042 28.631  -37.905 1.00 26.09 ? 29  SER A CA    1 
ATOM   227  C  C     . SER A 1 37  ? -39.827 28.510  -36.598 1.00 25.74 ? 29  SER A C     1 
ATOM   228  O  O     . SER A 1 37  ? -40.482 29.453  -36.172 1.00 25.78 ? 29  SER A O     1 
ATOM   229  C  CB    . SER A 1 37  ? -39.879 28.115  -39.074 1.00 25.93 ? 29  SER A CB    1 
ATOM   230  O  OG    . SER A 1 37  ? -40.916 29.018  -39.388 1.00 26.39 ? 29  SER A OG    1 
ATOM   231  N  N     . LYS A 1 38  ? -39.735 27.353  -35.958 1.00 25.45 ? 30  LYS A N     1 
ATOM   232  C  CA    . LYS A 1 38  ? -40.484 27.101  -34.733 1.00 25.44 ? 30  LYS A CA    1 
ATOM   233  C  C     . LYS A 1 38  ? -39.754 27.627  -33.489 1.00 25.24 ? 30  LYS A C     1 
ATOM   234  O  O     . LYS A 1 38  ? -40.388 28.102  -32.546 1.00 25.34 ? 30  LYS A O     1 
ATOM   235  C  CB    . LYS A 1 38  ? -40.777 25.605  -34.587 1.00 25.58 ? 30  LYS A CB    1 
ATOM   236  C  CG    . LYS A 1 38  ? -41.938 25.279  -33.669 1.00 25.96 ? 30  LYS A CG    1 
ATOM   237  C  CD    . LYS A 1 38  ? -42.192 23.781  -33.620 1.00 27.08 ? 30  LYS A CD    1 
ATOM   238  C  CE    . LYS A 1 38  ? -43.032 23.408  -32.415 1.00 27.89 ? 30  LYS A CE    1 
ATOM   239  N  NZ    . LYS A 1 38  ? -42.919 21.960  -32.086 1.00 29.30 ? 30  LYS A NZ    1 
ATOM   240  N  N     . ASN A 1 39  ? -38.424 27.556  -33.507 1.00 24.98 ? 31  ASN A N     1 
ATOM   241  C  CA    . ASN A 1 39  ? -37.604 27.901  -32.338 1.00 24.49 ? 31  ASN A CA    1 
ATOM   242  C  C     . ASN A 1 39  ? -37.616 29.388  -31.992 1.00 24.37 ? 31  ASN A C     1 
ATOM   243  O  O     . ASN A 1 39  ? -37.760 29.761  -30.828 1.00 24.45 ? 31  ASN A O     1 
ATOM   244  C  CB    . ASN A 1 39  ? -36.159 27.436  -32.540 1.00 24.40 ? 31  ASN A CB    1 
ATOM   245  C  CG    . ASN A 1 39  ? -35.996 25.943  -32.378 1.00 24.08 ? 31  ASN A CG    1 
ATOM   246  O  OD1   . ASN A 1 39  ? -36.942 25.233  -32.039 1.00 24.20 ? 31  ASN A OD1   1 
ATOM   247  N  ND2   . ASN A 1 39  ? -34.787 25.453  -32.624 1.00 23.89 ? 31  ASN A ND2   1 
ATOM   248  N  N     . LEU A 1 40  ? -37.463 30.231  -33.005 1.00 24.11 ? 32  LEU A N     1 
ATOM   249  C  CA    . LEU A 1 40  ? -37.220 31.660  -32.782 1.00 24.20 ? 32  LEU A CA    1 
ATOM   250  C  C     . LEU A 1 40  ? -38.377 32.434  -32.096 1.00 23.93 ? 32  LEU A C     1 
ATOM   251  O  O     . LEU A 1 40  ? -38.128 33.226  -31.188 1.00 24.07 ? 32  LEU A O     1 
ATOM   252  C  CB    . LEU A 1 40  ? -36.769 32.357  -34.075 1.00 24.03 ? 32  LEU A CB    1 
ATOM   253  C  CG    . LEU A 1 40  ? -35.750 33.487  -33.901 1.00 24.43 ? 32  LEU A CG    1 
ATOM   254  C  CD1   . LEU A 1 40  ? -34.451 32.968  -33.303 1.00 23.70 ? 32  LEU A CD1   1 
ATOM   255  C  CD2   . LEU A 1 40  ? -35.486 34.173  -35.218 1.00 24.59 ? 32  LEU A CD2   1 
ATOM   256  N  N     . PRO A 1 41  ? -39.641 32.208  -32.532 1.00 23.83 ? 33  PRO A N     1 
ATOM   257  C  CA    . PRO A 1 41  ? -40.759 32.853  -31.833 1.00 23.55 ? 33  PRO A CA    1 
ATOM   258  C  C     . PRO A 1 41  ? -40.832 32.438  -30.367 1.00 23.44 ? 33  PRO A C     1 
ATOM   259  O  O     . PRO A 1 41  ? -41.212 33.240  -29.517 1.00 23.41 ? 33  PRO A O     1 
ATOM   260  C  CB    . PRO A 1 41  ? -41.989 32.332  -32.583 1.00 23.52 ? 33  PRO A CB    1 
ATOM   261  C  CG    . PRO A 1 41  ? -41.477 31.919  -33.913 1.00 23.87 ? 33  PRO A CG    1 
ATOM   262  C  CD    . PRO A 1 41  ? -40.106 31.400  -33.673 1.00 23.76 ? 33  PRO A CD    1 
ATOM   263  N  N     . LEU A 1 42  ? -40.445 31.197  -30.079 1.00 23.19 ? 34  LEU A N     1 
ATOM   264  C  CA    . LEU A 1 42  ? -40.494 30.669  -28.718 1.00 22.85 ? 34  LEU A CA    1 
ATOM   265  C  C     . LEU A 1 42  ? -39.240 31.018  -27.916 1.00 22.63 ? 34  LEU A C     1 
ATOM   266  O  O     . LEU A 1 42  ? -39.041 30.508  -26.819 1.00 22.60 ? 34  LEU A O     1 
ATOM   267  C  CB    . LEU A 1 42  ? -40.689 29.152  -28.739 1.00 22.72 ? 34  LEU A CB    1 
ATOM   268  C  CG    . LEU A 1 42  ? -42.002 28.610  -29.299 1.00 22.75 ? 34  LEU A CG    1 
ATOM   269  C  CD1   . LEU A 1 42  ? -41.897 27.106  -29.502 1.00 22.60 ? 34  LEU A CD1   1 
ATOM   270  C  CD2   . LEU A 1 42  ? -43.190 28.960  -28.392 1.00 22.44 ? 34  LEU A CD2   1 
ATOM   271  N  N     . GLY A 1 43  ? -38.398 31.881  -28.473 1.00 22.50 ? 35  GLY A N     1 
ATOM   272  C  CA    . GLY A 1 43  ? -37.151 32.270  -27.820 1.00 22.48 ? 35  GLY A CA    1 
ATOM   273  C  C     . GLY A 1 43  ? -36.168 31.117  -27.667 1.00 22.53 ? 35  GLY A C     1 
ATOM   274  O  O     . GLY A 1 43  ? -35.476 31.012  -26.653 1.00 22.51 ? 35  GLY A O     1 
ATOM   275  N  N     . ILE A 1 44  ? -36.120 30.241  -28.669 1.00 22.28 ? 36  ILE A N     1 
ATOM   276  C  CA    . ILE A 1 44  ? -35.156 29.145  -28.681 1.00 22.11 ? 36  ILE A CA    1 
ATOM   277  C  C     . ILE A 1 44  ? -34.149 29.350  -29.801 1.00 22.11 ? 36  ILE A C     1 
ATOM   278  O  O     . ILE A 1 44  ? -34.522 29.645  -30.935 1.00 22.21 ? 36  ILE A O     1 
ATOM   279  C  CB    . ILE A 1 44  ? -35.848 27.760  -28.845 1.00 22.07 ? 36  ILE A CB    1 
ATOM   280  C  CG1   . ILE A 1 44  ? -36.921 27.565  -27.775 1.00 22.07 ? 36  ILE A CG1   1 
ATOM   281  C  CG2   . ILE A 1 44  ? -34.822 26.622  -28.781 1.00 21.72 ? 36  ILE A CG2   1 
ATOM   282  C  CD1   . ILE A 1 44  ? -37.799 26.347  -28.004 1.00 22.19 ? 36  ILE A CD1   1 
ATOM   283  N  N     . THR A 1 45  ? -32.870 29.227  -29.473 1.00 22.14 ? 37  THR A N     1 
ATOM   284  C  CA    . THR A 1 45  ? -31.815 29.327  -30.471 1.00 22.33 ? 37  THR A CA    1 
ATOM   285  C  C     . THR A 1 45  ? -30.861 28.152  -30.365 1.00 22.37 ? 37  THR A C     1 
ATOM   286  O  O     . THR A 1 45  ? -30.948 27.354  -29.431 1.00 22.51 ? 37  THR A O     1 
ATOM   287  C  CB    . THR A 1 45  ? -31.013 30.631  -30.321 1.00 22.24 ? 37  THR A CB    1 
ATOM   288  O  OG1   . THR A 1 45  ? -30.622 30.799  -28.955 1.00 22.58 ? 37  THR A OG1   1 
ATOM   289  C  CG2   . THR A 1 45  ? -31.842 31.826  -30.759 1.00 22.51 ? 37  THR A CG2   1 
ATOM   290  N  N     . GLY A 1 46  ? -29.947 28.049  -31.326 1.00 22.35 ? 38  GLY A N     1 
ATOM   291  C  CA    . GLY A 1 46  ? -28.880 27.055  -31.267 1.00 22.29 ? 38  GLY A CA    1 
ATOM   292  C  C     . GLY A 1 46  ? -28.507 26.480  -32.619 1.00 22.25 ? 38  GLY A C     1 
ATOM   293  O  O     . GLY A 1 46  ? -28.923 26.991  -33.664 1.00 22.29 ? 38  GLY A O     1 
ATOM   294  N  N     . ILE A 1 47  ? -27.721 25.406  -32.599 1.00 22.03 ? 39  ILE A N     1 
ATOM   295  C  CA    . ILE A 1 47  ? -27.211 24.806  -33.823 1.00 21.88 ? 39  ILE A CA    1 
ATOM   296  C  C     . ILE A 1 47  ? -27.314 23.288  -33.807 1.00 21.79 ? 39  ILE A C     1 
ATOM   297  O  O     . ILE A 1 47  ? -27.428 22.671  -32.750 1.00 21.74 ? 39  ILE A O     1 
ATOM   298  C  CB    . ILE A 1 47  ? -25.747 25.189  -34.074 1.00 21.91 ? 39  ILE A CB    1 
ATOM   299  C  CG1   . ILE A 1 47  ? -24.910 24.925  -32.824 1.00 22.03 ? 39  ILE A CG1   1 
ATOM   300  C  CG2   . ILE A 1 47  ? -25.640 26.640  -34.507 1.00 22.21 ? 39  ILE A CG2   1 
ATOM   301  C  CD1   . ILE A 1 47  ? -23.445 24.789  -33.098 1.00 22.62 ? 39  ILE A CD1   1 
ATOM   302  N  N     . LEU A 1 48  ? -27.271 22.695  -34.995 1.00 21.71 ? 40  LEU A N     1 
ATOM   303  C  CA    . LEU A 1 48  ? -27.249 21.254  -35.137 1.00 21.56 ? 40  LEU A CA    1 
ATOM   304  C  C     . LEU A 1 48  ? -25.960 20.820  -35.822 1.00 21.75 ? 40  LEU A C     1 
ATOM   305  O  O     . LEU A 1 48  ? -25.523 21.444  -36.782 1.00 21.98 ? 40  LEU A O     1 
ATOM   306  C  CB    . LEU A 1 48  ? -28.455 20.789  -35.949 1.00 21.47 ? 40  LEU A CB    1 
ATOM   307  C  CG    . LEU A 1 48  ? -28.701 19.288  -36.034 1.00 21.05 ? 40  LEU A CG    1 
ATOM   308  C  CD1   . LEU A 1 48  ? -28.760 18.679  -34.645 1.00 20.71 ? 40  LEU A CD1   1 
ATOM   309  C  CD2   . LEU A 1 48  ? -29.981 19.011  -36.798 1.00 21.26 ? 40  LEU A CD2   1 
ATOM   310  N  N     . LEU A 1 49  ? -25.342 19.765  -35.306 1.00 21.75 ? 41  LEU A N     1 
ATOM   311  C  CA    . LEU A 1 49  ? -24.132 19.222  -35.909 1.00 21.67 ? 41  LEU A CA    1 
ATOM   312  C  C     . LEU A 1 49  ? -24.362 17.796  -36.375 1.00 21.73 ? 41  LEU A C     1 
ATOM   313  O  O     . LEU A 1 49  ? -24.787 16.943  -35.597 1.00 21.51 ? 41  LEU A O     1 
ATOM   314  C  CB    . LEU A 1 49  ? -22.962 19.277  -34.924 1.00 21.59 ? 41  LEU A CB    1 
ATOM   315  C  CG    . LEU A 1 49  ? -21.913 20.370  -35.138 1.00 22.05 ? 41  LEU A CG    1 
ATOM   316  C  CD1   . LEU A 1 49  ? -22.538 21.756  -35.149 1.00 22.45 ? 41  LEU A CD1   1 
ATOM   317  C  CD2   . LEU A 1 49  ? -20.826 20.281  -34.084 1.00 21.64 ? 41  LEU A CD2   1 
ATOM   318  N  N     . PHE A 1 50  ? -24.086 17.548  -37.655 1.00 21.72 ? 42  PHE A N     1 
ATOM   319  C  CA    . PHE A 1 50  ? -24.271 16.232  -38.245 1.00 21.73 ? 42  PHE A CA    1 
ATOM   320  C  C     . PHE A 1 50  ? -22.958 15.730  -38.834 1.00 21.81 ? 42  PHE A C     1 
ATOM   321  O  O     . PHE A 1 50  ? -22.250 16.476  -39.512 1.00 21.86 ? 42  PHE A O     1 
ATOM   322  C  CB    . PHE A 1 50  ? -25.350 16.290  -39.320 1.00 21.84 ? 42  PHE A CB    1 
ATOM   323  C  CG    . PHE A 1 50  ? -25.717 14.952  -39.890 1.00 22.39 ? 42  PHE A CG    1 
ATOM   324  C  CD1   . PHE A 1 50  ? -26.031 13.887  -39.056 1.00 22.82 ? 42  PHE A CD1   1 
ATOM   325  C  CD2   . PHE A 1 50  ? -25.776 14.762  -41.266 1.00 22.83 ? 42  PHE A CD2   1 
ATOM   326  C  CE1   . PHE A 1 50  ? -26.380 12.649  -39.586 1.00 23.23 ? 42  PHE A CE1   1 
ATOM   327  C  CE2   . PHE A 1 50  ? -26.126 13.528  -41.801 1.00 22.80 ? 42  PHE A CE2   1 
ATOM   328  C  CZ    . PHE A 1 50  ? -26.434 12.474  -40.959 1.00 22.85 ? 42  PHE A CZ    1 
ATOM   329  N  N     . ASN A 1 51  ? -22.624 14.472  -38.553 1.00 21.83 ? 43  ASN A N     1 
ATOM   330  C  CA    . ASN A 1 51  ? -21.378 13.882  -39.046 1.00 22.02 ? 43  ASN A CA    1 
ATOM   331  C  C     . ASN A 1 51  ? -21.595 12.656  -39.923 1.00 22.42 ? 43  ASN A C     1 
ATOM   332  O  O     . ASN A 1 51  ? -20.640 12.013  -40.343 1.00 22.54 ? 43  ASN A O     1 
ATOM   333  C  CB    . ASN A 1 51  ? -20.425 13.551  -37.885 1.00 21.74 ? 43  ASN A CB    1 
ATOM   334  C  CG    . ASN A 1 51  ? -20.934 12.416  -37.003 1.00 21.06 ? 43  ASN A CG    1 
ATOM   335  O  OD1   . ASN A 1 51  ? -21.997 11.851  -37.241 1.00 20.47 ? 43  ASN A OD1   1 
ATOM   336  N  ND2   . ASN A 1 51  ? -20.170 12.089  -35.974 1.00 20.54 ? 43  ASN A ND2   1 
ATOM   337  N  N     . GLY A 1 52  ? -22.859 12.335  -40.188 1.00 23.00 ? 44  GLY A N     1 
ATOM   338  C  CA    . GLY A 1 52  ? -23.202 11.176  -41.007 1.00 23.55 ? 44  GLY A CA    1 
ATOM   339  C  C     . GLY A 1 52  ? -23.913 10.101  -40.210 1.00 24.13 ? 44  GLY A C     1 
ATOM   340  O  O     . GLY A 1 52  ? -24.822 9.434   -40.716 1.00 24.23 ? 44  GLY A O     1 
ATOM   341  N  N     . LEU A 1 53  ? -23.503 9.935   -38.954 1.00 24.51 ? 45  LEU A N     1 
ATOM   342  C  CA    . LEU A 1 53  ? -24.066 8.902   -38.092 1.00 24.76 ? 45  LEU A CA    1 
ATOM   343  C  C     . LEU A 1 53  ? -24.719 9.494   -36.858 1.00 24.72 ? 45  LEU A C     1 
ATOM   344  O  O     . LEU A 1 53  ? -25.605 8.882   -36.262 1.00 25.02 ? 45  LEU A O     1 
ATOM   345  C  CB    . LEU A 1 53  ? -22.988 7.904   -37.669 1.00 25.08 ? 45  LEU A CB    1 
ATOM   346  C  CG    . LEU A 1 53  ? -22.556 6.842   -38.679 1.00 25.61 ? 45  LEU A CG    1 
ATOM   347  C  CD1   . LEU A 1 53  ? -21.335 7.309   -39.464 1.00 26.55 ? 45  LEU A CD1   1 
ATOM   348  C  CD2   . LEU A 1 53  ? -22.259 5.533   -37.957 1.00 26.61 ? 45  LEU A CD2   1 
ATOM   349  N  N     . GLN A 1 54  ? -24.273 10.683  -36.467 1.00 24.51 ? 46  GLN A N     1 
ATOM   350  C  CA    . GLN A 1 54  ? -24.660 11.254  -35.182 1.00 24.18 ? 46  GLN A CA    1 
ATOM   351  C  C     . GLN A 1 54  ? -25.082 12.707  -35.284 1.00 23.79 ? 46  GLN A C     1 
ATOM   352  O  O     . GLN A 1 54  ? -24.553 13.466  -36.099 1.00 23.66 ? 46  GLN A O     1 
ATOM   353  C  CB    . GLN A 1 54  ? -23.518 11.127  -34.183 1.00 24.26 ? 46  GLN A CB    1 
ATOM   354  C  CG    . GLN A 1 54  ? -23.189 9.709   -33.805 1.00 25.13 ? 46  GLN A CG    1 
ATOM   355  C  CD    . GLN A 1 54  ? -21.717 9.507   -33.608 1.00 26.69 ? 46  GLN A CD    1 
ATOM   356  O  OE1   . GLN A 1 54  ? -20.963 9.375   -34.572 1.00 27.31 ? 46  GLN A OE1   1 
ATOM   357  N  NE2   . GLN A 1 54  ? -21.287 9.492   -32.354 1.00 27.32 ? 46  GLN A NE2   1 
ATOM   358  N  N     . PHE A 1 55  ? -26.034 13.094  -34.440 1.00 23.32 ? 47  PHE A N     1 
ATOM   359  C  CA    . PHE A 1 55  ? -26.390 14.494  -34.281 1.00 22.69 ? 47  PHE A CA    1 
ATOM   360  C  C     . PHE A 1 55  ? -25.771 15.058  -33.020 1.00 22.56 ? 47  PHE A C     1 
ATOM   361  O  O     . PHE A 1 55  ? -25.450 14.320  -32.090 1.00 22.68 ? 47  PHE A O     1 
ATOM   362  C  CB    . PHE A 1 55  ? -27.903 14.669  -34.226 1.00 22.53 ? 47  PHE A CB    1 
ATOM   363  C  CG    . PHE A 1 55  ? -28.601 14.244  -35.468 1.00 22.29 ? 47  PHE A CG    1 
ATOM   364  C  CD1   . PHE A 1 55  ? -28.481 14.986  -36.636 1.00 22.46 ? 47  PHE A CD1   1 
ATOM   365  C  CD2   . PHE A 1 55  ? -29.384 13.101  -35.480 1.00 21.73 ? 47  PHE A CD2   1 
ATOM   366  C  CE1   . PHE A 1 55  ? -29.130 14.594  -37.791 1.00 21.91 ? 47  PHE A CE1   1 
ATOM   367  C  CE2   . PHE A 1 55  ? -30.033 12.704  -36.628 1.00 21.88 ? 47  PHE A CE2   1 
ATOM   368  C  CZ    . PHE A 1 55  ? -29.905 13.452  -37.790 1.00 22.24 ? 47  PHE A CZ    1 
ATOM   369  N  N     . PHE A 1 56  ? -25.611 16.375  -32.999 1.00 22.16 ? 48  PHE A N     1 
ATOM   370  C  CA    . PHE A 1 56  ? -25.161 17.093  -31.827 1.00 21.62 ? 48  PHE A CA    1 
ATOM   371  C  C     . PHE A 1 56  ? -25.848 18.448  -31.826 1.00 21.34 ? 48  PHE A C     1 
ATOM   372  O  O     . PHE A 1 56  ? -25.618 19.265  -32.716 1.00 21.14 ? 48  PHE A O     1 
ATOM   373  C  CB    . PHE A 1 56  ? -23.652 17.275  -31.887 1.00 21.72 ? 48  PHE A CB    1 
ATOM   374  C  CG    . PHE A 1 56  ? -23.064 17.909  -30.664 1.00 21.99 ? 48  PHE A CG    1 
ATOM   375  C  CD1   . PHE A 1 56  ? -22.951 19.286  -30.565 1.00 21.44 ? 48  PHE A CD1   1 
ATOM   376  C  CD2   . PHE A 1 56  ? -22.593 17.126  -29.619 1.00 22.44 ? 48  PHE A CD2   1 
ATOM   377  C  CE1   . PHE A 1 56  ? -22.396 19.869  -29.441 1.00 22.41 ? 48  PHE A CE1   1 
ATOM   378  C  CE2   . PHE A 1 56  ? -22.022 17.705  -28.502 1.00 22.72 ? 48  PHE A CE2   1 
ATOM   379  C  CZ    . PHE A 1 56  ? -21.923 19.076  -28.412 1.00 22.35 ? 48  PHE A CZ    1 
ATOM   380  N  N     . GLN A 1 57  ? -26.706 18.681  -30.841 1.00 20.99 ? 49  GLN A N     1 
ATOM   381  C  CA    . GLN A 1 57  ? -27.533 19.878  -30.844 1.00 20.80 ? 49  GLN A CA    1 
ATOM   382  C  C     . GLN A 1 57  ? -27.352 20.734  -29.599 1.00 20.97 ? 49  GLN A C     1 
ATOM   383  O  O     . GLN A 1 57  ? -27.327 20.228  -28.476 1.00 20.91 ? 49  GLN A O     1 
ATOM   384  C  CB    . GLN A 1 57  ? -29.009 19.521  -31.031 1.00 20.53 ? 49  GLN A CB    1 
ATOM   385  C  CG    . GLN A 1 57  ? -29.874 20.710  -31.418 1.00 20.18 ? 49  GLN A CG    1 
ATOM   386  C  CD    . GLN A 1 57  ? -31.289 20.322  -31.772 1.00 20.23 ? 49  GLN A CD    1 
ATOM   387  O  OE1   . GLN A 1 57  ? -31.833 19.354  -31.247 1.00 20.54 ? 49  GLN A OE1   1 
ATOM   388  N  NE2   . GLN A 1 57  ? -31.898 21.086  -32.658 1.00 20.17 ? 49  GLN A NE2   1 
ATOM   389  N  N     . VAL A 1 58  ? -27.233 22.038  -29.811 1.00 21.03 ? 50  VAL A N     1 
ATOM   390  C  CA    . VAL A 1 58  ? -27.206 22.991  -28.722 1.00 21.16 ? 50  VAL A CA    1 
ATOM   391  C  C     . VAL A 1 58  ? -28.514 23.775  -28.716 1.00 21.46 ? 50  VAL A C     1 
ATOM   392  O  O     . VAL A 1 58  ? -28.992 24.199  -29.766 1.00 21.55 ? 50  VAL A O     1 
ATOM   393  C  CB    . VAL A 1 58  ? -26.003 23.957  -28.851 1.00 21.05 ? 50  VAL A CB    1 
ATOM   394  C  CG1   . VAL A 1 58  ? -25.997 24.959  -27.710 1.00 20.85 ? 50  VAL A CG1   1 
ATOM   395  C  CG2   . VAL A 1 58  ? -24.701 23.175  -28.879 1.00 20.26 ? 50  VAL A CG2   1 
ATOM   396  N  N     . LEU A 1 59  ? -29.108 23.928  -27.536 1.00 21.64 ? 51  LEU A N     1 
ATOM   397  C  CA    . LEU A 1 59  ? -30.374 24.634  -27.405 1.00 22.07 ? 51  LEU A CA    1 
ATOM   398  C  C     . LEU A 1 59  ? -30.288 25.699  -26.330 1.00 22.57 ? 51  LEU A C     1 
ATOM   399  O  O     . LEU A 1 59  ? -29.795 25.445  -25.237 1.00 22.82 ? 51  LEU A O     1 
ATOM   400  C  CB    . LEU A 1 59  ? -31.507 23.655  -27.081 1.00 21.84 ? 51  LEU A CB    1 
ATOM   401  C  CG    . LEU A 1 59  ? -31.918 22.663  -28.175 1.00 21.94 ? 51  LEU A CG    1 
ATOM   402  C  CD1   . LEU A 1 59  ? -32.947 21.673  -27.646 1.00 21.62 ? 51  LEU A CD1   1 
ATOM   403  C  CD2   . LEU A 1 59  ? -32.450 23.388  -29.408 1.00 21.67 ? 51  LEU A CD2   1 
ATOM   404  N  N     . GLU A 1 60  ? -30.766 26.897  -26.651 1.00 23.06 ? 52  GLU A N     1 
ATOM   405  C  CA    . GLU A 1 60  ? -30.773 28.004  -25.708 1.00 23.51 ? 52  GLU A CA    1 
ATOM   406  C  C     . GLU A 1 60  ? -32.179 28.548  -25.556 1.00 23.89 ? 52  GLU A C     1 
ATOM   407  O  O     . GLU A 1 60  ? -32.904 28.691  -26.535 1.00 24.03 ? 52  GLU A O     1 
ATOM   408  C  CB    . GLU A 1 60  ? -29.831 29.117  -26.176 1.00 23.58 ? 52  GLU A CB    1 
ATOM   409  C  CG    . GLU A 1 60  ? -28.415 28.647  -26.508 1.00 23.79 ? 52  GLU A CG    1 
ATOM   410  C  CD    . GLU A 1 60  ? -27.486 29.788  -26.885 1.00 24.21 ? 52  GLU A CD    1 
ATOM   411  O  OE1   . GLU A 1 60  ? -27.731 30.456  -27.918 1.00 25.17 ? 52  GLU A OE1   1 
ATOM   412  O  OE2   . GLU A 1 60  ? -26.496 30.007  -26.158 1.00 25.49 ? 52  GLU A OE2   1 
ATOM   413  N  N     . GLY A 1 61  ? -32.560 28.854  -24.323 1.00 24.22 ? 53  GLY A N     1 
ATOM   414  C  CA    . GLY A 1 61  ? -33.897 29.346  -24.027 1.00 24.49 ? 53  GLY A CA    1 
ATOM   415  C  C     . GLY A 1 61  ? -34.197 29.168  -22.559 1.00 24.90 ? 53  GLY A C     1 
ATOM   416  O  O     . GLY A 1 61  ? -33.344 28.721  -21.804 1.00 24.90 ? 53  GLY A O     1 
ATOM   417  N  N     . THR A 1 62  ? -35.413 29.517  -22.149 1.00 25.28 ? 54  THR A N     1 
ATOM   418  C  CA    . THR A 1 62  ? -35.824 29.327  -20.764 1.00 25.63 ? 54  THR A CA    1 
ATOM   419  C  C     . THR A 1 62  ? -35.897 27.840  -20.425 1.00 26.32 ? 54  THR A C     1 
ATOM   420  O  O     . THR A 1 62  ? -36.023 26.994  -21.320 1.00 26.37 ? 54  THR A O     1 
ATOM   421  C  CB    . THR A 1 62  ? -37.190 29.985  -20.470 1.00 25.52 ? 54  THR A CB    1 
ATOM   422  O  OG1   . THR A 1 62  ? -38.211 29.343  -21.241 1.00 25.48 ? 54  THR A OG1   1 
ATOM   423  C  CG2   . THR A 1 62  ? -37.157 31.466  -20.801 1.00 24.73 ? 54  THR A CG2   1 
ATOM   424  N  N     . GLU A 1 63  ? -35.802 27.529  -19.132 1.00 26.88 ? 55  GLU A N     1 
ATOM   425  C  CA    . GLU A 1 63  ? -35.866 26.153  -18.645 1.00 27.51 ? 55  GLU A CA    1 
ATOM   426  C  C     . GLU A 1 63  ? -37.137 25.465  -19.145 1.00 27.76 ? 55  GLU A C     1 
ATOM   427  O  O     . GLU A 1 63  ? -37.114 24.292  -19.525 1.00 27.72 ? 55  GLU A O     1 
ATOM   428  C  CB    . GLU A 1 63  ? -35.816 26.140  -17.106 1.00 27.49 ? 55  GLU A CB    1 
ATOM   429  C  CG    . GLU A 1 63  ? -35.772 24.744  -16.465 1.00 28.05 ? 55  GLU A CG    1 
ATOM   430  C  CD    . GLU A 1 63  ? -35.807 24.789  -14.923 1.00 28.50 ? 55  GLU A CD    1 
ATOM   431  O  OE1   . GLU A 1 63  ? -35.551 25.866  -14.345 1.00 29.11 ? 55  GLU A OE1   1 
ATOM   432  O  OE2   . GLU A 1 63  ? -36.090 23.742  -14.297 1.00 29.55 ? 55  GLU A OE2   1 
ATOM   433  N  N     . GLU A 1 64  ? -38.231 26.222  -19.182 1.00 28.23 ? 56  GLU A N     1 
ATOM   434  C  CA    . GLU A 1 64  ? -39.547 25.682  -19.504 1.00 28.73 ? 56  GLU A CA    1 
ATOM   435  C  C     . GLU A 1 64  ? -39.716 25.418  -21.008 1.00 28.57 ? 56  GLU A C     1 
ATOM   436  O  O     . GLU A 1 64  ? -40.357 24.439  -21.408 1.00 28.63 ? 56  GLU A O     1 
ATOM   437  C  CB    . GLU A 1 64  ? -40.650 26.624  -18.992 1.00 28.93 ? 56  GLU A CB    1 
ATOM   438  C  CG    . GLU A 1 64  ? -40.994 26.461  -17.489 1.00 30.78 ? 56  GLU A CG    1 
ATOM   439  C  CD    . GLU A 1 64  ? -39.818 26.796  -16.546 1.00 33.30 ? 56  GLU A CD    1 
ATOM   440  O  OE1   . GLU A 1 64  ? -39.003 27.687  -16.886 1.00 34.06 ? 56  GLU A OE1   1 
ATOM   441  O  OE2   . GLU A 1 64  ? -39.722 26.169  -15.460 1.00 33.91 ? 56  GLU A OE2   1 
ATOM   442  N  N     . ALA A 1 65  ? -39.132 26.286  -21.833 1.00 28.40 ? 57  ALA A N     1 
ATOM   443  C  CA    . ALA A 1 65  ? -39.214 26.134  -23.287 1.00 28.26 ? 57  ALA A CA    1 
ATOM   444  C  C     . ALA A 1 65  ? -38.337 24.985  -23.784 1.00 28.20 ? 57  ALA A C     1 
ATOM   445  O  O     . ALA A 1 65  ? -38.670 24.319  -24.762 1.00 28.05 ? 57  ALA A O     1 
ATOM   446  C  CB    . ALA A 1 65  ? -38.835 27.433  -23.982 1.00 28.20 ? 57  ALA A CB    1 
ATOM   447  N  N     . LEU A 1 66  ? -37.220 24.758  -23.100 1.00 28.11 ? 58  LEU A N     1 
ATOM   448  C  CA    . LEU A 1 66  ? -36.287 23.713  -23.496 1.00 28.17 ? 58  LEU A CA    1 
ATOM   449  C  C     . LEU A 1 66  ? -36.768 22.344  -23.059 1.00 28.32 ? 58  LEU A C     1 
ATOM   450  O  O     . LEU A 1 66  ? -36.585 21.362  -23.771 1.00 28.52 ? 58  LEU A O     1 
ATOM   451  C  CB    . LEU A 1 66  ? -34.885 23.990  -22.943 1.00 27.95 ? 58  LEU A CB    1 
ATOM   452  C  CG    . LEU A 1 66  ? -34.137 25.170  -23.571 1.00 27.40 ? 58  LEU A CG    1 
ATOM   453  C  CD1   . LEU A 1 66  ? -32.661 25.117  -23.229 1.00 27.16 ? 58  LEU A CD1   1 
ATOM   454  C  CD2   . LEU A 1 66  ? -34.338 25.204  -25.078 1.00 26.77 ? 58  LEU A CD2   1 
ATOM   455  N  N     . GLU A 1 67  ? -37.391 22.283  -21.888 1.00 28.37 ? 59  GLU A N     1 
ATOM   456  C  CA    . GLU A 1 67  ? -37.954 21.037  -21.385 1.00 28.45 ? 59  GLU A CA    1 
ATOM   457  C  C     . GLU A 1 67  ? -39.016 20.513  -22.338 1.00 28.10 ? 59  GLU A C     1 
ATOM   458  O  O     . GLU A 1 67  ? -38.974 19.351  -22.751 1.00 28.17 ? 59  GLU A O     1 
ATOM   459  C  CB    . GLU A 1 67  ? -38.553 21.243  -19.989 1.00 28.68 ? 59  GLU A CB    1 
ATOM   460  C  CG    . GLU A 1 67  ? -38.763 19.957  -19.200 1.00 29.66 ? 59  GLU A CG    1 
ATOM   461  C  CD    . GLU A 1 67  ? -38.709 20.182  -17.693 1.00 31.53 ? 59  GLU A CD    1 
ATOM   462  O  OE1   . GLU A 1 67  ? -39.186 21.246  -17.226 1.00 31.69 ? 59  GLU A OE1   1 
ATOM   463  O  OE2   . GLU A 1 67  ? -38.189 19.293  -16.976 1.00 31.59 ? 59  GLU A OE2   1 
ATOM   464  N  N     . SER A 1 68  ? -39.949 21.387  -22.706 1.00 27.67 ? 60  SER A N     1 
ATOM   465  C  CA    . SER A 1 68  ? -41.054 21.021  -23.589 1.00 27.44 ? 60  SER A CA    1 
ATOM   466  C  C     . SER A 1 68  ? -40.578 20.615  -24.989 1.00 27.05 ? 60  SER A C     1 
ATOM   467  O  O     . SER A 1 68  ? -41.181 19.757  -25.631 1.00 27.04 ? 60  SER A O     1 
ATOM   468  C  CB    . SER A 1 68  ? -42.057 22.169  -23.691 1.00 27.45 ? 60  SER A CB    1 
ATOM   469  O  OG    . SER A 1 68  ? -43.053 21.882  -24.653 1.00 27.84 ? 60  SER A OG    1 
ATOM   470  N  N     . LEU A 1 69  ? -39.497 21.239  -25.450 1.00 26.66 ? 61  LEU A N     1 
ATOM   471  C  CA    . LEU A 1 69  ? -38.932 20.938  -26.762 1.00 26.17 ? 61  LEU A CA    1 
ATOM   472  C  C     . LEU A 1 69  ? -38.166 19.615  -26.752 1.00 26.11 ? 61  LEU A C     1 
ATOM   473  O  O     . LEU A 1 69  ? -38.250 18.828  -27.702 1.00 26.08 ? 61  LEU A O     1 
ATOM   474  C  CB    . LEU A 1 69  ? -38.016 22.075  -27.228 1.00 26.01 ? 61  LEU A CB    1 
ATOM   475  C  CG    . LEU A 1 69  ? -37.315 21.873  -28.573 1.00 25.83 ? 61  LEU A CG    1 
ATOM   476  C  CD1   . LEU A 1 69  ? -38.332 21.755  -29.695 1.00 25.70 ? 61  LEU A CD1   1 
ATOM   477  C  CD2   . LEU A 1 69  ? -36.324 22.989  -28.855 1.00 25.78 ? 61  LEU A CD2   1 
ATOM   478  N  N     . PHE A 1 70  ? -37.427 19.375  -25.670 1.00 25.79 ? 62  PHE A N     1 
ATOM   479  C  CA    . PHE A 1 70  ? -36.576 18.196  -25.554 1.00 25.48 ? 62  PHE A CA    1 
ATOM   480  C  C     . PHE A 1 70  ? -37.391 16.909  -25.392 1.00 25.57 ? 62  PHE A C     1 
ATOM   481  O  O     . PHE A 1 70  ? -36.943 15.837  -25.780 1.00 25.31 ? 62  PHE A O     1 
ATOM   482  C  CB    . PHE A 1 70  ? -35.598 18.363  -24.391 1.00 25.40 ? 62  PHE A CB    1 
ATOM   483  C  CG    . PHE A 1 70  ? -34.528 17.314  -24.337 1.00 24.96 ? 62  PHE A CG    1 
ATOM   484  C  CD1   . PHE A 1 70  ? -34.163 16.742  -23.128 1.00 24.53 ? 62  PHE A CD1   1 
ATOM   485  C  CD2   . PHE A 1 70  ? -33.878 16.902  -25.492 1.00 24.58 ? 62  PHE A CD2   1 
ATOM   486  C  CE1   . PHE A 1 70  ? -33.170 15.780  -23.069 1.00 24.33 ? 62  PHE A CE1   1 
ATOM   487  C  CE2   . PHE A 1 70  ? -32.890 15.936  -25.439 1.00 24.37 ? 62  PHE A CE2   1 
ATOM   488  C  CZ    . PHE A 1 70  ? -32.534 15.376  -24.223 1.00 24.35 ? 62  PHE A CZ    1 
ATOM   489  N  N     . SER A 1 71  ? -38.591 17.029  -24.826 1.00 25.89 ? 63  SER A N     1 
ATOM   490  C  CA    . SER A 1 71  ? -39.510 15.890  -24.723 1.00 26.11 ? 63  SER A CA    1 
ATOM   491  C  C     . SER A 1 71  ? -39.948 15.444  -26.107 1.00 26.23 ? 63  SER A C     1 
ATOM   492  O  O     . SER A 1 71  ? -39.980 14.248  -26.403 1.00 26.27 ? 63  SER A O     1 
ATOM   493  C  CB    . SER A 1 71  ? -40.734 16.256  -23.883 1.00 26.03 ? 63  SER A CB    1 
ATOM   494  O  OG    . SER A 1 71  ? -40.352 16.795  -22.631 1.00 26.40 ? 63  SER A OG    1 
ATOM   495  N  N     . GLU A 1 72  ? -40.276 16.417  -26.954 1.00 26.49 ? 64  GLU A N     1 
ATOM   496  C  CA    . GLU A 1 72  ? -40.594 16.154  -28.351 1.00 26.89 ? 64  GLU A CA    1 
ATOM   497  C  C     . GLU A 1 72  ? -39.400 15.553  -29.078 1.00 26.61 ? 64  GLU A C     1 
ATOM   498  O  O     . GLU A 1 72  ? -39.544 14.584  -29.825 1.00 26.81 ? 64  GLU A O     1 
ATOM   499  C  CB    . GLU A 1 72  ? -41.040 17.438  -29.051 1.00 27.25 ? 64  GLU A CB    1 
ATOM   500  C  CG    . GLU A 1 72  ? -42.477 17.843  -28.760 1.00 29.08 ? 64  GLU A CG    1 
ATOM   501  C  CD    . GLU A 1 72  ? -42.964 18.955  -29.672 1.00 32.15 ? 64  GLU A CD    1 
ATOM   502  O  OE1   . GLU A 1 72  ? -42.241 19.971  -29.819 1.00 33.09 ? 64  GLU A OE1   1 
ATOM   503  O  OE2   . GLU A 1 72  ? -44.073 18.817  -30.239 1.00 33.95 ? 64  GLU A OE2   1 
ATOM   504  N  N     . ILE A 1 73  ? -38.219 16.119  -28.835 1.00 26.28 ? 65  ILE A N     1 
ATOM   505  C  CA    . ILE A 1 73  ? -36.992 15.655  -29.472 1.00 26.10 ? 65  ILE A CA    1 
ATOM   506  C  C     . ILE A 1 73  ? -36.607 14.235  -29.026 1.00 26.31 ? 65  ILE A C     1 
ATOM   507  O  O     . ILE A 1 73  ? -36.187 13.413  -29.847 1.00 26.41 ? 65  ILE A O     1 
ATOM   508  C  CB    . ILE A 1 73  ? -35.819 16.648  -29.240 1.00 26.08 ? 65  ILE A CB    1 
ATOM   509  C  CG1   . ILE A 1 73  ? -35.943 17.839  -30.195 1.00 25.53 ? 65  ILE A CG1   1 
ATOM   510  C  CG2   . ILE A 1 73  ? -34.473 15.959  -29.433 1.00 25.69 ? 65  ILE A CG2   1 
ATOM   511  C  CD1   . ILE A 1 73  ? -35.024 18.982  -29.871 1.00 24.70 ? 65  ILE A CD1   1 
ATOM   512  N  N     . GLN A 1 74  ? -36.792 13.947  -27.737 1.00 26.44 ? 66  GLN A N     1 
ATOM   513  C  CA    . GLN A 1 74  ? -36.517 12.615  -27.182 1.00 26.51 ? 66  GLN A CA    1 
ATOM   514  C  C     . GLN A 1 74  ? -37.348 11.527  -27.855 1.00 26.32 ? 66  GLN A C     1 
ATOM   515  O  O     . GLN A 1 74  ? -36.860 10.425  -28.098 1.00 25.99 ? 66  GLN A O     1 
ATOM   516  C  CB    . GLN A 1 74  ? -36.795 12.595  -25.681 1.00 26.78 ? 66  GLN A CB    1 
ATOM   517  C  CG    . GLN A 1 74  ? -35.616 12.960  -24.813 1.00 27.51 ? 66  GLN A CG    1 
ATOM   518  C  CD    . GLN A 1 74  ? -36.007 13.118  -23.357 1.00 29.16 ? 66  GLN A CD    1 
ATOM   519  O  OE1   . GLN A 1 74  ? -37.051 13.696  -23.041 1.00 30.46 ? 66  GLN A OE1   1 
ATOM   520  N  NE2   . GLN A 1 74  ? -35.174 12.603  -22.459 1.00 29.42 ? 66  GLN A NE2   1 
ATOM   521  N  N     . SER A 1 75  ? -38.607 11.842  -28.145 1.00 26.30 ? 67  SER A N     1 
ATOM   522  C  CA    . SER A 1 75  ? -39.551 10.848  -28.652 1.00 26.31 ? 67  SER A CA    1 
ATOM   523  C  C     . SER A 1 75  ? -39.623 10.821  -30.178 1.00 26.18 ? 67  SER A C     1 
ATOM   524  O  O     . SER A 1 75  ? -40.439 10.098  -30.754 1.00 26.05 ? 67  SER A O     1 
ATOM   525  C  CB    . SER A 1 75  ? -40.936 11.084  -28.061 1.00 26.34 ? 67  SER A CB    1 
ATOM   526  O  OG    . SER A 1 75  ? -40.930 10.825  -26.669 1.00 27.04 ? 67  SER A OG    1 
ATOM   527  N  N     . ASP A 1 76  ? -38.764 11.610  -30.823 1.00 25.93 ? 68  ASP A N     1 
ATOM   528  C  CA    . ASP A 1 76  ? -38.701 11.658  -32.279 1.00 25.64 ? 68  ASP A CA    1 
ATOM   529  C  C     . ASP A 1 76  ? -38.036 10.397  -32.835 1.00 25.62 ? 68  ASP A C     1 
ATOM   530  O  O     . ASP A 1 76  ? -36.879 10.109  -32.520 1.00 25.59 ? 68  ASP A O     1 
ATOM   531  C  CB    . ASP A 1 76  ? -37.941 12.904  -32.737 1.00 25.56 ? 68  ASP A CB    1 
ATOM   532  C  CG    . ASP A 1 76  ? -38.284 13.310  -34.154 1.00 25.20 ? 68  ASP A CG    1 
ATOM   533  O  OD1   . ASP A 1 76  ? -38.173 12.466  -35.067 1.00 24.57 ? 68  ASP A OD1   1 
ATOM   534  O  OD2   . ASP A 1 76  ? -38.652 14.483  -34.360 1.00 25.29 ? 68  ASP A OD2   1 
ATOM   535  N  N     . PRO A 1 77  ? -38.777 9.641   -33.665 1.00 25.66 ? 69  PRO A N     1 
ATOM   536  C  CA    . PRO A 1 77  ? -38.328 8.372   -34.250 1.00 25.51 ? 69  PRO A CA    1 
ATOM   537  C  C     . PRO A 1 77  ? -37.188 8.535   -35.250 1.00 25.51 ? 69  PRO A C     1 
ATOM   538  O  O     . PRO A 1 77  ? -36.552 7.552   -35.620 1.00 25.33 ? 69  PRO A O     1 
ATOM   539  C  CB    . PRO A 1 77  ? -39.582 7.854   -34.977 1.00 25.56 ? 69  PRO A CB    1 
ATOM   540  C  CG    . PRO A 1 77  ? -40.722 8.637   -34.406 1.00 25.82 ? 69  PRO A CG    1 
ATOM   541  C  CD    . PRO A 1 77  ? -40.155 9.967   -34.066 1.00 25.78 ? 69  PRO A CD    1 
ATOM   542  N  N     . ARG A 1 78  ? -36.938 9.767   -35.684 1.00 25.64 ? 70  ARG A N     1 
ATOM   543  C  CA    . ARG A 1 78  ? -35.925 10.028  -36.707 1.00 25.82 ? 70  ARG A CA    1 
ATOM   544  C  C     . ARG A 1 78  ? -34.495 9.896   -36.170 1.00 25.88 ? 70  ARG A C     1 
ATOM   545  O  O     . ARG A 1 78  ? -33.535 9.861   -36.941 1.00 25.79 ? 70  ARG A O     1 
ATOM   546  C  CB    . ARG A 1 78  ? -36.139 11.403  -37.350 1.00 25.89 ? 70  ARG A CB    1 
ATOM   547  C  CG    . ARG A 1 78  ? -37.325 11.462  -38.311 1.00 25.79 ? 70  ARG A CG    1 
ATOM   548  C  CD    . ARG A 1 78  ? -37.628 12.887  -38.739 1.00 25.94 ? 70  ARG A CD    1 
ATOM   549  N  NE    . ARG A 1 78  ? -38.161 13.683  -37.637 1.00 26.54 ? 70  ARG A NE    1 
ATOM   550  C  CZ    . ARG A 1 78  ? -38.450 14.979  -37.717 1.00 26.36 ? 70  ARG A CZ    1 
ATOM   551  N  NH1   . ARG A 1 78  ? -38.928 15.618  -36.661 1.00 26.01 ? 70  ARG A NH1   1 
ATOM   552  N  NH2   . ARG A 1 78  ? -38.265 15.634  -38.853 1.00 26.43 ? 70  ARG A NH2   1 
ATOM   553  N  N     . HIS A 1 79  ? -34.362 9.832   -34.850 1.00 26.05 ? 71  HIS A N     1 
ATOM   554  C  CA    . HIS A 1 79  ? -33.096 9.454   -34.233 1.00 26.19 ? 71  HIS A CA    1 
ATOM   555  C  C     . HIS A 1 79  ? -33.289 8.576   -32.996 1.00 26.43 ? 71  HIS A C     1 
ATOM   556  O  O     . HIS A 1 79  ? -34.418 8.358   -32.544 1.00 26.41 ? 71  HIS A O     1 
ATOM   557  C  CB    . HIS A 1 79  ? -32.230 10.693  -33.912 1.00 26.12 ? 71  HIS A CB    1 
ATOM   558  C  CG    . HIS A 1 79  ? -32.804 11.591  -32.856 1.00 25.91 ? 71  HIS A CG    1 
ATOM   559  N  ND1   . HIS A 1 79  ? -32.293 12.844  -32.595 1.00 25.54 ? 71  HIS A ND1   1 
ATOM   560  C  CD2   . HIS A 1 79  ? -33.845 11.426  -32.005 1.00 25.75 ? 71  HIS A CD2   1 
ATOM   561  C  CE1   . HIS A 1 79  ? -32.988 13.408  -31.624 1.00 25.23 ? 71  HIS A CE1   1 
ATOM   562  N  NE2   . HIS A 1 79  ? -33.936 12.569  -31.250 1.00 25.72 ? 71  HIS A NE2   1 
ATOM   563  N  N     . ARG A 1 80  ? -32.181 8.064   -32.465 1.00 26.83 ? 72  ARG A N     1 
ATOM   564  C  CA    . ARG A 1 80  ? -32.205 7.218   -31.272 1.00 27.05 ? 72  ARG A CA    1 
ATOM   565  C  C     . ARG A 1 80  ? -30.999 7.515   -30.386 1.00 26.94 ? 72  ARG A C     1 
ATOM   566  O  O     . ARG A 1 80  ? -30.108 8.278   -30.775 1.00 26.89 ? 72  ARG A O     1 
ATOM   567  C  CB    . ARG A 1 80  ? -32.208 5.740   -31.668 1.00 27.28 ? 72  ARG A CB    1 
ATOM   568  C  CG    . ARG A 1 80  ? -30.877 5.247   -32.212 1.00 28.17 ? 72  ARG A CG    1 
ATOM   569  C  CD    . ARG A 1 80  ? -31.005 3.878   -32.834 1.00 30.42 ? 72  ARG A CD    1 
ATOM   570  N  NE    . ARG A 1 80  ? -29.715 3.383   -33.314 1.00 32.08 ? 72  ARG A NE    1 
ATOM   571  C  CZ    . ARG A 1 80  ? -29.571 2.412   -34.213 1.00 32.94 ? 72  ARG A CZ    1 
ATOM   572  N  NH1   . ARG A 1 80  ? -30.641 1.829   -34.747 1.00 33.49 ? 72  ARG A NH1   1 
ATOM   573  N  NH2   . ARG A 1 80  ? -28.357 2.026   -34.582 1.00 33.06 ? 72  ARG A NH2   1 
ATOM   574  N  N     . ASP A 1 81  ? -30.975 6.897   -29.202 1.00 26.92 ? 73  ASP A N     1 
ATOM   575  C  CA    . ASP A 1 81  ? -29.848 7.014   -28.256 1.00 26.83 ? 73  ASP A CA    1 
ATOM   576  C  C     . ASP A 1 81  ? -29.555 8.463   -27.875 1.00 26.64 ? 73  ASP A C     1 
ATOM   577  O  O     . ASP A 1 81  ? -28.405 8.915   -27.934 1.00 26.69 ? 73  ASP A O     1 
ATOM   578  C  CB    . ASP A 1 81  ? -28.583 6.333   -28.811 1.00 26.88 ? 73  ASP A CB    1 
ATOM   579  C  CG    . ASP A 1 81  ? -28.801 4.860   -29.140 1.00 27.60 ? 73  ASP A CG    1 
ATOM   580  O  OD1   . ASP A 1 81  ? -29.764 4.262   -28.616 1.00 28.41 ? 73  ASP A OD1   1 
ATOM   581  O  OD2   . ASP A 1 81  ? -28.002 4.300   -29.925 1.00 28.63 ? 73  ASP A OD2   1 
ATOM   582  N  N     . VAL A 1 82  ? -30.601 9.189   -27.493 1.00 26.40 ? 74  VAL A N     1 
ATOM   583  C  CA    . VAL A 1 82  ? -30.462 10.581  -27.078 1.00 26.28 ? 74  VAL A CA    1 
ATOM   584  C  C     . VAL A 1 82  ? -29.778 10.676  -25.711 1.00 26.38 ? 74  VAL A C     1 
ATOM   585  O  O     . VAL A 1 82  ? -30.313 10.209  -24.699 1.00 26.43 ? 74  VAL A O     1 
ATOM   586  C  CB    . VAL A 1 82  ? -31.833 11.304  -27.029 1.00 26.22 ? 74  VAL A CB    1 
ATOM   587  C  CG1   . VAL A 1 82  ? -31.645 12.758  -26.674 1.00 25.93 ? 74  VAL A CG1   1 
ATOM   588  C  CG2   . VAL A 1 82  ? -32.561 11.169  -28.366 1.00 26.02 ? 74  VAL A CG2   1 
ATOM   589  N  N     . VAL A 1 83  ? -28.591 11.275  -25.697 1.00 26.37 ? 75  VAL A N     1 
ATOM   590  C  CA    . VAL A 1 83  ? -27.771 11.356  -24.495 1.00 26.42 ? 75  VAL A CA    1 
ATOM   591  C  C     . VAL A 1 83  ? -27.481 12.808  -24.148 1.00 26.79 ? 75  VAL A C     1 
ATOM   592  O  O     . VAL A 1 83  ? -26.789 13.509  -24.892 1.00 26.77 ? 75  VAL A O     1 
ATOM   593  C  CB    . VAL A 1 83  ? -26.430 10.615  -24.679 1.00 26.39 ? 75  VAL A CB    1 
ATOM   594  C  CG1   . VAL A 1 83  ? -25.583 10.734  -23.427 1.00 26.10 ? 75  VAL A CG1   1 
ATOM   595  C  CG2   . VAL A 1 83  ? -26.669 9.161   -25.025 1.00 26.01 ? 75  VAL A CG2   1 
ATOM   596  N  N     . GLU A 1 84  ? -28.010 13.254  -23.013 1.00 27.15 ? 76  GLU A N     1 
ATOM   597  C  CA    . GLU A 1 84  ? -27.823 14.625  -22.558 1.00 27.42 ? 76  GLU A CA    1 
ATOM   598  C  C     . GLU A 1 84  ? -26.399 14.820  -22.038 1.00 27.47 ? 76  GLU A C     1 
ATOM   599  O  O     . GLU A 1 84  ? -25.881 13.978  -21.312 1.00 27.57 ? 76  GLU A O     1 
ATOM   600  C  CB    . GLU A 1 84  ? -28.842 14.954  -21.470 1.00 27.51 ? 76  GLU A CB    1 
ATOM   601  C  CG    . GLU A 1 84  ? -28.757 16.363  -20.931 1.00 28.49 ? 76  GLU A CG    1 
ATOM   602  C  CD    . GLU A 1 84  ? -29.492 16.518  -19.621 1.00 30.22 ? 76  GLU A CD    1 
ATOM   603  O  OE1   . GLU A 1 84  ? -30.733 16.662  -19.648 1.00 30.37 ? 76  GLU A OE1   1 
ATOM   604  O  OE2   . GLU A 1 84  ? -28.827 16.489  -18.559 1.00 31.79 ? 76  GLU A OE2   1 
ATOM   605  N  N     . LEU A 1 85  ? -25.766 15.923  -22.434 1.00 27.64 ? 77  LEU A N     1 
ATOM   606  C  CA    . LEU A 1 85  ? -24.373 16.191  -22.058 1.00 27.75 ? 77  LEU A CA    1 
ATOM   607  C  C     . LEU A 1 85  ? -24.280 17.361  -21.088 1.00 27.95 ? 77  LEU A C     1 
ATOM   608  O  O     . LEU A 1 85  ? -23.405 17.397  -20.225 1.00 27.93 ? 77  LEU A O     1 
ATOM   609  C  CB    . LEU A 1 85  ? -23.517 16.486  -23.300 1.00 27.64 ? 77  LEU A CB    1 
ATOM   610  C  CG    . LEU A 1 85  ? -23.661 15.604  -24.547 1.00 27.43 ? 77  LEU A CG    1 
ATOM   611  C  CD1   . LEU A 1 85  ? -22.611 15.979  -25.554 1.00 27.04 ? 77  LEU A CD1   1 
ATOM   612  C  CD2   . LEU A 1 85  ? -23.553 14.131  -24.206 1.00 27.95 ? 77  LEU A CD2   1 
ATOM   613  N  N     . MET A 1 86  ? -25.181 18.323  -21.248 1.00 28.30 ? 78  MET A N     1 
ATOM   614  C  CA    . MET A 1 86  ? -25.167 19.531  -20.445 1.00 28.59 ? 78  MET A CA    1 
ATOM   615  C  C     . MET A 1 86  ? -26.564 20.110  -20.307 1.00 28.76 ? 78  MET A C     1 
ATOM   616  O  O     . MET A 1 86  ? -27.269 20.292  -21.295 1.00 28.59 ? 78  MET A O     1 
ATOM   617  C  CB    . MET A 1 86  ? -24.230 20.568  -21.065 1.00 28.57 ? 78  MET A CB    1 
ATOM   618  C  CG    . MET A 1 86  ? -24.365 21.967  -20.481 1.00 28.63 ? 78  MET A CG    1 
ATOM   619  S  SD    . MET A 1 86  ? -23.058 23.066  -21.045 1.00 29.20 ? 78  MET A SD    1 
ATOM   620  C  CE    . MET A 1 86  ? -23.701 24.663  -20.554 1.00 28.83 ? 78  MET A CE    1 
ATOM   621  N  N     . ARG A 1 87  ? -26.965 20.369  -19.069 1.00 29.07 ? 79  ARG A N     1 
ATOM   622  C  CA    . ARG A 1 87  ? -28.126 21.194  -18.792 1.00 29.71 ? 79  ARG A CA    1 
ATOM   623  C  C     . ARG A 1 87  ? -27.770 22.169  -17.679 1.00 29.95 ? 79  ARG A C     1 
ATOM   624  O  O     . ARG A 1 87  ? -27.519 21.759  -16.540 1.00 30.34 ? 79  ARG A O     1 
ATOM   625  C  CB    . ARG A 1 87  ? -29.324 20.330  -18.384 1.00 29.60 ? 79  ARG A CB    1 
ATOM   626  C  CG    . ARG A 1 87  ? -30.683 21.003  -18.608 1.00 30.16 ? 79  ARG A CG    1 
ATOM   627  C  CD    . ARG A 1 87  ? -31.805 20.296  -17.839 1.00 30.62 ? 79  ARG A CD    1 
ATOM   628  N  NE    . ARG A 1 87  ? -32.152 18.993  -18.413 1.00 31.66 ? 79  ARG A NE    1 
ATOM   629  C  CZ    . ARG A 1 87  ? -33.226 18.764  -19.167 1.00 32.17 ? 79  ARG A CZ    1 
ATOM   630  N  NH1   . ARG A 1 87  ? -34.067 19.753  -19.451 1.00 32.26 ? 79  ARG A NH1   1 
ATOM   631  N  NH2   . ARG A 1 87  ? -33.459 17.545  -19.641 1.00 32.23 ? 79  ARG A NH2   1 
ATOM   632  N  N     . ASP A 1 88  ? -27.714 23.454  -18.014 1.00 30.01 ? 80  ASP A N     1 
ATOM   633  C  CA    . ASP A 1 88  ? -27.247 24.460  -17.069 1.00 30.15 ? 80  ASP A CA    1 
ATOM   634  C  C     . ASP A 1 88  ? -27.793 25.850  -17.376 1.00 30.02 ? 80  ASP A C     1 
ATOM   635  O  O     . ASP A 1 88  ? -28.188 26.144  -18.502 1.00 30.05 ? 80  ASP A O     1 
ATOM   636  C  CB    . ASP A 1 88  ? -25.713 24.496  -17.040 1.00 30.26 ? 80  ASP A CB    1 
ATOM   637  C  CG    . ASP A 1 88  ? -25.160 24.845  -15.663 1.00 30.71 ? 80  ASP A CG    1 
ATOM   638  O  OD1   . ASP A 1 88  ? -25.804 25.632  -14.932 1.00 30.84 ? 80  ASP A OD1   1 
ATOM   639  O  OD2   . ASP A 1 88  ? -24.077 24.329  -15.315 1.00 31.78 ? 80  ASP A OD2   1 
ATOM   640  N  N     . TYR A 1 89  ? -27.800 26.700  -16.358 1.00 29.93 ? 81  TYR A N     1 
ATOM   641  C  CA    . TYR A 1 89  ? -28.149 28.102  -16.520 1.00 29.98 ? 81  TYR A CA    1 
ATOM   642  C  C     . TYR A 1 89  ? -27.062 28.828  -17.305 1.00 29.68 ? 81  TYR A C     1 
ATOM   643  O  O     . TYR A 1 89  ? -25.896 28.434  -17.277 1.00 29.74 ? 81  TYR A O     1 
ATOM   644  C  CB    . TYR A 1 89  ? -28.366 28.753  -15.148 1.00 30.10 ? 81  TYR A CB    1 
ATOM   645  C  CG    . TYR A 1 89  ? -29.398 28.028  -14.304 1.00 30.86 ? 81  TYR A CG    1 
ATOM   646  C  CD1   . TYR A 1 89  ? -30.760 28.303  -14.444 1.00 30.74 ? 81  TYR A CD1   1 
ATOM   647  C  CD2   . TYR A 1 89  ? -29.017 27.036  -13.396 1.00 31.24 ? 81  TYR A CD2   1 
ATOM   648  C  CE1   . TYR A 1 89  ? -31.710 27.629  -13.695 1.00 30.60 ? 81  TYR A CE1   1 
ATOM   649  C  CE2   . TYR A 1 89  ? -29.964 26.354  -12.641 1.00 31.39 ? 81  TYR A CE2   1 
ATOM   650  C  CZ    . TYR A 1 89  ? -31.309 26.658  -12.795 1.00 31.12 ? 81  TYR A CZ    1 
ATOM   651  O  OH    . TYR A 1 89  ? -32.251 25.988  -12.049 1.00 31.70 ? 81  TYR A OH    1 
ATOM   652  N  N     . SER A 1 90  ? -27.453 29.875  -18.023 1.00 29.46 ? 82  SER A N     1 
ATOM   653  C  CA    . SER A 1 90  ? -26.543 30.560  -18.933 1.00 29.22 ? 82  SER A CA    1 
ATOM   654  C  C     . SER A 1 90  ? -26.530 32.073  -18.721 1.00 29.10 ? 82  SER A C     1 
ATOM   655  O  O     . SER A 1 90  ? -27.534 32.669  -18.320 1.00 29.08 ? 82  SER A O     1 
ATOM   656  C  CB    . SER A 1 90  ? -26.894 30.232  -20.384 1.00 29.11 ? 82  SER A CB    1 
ATOM   657  O  OG    . SER A 1 90  ? -26.017 30.890  -21.276 1.00 29.24 ? 82  SER A OG    1 
ATOM   658  N  N     . ALA A 1 91  ? -25.385 32.685  -19.002 1.00 28.94 ? 83  ALA A N     1 
ATOM   659  C  CA    . ALA A 1 91  ? -25.216 34.119  -18.845 1.00 28.84 ? 83  ALA A CA    1 
ATOM   660  C  C     . ALA A 1 91  ? -25.712 34.878  -20.074 1.00 28.83 ? 83  ALA A C     1 
ATOM   661  O  O     . ALA A 1 91  ? -26.276 35.962  -19.953 1.00 28.83 ? 83  ALA A O     1 
ATOM   662  C  CB    . ALA A 1 91  ? -23.762 34.446  -18.574 1.00 28.81 ? 83  ALA A CB    1 
ATOM   663  N  N     . TYR A 1 92  ? -25.490 34.302  -21.256 1.00 28.88 ? 84  TYR A N     1 
ATOM   664  C  CA    . TYR A 1 92  ? -25.846 34.958  -22.521 1.00 28.79 ? 84  TYR A CA    1 
ATOM   665  C  C     . TYR A 1 92  ? -26.111 33.932  -23.620 1.00 28.68 ? 84  TYR A C     1 
ATOM   666  O  O     . TYR A 1 92  ? -25.655 32.786  -23.540 1.00 28.66 ? 84  TYR A O     1 
ATOM   667  C  CB    . TYR A 1 92  ? -24.733 35.923  -22.964 1.00 28.91 ? 84  TYR A CB    1 
ATOM   668  C  CG    . TYR A 1 92  ? -23.403 35.247  -23.253 1.00 29.13 ? 84  TYR A CG    1 
ATOM   669  C  CD1   . TYR A 1 92  ? -22.515 34.944  -22.222 1.00 29.38 ? 84  TYR A CD1   1 
ATOM   670  C  CD2   . TYR A 1 92  ? -23.033 34.918  -24.555 1.00 29.13 ? 84  TYR A CD2   1 
ATOM   671  C  CE1   . TYR A 1 92  ? -21.300 34.324  -22.479 1.00 29.69 ? 84  TYR A CE1   1 
ATOM   672  C  CE2   . TYR A 1 92  ? -21.816 34.299  -24.822 1.00 29.18 ? 84  TYR A CE2   1 
ATOM   673  C  CZ    . TYR A 1 92  ? -20.957 34.004  -23.780 1.00 29.34 ? 84  TYR A CZ    1 
ATOM   674  O  OH    . TYR A 1 92  ? -19.756 33.391  -24.033 1.00 29.29 ? 84  TYR A OH    1 
ATOM   675  N  N     . ARG A 1 93  ? -26.857 34.348  -24.642 1.00 28.46 ? 85  ARG A N     1 
ATOM   676  C  CA    . ARG A 1 93  ? -27.075 33.519  -25.826 1.00 28.22 ? 85  ARG A CA    1 
ATOM   677  C  C     . ARG A 1 93  ? -25.827 33.476  -26.686 1.00 28.23 ? 85  ARG A C     1 
ATOM   678  O  O     . ARG A 1 93  ? -25.261 34.515  -27.024 1.00 28.11 ? 85  ARG A O     1 
ATOM   679  C  CB    . ARG A 1 93  ? -28.246 34.052  -26.650 1.00 28.15 ? 85  ARG A CB    1 
ATOM   680  C  CG    . ARG A 1 93  ? -29.593 33.678  -26.110 1.00 27.46 ? 85  ARG A CG    1 
ATOM   681  C  CD    . ARG A 1 93  ? -30.689 34.046  -27.080 1.00 26.61 ? 85  ARG A CD    1 
ATOM   682  N  NE    . ARG A 1 93  ? -32.009 33.914  -26.473 1.00 25.93 ? 85  ARG A NE    1 
ATOM   683  C  CZ    . ARG A 1 93  ? -32.703 32.780  -26.426 1.00 26.20 ? 85  ARG A CZ    1 
ATOM   684  N  NH1   . ARG A 1 93  ? -32.206 31.665  -26.953 1.00 26.24 ? 85  ARG A NH1   1 
ATOM   685  N  NH2   . ARG A 1 93  ? -33.895 32.760  -25.850 1.00 25.90 ? 85  ARG A NH2   1 
ATOM   686  N  N     . ARG A 1 94  ? -25.395 32.268  -27.032 1.00 28.27 ? 86  ARG A N     1 
ATOM   687  C  CA    . ARG A 1 94  ? -24.229 32.086  -27.885 1.00 28.49 ? 86  ARG A CA    1 
ATOM   688  C  C     . ARG A 1 94  ? -24.628 32.082  -29.352 1.00 28.41 ? 86  ARG A C     1 
ATOM   689  O  O     . ARG A 1 94  ? -23.786 32.236  -30.225 1.00 28.42 ? 86  ARG A O     1 
ATOM   690  C  CB    . ARG A 1 94  ? -23.495 30.786  -27.538 1.00 28.58 ? 86  ARG A CB    1 
ATOM   691  C  CG    . ARG A 1 94  ? -22.414 30.929  -26.465 1.00 29.57 ? 86  ARG A CG    1 
ATOM   692  C  CD    . ARG A 1 94  ? -23.010 30.992  -25.060 1.00 30.99 ? 86  ARG A CD    1 
ATOM   693  N  NE    . ARG A 1 94  ? -22.084 30.480  -24.050 1.00 32.82 ? 86  ARG A NE    1 
ATOM   694  C  CZ    . ARG A 1 94  ? -22.247 30.629  -22.735 1.00 33.62 ? 86  ARG A CZ    1 
ATOM   695  N  NH1   . ARG A 1 94  ? -23.294 31.291  -22.259 1.00 34.03 ? 86  ARG A NH1   1 
ATOM   696  N  NH2   . ARG A 1 94  ? -21.357 30.118  -21.895 1.00 33.86 ? 86  ARG A NH2   1 
ATOM   697  N  N     . PHE A 1 95  ? -25.920 31.905  -29.617 1.00 28.33 ? 87  PHE A N     1 
ATOM   698  C  CA    . PHE A 1 95  ? -26.415 31.835  -30.987 1.00 28.12 ? 87  PHE A CA    1 
ATOM   699  C  C     . PHE A 1 95  ? -27.593 32.763  -31.211 1.00 28.11 ? 87  PHE A C     1 
ATOM   700  O  O     . PHE A 1 95  ? -28.616 32.365  -31.769 1.00 28.12 ? 87  PHE A O     1 
ATOM   701  C  CB    . PHE A 1 95  ? -26.774 30.393  -31.358 1.00 28.09 ? 87  PHE A CB    1 
ATOM   702  C  CG    . PHE A 1 95  ? -25.609 29.457  -31.308 1.00 27.76 ? 87  PHE A CG    1 
ATOM   703  C  CD1   . PHE A 1 95  ? -24.594 29.542  -32.254 1.00 27.24 ? 87  PHE A CD1   1 
ATOM   704  C  CD2   . PHE A 1 95  ? -25.497 28.522  -30.293 1.00 27.42 ? 87  PHE A CD2   1 
ATOM   705  C  CE1   . PHE A 1 95  ? -23.503 28.698  -32.196 1.00 27.47 ? 87  PHE A CE1   1 
ATOM   706  C  CE2   . PHE A 1 95  ? -24.405 27.671  -30.232 1.00 27.35 ? 87  PHE A CE2   1 
ATOM   707  C  CZ    . PHE A 1 95  ? -23.406 27.764  -31.180 1.00 27.44 ? 87  PHE A CZ    1 
ATOM   708  N  N     . HIS A 1 96  ? -27.431 34.010  -30.779 1.00 28.09 ? 88  HIS A N     1 
ATOM   709  C  CA    . HIS A 1 96  ? -28.450 35.038  -30.950 1.00 28.04 ? 88  HIS A CA    1 
ATOM   710  C  C     . HIS A 1 96  ? -28.791 35.230  -32.432 1.00 27.85 ? 88  HIS A C     1 
ATOM   711  O  O     . HIS A 1 96  ? -27.911 35.491  -33.255 1.00 27.73 ? 88  HIS A O     1 
ATOM   712  C  CB    . HIS A 1 96  ? -27.967 36.357  -30.342 1.00 28.04 ? 88  HIS A CB    1 
ATOM   713  C  CG    . HIS A 1 96  ? -29.069 37.218  -29.811 1.00 29.14 ? 88  HIS A CG    1 
ATOM   714  N  ND1   . HIS A 1 96  ? -29.801 38.070  -30.611 1.00 29.69 ? 88  HIS A ND1   1 
ATOM   715  C  CD2   . HIS A 1 96  ? -29.557 37.367  -28.556 1.00 29.99 ? 88  HIS A CD2   1 
ATOM   716  C  CE1   . HIS A 1 96  ? -30.696 38.703  -29.872 1.00 30.12 ? 88  HIS A CE1   1 
ATOM   717  N  NE2   . HIS A 1 96  ? -30.569 38.294  -28.622 1.00 30.50 ? 88  HIS A NE2   1 
ATOM   718  N  N     . GLY A 1 97  ? -30.067 35.072  -32.766 1.00 27.63 ? 89  GLY A N     1 
ATOM   719  C  CA    . GLY A 1 97  ? -30.527 35.264  -34.136 1.00 27.44 ? 89  GLY A CA    1 
ATOM   720  C  C     . GLY A 1 97  ? -30.550 33.985  -34.948 1.00 27.30 ? 89  GLY A C     1 
ATOM   721  O  O     . GLY A 1 97  ? -30.873 33.999  -36.139 1.00 27.48 ? 89  GLY A O     1 
ATOM   722  N  N     . THR A 1 98  ? -30.216 32.873  -34.300 1.00 26.91 ? 90  THR A N     1 
ATOM   723  C  CA    . THR A 1 98  ? -30.153 31.585  -34.970 1.00 26.43 ? 90  THR A CA    1 
ATOM   724  C  C     . THR A 1 98  ? -31.111 30.585  -34.324 1.00 26.18 ? 90  THR A C     1 
ATOM   725  O  O     . THR A 1 98  ? -30.733 29.865  -33.410 1.00 26.33 ? 90  THR A O     1 
ATOM   726  C  CB    . THR A 1 98  ? -28.718 31.009  -34.941 1.00 26.43 ? 90  THR A CB    1 
ATOM   727  O  OG1   . THR A 1 98  ? -27.778 32.037  -35.271 1.00 25.71 ? 90  THR A OG1   1 
ATOM   728  C  CG2   . THR A 1 98  ? -28.581 29.869  -35.932 1.00 26.79 ? 90  THR A CG2   1 
ATOM   729  N  N     . GLY A 1 99  ? -32.352 30.555  -34.804 1.00 25.94 ? 91  GLY A N     1 
ATOM   730  C  CA    . GLY A 1 99  ? -33.342 29.579  -34.333 1.00 25.45 ? 91  GLY A CA    1 
ATOM   731  C  C     . GLY A 1 99  ? -32.803 28.166  -34.386 1.00 25.22 ? 91  GLY A C     1 
ATOM   732  O  O     . GLY A 1 99  ? -32.749 27.472  -33.372 1.00 25.36 ? 91  GLY A O     1 
ATOM   733  N  N     . MET A 1 100 ? -32.387 27.751  -35.578 1.00 24.87 ? 92  MET A N     1 
ATOM   734  C  CA    . MET A 1 100 ? -31.669 26.505  -35.764 1.00 24.48 ? 92  MET A CA    1 
ATOM   735  C  C     . MET A 1 100 ? -30.872 26.561  -37.057 1.00 24.31 ? 92  MET A C     1 
ATOM   736  O  O     . MET A 1 100 ? -31.262 27.238  -38.008 1.00 24.35 ? 92  MET A O     1 
ATOM   737  C  CB    . MET A 1 100 ? -32.635 25.316  -35.778 1.00 24.57 ? 92  MET A CB    1 
ATOM   738  C  CG    . MET A 1 100 ? -31.965 23.947  -35.599 1.00 24.68 ? 92  MET A CG    1 
ATOM   739  S  SD    . MET A 1 100 ? -30.585 23.949  -34.423 1.00 24.67 ? 92  MET A SD    1 
ATOM   740  C  CE    . MET A 1 100 ? -31.412 24.343  -32.885 1.00 24.97 ? 92  MET A CE    1 
ATOM   741  N  N     . ARG A 1 101 ? -29.744 25.865  -37.076 1.00 24.08 ? 93  ARG A N     1 
ATOM   742  C  CA    . ARG A 1 101 ? -28.848 25.883  -38.216 1.00 23.83 ? 93  ARG A CA    1 
ATOM   743  C  C     . ARG A 1 101 ? -27.951 24.670  -38.157 1.00 23.83 ? 93  ARG A C     1 
ATOM   744  O  O     . ARG A 1 101 ? -27.297 24.426  -37.149 1.00 23.70 ? 93  ARG A O     1 
ATOM   745  C  CB    . ARG A 1 101 ? -28.006 27.157  -38.206 1.00 23.77 ? 93  ARG A CB    1 
ATOM   746  C  CG    . ARG A 1 101 ? -27.028 27.274  -39.344 1.00 23.17 ? 93  ARG A CG    1 
ATOM   747  C  CD    . ARG A 1 101 ? -26.589 28.701  -39.519 1.00 22.61 ? 93  ARG A CD    1 
ATOM   748  N  NE    . ARG A 1 101 ? -25.374 28.805  -40.314 1.00 22.28 ? 93  ARG A NE    1 
ATOM   749  C  CZ    . ARG A 1 101 ? -24.836 29.953  -40.706 1.00 22.25 ? 93  ARG A CZ    1 
ATOM   750  N  NH1   . ARG A 1 101 ? -25.404 31.102  -40.374 1.00 21.76 ? 93  ARG A NH1   1 
ATOM   751  N  NH2   . ARG A 1 101 ? -23.721 29.951  -41.426 1.00 22.78 ? 93  ARG A NH2   1 
ATOM   752  N  N     . ILE A 1 102 ? -27.935 23.895  -39.233 1.00 23.92 ? 94  ILE A N     1 
ATOM   753  C  CA    . ILE A 1 102 ? -27.148 22.679  -39.264 1.00 24.16 ? 94  ILE A CA    1 
ATOM   754  C  C     . ILE A 1 102 ? -25.747 22.930  -39.795 1.00 24.26 ? 94  ILE A C     1 
ATOM   755  O  O     . ILE A 1 102 ? -25.537 23.791  -40.645 1.00 24.30 ? 94  ILE A O     1 
ATOM   756  C  CB    . ILE A 1 102 ? -27.842 21.548  -40.081 1.00 24.17 ? 94  ILE A CB    1 
ATOM   757  C  CG1   . ILE A 1 102 ? -27.160 20.198  -39.813 1.00 24.41 ? 94  ILE A CG1   1 
ATOM   758  C  CG2   . ILE A 1 102 ? -27.864 21.884  -41.583 1.00 24.25 ? 94  ILE A CG2   1 
ATOM   759  C  CD1   . ILE A 1 102 ? -28.034 19.005  -40.056 1.00 24.06 ? 94  ILE A CD1   1 
ATOM   760  N  N     . LEU A 1 103 ? -24.785 22.206  -39.245 1.00 24.53 ? 95  LEU A N     1 
ATOM   761  C  CA    . LEU A 1 103 ? -23.487 22.068  -39.866 1.00 24.80 ? 95  LEU A CA    1 
ATOM   762  C  C     . LEU A 1 103 ? -23.204 20.609  -40.149 1.00 25.11 ? 95  LEU A C     1 
ATOM   763  O  O     . LEU A 1 103 ? -23.079 19.800  -39.229 1.00 25.22 ? 95  LEU A O     1 
ATOM   764  C  CB    . LEU A 1 103 ? -22.394 22.653  -38.978 1.00 24.74 ? 95  LEU A CB    1 
ATOM   765  C  CG    . LEU A 1 103 ? -21.984 24.094  -39.274 1.00 24.58 ? 95  LEU A CG    1 
ATOM   766  C  CD1   . LEU A 1 103 ? -22.913 25.072  -38.579 1.00 24.41 ? 95  LEU A CD1   1 
ATOM   767  C  CD2   . LEU A 1 103 ? -20.545 24.328  -38.854 1.00 24.64 ? 95  LEU A CD2   1 
ATOM   768  N  N     . ASP A 1 104 ? -23.147 20.267  -41.428 1.00 25.55 ? 96  ASP A N     1 
ATOM   769  C  CA    . ASP A 1 104 ? -22.657 18.973  -41.844 1.00 26.01 ? 96  ASP A CA    1 
ATOM   770  C  C     . ASP A 1 104 ? -21.134 19.005  -41.848 1.00 26.16 ? 96  ASP A C     1 
ATOM   771  O  O     . ASP A 1 104 ? -20.522 19.676  -42.684 1.00 26.22 ? 96  ASP A O     1 
ATOM   772  C  CB    . ASP A 1 104 ? -23.190 18.620  -43.233 1.00 26.02 ? 96  ASP A CB    1 
ATOM   773  C  CG    . ASP A 1 104 ? -23.060 17.142  -43.552 1.00 26.76 ? 96  ASP A CG    1 
ATOM   774  O  OD1   . ASP A 1 104 ? -22.030 16.537  -43.185 1.00 27.28 ? 96  ASP A OD1   1 
ATOM   775  O  OD2   . ASP A 1 104 ? -23.988 16.584  -44.178 1.00 27.59 ? 96  ASP A OD2   1 
ATOM   776  N  N     . LEU A 1 105 ? -20.531 18.278  -40.908 1.00 26.28 ? 97  LEU A N     1 
ATOM   777  C  CA    . LEU A 1 105 ? -19.076 18.298  -40.711 1.00 26.54 ? 97  LEU A CA    1 
ATOM   778  C  C     . LEU A 1 105 ? -18.326 17.647  -41.861 1.00 26.72 ? 97  LEU A C     1 
ATOM   779  O  O     . LEU A 1 105 ? -17.139 17.904  -42.059 1.00 26.66 ? 97  LEU A O     1 
ATOM   780  C  CB    . LEU A 1 105 ? -18.697 17.607  -39.397 1.00 26.43 ? 97  LEU A CB    1 
ATOM   781  C  CG    . LEU A 1 105 ? -19.410 18.062  -38.126 1.00 26.22 ? 97  LEU A CG    1 
ATOM   782  C  CD1   . LEU A 1 105 ? -18.899 17.279  -36.928 1.00 26.25 ? 97  LEU A CD1   1 
ATOM   783  C  CD2   . LEU A 1 105 ? -19.237 19.553  -37.910 1.00 25.75 ? 97  LEU A CD2   1 
ATOM   784  N  N     . ARG A 1 106 ? -19.026 16.800  -42.613 1.00 27.19 ? 98  ARG A N     1 
ATOM   785  C  CA    . ARG A 1 106 ? -18.450 16.134  -43.775 1.00 27.74 ? 98  ARG A CA    1 
ATOM   786  C  C     . ARG A 1 106 ? -18.214 17.113  -44.924 1.00 28.15 ? 98  ARG A C     1 
ATOM   787  O  O     . ARG A 1 106 ? -17.401 16.861  -45.803 1.00 28.39 ? 98  ARG A O     1 
ATOM   788  C  CB    . ARG A 1 106 ? -19.352 14.992  -44.242 1.00 27.61 ? 98  ARG A CB    1 
ATOM   789  C  CG    . ARG A 1 106 ? -19.551 13.884  -43.219 1.00 27.75 ? 98  ARG A CG    1 
ATOM   790  C  CD    . ARG A 1 106 ? -20.613 12.885  -43.686 1.00 27.60 ? 98  ARG A CD    1 
ATOM   791  N  NE    . ARG A 1 106 ? -21.907 13.528  -43.918 1.00 26.90 ? 98  ARG A NE    1 
ATOM   792  C  CZ    . ARG A 1 106 ? -22.985 12.902  -44.380 1.00 26.85 ? 98  ARG A CZ    1 
ATOM   793  N  NH1   . ARG A 1 106 ? -22.937 11.607  -44.667 1.00 26.98 ? 98  ARG A NH1   1 
ATOM   794  N  NH2   . ARG A 1 106 ? -24.114 13.571  -44.558 1.00 26.77 ? 98  ARG A NH2   1 
ATOM   795  N  N     . LEU A 1 107 ? -18.930 18.232  -44.905 1.00 28.74 ? 99  LEU A N     1 
ATOM   796  C  CA    . LEU A 1 107 ? -18.767 19.271  -45.916 1.00 29.31 ? 99  LEU A CA    1 
ATOM   797  C  C     . LEU A 1 107 ? -17.640 20.236  -45.543 1.00 29.76 ? 99  LEU A C     1 
ATOM   798  O  O     . LEU A 1 107 ? -17.379 21.203  -46.261 1.00 29.87 ? 99  LEU A O     1 
ATOM   799  C  CB    . LEU A 1 107 ? -20.077 20.052  -46.100 1.00 29.29 ? 99  LEU A CB    1 
ATOM   800  C  CG    . LEU A 1 107 ? -21.097 19.585  -47.149 1.00 29.49 ? 99  LEU A CG    1 
ATOM   801  C  CD1   . LEU A 1 107 ? -21.796 18.315  -46.717 1.00 29.95 ? 99  LEU A CD1   1 
ATOM   802  C  CD2   . LEU A 1 107 ? -22.120 20.680  -47.411 1.00 29.43 ? 99  LEU A CD2   1 
ATOM   803  N  N     . PHE A 1 108 ? -16.972 19.969  -44.424 1.00 30.22 ? 100 PHE A N     1 
ATOM   804  C  CA    . PHE A 1 108 ? -15.989 20.902  -43.887 1.00 30.93 ? 100 PHE A CA    1 
ATOM   805  C  C     . PHE A 1 108 ? -14.578 20.352  -43.862 1.00 31.74 ? 100 PHE A C     1 
ATOM   806  O  O     . PHE A 1 108 ? -14.362 19.175  -43.579 1.00 31.89 ? 100 PHE A O     1 
ATOM   807  C  CB    . PHE A 1 108 ? -16.389 21.358  -42.486 1.00 30.72 ? 100 PHE A CB    1 
ATOM   808  C  CG    . PHE A 1 108 ? -17.380 22.477  -42.478 1.00 30.04 ? 100 PHE A CG    1 
ATOM   809  C  CD1   . PHE A 1 108 ? -18.730 22.222  -42.306 1.00 29.11 ? 100 PHE A CD1   1 
ATOM   810  C  CD2   . PHE A 1 108 ? -16.966 23.788  -42.658 1.00 29.11 ? 100 PHE A CD2   1 
ATOM   811  C  CE1   . PHE A 1 108 ? -19.648 23.249  -42.304 1.00 29.04 ? 100 PHE A CE1   1 
ATOM   812  C  CE2   . PHE A 1 108 ? -17.881 24.819  -42.656 1.00 29.28 ? 100 PHE A CE2   1 
ATOM   813  C  CZ    . PHE A 1 108 ? -19.227 24.547  -42.480 1.00 29.43 ? 100 PHE A CZ    1 
ATOM   814  N  N     . GLU A 1 109 ? -13.616 21.226  -44.153 1.00 32.83 ? 101 GLU A N     1 
ATOM   815  C  CA    . GLU A 1 109 ? -12.200 20.936  -43.943 1.00 34.02 ? 101 GLU A CA    1 
ATOM   816  C  C     . GLU A 1 109 ? -11.864 20.981  -42.452 1.00 34.27 ? 101 GLU A C     1 
ATOM   817  O  O     . GLU A 1 109 ? -12.716 21.313  -41.625 1.00 34.54 ? 101 GLU A O     1 
ATOM   818  C  CB    . GLU A 1 109 ? -11.337 21.959  -44.684 1.00 34.21 ? 101 GLU A CB    1 
ATOM   819  C  CG    . GLU A 1 109 ? -10.950 21.549  -46.094 1.00 36.22 ? 101 GLU A CG    1 
ATOM   820  C  CD    . GLU A 1 109 ? -9.530  21.004  -46.175 1.00 38.90 ? 101 GLU A CD    1 
ATOM   821  O  OE1   . GLU A 1 109 ? -8.983  20.593  -45.121 1.00 39.97 ? 101 GLU A OE1   1 
ATOM   822  O  OE2   . GLU A 1 109 ? -8.959  20.994  -47.292 1.00 39.50 ? 101 GLU A OE2   1 
ATOM   823  N  N     . THR A 1 110 ? -10.617 20.662  -42.117 1.00 34.58 ? 102 THR A N     1 
ATOM   824  C  CA    . THR A 1 110 ? -10.166 20.669  -40.728 1.00 34.81 ? 102 THR A CA    1 
ATOM   825  C  C     . THR A 1 110 ? -10.277 22.069  -40.103 1.00 34.96 ? 102 THR A C     1 
ATOM   826  O  O     . THR A 1 110 ? -9.943  23.076  -40.744 1.00 34.87 ? 102 THR A O     1 
ATOM   827  C  CB    . THR A 1 110 ? -8.717  20.131  -40.594 1.00 34.88 ? 102 THR A CB    1 
ATOM   828  O  OG1   . THR A 1 110 ? -8.235  20.362  -39.264 1.00 34.96 ? 102 THR A OG1   1 
ATOM   829  C  CG2   . THR A 1 110 ? -7.785  20.811  -41.601 1.00 35.15 ? 102 THR A CG2   1 
ATOM   830  N  N     . ASP A 1 111 ? -10.788 22.118  -38.866 1.00 34.95 ? 103 ASP A N     1 
ATOM   831  C  CA    . ASP A 1 111 ? -11.038 23.385  -38.141 1.00 34.98 ? 103 ASP A CA    1 
ATOM   832  C  C     . ASP A 1 111 ? -12.160 24.249  -38.743 1.00 34.71 ? 103 ASP A C     1 
ATOM   833  O  O     . ASP A 1 111 ? -12.673 25.156  -38.082 1.00 34.93 ? 103 ASP A O     1 
ATOM   834  C  CB    . ASP A 1 111 ? -9.751  24.209  -37.999 1.00 35.13 ? 103 ASP A CB    1 
ATOM   835  C  CG    . ASP A 1 111 ? -8.906  23.772  -36.824 1.00 36.12 ? 103 ASP A CG    1 
ATOM   836  O  OD1   . ASP A 1 111 ? -9.484  23.366  -35.789 1.00 36.55 ? 103 ASP A OD1   1 
ATOM   837  O  OD2   . ASP A 1 111 ? -7.660  23.846  -36.929 1.00 37.21 ? 103 ASP A OD2   1 
ATOM   838  N  N     . GLY A 1 112 ? -12.539 23.955  -39.986 1.00 34.24 ? 104 GLY A N     1 
ATOM   839  C  CA    . GLY A 1 112 ? -13.451 24.803  -40.747 1.00 33.64 ? 104 GLY A CA    1 
ATOM   840  C  C     . GLY A 1 112 ? -14.806 24.988  -40.101 1.00 33.37 ? 104 GLY A C     1 
ATOM   841  O  O     . GLY A 1 112 ? -15.340 26.100  -40.070 1.00 33.25 ? 104 GLY A O     1 
ATOM   842  N  N     . ALA A 1 113 ? -15.365 23.896  -39.585 1.00 33.12 ? 105 ALA A N     1 
ATOM   843  C  CA    . ALA A 1 113 ? -16.690 23.921  -38.973 1.00 32.97 ? 105 ALA A CA    1 
ATOM   844  C  C     . ALA A 1 113 ? -16.716 24.840  -37.756 1.00 32.91 ? 105 ALA A C     1 
ATOM   845  O  O     . ALA A 1 113 ? -17.625 25.654  -37.598 1.00 32.90 ? 105 ALA A O     1 
ATOM   846  C  CB    . ALA A 1 113 ? -17.124 22.521  -38.594 1.00 32.87 ? 105 ALA A CB    1 
ATOM   847  N  N     . LEU A 1 114 ? -15.691 24.720  -36.921 1.00 32.74 ? 106 LEU A N     1 
ATOM   848  C  CA    . LEU A 1 114 ? -15.545 25.547  -35.737 1.00 32.74 ? 106 LEU A CA    1 
ATOM   849  C  C     . LEU A 1 114 ? -15.389 27.026  -36.092 1.00 32.70 ? 106 LEU A C     1 
ATOM   850  O  O     . LEU A 1 114 ? -15.892 27.902  -35.386 1.00 32.53 ? 106 LEU A O     1 
ATOM   851  C  CB    . LEU A 1 114 ? -14.338 25.080  -34.929 1.00 32.68 ? 106 LEU A CB    1 
ATOM   852  C  CG    . LEU A 1 114 ? -14.377 25.298  -33.423 1.00 32.81 ? 106 LEU A CG    1 
ATOM   853  C  CD1   . LEU A 1 114 ? -15.628 24.662  -32.818 1.00 32.77 ? 106 LEU A CD1   1 
ATOM   854  C  CD2   . LEU A 1 114 ? -13.118 24.721  -32.795 1.00 33.11 ? 106 LEU A CD2   1 
ATOM   855  N  N     . GLU A 1 115 ? -14.686 27.298  -37.187 1.00 32.67 ? 107 GLU A N     1 
ATOM   856  C  CA    . GLU A 1 115 ? -14.463 28.672  -37.622 1.00 32.59 ? 107 GLU A CA    1 
ATOM   857  C  C     . GLU A 1 115 ? -15.707 29.290  -38.243 1.00 32.20 ? 107 GLU A C     1 
ATOM   858  O  O     . GLU A 1 115 ? -15.896 30.505  -38.183 1.00 32.07 ? 107 GLU A O     1 
ATOM   859  C  CB    . GLU A 1 115 ? -13.273 28.757  -38.576 1.00 32.71 ? 107 GLU A CB    1 
ATOM   860  C  CG    . GLU A 1 115 ? -11.953 28.996  -37.864 1.00 33.49 ? 107 GLU A CG    1 
ATOM   861  C  CD    . GLU A 1 115 ? -10.780 28.332  -38.556 1.00 34.84 ? 107 GLU A CD    1 
ATOM   862  O  OE1   . GLU A 1 115 ? -10.909 27.972  -39.747 1.00 35.12 ? 107 GLU A OE1   1 
ATOM   863  O  OE2   . GLU A 1 115 ? -9.727  28.166  -37.904 1.00 35.33 ? 107 GLU A OE2   1 
ATOM   864  N  N     . GLU A 1 116 ? -16.562 28.450  -38.827 1.00 32.00 ? 108 GLU A N     1 
ATOM   865  C  CA    . GLU A 1 116 ? -17.879 28.900  -39.279 1.00 31.81 ? 108 GLU A CA    1 
ATOM   866  C  C     . GLU A 1 116 ? -18.784 29.187  -38.090 1.00 31.66 ? 108 GLU A C     1 
ATOM   867  O  O     . GLU A 1 116 ? -19.398 30.252  -38.024 1.00 31.57 ? 108 GLU A O     1 
ATOM   868  C  CB    . GLU A 1 116 ? -18.531 27.883  -40.219 1.00 31.78 ? 108 GLU A CB    1 
ATOM   869  C  CG    . GLU A 1 116 ? -19.926 28.289  -40.699 1.00 32.02 ? 108 GLU A CG    1 
ATOM   870  C  CD    . GLU A 1 116 ? -20.228 27.803  -42.104 1.00 33.36 ? 108 GLU A CD    1 
ATOM   871  O  OE1   . GLU A 1 116 ? -19.299 27.796  -42.943 1.00 33.63 ? 108 GLU A OE1   1 
ATOM   872  O  OE2   . GLU A 1 116 ? -21.394 27.433  -42.375 1.00 33.67 ? 108 GLU A OE2   1 
ATOM   873  N  N     . ILE A 1 117 ? -18.845 28.240  -37.143 1.00 31.52 ? 109 ILE A N     1 
ATOM   874  C  CA    . ILE A 1 117 ? -19.538 28.457  -35.854 1.00 31.38 ? 109 ILE A CA    1 
ATOM   875  C  C     . ILE A 1 117 ? -19.234 29.850  -35.315 1.00 31.18 ? 109 ILE A C     1 
ATOM   876  O  O     . ILE A 1 117 ? -20.139 30.641  -35.056 1.00 31.05 ? 109 ILE A O     1 
ATOM   877  C  CB    . ILE A 1 117 ? -19.112 27.409  -34.772 1.00 31.36 ? 109 ILE A CB    1 
ATOM   878  C  CG1   . ILE A 1 117 ? -19.489 25.986  -35.193 1.00 31.47 ? 109 ILE A CG1   1 
ATOM   879  C  CG2   . ILE A 1 117 ? -19.726 27.750  -33.412 1.00 31.36 ? 109 ILE A CG2   1 
ATOM   880  C  CD1   . ILE A 1 117 ? -20.950 25.785  -35.435 1.00 32.07 ? 109 ILE A CD1   1 
ATOM   881  N  N     . LEU A 1 118 ? -17.943 30.154  -35.220 1.00 31.13 ? 110 LEU A N     1 
ATOM   882  C  CA    . LEU A 1 118 ? -17.452 31.342  -34.550 1.00 31.21 ? 110 LEU A CA    1 
ATOM   883  C  C     . LEU A 1 118 ? -17.851 32.637  -35.266 1.00 31.40 ? 110 LEU A C     1 
ATOM   884  O  O     . LEU A 1 118 ? -17.834 33.714  -34.670 1.00 31.45 ? 110 LEU A O     1 
ATOM   885  C  CB    . LEU A 1 118 ? -15.935 31.260  -34.433 1.00 31.11 ? 110 LEU A CB    1 
ATOM   886  C  CG    . LEU A 1 118 ? -15.311 31.502  -33.063 1.00 31.29 ? 110 LEU A CG    1 
ATOM   887  C  CD1   . LEU A 1 118 ? -16.121 30.832  -31.957 1.00 31.03 ? 110 LEU A CD1   1 
ATOM   888  C  CD2   . LEU A 1 118 ? -13.881 31.001  -33.062 1.00 31.46 ? 110 LEU A CD2   1 
ATOM   889  N  N     . ARG A 1 119 ? -18.223 32.525  -36.537 1.00 31.51 ? 111 ARG A N     1 
ATOM   890  C  CA    . ARG A 1 119 ? -18.523 33.696  -37.348 1.00 31.59 ? 111 ARG A CA    1 
ATOM   891  C  C     . ARG A 1 119 ? -19.986 34.156  -37.269 1.00 31.83 ? 111 ARG A C     1 
ATOM   892  O  O     . ARG A 1 119 ? -20.283 35.331  -37.504 1.00 31.74 ? 111 ARG A O     1 
ATOM   893  C  CB    . ARG A 1 119 ? -18.109 33.465  -38.798 1.00 31.60 ? 111 ARG A CB    1 
ATOM   894  C  CG    . ARG A 1 119 ? -16.625 33.609  -39.032 1.00 31.21 ? 111 ARG A CG    1 
ATOM   895  C  CD    . ARG A 1 119 ? -16.308 33.667  -40.503 1.00 30.84 ? 111 ARG A CD    1 
ATOM   896  N  NE    . ARG A 1 119 ? -16.583 32.400  -41.179 1.00 30.68 ? 111 ARG A NE    1 
ATOM   897  C  CZ    . ARG A 1 119 ? -15.695 31.420  -41.330 1.00 29.41 ? 111 ARG A CZ    1 
ATOM   898  N  NH1   . ARG A 1 119 ? -16.037 30.310  -41.964 1.00 28.22 ? 111 ARG A NH1   1 
ATOM   899  N  NH2   . ARG A 1 119 ? -14.465 31.552  -40.849 1.00 29.22 ? 111 ARG A NH2   1 
ATOM   900  N  N     . PHE A 1 120 ? -20.896 33.236  -36.953 1.00 32.15 ? 112 PHE A N     1 
ATOM   901  C  CA    . PHE A 1 120 ? -22.300 33.607  -36.758 1.00 32.53 ? 112 PHE A CA    1 
ATOM   902  C  C     . PHE A 1 120 ? -22.727 33.549  -35.295 1.00 32.86 ? 112 PHE A C     1 
ATOM   903  O  O     . PHE A 1 120 ? -23.797 34.036  -34.935 1.00 32.95 ? 112 PHE A O     1 
ATOM   904  C  CB    . PHE A 1 120 ? -23.240 32.770  -37.645 1.00 32.39 ? 112 PHE A CB    1 
ATOM   905  C  CG    . PHE A 1 120 ? -23.202 31.290  -37.363 1.00 32.63 ? 112 PHE A CG    1 
ATOM   906  C  CD1   . PHE A 1 120 ? -22.495 30.432  -38.194 1.00 32.63 ? 112 PHE A CD1   1 
ATOM   907  C  CD2   . PHE A 1 120 ? -23.908 30.749  -36.293 1.00 32.74 ? 112 PHE A CD2   1 
ATOM   908  C  CE1   . PHE A 1 120 ? -22.468 29.066  -37.949 1.00 32.52 ? 112 PHE A CE1   1 
ATOM   909  C  CE2   . PHE A 1 120 ? -23.877 29.387  -36.038 1.00 32.26 ? 112 PHE A CE2   1 
ATOM   910  C  CZ    . PHE A 1 120 ? -23.157 28.545  -36.867 1.00 32.47 ? 112 PHE A CZ    1 
ATOM   911  N  N     . SER A 1 121 ? -21.883 32.960  -34.457 1.00 33.33 ? 113 SER A N     1 
ATOM   912  C  CA    . SER A 1 121 ? -22.173 32.858  -33.032 1.00 33.97 ? 113 SER A CA    1 
ATOM   913  C  C     . SER A 1 121 ? -21.934 34.186  -32.310 1.00 34.20 ? 113 SER A C     1 
ATOM   914  O  O     . SER A 1 121 ? -21.202 35.047  -32.796 1.00 34.27 ? 113 SER A O     1 
ATOM   915  C  CB    . SER A 1 121 ? -21.337 31.751  -32.387 1.00 33.92 ? 113 SER A CB    1 
ATOM   916  O  OG    . SER A 1 121 ? -19.973 32.122  -32.321 1.00 34.46 ? 113 SER A OG    1 
ATOM   917  N  N     . THR A 1 122 ? -22.548 34.333  -31.141 1.00 34.57 ? 114 THR A N     1 
ATOM   918  C  CA    . THR A 1 122 ? -22.485 35.576  -30.381 1.00 34.83 ? 114 THR A CA    1 
ATOM   919  C  C     . THR A 1 122 ? -21.950 35.331  -28.970 1.00 34.78 ? 114 THR A C     1 
ATOM   920  O  O     . THR A 1 122 ? -20.891 34.724  -28.793 1.00 34.99 ? 114 THR A O     1 
ATOM   921  C  CB    . THR A 1 122 ? -23.871 36.237  -30.284 1.00 34.92 ? 114 THR A CB    1 
ATOM   922  O  OG1   . THR A 1 122 ? -24.802 35.309  -29.716 1.00 34.82 ? 114 THR A OG1   1 
ATOM   923  C  CG2   . THR A 1 122 ? -24.367 36.660  -31.673 1.00 34.99 ? 114 THR A CG2   1 
ATOM   924  N  N     . PRO A 1 128 ? -12.160 32.430  -26.254 1.00 40.98 ? 120 PRO A N     1 
ATOM   925  C  CA    . PRO A 1 128 ? -13.329 31.657  -26.686 1.00 40.86 ? 120 PRO A CA    1 
ATOM   926  C  C     . PRO A 1 128 ? -13.218 30.186  -26.292 1.00 40.73 ? 120 PRO A C     1 
ATOM   927  O  O     . PRO A 1 128 ? -14.193 29.442  -26.390 1.00 40.71 ? 120 PRO A O     1 
ATOM   928  C  CB    . PRO A 1 128 ? -13.290 31.794  -28.212 1.00 40.91 ? 120 PRO A CB    1 
ATOM   929  C  CG    . PRO A 1 128 ? -11.850 32.025  -28.532 1.00 40.88 ? 120 PRO A CG    1 
ATOM   930  C  CD    . PRO A 1 128 ? -11.298 32.821  -27.386 1.00 40.95 ? 120 PRO A CD    1 
ATOM   931  N  N     . VAL A 1 129 ? -12.031 29.786  -25.839 1.00 40.55 ? 121 VAL A N     1 
ATOM   932  C  CA    . VAL A 1 129 ? -11.722 28.380  -25.579 1.00 40.26 ? 121 VAL A CA    1 
ATOM   933  C  C     . VAL A 1 129 ? -11.965 28.023  -24.097 1.00 39.98 ? 121 VAL A C     1 
ATOM   934  O  O     . VAL A 1 129 ? -11.715 26.891  -23.659 1.00 39.92 ? 121 VAL A O     1 
ATOM   935  C  CB    . VAL A 1 129 ? -10.247 28.037  -26.019 1.00 40.36 ? 121 VAL A CB    1 
ATOM   936  C  CG1   . VAL A 1 129 ? -9.232  28.512  -24.975 1.00 40.33 ? 121 VAL A CG1   1 
ATOM   937  C  CG2   . VAL A 1 129 ? -10.088 26.538  -26.317 1.00 40.34 ? 121 VAL A CG2   1 
ATOM   938  N  N     . ASN A 1 130 ? -12.496 28.986  -23.347 1.00 39.58 ? 122 ASN A N     1 
ATOM   939  C  CA    . ASN A 1 130 ? -12.778 28.795  -21.925 1.00 39.12 ? 122 ASN A CA    1 
ATOM   940  C  C     . ASN A 1 130 ? -14.247 28.426  -21.654 1.00 38.66 ? 122 ASN A C     1 
ATOM   941  O  O     . ASN A 1 130 ? -14.659 28.277  -20.495 1.00 38.65 ? 122 ASN A O     1 
ATOM   942  C  CB    . ASN A 1 130 ? -12.391 30.050  -21.138 1.00 39.17 ? 122 ASN A CB    1 
ATOM   943  C  CG    . ASN A 1 130 ? -11.048 30.626  -21.576 1.00 39.58 ? 122 ASN A CG    1 
ATOM   944  O  OD1   . ASN A 1 130 ? -10.063 29.898  -21.729 1.00 40.16 ? 122 ASN A OD1   1 
ATOM   945  N  ND2   . ASN A 1 130 ? -11.006 31.939  -21.778 1.00 39.41 ? 122 ASN A ND2   1 
ATOM   946  N  N     . ASP A 1 131 ? -15.023 28.268  -22.729 1.00 37.79 ? 123 ASP A N     1 
ATOM   947  C  CA    . ASP A 1 131 ? -16.466 28.010  -22.623 1.00 37.00 ? 123 ASP A CA    1 
ATOM   948  C  C     . ASP A 1 131 ? -16.754 26.513  -22.665 1.00 36.31 ? 123 ASP A C     1 
ATOM   949  O  O     . ASP A 1 131 ? -16.157 25.784  -23.451 1.00 36.47 ? 123 ASP A O     1 
ATOM   950  C  CB    . ASP A 1 131 ? -17.211 28.715  -23.761 1.00 37.08 ? 123 ASP A CB    1 
ATOM   951  C  CG    . ASP A 1 131 ? -18.671 28.990  -23.429 1.00 37.44 ? 123 ASP A CG    1 
ATOM   952  O  OD1   . ASP A 1 131 ? -19.445 28.024  -23.245 1.00 37.73 ? 123 ASP A OD1   1 
ATOM   953  O  OD2   . ASP A 1 131 ? -19.050 30.178  -23.382 1.00 37.97 ? 123 ASP A OD2   1 
ATOM   954  N  N     . ARG A 1 132 ? -17.690 26.066  -21.830 1.00 35.43 ? 124 ARG A N     1 
ATOM   955  C  CA    . ARG A 1 132 ? -18.014 24.642  -21.729 1.00 34.43 ? 124 ARG A CA    1 
ATOM   956  C  C     . ARG A 1 132 ? -18.809 24.148  -22.929 1.00 33.76 ? 124 ARG A C     1 
ATOM   957  O  O     . ARG A 1 132 ? -18.695 22.991  -23.319 1.00 33.62 ? 124 ARG A O     1 
ATOM   958  C  CB    . ARG A 1 132 ? -18.775 24.341  -20.434 1.00 34.48 ? 124 ARG A CB    1 
ATOM   959  C  CG    . ARG A 1 132 ? -18.631 22.904  -19.967 1.00 34.38 ? 124 ARG A CG    1 
ATOM   960  C  CD    . ARG A 1 132 ? -19.655 22.545  -18.914 1.00 34.90 ? 124 ARG A CD    1 
ATOM   961  N  NE    . ARG A 1 132 ? -19.877 21.099  -18.861 1.00 35.46 ? 124 ARG A NE    1 
ATOM   962  C  CZ    . ARG A 1 132 ? -20.952 20.521  -18.331 1.00 35.49 ? 124 ARG A CZ    1 
ATOM   963  N  NH1   . ARG A 1 132 ? -21.917 21.260  -17.798 1.00 35.95 ? 124 ARG A NH1   1 
ATOM   964  N  NH2   . ARG A 1 132 ? -21.061 19.202  -18.334 1.00 35.82 ? 124 ARG A NH2   1 
ATOM   965  N  N     . MET A 1 133 ? -19.624 25.028  -23.500 1.00 33.04 ? 125 MET A N     1 
ATOM   966  C  CA    . MET A 1 133 ? -20.352 24.719  -24.728 1.00 32.39 ? 125 MET A CA    1 
ATOM   967  C  C     . MET A 1 133 ? -19.386 24.580  -25.906 1.00 31.83 ? 125 MET A C     1 
ATOM   968  O  O     . MET A 1 133 ? -19.517 23.669  -26.730 1.00 31.62 ? 125 MET A O     1 
ATOM   969  C  CB    . MET A 1 133 ? -21.379 25.815  -25.021 1.00 32.52 ? 125 MET A CB    1 
ATOM   970  C  CG    . MET A 1 133 ? -22.260 25.551  -26.235 1.00 32.34 ? 125 MET A CG    1 
ATOM   971  S  SD    . MET A 1 133 ? -23.077 27.042  -26.840 1.00 32.93 ? 125 MET A SD    1 
ATOM   972  C  CE    . MET A 1 133 ? -24.162 27.430  -25.467 1.00 32.22 ? 125 MET A CE    1 
ATOM   973  N  N     . PHE A 1 134 ? -18.408 25.479  -25.965 1.00 31.21 ? 126 PHE A N     1 
ATOM   974  C  CA    . PHE A 1 134 ? -17.448 25.502  -27.056 1.00 30.74 ? 126 PHE A CA    1 
ATOM   975  C  C     . PHE A 1 134 ? -16.526 24.285  -27.030 1.00 30.34 ? 126 PHE A C     1 
ATOM   976  O  O     . PHE A 1 134 ? -16.185 23.734  -28.076 1.00 30.37 ? 126 PHE A O     1 
ATOM   977  C  CB    . PHE A 1 134 ? -16.623 26.790  -27.016 1.00 30.86 ? 126 PHE A CB    1 
ATOM   978  C  CG    . PHE A 1 134 ? -15.655 26.927  -28.158 1.00 30.97 ? 126 PHE A CG    1 
ATOM   979  C  CD1   . PHE A 1 134 ? -16.080 27.413  -29.392 1.00 30.86 ? 126 PHE A CD1   1 
ATOM   980  C  CD2   . PHE A 1 134 ? -14.317 26.570  -28.003 1.00 31.10 ? 126 PHE A CD2   1 
ATOM   981  C  CE1   . PHE A 1 134 ? -15.191 27.539  -30.448 1.00 30.96 ? 126 PHE A CE1   1 
ATOM   982  C  CE2   . PHE A 1 134 ? -13.423 26.692  -29.056 1.00 31.20 ? 126 PHE A CE2   1 
ATOM   983  C  CZ    . PHE A 1 134 ? -13.859 27.182  -30.279 1.00 31.21 ? 126 PHE A CZ    1 
ATOM   984  N  N     . ARG A 1 135 ? -16.119 23.878  -25.833 1.00 29.81 ? 127 ARG A N     1 
ATOM   985  C  CA    . ARG A 1 135 ? -15.215 22.743  -25.678 1.00 29.46 ? 127 ARG A CA    1 
ATOM   986  C  C     . ARG A 1 135 ? -15.886 21.437  -26.076 1.00 28.81 ? 127 ARG A C     1 
ATOM   987  O  O     . ARG A 1 135 ? -15.251 20.562  -26.658 1.00 28.69 ? 127 ARG A O     1 
ATOM   988  C  CB    . ARG A 1 135 ? -14.689 22.660  -24.244 1.00 29.57 ? 127 ARG A CB    1 
ATOM   989  C  CG    . ARG A 1 135 ? -13.507 23.581  -23.965 1.00 31.03 ? 127 ARG A CG    1 
ATOM   990  C  CD    . ARG A 1 135 ? -12.796 23.194  -22.675 1.00 33.54 ? 127 ARG A CD    1 
ATOM   991  N  NE    . ARG A 1 135 ? -11.472 23.810  -22.560 1.00 35.50 ? 127 ARG A NE    1 
ATOM   992  C  CZ    . ARG A 1 135 ? -10.348 23.277  -23.041 1.00 36.26 ? 127 ARG A CZ    1 
ATOM   993  N  NH1   . ARG A 1 135 ? -10.378 22.117  -23.688 1.00 36.11 ? 127 ARG A NH1   1 
ATOM   994  N  NH2   . ARG A 1 135 ? -9.191  23.909  -22.878 1.00 36.41 ? 127 ARG A NH2   1 
ATOM   995  N  N     . LEU A 1 136 ? -17.177 21.321  -25.771 1.00 28.29 ? 128 LEU A N     1 
ATOM   996  C  CA    . LEU A 1 136 ? -17.953 20.135  -26.122 1.00 27.83 ? 128 LEU A CA    1 
ATOM   997  C  C     . LEU A 1 136 ? -18.170 20.038  -27.630 1.00 27.52 ? 128 LEU A C     1 
ATOM   998  O  O     . LEU A 1 136 ? -18.072 18.957  -28.209 1.00 27.38 ? 128 LEU A O     1 
ATOM   999  C  CB    . LEU A 1 136 ? -19.295 20.131  -25.389 1.00 27.84 ? 128 LEU A CB    1 
ATOM   1000 C  CG    . LEU A 1 136 ? -19.285 19.723  -23.910 1.00 27.92 ? 128 LEU A CG    1 
ATOM   1001 C  CD1   . LEU A 1 136 ? -20.630 20.038  -23.254 1.00 27.29 ? 128 LEU A CD1   1 
ATOM   1002 C  CD2   . LEU A 1 136 ? -18.940 18.246  -23.752 1.00 27.71 ? 128 LEU A CD2   1 
ATOM   1003 N  N     . LEU A 1 137 ? -18.460 21.178  -28.257 1.00 27.24 ? 129 LEU A N     1 
ATOM   1004 C  CA    . LEU A 1 137 ? -18.550 21.260  -29.709 1.00 27.01 ? 129 LEU A CA    1 
ATOM   1005 C  C     . LEU A 1 137 ? -17.286 20.721  -30.346 1.00 26.98 ? 129 LEU A C     1 
ATOM   1006 O  O     . LEU A 1 137 ? -17.341 19.826  -31.191 1.00 26.99 ? 129 LEU A O     1 
ATOM   1007 C  CB    . LEU A 1 137 ? -18.770 22.706  -30.151 1.00 27.06 ? 129 LEU A CB    1 
ATOM   1008 C  CG    . LEU A 1 137 ? -20.198 23.243  -30.153 1.00 26.92 ? 129 LEU A CG    1 
ATOM   1009 C  CD1   . LEU A 1 137 ? -20.193 24.745  -30.372 1.00 26.99 ? 129 LEU A CD1   1 
ATOM   1010 C  CD2   . LEU A 1 137 ? -21.015 22.558  -31.216 1.00 26.54 ? 129 LEU A CD2   1 
ATOM   1011 N  N     . SER A 1 138 ? -16.143 21.266  -29.926 1.00 26.95 ? 130 SER A N     1 
ATOM   1012 C  CA    . SER A 1 138 ? -14.838 20.769  -30.349 1.00 26.90 ? 130 SER A CA    1 
ATOM   1013 C  C     . SER A 1 138 ? -14.735 19.273  -30.136 1.00 26.94 ? 130 SER A C     1 
ATOM   1014 O  O     . SER A 1 138 ? -14.328 18.542  -31.034 1.00 26.99 ? 130 SER A O     1 
ATOM   1015 C  CB    . SER A 1 138 ? -13.722 21.472  -29.579 1.00 26.89 ? 130 SER A CB    1 
ATOM   1016 O  OG    . SER A 1 138 ? -13.434 22.735  -30.138 1.00 27.22 ? 130 SER A OG    1 
ATOM   1017 N  N     . ALA A 1 139 ? -15.128 18.824  -28.944 1.00 27.03 ? 131 ALA A N     1 
ATOM   1018 C  CA    . ALA A 1 139 ? -15.045 17.416  -28.577 1.00 27.24 ? 131 ALA A CA    1 
ATOM   1019 C  C     . ALA A 1 139 ? -15.880 16.527  -29.502 1.00 27.42 ? 131 ALA A C     1 
ATOM   1020 O  O     . ALA A 1 139 ? -15.473 15.410  -29.828 1.00 27.51 ? 131 ALA A O     1 
ATOM   1021 C  CB    . ALA A 1 139 ? -15.456 17.214  -27.114 1.00 27.08 ? 131 ALA A CB    1 
ATOM   1022 N  N     . PHE A 1 140 ? -17.040 17.024  -29.928 1.00 27.56 ? 132 PHE A N     1 
ATOM   1023 C  CA    . PHE A 1 140 ? -17.860 16.288  -30.884 1.00 27.85 ? 132 PHE A CA    1 
ATOM   1024 C  C     . PHE A 1 140 ? -17.239 16.271  -32.278 1.00 28.27 ? 132 PHE A C     1 
ATOM   1025 O  O     . PHE A 1 140 ? -17.307 15.271  -32.977 1.00 28.27 ? 132 PHE A O     1 
ATOM   1026 C  CB    . PHE A 1 140 ? -19.281 16.842  -30.951 1.00 27.53 ? 132 PHE A CB    1 
ATOM   1027 C  CG    . PHE A 1 140 ? -20.175 16.085  -31.895 1.00 26.99 ? 132 PHE A CG    1 
ATOM   1028 C  CD1   . PHE A 1 140 ? -20.724 14.862  -31.522 1.00 26.49 ? 132 PHE A CD1   1 
ATOM   1029 C  CD2   . PHE A 1 140 ? -20.434 16.571  -33.172 1.00 26.44 ? 132 PHE A CD2   1 
ATOM   1030 C  CE1   . PHE A 1 140 ? -21.538 14.148  -32.396 1.00 26.21 ? 132 PHE A CE1   1 
ATOM   1031 C  CE2   . PHE A 1 140 ? -21.243 15.860  -34.055 1.00 26.61 ? 132 PHE A CE2   1 
ATOM   1032 C  CZ    . PHE A 1 140 ? -21.797 14.647  -33.662 1.00 26.43 ? 132 PHE A CZ    1 
ATOM   1033 N  N     . ILE A 1 141 ? -16.644 17.389  -32.676 1.00 29.00 ? 133 ILE A N     1 
ATOM   1034 C  CA    . ILE A 1 141 ? -16.021 17.494  -33.994 1.00 29.79 ? 133 ILE A CA    1 
ATOM   1035 C  C     . ILE A 1 141 ? -14.737 16.658  -34.082 1.00 30.40 ? 133 ILE A C     1 
ATOM   1036 O  O     . ILE A 1 141 ? -14.480 16.007  -35.095 1.00 30.49 ? 133 ILE A O     1 
ATOM   1037 C  CB    . ILE A 1 141 ? -15.740 18.969  -34.373 1.00 29.67 ? 133 ILE A CB    1 
ATOM   1038 C  CG1   . ILE A 1 141 ? -17.061 19.732  -34.529 1.00 29.61 ? 133 ILE A CG1   1 
ATOM   1039 C  CG2   . ILE A 1 141 ? -14.924 19.051  -35.660 1.00 29.62 ? 133 ILE A CG2   1 
ATOM   1040 C  CD1   . ILE A 1 141 ? -16.927 21.241  -34.412 1.00 29.38 ? 133 ILE A CD1   1 
ATOM   1041 N  N     . ALA A 1 142 ? -13.960 16.650  -33.002 1.00 31.27 ? 134 ALA A N     1 
ATOM   1042 C  CA    . ALA A 1 142 ? -12.690 15.923  -32.973 1.00 32.18 ? 134 ALA A CA    1 
ATOM   1043 C  C     . ALA A 1 142 ? -12.887 14.410  -32.867 1.00 32.86 ? 134 ALA A C     1 
ATOM   1044 O  O     . ALA A 1 142 ? -12.207 13.643  -33.549 1.00 32.91 ? 134 ALA A O     1 
ATOM   1045 C  CB    . ALA A 1 142 ? -11.810 16.429  -31.837 1.00 32.11 ? 134 ALA A CB    1 
ATOM   1046 N  N     . ASP A 1 143 ? -13.820 13.990  -32.011 1.00 33.75 ? 135 ASP A N     1 
ATOM   1047 C  CA    . ASP A 1 143 ? -14.052 12.565  -31.755 1.00 34.57 ? 135 ASP A CA    1 
ATOM   1048 C  C     . ASP A 1 143 ? -15.491 12.306  -31.312 1.00 34.89 ? 135 ASP A C     1 
ATOM   1049 O  O     . ASP A 1 143 ? -15.752 12.023  -30.138 1.00 35.06 ? 135 ASP A O     1 
ATOM   1050 C  CB    . ASP A 1 143 ? -13.068 12.043  -30.695 1.00 34.85 ? 135 ASP A CB    1 
ATOM   1051 C  CG    . ASP A 1 143 ? -13.013 10.519  -30.642 1.00 35.86 ? 135 ASP A CG    1 
ATOM   1052 O  OD1   . ASP A 1 143 ? -13.446 9.867   -31.621 1.00 36.98 ? 135 ASP A OD1   1 
ATOM   1053 O  OD2   . ASP A 1 143 ? -12.531 9.975   -29.623 1.00 36.61 ? 135 ASP A OD2   1 
ATOM   1054 N  N     . GLY A 1 144 ? -16.421 12.398  -32.258 1.00 35.24 ? 136 GLY A N     1 
ATOM   1055 C  CA    . GLY A 1 144 ? -17.841 12.253  -31.955 1.00 35.66 ? 136 GLY A CA    1 
ATOM   1056 C  C     . GLY A 1 144 ? -18.269 10.813  -31.758 1.00 36.15 ? 136 GLY A C     1 
ATOM   1057 O  O     . GLY A 1 144 ? -19.186 10.531  -30.988 1.00 36.07 ? 136 GLY A O     1 
ATOM   1058 N  N     . GLY A 1 145 ? -17.591 9.895   -32.443 1.00 36.57 ? 137 GLY A N     1 
ATOM   1059 C  CA    . GLY A 1 145 ? -17.988 8.490   -32.449 1.00 37.09 ? 137 GLY A CA    1 
ATOM   1060 C  C     . GLY A 1 145 ? -17.560 7.721   -31.213 1.00 37.52 ? 137 GLY A C     1 
ATOM   1061 O  O     . GLY A 1 145 ? -17.696 6.497   -31.160 1.00 37.61 ? 137 GLY A O     1 
ATOM   1062 N  N     . ARG A 1 146 ? -17.062 8.441   -30.209 1.00 37.83 ? 138 ARG A N     1 
ATOM   1063 C  CA    . ARG A 1 146 ? -16.457 7.815   -29.037 1.00 38.20 ? 138 ARG A CA    1 
ATOM   1064 C  C     . ARG A 1 146 ? -17.473 7.084   -28.160 1.00 38.47 ? 138 ARG A C     1 
ATOM   1065 O  O     . ARG A 1 146 ? -17.312 5.897   -27.872 1.00 38.45 ? 138 ARG A O     1 
ATOM   1066 C  CB    . ARG A 1 146 ? -15.697 8.843   -28.208 1.00 38.17 ? 138 ARG A CB    1 
ATOM   1067 C  CG    . ARG A 1 146 ? -14.961 8.240   -27.030 1.00 38.12 ? 138 ARG A CG    1 
ATOM   1068 C  CD    . ARG A 1 146 ? -14.713 9.267   -25.954 1.00 38.19 ? 138 ARG A CD    1 
ATOM   1069 N  NE    . ARG A 1 146 ? -13.868 10.357  -26.420 1.00 37.78 ? 138 ARG A NE    1 
ATOM   1070 C  CZ    . ARG A 1 146 ? -12.552 10.271  -26.548 1.00 37.83 ? 138 ARG A CZ    1 
ATOM   1071 N  NH1   . ARG A 1 146 ? -11.859 11.315  -26.981 1.00 37.57 ? 138 ARG A NH1   1 
ATOM   1072 N  NH2   . ARG A 1 146 ? -11.930 9.135   -26.255 1.00 37.86 ? 138 ARG A NH2   1 
ATOM   1073 N  N     . TYR A 1 147 ? -18.505 7.801   -27.721 1.00 38.79 ? 139 TYR A N     1 
ATOM   1074 C  CA    . TYR A 1 147 ? -19.567 7.198   -26.917 1.00 39.23 ? 139 TYR A CA    1 
ATOM   1075 C  C     . TYR A 1 147 ? -20.787 6.878   -27.764 1.00 39.36 ? 139 TYR A C     1 
ATOM   1076 O  O     . TYR A 1 147 ? -21.918 6.871   -27.278 1.00 39.26 ? 139 TYR A O     1 
ATOM   1077 C  CB    . TYR A 1 147 ? -19.937 8.096   -25.737 1.00 39.41 ? 139 TYR A CB    1 
ATOM   1078 C  CG    . TYR A 1 147 ? -18.851 8.180   -24.695 1.00 39.71 ? 139 TYR A CG    1 
ATOM   1079 C  CD1   . TYR A 1 147 ? -18.467 7.052   -23.971 1.00 39.95 ? 139 TYR A CD1   1 
ATOM   1080 C  CD2   . TYR A 1 147 ? -18.192 9.377   -24.445 1.00 40.00 ? 139 TYR A CD2   1 
ATOM   1081 C  CE1   . TYR A 1 147 ? -17.460 7.118   -23.023 1.00 40.07 ? 139 TYR A CE1   1 
ATOM   1082 C  CE2   . TYR A 1 147 ? -17.189 9.456   -23.494 1.00 40.20 ? 139 TYR A CE2   1 
ATOM   1083 C  CZ    . TYR A 1 147 ? -16.826 8.324   -22.789 1.00 40.06 ? 139 TYR A CZ    1 
ATOM   1084 O  OH    . TYR A 1 147 ? -15.833 8.399   -21.849 1.00 40.02 ? 139 TYR A OH    1 
ATOM   1085 N  N     . CYS A 1 148 ? -20.541 6.612   -29.039 1.00 39.82 ? 140 CYS A N     1 
ATOM   1086 C  CA    . CYS A 1 148 ? -21.545 6.062   -29.914 1.00 39.82 ? 140 CYS A CA    1 
ATOM   1087 C  C     . CYS A 1 148 ? -21.755 4.594   -29.569 1.00 39.72 ? 140 CYS A C     1 
ATOM   1088 O  O     . CYS A 1 148 ? -20.796 3.828   -29.484 1.00 39.77 ? 140 CYS A O     1 
ATOM   1089 C  CB    . CYS A 1 148 ? -21.097 6.197   -31.363 1.00 39.83 ? 140 CYS A CB    1 
ATOM   1090 S  SG    . CYS A 1 148 ? -22.382 5.846   -32.560 1.00 41.01 ? 140 CYS A SG    1 
ATOM   1091 N  N     . LEU A 1 149 ? -23.009 4.214   -29.348 1.00 39.56 ? 141 LEU A N     1 
ATOM   1092 C  CA    . LEU A 1 149 ? -23.348 2.836   -29.008 1.00 39.44 ? 141 LEU A CA    1 
ATOM   1093 C  C     . LEU A 1 149 ? -23.292 1.946   -30.246 1.00 39.52 ? 141 LEU A C     1 
ATOM   1094 O  O     . LEU A 1 149 ? -24.061 2.143   -31.187 1.00 39.50 ? 141 LEU A O     1 
ATOM   1095 C  CB    . LEU A 1 149 ? -24.743 2.776   -28.381 1.00 39.44 ? 141 LEU A CB    1 
ATOM   1096 C  CG    . LEU A 1 149 ? -25.130 1.494   -27.643 1.00 39.31 ? 141 LEU A CG    1 
ATOM   1097 C  CD1   . LEU A 1 149 ? -24.352 1.368   -26.343 1.00 38.93 ? 141 LEU A CD1   1 
ATOM   1098 C  CD2   . LEU A 1 149 ? -26.627 1.468   -27.375 1.00 39.26 ? 141 LEU A CD2   1 
ATOM   1099 N  N     . PRO A 1 150 ? -22.371 0.962   -30.251 1.00 39.64 ? 142 PRO A N     1 
ATOM   1100 C  CA    . PRO A 1 150 ? -22.196 0.057   -31.390 1.00 39.77 ? 142 PRO A CA    1 
ATOM   1101 C  C     . PRO A 1 150 ? -23.457 -0.764  -31.682 1.00 39.98 ? 142 PRO A C     1 
ATOM   1102 O  O     . PRO A 1 150 ? -24.289 -0.962  -30.793 1.00 39.98 ? 142 PRO A O     1 
ATOM   1103 C  CB    . PRO A 1 150 ? -21.054 -0.865  -30.933 1.00 39.74 ? 142 PRO A CB    1 
ATOM   1104 C  CG    . PRO A 1 150 ? -20.356 -0.104  -29.857 1.00 39.45 ? 142 PRO A CG    1 
ATOM   1105 C  CD    . PRO A 1 150 ? -21.427 0.657   -29.162 1.00 39.61 ? 142 PRO A CD    1 
ATOM   1106 N  N     . GLU A 1 151 ? -23.583 -1.235  -32.922 1.00 40.13 ? 143 GLU A N     1 
ATOM   1107 C  CA    . GLU A 1 151 ? -24.787 -1.942  -33.374 1.00 40.22 ? 143 GLU A CA    1 
ATOM   1108 C  C     . GLU A 1 151 ? -25.084 -3.247  -32.608 1.00 39.90 ? 143 GLU A C     1 
ATOM   1109 O  O     . GLU A 1 151 ? -26.240 -3.517  -32.288 1.00 39.77 ? 143 GLU A O     1 
ATOM   1110 C  CB    . GLU A 1 151 ? -24.737 -2.205  -34.891 1.00 40.48 ? 143 GLU A CB    1 
ATOM   1111 C  CG    . GLU A 1 151 ? -24.448 -0.964  -35.747 1.00 41.56 ? 143 GLU A CG    1 
ATOM   1112 C  CD    . GLU A 1 151 ? -25.578 0.064   -35.714 1.00 42.72 ? 143 GLU A CD    1 
ATOM   1113 O  OE1   . GLU A 1 151 ? -26.754 -0.337  -35.556 1.00 42.88 ? 143 GLU A OE1   1 
ATOM   1114 O  OE2   . GLU A 1 151 ? -25.285 1.272   -35.861 1.00 43.25 ? 143 GLU A OE2   1 
ATOM   1115 N  N     . PRO A 1 152 ? -24.042 -4.066  -32.327 1.00 39.75 ? 144 PRO A N     1 
ATOM   1116 C  CA    . PRO A 1 152 ? -24.280 -5.277  -31.530 1.00 39.61 ? 144 PRO A CA    1 
ATOM   1117 C  C     . PRO A 1 152 ? -24.817 -4.989  -30.118 1.00 39.43 ? 144 PRO A C     1 
ATOM   1118 O  O     . PRO A 1 152 ? -25.513 -5.826  -29.544 1.00 39.43 ? 144 PRO A O     1 
ATOM   1119 C  CB    . PRO A 1 152 ? -22.887 -5.924  -31.446 1.00 39.68 ? 144 PRO A CB    1 
ATOM   1120 C  CG    . PRO A 1 152 ? -21.926 -4.822  -31.767 1.00 39.76 ? 144 PRO A CG    1 
ATOM   1121 C  CD    . PRO A 1 152 ? -22.630 -3.964  -32.750 1.00 39.74 ? 144 PRO A CD    1 
ATOM   1122 N  N     . LEU A 1 153 ? -24.509 -3.809  -29.583 1.00 39.17 ? 145 LEU A N     1 
ATOM   1123 C  CA    . LEU A 1 153 ? -24.847 -3.481  -28.196 1.00 38.91 ? 145 LEU A CA    1 
ATOM   1124 C  C     . LEU A 1 153 ? -26.113 -2.639  -28.059 1.00 38.79 ? 145 LEU A C     1 
ATOM   1125 O  O     . LEU A 1 153 ? -26.319 -1.981  -27.043 1.00 38.69 ? 145 LEU A O     1 
ATOM   1126 C  CB    . LEU A 1 153 ? -23.668 -2.792  -27.498 1.00 38.92 ? 145 LEU A CB    1 
ATOM   1127 C  CG    . LEU A 1 153 ? -22.518 -3.705  -27.060 1.00 38.85 ? 145 LEU A CG    1 
ATOM   1128 C  CD1   . LEU A 1 153 ? -21.329 -2.885  -26.586 1.00 39.02 ? 145 LEU A CD1   1 
ATOM   1129 C  CD2   . LEU A 1 153 ? -22.977 -4.672  -25.974 1.00 38.49 ? 145 LEU A CD2   1 
ATOM   1130 N  N     . GLN A 1 154 ? -26.961 -2.666  -29.081 1.00 38.69 ? 146 GLN A N     1 
ATOM   1131 C  CA    . GLN A 1 154 ? -28.295 -2.086  -28.970 1.00 38.56 ? 146 GLN A CA    1 
ATOM   1132 C  C     . GLN A 1 154 ? -29.153 -2.976  -28.077 1.00 38.24 ? 146 GLN A C     1 
ATOM   1133 O  O     . GLN A 1 154 ? -29.099 -4.202  -28.191 1.00 38.32 ? 146 GLN A O     1 
ATOM   1134 C  CB    . GLN A 1 154 ? -28.943 -1.947  -30.353 1.00 38.74 ? 146 GLN A CB    1 
ATOM   1135 C  CG    . GLN A 1 154 ? -28.216 -1.002  -31.298 1.00 39.41 ? 146 GLN A CG    1 
ATOM   1136 C  CD    . GLN A 1 154 ? -28.297 0.448   -30.859 1.00 40.99 ? 146 GLN A CD    1 
ATOM   1137 O  OE1   . GLN A 1 154 ? -29.315 0.894   -30.316 1.00 41.45 ? 146 GLN A OE1   1 
ATOM   1138 N  NE2   . GLN A 1 154 ? -27.225 1.200   -31.103 1.00 41.42 ? 146 GLN A NE2   1 
ATOM   1139 N  N     . PRO A 1 155 ? -29.936 -2.362  -27.168 1.00 37.91 ? 147 PRO A N     1 
ATOM   1140 C  CA    . PRO A 1 155 ? -30.801 -3.115  -26.251 1.00 37.55 ? 147 PRO A CA    1 
ATOM   1141 C  C     . PRO A 1 155 ? -31.837 -3.961  -26.987 1.00 37.17 ? 147 PRO A C     1 
ATOM   1142 O  O     . PRO A 1 155 ? -32.195 -5.043  -26.519 1.00 37.15 ? 147 PRO A O     1 
ATOM   1143 C  CB    . PRO A 1 155 ? -31.493 -2.013  -25.438 1.00 37.57 ? 147 PRO A CB    1 
ATOM   1144 C  CG    . PRO A 1 155 ? -30.596 -0.830  -25.561 1.00 37.64 ? 147 PRO A CG    1 
ATOM   1145 C  CD    . PRO A 1 155 ? -30.025 -0.912  -26.936 1.00 37.89 ? 147 PRO A CD    1 
ATOM   1146 N  N     . SER A 1 156 ? -32.284 -3.479  -28.148 1.00 36.78 ? 148 SER A N     1 
ATOM   1147 C  CA    . SER A 1 156 ? -33.267 -4.196  -28.967 1.00 36.32 ? 148 SER A CA    1 
ATOM   1148 C  C     . SER A 1 156 ? -32.699 -5.487  -29.567 1.00 35.96 ? 148 SER A C     1 
ATOM   1149 O  O     . SER A 1 156 ? -33.447 -6.350  -30.014 1.00 35.92 ? 148 SER A O     1 
ATOM   1150 C  CB    . SER A 1 156 ? -33.807 -3.287  -30.081 1.00 36.37 ? 148 SER A CB    1 
ATOM   1151 O  OG    . SER A 1 156 ? -32.816 -3.037  -31.068 1.00 36.10 ? 148 SER A OG    1 
ATOM   1152 N  N     . ARG A 1 157 ? -31.375 -5.608  -29.573 1.00 35.57 ? 149 ARG A N     1 
ATOM   1153 C  CA    . ARG A 1 157 ? -30.719 -6.813  -30.068 1.00 35.23 ? 149 ARG A CA    1 
ATOM   1154 C  C     . ARG A 1 157 ? -30.247 -7.720  -28.934 1.00 34.71 ? 149 ARG A C     1 
ATOM   1155 O  O     . ARG A 1 157 ? -29.300 -8.492  -29.096 1.00 34.48 ? 149 ARG A O     1 
ATOM   1156 C  CB    . ARG A 1 157 ? -29.554 -6.453  -30.990 1.00 35.46 ? 149 ARG A CB    1 
ATOM   1157 C  CG    . ARG A 1 157 ? -29.988 -6.084  -32.401 1.00 36.36 ? 149 ARG A CG    1 
ATOM   1158 C  CD    . ARG A 1 157 ? -28.829 -5.558  -33.226 1.00 37.74 ? 149 ARG A CD    1 
ATOM   1159 N  NE    . ARG A 1 157 ? -27.829 -6.589  -33.488 1.00 38.71 ? 149 ARG A NE    1 
ATOM   1160 C  CZ    . ARG A 1 157 ? -26.815 -6.447  -34.336 1.00 39.20 ? 149 ARG A CZ    1 
ATOM   1161 N  NH1   . ARG A 1 157 ? -26.667 -5.315  -35.016 1.00 39.76 ? 149 ARG A NH1   1 
ATOM   1162 N  NH2   . ARG A 1 157 ? -25.949 -7.438  -34.506 1.00 39.23 ? 149 ARG A NH2   1 
ATOM   1163 N  N     . TRP A 1 158 ? -30.914 -7.621  -27.786 1.00 34.20 ? 150 TRP A N     1 
ATOM   1164 C  CA    . TRP A 1 158 ? -30.637 -8.504  -26.654 1.00 33.66 ? 150 TRP A CA    1 
ATOM   1165 C  C     . TRP A 1 158 ? -31.917 -8.940  -25.945 1.00 33.61 ? 150 TRP A C     1 
ATOM   1166 O  O     . TRP A 1 158 ? -32.926 -8.236  -25.973 1.00 33.64 ? 150 TRP A O     1 
ATOM   1167 C  CB    . TRP A 1 158 ? -29.676 -7.840  -25.668 1.00 33.12 ? 150 TRP A CB    1 
ATOM   1168 C  CG    . TRP A 1 158 ? -28.284 -7.740  -26.186 1.00 32.41 ? 150 TRP A CG    1 
ATOM   1169 C  CD1   . TRP A 1 158 ? -27.738 -6.694  -26.870 1.00 31.76 ? 150 TRP A CD1   1 
ATOM   1170 C  CD2   . TRP A 1 158 ? -27.259 -8.734  -26.088 1.00 31.70 ? 150 TRP A CD2   1 
ATOM   1171 N  NE1   . TRP A 1 158 ? -26.434 -6.969  -27.196 1.00 31.30 ? 150 TRP A NE1   1 
ATOM   1172 C  CE2   . TRP A 1 158 ? -26.112 -8.215  -26.728 1.00 31.57 ? 150 TRP A CE2   1 
ATOM   1173 C  CE3   . TRP A 1 158 ? -27.193 -10.006 -25.510 1.00 31.27 ? 150 TRP A CE3   1 
ATOM   1174 C  CZ2   . TRP A 1 158 ? -24.913 -8.927  -26.811 1.00 31.80 ? 150 TRP A CZ2   1 
ATOM   1175 C  CZ3   . TRP A 1 158 ? -26.004 -10.715 -25.594 1.00 32.02 ? 150 TRP A CZ3   1 
ATOM   1176 C  CH2   . TRP A 1 158 ? -24.877 -10.171 -26.241 1.00 32.18 ? 150 TRP A CH2   1 
ATOM   1177 N  N     . MET A 1 159 ? -31.859 -10.107 -25.312 1.00 33.64 ? 151 MET A N     1 
ATOM   1178 C  CA    . MET A 1 159 ? -33.023 -10.712 -24.681 1.00 33.73 ? 151 MET A CA    1 
ATOM   1179 C  C     . MET A 1 159 ? -32.612 -11.419 -23.395 1.00 33.73 ? 151 MET A C     1 
ATOM   1180 O  O     . MET A 1 159 ? -31.748 -12.299 -23.412 1.00 33.70 ? 151 MET A O     1 
ATOM   1181 C  CB    . MET A 1 159 ? -33.673 -11.709 -25.642 1.00 33.83 ? 151 MET A CB    1 
ATOM   1182 C  CG    . MET A 1 159 ? -34.761 -12.587 -25.030 1.00 34.23 ? 151 MET A CG    1 
ATOM   1183 S  SD    . MET A 1 159 ? -36.390 -11.819 -25.068 1.00 35.56 ? 151 MET A SD    1 
ATOM   1184 C  CE    . MET A 1 159 ? -36.451 -11.199 -26.751 1.00 35.32 ? 151 MET A CE    1 
ATOM   1185 N  N     . MET A 1 160 ? -33.227 -11.027 -22.282 1.00 33.80 ? 152 MET A N     1 
ATOM   1186 C  CA    . MET A 1 160 ? -32.987 -11.686 -20.998 1.00 33.93 ? 152 MET A CA    1 
ATOM   1187 C  C     . MET A 1 160 ? -33.699 -13.038 -20.936 1.00 34.39 ? 152 MET A C     1 
ATOM   1188 O  O     . MET A 1 160 ? -34.871 -13.151 -21.307 1.00 34.35 ? 152 MET A O     1 
ATOM   1189 C  CB    . MET A 1 160 ? -33.442 -10.796 -19.838 1.00 33.59 ? 152 MET A CB    1 
ATOM   1190 C  CG    . MET A 1 160 ? -32.684 -9.475  -19.713 1.00 32.98 ? 152 MET A CG    1 
ATOM   1191 S  SD    . MET A 1 160 ? -30.883 -9.653  -19.578 1.00 31.68 ? 152 MET A SD    1 
ATOM   1192 C  CE    . MET A 1 160 ? -30.723 -10.522 -18.019 1.00 31.97 ? 152 MET A CE    1 
ATOM   1193 N  N     . MET A 1 161 ? -32.983 -14.060 -20.470 1.00 35.03 ? 153 MET A N     1 
ATOM   1194 C  CA    . MET A 1 161 ? -33.519 -15.423 -20.426 1.00 35.85 ? 153 MET A CA    1 
ATOM   1195 C  C     . MET A 1 161 ? -33.355 -16.073 -19.059 1.00 35.98 ? 153 MET A C     1 
ATOM   1196 O  O     . MET A 1 161 ? -32.245 -16.135 -18.530 1.00 36.09 ? 153 MET A O     1 
ATOM   1197 C  CB    . MET A 1 161 ? -32.855 -16.297 -21.487 1.00 35.79 ? 153 MET A CB    1 
ATOM   1198 C  CG    . MET A 1 161 ? -33.320 -16.015 -22.889 1.00 36.44 ? 153 MET A CG    1 
ATOM   1199 S  SD    . MET A 1 161 ? -32.990 -17.384 -24.005 1.00 37.19 ? 153 MET A SD    1 
ATOM   1200 C  CE    . MET A 1 161 ? -33.508 -16.655 -25.555 1.00 36.83 ? 153 MET A CE    1 
ATOM   1201 N  N     . PRO A 1 162 ? -34.467 -16.580 -18.492 1.00 36.22 ? 154 PRO A N     1 
ATOM   1202 C  CA    . PRO A 1 162 ? -34.460 -17.365 -17.255 1.00 36.25 ? 154 PRO A CA    1 
ATOM   1203 C  C     . PRO A 1 162 ? -33.655 -18.656 -17.404 1.00 36.36 ? 154 PRO A C     1 
ATOM   1204 O  O     . PRO A 1 162 ? -32.461 -18.679 -17.099 1.00 36.44 ? 154 PRO A O     1 
ATOM   1205 C  CB    . PRO A 1 162 ? -35.944 -17.701 -17.045 1.00 36.27 ? 154 PRO A CB    1 
ATOM   1206 C  CG    . PRO A 1 162 ? -36.688 -16.694 -17.847 1.00 36.36 ? 154 PRO A CG    1 
ATOM   1207 C  CD    . PRO A 1 162 ? -35.829 -16.406 -19.025 1.00 36.31 ? 154 PRO A CD    1 
ATOM   1208 N  N     . THR A 1 166 ? -33.421 -22.621 -11.045 1.00 53.16 ? 158 THR A N     1 
ATOM   1209 C  CA    . THR A 1 166 ? -34.476 -22.495 -10.042 1.00 53.16 ? 158 THR A CA    1 
ATOM   1210 C  C     . THR A 1 166 ? -33.894 -22.428 -8.628  1.00 53.08 ? 158 THR A C     1 
ATOM   1211 O  O     . THR A 1 166 ? -33.141 -23.315 -8.208  1.00 52.98 ? 158 THR A O     1 
ATOM   1212 C  CB    . THR A 1 166 ? -35.491 -23.658 -10.138 1.00 53.26 ? 158 THR A CB    1 
ATOM   1213 O  OG1   . THR A 1 166 ? -36.001 -23.739 -11.476 1.00 53.27 ? 158 THR A OG1   1 
ATOM   1214 C  CG2   . THR A 1 166 ? -36.656 -23.447 -9.167  1.00 53.21 ? 158 THR A CG2   1 
ATOM   1215 N  N     . ALA A 1 167 ? -34.251 -21.369 -7.904  1.00 53.02 ? 159 ALA A N     1 
ATOM   1216 C  CA    . ALA A 1 167 ? -33.716 -21.114 -6.565  1.00 52.90 ? 159 ALA A CA    1 
ATOM   1217 C  C     . ALA A 1 167 ? -34.281 -22.071 -5.520  1.00 52.76 ? 159 ALA A C     1 
ATOM   1218 O  O     . ALA A 1 167 ? -35.394 -22.586 -5.667  1.00 52.80 ? 159 ALA A O     1 
ATOM   1219 C  CB    . ALA A 1 167 ? -33.988 -19.671 -6.156  1.00 52.91 ? 159 ALA A CB    1 
ATOM   1220 N  N     . ALA A 1 168 ? -33.511 -22.297 -4.461  1.00 52.50 ? 160 ALA A N     1 
ATOM   1221 C  CA    . ALA A 1 168 ? -33.994 -23.048 -3.308  1.00 52.35 ? 160 ALA A CA    1 
ATOM   1222 C  C     . ALA A 1 168 ? -33.911 -22.203 -2.032  1.00 52.19 ? 160 ALA A C     1 
ATOM   1223 O  O     . ALA A 1 168 ? -32.922 -22.276 -1.296  1.00 52.26 ? 160 ALA A O     1 
ATOM   1224 C  CB    . ALA A 1 168 ? -33.209 -24.350 -3.148  1.00 52.30 ? 160 ALA A CB    1 
ATOM   1225 N  N     . PRO A 1 169 ? -34.947 -21.379 -1.777  1.00 52.03 ? 161 PRO A N     1 
ATOM   1226 C  CA    . PRO A 1 169 ? -35.002 -20.586 -0.548  1.00 51.73 ? 161 PRO A CA    1 
ATOM   1227 C  C     . PRO A 1 169 ? -35.255 -21.478 0.661   1.00 51.38 ? 161 PRO A C     1 
ATOM   1228 O  O     . PRO A 1 169 ? -35.975 -22.473 0.557   1.00 51.28 ? 161 PRO A O     1 
ATOM   1229 C  CB    . PRO A 1 169 ? -36.202 -19.648 -0.781  1.00 51.83 ? 161 PRO A CB    1 
ATOM   1230 C  CG    . PRO A 1 169 ? -36.537 -19.778 -2.252  1.00 51.97 ? 161 PRO A CG    1 
ATOM   1231 C  CD    . PRO A 1 169 ? -36.125 -21.150 -2.630  1.00 52.02 ? 161 PRO A CD    1 
ATOM   1232 N  N     . GLN A 1 170 ? -34.666 -21.117 1.797   1.00 50.97 ? 162 GLN A N     1 
ATOM   1233 C  CA    . GLN A 1 170 ? -34.686 -21.966 2.982   1.00 50.57 ? 162 GLN A CA    1 
ATOM   1234 C  C     . GLN A 1 170 ? -34.496 -21.116 4.234   1.00 50.06 ? 162 GLN A C     1 
ATOM   1235 O  O     . GLN A 1 170 ? -33.632 -20.243 4.269   1.00 50.12 ? 162 GLN A O     1 
ATOM   1236 C  CB    . GLN A 1 170 ? -33.571 -23.014 2.886   1.00 50.52 ? 162 GLN A CB    1 
ATOM   1237 C  CG    . GLN A 1 170 ? -33.678 -24.155 3.883   1.00 50.93 ? 162 GLN A CG    1 
ATOM   1238 C  CD    . GLN A 1 170 ? -32.443 -25.048 3.880   1.00 51.12 ? 162 GLN A CD    1 
ATOM   1239 O  OE1   . GLN A 1 170 ? -31.327 -24.584 3.630   1.00 51.70 ? 162 GLN A OE1   1 
ATOM   1240 N  NE2   . GLN A 1 170 ? -32.638 -26.334 4.158   1.00 51.50 ? 162 GLN A NE2   1 
ATOM   1241 N  N     . HIS A 1 171 ? -35.311 -21.362 5.255   1.00 49.48 ? 163 HIS A N     1 
ATOM   1242 C  CA    . HIS A 1 171 ? -35.103 -20.724 6.557   1.00 48.85 ? 163 HIS A CA    1 
ATOM   1243 C  C     . HIS A 1 171 ? -34.191 -21.571 7.431   1.00 48.12 ? 163 HIS A C     1 
ATOM   1244 O  O     . HIS A 1 171 ? -34.435 -22.760 7.624   1.00 48.11 ? 163 HIS A O     1 
ATOM   1245 C  CB    . HIS A 1 171 ? -36.436 -20.472 7.275   1.00 49.01 ? 163 HIS A CB    1 
ATOM   1246 C  CG    . HIS A 1 171 ? -36.281 -19.988 8.689   1.00 49.41 ? 163 HIS A CG    1 
ATOM   1247 N  ND1   . HIS A 1 171 ? -36.017 -18.670 9.001   1.00 49.56 ? 163 HIS A ND1   1 
ATOM   1248 C  CD2   . HIS A 1 171 ? -36.349 -20.647 9.872   1.00 49.66 ? 163 HIS A CD2   1 
ATOM   1249 C  CE1   . HIS A 1 171 ? -35.928 -18.540 10.313  1.00 49.53 ? 163 HIS A CE1   1 
ATOM   1250 N  NE2   . HIS A 1 171 ? -36.125 -19.724 10.865  1.00 49.32 ? 163 HIS A NE2   1 
ATOM   1251 N  N     . LEU A 1 172 ? -33.137 -20.952 7.953   1.00 47.19 ? 164 LEU A N     1 
ATOM   1252 C  CA    . LEU A 1 172 ? -32.249 -21.618 8.898   1.00 46.32 ? 164 LEU A CA    1 
ATOM   1253 C  C     . LEU A 1 172 ? -32.569 -21.179 10.327  1.00 45.68 ? 164 LEU A C     1 
ATOM   1254 O  O     . LEU A 1 172 ? -32.469 -19.992 10.652  1.00 45.81 ? 164 LEU A O     1 
ATOM   1255 C  CB    . LEU A 1 172 ? -30.780 -21.327 8.565   1.00 46.23 ? 164 LEU A CB    1 
ATOM   1256 C  CG    . LEU A 1 172 ? -30.278 -21.731 7.174   1.00 46.00 ? 164 LEU A CG    1 
ATOM   1257 C  CD1   . LEU A 1 172 ? -28.879 -21.182 6.924   1.00 45.74 ? 164 LEU A CD1   1 
ATOM   1258 C  CD2   . LEU A 1 172 ? -30.305 -23.247 6.990   1.00 45.93 ? 164 LEU A CD2   1 
ATOM   1259 N  N     . PRO A 1 173 ? -32.975 -22.137 11.180  1.00 44.85 ? 165 PRO A N     1 
ATOM   1260 C  CA    . PRO A 1 173 ? -33.345 -21.852 12.563  1.00 44.05 ? 165 PRO A CA    1 
ATOM   1261 C  C     . PRO A 1 173 ? -32.123 -21.844 13.479  1.00 43.20 ? 165 PRO A C     1 
ATOM   1262 O  O     . PRO A 1 173 ? -31.016 -22.168 13.036  1.00 43.26 ? 165 PRO A O     1 
ATOM   1263 C  CB    . PRO A 1 173 ? -34.262 -23.020 12.917  1.00 44.13 ? 165 PRO A CB    1 
ATOM   1264 C  CG    . PRO A 1 173 ? -33.723 -24.165 12.116  1.00 44.46 ? 165 PRO A CG    1 
ATOM   1265 C  CD    . PRO A 1 173 ? -33.105 -23.573 10.859  1.00 44.78 ? 165 PRO A CD    1 
ATOM   1266 N  N     . GLY A 1 174 ? -32.328 -21.479 14.746  1.00 42.15 ? 166 GLY A N     1 
ATOM   1267 C  CA    . GLY A 1 174 ? -31.233 -21.412 15.721  1.00 40.52 ? 166 GLY A CA    1 
ATOM   1268 C  C     . GLY A 1 174 ? -30.166 -20.419 15.302  1.00 39.31 ? 166 GLY A C     1 
ATOM   1269 O  O     . GLY A 1 174 ? -28.965 -20.686 15.428  1.00 39.28 ? 166 GLY A O     1 
ATOM   1270 N  N     . GLN A 1 175 ? -30.609 -19.276 14.784  1.00 37.99 ? 167 GLN A N     1 
ATOM   1271 C  CA    . GLN A 1 175 ? -29.705 -18.282 14.224  1.00 36.45 ? 167 GLN A CA    1 
ATOM   1272 C  C     . GLN A 1 175 ? -30.155 -16.864 14.570  1.00 35.21 ? 167 GLN A C     1 
ATOM   1273 O  O     . GLN A 1 175 ? -31.305 -16.494 14.320  1.00 35.02 ? 167 GLN A O     1 
ATOM   1274 C  CB    . GLN A 1 175 ? -29.601 -18.451 12.704  1.00 36.47 ? 167 GLN A CB    1 
ATOM   1275 C  CG    . GLN A 1 175 ? -28.663 -19.568 12.263  1.00 36.52 ? 167 GLN A CG    1 
ATOM   1276 C  CD    . GLN A 1 175 ? -28.311 -19.495 10.787  1.00 36.60 ? 167 GLN A CD    1 
ATOM   1277 O  OE1   . GLN A 1 175 ? -27.471 -20.254 10.300  1.00 36.27 ? 167 GLN A OE1   1 
ATOM   1278 N  NE2   . GLN A 1 175 ? -28.952 -18.578 10.068  1.00 36.68 ? 167 GLN A NE2   1 
ATOM   1279 N  N     . PRO A 1 176 ? -29.240 -16.066 15.153  1.00 34.08 ? 168 PRO A N     1 
ATOM   1280 C  CA    . PRO A 1 176 ? -29.501 -14.666 15.499  1.00 33.11 ? 168 PRO A CA    1 
ATOM   1281 C  C     . PRO A 1 176 ? -29.604 -13.787 14.258  1.00 32.10 ? 168 PRO A C     1 
ATOM   1282 O  O     . PRO A 1 176 ? -30.088 -12.653 14.336  1.00 32.05 ? 168 PRO A O     1 
ATOM   1283 C  CB    . PRO A 1 176 ? -28.272 -14.276 16.324  1.00 33.26 ? 168 PRO A CB    1 
ATOM   1284 C  CG    . PRO A 1 176 ? -27.198 -15.198 15.859  1.00 33.54 ? 168 PRO A CG    1 
ATOM   1285 C  CD    . PRO A 1 176 ? -27.877 -16.485 15.531  1.00 33.96 ? 168 PRO A CD    1 
ATOM   1286 N  N     . CYS A 1 177 ? -29.144 -14.314 13.124  1.00 30.83 ? 169 CYS A N     1 
ATOM   1287 C  CA    . CYS A 1 177 ? -29.277 -13.640 11.836  1.00 29.49 ? 169 CYS A CA    1 
ATOM   1288 C  C     . CYS A 1 177 ? -29.235 -14.656 10.705  1.00 28.59 ? 169 CYS A C     1 
ATOM   1289 O  O     . CYS A 1 177 ? -28.911 -15.822 10.918  1.00 28.42 ? 169 CYS A O     1 
ATOM   1290 C  CB    . CYS A 1 177 ? -28.153 -12.620 11.646  1.00 29.54 ? 169 CYS A CB    1 
ATOM   1291 S  SG    . CYS A 1 177 ? -26.539 -13.351 11.327  1.00 29.18 ? 169 CYS A SG    1 
ATOM   1292 N  N     . GLN A 1 178 ? -29.567 -14.209 9.500   1.00 27.41 ? 170 GLN A N     1 
ATOM   1293 C  CA    . GLN A 1 178 ? -29.312 -14.994 8.302   1.00 26.36 ? 170 GLN A CA    1 
ATOM   1294 C  C     . GLN A 1 178 ? -28.857 -14.106 7.168   1.00 25.69 ? 170 GLN A C     1 
ATOM   1295 O  O     . GLN A 1 178 ? -28.802 -12.887 7.309   1.00 25.83 ? 170 GLN A O     1 
ATOM   1296 C  CB    . GLN A 1 178 ? -30.544 -15.812 7.896   1.00 26.36 ? 170 GLN A CB    1 
ATOM   1297 C  CG    . GLN A 1 178 ? -31.866 -15.085 8.023   1.00 25.78 ? 170 GLN A CG    1 
ATOM   1298 C  CD    . GLN A 1 178 ? -33.046 -16.037 8.045   1.00 25.69 ? 170 GLN A CD    1 
ATOM   1299 O  OE1   . GLN A 1 178 ? -32.880 -17.254 7.931   1.00 25.59 ? 170 GLN A OE1   1 
ATOM   1300 N  NE2   . GLN A 1 178 ? -34.247 -15.488 8.197   1.00 26.11 ? 170 GLN A NE2   1 
ATOM   1301 N  N     . PHE A 1 179 ? -28.494 -14.717 6.052   1.00 24.76 ? 171 PHE A N     1 
ATOM   1302 C  CA    . PHE A 1 179 ? -27.991 -13.965 4.923   1.00 24.03 ? 171 PHE A CA    1 
ATOM   1303 C  C     . PHE A 1 179 ? -28.678 -14.350 3.633   1.00 23.52 ? 171 PHE A C     1 
ATOM   1304 O  O     . PHE A 1 179 ? -29.047 -15.507 3.430   1.00 23.51 ? 171 PHE A O     1 
ATOM   1305 C  CB    . PHE A 1 179 ? -26.476 -14.134 4.793   1.00 23.93 ? 171 PHE A CB    1 
ATOM   1306 C  CG    . PHE A 1 179 ? -25.692 -13.355 5.814   1.00 24.02 ? 171 PHE A CG    1 
ATOM   1307 C  CD1   . PHE A 1 179 ? -25.547 -13.831 7.118   1.00 23.84 ? 171 PHE A CD1   1 
ATOM   1308 C  CD2   . PHE A 1 179 ? -25.096 -12.145 5.475   1.00 23.59 ? 171 PHE A CD2   1 
ATOM   1309 C  CE1   . PHE A 1 179 ? -24.832 -13.109 8.063   1.00 23.44 ? 171 PHE A CE1   1 
ATOM   1310 C  CE2   . PHE A 1 179 ? -24.373 -11.421 6.414   1.00 23.51 ? 171 PHE A CE2   1 
ATOM   1311 C  CZ    . PHE A 1 179 ? -24.242 -11.902 7.711   1.00 23.44 ? 171 PHE A CZ    1 
ATOM   1312 N  N     . ALA A 1 180 ? -28.886 -13.360 2.778   1.00 22.95 ? 172 ALA A N     1 
ATOM   1313 C  CA    . ALA A 1 180 ? -29.242 -13.604 1.401   1.00 22.14 ? 172 ALA A CA    1 
ATOM   1314 C  C     . ALA A 1 180 ? -27.983 -13.508 0.550   1.00 21.83 ? 172 ALA A C     1 
ATOM   1315 O  O     . ALA A 1 180 ? -26.999 -12.887 0.951   1.00 21.61 ? 172 ALA A O     1 
ATOM   1316 C  CB    . ALA A 1 180 ? -30.276 -12.598 0.942   1.00 22.16 ? 172 ALA A CB    1 
ATOM   1317 N  N     . LEU A 1 181 ? -28.007 -14.140 -0.615  1.00 21.40 ? 173 LEU A N     1 
ATOM   1318 C  CA    . LEU A 1 181 ? -26.873 -14.093 -1.517  1.00 21.08 ? 173 LEU A CA    1 
ATOM   1319 C  C     . LEU A 1 181 ? -27.261 -13.515 -2.869  1.00 20.91 ? 173 LEU A C     1 
ATOM   1320 O  O     . LEU A 1 181 ? -28.263 -13.914 -3.464  1.00 20.92 ? 173 LEU A O     1 
ATOM   1321 C  CB    . LEU A 1 181 ? -26.257 -15.485 -1.685  1.00 21.16 ? 173 LEU A CB    1 
ATOM   1322 C  CG    . LEU A 1 181 ? -25.529 -16.069 -0.465  1.00 21.01 ? 173 LEU A CG    1 
ATOM   1323 C  CD1   . LEU A 1 181 ? -25.424 -17.589 -0.573  1.00 20.57 ? 173 LEU A CD1   1 
ATOM   1324 C  CD2   . LEU A 1 181 ? -24.151 -15.443 -0.300  1.00 20.28 ? 173 LEU A CD2   1 
ATOM   1325 N  N     . GLN A 1 182 ? -26.475 -12.560 -3.343  1.00 20.64 ? 174 GLN A N     1 
ATOM   1326 C  CA    . GLN A 1 182 ? -26.647 -12.047 -4.687  1.00 20.51 ? 174 GLN A CA    1 
ATOM   1327 C  C     . GLN A 1 182 ? -25.415 -12.327 -5.526  1.00 20.56 ? 174 GLN A C     1 
ATOM   1328 O  O     . GLN A 1 182 ? -24.292 -12.077 -5.099  1.00 20.52 ? 174 GLN A O     1 
ATOM   1329 C  CB    . GLN A 1 182 ? -26.952 -10.548 -4.673  1.00 20.40 ? 174 GLN A CB    1 
ATOM   1330 C  CG    . GLN A 1 182 ? -27.356 -9.996  -6.036  1.00 19.80 ? 174 GLN A CG    1 
ATOM   1331 C  CD    . GLN A 1 182 ? -27.748 -8.535  -5.989  1.00 19.98 ? 174 GLN A CD    1 
ATOM   1332 O  OE1   . GLN A 1 182 ? -27.394 -7.814  -5.056  1.00 19.69 ? 174 GLN A OE1   1 
ATOM   1333 N  NE2   . GLN A 1 182 ? -28.478 -8.085  -7.005  1.00 19.01 ? 174 GLN A NE2   1 
ATOM   1334 N  N     . ALA A 1 183 ? -25.636 -12.849 -6.723  1.00 20.60 ? 175 ALA A N     1 
ATOM   1335 C  CA    . ALA A 1 183 ? -24.552 -13.121 -7.640  1.00 20.55 ? 175 ALA A CA    1 
ATOM   1336 C  C     . ALA A 1 183 ? -24.031 -11.843 -8.280  1.00 20.47 ? 175 ALA A C     1 
ATOM   1337 O  O     . ALA A 1 183 ? -24.804 -10.969 -8.679  1.00 20.41 ? 175 ALA A O     1 
ATOM   1338 C  CB    . ALA A 1 183 ? -24.995 -14.098 -8.701  1.00 20.61 ? 175 ALA A CB    1 
ATOM   1339 N  N     . ILE A 1 184 ? -22.712 -11.722 -8.328  1.00 20.43 ? 176 ILE A N     1 
ATOM   1340 C  CA    . ILE A 1 184 ? -22.060 -10.822 -9.254  1.00 20.53 ? 176 ILE A CA    1 
ATOM   1341 C  C     . ILE A 1 184 ? -21.678 -11.641 -10.490 1.00 20.73 ? 176 ILE A C     1 
ATOM   1342 O  O     . ILE A 1 184 ? -21.047 -12.688 -10.371 1.00 20.87 ? 176 ILE A O     1 
ATOM   1343 C  CB    . ILE A 1 184 ? -20.804 -10.168 -8.621  1.00 20.27 ? 176 ILE A CB    1 
ATOM   1344 C  CG1   . ILE A 1 184 ? -21.211 -9.143  -7.557  1.00 20.22 ? 176 ILE A CG1   1 
ATOM   1345 C  CG2   . ILE A 1 184 ? -19.957 -9.493  -9.682  1.00 20.43 ? 176 ILE A CG2   1 
ATOM   1346 C  CD1   . ILE A 1 184 ? -21.164 -9.665  -6.129  1.00 20.85 ? 176 ILE A CD1   1 
ATOM   1347 N  N     . VAL A 1 185 ? -22.108 -11.190 -11.666 1.00 20.96 ? 177 VAL A N     1 
ATOM   1348 C  CA    . VAL A 1 185 ? -22.020 -12.016 -12.876 1.00 21.38 ? 177 VAL A CA    1 
ATOM   1349 C  C     . VAL A 1 185 ? -21.105 -11.426 -13.937 1.00 21.75 ? 177 VAL A C     1 
ATOM   1350 O  O     . VAL A 1 185 ? -20.910 -10.212 -13.999 1.00 21.66 ? 177 VAL A O     1 
ATOM   1351 C  CB    . VAL A 1 185 ? -23.417 -12.270 -13.504 1.00 21.33 ? 177 VAL A CB    1 
ATOM   1352 C  CG1   . VAL A 1 185 ? -24.333 -12.967 -12.513 1.00 21.30 ? 177 VAL A CG1   1 
ATOM   1353 C  CG2   . VAL A 1 185 ? -24.039 -10.962 -13.993 1.00 21.23 ? 177 VAL A CG2   1 
ATOM   1354 N  N     . GLU A 1 186 ? -20.536 -12.299 -14.765 1.00 22.38 ? 178 GLU A N     1 
ATOM   1355 C  CA    . GLU A 1 186 ? -19.831 -11.874 -15.975 1.00 23.43 ? 178 GLU A CA    1 
ATOM   1356 C  C     . GLU A 1 186 ? -20.520 -12.428 -17.223 1.00 23.40 ? 178 GLU A C     1 
ATOM   1357 O  O     . GLU A 1 186 ? -20.130 -13.476 -17.734 1.00 23.54 ? 178 GLU A O     1 
ATOM   1358 C  CB    . GLU A 1 186 ? -18.359 -12.316 -15.944 1.00 23.26 ? 178 GLU A CB    1 
ATOM   1359 C  CG    . GLU A 1 186 ? -17.523 -11.728 -17.091 1.00 24.05 ? 178 GLU A CG    1 
ATOM   1360 C  CD    . GLU A 1 186 ? -16.082 -12.211 -17.099 1.00 24.57 ? 178 GLU A CD    1 
ATOM   1361 O  OE1   . GLU A 1 186 ? -15.783 -13.231 -16.439 1.00 25.75 ? 178 GLU A OE1   1 
ATOM   1362 O  OE2   . GLU A 1 186 ? -15.248 -11.570 -17.779 1.00 25.68 ? 178 GLU A OE2   1 
ATOM   1363 N  N     . PRO A 1 187 ? -21.539 -11.711 -17.722 1.00 23.72 ? 179 PRO A N     1 
ATOM   1364 C  CA    . PRO A 1 187 ? -22.429 -12.187 -18.791 1.00 24.15 ? 179 PRO A CA    1 
ATOM   1365 C  C     . PRO A 1 187 ? -21.703 -12.567 -20.088 1.00 24.56 ? 179 PRO A C     1 
ATOM   1366 O  O     . PRO A 1 187 ? -22.208 -13.384 -20.857 1.00 24.93 ? 179 PRO A O     1 
ATOM   1367 C  CB    . PRO A 1 187 ? -23.361 -10.992 -19.027 1.00 24.02 ? 179 PRO A CB    1 
ATOM   1368 C  CG    . PRO A 1 187 ? -23.323 -10.231 -17.753 1.00 23.79 ? 179 PRO A CG    1 
ATOM   1369 C  CD    . PRO A 1 187 ? -21.916 -10.366 -17.264 1.00 23.71 ? 179 PRO A CD    1 
ATOM   1370 N  N     . ALA A 1 188 ? -20.529 -11.988 -20.312 1.00 24.97 ? 180 ALA A N     1 
ATOM   1371 C  CA    . ALA A 1 188 ? -19.714 -12.315 -21.478 1.00 25.48 ? 180 ALA A CA    1 
ATOM   1372 C  C     . ALA A 1 188 ? -19.207 -13.757 -21.440 1.00 25.92 ? 180 ALA A C     1 
ATOM   1373 O  O     . ALA A 1 188 ? -18.989 -14.372 -22.484 1.00 26.30 ? 180 ALA A O     1 
ATOM   1374 C  CB    . ALA A 1 188 ? -18.548 -11.347 -21.599 1.00 25.52 ? 180 ALA A CB    1 
ATOM   1375 N  N     . LYS A 1 189 ? -19.014 -14.288 -20.237 1.00 26.18 ? 181 LYS A N     1 
ATOM   1376 C  CA    . LYS A 1 189 ? -18.609 -15.684 -20.073 1.00 26.36 ? 181 LYS A CA    1 
ATOM   1377 C  C     . LYS A 1 189 ? -19.714 -16.528 -19.430 1.00 26.25 ? 181 LYS A C     1 
ATOM   1378 O  O     . LYS A 1 189 ? -19.473 -17.668 -19.016 1.00 26.18 ? 181 LYS A O     1 
ATOM   1379 C  CB    . LYS A 1 189 ? -17.322 -15.778 -19.251 1.00 26.44 ? 181 LYS A CB    1 
ATOM   1380 C  CG    . LYS A 1 189 ? -16.063 -15.517 -20.049 1.00 27.20 ? 181 LYS A CG    1 
ATOM   1381 C  CD    . LYS A 1 189 ? -14.848 -15.388 -19.140 1.00 28.50 ? 181 LYS A CD    1 
ATOM   1382 C  CE    . LYS A 1 189 ? -13.567 -15.208 -19.942 1.00 28.92 ? 181 LYS A CE    1 
ATOM   1383 N  NZ    . LYS A 1 189 ? -13.624 -14.017 -20.840 1.00 29.49 ? 181 LYS A NZ    1 
ATOM   1384 N  N     . LYS A 1 190 ? -20.924 -15.965 -19.365 1.00 26.16 ? 182 LYS A N     1 
ATOM   1385 C  CA    . LYS A 1 190 ? -22.065 -16.596 -18.674 1.00 26.19 ? 182 LYS A CA    1 
ATOM   1386 C  C     . LYS A 1 190 ? -21.658 -17.195 -17.320 1.00 26.10 ? 182 LYS A C     1 
ATOM   1387 O  O     . LYS A 1 190 ? -22.086 -18.292 -16.955 1.00 26.13 ? 182 LYS A O     1 
ATOM   1388 C  CB    . LYS A 1 190 ? -22.725 -17.654 -19.566 1.00 26.24 ? 182 LYS A CB    1 
ATOM   1389 C  CG    . LYS A 1 190 ? -23.245 -17.109 -20.893 1.00 26.96 ? 182 LYS A CG    1 
ATOM   1390 C  CD    . LYS A 1 190 ? -24.424 -17.919 -21.405 1.00 27.55 ? 182 LYS A CD    1 
ATOM   1391 C  CE    . LYS A 1 190 ? -25.310 -17.083 -22.321 1.00 28.43 ? 182 LYS A CE    1 
ATOM   1392 N  NZ    . LYS A 1 190 ? -26.737 -17.548 -22.299 1.00 28.90 ? 182 LYS A NZ    1 
ATOM   1393 N  N     . ARG A 1 191 ? -20.851 -16.447 -16.575 1.00 25.77 ? 183 ARG A N     1 
ATOM   1394 C  CA    . ARG A 1 191 ? -20.164 -16.976 -15.411 1.00 25.84 ? 183 ARG A CA    1 
ATOM   1395 C  C     . ARG A 1 191 ? -20.477 -16.152 -14.162 1.00 25.39 ? 183 ARG A C     1 
ATOM   1396 O  O     . ARG A 1 191 ? -20.475 -14.927 -14.201 1.00 25.54 ? 183 ARG A O     1 
ATOM   1397 C  CB    . ARG A 1 191 ? -18.650 -16.993 -15.668 1.00 25.87 ? 183 ARG A CB    1 
ATOM   1398 C  CG    . ARG A 1 191 ? -17.800 -17.455 -14.493 1.00 26.32 ? 183 ARG A CG    1 
ATOM   1399 C  CD    . ARG A 1 191 ? -16.316 -17.134 -14.724 1.00 26.74 ? 183 ARG A CD    1 
ATOM   1400 N  NE    . ARG A 1 191 ? -16.028 -15.701 -14.597 1.00 27.96 ? 183 ARG A NE    1 
ATOM   1401 C  CZ    . ARG A 1 191 ? -15.248 -15.168 -13.656 1.00 28.11 ? 183 ARG A CZ    1 
ATOM   1402 N  NH1   . ARG A 1 191 ? -14.662 -15.947 -12.753 1.00 28.07 ? 183 ARG A NH1   1 
ATOM   1403 N  NH2   . ARG A 1 191 ? -15.045 -13.852 -13.623 1.00 27.71 ? 183 ARG A NH2   1 
ATOM   1404 N  N     . VAL A 1 192 ? -20.769 -16.838 -13.065 1.00 24.99 ? 184 VAL A N     1 
ATOM   1405 C  CA    . VAL A 1 192 ? -20.821 -16.204 -11.761 1.00 24.58 ? 184 VAL A CA    1 
ATOM   1406 C  C     . VAL A 1 192 ? -19.405 -15.929 -11.281 1.00 24.52 ? 184 VAL A C     1 
ATOM   1407 O  O     . VAL A 1 192 ? -18.578 -16.839 -11.210 1.00 24.62 ? 184 VAL A O     1 
ATOM   1408 C  CB    . VAL A 1 192 ? -21.532 -17.093 -10.736 1.00 24.50 ? 184 VAL A CB    1 
ATOM   1409 C  CG1   . VAL A 1 192 ? -21.608 -16.396 -9.389  1.00 24.53 ? 184 VAL A CG1   1 
ATOM   1410 C  CG2   . VAL A 1 192 ? -22.914 -17.459 -11.229 1.00 24.42 ? 184 VAL A CG2   1 
ATOM   1411 N  N     . SER A 1 193 ? -19.120 -14.669 -10.981 1.00 24.36 ? 185 SER A N     1 
ATOM   1412 C  CA    . SER A 1 193 ? -17.815 -14.287 -10.463 1.00 24.33 ? 185 SER A CA    1 
ATOM   1413 C  C     . SER A 1 193 ? -17.753 -14.512 -8.960  1.00 24.22 ? 185 SER A C     1 
ATOM   1414 O  O     . SER A 1 193 ? -16.825 -15.148 -8.451  1.00 24.29 ? 185 SER A O     1 
ATOM   1415 C  CB    . SER A 1 193 ? -17.523 -12.821 -10.780 1.00 24.40 ? 185 SER A CB    1 
ATOM   1416 O  OG    . SER A 1 193 ? -16.212 -12.470 -10.374 1.00 24.92 ? 185 SER A OG    1 
ATOM   1417 N  N     . SER A 1 194 ? -18.750 -13.988 -8.256  1.00 23.85 ? 186 SER A N     1 
ATOM   1418 C  CA    . SER A 1 194 ? -18.791 -14.060 -6.807  1.00 23.49 ? 186 SER A CA    1 
ATOM   1419 C  C     . SER A 1 194 ? -20.214 -13.862 -6.299  1.00 23.16 ? 186 SER A C     1 
ATOM   1420 O  O     . SER A 1 194 ? -21.102 -13.448 -7.048  1.00 23.24 ? 186 SER A O     1 
ATOM   1421 C  CB    . SER A 1 194 ? -17.865 -13.006 -6.193  1.00 23.49 ? 186 SER A CB    1 
ATOM   1422 O  OG    . SER A 1 194 ? -18.317 -11.696 -6.479  1.00 23.86 ? 186 SER A OG    1 
ATOM   1423 N  N     . PHE A 1 195 ? -20.429 -14.178 -5.027  1.00 22.69 ? 187 PHE A N     1 
ATOM   1424 C  CA    . PHE A 1 195 ? -21.696 -13.908 -4.377  1.00 22.05 ? 187 PHE A CA    1 
ATOM   1425 C  C     . PHE A 1 195 ? -21.478 -12.910 -3.264  1.00 21.60 ? 187 PHE A C     1 
ATOM   1426 O  O     . PHE A 1 195 ? -20.490 -12.996 -2.541  1.00 21.52 ? 187 PHE A O     1 
ATOM   1427 C  CB    . PHE A 1 195 ? -22.285 -15.190 -3.800  1.00 22.17 ? 187 PHE A CB    1 
ATOM   1428 C  CG    . PHE A 1 195 ? -22.699 -16.196 -4.839  1.00 22.49 ? 187 PHE A CG    1 
ATOM   1429 C  CD1   . PHE A 1 195 ? -21.820 -17.197 -5.250  1.00 22.87 ? 187 PHE A CD1   1 
ATOM   1430 C  CD2   . PHE A 1 195 ? -23.981 -16.167 -5.383  1.00 22.69 ? 187 PHE A CD2   1 
ATOM   1431 C  CE1   . PHE A 1 195 ? -22.208 -18.142 -6.199  1.00 23.06 ? 187 PHE A CE1   1 
ATOM   1432 C  CE2   . PHE A 1 195 ? -24.374 -17.105 -6.332  1.00 22.89 ? 187 PHE A CE2   1 
ATOM   1433 C  CZ    . PHE A 1 195 ? -23.487 -18.094 -6.740  1.00 23.05 ? 187 PHE A CZ    1 
ATOM   1434 N  N     . GLU A 1 196 ? -22.392 -11.951 -3.136  1.00 21.06 ? 188 GLU A N     1 
ATOM   1435 C  CA    . GLU A 1 196 ? -22.384 -11.052 -1.992  1.00 20.61 ? 188 GLU A CA    1 
ATOM   1436 C  C     . GLU A 1 196 ? -23.370 -11.517 -0.937  1.00 20.26 ? 188 GLU A C     1 
ATOM   1437 O  O     . GLU A 1 196 ? -24.533 -11.783 -1.236  1.00 20.09 ? 188 GLU A O     1 
ATOM   1438 C  CB    . GLU A 1 196 ? -22.698 -9.608  -2.409  1.00 20.74 ? 188 GLU A CB    1 
ATOM   1439 C  CG    . GLU A 1 196 ? -22.304 -8.575  -1.341  1.00 20.68 ? 188 GLU A CG    1 
ATOM   1440 C  CD    . GLU A 1 196 ? -22.792 -7.163  -1.646  1.00 20.76 ? 188 GLU A CD    1 
ATOM   1441 O  OE1   . GLU A 1 196 ? -23.175 -6.882  -2.810  1.00 20.40 ? 188 GLU A OE1   1 
ATOM   1442 O  OE2   . GLU A 1 196 ? -22.779 -6.329  -0.715  1.00 19.74 ? 188 GLU A OE2   1 
ATOM   1443 N  N     . ALA A 1 197 ? -22.888 -11.636 0.297   1.00 19.87 ? 189 ALA A N     1 
ATOM   1444 C  CA    . ALA A 1 197 ? -23.744 -11.950 1.430   1.00 19.31 ? 189 ALA A CA    1 
ATOM   1445 C  C     . ALA A 1 197 ? -24.367 -10.681 1.985   1.00 19.10 ? 189 ALA A C     1 
ATOM   1446 O  O     . ALA A 1 197 ? -23.665 -9.720  2.290   1.00 19.01 ? 189 ALA A O     1 
ATOM   1447 C  CB    . ALA A 1 197 ? -22.953 -12.662 2.502   1.00 19.42 ? 189 ALA A CB    1 
ATOM   1448 N  N     . LEU A 1 198 ? -25.692 -10.681 2.102   1.00 18.94 ? 190 LEU A N     1 
ATOM   1449 C  CA    . LEU A 1 198 ? -26.431 -9.524  2.593   1.00 18.68 ? 190 LEU A CA    1 
ATOM   1450 C  C     . LEU A 1 198 ? -27.269 -9.910  3.805   1.00 18.79 ? 190 LEU A C     1 
ATOM   1451 O  O     . LEU A 1 198 ? -28.149 -10.767 3.713   1.00 18.82 ? 190 LEU A O     1 
ATOM   1452 C  CB    . LEU A 1 198 ? -27.334 -8.961  1.490   1.00 18.41 ? 190 LEU A CB    1 
ATOM   1453 C  CG    . LEU A 1 198 ? -26.649 -8.521  0.192   1.00 18.15 ? 190 LEU A CG    1 
ATOM   1454 C  CD1   . LEU A 1 198 ? -27.655 -8.375  -0.938  1.00 16.96 ? 190 LEU A CD1   1 
ATOM   1455 C  CD2   . LEU A 1 198 ? -25.869 -7.241  0.393   1.00 17.21 ? 190 LEU A CD2   1 
ATOM   1456 N  N     . ILE A 1 199 ? -27.000 -9.266  4.937   1.00 18.88 ? 191 ILE A N     1 
ATOM   1457 C  CA    . ILE A 1 199 ? -27.600 -9.658  6.216   1.00 19.04 ? 191 ILE A CA    1 
ATOM   1458 C  C     . ILE A 1 199 ? -29.133 -9.490  6.253   1.00 19.60 ? 191 ILE A C     1 
ATOM   1459 O  O     . ILE A 1 199 ? -29.683 -8.497  5.759   1.00 19.77 ? 191 ILE A O     1 
ATOM   1460 C  CB    . ILE A 1 199 ? -26.938 -8.915  7.405   1.00 18.72 ? 191 ILE A CB    1 
ATOM   1461 C  CG1   . ILE A 1 199 ? -27.220 -9.640  8.722   1.00 18.67 ? 191 ILE A CG1   1 
ATOM   1462 C  CG2   . ILE A 1 199 ? -27.389 -7.458  7.464   1.00 18.40 ? 191 ILE A CG2   1 
ATOM   1463 C  CD1   . ILE A 1 199 ? -26.366 -9.158  9.881   1.00 17.55 ? 191 ILE A CD1   1 
ATOM   1464 N  N     . ARG A 1 200 ? -29.810 -10.490 6.802   1.00 20.12 ? 192 ARG A N     1 
ATOM   1465 C  CA    . ARG A 1 200 ? -31.252 -10.429 6.997   1.00 20.62 ? 192 ARG A CA    1 
ATOM   1466 C  C     . ARG A 1 200 ? -31.612 -10.745 8.443   1.00 21.15 ? 192 ARG A C     1 
ATOM   1467 O  O     . ARG A 1 200 ? -30.914 -11.510 9.115   1.00 21.07 ? 192 ARG A O     1 
ATOM   1468 C  CB    . ARG A 1 200 ? -31.967 -11.406 6.059   1.00 20.45 ? 192 ARG A CB    1 
ATOM   1469 C  CG    . ARG A 1 200 ? -31.713 -11.166 4.574   1.00 20.18 ? 192 ARG A CG    1 
ATOM   1470 C  CD    . ARG A 1 200 ? -32.504 -9.978  4.061   1.00 19.36 ? 192 ARG A CD    1 
ATOM   1471 N  NE    . ARG A 1 200 ? -32.296 -9.757  2.634   1.00 19.24 ? 192 ARG A NE    1 
ATOM   1472 C  CZ    . ARG A 1 200 ? -31.336 -8.987  2.126   1.00 19.61 ? 192 ARG A CZ    1 
ATOM   1473 N  NH1   . ARG A 1 200 ? -30.478 -8.360  2.930   1.00 18.96 ? 192 ARG A NH1   1 
ATOM   1474 N  NH2   . ARG A 1 200 ? -31.230 -8.844  0.813   1.00 19.17 ? 192 ARG A NH2   1 
ATOM   1475 N  N     . SER A 1 201 ? -32.716 -10.164 8.910   1.00 21.82 ? 193 SER A N     1 
ATOM   1476 C  CA    . SER A 1 201 ? -33.247 -10.441 10.243  1.00 22.55 ? 193 SER A CA    1 
ATOM   1477 C  C     . SER A 1 201 ? -33.605 -11.927 10.390  1.00 22.94 ? 193 SER A C     1 
ATOM   1478 O  O     . SER A 1 201 ? -33.681 -12.646 9.394   1.00 22.96 ? 193 SER A O     1 
ATOM   1479 C  CB    . SER A 1 201 ? -34.483 -9.568  10.510  1.00 22.71 ? 193 SER A CB    1 
ATOM   1480 O  OG    . SER A 1 201 ? -35.644 -10.125 9.913   1.00 23.25 ? 193 SER A OG    1 
ATOM   1481 N  N     . PRO A 1 202 ? -33.817 -12.393 11.641  1.00 23.38 ? 194 PRO A N     1 
ATOM   1482 C  CA    . PRO A 1 202 ? -34.272 -13.768 11.864  1.00 23.64 ? 194 PRO A CA    1 
ATOM   1483 C  C     . PRO A 1 202 ? -35.560 -14.084 11.100  1.00 23.78 ? 194 PRO A C     1 
ATOM   1484 O  O     . PRO A 1 202 ? -35.747 -15.215 10.651  1.00 23.87 ? 194 PRO A O     1 
ATOM   1485 C  CB    . PRO A 1 202 ? -34.531 -13.811 13.375  1.00 23.60 ? 194 PRO A CB    1 
ATOM   1486 C  CG    . PRO A 1 202 ? -33.659 -12.758 13.934  1.00 23.72 ? 194 PRO A CG    1 
ATOM   1487 C  CD    . PRO A 1 202 ? -33.617 -11.669 12.912  1.00 23.46 ? 194 PRO A CD    1 
ATOM   1488 N  N     . THR A 1 203 ? -36.427 -13.082 10.948  1.00 23.99 ? 195 THR A N     1 
ATOM   1489 C  CA    . THR A 1 203 ? -37.695 -13.254 10.236  1.00 24.48 ? 195 THR A CA    1 
ATOM   1490 C  C     . THR A 1 203 ? -37.610 -12.758 8.778   1.00 24.55 ? 195 THR A C     1 
ATOM   1491 O  O     . THR A 1 203 ? -38.616 -12.349 8.185   1.00 24.70 ? 195 THR A O     1 
ATOM   1492 C  CB    . THR A 1 203 ? -38.878 -12.549 10.976  1.00 24.51 ? 195 THR A CB    1 
ATOM   1493 O  OG1   . THR A 1 203 ? -38.915 -11.159 10.627  1.00 25.25 ? 195 THR A OG1   1 
ATOM   1494 C  CG2   . THR A 1 203 ? -38.727 -12.685 12.486  1.00 24.55 ? 195 THR A CG2   1 
ATOM   1495 N  N     . GLY A 1 204 ? -36.402 -12.789 8.217   1.00 24.57 ? 196 GLY A N     1 
ATOM   1496 C  CA    . GLY A 1 204 ? -36.199 -12.524 6.788   1.00 24.61 ? 196 GLY A CA    1 
ATOM   1497 C  C     . GLY A 1 204 ? -36.221 -11.056 6.387   1.00 24.50 ? 196 GLY A C     1 
ATOM   1498 O  O     . GLY A 1 204 ? -36.274 -10.738 5.203   1.00 24.55 ? 196 GLY A O     1 
ATOM   1499 N  N     . GLY A 1 205 ? -36.153 -10.163 7.371   1.00 24.36 ? 197 GLY A N     1 
ATOM   1500 C  CA    . GLY A 1 205 ? -36.275 -8.724  7.117   1.00 24.51 ? 197 GLY A CA    1 
ATOM   1501 C  C     . GLY A 1 205 ? -34.962 -8.036  6.764   1.00 24.62 ? 197 GLY A C     1 
ATOM   1502 O  O     . GLY A 1 205 ? -33.907 -8.667  6.734   1.00 24.66 ? 197 GLY A O     1 
ATOM   1503 N  N     . SER A 1 206 ? -35.035 -6.729  6.525   1.00 24.63 ? 198 SER A N     1 
ATOM   1504 C  CA    . SER A 1 206 ? -33.921 -5.967  5.951   1.00 24.75 ? 198 SER A CA    1 
ATOM   1505 C  C     . SER A 1 206 ? -32.733 -5.830  6.913   1.00 25.18 ? 198 SER A C     1 
ATOM   1506 O  O     . SER A 1 206 ? -32.881 -6.039  8.113   1.00 25.25 ? 198 SER A O     1 
ATOM   1507 C  CB    . SER A 1 206 ? -34.406 -4.581  5.515   1.00 24.45 ? 198 SER A CB    1 
ATOM   1508 O  OG    . SER A 1 206 ? -34.564 -3.725  6.625   1.00 23.64 ? 198 SER A OG    1 
ATOM   1509 N  N     . PRO A 1 207 ? -31.539 -5.498  6.371   1.00 25.63 ? 199 PRO A N     1 
ATOM   1510 C  CA    . PRO A 1 207 ? -30.371 -5.121  7.176   1.00 26.04 ? 199 PRO A CA    1 
ATOM   1511 C  C     . PRO A 1 207 ? -30.695 -4.086  8.258   1.00 26.57 ? 199 PRO A C     1 
ATOM   1512 O  O     . PRO A 1 207 ? -30.234 -4.217  9.401   1.00 26.46 ? 199 PRO A O     1 
ATOM   1513 C  CB    . PRO A 1 207 ? -29.423 -4.515  6.139   1.00 25.86 ? 199 PRO A CB    1 
ATOM   1514 C  CG    . PRO A 1 207 ? -29.739 -5.239  4.893   1.00 25.71 ? 199 PRO A CG    1 
ATOM   1515 C  CD    . PRO A 1 207 ? -31.221 -5.518  4.929   1.00 25.52 ? 199 PRO A CD    1 
ATOM   1516 N  N     . VAL A 1 208 ? -31.478 -3.069  7.894   1.00 27.14 ? 200 VAL A N     1 
ATOM   1517 C  CA    . VAL A 1 208 ? -31.917 -2.057  8.846   1.00 27.66 ? 200 VAL A CA    1 
ATOM   1518 C  C     . VAL A 1 208 ? -32.745 -2.696  9.960   1.00 28.07 ? 200 VAL A C     1 
ATOM   1519 O  O     . VAL A 1 208 ? -32.509 -2.438  11.138  1.00 28.14 ? 200 VAL A O     1 
ATOM   1520 C  CB    . VAL A 1 208 ? -32.711 -0.914  8.141   1.00 27.69 ? 200 VAL A CB    1 
ATOM   1521 C  CG1   . VAL A 1 208 ? -33.591 -0.151  9.137   1.00 27.76 ? 200 VAL A CG1   1 
ATOM   1522 C  CG2   . VAL A 1 208 ? -31.751 0.040   7.439   1.00 27.92 ? 200 VAL A CG2   1 
ATOM   1523 N  N     . GLU A 1 209 ? -33.670 -3.579  9.578   1.00 28.57 ? 201 GLU A N     1 
ATOM   1524 C  CA    . GLU A 1 209 ? -34.510 -4.294  10.541  1.00 29.17 ? 201 GLU A CA    1 
ATOM   1525 C  C     . GLU A 1 209 ? -33.670 -5.143  11.495  1.00 29.19 ? 201 GLU A C     1 
ATOM   1526 O  O     . GLU A 1 209 ? -33.989 -5.258  12.677  1.00 29.46 ? 201 GLU A O     1 
ATOM   1527 C  CB    . GLU A 1 209 ? -35.539 -5.171  9.812   1.00 29.08 ? 201 GLU A CB    1 
ATOM   1528 C  CG    . GLU A 1 209 ? -36.583 -5.810  10.724  1.00 29.70 ? 201 GLU A CG    1 
ATOM   1529 C  CD    . GLU A 1 209 ? -37.589 -6.656  9.965   1.00 30.04 ? 201 GLU A CD    1 
ATOM   1530 O  OE1   . GLU A 1 209 ? -38.150 -6.161  8.962   1.00 30.77 ? 201 GLU A OE1   1 
ATOM   1531 O  OE2   . GLU A 1 209 ? -37.821 -7.818  10.375  1.00 30.97 ? 201 GLU A OE2   1 
ATOM   1532 N  N     . MET A 1 210 ? -32.588 -5.716  10.977  1.00 29.34 ? 202 MET A N     1 
ATOM   1533 C  CA    . MET A 1 210 ? -31.689 -6.531  11.784  1.00 29.50 ? 202 MET A CA    1 
ATOM   1534 C  C     . MET A 1 210 ? -30.938 -5.697  12.820  1.00 29.66 ? 202 MET A C     1 
ATOM   1535 O  O     . MET A 1 210 ? -30.952 -6.012  14.011  1.00 29.66 ? 202 MET A O     1 
ATOM   1536 C  CB    . MET A 1 210 ? -30.696 -7.285  10.894  1.00 29.36 ? 202 MET A CB    1 
ATOM   1537 C  CG    . MET A 1 210 ? -29.638 -8.080  11.663  1.00 29.56 ? 202 MET A CG    1 
ATOM   1538 S  SD    . MET A 1 210 ? -30.228 -9.682  12.267  1.00 30.46 ? 202 MET A SD    1 
ATOM   1539 C  CE    . MET A 1 210 ? -30.741 -9.287  13.942  1.00 30.76 ? 202 MET A CE    1 
ATOM   1540 N  N     . PHE A 1 211 ? -30.293 -4.628  12.364  1.00 29.86 ? 203 PHE A N     1 
ATOM   1541 C  CA    . PHE A 1 211 ? -29.450 -3.820  13.238  1.00 30.17 ? 203 PHE A CA    1 
ATOM   1542 C  C     . PHE A 1 211 ? -30.256 -2.989  14.238  1.00 30.48 ? 203 PHE A C     1 
ATOM   1543 O  O     . PHE A 1 211 ? -29.753 -2.640  15.304  1.00 30.58 ? 203 PHE A O     1 
ATOM   1544 C  CB    . PHE A 1 211 ? -28.511 -2.926  12.420  1.00 30.08 ? 203 PHE A CB    1 
ATOM   1545 C  CG    . PHE A 1 211 ? -27.264 -3.630  11.946  1.00 30.16 ? 203 PHE A CG    1 
ATOM   1546 C  CD1   . PHE A 1 211 ? -26.204 -3.860  12.818  1.00 29.94 ? 203 PHE A CD1   1 
ATOM   1547 C  CD2   . PHE A 1 211 ? -27.153 -4.069  10.629  1.00 29.75 ? 203 PHE A CD2   1 
ATOM   1548 C  CE1   . PHE A 1 211 ? -25.056 -4.511  12.387  1.00 30.21 ? 203 PHE A CE1   1 
ATOM   1549 C  CE2   . PHE A 1 211 ? -26.012 -4.719  10.191  1.00 29.57 ? 203 PHE A CE2   1 
ATOM   1550 C  CZ    . PHE A 1 211 ? -24.959 -4.942  11.072  1.00 30.19 ? 203 PHE A CZ    1 
ATOM   1551 N  N     . ALA A 1 212 ? -31.511 -2.698  13.897  1.00 30.92 ? 204 ALA A N     1 
ATOM   1552 C  CA    . ALA A 1 212 ? -32.395 -1.936  14.779  1.00 31.20 ? 204 ALA A CA    1 
ATOM   1553 C  C     . ALA A 1 212 ? -32.746 -2.713  16.043  1.00 31.59 ? 204 ALA A C     1 
ATOM   1554 O  O     . ALA A 1 212 ? -32.939 -2.123  17.103  1.00 31.79 ? 204 ALA A O     1 
ATOM   1555 C  CB    . ALA A 1 212 ? -33.651 -1.528  14.049  1.00 31.28 ? 204 ALA A CB    1 
ATOM   1556 N  N     . ALA A 1 213 ? -32.823 -4.038  15.925  1.00 31.85 ? 205 ALA A N     1 
ATOM   1557 C  CA    . ALA A 1 213 ? -33.134 -4.896  17.070  1.00 32.10 ? 205 ALA A CA    1 
ATOM   1558 C  C     . ALA A 1 213 ? -31.948 -5.034  18.024  1.00 32.28 ? 205 ALA A C     1 
ATOM   1559 O  O     . ALA A 1 213 ? -32.127 -5.238  19.222  1.00 32.34 ? 205 ALA A O     1 
ATOM   1560 C  CB    . ALA A 1 213 ? -33.600 -6.264  16.597  1.00 32.11 ? 205 ALA A CB    1 
ATOM   1561 N  N     . ILE A 1 214 ? -30.740 -4.923  17.480  1.00 32.62 ? 206 ILE A N     1 
ATOM   1562 C  CA    . ILE A 1 214 ? -29.515 -5.007  18.275  1.00 33.00 ? 206 ILE A CA    1 
ATOM   1563 C  C     . ILE A 1 214 ? -29.232 -3.670  18.960  1.00 33.36 ? 206 ILE A C     1 
ATOM   1564 O  O     . ILE A 1 214 ? -29.352 -2.613  18.338  1.00 33.33 ? 206 ILE A O     1 
ATOM   1565 C  CB    . ILE A 1 214 ? -28.293 -5.395  17.388  1.00 32.95 ? 206 ILE A CB    1 
ATOM   1566 C  CG1   . ILE A 1 214 ? -28.576 -6.680  16.591  1.00 33.17 ? 206 ILE A CG1   1 
ATOM   1567 C  CG2   . ILE A 1 214 ? -27.020 -5.525  18.226  1.00 32.76 ? 206 ILE A CG2   1 
ATOM   1568 C  CD1   . ILE A 1 214 ? -29.027 -7.874  17.440  1.00 32.87 ? 206 ILE A CD1   1 
ATOM   1569 N  N     . ALA A 1 215 ? -28.860 -3.725  20.243  1.00 33.85 ? 207 ALA A N     1 
ATOM   1570 C  CA    . ALA A 1 215 ? -28.522 -2.518  21.011  1.00 34.30 ? 207 ALA A CA    1 
ATOM   1571 C  C     . ALA A 1 215 ? -27.406 -1.713  20.340  1.00 34.67 ? 207 ALA A C     1 
ATOM   1572 O  O     . ALA A 1 215 ? -26.421 -2.282  19.854  1.00 34.69 ? 207 ALA A O     1 
ATOM   1573 C  CB    . ALA A 1 215 ? -28.135 -2.883  22.436  1.00 34.30 ? 207 ALA A CB    1 
ATOM   1574 N  N     . ALA A 1 216 ? -27.571 -0.389  20.329  1.00 35.01 ? 208 ALA A N     1 
ATOM   1575 C  CA    . ALA A 1 216 ? -26.736 0.511   19.520  1.00 35.35 ? 208 ALA A CA    1 
ATOM   1576 C  C     . ALA A 1 216 ? -25.238 0.263   19.689  1.00 35.57 ? 208 ALA A C     1 
ATOM   1577 O  O     . ALA A 1 216 ? -24.491 0.237   18.710  1.00 35.71 ? 208 ALA A O     1 
ATOM   1578 C  CB    . ALA A 1 216 ? -27.072 1.965   19.830  1.00 35.40 ? 208 ALA A CB    1 
ATOM   1579 N  N     . GLU A 1 217 ? -24.815 0.060   20.933  1.00 35.62 ? 209 GLU A N     1 
ATOM   1580 C  CA    . GLU A 1 217 ? -23.400 -0.077  21.264  1.00 35.67 ? 209 GLU A CA    1 
ATOM   1581 C  C     . GLU A 1 217 ? -22.823 -1.451  20.887  1.00 35.49 ? 209 GLU A C     1 
ATOM   1582 O  O     . GLU A 1 217 ? -21.607 -1.648  20.924  1.00 35.49 ? 209 GLU A O     1 
ATOM   1583 C  CB    . GLU A 1 217 ? -23.172 0.208   22.759  1.00 35.87 ? 209 GLU A CB    1 
ATOM   1584 C  CG    . GLU A 1 217 ? -23.813 -0.816  23.714  1.00 36.77 ? 209 GLU A CG    1 
ATOM   1585 C  CD    . GLU A 1 217 ? -25.248 -0.455  24.117  1.00 38.36 ? 209 GLU A CD    1 
ATOM   1586 O  OE1   . GLU A 1 217 ? -26.039 -0.033  23.240  1.00 38.82 ? 209 GLU A OE1   1 
ATOM   1587 O  OE2   . GLU A 1 217 ? -25.586 -0.614  25.314  1.00 38.73 ? 209 GLU A OE2   1 
ATOM   1588 N  N     . ASP A 1 218 ? -23.699 -2.391  20.525  1.00 35.25 ? 210 ASP A N     1 
ATOM   1589 C  CA    . ASP A 1 218 ? -23.274 -3.753  20.173  1.00 34.91 ? 210 ASP A CA    1 
ATOM   1590 C  C     . ASP A 1 218 ? -23.297 -3.985  18.666  1.00 34.46 ? 210 ASP A C     1 
ATOM   1591 O  O     . ASP A 1 218 ? -23.078 -5.105  18.200  1.00 34.43 ? 210 ASP A O     1 
ATOM   1592 C  CB    . ASP A 1 218 ? -24.164 -4.794  20.863  1.00 35.05 ? 210 ASP A CB    1 
ATOM   1593 C  CG    . ASP A 1 218 ? -24.275 -4.574  22.362  1.00 36.09 ? 210 ASP A CG    1 
ATOM   1594 O  OD1   . ASP A 1 218 ? -23.262 -4.189  22.995  1.00 36.43 ? 210 ASP A OD1   1 
ATOM   1595 O  OD2   . ASP A 1 218 ? -25.378 -4.802  22.912  1.00 37.17 ? 210 ASP A OD2   1 
ATOM   1596 N  N     . ARG A 1 219 ? -23.565 -2.926  17.909  1.00 33.88 ? 211 ARG A N     1 
ATOM   1597 C  CA    . ARG A 1 219 ? -23.776 -3.055  16.470  1.00 33.37 ? 211 ARG A CA    1 
ATOM   1598 C  C     . ARG A 1 219 ? -22.503 -3.394  15.701  1.00 32.91 ? 211 ARG A C     1 
ATOM   1599 O  O     . ARG A 1 219 ? -22.538 -4.181  14.760  1.00 32.92 ? 211 ARG A O     1 
ATOM   1600 C  CB    . ARG A 1 219 ? -24.457 -1.812  15.901  1.00 33.29 ? 211 ARG A CB    1 
ATOM   1601 C  CG    . ARG A 1 219 ? -25.964 -1.845  16.066  1.00 33.71 ? 211 ARG A CG    1 
ATOM   1602 C  CD    . ARG A 1 219 ? -26.608 -0.543  15.684  1.00 34.62 ? 211 ARG A CD    1 
ATOM   1603 N  NE    . ARG A 1 219 ? -27.889 -0.374  16.362  1.00 35.44 ? 211 ARG A NE    1 
ATOM   1604 C  CZ    . ARG A 1 219 ? -28.854 0.444   15.952  1.00 35.92 ? 211 ARG A CZ    1 
ATOM   1605 N  NH1   . ARG A 1 219 ? -28.695 1.165   14.847  1.00 36.10 ? 211 ARG A NH1   1 
ATOM   1606 N  NH2   . ARG A 1 219 ? -29.985 0.528   16.639  1.00 35.81 ? 211 ARG A NH2   1 
ATOM   1607 N  N     . TYR A 1 220 ? -21.383 -2.810  16.116  1.00 32.42 ? 212 TYR A N     1 
ATOM   1608 C  CA    . TYR A 1 220 ? -20.084 -3.161  15.546  1.00 31.94 ? 212 TYR A CA    1 
ATOM   1609 C  C     . TYR A 1 220 ? -19.719 -4.617  15.846  1.00 31.80 ? 212 TYR A C     1 
ATOM   1610 O  O     . TYR A 1 220 ? -19.302 -5.357  14.953  1.00 31.83 ? 212 TYR A O     1 
ATOM   1611 C  CB    . TYR A 1 220 ? -18.989 -2.219  16.056  1.00 31.76 ? 212 TYR A CB    1 
ATOM   1612 C  CG    . TYR A 1 220 ? -19.030 -0.831  15.446  1.00 31.53 ? 212 TYR A CG    1 
ATOM   1613 C  CD1   . TYR A 1 220 ? -19.237 -0.655  14.077  1.00 31.16 ? 212 TYR A CD1   1 
ATOM   1614 C  CD2   . TYR A 1 220 ? -18.840 0.303   16.232  1.00 30.90 ? 212 TYR A CD2   1 
ATOM   1615 C  CE1   . TYR A 1 220 ? -19.273 0.612   13.513  1.00 30.64 ? 212 TYR A CE1   1 
ATOM   1616 C  CE2   . TYR A 1 220 ? -18.869 1.573   15.675  1.00 30.85 ? 212 TYR A CE2   1 
ATOM   1617 C  CZ    . TYR A 1 220 ? -19.085 1.719   14.314  1.00 30.92 ? 212 TYR A CZ    1 
ATOM   1618 O  OH    . TYR A 1 220 ? -19.116 2.972   13.755  1.00 31.14 ? 212 TYR A OH    1 
ATOM   1619 N  N     . ARG A 1 221 ? -19.891 -5.024  17.102  1.00 31.56 ? 213 ARG A N     1 
ATOM   1620 C  CA    . ARG A 1 221 ? -19.647 -6.406  17.499  1.00 31.20 ? 213 ARG A CA    1 
ATOM   1621 C  C     . ARG A 1 221 ? -20.516 -7.359  16.686  1.00 30.69 ? 213 ARG A C     1 
ATOM   1622 O  O     . ARG A 1 221 ? -20.011 -8.297  16.071  1.00 30.80 ? 213 ARG A O     1 
ATOM   1623 C  CB    . ARG A 1 221 ? -19.915 -6.596  18.994  1.00 31.42 ? 213 ARG A CB    1 
ATOM   1624 C  CG    . ARG A 1 221 ? -19.704 -8.028  19.490  1.00 32.10 ? 213 ARG A CG    1 
ATOM   1625 C  CD    . ARG A 1 221 ? -20.588 -8.335  20.697  1.00 33.85 ? 213 ARG A CD    1 
ATOM   1626 N  NE    . ARG A 1 221 ? -22.004 -8.056  20.432  1.00 35.18 ? 213 ARG A NE    1 
ATOM   1627 C  CZ    . ARG A 1 221 ? -22.848 -8.911  19.852  1.00 35.95 ? 213 ARG A CZ    1 
ATOM   1628 N  NH1   . ARG A 1 221 ? -22.427 -10.114 19.463  1.00 36.05 ? 213 ARG A NH1   1 
ATOM   1629 N  NH2   . ARG A 1 221 ? -24.114 -8.561  19.655  1.00 36.08 ? 213 ARG A NH2   1 
ATOM   1630 N  N     . PHE A 1 222 ? -21.820 -7.094  16.667  1.00 30.01 ? 214 PHE A N     1 
ATOM   1631 C  CA    . PHE A 1 222 ? -22.771 -7.946  15.960  1.00 29.41 ? 214 PHE A CA    1 
ATOM   1632 C  C     . PHE A 1 222 ? -22.450 -8.052  14.471  1.00 28.92 ? 214 PHE A C     1 
ATOM   1633 O  O     . PHE A 1 222 ? -22.588 -9.117  13.879  1.00 28.81 ? 214 PHE A O     1 
ATOM   1634 C  CB    . PHE A 1 222 ? -24.198 -7.432  16.152  1.00 29.45 ? 214 PHE A CB    1 
ATOM   1635 C  CG    . PHE A 1 222 ? -25.251 -8.349  15.603  1.00 29.52 ? 214 PHE A CG    1 
ATOM   1636 C  CD1   . PHE A 1 222 ? -25.812 -8.118  14.350  1.00 29.69 ? 214 PHE A CD1   1 
ATOM   1637 C  CD2   . PHE A 1 222 ? -25.688 -9.445  16.338  1.00 29.59 ? 214 PHE A CD2   1 
ATOM   1638 C  CE1   . PHE A 1 222 ? -26.785 -8.964  13.843  1.00 29.67 ? 214 PHE A CE1   1 
ATOM   1639 C  CE2   . PHE A 1 222 ? -26.663 -10.295 15.836  1.00 29.41 ? 214 PHE A CE2   1 
ATOM   1640 C  CZ    . PHE A 1 222 ? -27.211 -10.056 14.589  1.00 29.60 ? 214 PHE A CZ    1 
ATOM   1641 N  N     . ASP A 1 223 ? -22.026 -6.936  13.877  1.00 28.33 ? 215 ASP A N     1 
ATOM   1642 C  CA    . ASP A 1 223 ? -21.669 -6.891  12.460  1.00 27.71 ? 215 ASP A CA    1 
ATOM   1643 C  C     . ASP A 1 223 ? -20.522 -7.851  12.159  1.00 27.36 ? 215 ASP A C     1 
ATOM   1644 O  O     . ASP A 1 223 ? -20.562 -8.591  11.178  1.00 27.34 ? 215 ASP A O     1 
ATOM   1645 C  CB    . ASP A 1 223 ? -21.290 -5.461  12.054  1.00 27.76 ? 215 ASP A CB    1 
ATOM   1646 C  CG    . ASP A 1 223 ? -20.983 -5.331  10.569  1.00 27.68 ? 215 ASP A CG    1 
ATOM   1647 O  OD1   . ASP A 1 223 ? -21.524 -6.120  9.774   1.00 27.74 ? 215 ASP A OD1   1 
ATOM   1648 O  OD2   . ASP A 1 223 ? -20.200 -4.432  10.198  1.00 27.50 ? 215 ASP A OD2   1 
ATOM   1649 N  N     . LEU A 1 224 ? -19.511 -7.846  13.021  1.00 26.99 ? 216 LEU A N     1 
ATOM   1650 C  CA    . LEU A 1 224 ? -18.384 -8.758  12.887  1.00 26.62 ? 216 LEU A CA    1 
ATOM   1651 C  C     . LEU A 1 224 ? -18.789 -10.202 13.190  1.00 26.56 ? 216 LEU A C     1 
ATOM   1652 O  O     . LEU A 1 224 ? -18.468 -11.113 12.429  1.00 26.25 ? 216 LEU A O     1 
ATOM   1653 C  CB    . LEU A 1 224 ? -17.235 -8.323  13.798  1.00 26.49 ? 216 LEU A CB    1 
ATOM   1654 C  CG    . LEU A 1 224 ? -15.913 -9.078  13.657  1.00 26.23 ? 216 LEU A CG    1 
ATOM   1655 C  CD1   . LEU A 1 224 ? -15.293 -8.848  12.292  1.00 25.43 ? 216 LEU A CD1   1 
ATOM   1656 C  CD2   . LEU A 1 224 ? -14.958 -8.665  14.758  1.00 26.49 ? 216 LEU A CD2   1 
ATOM   1657 N  N     . GLU A 1 225 ? -19.512 -10.395 14.297  1.00 26.45 ? 217 GLU A N     1 
ATOM   1658 C  CA    . GLU A 1 225 ? -19.966 -11.728 14.710  1.00 26.41 ? 217 GLU A CA    1 
ATOM   1659 C  C     . GLU A 1 225 ? -20.777 -12.416 13.624  1.00 25.79 ? 217 GLU A C     1 
ATOM   1660 O  O     . GLU A 1 225 ? -20.533 -13.576 13.307  1.00 25.94 ? 217 GLU A O     1 
ATOM   1661 C  CB    . GLU A 1 225 ? -20.794 -11.650 16.003  1.00 26.76 ? 217 GLU A CB    1 
ATOM   1662 C  CG    . GLU A 1 225 ? -19.970 -11.492 17.280  1.00 28.51 ? 217 GLU A CG    1 
ATOM   1663 C  CD    . GLU A 1 225 ? -18.902 -12.564 17.429  1.00 31.16 ? 217 GLU A CD    1 
ATOM   1664 O  OE1   . GLU A 1 225 ? -19.265 -13.750 17.629  1.00 31.83 ? 217 GLU A OE1   1 
ATOM   1665 O  OE2   . GLU A 1 225 ? -17.697 -12.218 17.352  1.00 32.47 ? 217 GLU A OE2   1 
ATOM   1666 N  N     . SER A 1 226 ? -21.724 -11.682 13.039  1.00 25.13 ? 218 SER A N     1 
ATOM   1667 C  CA    . SER A 1 226 ? -22.685 -12.249 12.084  1.00 24.43 ? 218 SER A CA    1 
ATOM   1668 C  C     . SER A 1 226 ? -22.023 -12.862 10.853  1.00 24.03 ? 218 SER A C     1 
ATOM   1669 O  O     . SER A 1 226 ? -22.592 -13.743 10.217  1.00 24.05 ? 218 SER A O     1 
ATOM   1670 C  CB    . SER A 1 226 ? -23.714 -11.198 11.659  1.00 24.30 ? 218 SER A CB    1 
ATOM   1671 O  OG    . SER A 1 226 ? -23.090 -10.081 11.050  1.00 24.12 ? 218 SER A OG    1 
ATOM   1672 N  N     . LYS A 1 227 ? -20.812 -12.412 10.544  1.00 23.54 ? 219 LYS A N     1 
ATOM   1673 C  CA    . LYS A 1 227 ? -20.076 -12.906 9.382   1.00 23.29 ? 219 LYS A CA    1 
ATOM   1674 C  C     . LYS A 1 227 ? -19.792 -14.401 9.448   1.00 23.37 ? 219 LYS A C     1 
ATOM   1675 O  O     . LYS A 1 227 ? -19.618 -15.050 8.418   1.00 23.34 ? 219 LYS A O     1 
ATOM   1676 C  CB    . LYS A 1 227 ? -18.773 -12.125 9.195   1.00 23.16 ? 219 LYS A CB    1 
ATOM   1677 C  CG    . LYS A 1 227 ? -18.982 -10.679 8.784   1.00 22.55 ? 219 LYS A CG    1 
ATOM   1678 C  CD    . LYS A 1 227 ? -20.160 -10.560 7.845   1.00 21.37 ? 219 LYS A CD    1 
ATOM   1679 C  CE    . LYS A 1 227 ? -20.413 -9.139  7.450   1.00 21.57 ? 219 LYS A CE    1 
ATOM   1680 N  NZ    . LYS A 1 227 ? -21.262 -8.427  8.435   1.00 21.41 ? 219 LYS A NZ    1 
ATOM   1681 N  N     . ALA A 1 228 ? -19.769 -14.946 10.661  1.00 23.55 ? 220 ALA A N     1 
ATOM   1682 C  CA    . ALA A 1 228 ? -19.551 -16.380 10.863  1.00 23.94 ? 220 ALA A CA    1 
ATOM   1683 C  C     . ALA A 1 228 ? -20.677 -17.221 10.260  1.00 24.19 ? 220 ALA A C     1 
ATOM   1684 O  O     . ALA A 1 228 ? -20.457 -18.361 9.855   1.00 24.24 ? 220 ALA A O     1 
ATOM   1685 C  CB    . ALA A 1 228 ? -19.388 -16.693 12.351  1.00 23.78 ? 220 ALA A CB    1 
ATOM   1686 N  N     . TYR A 1 229 ? -21.880 -16.648 10.201  1.00 24.48 ? 221 TYR A N     1 
ATOM   1687 C  CA    . TYR A 1 229 ? -23.046 -17.352 9.674   1.00 24.87 ? 221 TYR A CA    1 
ATOM   1688 C  C     . TYR A 1 229 ? -23.113 -17.245 8.164   1.00 25.01 ? 221 TYR A C     1 
ATOM   1689 O  O     . TYR A 1 229 ? -23.746 -18.066 7.502   1.00 25.23 ? 221 TYR A O     1 
ATOM   1690 C  CB    . TYR A 1 229 ? -24.331 -16.814 10.304  1.00 25.17 ? 221 TYR A CB    1 
ATOM   1691 C  CG    . TYR A 1 229 ? -24.449 -17.115 11.782  1.00 25.78 ? 221 TYR A CG    1 
ATOM   1692 C  CD1   . TYR A 1 229 ? -25.080 -18.271 12.229  1.00 26.44 ? 221 TYR A CD1   1 
ATOM   1693 C  CD2   . TYR A 1 229 ? -23.911 -16.250 12.733  1.00 26.08 ? 221 TYR A CD2   1 
ATOM   1694 C  CE1   . TYR A 1 229 ? -25.179 -18.557 13.585  1.00 26.96 ? 221 TYR A CE1   1 
ATOM   1695 C  CE2   . TYR A 1 229 ? -24.005 -16.525 14.090  1.00 26.48 ? 221 TYR A CE2   1 
ATOM   1696 C  CZ    . TYR A 1 229 ? -24.638 -17.677 14.510  1.00 26.56 ? 221 TYR A CZ    1 
ATOM   1697 O  OH    . TYR A 1 229 ? -24.731 -17.951 15.856  1.00 26.83 ? 221 TYR A OH    1 
ATOM   1698 N  N     . ALA A 1 230 ? -22.456 -16.227 7.622   1.00 25.24 ? 222 ALA A N     1 
ATOM   1699 C  CA    . ALA A 1 230 ? -22.322 -16.082 6.180   1.00 25.52 ? 222 ALA A CA    1 
ATOM   1700 C  C     . ALA A 1 230 ? -21.269 -17.045 5.643   1.00 25.70 ? 222 ALA A C     1 
ATOM   1701 O  O     . ALA A 1 230 ? -21.455 -17.647 4.584   1.00 25.58 ? 222 ALA A O     1 
ATOM   1702 C  CB    . ALA A 1 230 ? -21.971 -14.647 5.819   1.00 25.48 ? 222 ALA A CB    1 
ATOM   1703 N  N     . PHE A 1 231 ? -20.165 -17.190 6.383   1.00 25.99 ? 223 PHE A N     1 
ATOM   1704 C  CA    . PHE A 1 231 ? -19.127 -18.163 6.037   1.00 26.20 ? 223 PHE A CA    1 
ATOM   1705 C  C     . PHE A 1 231 ? -19.690 -19.575 6.057   1.00 26.67 ? 223 PHE A C     1 
ATOM   1706 O  O     . PHE A 1 231 ? -19.443 -20.363 5.148   1.00 26.95 ? 223 PHE A O     1 
ATOM   1707 C  CB    . PHE A 1 231 ? -17.936 -18.065 6.996   1.00 25.99 ? 223 PHE A CB    1 
ATOM   1708 C  CG    . PHE A 1 231 ? -17.165 -16.775 6.889   1.00 25.79 ? 223 PHE A CG    1 
ATOM   1709 C  CD1   . PHE A 1 231 ? -17.045 -16.115 5.674   1.00 25.26 ? 223 PHE A CD1   1 
ATOM   1710 C  CD2   . PHE A 1 231 ? -16.531 -16.238 8.003   1.00 25.52 ? 223 PHE A CD2   1 
ATOM   1711 C  CE1   . PHE A 1 231 ? -16.332 -14.931 5.578   1.00 25.21 ? 223 PHE A CE1   1 
ATOM   1712 C  CE2   . PHE A 1 231 ? -15.814 -15.051 7.912   1.00 25.14 ? 223 PHE A CE2   1 
ATOM   1713 C  CZ    . PHE A 1 231 ? -15.715 -14.400 6.700   1.00 25.18 ? 223 PHE A CZ    1 
ATOM   1714 N  N     . ALA A 1 232 ? -20.458 -19.886 7.099   1.00 27.16 ? 224 ALA A N     1 
ATOM   1715 C  CA    . ALA A 1 232 ? -21.132 -21.175 7.205   1.00 27.64 ? 224 ALA A CA    1 
ATOM   1716 C  C     . ALA A 1 232 ? -22.049 -21.418 6.009   1.00 27.89 ? 224 ALA A C     1 
ATOM   1717 O  O     . ALA A 1 232 ? -22.114 -22.528 5.486   1.00 28.07 ? 224 ALA A O     1 
ATOM   1718 C  CB    . ALA A 1 232 ? -21.923 -21.260 8.514   1.00 27.45 ? 224 ALA A CB    1 
ATOM   1719 N  N     . LEU A 1 233 ? -22.742 -20.366 5.578   1.00 28.14 ? 225 LEU A N     1 
ATOM   1720 C  CA    . LEU A 1 233 ? -23.638 -20.441 4.433   1.00 28.41 ? 225 LEU A CA    1 
ATOM   1721 C  C     . LEU A 1 233 ? -22.870 -20.693 3.139   1.00 28.80 ? 225 LEU A C     1 
ATOM   1722 O  O     . LEU A 1 233 ? -23.334 -21.422 2.264   1.00 28.87 ? 225 LEU A O     1 
ATOM   1723 C  CB    . LEU A 1 233 ? -24.459 -19.155 4.319   1.00 28.41 ? 225 LEU A CB    1 
ATOM   1724 C  CG    . LEU A 1 233 ? -25.492 -19.084 3.194   1.00 28.19 ? 225 LEU A CG    1 
ATOM   1725 C  CD1   . LEU A 1 233 ? -26.504 -20.221 3.314   1.00 28.08 ? 225 LEU A CD1   1 
ATOM   1726 C  CD2   . LEU A 1 233 ? -26.185 -17.732 3.192   1.00 28.02 ? 225 LEU A CD2   1 
ATOM   1727 N  N     . ALA A 1 234 ? -21.689 -20.091 3.032   1.00 29.35 ? 226 ALA A N     1 
ATOM   1728 C  CA    . ALA A 1 234 ? -20.812 -20.312 1.888   1.00 29.79 ? 226 ALA A CA    1 
ATOM   1729 C  C     . ALA A 1 234 ? -20.224 -21.717 1.906   1.00 30.28 ? 226 ALA A C     1 
ATOM   1730 O  O     . ALA A 1 234 ? -20.081 -22.352 0.860   1.00 30.30 ? 226 ALA A O     1 
ATOM   1731 C  CB    . ALA A 1 234 ? -19.709 -19.281 1.866   1.00 29.69 ? 226 ALA A CB    1 
ATOM   1732 N  N     . GLY A 1 235 ? -19.891 -22.198 3.099   1.00 30.86 ? 227 GLY A N     1 
ATOM   1733 C  CA    . GLY A 1 235 ? -19.293 -23.520 3.260   1.00 31.72 ? 227 GLY A CA    1 
ATOM   1734 C  C     . GLY A 1 235 ? -20.216 -24.652 2.851   1.00 32.42 ? 227 GLY A C     1 
ATOM   1735 O  O     . GLY A 1 235 ? -19.773 -25.640 2.270   1.00 32.53 ? 227 GLY A O     1 
ATOM   1736 N  N     . GLN A 1 236 ? -21.508 -24.495 3.136   1.00 33.10 ? 228 GLN A N     1 
ATOM   1737 C  CA    . GLN A 1 236 ? -22.487 -25.555 2.896   1.00 34.00 ? 228 GLN A CA    1 
ATOM   1738 C  C     . GLN A 1 236 ? -23.138 -25.443 1.512   1.00 34.52 ? 228 GLN A C     1 
ATOM   1739 O  O     . GLN A 1 236 ? -24.134 -26.113 1.224   1.00 34.52 ? 228 GLN A O     1 
ATOM   1740 C  CB    . GLN A 1 236 ? -23.561 -25.557 3.999   1.00 33.90 ? 228 GLN A CB    1 
ATOM   1741 C  CG    . GLN A 1 236 ? -24.531 -24.373 3.948   1.00 34.38 ? 228 GLN A CG    1 
ATOM   1742 C  CD    . GLN A 1 236 ? -25.400 -24.255 5.199   1.00 34.32 ? 228 GLN A CD    1 
ATOM   1743 O  OE1   . GLN A 1 236 ? -24.899 -24.281 6.328   1.00 34.89 ? 228 GLN A OE1   1 
ATOM   1744 N  NE2   . GLN A 1 236 ? -26.705 -24.100 4.999   1.00 34.16 ? 228 GLN A NE2   1 
ATOM   1745 N  N     . LEU A 1 237 ? -22.553 -24.613 0.653   1.00 35.36 ? 229 LEU A N     1 
ATOM   1746 C  CA    . LEU A 1 237 ? -23.168 -24.271 -0.632  1.00 36.02 ? 229 LEU A CA    1 
ATOM   1747 C  C     . LEU A 1 237 ? -22.889 -25.276 -1.772  1.00 36.31 ? 229 LEU A C     1 
ATOM   1748 O  O     . LEU A 1 237 ? -23.810 -25.641 -2.498  1.00 36.37 ? 229 LEU A O     1 
ATOM   1749 C  CB    . LEU A 1 237 ? -22.804 -22.841 -1.054  1.00 36.04 ? 229 LEU A CB    1 
ATOM   1750 C  CG    . LEU A 1 237 ? -23.913 -21.979 -1.661  1.00 36.19 ? 229 LEU A CG    1 
ATOM   1751 C  CD1   . LEU A 1 237 ? -25.060 -21.774 -0.666  1.00 35.71 ? 229 LEU A CD1   1 
ATOM   1752 C  CD2   . LEU A 1 237 ? -23.345 -20.642 -2.113  1.00 36.05 ? 229 LEU A CD2   1 
ATOM   1753 N  N     . PRO A 1 238 ? -21.625 -25.747 -1.916  1.00 36.69 ? 230 PRO A N     1 
ATOM   1754 C  CA    . PRO A 1 238 ? -20.426 -25.487 -1.125  1.00 37.00 ? 230 PRO A CA    1 
ATOM   1755 C  C     . PRO A 1 238 ? -19.464 -24.487 -1.781  1.00 37.35 ? 230 PRO A C     1 
ATOM   1756 O  O     . PRO A 1 238 ? -18.249 -24.571 -1.561  1.00 37.58 ? 230 PRO A O     1 
ATOM   1757 C  CB    . PRO A 1 238 ? -19.768 -26.863 -1.065  1.00 37.02 ? 230 PRO A CB    1 
ATOM   1758 C  CG    . PRO A 1 238 ? -20.202 -27.553 -2.389  1.00 36.94 ? 230 PRO A CG    1 
ATOM   1759 C  CD    . PRO A 1 238 ? -21.349 -26.732 -2.974  1.00 36.74 ? 230 PRO A CD    1 
ATOM   1760 N  N     . LEU A 1 239 ? -20.004 -23.583 -2.605  1.00 37.50 ? 231 LEU A N     1 
ATOM   1761 C  CA    . LEU A 1 239 ? -19.259 -22.409 -3.132  1.00 37.68 ? 231 LEU A CA    1 
ATOM   1762 C  C     . LEU A 1 239 ? -18.165 -22.743 -4.153  1.00 37.61 ? 231 LEU A C     1 
ATOM   1763 O  O     . LEU A 1 239 ? -18.152 -22.198 -5.257  1.00 37.68 ? 231 LEU A O     1 
ATOM   1764 C  CB    . LEU A 1 239 ? -18.688 -21.550 -1.994  1.00 37.69 ? 231 LEU A CB    1 
ATOM   1765 C  CG    . LEU A 1 239 ? -18.020 -20.235 -2.405  1.00 37.88 ? 231 LEU A CG    1 
ATOM   1766 C  CD1   . LEU A 1 239 ? -19.036 -19.276 -3.018  1.00 38.03 ? 231 LEU A CD1   1 
ATOM   1767 C  CD2   . LEU A 1 239 ? -17.325 -19.594 -1.217  1.00 37.80 ? 231 LEU A CD2   1 
ATOM   1768 N  N     . GLY A 1 240 ? -17.226 -23.597 -3.759  1.00 37.50 ? 232 GLY A N     1 
ATOM   1769 C  CA    . GLY A 1 240 ? -16.202 -24.083 -4.670  1.00 37.28 ? 232 GLY A CA    1 
ATOM   1770 C  C     . GLY A 1 240 ? -15.139 -23.051 -4.983  1.00 37.14 ? 232 GLY A C     1 
ATOM   1771 O  O     . GLY A 1 240 ? -14.275 -22.768 -4.153  1.00 37.14 ? 232 GLY A O     1 
ATOM   1772 N  N     . LYS A 1 241 ? -15.205 -22.486 -6.185  1.00 36.87 ? 233 LYS A N     1 
ATOM   1773 C  CA    . LYS A 1 241 ? -14.133 -21.627 -6.687  1.00 36.64 ? 233 LYS A CA    1 
ATOM   1774 C  C     . LYS A 1 241 ? -14.569 -20.162 -6.838  1.00 36.15 ? 233 LYS A C     1 
ATOM   1775 O  O     . LYS A 1 241 ? -13.813 -19.332 -7.346  1.00 36.16 ? 233 LYS A O     1 
ATOM   1776 C  CB    . LYS A 1 241 ? -13.598 -22.164 -8.021  1.00 36.74 ? 233 LYS A CB    1 
ATOM   1777 C  CG    . LYS A 1 241 ? -13.198 -23.639 -7.990  1.00 37.13 ? 233 LYS A CG    1 
ATOM   1778 C  CD    . LYS A 1 241 ? -12.927 -24.166 -9.400  1.00 37.24 ? 233 LYS A CD    1 
ATOM   1779 C  CE    . LYS A 1 241 ? -13.225 -25.663 -9.508  1.00 37.77 ? 233 LYS A CE    1 
ATOM   1780 N  NZ    . LYS A 1 241 ? -12.181 -26.497 -8.845  1.00 38.24 ? 233 LYS A NZ    1 
ATOM   1781 N  N     . HIS A 1 242 ? -15.785 -19.855 -6.394  1.00 35.52 ? 234 HIS A N     1 
ATOM   1782 C  CA    . HIS A 1 242 ? -16.300 -18.489 -6.443  1.00 34.81 ? 234 HIS A CA    1 
ATOM   1783 C  C     . HIS A 1 242 ? -15.903 -17.710 -5.194  1.00 34.37 ? 234 HIS A C     1 
ATOM   1784 O  O     . HIS A 1 242 ? -15.765 -18.285 -4.118  1.00 34.29 ? 234 HIS A O     1 
ATOM   1785 C  CB    . HIS A 1 242 ? -17.821 -18.501 -6.585  1.00 34.85 ? 234 HIS A CB    1 
ATOM   1786 C  CG    . HIS A 1 242 ? -18.318 -19.427 -7.648  1.00 35.10 ? 234 HIS A CG    1 
ATOM   1787 N  ND1   . HIS A 1 242 ? -18.723 -20.716 -7.380  1.00 35.25 ? 234 HIS A ND1   1 
ATOM   1788 C  CD2   . HIS A 1 242 ? -18.461 -19.258 -8.983  1.00 35.33 ? 234 HIS A CD2   1 
ATOM   1789 C  CE1   . HIS A 1 242 ? -19.103 -21.298 -8.504  1.00 35.49 ? 234 HIS A CE1   1 
ATOM   1790 N  NE2   . HIS A 1 242 ? -18.954 -20.434 -9.491  1.00 35.23 ? 234 HIS A NE2   1 
ATOM   1791 N  N     . GLN A 1 243 ? -15.723 -16.399 -5.344  1.00 33.82 ? 235 GLN A N     1 
ATOM   1792 C  CA    . GLN A 1 243 ? -15.417 -15.526 -4.212  1.00 33.31 ? 235 GLN A CA    1 
ATOM   1793 C  C     . GLN A 1 243 ? -16.652 -15.281 -3.355  1.00 32.67 ? 235 GLN A C     1 
ATOM   1794 O  O     . GLN A 1 243 ? -17.777 -15.352 -3.840  1.00 32.59 ? 235 GLN A O     1 
ATOM   1795 C  CB    . GLN A 1 243 ? -14.870 -14.181 -4.693  1.00 33.38 ? 235 GLN A CB    1 
ATOM   1796 C  CG    . GLN A 1 243 ? -13.484 -14.225 -5.298  1.00 33.95 ? 235 GLN A CG    1 
ATOM   1797 C  CD    . GLN A 1 243 ? -12.983 -12.841 -5.691  1.00 34.64 ? 235 GLN A CD    1 
ATOM   1798 O  OE1   . GLN A 1 243 ? -13.623 -12.133 -6.472  1.00 35.58 ? 235 GLN A OE1   1 
ATOM   1799 N  NE2   . GLN A 1 243 ? -11.836 -12.448 -5.144  1.00 35.00 ? 235 GLN A NE2   1 
ATOM   1800 N  N     . LEU A 1 244 ? -16.430 -14.989 -2.078  1.00 32.11 ? 236 LEU A N     1 
ATOM   1801 C  CA    . LEU A 1 244 ? -17.487 -14.496 -1.207  1.00 31.58 ? 236 LEU A CA    1 
ATOM   1802 C  C     . LEU A 1 244 ? -17.249 -13.032 -0.850  1.00 31.21 ? 236 LEU A C     1 
ATOM   1803 O  O     . LEU A 1 244 ? -16.138 -12.644 -0.497  1.00 31.25 ? 236 LEU A O     1 
ATOM   1804 C  CB    . LEU A 1 244 ? -17.577 -15.339 0.063   1.00 31.50 ? 236 LEU A CB    1 
ATOM   1805 C  CG    . LEU A 1 244 ? -18.689 -14.960 1.045   1.00 31.62 ? 236 LEU A CG    1 
ATOM   1806 C  CD1   . LEU A 1 244 ? -20.067 -15.154 0.419   1.00 31.31 ? 236 LEU A CD1   1 
ATOM   1807 C  CD2   . LEU A 1 244 ? -18.562 -15.754 2.332   1.00 31.56 ? 236 LEU A CD2   1 
ATOM   1808 N  N     . ALA A 1 245 ? -18.291 -12.221 -0.970  1.00 30.86 ? 237 ALA A N     1 
ATOM   1809 C  CA    . ALA A 1 245 ? -18.196 -10.804 -0.651  1.00 30.63 ? 237 ALA A CA    1 
ATOM   1810 C  C     . ALA A 1 245 ? -18.973 -10.485 0.612   1.00 30.49 ? 237 ALA A C     1 
ATOM   1811 O  O     . ALA A 1 245 ? -20.088 -10.969 0.813   1.00 30.49 ? 237 ALA A O     1 
ATOM   1812 C  CB    . ALA A 1 245 ? -18.687 -9.964  -1.805  1.00 30.48 ? 237 ALA A CB    1 
ATOM   1813 N  N     . ILE A 1 246 ? -18.381 -9.658  1.457   1.00 30.49 ? 238 ILE A N     1 
ATOM   1814 C  CA    . ILE A 1 246 ? -18.896 -9.436  2.788   1.00 30.39 ? 238 ILE A CA    1 
ATOM   1815 C  C     . ILE A 1 246 ? -18.828 -7.946  3.162   1.00 30.30 ? 238 ILE A C     1 
ATOM   1816 O  O     . ILE A 1 246 ? -17.791 -7.306  2.998   1.00 30.26 ? 238 ILE A O     1 
ATOM   1817 C  CB    . ILE A 1 246 ? -18.132 -10.319 3.819   1.00 30.33 ? 238 ILE A CB    1 
ATOM   1818 C  CG1   . ILE A 1 246 ? -19.099 -11.213 4.577   1.00 30.54 ? 238 ILE A CG1   1 
ATOM   1819 C  CG2   . ILE A 1 246 ? -17.286 -9.486  4.757   1.00 30.49 ? 238 ILE A CG2   1 
ATOM   1820 C  CD1   . ILE A 1 246 ? -19.442 -12.475 3.857   1.00 31.04 ? 238 ILE A CD1   1 
ATOM   1821 N  N     . ASN A 1 247 ? -19.947 -7.380  3.618   1.00 30.13 ? 239 ASN A N     1 
ATOM   1822 C  CA    . ASN A 1 247 ? -20.013 -5.981  4.042   1.00 29.97 ? 239 ASN A CA    1 
ATOM   1823 C  C     . ASN A 1 247 ? -19.650 -5.811  5.511   1.00 30.03 ? 239 ASN A C     1 
ATOM   1824 O  O     . ASN A 1 247 ? -20.334 -6.327  6.392   1.00 30.14 ? 239 ASN A O     1 
ATOM   1825 C  CB    . ASN A 1 247 ? -21.411 -5.395  3.794   1.00 29.93 ? 239 ASN A CB    1 
ATOM   1826 C  CG    . ASN A 1 247 ? -21.841 -5.491  2.341   1.00 30.00 ? 239 ASN A CG    1 
ATOM   1827 O  OD1   . ASN A 1 247 ? -21.645 -4.553  1.557   1.00 29.78 ? 239 ASN A OD1   1 
ATOM   1828 N  ND2   . ASN A 1 247 ? -22.449 -6.625  1.975   1.00 30.21 ? 239 ASN A ND2   1 
ATOM   1829 N  N     . LEU A 1 248 ? -18.565 -5.113  5.800   1.00 29.95 ? 240 LEU A N     1 
ATOM   1830 C  CA    . LEU A 1 248 ? -18.242 -4.721  7.171   1.00 29.73 ? 240 LEU A CA    1 
ATOM   1831 C  C     . LEU A 1 248 ? -18.016 -3.225  7.258   1.00 29.79 ? 240 LEU A C     1 
ATOM   1832 O  O     . LEU A 1 248 ? -17.341 -2.640  6.408   1.00 29.75 ? 240 LEU A O     1 
ATOM   1833 C  CB    . LEU A 1 248 ? -16.995 -5.456  7.671   1.00 29.61 ? 240 LEU A CB    1 
ATOM   1834 C  CG    . LEU A 1 248 ? -17.155 -6.889  8.179   1.00 29.39 ? 240 LEU A CG    1 
ATOM   1835 C  CD1   . LEU A 1 248 ? -15.794 -7.486  8.504   1.00 29.19 ? 240 LEU A CD1   1 
ATOM   1836 C  CD2   . LEU A 1 248 ? -18.060 -6.941  9.391   1.00 28.59 ? 240 LEU A CD2   1 
ATOM   1837 N  N     . LEU A 1 249 ? -18.589 -2.604  8.282   1.00 29.93 ? 241 LEU A N     1 
ATOM   1838 C  CA    . LEU A 1 249 ? -18.209 -1.249  8.658   1.00 30.10 ? 241 LEU A CA    1 
ATOM   1839 C  C     . LEU A 1 249 ? -16.800 -1.281  9.243   1.00 30.18 ? 241 LEU A C     1 
ATOM   1840 O  O     . LEU A 1 249 ? -16.441 -2.233  9.937   1.00 30.03 ? 241 LEU A O     1 
ATOM   1841 C  CB    . LEU A 1 249 ? -19.198 -0.673  9.681   1.00 29.98 ? 241 LEU A CB    1 
ATOM   1842 C  CG    . LEU A 1 249 ? -20.685 -0.718  9.299   1.00 30.44 ? 241 LEU A CG    1 
ATOM   1843 C  CD1   . LEU A 1 249 ? -21.560 -0.166  10.419  1.00 30.04 ? 241 LEU A CD1   1 
ATOM   1844 C  CD2   . LEU A 1 249 ? -20.948 0.022   7.990   1.00 30.27 ? 241 LEU A CD2   1 
ATOM   1845 N  N     . PRO A 1 250 ? -15.981 -0.259  8.929   1.00 30.41 ? 242 PRO A N     1 
ATOM   1846 C  CA    . PRO A 1 250 ? -14.622 -0.148  9.473   1.00 30.71 ? 242 PRO A CA    1 
ATOM   1847 C  C     . PRO A 1 250 ? -14.586 -0.276  10.997  1.00 31.05 ? 242 PRO A C     1 
ATOM   1848 O  O     . PRO A 1 250 ? -13.656 -0.878  11.543  1.00 31.13 ? 242 PRO A O     1 
ATOM   1849 C  CB    . PRO A 1 250 ? -14.195 1.257   9.050   1.00 30.61 ? 242 PRO A CB    1 
ATOM   1850 C  CG    . PRO A 1 250 ? -14.961 1.511   7.807   1.00 30.62 ? 242 PRO A CG    1 
ATOM   1851 C  CD    . PRO A 1 250 ? -16.291 0.841   8.000   1.00 30.33 ? 242 PRO A CD    1 
ATOM   1852 N  N     . GLY A 1 251 ? -15.606 0.263   11.667  1.00 31.22 ? 243 GLY A N     1 
ATOM   1853 C  CA    . GLY A 1 251 ? -15.691 0.212   13.126  1.00 31.67 ? 243 GLY A CA    1 
ATOM   1854 C  C     . GLY A 1 251 ? -15.782 -1.200  13.666  1.00 31.99 ? 243 GLY A C     1 
ATOM   1855 O  O     . GLY A 1 251 ? -15.304 -1.487  14.764  1.00 31.97 ? 243 GLY A O     1 
ATOM   1856 N  N     . SER A 1 252 ? -16.396 -2.087  12.884  1.00 32.36 ? 244 SER A N     1 
ATOM   1857 C  CA    . SER A 1 252 ? -16.491 -3.499  13.240  1.00 32.68 ? 244 SER A CA    1 
ATOM   1858 C  C     . SER A 1 252 ? -15.131 -4.174  13.141  1.00 33.13 ? 244 SER A C     1 
ATOM   1859 O  O     . SER A 1 252 ? -14.852 -5.141  13.852  1.00 33.25 ? 244 SER A O     1 
ATOM   1860 C  CB    . SER A 1 252 ? -17.489 -4.207  12.332  1.00 32.48 ? 244 SER A CB    1 
ATOM   1861 O  OG    . SER A 1 252 ? -18.615 -3.390  12.093  1.00 32.34 ? 244 SER A OG    1 
ATOM   1862 N  N     . LEU A 1 253 ? -14.284 -3.657  12.259  1.00 33.64 ? 245 LEU A N     1 
ATOM   1863 C  CA    . LEU A 1 253 ? -12.949 -4.191  12.088  1.00 34.19 ? 245 LEU A CA    1 
ATOM   1864 C  C     . LEU A 1 253 ? -12.003 -3.708  13.181  1.00 34.76 ? 245 LEU A C     1 
ATOM   1865 O  O     . LEU A 1 253 ? -10.981 -4.336  13.438  1.00 34.95 ? 245 LEU A O     1 
ATOM   1866 C  CB    . LEU A 1 253 ? -12.400 -3.843  10.701  1.00 34.12 ? 245 LEU A CB    1 
ATOM   1867 C  CG    . LEU A 1 253 ? -12.991 -4.641  9.532   1.00 33.85 ? 245 LEU A CG    1 
ATOM   1868 C  CD1   . LEU A 1 253 ? -12.840 -3.890  8.213   1.00 33.55 ? 245 LEU A CD1   1 
ATOM   1869 C  CD2   . LEU A 1 253 ? -12.360 -6.022  9.446   1.00 33.22 ? 245 LEU A CD2   1 
ATOM   1870 N  N     . TYR A 1 254 ? -12.350 -2.597  13.832  1.00 35.55 ? 246 TYR A N     1 
ATOM   1871 C  CA    . TYR A 1 254 ? -11.554 -2.097  14.962  1.00 36.22 ? 246 TYR A CA    1 
ATOM   1872 C  C     . TYR A 1 254 ? -12.076 -2.616  16.302  1.00 36.56 ? 246 TYR A C     1 
ATOM   1873 O  O     . TYR A 1 254 ? -11.538 -2.270  17.356  1.00 36.60 ? 246 TYR A O     1 
ATOM   1874 C  CB    . TYR A 1 254 ? -11.517 -0.561  15.002  1.00 36.34 ? 246 TYR A CB    1 
ATOM   1875 C  CG    . TYR A 1 254 ? -11.382 0.134   13.663  1.00 36.73 ? 246 TYR A CG    1 
ATOM   1876 C  CD1   . TYR A 1 254 ? -10.471 -0.310  12.704  1.00 37.29 ? 246 TYR A CD1   1 
ATOM   1877 C  CD2   . TYR A 1 254 ? -12.127 1.282   13.382  1.00 36.76 ? 246 TYR A CD2   1 
ATOM   1878 C  CE1   . TYR A 1 254 ? -10.343 0.347   11.475  1.00 37.34 ? 246 TYR A CE1   1 
ATOM   1879 C  CE2   . TYR A 1 254 ? -12.004 1.944   12.167  1.00 36.56 ? 246 TYR A CE2   1 
ATOM   1880 C  CZ    . TYR A 1 254 ? -11.113 1.475   11.220  1.00 36.94 ? 246 TYR A CZ    1 
ATOM   1881 O  OH    . TYR A 1 254 ? -10.995 2.134   10.021  1.00 37.13 ? 246 TYR A OH    1 
ATOM   1882 N  N     . HIS A 1 255 ? -13.134 -3.427  16.263  1.00 36.96 ? 247 HIS A N     1 
ATOM   1883 C  CA    . HIS A 1 255 ? -13.803 -3.862  17.488  1.00 37.43 ? 247 HIS A CA    1 
ATOM   1884 C  C     . HIS A 1 255 ? -12.857 -4.636  18.392  1.00 37.59 ? 247 HIS A C     1 
ATOM   1885 O  O     . HIS A 1 255 ? -12.507 -4.172  19.478  1.00 37.84 ? 247 HIS A O     1 
ATOM   1886 C  CB    . HIS A 1 255 ? -15.040 -4.699  17.177  1.00 37.46 ? 247 HIS A CB    1 
ATOM   1887 C  CG    . HIS A 1 255 ? -15.793 -5.127  18.396  1.00 38.45 ? 247 HIS A CG    1 
ATOM   1888 N  ND1   . HIS A 1 255 ? -15.742 -6.413  18.891  1.00 39.47 ? 247 HIS A ND1   1 
ATOM   1889 C  CD2   . HIS A 1 255 ? -16.582 -4.428  19.247  1.00 39.16 ? 247 HIS A CD2   1 
ATOM   1890 C  CE1   . HIS A 1 255 ? -16.483 -6.492  19.982  1.00 39.42 ? 247 HIS A CE1   1 
ATOM   1891 N  NE2   . HIS A 1 255 ? -17.003 -5.302  20.220  1.00 39.49 ? 247 HIS A NE2   1 
ATOM   1892 N  N     . HIS A 1 256 ? -12.450 -5.817  17.941  1.00 37.63 ? 248 HIS A N     1 
ATOM   1893 C  CA    . HIS A 1 256 ? -11.364 -6.543  18.577  1.00 37.66 ? 248 HIS A CA    1 
ATOM   1894 C  C     . HIS A 1 256 ? -10.054 -6.182  17.899  1.00 37.48 ? 248 HIS A C     1 
ATOM   1895 O  O     . HIS A 1 256 ? -10.042 -5.854  16.712  1.00 37.68 ? 248 HIS A O     1 
ATOM   1896 C  CB    . HIS A 1 256 ? -11.599 -8.051  18.485  1.00 37.89 ? 248 HIS A CB    1 
ATOM   1897 C  CG    . HIS A 1 256 ? -12.826 -8.515  19.205  1.00 38.44 ? 248 HIS A CG    1 
ATOM   1898 N  ND1   . HIS A 1 256 ? -13.059 -8.235  20.536  1.00 38.95 ? 248 HIS A ND1   1 
ATOM   1899 C  CD2   . HIS A 1 256 ? -13.885 -9.244  18.782  1.00 38.74 ? 248 HIS A CD2   1 
ATOM   1900 C  CE1   . HIS A 1 256 ? -14.210 -8.771  20.899  1.00 39.36 ? 248 HIS A CE1   1 
ATOM   1901 N  NE2   . HIS A 1 256 ? -14.732 -9.388  19.854  1.00 39.37 ? 248 HIS A NE2   1 
ATOM   1902 N  N     . PRO A 1 257 ? -8.942  -6.208  18.661  1.00 37.16 ? 249 PRO A N     1 
ATOM   1903 C  CA    . PRO A 1 257 ? -7.594  -6.080  18.091  1.00 36.71 ? 249 PRO A CA    1 
ATOM   1904 C  C     . PRO A 1 257 ? -7.303  -7.125  17.007  1.00 36.21 ? 249 PRO A C     1 
ATOM   1905 O  O     . PRO A 1 257 ? -6.689  -6.802  15.991  1.00 36.28 ? 249 PRO A O     1 
ATOM   1906 C  CB    . PRO A 1 257 ? -6.682  -6.304  19.300  1.00 36.84 ? 249 PRO A CB    1 
ATOM   1907 C  CG    . PRO A 1 257 ? -7.509  -5.895  20.471  1.00 37.18 ? 249 PRO A CG    1 
ATOM   1908 C  CD    . PRO A 1 257 ? -8.911  -6.301  20.133  1.00 37.16 ? 249 PRO A CD    1 
ATOM   1909 N  N     . ASP A 1 258 ? -7.749  -8.361  17.224  1.00 35.53 ? 250 ASP A N     1 
ATOM   1910 C  CA    . ASP A 1 258 ? -7.509  -9.445  16.270  1.00 34.80 ? 250 ASP A CA    1 
ATOM   1911 C  C     . ASP A 1 258 ? -8.770  -9.809  15.482  1.00 34.12 ? 250 ASP A C     1 
ATOM   1912 O  O     . ASP A 1 258 ? -9.060  -10.990 15.265  1.00 33.94 ? 250 ASP A O     1 
ATOM   1913 C  CB    . ASP A 1 258 ? -6.958  -10.681 16.987  1.00 34.93 ? 250 ASP A CB    1 
ATOM   1914 C  CG    . ASP A 1 258 ? -7.972  -11.315 17.930  1.00 35.39 ? 250 ASP A CG    1 
ATOM   1915 O  OD1   . ASP A 1 258 ? -8.803  -10.573 18.511  1.00 35.55 ? 250 ASP A OD1   1 
ATOM   1916 O  OD2   . ASP A 1 258 ? -7.941  -12.556 18.082  1.00 35.42 ? 250 ASP A OD2   1 
ATOM   1917 N  N     . ALA A 1 259 ? -9.506  -8.789  15.045  1.00 33.20 ? 251 ALA A N     1 
ATOM   1918 C  CA    . ALA A 1 259 ? -10.735 -8.991  14.275  1.00 32.35 ? 251 ALA A CA    1 
ATOM   1919 C  C     . ALA A 1 259 ? -10.466 -9.719  12.956  1.00 31.76 ? 251 ALA A C     1 
ATOM   1920 O  O     . ALA A 1 259 ? -11.262 -10.557 12.526  1.00 31.49 ? 251 ALA A O     1 
ATOM   1921 C  CB    . ALA A 1 259 ? -11.419 -7.664  14.018  1.00 32.41 ? 251 ALA A CB    1 
ATOM   1922 N  N     . VAL A 1 260 ? -9.335  -9.397  12.331  1.00 31.04 ? 252 VAL A N     1 
ATOM   1923 C  CA    . VAL A 1 260 ? -8.909  -10.053 11.101  1.00 30.47 ? 252 VAL A CA    1 
ATOM   1924 C  C     . VAL A 1 260 ? -8.559  -11.522 11.347  1.00 30.18 ? 252 VAL A C     1 
ATOM   1925 O  O     . VAL A 1 260 ? -8.933  -12.403 10.562  1.00 30.18 ? 252 VAL A O     1 
ATOM   1926 C  CB    . VAL A 1 260 ? -7.705  -9.315  10.464  1.00 30.53 ? 252 VAL A CB    1 
ATOM   1927 C  CG1   . VAL A 1 260 ? -7.019  -10.186 9.421   1.00 30.29 ? 252 VAL A CG1   1 
ATOM   1928 C  CG2   . VAL A 1 260 ? -8.158  -7.999  9.851   1.00 30.19 ? 252 VAL A CG2   1 
ATOM   1929 N  N     . GLY A 1 261 ? -7.868  -11.782 12.455  1.00 29.79 ? 253 GLY A N     1 
ATOM   1930 C  CA    . GLY A 1 261 ? -7.497  -13.144 12.836  1.00 29.27 ? 253 GLY A CA    1 
ATOM   1931 C  C     . GLY A 1 261 ? -8.699  -14.016 13.151  1.00 28.91 ? 253 GLY A C     1 
ATOM   1932 O  O     . GLY A 1 261 ? -8.687  -15.222 12.896  1.00 28.66 ? 253 GLY A O     1 
ATOM   1933 N  N     . TRP A 1 262 ? -9.742  -13.400 13.705  1.00 28.71 ? 254 TRP A N     1 
ATOM   1934 C  CA    . TRP A 1 262 ? -10.988 -14.103 13.982  1.00 28.51 ? 254 TRP A CA    1 
ATOM   1935 C  C     . TRP A 1 262 ? -11.734 -14.445 12.697  1.00 28.33 ? 254 TRP A C     1 
ATOM   1936 O  O     . TRP A 1 262 ? -12.260 -15.549 12.554  1.00 28.22 ? 254 TRP A O     1 
ATOM   1937 C  CB    . TRP A 1 262 ? -11.889 -13.288 14.910  1.00 28.51 ? 254 TRP A CB    1 
ATOM   1938 C  CG    . TRP A 1 262 ? -13.221 -13.928 15.114  1.00 28.62 ? 254 TRP A CG    1 
ATOM   1939 C  CD1   . TRP A 1 262 ? -13.538 -14.872 16.036  1.00 28.77 ? 254 TRP A CD1   1 
ATOM   1940 C  CD2   . TRP A 1 262 ? -14.408 -13.708 14.341  1.00 28.63 ? 254 TRP A CD2   1 
ATOM   1941 N  NE1   . TRP A 1 262 ? -14.852 -15.246 15.902  1.00 28.72 ? 254 TRP A NE1   1 
ATOM   1942 C  CE2   . TRP A 1 262 ? -15.409 -14.545 14.868  1.00 28.45 ? 254 TRP A CE2   1 
ATOM   1943 C  CE3   . TRP A 1 262 ? -14.721 -12.881 13.259  1.00 28.49 ? 254 TRP A CE3   1 
ATOM   1944 C  CZ2   . TRP A 1 262 ? -16.698 -14.579 14.354  1.00 28.59 ? 254 TRP A CZ2   1 
ATOM   1945 C  CZ3   . TRP A 1 262 ? -15.999 -12.918 12.750  1.00 28.55 ? 254 TRP A CZ3   1 
ATOM   1946 C  CH2   . TRP A 1 262 ? -16.975 -13.761 13.298  1.00 28.70 ? 254 TRP A CH2   1 
ATOM   1947 N  N     . LEU A 1 263 ? -11.799 -13.486 11.776  1.00 28.25 ? 255 LEU A N     1 
ATOM   1948 C  CA    . LEU A 1 263 ? -12.357 -13.736 10.447  1.00 28.26 ? 255 LEU A CA    1 
ATOM   1949 C  C     . LEU A 1 263 ? -11.679 -14.938 9.817   1.00 28.17 ? 255 LEU A C     1 
ATOM   1950 O  O     . LEU A 1 263 ? -12.343 -15.884 9.392   1.00 28.23 ? 255 LEU A O     1 
ATOM   1951 C  CB    . LEU A 1 263 ? -12.190 -12.507 9.544   1.00 28.24 ? 255 LEU A CB    1 
ATOM   1952 C  CG    . LEU A 1 263 ? -13.128 -11.320 9.794   1.00 28.22 ? 255 LEU A CG    1 
ATOM   1953 C  CD1   . LEU A 1 263 ? -12.676 -10.107 8.996   1.00 27.74 ? 255 LEU A CD1   1 
ATOM   1954 C  CD2   . LEU A 1 263 ? -14.585 -11.674 9.474   1.00 27.59 ? 255 LEU A CD2   1 
ATOM   1955 N  N     . MET A 1 264 ? -10.349 -14.906 9.794   1.00 28.20 ? 256 MET A N     1 
ATOM   1956 C  CA    . MET A 1 264 ? -9.539  -16.018 9.296   1.00 28.18 ? 256 MET A CA    1 
ATOM   1957 C  C     . MET A 1 264 ? -9.941  -17.355 9.900   1.00 28.03 ? 256 MET A C     1 
ATOM   1958 O  O     . MET A 1 264 ? -10.287 -18.288 9.176   1.00 28.10 ? 256 MET A O     1 
ATOM   1959 C  CB    . MET A 1 264 ? -8.061  -15.753 9.555   1.00 28.10 ? 256 MET A CB    1 
ATOM   1960 C  CG    . MET A 1 264 ? -7.425  -14.880 8.520   1.00 28.91 ? 256 MET A CG    1 
ATOM   1961 S  SD    . MET A 1 264 ? -7.442  -15.655 6.894   1.00 30.94 ? 256 MET A SD    1 
ATOM   1962 C  CE    . MET A 1 264 ? -6.121  -16.859 7.096   1.00 30.38 ? 256 MET A CE    1 
ATOM   1963 N  N     . ASP A 1 265 ? -9.898  -17.440 11.228  1.00 27.88 ? 257 ASP A N     1 
ATOM   1964 C  CA    . ASP A 1 265 ? -10.271 -18.663 11.932  1.00 28.01 ? 257 ASP A CA    1 
ATOM   1965 C  C     . ASP A 1 265 ? -11.700 -19.105 11.586  1.00 27.83 ? 257 ASP A C     1 
ATOM   1966 O  O     . ASP A 1 265 ? -11.948 -20.286 11.341  1.00 27.83 ? 257 ASP A O     1 
ATOM   1967 C  CB    . ASP A 1 265 ? -10.116 -18.484 13.452  1.00 28.12 ? 257 ASP A CB    1 
ATOM   1968 C  CG    . ASP A 1 265 ? -8.653  -18.507 13.906  1.00 29.00 ? 257 ASP A CG    1 
ATOM   1969 O  OD1   . ASP A 1 265 ? -7.754  -18.655 13.050  1.00 30.67 ? 257 ASP A OD1   1 
ATOM   1970 O  OD2   . ASP A 1 265 ? -8.404  -18.375 15.122  1.00 29.80 ? 257 ASP A OD2   1 
ATOM   1971 N  N     . SER A 1 266 ? -12.621 -18.145 11.537  1.00 27.70 ? 258 SER A N     1 
ATOM   1972 C  CA    . SER A 1 266 ? -14.025 -18.432 11.246  1.00 27.63 ? 258 SER A CA    1 
ATOM   1973 C  C     . SER A 1 266 ? -14.235 -18.986 9.832   1.00 27.73 ? 258 SER A C     1 
ATOM   1974 O  O     . SER A 1 266 ? -14.973 -19.958 9.646   1.00 27.76 ? 258 SER A O     1 
ATOM   1975 C  CB    . SER A 1 266 ? -14.888 -17.185 11.463  1.00 27.65 ? 258 SER A CB    1 
ATOM   1976 O  OG    . SER A 1 266 ? -16.251 -17.444 11.168  1.00 27.36 ? 258 SER A OG    1 
ATOM   1977 N  N     . LEU A 1 267 ? -13.581 -18.373 8.842   1.00 27.63 ? 259 LEU A N     1 
ATOM   1978 C  CA    . LEU A 1 267 ? -13.782 -18.765 7.444   1.00 27.62 ? 259 LEU A CA    1 
ATOM   1979 C  C     . LEU A 1 267 ? -13.109 -20.098 7.117   1.00 27.86 ? 259 LEU A C     1 
ATOM   1980 O  O     . LEU A 1 267 ? -13.621 -20.879 6.314   1.00 27.79 ? 259 LEU A O     1 
ATOM   1981 C  CB    . LEU A 1 267 ? -13.328 -17.655 6.478   1.00 27.41 ? 259 LEU A CB    1 
ATOM   1982 C  CG    . LEU A 1 267 ? -11.840 -17.316 6.326   1.00 26.97 ? 259 LEU A CG    1 
ATOM   1983 C  CD1   . LEU A 1 267 ? -11.227 -18.074 5.160   1.00 26.08 ? 259 LEU A CD1   1 
ATOM   1984 C  CD2   . LEU A 1 267 ? -11.661 -15.824 6.133   1.00 26.22 ? 259 LEU A CD2   1 
ATOM   1985 N  N     . LEU A 1 268 ? -11.972 -20.359 7.759   1.00 28.09 ? 260 LEU A N     1 
ATOM   1986 C  CA    . LEU A 1 268 ? -11.273 -21.623 7.590   1.00 28.33 ? 260 LEU A CA    1 
ATOM   1987 C  C     . LEU A 1 268 ? -12.062 -22.772 8.198   1.00 28.51 ? 260 LEU A C     1 
ATOM   1988 O  O     . LEU A 1 268 ? -12.100 -23.868 7.644   1.00 28.64 ? 260 LEU A O     1 
ATOM   1989 C  CB    . LEU A 1 268 ? -9.875  -21.554 8.201   1.00 28.34 ? 260 LEU A CB    1 
ATOM   1990 C  CG    . LEU A 1 268 ? -8.815  -20.847 7.350   1.00 28.61 ? 260 LEU A CG    1 
ATOM   1991 C  CD1   . LEU A 1 268 ? -7.571  -20.522 8.175   1.00 28.41 ? 260 LEU A CD1   1 
ATOM   1992 C  CD2   . LEU A 1 268 ? -8.454  -21.683 6.125   1.00 28.02 ? 260 LEU A CD2   1 
ATOM   1993 N  N     . ALA A 1 269 ? -12.714 -22.507 9.328   1.00 28.77 ? 261 ALA A N     1 
ATOM   1994 C  CA    . ALA A 1 269 ? -13.570 -23.502 9.979   1.00 28.89 ? 261 ALA A CA    1 
ATOM   1995 C  C     . ALA A 1 269 ? -14.806 -23.807 9.131   1.00 28.99 ? 261 ALA A C     1 
ATOM   1996 O  O     . ALA A 1 269 ? -15.426 -24.862 9.276   1.00 29.01 ? 261 ALA A O     1 
ATOM   1997 C  CB    . ALA A 1 269 ? -13.978 -23.028 11.365  1.00 28.79 ? 261 ALA A CB    1 
ATOM   1998 N  N     . ALA A 1 270 ? -15.160 -22.870 8.253   1.00 29.08 ? 262 ALA A N     1 
ATOM   1999 C  CA    . ALA A 1 270 ? -16.245 -23.074 7.299   1.00 29.06 ? 262 ALA A CA    1 
ATOM   2000 C  C     . ALA A 1 270 ? -15.726 -23.739 6.027   1.00 29.07 ? 262 ALA A C     1 
ATOM   2001 O  O     . ALA A 1 270 ? -16.499 -24.062 5.124   1.00 29.21 ? 262 ALA A O     1 
ATOM   2002 C  CB    . ALA A 1 270 ? -16.919 -21.752 6.975   1.00 28.86 ? 262 ALA A CB    1 
ATOM   2003 N  N     . GLY A 1 271 ? -14.414 -23.945 5.966   1.00 28.97 ? 263 GLY A N     1 
ATOM   2004 C  CA    . GLY A 1 271 ? -13.796 -24.626 4.836   1.00 28.95 ? 263 GLY A CA    1 
ATOM   2005 C  C     . GLY A 1 271 ? -13.591 -23.710 3.652   1.00 28.95 ? 263 GLY A C     1 
ATOM   2006 O  O     . GLY A 1 271 ? -13.570 -24.158 2.508   1.00 29.00 ? 263 GLY A O     1 
ATOM   2007 N  N     . LEU A 1 272 ? -13.447 -22.418 3.928   1.00 28.93 ? 264 LEU A N     1 
ATOM   2008 C  CA    . LEU A 1 272 ? -13.189 -21.437 2.885   1.00 28.84 ? 264 LEU A CA    1 
ATOM   2009 C  C     . LEU A 1 272 ? -11.726 -21.045 2.875   1.00 29.03 ? 264 LEU A C     1 
ATOM   2010 O  O     . LEU A 1 272 ? -11.008 -21.272 3.846   1.00 29.20 ? 264 LEU A O     1 
ATOM   2011 C  CB    . LEU A 1 272 ? -14.058 -20.195 3.083   1.00 28.66 ? 264 LEU A CB    1 
ATOM   2012 C  CG    . LEU A 1 272 ? -15.555 -20.420 3.297   1.00 28.42 ? 264 LEU A CG    1 
ATOM   2013 C  CD1   . LEU A 1 272 ? -16.254 -19.099 3.568   1.00 27.99 ? 264 LEU A CD1   1 
ATOM   2014 C  CD2   . LEU A 1 272 ? -16.174 -21.127 2.102   1.00 28.02 ? 264 LEU A CD2   1 
ATOM   2015 N  N     . ARG A 1 273 ? -11.285 -20.459 1.770   1.00 29.18 ? 265 ARG A N     1 
ATOM   2016 C  CA    . ARG A 1 273 ? -9.928  -19.946 1.665   1.00 29.38 ? 265 ARG A CA    1 
ATOM   2017 C  C     . ARG A 1 273 ? -9.925  -18.428 1.875   1.00 29.26 ? 265 ARG A C     1 
ATOM   2018 O  O     . ARG A 1 273 ? -10.938 -17.770 1.646   1.00 29.21 ? 265 ARG A O     1 
ATOM   2019 C  CB    . ARG A 1 273 ? -9.331  -20.308 0.298   1.00 29.62 ? 265 ARG A CB    1 
ATOM   2020 C  CG    . ARG A 1 273 ? -9.377  -21.808 -0.031  1.00 30.41 ? 265 ARG A CG    1 
ATOM   2021 C  CD    . ARG A 1 273 ? -8.512  -22.622 0.924   1.00 32.31 ? 265 ARG A CD    1 
ATOM   2022 N  NE    . ARG A 1 273 ? -7.203  -22.006 1.129   1.00 33.80 ? 265 ARG A NE    1 
ATOM   2023 C  CZ    . ARG A 1 273 ? -6.487  -22.119 2.243   1.00 34.15 ? 265 ARG A CZ    1 
ATOM   2024 N  NH1   . ARG A 1 273 ? -6.947  -22.832 3.265   1.00 34.47 ? 265 ARG A NH1   1 
ATOM   2025 N  NH2   . ARG A 1 273 ? -5.311  -21.514 2.337   1.00 34.43 ? 265 ARG A NH2   1 
ATOM   2026 N  N     . PRO A 1 274 ? -8.791  -17.869 2.339   1.00 29.25 ? 266 PRO A N     1 
ATOM   2027 C  CA    . PRO A 1 274 ? -8.732  -16.425 2.582   1.00 29.27 ? 266 PRO A CA    1 
ATOM   2028 C  C     . PRO A 1 274 ? -8.876  -15.630 1.284   1.00 29.34 ? 266 PRO A C     1 
ATOM   2029 O  O     . PRO A 1 274 ? -9.613  -14.647 1.238   1.00 29.46 ? 266 PRO A O     1 
ATOM   2030 C  CB    . PRO A 1 274 ? -7.331  -16.223 3.173   1.00 29.19 ? 266 PRO A CB    1 
ATOM   2031 C  CG    . PRO A 1 274 ? -6.865  -17.588 3.566   1.00 29.09 ? 266 PRO A CG    1 
ATOM   2032 C  CD    . PRO A 1 274 ? -7.514  -18.533 2.646   1.00 29.21 ? 266 PRO A CD    1 
ATOM   2033 N  N     . ASP A 1 275 ? -8.196  -16.084 0.233   1.00 29.34 ? 267 ASP A N     1 
ATOM   2034 C  CA    . ASP A 1 275 ? -8.254  -15.441 -1.087  1.00 29.40 ? 267 ASP A CA    1 
ATOM   2035 C  C     . ASP A 1 275 ? -9.643  -15.547 -1.715  1.00 29.06 ? 267 ASP A C     1 
ATOM   2036 O  O     . ASP A 1 275 ? -9.910  -14.963 -2.759  1.00 29.07 ? 267 ASP A O     1 
ATOM   2037 C  CB    . ASP A 1 275 ? -7.202  -16.053 -2.022  1.00 29.55 ? 267 ASP A CB    1 
ATOM   2038 C  CG    . ASP A 1 275 ? -7.054  -17.559 -1.832  1.00 30.54 ? 267 ASP A CG    1 
ATOM   2039 O  OD1   . ASP A 1 275 ? -6.722  -17.995 -0.701  1.00 31.67 ? 267 ASP A OD1   1 
ATOM   2040 O  OD2   . ASP A 1 275 ? -7.268  -18.306 -2.810  1.00 31.27 ? 267 ASP A OD2   1 
ATOM   2041 N  N     . GLN A 1 276 ? -10.516 -16.294 -1.058  1.00 28.89 ? 268 GLN A N     1 
ATOM   2042 C  CA    . GLN A 1 276 ? -11.860 -16.533 -1.541  1.00 28.75 ? 268 GLN A CA    1 
ATOM   2043 C  C     . GLN A 1 276 ? -12.836 -15.568 -0.862  1.00 28.76 ? 268 GLN A C     1 
ATOM   2044 O  O     . GLN A 1 276 ? -13.970 -15.401 -1.301  1.00 28.37 ? 268 GLN A O     1 
ATOM   2045 C  CB    . GLN A 1 276 ? -12.251 -17.974 -1.232  1.00 28.70 ? 268 GLN A CB    1 
ATOM   2046 C  CG    . GLN A 1 276 ? -13.319 -18.536 -2.101  1.00 28.69 ? 268 GLN A CG    1 
ATOM   2047 C  CD    . GLN A 1 276 ? -13.588 -19.984 -1.805  1.00 28.92 ? 268 GLN A CD    1 
ATOM   2048 O  OE1   . GLN A 1 276 ? -13.096 -20.531 -0.816  1.00 29.11 ? 268 GLN A OE1   1 
ATOM   2049 N  NE2   . GLN A 1 276 ? -14.369 -20.624 -2.661  1.00 29.51 ? 268 GLN A NE2   1 
ATOM   2050 N  N     . VAL A 1 277 ? -12.376 -14.940 0.217   1.00 28.89 ? 269 VAL A N     1 
ATOM   2051 C  CA    . VAL A 1 277 ? -13.195 -14.012 0.978   1.00 28.90 ? 269 VAL A CA    1 
ATOM   2052 C  C     . VAL A 1 277 ? -12.799 -12.572 0.672   1.00 29.26 ? 269 VAL A C     1 
ATOM   2053 O  O     . VAL A 1 277 ? -11.615 -12.222 0.677   1.00 29.34 ? 269 VAL A O     1 
ATOM   2054 C  CB    . VAL A 1 277 ? -13.079 -14.271 2.494   1.00 28.83 ? 269 VAL A CB    1 
ATOM   2055 C  CG1   . VAL A 1 277 ? -13.945 -13.290 3.279   1.00 28.92 ? 269 VAL A CG1   1 
ATOM   2056 C  CG2   . VAL A 1 277 ? -13.469 -15.701 2.815   1.00 28.65 ? 269 VAL A CG2   1 
ATOM   2057 N  N     . LEU A 1 278 ? -13.800 -11.744 0.402   1.00 29.62 ? 270 LEU A N     1 
ATOM   2058 C  CA    . LEU A 1 278 ? -13.581 -10.351 0.067   1.00 29.97 ? 270 LEU A CA    1 
ATOM   2059 C  C     . LEU A 1 278 ? -14.400 -9.446  0.997   1.00 30.13 ? 270 LEU A C     1 
ATOM   2060 O  O     . LEU A 1 278 ? -15.577 -9.709  1.253   1.00 29.92 ? 270 LEU A O     1 
ATOM   2061 C  CB    . LEU A 1 278 ? -13.947 -10.108 -1.403  1.00 30.03 ? 270 LEU A CB    1 
ATOM   2062 C  CG    . LEU A 1 278 ? -13.859 -8.693  -1.961  1.00 30.25 ? 270 LEU A CG    1 
ATOM   2063 C  CD1   . LEU A 1 278 ? -13.351 -8.716  -3.396  1.00 30.76 ? 270 LEU A CD1   1 
ATOM   2064 C  CD2   . LEU A 1 278 ? -15.212 -8.020  -1.882  1.00 30.81 ? 270 LEU A CD2   1 
ATOM   2065 N  N     . ILE A 1 279 ? -13.766 -8.389  1.501   1.00 30.43 ? 271 ILE A N     1 
ATOM   2066 C  CA    . ILE A 1 279 ? -14.420 -7.464  2.427   1.00 30.97 ? 271 ILE A CA    1 
ATOM   2067 C  C     . ILE A 1 279 ? -14.873 -6.188  1.713   1.00 31.63 ? 271 ILE A C     1 
ATOM   2068 O  O     . ILE A 1 279 ? -14.076 -5.516  1.061   1.00 31.54 ? 271 ILE A O     1 
ATOM   2069 C  CB    . ILE A 1 279 ? -13.486 -7.077  3.602   1.00 30.84 ? 271 ILE A CB    1 
ATOM   2070 C  CG1   . ILE A 1 279 ? -12.765 -8.313  4.162   1.00 30.51 ? 271 ILE A CG1   1 
ATOM   2071 C  CG2   . ILE A 1 279 ? -14.261 -6.329  4.689   1.00 30.48 ? 271 ILE A CG2   1 
ATOM   2072 C  CD1   . ILE A 1 279 ? -13.654 -9.257  4.933   1.00 30.45 ? 271 ILE A CD1   1 
ATOM   2073 N  N     . GLU A 1 280 ? -16.158 -5.864  1.847   1.00 32.55 ? 272 GLU A N     1 
ATOM   2074 C  CA    . GLU A 1 280 ? -16.720 -4.651  1.264   1.00 33.61 ? 272 GLU A CA    1 
ATOM   2075 C  C     . GLU A 1 280 ? -16.871 -3.556  2.310   1.00 34.64 ? 272 GLU A C     1 
ATOM   2076 O  O     . GLU A 1 280 ? -17.642 -3.691  3.259   1.00 34.70 ? 272 GLU A O     1 
ATOM   2077 C  CB    . GLU A 1 280 ? -18.082 -4.940  0.638   1.00 33.49 ? 272 GLU A CB    1 
ATOM   2078 C  CG    . GLU A 1 280 ? -18.037 -5.794  -0.608  1.00 33.04 ? 272 GLU A CG    1 
ATOM   2079 C  CD    . GLU A 1 280 ? -19.373 -5.843  -1.324  1.00 32.27 ? 272 GLU A CD    1 
ATOM   2080 O  OE1   . GLU A 1 280 ? -19.563 -6.738  -2.167  1.00 32.79 ? 272 GLU A OE1   1 
ATOM   2081 O  OE2   . GLU A 1 280 ? -20.231 -4.980  -1.049  1.00 31.18 ? 272 GLU A OE2   1 
ATOM   2082 N  N     . VAL A 1 281 ? -16.135 -2.469  2.127   1.00 36.02 ? 273 VAL A N     1 
ATOM   2083 C  CA    . VAL A 1 281 ? -16.277 -1.295  2.980   1.00 37.40 ? 273 VAL A CA    1 
ATOM   2084 C  C     . VAL A 1 281 ? -16.835 -0.118  2.177   1.00 38.33 ? 273 VAL A C     1 
ATOM   2085 O  O     . VAL A 1 281 ? -16.460 0.087   1.021   1.00 38.28 ? 273 VAL A O     1 
ATOM   2086 C  CB    . VAL A 1 281 ? -14.925 -0.898  3.636   1.00 37.30 ? 273 VAL A CB    1 
ATOM   2087 C  CG1   . VAL A 1 281 ? -14.568 -1.870  4.742   1.00 37.20 ? 273 VAL A CG1   1 
ATOM   2088 C  CG2   . VAL A 1 281 ? -13.820 -0.853  2.598   1.00 37.56 ? 273 VAL A CG2   1 
ATOM   2089 N  N     . THR A 1 282 ? -17.745 0.638   2.788   1.00 39.81 ? 274 THR A N     1 
ATOM   2090 C  CA    . THR A 1 282 ? -18.369 1.782   2.115   1.00 41.33 ? 274 THR A CA    1 
ATOM   2091 C  C     . THR A 1 282 ? -17.416 2.964   1.988   1.00 42.44 ? 274 THR A C     1 
ATOM   2092 O  O     . THR A 1 282 ? -16.681 3.287   2.924   1.00 42.33 ? 274 THR A O     1 
ATOM   2093 C  CB    . THR A 1 282 ? -19.658 2.243   2.821   1.00 41.25 ? 274 THR A CB    1 
ATOM   2094 O  OG1   . THR A 1 282 ? -19.535 2.034   4.234   1.00 41.96 ? 274 THR A OG1   1 
ATOM   2095 C  CG2   . THR A 1 282 ? -20.854 1.467   2.301   1.00 41.02 ? 274 THR A CG2   1 
ATOM   2096 N  N     . GLU A 1 283 ? -17.460 3.610   0.821   1.00 44.02 ? 275 GLU A N     1 
ATOM   2097 C  CA    . GLU A 1 283 ? -16.560 4.716   0.467   1.00 45.54 ? 275 GLU A CA    1 
ATOM   2098 C  C     . GLU A 1 283 ? -16.525 5.816   1.536   1.00 46.44 ? 275 GLU A C     1 
ATOM   2099 O  O     . GLU A 1 283 ? -15.467 6.371   1.834   1.00 46.65 ? 275 GLU A O     1 
ATOM   2100 C  CB    . GLU A 1 283 ? -16.976 5.305   -0.893  1.00 45.46 ? 275 GLU A CB    1 
ATOM   2101 C  CG    . GLU A 1 283 ? -16.040 6.377   -1.456  1.00 45.73 ? 275 GLU A CG    1 
ATOM   2102 C  CD    . GLU A 1 283 ? -16.604 7.049   -2.711  1.00 46.00 ? 275 GLU A CD    1 
ATOM   2103 O  OE1   . GLU A 1 283 ? -17.781 7.464   -2.692  1.00 46.66 ? 275 GLU A OE1   1 
ATOM   2104 O  OE2   . GLU A 1 283 ? -15.869 7.164   -3.712  1.00 46.30 ? 275 GLU A OE2   1 
ATOM   2105 N  N     . THR A 1 284 ? -17.683 6.100   2.125   1.00 47.70 ? 276 THR A N     1 
ATOM   2106 C  CA    . THR A 1 284 ? -17.831 7.214   3.062   1.00 48.87 ? 276 THR A CA    1 
ATOM   2107 C  C     . THR A 1 284 ? -17.150 6.954   4.416   1.00 49.68 ? 276 THR A C     1 
ATOM   2108 O  O     . THR A 1 284 ? -16.794 7.894   5.130   1.00 49.89 ? 276 THR A O     1 
ATOM   2109 C  CB    . THR A 1 284 ? -19.323 7.549   3.311   1.00 48.83 ? 276 THR A CB    1 
ATOM   2110 O  OG1   . THR A 1 284 ? -19.799 6.816   4.446   1.00 48.89 ? 276 THR A OG1   1 
ATOM   2111 C  CG2   . THR A 1 284 ? -20.170 7.196   2.087   1.00 48.80 ? 276 THR A CG2   1 
ATOM   2112 N  N     . GLU A 1 285 ? -16.980 5.682   4.764   1.00 50.58 ? 277 GLU A N     1 
ATOM   2113 C  CA    . GLU A 1 285 ? -16.532 5.316   6.106   1.00 51.59 ? 277 GLU A CA    1 
ATOM   2114 C  C     . GLU A 1 285 ? -15.024 5.045   6.177   1.00 52.15 ? 277 GLU A C     1 
ATOM   2115 O  O     . GLU A 1 285 ? -14.427 5.084   7.258   1.00 52.11 ? 277 GLU A O     1 
ATOM   2116 C  CB    . GLU A 1 285 ? -17.321 4.111   6.627   1.00 51.60 ? 277 GLU A CB    1 
ATOM   2117 C  CG    . GLU A 1 285 ? -18.849 4.242   6.501   1.00 52.52 ? 277 GLU A CG    1 
ATOM   2118 C  CD    . GLU A 1 285 ? -19.441 5.303   7.426   1.00 53.48 ? 277 GLU A CD    1 
ATOM   2119 O  OE1   . GLU A 1 285 ? -19.439 6.496   7.049   1.00 53.89 ? 277 GLU A OE1   1 
ATOM   2120 O  OE2   . GLU A 1 285 ? -19.936 4.936   8.517   1.00 53.59 ? 277 GLU A OE2   1 
ATOM   2121 N  N     . VAL A 1 286 ? -14.418 4.778   5.023   1.00 52.92 ? 278 VAL A N     1 
ATOM   2122 C  CA    . VAL A 1 286 ? -12.972 4.559   4.940   1.00 53.61 ? 278 VAL A CA    1 
ATOM   2123 C  C     . VAL A 1 286 ? -12.224 5.883   5.080   1.00 54.15 ? 278 VAL A C     1 
ATOM   2124 O  O     . VAL A 1 286 ? -11.164 5.955   5.715   1.00 54.17 ? 278 VAL A O     1 
ATOM   2125 C  CB    . VAL A 1 286 ? -12.579 3.907   3.597   1.00 53.55 ? 278 VAL A CB    1 
ATOM   2126 C  CG1   . VAL A 1 286 ? -11.103 3.532   3.595   1.00 53.61 ? 278 VAL A CG1   1 
ATOM   2127 C  CG2   . VAL A 1 286 ? -13.437 2.691   3.330   1.00 53.47 ? 278 VAL A CG2   1 
ATOM   2128 N  N     . ILE A 1 287 ? -12.802 6.932   4.503   1.00 54.78 ? 279 ILE A N     1 
ATOM   2129 C  CA    . ILE A 1 287 ? -12.170 8.246   4.458   1.00 55.36 ? 279 ILE A CA    1 
ATOM   2130 C  C     . ILE A 1 287 ? -12.206 8.945   5.815   1.00 55.80 ? 279 ILE A C     1 
ATOM   2131 O  O     . ILE A 1 287 ? -11.612 10.013  5.989   1.00 55.91 ? 279 ILE A O     1 
ATOM   2132 C  CB    . ILE A 1 287 ? -12.833 9.141   3.397   1.00 55.32 ? 279 ILE A CB    1 
ATOM   2133 C  CG1   . ILE A 1 287 ? -14.285 9.449   3.791   1.00 55.34 ? 279 ILE A CG1   1 
ATOM   2134 C  CG2   . ILE A 1 287 ? -12.775 8.462   2.037   1.00 55.25 ? 279 ILE A CG2   1 
ATOM   2135 C  CD1   . ILE A 1 287 ? -14.911 10.605  3.029   1.00 55.19 ? 279 ILE A CD1   1 
ATOM   2136 N  N     . THR A 1 288 ? -12.906 8.333   6.770   1.00 56.27 ? 280 THR A N     1 
ATOM   2137 C  CA    . THR A 1 288 ? -12.999 8.855   8.129   1.00 56.72 ? 280 THR A CA    1 
ATOM   2138 C  C     . THR A 1 288 ? -11.629 8.871   8.809   1.00 57.00 ? 280 THR A C     1 
ATOM   2139 O  O     . THR A 1 288 ? -11.144 9.925   9.215   1.00 57.10 ? 280 THR A O     1 
ATOM   2140 C  CB    . THR A 1 288 ? -13.997 8.030   8.983   1.00 56.75 ? 280 THR A CB    1 
ATOM   2141 O  OG1   . THR A 1 288 ? -15.236 7.893   8.274   1.00 56.78 ? 280 THR A OG1   1 
ATOM   2142 C  CG2   . THR A 1 288 ? -14.255 8.712   10.326  1.00 56.72 ? 280 THR A CG2   1 
ATOM   2143 N  N     . CYS A 1 289 ? -11.005 7.699   8.913   1.00 57.40 ? 281 CYS A N     1 
ATOM   2144 C  CA    . CYS A 1 289 ? -9.697  7.583   9.555   1.00 57.65 ? 281 CYS A CA    1 
ATOM   2145 C  C     . CYS A 1 289 ? -8.777  6.626   8.802   1.00 57.65 ? 281 CYS A C     1 
ATOM   2146 O  O     . CYS A 1 289 ? -8.989  5.411   8.809   1.00 57.66 ? 281 CYS A O     1 
ATOM   2147 C  CB    . CYS A 1 289 ? -9.849  7.133   11.012  1.00 57.71 ? 281 CYS A CB    1 
ATOM   2148 S  SG    . CYS A 1 289 ? -8.283  6.680   11.813  1.00 58.21 ? 281 CYS A SG    1 
ATOM   2149 N  N     . PHE A 1 290 ? -7.748  7.181   8.166   1.00 57.66 ? 282 PHE A N     1 
ATOM   2150 C  CA    . PHE A 1 290 ? -6.770  6.379   7.430   1.00 57.62 ? 282 PHE A CA    1 
ATOM   2151 C  C     . PHE A 1 290 ? -5.738  5.759   8.370   1.00 57.38 ? 282 PHE A C     1 
ATOM   2152 O  O     . PHE A 1 290 ? -5.050  4.803   8.005   1.00 57.37 ? 282 PHE A O     1 
ATOM   2153 C  CB    . PHE A 1 290 ? -6.062  7.229   6.365   1.00 57.82 ? 282 PHE A CB    1 
ATOM   2154 C  CG    . PHE A 1 290 ? -6.984  7.771   5.299   1.00 58.25 ? 282 PHE A CG    1 
ATOM   2155 C  CD1   . PHE A 1 290 ? -7.517  6.931   4.324   1.00 58.40 ? 282 PHE A CD1   1 
ATOM   2156 C  CD2   . PHE A 1 290 ? -7.300  9.130   5.257   1.00 58.64 ? 282 PHE A CD2   1 
ATOM   2157 C  CE1   . PHE A 1 290 ? -8.363  7.433   3.335   1.00 58.55 ? 282 PHE A CE1   1 
ATOM   2158 C  CE2   . PHE A 1 290 ? -8.146  9.639   4.269   1.00 58.65 ? 282 PHE A CE2   1 
ATOM   2159 C  CZ    . PHE A 1 290 ? -8.675  8.790   3.308   1.00 58.37 ? 282 PHE A CZ    1 
ATOM   2160 N  N     . ASP A 1 291 ? -5.637  6.310   9.579   1.00 57.07 ? 283 ASP A N     1 
ATOM   2161 C  CA    . ASP A 1 291 ? -4.632  5.881   10.551  1.00 56.78 ? 283 ASP A CA    1 
ATOM   2162 C  C     . ASP A 1 291 ? -4.899  4.463   11.051  1.00 56.39 ? 283 ASP A C     1 
ATOM   2163 O  O     . ASP A 1 291 ? -3.994  3.631   11.090  1.00 56.50 ? 283 ASP A O     1 
ATOM   2164 C  CB    . ASP A 1 291 ? -4.579  6.850   11.743  1.00 56.93 ? 283 ASP A CB    1 
ATOM   2165 C  CG    . ASP A 1 291 ? -4.730  8.309   11.325  1.00 57.24 ? 283 ASP A CG    1 
ATOM   2166 O  OD1   . ASP A 1 291 ? -5.819  8.684   10.837  1.00 57.38 ? 283 ASP A OD1   1 
ATOM   2167 O  OD2   . ASP A 1 291 ? -3.766  9.083   11.507  1.00 57.72 ? 283 ASP A OD2   1 
ATOM   2168 N  N     . GLN A 1 292 ? -6.148  4.196   11.422  1.00 55.83 ? 284 GLN A N     1 
ATOM   2169 C  CA    . GLN A 1 292 ? -6.516  2.924   12.043  1.00 55.20 ? 284 GLN A CA    1 
ATOM   2170 C  C     . GLN A 1 292 ? -6.907  1.870   11.007  1.00 54.71 ? 284 GLN A C     1 
ATOM   2171 O  O     . GLN A 1 292 ? -6.766  0.667   11.247  1.00 54.67 ? 284 GLN A O     1 
ATOM   2172 C  CB    . GLN A 1 292 ? -7.654  3.130   13.045  1.00 55.27 ? 284 GLN A CB    1 
ATOM   2173 C  CG    . GLN A 1 292 ? -7.300  4.055   14.209  1.00 55.43 ? 284 GLN A CG    1 
ATOM   2174 C  CD    . GLN A 1 292 ? -8.526  4.639   14.888  1.00 55.47 ? 284 GLN A CD    1 
ATOM   2175 O  OE1   . GLN A 1 292 ? -9.461  3.916   15.238  1.00 55.09 ? 284 GLN A OE1   1 
ATOM   2176 N  NE2   . GLN A 1 292 ? -8.524  5.954   15.083  1.00 55.26 ? 284 GLN A NE2   1 
ATOM   2177 N  N     . PHE A 1 293 ? -7.397  2.330   9.857   1.00 54.02 ? 285 PHE A N     1 
ATOM   2178 C  CA    . PHE A 1 293 ? -7.816  1.436   8.779   1.00 53.27 ? 285 PHE A CA    1 
ATOM   2179 C  C     . PHE A 1 293 ? -6.627  0.760   8.097   1.00 52.71 ? 285 PHE A C     1 
ATOM   2180 O  O     . PHE A 1 293 ? -6.728  -0.384  7.660   1.00 52.63 ? 285 PHE A O     1 
ATOM   2181 C  CB    . PHE A 1 293 ? -8.654  2.197   7.745   1.00 53.37 ? 285 PHE A CB    1 
ATOM   2182 C  CG    . PHE A 1 293 ? -9.221  1.321   6.660   1.00 53.47 ? 285 PHE A CG    1 
ATOM   2183 C  CD1   . PHE A 1 293 ? -8.663  1.319   5.385   1.00 53.63 ? 285 PHE A CD1   1 
ATOM   2184 C  CD2   . PHE A 1 293 ? -10.307 0.492   6.915   1.00 53.50 ? 285 PHE A CD2   1 
ATOM   2185 C  CE1   . PHE A 1 293 ? -9.178  0.507   4.384   1.00 53.40 ? 285 PHE A CE1   1 
ATOM   2186 C  CE2   . PHE A 1 293 ? -10.828 -0.321  5.918   1.00 53.56 ? 285 PHE A CE2   1 
ATOM   2187 C  CZ    . PHE A 1 293 ? -10.263 -0.311  4.650   1.00 53.46 ? 285 PHE A CZ    1 
ATOM   2188 N  N     . ARG A 1 294 ? -5.505  1.472   8.010   1.00 52.05 ? 286 ARG A N     1 
ATOM   2189 C  CA    . ARG A 1 294 ? -4.317  0.951   7.333   1.00 51.45 ? 286 ARG A CA    1 
ATOM   2190 C  C     . ARG A 1 294 ? -3.696  -0.241  8.069   1.00 50.74 ? 286 ARG A C     1 
ATOM   2191 O  O     . ARG A 1 294 ? -3.081  -1.109  7.448   1.00 50.71 ? 286 ARG A O     1 
ATOM   2192 C  CB    . ARG A 1 294 ? -3.277  2.057   7.111   1.00 51.50 ? 286 ARG A CB    1 
ATOM   2193 C  CG    . ARG A 1 294 ? -2.562  2.527   8.373   1.00 51.94 ? 286 ARG A CG    1 
ATOM   2194 C  CD    . ARG A 1 294 ? -1.517  3.589   8.055   1.00 52.06 ? 286 ARG A CD    1 
ATOM   2195 N  NE    . ARG A 1 294 ? -2.128  4.837   7.601   1.00 52.95 ? 286 ARG A NE    1 
ATOM   2196 C  CZ    . ARG A 1 294 ? -1.455  5.850   7.063   1.00 53.03 ? 286 ARG A CZ    1 
ATOM   2197 N  NH1   . ARG A 1 294 ? -0.139  5.768   6.904   1.00 53.22 ? 286 ARG A NH1   1 
ATOM   2198 N  NH2   . ARG A 1 294 ? -2.097  6.946   6.681   1.00 52.70 ? 286 ARG A NH2   1 
ATOM   2199 N  N     . LYS A 1 295 ? -3.875  -0.284  9.390   1.00 49.95 ? 287 LYS A N     1 
ATOM   2200 C  CA    . LYS A 1 295 ? -3.431  -1.420  10.194  1.00 49.14 ? 287 LYS A CA    1 
ATOM   2201 C  C     . LYS A 1 295 ? -4.272  -2.645  9.871   1.00 48.29 ? 287 LYS A C     1 
ATOM   2202 O  O     . LYS A 1 295 ? -3.760  -3.763  9.804   1.00 48.19 ? 287 LYS A O     1 
ATOM   2203 C  CB    . LYS A 1 295 ? -3.531  -1.100  11.689  1.00 49.24 ? 287 LYS A CB    1 
ATOM   2204 C  CG    . LYS A 1 295 ? -2.860  0.205   12.105  1.00 49.57 ? 287 LYS A CG    1 
ATOM   2205 C  CD    . LYS A 1 295 ? -3.222  0.576   13.542  1.00 49.77 ? 287 LYS A CD    1 
ATOM   2206 C  CE    . LYS A 1 295 ? -2.833  2.019   13.864  1.00 50.39 ? 287 LYS A CE    1 
ATOM   2207 N  NZ    . LYS A 1 295 ? -3.342  2.451   15.200  1.00 50.11 ? 287 LYS A NZ    1 
ATOM   2208 N  N     . VAL A 1 296 ? -5.568  -2.421  9.666   1.00 47.31 ? 288 VAL A N     1 
ATOM   2209 C  CA    . VAL A 1 296 ? -6.490  -3.480  9.278   1.00 46.33 ? 288 VAL A CA    1 
ATOM   2210 C  C     . VAL A 1 296 ? -6.223  -3.926  7.844   1.00 45.66 ? 288 VAL A C     1 
ATOM   2211 O  O     . VAL A 1 296 ? -6.185  -5.125  7.556   1.00 45.47 ? 288 VAL A O     1 
ATOM   2212 C  CB    . VAL A 1 296 ? -7.962  -3.029  9.431   1.00 46.35 ? 288 VAL A CB    1 
ATOM   2213 C  CG1   . VAL A 1 296 ? -8.905  -3.991  8.720   1.00 46.51 ? 288 VAL A CG1   1 
ATOM   2214 C  CG2   . VAL A 1 296 ? -8.325  -2.914  10.900  1.00 46.43 ? 288 VAL A CG2   1 
ATOM   2215 N  N     . LEU A 1 297 ? -6.010  -2.954  6.956   1.00 44.84 ? 289 LEU A N     1 
ATOM   2216 C  CA    . LEU A 1 297 ? -5.651  -3.235  5.564   1.00 44.13 ? 289 LEU A CA    1 
ATOM   2217 C  C     . LEU A 1 297 ? -4.430  -4.145  5.476   1.00 43.35 ? 289 LEU A C     1 
ATOM   2218 O  O     . LEU A 1 297 ? -4.440  -5.139  4.748   1.00 43.24 ? 289 LEU A O     1 
ATOM   2219 C  CB    . LEU A 1 297 ? -5.397  -1.930  4.797   1.00 44.33 ? 289 LEU A CB    1 
ATOM   2220 C  CG    . LEU A 1 297 ? -4.771  -2.053  3.396   1.00 44.88 ? 289 LEU A CG    1 
ATOM   2221 C  CD1   . LEU A 1 297 ? -5.517  -1.190  2.391   1.00 45.52 ? 289 LEU A CD1   1 
ATOM   2222 C  CD2   . LEU A 1 297 ? -3.264  -1.716  3.403   1.00 45.13 ? 289 LEU A CD2   1 
ATOM   2223 N  N     . LYS A 1 298 ? -3.384  -3.801  6.227   1.00 42.43 ? 290 LYS A N     1 
ATOM   2224 C  CA    . LYS A 1 298 ? -2.162  -4.601  6.271   1.00 41.54 ? 290 LYS A CA    1 
ATOM   2225 C  C     . LYS A 1 298 ? -2.432  -6.027  6.756   1.00 40.79 ? 290 LYS A C     1 
ATOM   2226 O  O     . LYS A 1 298 ? -1.885  -6.984  6.217   1.00 40.82 ? 290 LYS A O     1 
ATOM   2227 C  CB    . LYS A 1 298 ? -1.108  -3.927  7.156   1.00 41.58 ? 290 LYS A CB    1 
ATOM   2228 C  CG    . LYS A 1 298 ? 0.268   -4.577  7.098   1.00 41.75 ? 290 LYS A CG    1 
ATOM   2229 C  CD    . LYS A 1 298 ? 1.304   -3.741  7.839   1.00 42.82 ? 290 LYS A CD    1 
ATOM   2230 C  CE    . LYS A 1 298 ? 2.595   -4.517  8.058   1.00 43.29 ? 290 LYS A CE    1 
ATOM   2231 N  NZ    . LYS A 1 298 ? 2.390   -5.699  8.948   1.00 44.10 ? 290 LYS A NZ    1 
ATOM   2232 N  N     . ALA A 1 299 ? -3.295  -6.161  7.760   1.00 39.90 ? 291 ALA A N     1 
ATOM   2233 C  CA    . ALA A 1 299 ? -3.663  -7.477  8.281   1.00 39.05 ? 291 ALA A CA    1 
ATOM   2234 C  C     . ALA A 1 299 ? -4.461  -8.298  7.262   1.00 38.45 ? 291 ALA A C     1 
ATOM   2235 O  O     . ALA A 1 299 ? -4.274  -9.505  7.154   1.00 38.41 ? 291 ALA A O     1 
ATOM   2236 C  CB    . ALA A 1 299 ? -4.431  -7.340  9.583   1.00 38.96 ? 291 ALA A CB    1 
ATOM   2237 N  N     . LEU A 1 300 ? -5.331  -7.629  6.508   1.00 37.89 ? 292 LEU A N     1 
ATOM   2238 C  CA    . LEU A 1 300 ? -6.134  -8.291  5.472   1.00 37.36 ? 292 LEU A CA    1 
ATOM   2239 C  C     . LEU A 1 300 ? -5.279  -8.763  4.294   1.00 37.11 ? 292 LEU A C     1 
ATOM   2240 O  O     . LEU A 1 300 ? -5.512  -9.838  3.739   1.00 37.13 ? 292 LEU A O     1 
ATOM   2241 C  CB    . LEU A 1 300 ? -7.241  -7.359  4.965   1.00 37.34 ? 292 LEU A CB    1 
ATOM   2242 C  CG    . LEU A 1 300 ? -8.391  -7.019  5.915   1.00 36.87 ? 292 LEU A CG    1 
ATOM   2243 C  CD1   . LEU A 1 300 ? -9.229  -5.893  5.344   1.00 36.60 ? 292 LEU A CD1   1 
ATOM   2244 C  CD2   . LEU A 1 300 ? -9.249  -8.234  6.188   1.00 36.81 ? 292 LEU A CD2   1 
ATOM   2245 N  N     . ARG A 1 301 ? -4.297  -7.948  3.913   1.00 36.70 ? 293 ARG A N     1 
ATOM   2246 C  CA    . ARG A 1 301 ? -3.389  -8.292  2.818   1.00 36.29 ? 293 ARG A CA    1 
ATOM   2247 C  C     . ARG A 1 301 ? -2.484  -9.462  3.187   1.00 35.88 ? 293 ARG A C     1 
ATOM   2248 O  O     . ARG A 1 301 ? -2.263  -10.364 2.374   1.00 35.86 ? 293 ARG A O     1 
ATOM   2249 C  CB    . ARG A 1 301 ? -2.539  -7.082  2.422   1.00 36.36 ? 293 ARG A CB    1 
ATOM   2250 C  CG    . ARG A 1 301 ? -3.291  -6.016  1.648   1.00 36.73 ? 293 ARG A CG    1 
ATOM   2251 C  CD    . ARG A 1 301 ? -3.425  -6.379  0.176   1.00 37.32 ? 293 ARG A CD    1 
ATOM   2252 N  NE    . ARG A 1 301 ? -4.094  -5.323  -0.578  1.00 37.98 ? 293 ARG A NE    1 
ATOM   2253 C  CZ    . ARG A 1 301 ? -5.410  -5.250  -0.757  1.00 38.68 ? 293 ARG A CZ    1 
ATOM   2254 N  NH1   . ARG A 1 301 ? -6.208  -6.177  -0.242  1.00 39.27 ? 293 ARG A NH1   1 
ATOM   2255 N  NH2   . ARG A 1 301 ? -5.929  -4.253  -1.455  1.00 38.69 ? 293 ARG A NH2   1 
ATOM   2256 N  N     . VAL A 1 302 ? -1.963  -9.437  4.416   1.00 35.34 ? 294 VAL A N     1 
ATOM   2257 C  CA    . VAL A 1 302 ? -1.082  -10.499 4.919   1.00 34.74 ? 294 VAL A CA    1 
ATOM   2258 C  C     . VAL A 1 302 ? -1.835  -11.827 5.084   1.00 34.31 ? 294 VAL A C     1 
ATOM   2259 O  O     . VAL A 1 302 ? -1.306  -12.894 4.758   1.00 34.40 ? 294 VAL A O     1 
ATOM   2260 C  CB    . VAL A 1 302 ? -0.399  -10.091 6.261   1.00 34.82 ? 294 VAL A CB    1 
ATOM   2261 C  CG1   . VAL A 1 302 ? 0.164   -11.309 6.983   1.00 34.68 ? 294 VAL A CG1   1 
ATOM   2262 C  CG2   . VAL A 1 302 ? 0.698   -9.069  6.009   1.00 34.57 ? 294 VAL A CG2   1 
ATOM   2263 N  N     . ALA A 1 303 ? -3.078  -11.750 5.560   1.00 33.49 ? 295 ALA A N     1 
ATOM   2264 C  CA    . ALA A 1 303 ? -3.915  -12.939 5.708   1.00 32.76 ? 295 ALA A CA    1 
ATOM   2265 C  C     . ALA A 1 303 ? -4.312  -13.521 4.352   1.00 32.38 ? 295 ALA A C     1 
ATOM   2266 O  O     . ALA A 1 303 ? -4.433  -14.735 4.203   1.00 32.40 ? 295 ALA A O     1 
ATOM   2267 C  CB    . ALA A 1 303 ? -5.138  -12.625 6.524   1.00 32.73 ? 295 ALA A CB    1 
ATOM   2268 N  N     . GLY A 1 304 ? -4.507  -12.650 3.366   1.00 31.85 ? 296 GLY A N     1 
ATOM   2269 C  CA    . GLY A 1 304 ? -4.847  -13.087 2.017   1.00 31.19 ? 296 GLY A CA    1 
ATOM   2270 C  C     . GLY A 1 304 ? -6.250  -12.702 1.586   1.00 30.81 ? 296 GLY A C     1 
ATOM   2271 O  O     . GLY A 1 304 ? -6.656  -12.976 0.457   1.00 30.68 ? 296 GLY A O     1 
ATOM   2272 N  N     . MET A 1 305 ? -6.993  -12.067 2.487   1.00 30.29 ? 297 MET A N     1 
ATOM   2273 C  CA    . MET A 1 305 ? -8.334  -11.586 2.167   1.00 29.94 ? 297 MET A CA    1 
ATOM   2274 C  C     . MET A 1 305 ? -8.284  -10.356 1.260   1.00 29.54 ? 297 MET A C     1 
ATOM   2275 O  O     . MET A 1 305 ? -7.409  -9.503  1.403   1.00 29.50 ? 297 MET A O     1 
ATOM   2276 C  CB    . MET A 1 305 ? -9.116  -11.279 3.443   1.00 29.86 ? 297 MET A CB    1 
ATOM   2277 C  CG    . MET A 1 305 ? -9.607  -12.515 4.168   1.00 29.69 ? 297 MET A CG    1 
ATOM   2278 S  SD    . MET A 1 305 ? -10.369 -12.136 5.752   1.00 29.93 ? 297 MET A SD    1 
ATOM   2279 C  CE    . MET A 1 305 ? -8.934  -11.981 6.795   1.00 29.89 ? 297 MET A CE    1 
ATOM   2280 N  N     . LYS A 1 306 ? -9.223  -10.279 0.324   1.00 29.05 ? 298 LYS A N     1 
ATOM   2281 C  CA    . LYS A 1 306 ? -9.272  -9.167  -0.616  1.00 28.68 ? 298 LYS A CA    1 
ATOM   2282 C  C     . LYS A 1 306 ? -10.181 -8.047  -0.118  1.00 28.32 ? 298 LYS A C     1 
ATOM   2283 O  O     . LYS A 1 306 ? -11.080 -8.275  0.689   1.00 28.03 ? 298 LYS A O     1 
ATOM   2284 C  CB    . LYS A 1 306 ? -9.717  -9.648  -2.000  1.00 28.79 ? 298 LYS A CB    1 
ATOM   2285 C  CG    . LYS A 1 306 ? -8.696  -10.528 -2.706  1.00 28.69 ? 298 LYS A CG    1 
ATOM   2286 C  CD    . LYS A 1 306 ? -9.014  -10.661 -4.183  1.00 30.01 ? 298 LYS A CD    1 
ATOM   2287 C  CE    . LYS A 1 306 ? -8.428  -11.943 -4.764  1.00 30.96 ? 298 LYS A CE    1 
ATOM   2288 N  NZ    . LYS A 1 306 ? -6.959  -11.850 -4.980  1.00 31.52 ? 298 LYS A NZ    1 
ATOM   2289 N  N     . LEU A 1 307 ? -9.931  -6.833  -0.598  1.00 28.02 ? 299 LEU A N     1 
ATOM   2290 C  CA    . LEU A 1 307 ? -10.703 -5.670  -0.185  1.00 27.65 ? 299 LEU A CA    1 
ATOM   2291 C  C     . LEU A 1 307 ? -11.432 -5.051  -1.365  1.00 27.49 ? 299 LEU A C     1 
ATOM   2292 O  O     . LEU A 1 307 ? -10.884 -4.948  -2.462  1.00 27.34 ? 299 LEU A O     1 
ATOM   2293 C  CB    . LEU A 1 307 ? -9.793  -4.631  0.471   1.00 27.63 ? 299 LEU A CB    1 
ATOM   2294 C  CG    . LEU A 1 307 ? -10.465 -3.347  0.966   1.00 27.82 ? 299 LEU A CG    1 
ATOM   2295 C  CD1   . LEU A 1 307 ? -11.245 -3.606  2.249   1.00 27.67 ? 299 LEU A CD1   1 
ATOM   2296 C  CD2   . LEU A 1 307 ? -9.438  -2.244  1.169   1.00 27.76 ? 299 LEU A CD2   1 
ATOM   2297 N  N     . ALA A 1 308 ? -12.677 -4.652  -1.136  1.00 27.44 ? 300 ALA A N     1 
ATOM   2298 C  CA    . ALA A 1 308 ? -13.433 -3.892  -2.118  1.00 27.42 ? 300 ALA A CA    1 
ATOM   2299 C  C     . ALA A 1 308 ? -13.937 -2.597  -1.513  1.00 27.50 ? 300 ALA A C     1 
ATOM   2300 O  O     . ALA A 1 308 ? -14.274 -2.547  -0.332  1.00 27.38 ? 300 ALA A O     1 
ATOM   2301 C  CB    . ALA A 1 308 ? -14.588 -4.708  -2.642  1.00 27.31 ? 300 ALA A CB    1 
ATOM   2302 N  N     . ILE A 1 309 ? -13.968 -1.543  -2.320  1.00 27.78 ? 301 ILE A N     1 
ATOM   2303 C  CA    . ILE A 1 309 ? -14.632 -0.310  -1.928  1.00 28.14 ? 301 ILE A CA    1 
ATOM   2304 C  C     . ILE A 1 309 ? -16.060 -0.337  -2.431  1.00 28.51 ? 301 ILE A C     1 
ATOM   2305 O  O     . ILE A 1 309 ? -16.307 -0.265  -3.636  1.00 28.74 ? 301 ILE A O     1 
ATOM   2306 C  CB    . ILE A 1 309 ? -13.911 0.944   -2.483  1.00 28.12 ? 301 ILE A CB    1 
ATOM   2307 C  CG1   . ILE A 1 309 ? -12.456 0.996   -1.998  1.00 27.95 ? 301 ILE A CG1   1 
ATOM   2308 C  CG2   . ILE A 1 309 ? -14.664 2.218   -2.088  1.00 27.95 ? 301 ILE A CG2   1 
ATOM   2309 C  CD1   . ILE A 1 309 ? -12.293 0.905   -0.481  1.00 28.33 ? 301 ILE A CD1   1 
ATOM   2310 N  N     . ASP A 1 310 ? -16.998 -0.470  -1.508  1.00 29.00 ? 302 ASP A N     1 
ATOM   2311 C  CA    . ASP A 1 310 ? -18.400 -0.552  -1.862  1.00 29.88 ? 302 ASP A CA    1 
ATOM   2312 C  C     . ASP A 1 310 ? -18.978 0.834   -2.107  1.00 30.60 ? 302 ASP A C     1 
ATOM   2313 O  O     . ASP A 1 310 ? -18.566 1.806   -1.477  1.00 30.59 ? 302 ASP A O     1 
ATOM   2314 C  CB    . ASP A 1 310 ? -19.183 -1.264  -0.764  1.00 29.52 ? 302 ASP A CB    1 
ATOM   2315 C  CG    . ASP A 1 310 ? -20.515 -1.792  -1.248  1.00 29.57 ? 302 ASP A CG    1 
ATOM   2316 O  OD1   . ASP A 1 310 ? -20.787 -1.726  -2.472  1.00 28.74 ? 302 ASP A OD1   1 
ATOM   2317 O  OD2   . ASP A 1 310 ? -21.290 -2.285  -0.404  1.00 29.27 ? 302 ASP A OD2   1 
ATOM   2318 N  N     . ASP A 1 311 ? -19.926 0.912   -3.038  1.00 31.76 ? 303 ASP A N     1 
ATOM   2319 C  CA    . ASP A 1 311 ? -20.649 2.156   -3.336  1.00 33.12 ? 303 ASP A CA    1 
ATOM   2320 C  C     . ASP A 1 311 ? -19.721 3.319   -3.710  1.00 33.84 ? 303 ASP A C     1 
ATOM   2321 O  O     . ASP A 1 311 ? -19.896 4.446   -3.246  1.00 33.77 ? 303 ASP A O     1 
ATOM   2322 C  CB    . ASP A 1 311 ? -21.583 2.537   -2.177  1.00 33.10 ? 303 ASP A CB    1 
ATOM   2323 C  CG    . ASP A 1 311 ? -22.684 1.505   -1.949  1.00 33.70 ? 303 ASP A CG    1 
ATOM   2324 O  OD1   . ASP A 1 311 ? -22.924 0.665   -2.850  1.00 33.00 ? 303 ASP A OD1   1 
ATOM   2325 O  OD2   . ASP A 1 311 ? -23.307 1.534   -0.866  1.00 34.65 ? 303 ASP A OD2   1 
ATOM   2326 N  N     . PHE A 1 312 ? -18.741 3.023   -4.557  1.00 35.03 ? 304 PHE A N     1 
ATOM   2327 C  CA    . PHE A 1 312 ? -17.820 4.026   -5.080  1.00 36.22 ? 304 PHE A CA    1 
ATOM   2328 C  C     . PHE A 1 312 ? -18.542 4.994   -6.023  1.00 37.25 ? 304 PHE A C     1 
ATOM   2329 O  O     . PHE A 1 312 ? -19.324 4.575   -6.880  1.00 37.07 ? 304 PHE A O     1 
ATOM   2330 C  CB    . PHE A 1 312 ? -16.671 3.332   -5.814  1.00 36.11 ? 304 PHE A CB    1 
ATOM   2331 C  CG    . PHE A 1 312 ? -15.587 4.262   -6.280  1.00 36.18 ? 304 PHE A CG    1 
ATOM   2332 C  CD1   . PHE A 1 312 ? -14.586 4.677   -5.408  1.00 35.93 ? 304 PHE A CD1   1 
ATOM   2333 C  CD2   . PHE A 1 312 ? -15.543 4.694   -7.604  1.00 35.98 ? 304 PHE A CD2   1 
ATOM   2334 C  CE1   . PHE A 1 312 ? -13.575 5.526   -5.840  1.00 36.04 ? 304 PHE A CE1   1 
ATOM   2335 C  CE2   . PHE A 1 312 ? -14.532 5.543   -8.043  1.00 35.89 ? 304 PHE A CE2   1 
ATOM   2336 C  CZ    . PHE A 1 312 ? -13.548 5.958   -7.161  1.00 35.84 ? 304 PHE A CZ    1 
ATOM   2337 N  N     . GLY A 1 313 ? -18.274 6.287   -5.856  1.00 38.62 ? 305 GLY A N     1 
ATOM   2338 C  CA    . GLY A 1 313 ? -18.918 7.319   -6.665  1.00 40.49 ? 305 GLY A CA    1 
ATOM   2339 C  C     . GLY A 1 313 ? -20.087 7.983   -5.955  1.00 41.92 ? 305 GLY A C     1 
ATOM   2340 O  O     . GLY A 1 313 ? -20.589 9.020   -6.397  1.00 41.99 ? 305 GLY A O     1 
ATOM   2341 N  N     . ALA A 1 314 ? -20.530 7.377   -4.857  1.00 43.26 ? 306 ALA A N     1 
ATOM   2342 C  CA    . ALA A 1 314 ? -21.578 7.962   -4.031  1.00 44.57 ? 306 ALA A CA    1 
ATOM   2343 C  C     . ALA A 1 314 ? -20.998 8.989   -3.060  1.00 45.51 ? 306 ALA A C     1 
ATOM   2344 O  O     . ALA A 1 314 ? -21.217 10.195  -3.212  1.00 45.71 ? 306 ALA A O     1 
ATOM   2345 C  CB    . ALA A 1 314 ? -22.330 6.875   -3.273  1.00 44.47 ? 306 ALA A CB    1 
ATOM   2346 N  N     . GLY A 1 315 ? -20.226 8.507   -2.086  1.00 46.58 ? 307 GLY A N     1 
ATOM   2347 C  CA    . GLY A 1 315 ? -19.763 9.337   -0.971  1.00 47.85 ? 307 GLY A CA    1 
ATOM   2348 C  C     . GLY A 1 315 ? -18.639 10.302  -1.313  1.00 48.70 ? 307 GLY A C     1 
ATOM   2349 O  O     . GLY A 1 315 ? -17.659 10.415  -0.566  1.00 48.80 ? 307 GLY A O     1 
ATOM   2350 N  N     . TYR A 1 316 ? -18.773 10.977  -2.457  1.00 49.47 ? 308 TYR A N     1 
ATOM   2351 C  CA    . TYR A 1 316 ? -18.016 12.207  -2.764  1.00 50.38 ? 308 TYR A CA    1 
ATOM   2352 C  C     . TYR A 1 316 ? -16.489 12.019  -2.881  1.00 50.55 ? 308 TYR A C     1 
ATOM   2353 O  O     . TYR A 1 316 ? -15.863 12.540  -3.814  1.00 50.66 ? 308 TYR A O     1 
ATOM   2354 C  CB    . TYR A 1 316 ? -18.364 13.333  -1.766  1.00 50.90 ? 308 TYR A CB    1 
ATOM   2355 C  CG    . TYR A 1 316 ? -19.846 13.408  -1.404  1.00 51.73 ? 308 TYR A CG    1 
ATOM   2356 C  CD1   . TYR A 1 316 ? -20.819 13.615  -2.388  1.00 52.29 ? 308 TYR A CD1   1 
ATOM   2357 C  CD2   . TYR A 1 316 ? -20.268 13.272  -0.078  1.00 52.32 ? 308 TYR A CD2   1 
ATOM   2358 C  CE1   . TYR A 1 316 ? -22.175 13.678  -2.060  1.00 52.49 ? 308 TYR A CE1   1 
ATOM   2359 C  CE2   . TYR A 1 316 ? -21.623 13.335  0.259   1.00 52.43 ? 308 TYR A CE2   1 
ATOM   2360 C  CZ    . TYR A 1 316 ? -22.568 13.537  -0.737  1.00 52.20 ? 308 TYR A CZ    1 
ATOM   2361 O  OH    . TYR A 1 316 ? -23.905 13.600  -0.412  1.00 52.10 ? 308 TYR A OH    1 
ATOM   2362 N  N     . SER A 1 317 ? -15.900 11.286  -1.936  1.00 50.62 ? 309 SER A N     1 
ATOM   2363 C  CA    . SER A 1 317 ? -14.461 11.033  -1.942  1.00 50.67 ? 309 SER A CA    1 
ATOM   2364 C  C     . SER A 1 317 ? -14.078 9.924   -2.920  1.00 50.56 ? 309 SER A C     1 
ATOM   2365 O  O     . SER A 1 317 ? -13.895 8.771   -2.523  1.00 50.64 ? 309 SER A O     1 
ATOM   2366 C  CB    . SER A 1 317 ? -13.974 10.683  -0.542  1.00 50.77 ? 309 SER A CB    1 
ATOM   2367 O  OG    . SER A 1 317 ? -12.572 10.465  -0.538  1.00 51.12 ? 309 SER A OG    1 
ATOM   2368 N  N     . GLY A 1 318 ? -13.911 10.292  -4.188  1.00 50.29 ? 310 GLY A N     1 
ATOM   2369 C  CA    . GLY A 1 318 ? -13.753 9.318   -5.262  1.00 49.85 ? 310 GLY A CA    1 
ATOM   2370 C  C     . GLY A 1 318 ? -12.322 8.899   -5.571  1.00 49.52 ? 310 GLY A C     1 
ATOM   2371 O  O     . GLY A 1 318 ? -11.673 8.224   -4.772  1.00 49.53 ? 310 GLY A O     1 
ATOM   2372 N  N     . LEU A 1 319 ? -11.833 9.321   -6.735  1.00 49.13 ? 311 LEU A N     1 
ATOM   2373 C  CA    . LEU A 1 319 ? -10.728 8.641   -7.414  1.00 48.72 ? 311 LEU A CA    1 
ATOM   2374 C  C     . LEU A 1 319 ? -9.330  8.972   -6.849  1.00 48.44 ? 311 LEU A C     1 
ATOM   2375 O  O     . LEU A 1 319 ? -8.349  8.294   -7.164  1.00 48.24 ? 311 LEU A O     1 
ATOM   2376 C  CB    . LEU A 1 319 ? -10.792 8.921   -8.921  1.00 48.82 ? 311 LEU A CB    1 
ATOM   2377 C  CG    . LEU A 1 319 ? -10.251 7.840   -9.856  1.00 48.81 ? 311 LEU A CG    1 
ATOM   2378 C  CD1   . LEU A 1 319 ? -11.298 7.418   -10.871 1.00 48.63 ? 311 LEU A CD1   1 
ATOM   2379 C  CD2   . LEU A 1 319 ? -9.000  8.328   -10.544 1.00 49.11 ? 311 LEU A CD2   1 
ATOM   2380 N  N     . SER A 1 320 ? -9.253  9.994   -6.001  1.00 48.05 ? 312 SER A N     1 
ATOM   2381 C  CA    . SER A 1 320 ? -7.990  10.364  -5.357  1.00 47.58 ? 312 SER A CA    1 
ATOM   2382 C  C     . SER A 1 320 ? -7.643  9.431   -4.189  1.00 47.11 ? 312 SER A C     1 
ATOM   2383 O  O     . SER A 1 320 ? -6.508  9.426   -3.702  1.00 46.96 ? 312 SER A O     1 
ATOM   2384 C  CB    . SER A 1 320 ? -8.042  11.809  -4.873  1.00 47.62 ? 312 SER A CB    1 
ATOM   2385 O  OG    . SER A 1 320 ? -8.971  11.957  -3.813  1.00 48.33 ? 312 SER A OG    1 
ATOM   2386 N  N     . LEU A 1 321 ? -8.628  8.646   -3.751  1.00 46.55 ? 313 LEU A N     1 
ATOM   2387 C  CA    . LEU A 1 321 ? -8.449  7.673   -2.663  1.00 46.02 ? 313 LEU A CA    1 
ATOM   2388 C  C     . LEU A 1 321 ? -7.383  6.623   -3.001  1.00 45.47 ? 313 LEU A C     1 
ATOM   2389 O  O     . LEU A 1 321 ? -6.741  6.061   -2.106  1.00 45.37 ? 313 LEU A O     1 
ATOM   2390 C  CB    . LEU A 1 321 ? -9.786  6.984   -2.350  1.00 46.14 ? 313 LEU A CB    1 
ATOM   2391 C  CG    . LEU A 1 321 ? -9.850  5.950   -1.219  1.00 46.38 ? 313 LEU A CG    1 
ATOM   2392 C  CD1   . LEU A 1 321 ? -10.018 6.626   0.137   1.00 46.71 ? 313 LEU A CD1   1 
ATOM   2393 C  CD2   . LEU A 1 321 ? -10.981 4.971   -1.468  1.00 46.84 ? 313 LEU A CD2   1 
ATOM   2394 N  N     . LEU A 1 322 ? -7.188  6.382   -4.296  1.00 44.75 ? 314 LEU A N     1 
ATOM   2395 C  CA    . LEU A 1 322 ? -6.249  5.369   -4.771  1.00 44.11 ? 314 LEU A CA    1 
ATOM   2396 C  C     . LEU A 1 322 ? -4.790  5.752   -4.504  1.00 43.57 ? 314 LEU A C     1 
ATOM   2397 O  O     . LEU A 1 322 ? -3.898  4.912   -4.579  1.00 43.52 ? 314 LEU A O     1 
ATOM   2398 C  CB    . LEU A 1 322 ? -6.469  5.096   -6.261  1.00 44.20 ? 314 LEU A CB    1 
ATOM   2399 C  CG    . LEU A 1 322 ? -7.913  4.791   -6.682  1.00 44.41 ? 314 LEU A CG    1 
ATOM   2400 C  CD1   . LEU A 1 322 ? -8.114  5.004   -8.182  1.00 44.53 ? 314 LEU A CD1   1 
ATOM   2401 C  CD2   . LEU A 1 322 ? -8.316  3.384   -6.274  1.00 44.69 ? 314 LEU A CD2   1 
ATOM   2402 N  N     . THR A 1 323 ? -4.563  7.023   -4.189  1.00 43.01 ? 315 THR A N     1 
ATOM   2403 C  CA    . THR A 1 323 ? -3.248  7.497   -3.768  1.00 42.56 ? 315 THR A CA    1 
ATOM   2404 C  C     . THR A 1 323 ? -2.881  6.915   -2.402  1.00 41.97 ? 315 THR A C     1 
ATOM   2405 O  O     . THR A 1 323 ? -1.712  6.620   -2.133  1.00 42.12 ? 315 THR A O     1 
ATOM   2406 C  CB    . THR A 1 323 ? -3.210  9.046   -3.694  1.00 42.68 ? 315 THR A CB    1 
ATOM   2407 O  OG1   . THR A 1 323 ? -3.643  9.593   -4.944  1.00 43.14 ? 315 THR A OG1   1 
ATOM   2408 C  CG2   . THR A 1 323 ? -1.807  9.546   -3.390  1.00 42.97 ? 315 THR A CG2   1 
ATOM   2409 N  N     . ARG A 1 324 ? -3.889  6.734   -1.551  1.00 41.05 ? 316 ARG A N     1 
ATOM   2410 C  CA    . ARG A 1 324 ? -3.672  6.261   -0.186  1.00 40.14 ? 316 ARG A CA    1 
ATOM   2411 C  C     . ARG A 1 324 ? -3.499  4.743   -0.152  1.00 39.27 ? 316 ARG A C     1 
ATOM   2412 O  O     . ARG A 1 324 ? -2.613  4.224   0.532   1.00 39.42 ? 316 ARG A O     1 
ATOM   2413 C  CB    . ARG A 1 324 ? -4.839  6.680   0.717   1.00 40.28 ? 316 ARG A CB    1 
ATOM   2414 C  CG    . ARG A 1 324 ? -5.466  8.033   0.358   1.00 40.86 ? 316 ARG A CG    1 
ATOM   2415 C  CD    . ARG A 1 324 ? -4.604  9.206   0.814   1.00 41.43 ? 316 ARG A CD    1 
ATOM   2416 N  NE    . ARG A 1 324 ? -5.224  10.490  0.488   1.00 42.59 ? 316 ARG A NE    1 
ATOM   2417 C  CZ    . ARG A 1 324 ? -4.595  11.504  -0.103  1.00 43.15 ? 316 ARG A CZ    1 
ATOM   2418 N  NH1   . ARG A 1 324 ? -3.308  11.402  -0.422  1.00 43.19 ? 316 ARG A NH1   1 
ATOM   2419 N  NH2   . ARG A 1 324 ? -5.250  12.631  -0.360  1.00 43.00 ? 316 ARG A NH2   1 
ATOM   2420 N  N     . PHE A 1 325 ? -4.349  4.043   -0.898  1.00 37.93 ? 317 PHE A N     1 
ATOM   2421 C  CA    . PHE A 1 325 ? -4.316  2.580   -0.975  1.00 36.44 ? 317 PHE A CA    1 
ATOM   2422 C  C     . PHE A 1 325 ? -5.120  2.118   -2.181  1.00 35.31 ? 317 PHE A C     1 
ATOM   2423 O  O     . PHE A 1 325 ? -5.978  2.847   -2.674  1.00 35.25 ? 317 PHE A O     1 
ATOM   2424 C  CB    . PHE A 1 325 ? -4.889  1.956   0.307   1.00 36.50 ? 317 PHE A CB    1 
ATOM   2425 C  CG    . PHE A 1 325 ? -6.379  2.125   0.456   1.00 36.22 ? 317 PHE A CG    1 
ATOM   2426 C  CD1   . PHE A 1 325 ? -6.913  3.309   0.951   1.00 36.09 ? 317 PHE A CD1   1 
ATOM   2427 C  CD2   . PHE A 1 325 ? -7.250  1.092   0.112   1.00 36.23 ? 317 PHE A CD2   1 
ATOM   2428 C  CE1   . PHE A 1 325 ? -8.286  3.464   1.092   1.00 36.33 ? 317 PHE A CE1   1 
ATOM   2429 C  CE2   . PHE A 1 325 ? -8.623  1.243   0.247   1.00 35.96 ? 317 PHE A CE2   1 
ATOM   2430 C  CZ    . PHE A 1 325 ? -9.141  2.428   0.738   1.00 36.16 ? 317 PHE A CZ    1 
ATOM   2431 N  N     . GLN A 1 326 ? -4.857  0.903   -2.645  1.00 33.90 ? 318 GLN A N     1 
ATOM   2432 C  CA    . GLN A 1 326 ? -5.621  0.341   -3.755  1.00 32.65 ? 318 GLN A CA    1 
ATOM   2433 C  C     . GLN A 1 326 ? -6.367  -0.902  -3.325  1.00 31.49 ? 318 GLN A C     1 
ATOM   2434 O  O     . GLN A 1 326 ? -5.762  -1.851  -2.843  1.00 31.39 ? 318 GLN A O     1 
ATOM   2435 C  CB    . GLN A 1 326 ? -4.713  0.018   -4.945  1.00 32.75 ? 318 GLN A CB    1 
ATOM   2436 C  CG    . GLN A 1 326 ? -3.948  1.207   -5.491  1.00 33.06 ? 318 GLN A CG    1 
ATOM   2437 C  CD    . GLN A 1 326 ? -2.654  1.449   -4.746  1.00 33.64 ? 318 GLN A CD    1 
ATOM   2438 O  OE1   . GLN A 1 326 ? -1.802  0.565   -4.656  1.00 34.02 ? 318 GLN A OE1   1 
ATOM   2439 N  NE2   . GLN A 1 326 ? -2.500  2.650   -4.201  1.00 33.64 ? 318 GLN A NE2   1 
ATOM   2440 N  N     . PRO A 1 327 ? -7.696  -0.903  -3.508  1.00 30.47 ? 319 PRO A N     1 
ATOM   2441 C  CA    . PRO A 1 327 ? -8.501  -2.089  -3.266  1.00 29.54 ? 319 PRO A CA    1 
ATOM   2442 C  C     . PRO A 1 327 ? -8.299  -3.123  -4.365  1.00 28.76 ? 319 PRO A C     1 
ATOM   2443 O  O     . PRO A 1 327 ? -7.668  -2.835  -5.384  1.00 28.57 ? 319 PRO A O     1 
ATOM   2444 C  CB    . PRO A 1 327 ? -9.930  -1.549  -3.318  1.00 29.48 ? 319 PRO A CB    1 
ATOM   2445 C  CG    . PRO A 1 327 ? -9.852  -0.395  -4.228  1.00 29.81 ? 319 PRO A CG    1 
ATOM   2446 C  CD    . PRO A 1 327 ? -8.514  0.233   -3.969  1.00 30.34 ? 319 PRO A CD    1 
ATOM   2447 N  N     . ASP A 1 328 ? -8.821  -4.320  -4.152  1.00 27.96 ? 320 ASP A N     1 
ATOM   2448 C  CA    . ASP A 1 328 ? -8.847  -5.321  -5.194  1.00 27.33 ? 320 ASP A CA    1 
ATOM   2449 C  C     . ASP A 1 328 ? -10.025 -5.063  -6.122  1.00 26.58 ? 320 ASP A C     1 
ATOM   2450 O  O     . ASP A 1 328 ? -9.923  -5.246  -7.333  1.00 26.60 ? 320 ASP A O     1 
ATOM   2451 C  CB    . ASP A 1 328 ? -8.930  -6.724  -4.589  1.00 27.36 ? 320 ASP A CB    1 
ATOM   2452 C  CG    . ASP A 1 328 ? -7.615  -7.174  -3.985  1.00 27.70 ? 320 ASP A CG    1 
ATOM   2453 O  OD1   . ASP A 1 328 ? -6.715  -7.569  -4.752  1.00 28.14 ? 320 ASP A OD1   1 
ATOM   2454 O  OD2   . ASP A 1 328 ? -7.479  -7.137  -2.742  1.00 28.76 ? 320 ASP A OD2   1 
ATOM   2455 N  N     . LYS A 1 329 ? -11.126 -4.592  -5.547  1.00 25.74 ? 321 LYS A N     1 
ATOM   2456 C  CA    . LYS A 1 329 ? -12.355 -4.376  -6.296  1.00 25.08 ? 321 LYS A CA    1 
ATOM   2457 C  C     . LYS A 1 329 ? -12.955 -2.994  -6.012  1.00 24.67 ? 321 LYS A C     1 
ATOM   2458 O  O     . LYS A 1 329 ? -12.866 -2.480  -4.894  1.00 24.59 ? 321 LYS A O     1 
ATOM   2459 C  CB    . LYS A 1 329 ? -13.367 -5.473  -5.964  1.00 25.02 ? 321 LYS A CB    1 
ATOM   2460 C  CG    . LYS A 1 329 ? -14.558 -5.551  -6.902  1.00 24.97 ? 321 LYS A CG    1 
ATOM   2461 C  CD    . LYS A 1 329 ? -15.399 -6.798  -6.637  1.00 25.24 ? 321 LYS A CD    1 
ATOM   2462 C  CE    . LYS A 1 329 ? -14.702 -8.060  -7.136  1.00 26.25 ? 321 LYS A CE    1 
ATOM   2463 N  NZ    . LYS A 1 329 ? -15.654 -9.204  -7.309  1.00 27.68 ? 321 LYS A NZ    1 
ATOM   2464 N  N     . ILE A 1 330 ? -13.544 -2.391  -7.037  1.00 24.03 ? 322 ILE A N     1 
ATOM   2465 C  CA    . ILE A 1 330 ? -14.329 -1.179  -6.864  1.00 23.64 ? 322 ILE A CA    1 
ATOM   2466 C  C     . ILE A 1 330 ? -15.745 -1.393  -7.396  1.00 23.51 ? 322 ILE A C     1 
ATOM   2467 O  O     . ILE A 1 330 ? -15.930 -1.821  -8.534  1.00 23.64 ? 322 ILE A O     1 
ATOM   2468 C  CB    . ILE A 1 330 ? -13.659 0.035   -7.555  1.00 23.55 ? 322 ILE A CB    1 
ATOM   2469 C  CG1   . ILE A 1 330 ? -12.603 0.645   -6.630  1.00 23.46 ? 322 ILE A CG1   1 
ATOM   2470 C  CG2   . ILE A 1 330 ? -14.693 1.083   -7.945  1.00 23.46 ? 322 ILE A CG2   1 
ATOM   2471 C  CD1   . ILE A 1 330 ? -11.877 1.837   -7.216  1.00 23.57 ? 322 ILE A CD1   1 
ATOM   2472 N  N     . LYS A 1 331 ? -16.738 -1.142  -6.549  1.00 23.27 ? 323 LYS A N     1 
ATOM   2473 C  CA    . LYS A 1 331 ? -18.135 -1.308  -6.945  1.00 23.19 ? 323 LYS A CA    1 
ATOM   2474 C  C     . LYS A 1 331 ? -18.785 0.033   -7.225  1.00 23.10 ? 323 LYS A C     1 
ATOM   2475 O  O     . LYS A 1 331 ? -19.052 0.812   -6.307  1.00 23.03 ? 323 LYS A O     1 
ATOM   2476 C  CB    . LYS A 1 331 ? -18.924 -2.069  -5.875  1.00 23.18 ? 323 LYS A CB    1 
ATOM   2477 C  CG    . LYS A 1 331 ? -18.315 -3.415  -5.497  1.00 22.94 ? 323 LYS A CG    1 
ATOM   2478 C  CD    . LYS A 1 331 ? -19.138 -4.117  -4.438  1.00 22.18 ? 323 LYS A CD    1 
ATOM   2479 C  CE    . LYS A 1 331 ? -20.165 -5.031  -5.059  1.00 21.60 ? 323 LYS A CE    1 
ATOM   2480 N  NZ    . LYS A 1 331 ? -21.200 -5.441  -4.075  1.00 20.88 ? 323 LYS A NZ    1 
ATOM   2481 N  N     . VAL A 1 332 ? -19.022 0.301   -8.504  1.00 23.15 ? 324 VAL A N     1 
ATOM   2482 C  CA    . VAL A 1 332 ? -19.665 1.533   -8.939  1.00 23.35 ? 324 VAL A CA    1 
ATOM   2483 C  C     . VAL A 1 332 ? -21.081 1.645   -8.352  1.00 23.66 ? 324 VAL A C     1 
ATOM   2484 O  O     . VAL A 1 332 ? -21.884 0.717   -8.466  1.00 23.22 ? 324 VAL A O     1 
ATOM   2485 C  CB    . VAL A 1 332 ? -19.717 1.614   -10.485 1.00 23.23 ? 324 VAL A CB    1 
ATOM   2486 C  CG1   . VAL A 1 332 ? -20.533 2.805   -10.936 1.00 23.22 ? 324 VAL A CG1   1 
ATOM   2487 C  CG2   . VAL A 1 332 ? -18.311 1.680   -11.058 1.00 22.98 ? 324 VAL A CG2   1 
ATOM   2488 N  N     . ASP A 1 333 ? -21.357 2.776   -7.701  1.00 24.13 ? 325 ASP A N     1 
ATOM   2489 C  CA    . ASP A 1 333 ? -22.635 3.001   -7.023  1.00 24.74 ? 325 ASP A CA    1 
ATOM   2490 C  C     . ASP A 1 333 ? -23.798 3.039   -8.008  1.00 24.94 ? 325 ASP A C     1 
ATOM   2491 O  O     . ASP A 1 333 ? -23.635 3.448   -9.159  1.00 24.84 ? 325 ASP A O     1 
ATOM   2492 C  CB    . ASP A 1 333 ? -22.589 4.304   -6.222  1.00 24.91 ? 325 ASP A CB    1 
ATOM   2493 C  CG    . ASP A 1 333 ? -23.818 4.500   -5.354  1.00 25.96 ? 325 ASP A CG    1 
ATOM   2494 O  OD1   . ASP A 1 333 ? -23.883 3.894   -4.255  1.00 27.25 ? 325 ASP A OD1   1 
ATOM   2495 O  OD2   . ASP A 1 333 ? -24.714 5.271   -5.763  1.00 26.64 ? 325 ASP A OD2   1 
ATOM   2496 N  N     . ALA A 1 334 ? -24.974 2.626   -7.537  1.00 25.31 ? 326 ALA A N     1 
ATOM   2497 C  CA    . ALA A 1 334 ? -26.172 2.528   -8.373  1.00 25.61 ? 326 ALA A CA    1 
ATOM   2498 C  C     . ALA A 1 334 ? -26.596 3.865   -8.996  1.00 25.90 ? 326 ALA A C     1 
ATOM   2499 O  O     . ALA A 1 334 ? -27.215 3.886   -10.065 1.00 25.96 ? 326 ALA A O     1 
ATOM   2500 C  CB    . ALA A 1 334 ? -27.316 1.924   -7.582  1.00 25.46 ? 326 ALA A CB    1 
ATOM   2501 N  N     . GLU A 1 335 ? -26.255 4.972   -8.334  1.00 26.40 ? 327 GLU A N     1 
ATOM   2502 C  CA    . GLU A 1 335 ? -26.609 6.311   -8.830  1.00 26.52 ? 327 GLU A CA    1 
ATOM   2503 C  C     . GLU A 1 335 ? -25.909 6.634   -10.149 1.00 26.41 ? 327 GLU A C     1 
ATOM   2504 O  O     . GLU A 1 335 ? -26.478 7.298   -11.014 1.00 26.55 ? 327 GLU A O     1 
ATOM   2505 C  CB    . GLU A 1 335 ? -26.323 7.393   -7.765  1.00 26.65 ? 327 GLU A CB    1 
ATOM   2506 C  CG    . GLU A 1 335 ? -26.424 8.875   -8.261  1.00 27.62 ? 327 GLU A CG    1 
ATOM   2507 C  CD    . GLU A 1 335 ? -27.757 9.213   -8.982  1.00 30.14 ? 327 GLU A CD    1 
ATOM   2508 O  OE1   . GLU A 1 335 ? -28.756 8.472   -8.814  1.00 31.45 ? 327 GLU A OE1   1 
ATOM   2509 O  OE2   . GLU A 1 335 ? -27.793 10.229  -9.719  1.00 30.42 ? 327 GLU A OE2   1 
ATOM   2510 N  N     . LEU A 1 336 ? -24.692 6.128   -10.312 1.00 26.31 ? 328 LEU A N     1 
ATOM   2511 C  CA    . LEU A 1 336 ? -23.963 6.276   -11.567 1.00 26.11 ? 328 LEU A CA    1 
ATOM   2512 C  C     . LEU A 1 336 ? -24.506 5.344   -12.653 1.00 26.16 ? 328 LEU A C     1 
ATOM   2513 O  O     . LEU A 1 336 ? -24.249 5.546   -13.842 1.00 26.21 ? 328 LEU A O     1 
ATOM   2514 C  CB    . LEU A 1 336 ? -22.471 6.029   -11.353 1.00 26.11 ? 328 LEU A CB    1 
ATOM   2515 C  CG    . LEU A 1 336 ? -21.713 7.065   -10.520 1.00 26.06 ? 328 LEU A CG    1 
ATOM   2516 C  CD1   . LEU A 1 336 ? -20.410 6.487   -10.016 1.00 26.13 ? 328 LEU A CD1   1 
ATOM   2517 C  CD2   . LEU A 1 336 ? -21.460 8.328   -11.328 1.00 26.23 ? 328 LEU A CD2   1 
ATOM   2518 N  N     . VAL A 1 337 ? -25.265 4.332   -12.241 1.00 25.98 ? 329 VAL A N     1 
ATOM   2519 C  CA    . VAL A 1 337 ? -25.828 3.370   -13.182 1.00 25.90 ? 329 VAL A CA    1 
ATOM   2520 C  C     . VAL A 1 337 ? -27.226 3.785   -13.647 1.00 25.85 ? 329 VAL A C     1 
ATOM   2521 O  O     . VAL A 1 337 ? -27.543 3.690   -14.835 1.00 25.76 ? 329 VAL A O     1 
ATOM   2522 C  CB    . VAL A 1 337 ? -25.852 1.940   -12.588 1.00 25.99 ? 329 VAL A CB    1 
ATOM   2523 C  CG1   . VAL A 1 337 ? -26.655 0.994   -13.475 1.00 25.72 ? 329 VAL A CG1   1 
ATOM   2524 C  CG2   . VAL A 1 337 ? -24.434 1.424   -12.409 1.00 25.78 ? 329 VAL A CG2   1 
ATOM   2525 N  N     . ARG A 1 338 ? -28.050 4.254   -12.708 1.00 25.92 ? 330 ARG A N     1 
ATOM   2526 C  CA    . ARG A 1 338 ? -29.382 4.776   -13.038 1.00 25.93 ? 330 ARG A CA    1 
ATOM   2527 C  C     . ARG A 1 338 ? -29.305 5.744   -14.191 1.00 25.72 ? 330 ARG A C     1 
ATOM   2528 O  O     . ARG A 1 338 ? -28.638 6.777   -14.092 1.00 25.75 ? 330 ARG A O     1 
ATOM   2529 C  CB    . ARG A 1 338 ? -30.000 5.496   -11.840 1.00 26.01 ? 330 ARG A CB    1 
ATOM   2530 C  CG    . ARG A 1 338 ? -30.571 4.595   -10.791 1.00 26.76 ? 330 ARG A CG    1 
ATOM   2531 C  CD    . ARG A 1 338 ? -31.695 3.706   -11.320 1.00 27.06 ? 330 ARG A CD    1 
ATOM   2532 N  NE    . ARG A 1 338 ? -31.842 2.540   -10.459 1.00 27.80 ? 330 ARG A NE    1 
ATOM   2533 C  CZ    . ARG A 1 338 ? -31.156 1.412   -10.608 1.00 27.72 ? 330 ARG A CZ    1 
ATOM   2534 N  NH1   . ARG A 1 338 ? -30.316 1.270   -11.626 1.00 27.23 ? 330 ARG A NH1   1 
ATOM   2535 N  NH2   . ARG A 1 338 ? -31.323 0.418   -9.751  1.00 27.99 ? 330 ARG A NH2   1 
ATOM   2536 N  N     . ASP A 1 339 ? -29.977 5.401   -15.290 1.00 25.56 ? 331 ASP A N     1 
ATOM   2537 C  CA    . ASP A 1 339 ? -30.121 6.301   -16.438 1.00 25.48 ? 331 ASP A CA    1 
ATOM   2538 C  C     . ASP A 1 339 ? -28.783 6.694   -17.044 1.00 24.85 ? 331 ASP A C     1 
ATOM   2539 O  O     . ASP A 1 339 ? -28.630 7.805   -17.545 1.00 25.03 ? 331 ASP A O     1 
ATOM   2540 C  CB    . ASP A 1 339 ? -30.910 7.566   -16.047 1.00 25.83 ? 331 ASP A CB    1 
ATOM   2541 C  CG    . ASP A 1 339 ? -32.339 7.264   -15.630 1.00 27.26 ? 331 ASP A CG    1 
ATOM   2542 O  OD1   . ASP A 1 339 ? -32.753 6.077   -15.686 1.00 27.94 ? 331 ASP A OD1   1 
ATOM   2543 O  OD2   . ASP A 1 339 ? -33.053 8.219   -15.246 1.00 29.49 ? 331 ASP A OD2   1 
ATOM   2544 N  N     . ILE A 1 340 ? -27.814 5.785   -16.988 1.00 24.33 ? 332 ILE A N     1 
ATOM   2545 C  CA    . ILE A 1 340 ? -26.513 6.014   -17.608 1.00 23.84 ? 332 ILE A CA    1 
ATOM   2546 C  C     . ILE A 1 340 ? -26.622 5.998   -19.139 1.00 23.80 ? 332 ILE A C     1 
ATOM   2547 O  O     . ILE A 1 340 ? -25.723 6.450   -19.838 1.00 23.83 ? 332 ILE A O     1 
ATOM   2548 C  CB    . ILE A 1 340 ? -25.456 4.981   -17.134 1.00 23.71 ? 332 ILE A CB    1 
ATOM   2549 C  CG1   . ILE A 1 340 ? -24.043 5.524   -17.358 1.00 23.75 ? 332 ILE A CG1   1 
ATOM   2550 C  CG2   . ILE A 1 340 ? -25.663 3.625   -17.818 1.00 23.26 ? 332 ILE A CG2   1 
ATOM   2551 C  CD1   . ILE A 1 340 ? -22.952 4.503   -17.177 1.00 23.99 ? 332 ILE A CD1   1 
ATOM   2552 N  N     . HIS A 1 341 ? -27.744 5.498   -19.644 1.00 23.66 ? 333 HIS A N     1 
ATOM   2553 C  CA    . HIS A 1 341 ? -27.990 5.466   -21.080 1.00 23.58 ? 333 HIS A CA    1 
ATOM   2554 C  C     . HIS A 1 341 ? -28.414 6.828   -21.647 1.00 23.20 ? 333 HIS A C     1 
ATOM   2555 O  O     . HIS A 1 341 ? -28.316 7.061   -22.851 1.00 23.06 ? 333 HIS A O     1 
ATOM   2556 C  CB    . HIS A 1 341 ? -29.013 4.370   -21.442 1.00 23.84 ? 333 HIS A CB    1 
ATOM   2557 C  CG    . HIS A 1 341 ? -30.324 4.486   -20.722 1.00 24.24 ? 333 HIS A CG    1 
ATOM   2558 N  ND1   . HIS A 1 341 ? -30.442 4.331   -19.356 1.00 25.02 ? 333 HIS A ND1   1 
ATOM   2559 C  CD2   . HIS A 1 341 ? -31.581 4.681   -21.187 1.00 24.96 ? 333 HIS A CD2   1 
ATOM   2560 C  CE1   . HIS A 1 341 ? -31.712 4.460   -19.008 1.00 25.42 ? 333 HIS A CE1   1 
ATOM   2561 N  NE2   . HIS A 1 341 ? -32.423 4.673   -20.101 1.00 25.71 ? 333 HIS A NE2   1 
ATOM   2562 N  N     . ILE A 1 342 ? -28.868 7.726   -20.774 1.00 22.91 ? 334 ILE A N     1 
ATOM   2563 C  CA    . ILE A 1 342 ? -29.311 9.058   -21.205 1.00 22.56 ? 334 ILE A CA    1 
ATOM   2564 C  C     . ILE A 1 342 ? -28.471 10.192  -20.607 1.00 22.38 ? 334 ILE A C     1 
ATOM   2565 O  O     . ILE A 1 342 ? -28.694 11.367  -20.915 1.00 22.53 ? 334 ILE A O     1 
ATOM   2566 C  CB    . ILE A 1 342 ? -30.820 9.301   -20.898 1.00 22.51 ? 334 ILE A CB    1 
ATOM   2567 C  CG1   . ILE A 1 342 ? -31.082 9.249   -19.391 1.00 22.56 ? 334 ILE A CG1   1 
ATOM   2568 C  CG2   . ILE A 1 342 ? -31.688 8.292   -21.639 1.00 22.06 ? 334 ILE A CG2   1 
ATOM   2569 C  CD1   . ILE A 1 342 ? -32.504 9.613   -18.996 1.00 22.77 ? 334 ILE A CD1   1 
ATOM   2570 N  N     . SER A 1 343 ? -27.501 9.837   -19.764 1.00 22.02 ? 335 SER A N     1 
ATOM   2571 C  CA    . SER A 1 343 ? -26.647 10.835  -19.108 1.00 21.61 ? 335 SER A CA    1 
ATOM   2572 C  C     . SER A 1 343 ? -25.201 10.744  -19.573 1.00 21.28 ? 335 SER A C     1 
ATOM   2573 O  O     . SER A 1 343 ? -24.520 9.744   -19.327 1.00 21.40 ? 335 SER A O     1 
ATOM   2574 C  CB    . SER A 1 343 ? -26.713 10.685  -17.584 1.00 21.65 ? 335 SER A CB    1 
ATOM   2575 O  OG    . SER A 1 343 ? -25.861 11.625  -16.946 1.00 21.55 ? 335 SER A OG    1 
ATOM   2576 N  N     . GLY A 1 344 ? -24.733 11.794  -20.234 1.00 20.82 ? 336 GLY A N     1 
ATOM   2577 C  CA    . GLY A 1 344 ? -23.344 11.860  -20.682 1.00 20.40 ? 336 GLY A CA    1 
ATOM   2578 C  C     . GLY A 1 344 ? -22.398 12.032  -19.518 1.00 20.15 ? 336 GLY A C     1 
ATOM   2579 O  O     . GLY A 1 344 ? -21.314 11.455  -19.499 1.00 19.89 ? 336 GLY A O     1 
ATOM   2580 N  N     . THR A 1 345 ? -22.817 12.847  -18.550 1.00 20.11 ? 337 THR A N     1 
ATOM   2581 C  CA    . THR A 1 345 ? -22.118 12.993  -17.277 1.00 20.29 ? 337 THR A CA    1 
ATOM   2582 C  C     . THR A 1 345 ? -21.763 11.632  -16.678 1.00 20.17 ? 337 THR A C     1 
ATOM   2583 O  O     . THR A 1 345 ? -20.596 11.345  -16.417 1.00 19.96 ? 337 THR A O     1 
ATOM   2584 C  CB    . THR A 1 345 ? -22.976 13.794  -16.259 1.00 20.25 ? 337 THR A CB    1 
ATOM   2585 O  OG1   . THR A 1 345 ? -23.166 15.128  -16.739 1.00 20.73 ? 337 THR A OG1   1 
ATOM   2586 C  CG2   . THR A 1 345 ? -22.299 13.851  -14.905 1.00 20.78 ? 337 THR A CG2   1 
ATOM   2587 N  N     . LYS A 1 346 ? -22.774 10.791  -16.494 1.00 20.34 ? 338 LYS A N     1 
ATOM   2588 C  CA    . LYS A 1 346 ? -22.592 9.498   -15.849 1.00 20.50 ? 338 LYS A CA    1 
ATOM   2589 C  C     . LYS A 1 346 ? -21.749 8.547   -16.698 1.00 20.59 ? 338 LYS A C     1 
ATOM   2590 O  O     . LYS A 1 346 ? -20.906 7.825   -16.171 1.00 20.80 ? 338 LYS A O     1 
ATOM   2591 C  CB    . LYS A 1 346 ? -23.943 8.873   -15.514 1.00 20.34 ? 338 LYS A CB    1 
ATOM   2592 C  CG    . LYS A 1 346 ? -24.737 9.661   -14.489 1.00 20.79 ? 338 LYS A CG    1 
ATOM   2593 C  CD    . LYS A 1 346 ? -26.059 8.989   -14.175 1.00 22.11 ? 338 LYS A CD    1 
ATOM   2594 C  CE    . LYS A 1 346 ? -26.927 9.873   -13.298 1.00 22.15 ? 338 LYS A CE    1 
ATOM   2595 N  NZ    . LYS A 1 346 ? -28.107 9.136   -12.779 1.00 22.38 ? 338 LYS A NZ    1 
ATOM   2596 N  N     . GLN A 1 347 ? -21.971 8.569   -18.012 1.00 20.61 ? 339 GLN A N     1 
ATOM   2597 C  CA    . GLN A 1 347 ? -21.169 7.789   -18.955 1.00 20.58 ? 339 GLN A CA    1 
ATOM   2598 C  C     . GLN A 1 347 ? -19.688 8.122   -18.838 1.00 20.57 ? 339 GLN A C     1 
ATOM   2599 O  O     . GLN A 1 347 ? -18.849 7.225   -18.720 1.00 20.33 ? 339 GLN A O     1 
ATOM   2600 C  CB    . GLN A 1 347 ? -21.631 8.049   -20.383 1.00 20.58 ? 339 GLN A CB    1 
ATOM   2601 C  CG    . GLN A 1 347 ? -22.829 7.253   -20.795 1.00 21.40 ? 339 GLN A CG    1 
ATOM   2602 C  CD    . GLN A 1 347 ? -23.462 7.773   -22.076 1.00 22.70 ? 339 GLN A CD    1 
ATOM   2603 O  OE1   . GLN A 1 347 ? -22.783 8.353   -22.932 1.00 22.97 ? 339 GLN A OE1   1 
ATOM   2604 N  NE2   . GLN A 1 347 ? -24.772 7.568   -22.215 1.00 22.16 ? 339 GLN A NE2   1 
ATOM   2605 N  N     . ALA A 1 348 ? -19.377 9.418   -18.870 1.00 20.55 ? 340 ALA A N     1 
ATOM   2606 C  CA    . ALA A 1 348 ? -17.996 9.892   -18.816 1.00 20.60 ? 340 ALA A CA    1 
ATOM   2607 C  C     . ALA A 1 348 ? -17.302 9.461   -17.533 1.00 20.78 ? 340 ALA A C     1 
ATOM   2608 O  O     . ALA A 1 348 ? -16.206 8.891   -17.574 1.00 20.81 ? 340 ALA A O     1 
ATOM   2609 C  CB    . ALA A 1 348 ? -17.948 11.397  -18.961 1.00 20.48 ? 340 ALA A CB    1 
ATOM   2610 N  N     . ILE A 1 349 ? -17.953 9.721   -16.397 1.00 20.98 ? 341 ILE A N     1 
ATOM   2611 C  CA    . ILE A 1 349 ? -17.414 9.352   -15.086 1.00 21.29 ? 341 ILE A CA    1 
ATOM   2612 C  C     . ILE A 1 349 ? -17.175 7.848   -14.976 1.00 21.51 ? 341 ILE A C     1 
ATOM   2613 O  O     . ILE A 1 349 ? -16.058 7.411   -14.676 1.00 21.68 ? 341 ILE A O     1 
ATOM   2614 C  CB    . ILE A 1 349 ? -18.339 9.813   -13.942 1.00 21.22 ? 341 ILE A CB    1 
ATOM   2615 C  CG1   . ILE A 1 349 ? -18.401 11.339  -13.895 1.00 21.47 ? 341 ILE A CG1   1 
ATOM   2616 C  CG2   . ILE A 1 349 ? -17.850 9.277   -12.610 1.00 21.44 ? 341 ILE A CG2   1 
ATOM   2617 C  CD1   . ILE A 1 349 ? -19.615 11.874  -13.177 1.00 22.21 ? 341 ILE A CD1   1 
ATOM   2618 N  N     . VAL A 1 350 ? -18.215 7.061   -15.248 1.00 21.58 ? 342 VAL A N     1 
ATOM   2619 C  CA    . VAL A 1 350 ? -18.109 5.606   -15.192 1.00 21.88 ? 342 VAL A CA    1 
ATOM   2620 C  C     . VAL A 1 350 ? -16.981 5.084   -16.091 1.00 22.23 ? 342 VAL A C     1 
ATOM   2621 O  O     . VAL A 1 350 ? -16.157 4.281   -15.653 1.00 22.28 ? 342 VAL A O     1 
ATOM   2622 C  CB    . VAL A 1 350 ? -19.452 4.913   -15.550 1.00 21.75 ? 342 VAL A CB    1 
ATOM   2623 C  CG1   . VAL A 1 350 ? -19.233 3.450   -15.875 1.00 21.68 ? 342 VAL A CG1   1 
ATOM   2624 C  CG2   . VAL A 1 350 ? -20.435 5.056   -14.409 1.00 21.63 ? 342 VAL A CG2   1 
ATOM   2625 N  N     . ALA A 1 351 ? -16.922 5.583   -17.327 1.00 22.55 ? 343 ALA A N     1 
ATOM   2626 C  CA    . ALA A 1 351 ? -15.880 5.178   -18.273 1.00 22.91 ? 343 ALA A CA    1 
ATOM   2627 C  C     . ALA A 1 351 ? -14.476 5.533   -17.775 1.00 23.26 ? 343 ALA A C     1 
ATOM   2628 O  O     . ALA A 1 351 ? -13.507 4.845   -18.088 1.00 23.33 ? 343 ALA A O     1 
ATOM   2629 C  CB    . ALA A 1 351 ? -16.131 5.791   -19.645 1.00 22.89 ? 343 ALA A CB    1 
ATOM   2630 N  N     . SER A 1 352 ? -14.377 6.598   -16.989 1.00 23.72 ? 344 SER A N     1 
ATOM   2631 C  CA    . SER A 1 352 ? -13.099 6.995   -16.413 1.00 24.32 ? 344 SER A CA    1 
ATOM   2632 C  C     . SER A 1 352 ? -12.690 6.154   -15.195 1.00 24.33 ? 344 SER A C     1 
ATOM   2633 O  O     . SER A 1 352 ? -11.502 5.989   -14.927 1.00 24.26 ? 344 SER A O     1 
ATOM   2634 C  CB    . SER A 1 352 ? -13.097 8.482   -16.071 1.00 24.58 ? 344 SER A CB    1 
ATOM   2635 O  OG    . SER A 1 352 ? -12.761 9.249   -17.218 1.00 25.75 ? 344 SER A OG    1 
ATOM   2636 N  N     . VAL A 1 353 ? -13.673 5.627   -14.464 1.00 24.25 ? 345 VAL A N     1 
ATOM   2637 C  CA    . VAL A 1 353 ? -13.390 4.653   -13.404 1.00 24.23 ? 345 VAL A CA    1 
ATOM   2638 C  C     . VAL A 1 353 ? -12.903 3.333   -14.016 1.00 24.29 ? 345 VAL A C     1 
ATOM   2639 O  O     . VAL A 1 353 ? -11.933 2.732   -13.532 1.00 24.01 ? 345 VAL A O     1 
ATOM   2640 C  CB    . VAL A 1 353 ? -14.629 4.399   -12.501 1.00 24.23 ? 345 VAL A CB    1 
ATOM   2641 C  CG1   . VAL A 1 353 ? -14.284 3.431   -11.376 1.00 24.02 ? 345 VAL A CG1   1 
ATOM   2642 C  CG2   . VAL A 1 353 ? -15.140 5.706   -11.926 1.00 24.54 ? 345 VAL A CG2   1 
ATOM   2643 N  N     . VAL A 1 354 ? -13.565 2.911   -15.097 1.00 24.33 ? 346 VAL A N     1 
ATOM   2644 C  CA    . VAL A 1 354 ? -13.164 1.726   -15.858 1.00 24.49 ? 346 VAL A CA    1 
ATOM   2645 C  C     . VAL A 1 354 ? -11.706 1.807   -16.281 1.00 24.74 ? 346 VAL A C     1 
ATOM   2646 O  O     . VAL A 1 354 ? -10.899 0.952   -15.918 1.00 24.79 ? 346 VAL A O     1 
ATOM   2647 C  CB    . VAL A 1 354 ? -14.033 1.552   -17.125 1.00 24.56 ? 346 VAL A CB    1 
ATOM   2648 C  CG1   . VAL A 1 354 ? -13.507 0.404   -17.997 1.00 24.60 ? 346 VAL A CG1   1 
ATOM   2649 C  CG2   . VAL A 1 354 ? -15.472 1.314   -16.749 1.00 24.34 ? 346 VAL A CG2   1 
ATOM   2650 N  N     . ARG A 1 355 ? -11.373 2.856   -17.029 1.00 25.15 ? 347 ARG A N     1 
ATOM   2651 C  CA    . ARG A 1 355 ? -10.052 2.992   -17.638 1.00 25.63 ? 347 ARG A CA    1 
ATOM   2652 C  C     . ARG A 1 355 ? -8.948  3.126   -16.585 1.00 25.49 ? 347 ARG A C     1 
ATOM   2653 O  O     . ARG A 1 355 ? -7.857  2.586   -16.751 1.00 25.46 ? 347 ARG A O     1 
ATOM   2654 C  CB    . ARG A 1 355 ? -10.028 4.186   -18.601 1.00 25.74 ? 347 ARG A CB    1 
ATOM   2655 C  CG    . ARG A 1 355 ? -9.157  3.981   -19.839 1.00 27.38 ? 347 ARG A CG    1 
ATOM   2656 C  CD    . ARG A 1 355 ? -9.749  2.925   -20.782 1.00 29.90 ? 347 ARG A CD    1 
ATOM   2657 N  NE    . ARG A 1 355 ? -9.091  2.922   -22.094 1.00 31.28 ? 347 ARG A NE    1 
ATOM   2658 C  CZ    . ARG A 1 355 ? -9.657  3.347   -23.225 1.00 31.73 ? 347 ARG A CZ    1 
ATOM   2659 N  NH1   . ARG A 1 355 ? -10.904 3.808   -23.222 1.00 31.56 ? 347 ARG A NH1   1 
ATOM   2660 N  NH2   . ARG A 1 355 ? -8.977  3.307   -24.363 1.00 31.91 ? 347 ARG A NH2   1 
ATOM   2661 N  N     . CYS A 1 356 ? -9.251  3.828   -15.495 1.00 25.65 ? 348 CYS A N     1 
ATOM   2662 C  CA    . CYS A 1 356 ? -8.312  3.972   -14.379 1.00 25.64 ? 348 CYS A CA    1 
ATOM   2663 C  C     . CYS A 1 356 ? -8.058  2.640   -13.670 1.00 25.65 ? 348 CYS A C     1 
ATOM   2664 O  O     . CYS A 1 356 ? -6.915  2.300   -13.360 1.00 25.65 ? 348 CYS A O     1 
ATOM   2665 C  CB    . CYS A 1 356 ? -8.820  5.004   -13.377 1.00 25.52 ? 348 CYS A CB    1 
ATOM   2666 S  SG    . CYS A 1 356 ? -7.755  5.230   -11.956 1.00 26.04 ? 348 CYS A SG    1 
ATOM   2667 N  N     . CYS A 1 357 ? -9.127  1.886   -13.434 1.00 25.61 ? 349 CYS A N     1 
ATOM   2668 C  CA    . CYS A 1 357 ? -9.026  0.601   -12.757 1.00 25.48 ? 349 CYS A CA    1 
ATOM   2669 C  C     . CYS A 1 357 ? -8.362  -0.469  -13.623 1.00 25.23 ? 349 CYS A C     1 
ATOM   2670 O  O     . CYS A 1 357 ? -7.720  -1.380  -13.104 1.00 25.42 ? 349 CYS A O     1 
ATOM   2671 C  CB    . CYS A 1 357 ? -10.397 0.131   -12.307 1.00 25.50 ? 349 CYS A CB    1 
ATOM   2672 S  SG    . CYS A 1 357 ? -11.080 1.065   -10.936 1.00 26.70 ? 349 CYS A SG    1 
ATOM   2673 N  N     . GLU A 1 358 ? -8.522  -0.357  -14.938 1.00 24.87 ? 350 GLU A N     1 
ATOM   2674 C  CA    . GLU A 1 358 ? -7.876  -1.276  -15.870 1.00 24.68 ? 350 GLU A CA    1 
ATOM   2675 C  C     . GLU A 1 358 ? -6.348  -1.142  -15.820 1.00 24.35 ? 350 GLU A C     1 
ATOM   2676 O  O     . GLU A 1 358 ? -5.629  -2.142  -15.822 1.00 24.38 ? 350 GLU A O     1 
ATOM   2677 C  CB    . GLU A 1 358 ? -8.389  -1.044  -17.295 1.00 24.81 ? 350 GLU A CB    1 
ATOM   2678 C  CG    . GLU A 1 358 ? -7.833  -2.025  -18.333 1.00 26.29 ? 350 GLU A CG    1 
ATOM   2679 C  CD    . GLU A 1 358 ? -8.713  -2.133  -19.574 1.00 28.30 ? 350 GLU A CD    1 
ATOM   2680 O  OE1   . GLU A 1 358 ? -9.204  -1.086  -20.061 1.00 29.51 ? 350 GLU A OE1   1 
ATOM   2681 O  OE2   . GLU A 1 358 ? -8.913  -3.267  -20.062 1.00 28.47 ? 350 GLU A OE2   1 
ATOM   2682 N  N     . ASP A 1 359 ? -5.864  0.095   -15.758 1.00 23.94 ? 351 ASP A N     1 
ATOM   2683 C  CA    . ASP A 1 359 ? -4.429  0.362   -15.677 1.00 23.68 ? 351 ASP A CA    1 
ATOM   2684 C  C     . ASP A 1 359 ? -3.870  -0.005  -14.305 1.00 23.54 ? 351 ASP A C     1 
ATOM   2685 O  O     . ASP A 1 359 ? -2.698  -0.371  -14.179 1.00 23.61 ? 351 ASP A O     1 
ATOM   2686 C  CB    . ASP A 1 359 ? -4.137  1.834   -15.982 1.00 23.57 ? 351 ASP A CB    1 
ATOM   2687 C  CG    . ASP A 1 359 ? -4.610  2.248   -17.361 1.00 23.65 ? 351 ASP A CG    1 
ATOM   2688 O  OD1   . ASP A 1 359 ? -4.546  1.412   -18.289 1.00 23.59 ? 351 ASP A OD1   1 
ATOM   2689 O  OD2   . ASP A 1 359 ? -5.038  3.414   -17.518 1.00 22.80 ? 351 ASP A OD2   1 
ATOM   2690 N  N     . LEU A 1 360 ? -4.713  0.095   -13.280 1.00 23.14 ? 352 LEU A N     1 
ATOM   2691 C  CA    . LEU A 1 360 ? -4.303  -0.217  -11.917 1.00 22.69 ? 352 LEU A CA    1 
ATOM   2692 C  C     . LEU A 1 360 ? -4.531  -1.684  -11.568 1.00 22.45 ? 352 LEU A C     1 
ATOM   2693 O  O     . LEU A 1 360 ? -4.120  -2.150  -10.507 1.00 22.45 ? 352 LEU A O     1 
ATOM   2694 C  CB    . LEU A 1 360 ? -5.035  0.681   -10.925 1.00 22.65 ? 352 LEU A CB    1 
ATOM   2695 C  CG    . LEU A 1 360 ? -4.676  2.165   -11.002 1.00 22.81 ? 352 LEU A CG    1 
ATOM   2696 C  CD1   . LEU A 1 360 ? -5.454  2.965   -9.969  1.00 22.22 ? 352 LEU A CD1   1 
ATOM   2697 C  CD2   . LEU A 1 360 ? -3.186  2.362   -10.829 1.00 22.73 ? 352 LEU A CD2   1 
ATOM   2698 N  N     . GLY A 1 361 ? -5.176  -2.412  -12.471 1.00 22.20 ? 353 GLY A N     1 
ATOM   2699 C  CA    . GLY A 1 361 ? -5.474  -3.819  -12.241 1.00 21.93 ? 353 GLY A CA    1 
ATOM   2700 C  C     . GLY A 1 361 ? -6.518  -4.012  -11.160 1.00 21.68 ? 353 GLY A C     1 
ATOM   2701 O  O     . GLY A 1 361 ? -6.470  -4.981  -10.408 1.00 21.45 ? 353 GLY A O     1 
ATOM   2702 N  N     . ILE A 1 362 ? -7.454  -3.071  -11.076 1.00 21.51 ? 354 ILE A N     1 
ATOM   2703 C  CA    . ILE A 1 362 ? -8.545  -3.145  -10.110 1.00 21.27 ? 354 ILE A CA    1 
ATOM   2704 C  C     . ILE A 1 362 ? -9.822  -3.652  -10.782 1.00 21.12 ? 354 ILE A C     1 
ATOM   2705 O  O     . ILE A 1 362 ? -10.197 -3.189  -11.856 1.00 21.01 ? 354 ILE A O     1 
ATOM   2706 C  CB    . ILE A 1 362 ? -8.809  -1.763  -9.442  1.00 21.27 ? 354 ILE A CB    1 
ATOM   2707 C  CG1   . ILE A 1 362 ? -7.578  -1.307  -8.653  1.00 21.19 ? 354 ILE A CG1   1 
ATOM   2708 C  CG2   . ILE A 1 362 ? -10.038 -1.820  -8.540  1.00 20.93 ? 354 ILE A CG2   1 
ATOM   2709 C  CD1   . ILE A 1 362 ? -7.710  0.076   -8.051  1.00 21.11 ? 354 ILE A CD1   1 
ATOM   2710 N  N     . THR A 1 363 ? -10.464 -4.626  -10.153 1.00 21.03 ? 355 THR A N     1 
ATOM   2711 C  CA    . THR A 1 363 ? -11.742 -5.140  -10.627 1.00 20.98 ? 355 THR A CA    1 
ATOM   2712 C  C     . THR A 1 363 ? -12.846 -4.081  -10.498 1.00 20.66 ? 355 THR A C     1 
ATOM   2713 O  O     . THR A 1 363 ? -12.969 -3.425  -9.462  1.00 20.74 ? 355 THR A O     1 
ATOM   2714 C  CB    . THR A 1 363 ? -12.145 -6.398  -9.838  1.00 21.11 ? 355 THR A CB    1 
ATOM   2715 O  OG1   . THR A 1 363 ? -11.135 -7.404  -9.995  1.00 21.32 ? 355 THR A OG1   1 
ATOM   2716 C  CG2   . THR A 1 363 ? -13.457 -6.934  -10.331 1.00 21.14 ? 355 THR A CG2   1 
ATOM   2717 N  N     . VAL A 1 364 ? -13.627 -3.903  -11.564 1.00 20.18 ? 356 VAL A N     1 
ATOM   2718 C  CA    . VAL A 1 364 ? -14.780 -2.994  -11.536 1.00 19.83 ? 356 VAL A CA    1 
ATOM   2719 C  C     . VAL A 1 364 ? -16.095 -3.748  -11.651 1.00 19.31 ? 356 VAL A C     1 
ATOM   2720 O  O     . VAL A 1 364 ? -16.305 -4.503  -12.597 1.00 19.27 ? 356 VAL A O     1 
ATOM   2721 C  CB    . VAL A 1 364 ? -14.730 -1.962  -12.679 1.00 20.01 ? 356 VAL A CB    1 
ATOM   2722 C  CG1   . VAL A 1 364 ? -15.629 -0.775  -12.358 1.00 20.01 ? 356 VAL A CG1   1 
ATOM   2723 C  CG2   . VAL A 1 364 ? -13.312 -1.509  -12.929 1.00 19.88 ? 356 VAL A CG2   1 
ATOM   2724 N  N     . VAL A 1 365 ? -16.983 -3.522  -10.690 1.00 18.96 ? 357 VAL A N     1 
ATOM   2725 C  CA    . VAL A 1 365 ? -18.350 -4.033  -10.759 1.00 18.61 ? 357 VAL A CA    1 
ATOM   2726 C  C     . VAL A 1 365 ? -19.339 -2.872  -10.821 1.00 18.68 ? 357 VAL A C     1 
ATOM   2727 O  O     . VAL A 1 365 ? -19.197 -1.889  -10.095 1.00 18.63 ? 357 VAL A O     1 
ATOM   2728 C  CB    . VAL A 1 365 ? -18.687 -4.922  -9.536  1.00 18.60 ? 357 VAL A CB    1 
ATOM   2729 C  CG1   . VAL A 1 365 ? -20.119 -5.449  -9.627  1.00 17.98 ? 357 VAL A CG1   1 
ATOM   2730 C  CG2   . VAL A 1 365 ? -17.701 -6.070  -9.423  1.00 17.96 ? 357 VAL A CG2   1 
ATOM   2731 N  N     . ALA A 1 366 ? -20.326 -2.978  -11.708 1.00 18.75 ? 358 ALA A N     1 
ATOM   2732 C  CA    . ALA A 1 366 ? -21.433 -2.022  -11.740 1.00 18.80 ? 358 ALA A CA    1 
ATOM   2733 C  C     . ALA A 1 366 ? -22.610 -2.555  -10.944 1.00 18.96 ? 358 ALA A C     1 
ATOM   2734 O  O     . ALA A 1 366 ? -22.982 -3.719  -11.072 1.00 18.99 ? 358 ALA A O     1 
ATOM   2735 C  CB    . ALA A 1 366 ? -21.846 -1.723  -13.177 1.00 18.72 ? 358 ALA A CB    1 
ATOM   2736 N  N     . GLU A 1 367 ? -23.193 -1.696  -10.120 1.00 19.39 ? 359 GLU A N     1 
ATOM   2737 C  CA    . GLU A 1 367 ? -24.218 -2.111  -9.170  1.00 19.49 ? 359 GLU A CA    1 
ATOM   2738 C  C     . GLU A 1 367 ? -25.580 -1.602  -9.561  1.00 19.55 ? 359 GLU A C     1 
ATOM   2739 O  O     . GLU A 1 367 ? -25.697 -0.597  -10.253 1.00 19.51 ? 359 GLU A O     1 
ATOM   2740 C  CB    . GLU A 1 367 ? -23.891 -1.578  -7.796  1.00 19.54 ? 359 GLU A CB    1 
ATOM   2741 C  CG    . GLU A 1 367 ? -23.320 -2.573  -6.857  1.00 20.08 ? 359 GLU A CG    1 
ATOM   2742 C  CD    . GLU A 1 367 ? -23.126 -1.986  -5.500  1.00 19.82 ? 359 GLU A CD    1 
ATOM   2743 O  OE1   . GLU A 1 367 ? -23.812 -2.428  -4.553  1.00 21.17 ? 359 GLU A OE1   1 
ATOM   2744 O  OE2   . GLU A 1 367 ? -22.327 -1.039  -5.379  1.00 19.60 ? 359 GLU A OE2   1 
ATOM   2745 N  N     . GLY A 1 368 ? -26.617 -2.279  -9.073  1.00 19.72 ? 360 GLY A N     1 
ATOM   2746 C  CA    . GLY A 1 368 ? -27.989 -1.829  -9.252  1.00 19.61 ? 360 GLY A CA    1 
ATOM   2747 C  C     . GLY A 1 368 ? -28.434 -1.821  -10.700 1.00 19.76 ? 360 GLY A C     1 
ATOM   2748 O  O     . GLY A 1 368 ? -29.292 -1.028  -11.085 1.00 19.79 ? 360 GLY A O     1 
ATOM   2749 N  N     . VAL A 1 369 ? -27.847 -2.704  -11.507 1.00 19.83 ? 361 VAL A N     1 
ATOM   2750 C  CA    . VAL A 1 369 ? -28.229 -2.838  -12.918 1.00 19.98 ? 361 VAL A CA    1 
ATOM   2751 C  C     . VAL A 1 369 ? -29.600 -3.511  -13.057 1.00 20.21 ? 361 VAL A C     1 
ATOM   2752 O  O     . VAL A 1 369 ? -29.767 -4.678  -12.714 1.00 20.00 ? 361 VAL A O     1 
ATOM   2753 C  CB    . VAL A 1 369 ? -27.178 -3.637  -13.721 1.00 19.92 ? 361 VAL A CB    1 
ATOM   2754 C  CG1   . VAL A 1 369 ? -27.531 -3.637  -15.205 1.00 19.79 ? 361 VAL A CG1   1 
ATOM   2755 C  CG2   . VAL A 1 369 ? -25.786 -3.061  -13.500 1.00 19.64 ? 361 VAL A CG2   1 
ATOM   2756 N  N     . GLU A 1 370 ? -30.571 -2.763  -13.569 1.00 20.66 ? 362 GLU A N     1 
ATOM   2757 C  CA    . GLU A 1 370 ? -31.961 -3.218  -13.591 1.00 21.18 ? 362 GLU A CA    1 
ATOM   2758 C  C     . GLU A 1 370 ? -32.512 -3.409  -15.002 1.00 21.34 ? 362 GLU A C     1 
ATOM   2759 O  O     . GLU A 1 370 ? -33.499 -4.118  -15.192 1.00 21.66 ? 362 GLU A O     1 
ATOM   2760 C  CB    . GLU A 1 370 ? -32.852 -2.244  -12.826 1.00 21.13 ? 362 GLU A CB    1 
ATOM   2761 C  CG    . GLU A 1 370 ? -32.702 -2.304  -11.319 1.00 21.69 ? 362 GLU A CG    1 
ATOM   2762 C  CD    . GLU A 1 370 ? -33.556 -1.265  -10.615 1.00 22.51 ? 362 GLU A CD    1 
ATOM   2763 O  OE1   . GLU A 1 370 ? -33.985 -0.295  -11.282 1.00 23.23 ? 362 GLU A OE1   1 
ATOM   2764 O  OE2   . GLU A 1 370 ? -33.789 -1.408  -9.395  1.00 22.47 ? 362 GLU A OE2   1 
ATOM   2765 N  N     . THR A 1 371 ? -31.899 -2.750  -15.983 1.00 21.56 ? 363 THR A N     1 
ATOM   2766 C  CA    . THR A 1 371 ? -32.434 -2.748  -17.347 1.00 22.01 ? 363 THR A CA    1 
ATOM   2767 C  C     . THR A 1 371 ? -31.395 -3.134  -18.392 1.00 22.21 ? 363 THR A C     1 
ATOM   2768 O  O     . THR A 1 371 ? -30.189 -2.917  -18.205 1.00 22.14 ? 363 THR A O     1 
ATOM   2769 C  CB    . THR A 1 371 ? -33.027 -1.371  -17.734 1.00 22.14 ? 363 THR A CB    1 
ATOM   2770 O  OG1   . THR A 1 371 ? -31.977 -0.395  -17.800 1.00 22.82 ? 363 THR A OG1   1 
ATOM   2771 C  CG2   . THR A 1 371 ? -34.089 -0.922  -16.723 1.00 21.95 ? 363 THR A CG2   1 
ATOM   2772 N  N     . LEU A 1 372 ? -31.876 -3.693  -19.501 1.00 22.53 ? 364 LEU A N     1 
ATOM   2773 C  CA    . LEU A 1 372 ? -31.038 -3.967  -20.664 1.00 22.76 ? 364 LEU A CA    1 
ATOM   2774 C  C     . LEU A 1 372 ? -30.314 -2.709  -21.122 1.00 22.80 ? 364 LEU A C     1 
ATOM   2775 O  O     . LEU A 1 372 ? -29.122 -2.745  -21.425 1.00 22.59 ? 364 LEU A O     1 
ATOM   2776 C  CB    . LEU A 1 372 ? -31.883 -4.526  -21.813 1.00 22.86 ? 364 LEU A CB    1 
ATOM   2777 C  CG    . LEU A 1 372 ? -32.074 -6.041  -21.907 1.00 23.16 ? 364 LEU A CG    1 
ATOM   2778 C  CD1   . LEU A 1 372 ? -32.975 -6.373  -23.082 1.00 23.02 ? 364 LEU A CD1   1 
ATOM   2779 C  CD2   . LEU A 1 372 ? -30.730 -6.751  -22.049 1.00 23.42 ? 364 LEU A CD2   1 
ATOM   2780 N  N     . GLU A 1 373 ? -31.042 -1.594  -21.153 1.00 23.03 ? 365 GLU A N     1 
ATOM   2781 C  CA    . GLU A 1 373 ? -30.470 -0.306  -21.534 1.00 23.51 ? 365 GLU A CA    1 
ATOM   2782 C  C     . GLU A 1 373 ? -29.228 0.009   -20.700 1.00 23.67 ? 365 GLU A C     1 
ATOM   2783 O  O     . GLU A 1 373 ? -28.189 0.395   -21.243 1.00 23.65 ? 365 GLU A O     1 
ATOM   2784 C  CB    . GLU A 1 373 ? -31.508 0.813   -21.391 1.00 23.48 ? 365 GLU A CB    1 
ATOM   2785 C  CG    . GLU A 1 373 ? -32.647 0.755   -22.410 1.00 24.59 ? 365 GLU A CG    1 
ATOM   2786 C  CD    . GLU A 1 373 ? -33.617 -0.391  -22.149 1.00 26.05 ? 365 GLU A CD    1 
ATOM   2787 O  OE1   . GLU A 1 373 ? -33.939 -0.642  -20.965 1.00 27.20 ? 365 GLU A OE1   1 
ATOM   2788 O  OE2   . GLU A 1 373 ? -34.052 -1.043  -23.126 1.00 25.52 ? 365 GLU A OE2   1 
ATOM   2789 N  N     . GLU A 1 374 ? -29.338 -0.188  -19.383 1.00 23.87 ? 366 GLU A N     1 
ATOM   2790 C  CA    . GLU A 1 374 ? -28.219 0.024   -18.469 1.00 23.91 ? 366 GLU A CA    1 
ATOM   2791 C  C     . GLU A 1 374 ? -27.043 -0.905  -18.764 1.00 23.92 ? 366 GLU A C     1 
ATOM   2792 O  O     . GLU A 1 374 ? -25.904 -0.452  -18.865 1.00 23.93 ? 366 GLU A O     1 
ATOM   2793 C  CB    . GLU A 1 374 ? -28.670 -0.129  -17.013 1.00 24.11 ? 366 GLU A CB    1 
ATOM   2794 C  CG    . GLU A 1 374 ? -29.319 1.120   -16.433 1.00 24.46 ? 366 GLU A CG    1 
ATOM   2795 C  CD    . GLU A 1 374 ? -30.264 0.811   -15.298 1.00 25.00 ? 366 GLU A CD    1 
ATOM   2796 O  OE1   . GLU A 1 374 ? -30.273 -0.346  -14.833 1.00 25.98 ? 366 GLU A OE1   1 
ATOM   2797 O  OE2   . GLU A 1 374 ? -31.005 1.723   -14.870 1.00 25.33 ? 366 GLU A OE2   1 
ATOM   2798 N  N     . TRP A 1 375 ? -27.323 -2.200  -18.923 1.00 23.91 ? 367 TRP A N     1 
ATOM   2799 C  CA    . TRP A 1 375 ? -26.268 -3.176  -19.197 1.00 24.08 ? 367 TRP A CA    1 
ATOM   2800 C  C     . TRP A 1 375 ? -25.487 -2.855  -20.480 1.00 24.34 ? 367 TRP A C     1 
ATOM   2801 O  O     . TRP A 1 375 ? -24.259 -2.932  -20.498 1.00 24.56 ? 367 TRP A O     1 
ATOM   2802 C  CB    . TRP A 1 375 ? -26.826 -4.607  -19.254 1.00 24.00 ? 367 TRP A CB    1 
ATOM   2803 C  CG    . TRP A 1 375 ? -25.785 -5.630  -19.665 1.00 23.88 ? 367 TRP A CG    1 
ATOM   2804 C  CD1   . TRP A 1 375 ? -24.719 -6.054  -18.927 1.00 23.74 ? 367 TRP A CD1   1 
ATOM   2805 C  CD2   . TRP A 1 375 ? -25.698 -6.314  -20.925 1.00 23.68 ? 367 TRP A CD2   1 
ATOM   2806 N  NE1   . TRP A 1 375 ? -23.980 -6.971  -19.639 1.00 23.82 ? 367 TRP A NE1   1 
ATOM   2807 C  CE2   . TRP A 1 375 ? -24.557 -7.149  -20.869 1.00 23.82 ? 367 TRP A CE2   1 
ATOM   2808 C  CE3   . TRP A 1 375 ? -26.475 -6.310  -22.091 1.00 24.00 ? 367 TRP A CE3   1 
ATOM   2809 C  CZ2   . TRP A 1 375 ? -24.173 -7.972  -21.937 1.00 23.72 ? 367 TRP A CZ2   1 
ATOM   2810 C  CZ3   . TRP A 1 375 ? -26.092 -7.130  -23.154 1.00 24.13 ? 367 TRP A CZ3   1 
ATOM   2811 C  CH2   . TRP A 1 375 ? -24.950 -7.948  -23.066 1.00 23.94 ? 367 TRP A CH2   1 
ATOM   2812 N  N     . CYS A 1 376 ? -26.206 -2.482  -21.537 1.00 24.43 ? 368 CYS A N     1 
ATOM   2813 C  CA    . CYS A 1 376 ? -25.594 -2.234  -22.850 1.00 24.68 ? 368 CYS A CA    1 
ATOM   2814 C  C     . CYS A 1 376 ? -24.591 -1.082  -22.830 1.00 24.98 ? 368 CYS A C     1 
ATOM   2815 O  O     . CYS A 1 376 ? -23.465 -1.218  -23.322 1.00 24.86 ? 368 CYS A O     1 
ATOM   2816 C  CB    . CYS A 1 376 ? -26.672 -1.965  -23.896 1.00 24.53 ? 368 CYS A CB    1 
ATOM   2817 S  SG    . CYS A 1 376 ? -27.704 -3.392  -24.280 1.00 24.61 ? 368 CYS A SG    1 
ATOM   2818 N  N     . TRP A 1 377 ? -25.004 0.048   -22.258 1.00 25.22 ? 369 TRP A N     1 
ATOM   2819 C  CA    . TRP A 1 377 ? -24.154 1.233   -22.188 1.00 25.52 ? 369 TRP A CA    1 
ATOM   2820 C  C     . TRP A 1 377 ? -22.978 1.042   -21.237 1.00 25.47 ? 369 TRP A C     1 
ATOM   2821 O  O     . TRP A 1 377 ? -21.896 1.588   -21.461 1.00 25.42 ? 369 TRP A O     1 
ATOM   2822 C  CB    . TRP A 1 377 ? -24.969 2.463   -21.792 1.00 25.78 ? 369 TRP A CB    1 
ATOM   2823 C  CG    . TRP A 1 377 ? -25.766 3.031   -22.926 1.00 26.46 ? 369 TRP A CG    1 
ATOM   2824 C  CD1   . TRP A 1 377 ? -27.018 2.647   -23.326 1.00 27.12 ? 369 TRP A CD1   1 
ATOM   2825 C  CD2   . TRP A 1 377 ? -25.359 4.067   -23.829 1.00 26.77 ? 369 TRP A CD2   1 
ATOM   2826 N  NE1   . TRP A 1 377 ? -27.422 3.395   -24.410 1.00 27.07 ? 369 TRP A NE1   1 
ATOM   2827 C  CE2   . TRP A 1 377 ? -26.423 4.273   -24.739 1.00 27.06 ? 369 TRP A CE2   1 
ATOM   2828 C  CE3   . TRP A 1 377 ? -24.201 4.846   -23.954 1.00 26.95 ? 369 TRP A CE3   1 
ATOM   2829 C  CZ2   . TRP A 1 377 ? -26.364 5.229   -25.759 1.00 27.23 ? 369 TRP A CZ2   1 
ATOM   2830 C  CZ3   . TRP A 1 377 ? -24.143 5.797   -24.971 1.00 27.19 ? 369 TRP A CZ3   1 
ATOM   2831 C  CH2   . TRP A 1 377 ? -25.217 5.975   -25.862 1.00 27.07 ? 369 TRP A CH2   1 
ATOM   2832 N  N     . LEU A 1 378 ? -23.191 0.252   -20.185 1.00 25.43 ? 370 LEU A N     1 
ATOM   2833 C  CA    . LEU A 1 378 ? -22.119 -0.101  -19.260 1.00 25.34 ? 370 LEU A CA    1 
ATOM   2834 C  C     . LEU A 1 378 ? -21.117 -1.032  -19.924 1.00 25.64 ? 370 LEU A C     1 
ATOM   2835 O  O     . LEU A 1 378 ? -19.915 -0.937  -19.687 1.00 25.75 ? 370 LEU A O     1 
ATOM   2836 C  CB    . LEU A 1 378 ? -22.688 -0.755  -18.003 1.00 25.19 ? 370 LEU A CB    1 
ATOM   2837 C  CG    . LEU A 1 378 ? -23.320 0.171   -16.966 1.00 24.34 ? 370 LEU A CG    1 
ATOM   2838 C  CD1   . LEU A 1 378 ? -24.167 -0.620  -15.991 1.00 23.00 ? 370 LEU A CD1   1 
ATOM   2839 C  CD2   . LEU A 1 378 ? -22.255 0.958   -16.240 1.00 23.83 ? 370 LEU A CD2   1 
ATOM   2840 N  N     . GLN A 1 379 ? -21.624 -1.932  -20.761 1.00 26.01 ? 371 GLN A N     1 
ATOM   2841 C  CA    . GLN A 1 379 ? -20.781 -2.836  -21.529 1.00 26.41 ? 371 GLN A CA    1 
ATOM   2842 C  C     . GLN A 1 379 ? -19.973 -2.058  -22.568 1.00 26.45 ? 371 GLN A C     1 
ATOM   2843 O  O     . GLN A 1 379 ? -18.819 -2.392  -22.851 1.00 26.48 ? 371 GLN A O     1 
ATOM   2844 C  CB    . GLN A 1 379 ? -21.641 -3.905  -22.214 1.00 26.55 ? 371 GLN A CB    1 
ATOM   2845 C  CG    . GLN A 1 379 ? -20.855 -5.014  -22.893 1.00 27.48 ? 371 GLN A CG    1 
ATOM   2846 C  CD    . GLN A 1 379 ? -20.518 -6.151  -21.955 1.00 28.71 ? 371 GLN A CD    1 
ATOM   2847 O  OE1   . GLN A 1 379 ? -21.278 -6.463  -21.039 1.00 30.26 ? 371 GLN A OE1   1 
ATOM   2848 N  NE2   . GLN A 1 379 ? -19.381 -6.790  -22.188 1.00 28.66 ? 371 GLN A NE2   1 
ATOM   2849 N  N     . SER A 1 380 ? -20.577 -1.005  -23.113 1.00 26.59 ? 372 SER A N     1 
ATOM   2850 C  CA    . SER A 1 380 ? -19.936 -0.211  -24.156 1.00 26.73 ? 372 SER A CA    1 
ATOM   2851 C  C     . SER A 1 380 ? -18.845 0.714   -23.609 1.00 26.70 ? 372 SER A C     1 
ATOM   2852 O  O     . SER A 1 380 ? -17.940 1.106   -24.343 1.00 26.81 ? 372 SER A O     1 
ATOM   2853 C  CB    . SER A 1 380 ? -20.971 0.589   -24.948 1.00 26.61 ? 372 SER A CB    1 
ATOM   2854 O  OG    . SER A 1 380 ? -21.478 1.667   -24.185 1.00 27.20 ? 372 SER A OG    1 
ATOM   2855 N  N     . VAL A 1 381 ? -18.935 1.066   -22.325 1.00 26.59 ? 373 VAL A N     1 
ATOM   2856 C  CA    . VAL A 1 381 ? -17.876 1.851   -21.678 1.00 26.35 ? 373 VAL A CA    1 
ATOM   2857 C  C     . VAL A 1 381 ? -16.816 0.957   -21.025 1.00 26.13 ? 373 VAL A C     1 
ATOM   2858 O  O     . VAL A 1 381 ? -15.829 1.450   -20.480 1.00 26.21 ? 373 VAL A O     1 
ATOM   2859 C  CB    . VAL A 1 381 ? -18.430 2.878   -20.643 1.00 26.46 ? 373 VAL A CB    1 
ATOM   2860 C  CG1   . VAL A 1 381 ? -19.386 3.860   -21.309 1.00 26.40 ? 373 VAL A CG1   1 
ATOM   2861 C  CG2   . VAL A 1 381 ? -19.100 2.174   -19.485 1.00 26.86 ? 373 VAL A CG2   1 
ATOM   2862 N  N     . GLY A 1 382 ? -17.034 -0.355  -21.080 1.00 25.80 ? 374 GLY A N     1 
ATOM   2863 C  CA    . GLY A 1 382 ? -15.979 -1.320  -20.780 1.00 25.44 ? 374 GLY A CA    1 
ATOM   2864 C  C     . GLY A 1 382 ? -16.093 -2.037  -19.443 1.00 25.25 ? 374 GLY A C     1 
ATOM   2865 O  O     . GLY A 1 382 ? -15.097 -2.530  -18.914 1.00 25.35 ? 374 GLY A O     1 
ATOM   2866 N  N     . ILE A 1 383 ? -17.304 -2.109  -18.898 1.00 24.94 ? 375 ILE A N     1 
ATOM   2867 C  CA    . ILE A 1 383 ? -17.533 -2.870  -17.666 1.00 24.70 ? 375 ILE A CA    1 
ATOM   2868 C  C     . ILE A 1 383 ? -17.954 -4.300  -17.983 1.00 24.49 ? 375 ILE A C     1 
ATOM   2869 O  O     . ILE A 1 383 ? -18.773 -4.528  -18.868 1.00 24.68 ? 375 ILE A O     1 
ATOM   2870 C  CB    . ILE A 1 383 ? -18.573 -2.183  -16.748 1.00 24.70 ? 375 ILE A CB    1 
ATOM   2871 C  CG1   . ILE A 1 383 ? -17.932 -0.992  -16.043 1.00 24.39 ? 375 ILE A CG1   1 
ATOM   2872 C  CG2   . ILE A 1 383 ? -19.117 -3.162  -15.712 1.00 24.70 ? 375 ILE A CG2   1 
ATOM   2873 C  CD1   . ILE A 1 383 ? -18.857 -0.241  -15.137 1.00 25.59 ? 375 ILE A CD1   1 
ATOM   2874 N  N     . ARG A 1 384 ? -17.362 -5.262  -17.279 1.00 24.14 ? 376 ARG A N     1 
ATOM   2875 C  CA    . ARG A 1 384 ? -17.610 -6.677  -17.552 1.00 23.71 ? 376 ARG A CA    1 
ATOM   2876 C  C     . ARG A 1 384 ? -18.315 -7.385  -16.401 1.00 23.26 ? 376 ARG A C     1 
ATOM   2877 O  O     . ARG A 1 384 ? -19.027 -8.369  -16.611 1.00 23.55 ? 376 ARG A O     1 
ATOM   2878 C  CB    . ARG A 1 384 ? -16.305 -7.391  -17.889 1.00 23.71 ? 376 ARG A CB    1 
ATOM   2879 C  CG    . ARG A 1 384 ? -15.688 -6.950  -19.205 1.00 24.50 ? 376 ARG A CG    1 
ATOM   2880 C  CD    . ARG A 1 384 ? -16.639 -7.207  -20.375 1.00 25.04 ? 376 ARG A CD    1 
ATOM   2881 N  NE    . ARG A 1 384 ? -16.134 -6.649  -21.627 1.00 25.37 ? 376 ARG A NE    1 
ATOM   2882 C  CZ    . ARG A 1 384 ? -16.448 -5.446  -22.095 1.00 25.94 ? 376 ARG A CZ    1 
ATOM   2883 N  NH1   . ARG A 1 384 ? -17.283 -4.661  -21.421 1.00 26.26 ? 376 ARG A NH1   1 
ATOM   2884 N  NH2   . ARG A 1 384 ? -15.935 -5.030  -23.243 1.00 26.14 ? 376 ARG A NH2   1 
ATOM   2885 N  N     . LEU A 1 385 ? -18.113 -6.887  -15.187 1.00 22.53 ? 377 LEU A N     1 
ATOM   2886 C  CA    . LEU A 1 385 ? -18.726 -7.486  -14.007 1.00 21.80 ? 377 LEU A CA    1 
ATOM   2887 C  C     . LEU A 1 385 ? -19.950 -6.696  -13.554 1.00 21.05 ? 377 LEU A C     1 
ATOM   2888 O  O     . LEU A 1 385 ? -19.878 -5.488  -13.346 1.00 20.88 ? 377 LEU A O     1 
ATOM   2889 C  CB    . LEU A 1 385 ? -17.703 -7.616  -12.870 1.00 21.87 ? 377 LEU A CB    1 
ATOM   2890 C  CG    . LEU A 1 385 ? -16.427 -8.416  -13.188 1.00 22.18 ? 377 LEU A CG    1 
ATOM   2891 C  CD1   . LEU A 1 385 ? -15.721 -8.829  -11.920 1.00 21.33 ? 377 LEU A CD1   1 
ATOM   2892 C  CD2   . LEU A 1 385 ? -16.738 -9.645  -14.033 1.00 22.54 ? 377 LEU A CD2   1 
ATOM   2893 N  N     . PHE A 1 386 ? -21.072 -7.390  -13.408 1.00 20.26 ? 378 PHE A N     1 
ATOM   2894 C  CA    . PHE A 1 386 ? -22.350 -6.738  -13.164 1.00 19.66 ? 378 PHE A CA    1 
ATOM   2895 C  C     . PHE A 1 386 ? -23.087 -7.337  -11.965 1.00 19.33 ? 378 PHE A C     1 
ATOM   2896 O  O     . PHE A 1 386 ? -23.076 -8.554  -11.752 1.00 19.24 ? 378 PHE A O     1 
ATOM   2897 C  CB    . PHE A 1 386 ? -23.236 -6.820  -14.413 1.00 19.63 ? 378 PHE A CB    1 
ATOM   2898 C  CG    . PHE A 1 386 ? -22.667 -6.111  -15.612 1.00 19.71 ? 378 PHE A CG    1 
ATOM   2899 C  CD1   . PHE A 1 386 ? -22.907 -4.760  -15.813 1.00 19.10 ? 378 PHE A CD1   1 
ATOM   2900 C  CD2   . PHE A 1 386 ? -21.887 -6.794  -16.539 1.00 19.57 ? 378 PHE A CD2   1 
ATOM   2901 C  CE1   . PHE A 1 386 ? -22.383 -4.103  -16.910 1.00 18.37 ? 378 PHE A CE1   1 
ATOM   2902 C  CE2   . PHE A 1 386 ? -21.360 -6.137  -17.638 1.00 19.21 ? 378 PHE A CE2   1 
ATOM   2903 C  CZ    . PHE A 1 386 ? -21.614 -4.788  -17.821 1.00 19.02 ? 378 PHE A CZ    1 
ATOM   2904 N  N     . GLN A 1 387 ? -23.733 -6.473  -11.191 1.00 18.85 ? 379 GLN A N     1 
ATOM   2905 C  CA    . GLN A 1 387 ? -24.573 -6.904  -10.086 1.00 18.43 ? 379 GLN A CA    1 
ATOM   2906 C  C     . GLN A 1 387 ? -25.880 -6.130  -10.117 1.00 18.42 ? 379 GLN A C     1 
ATOM   2907 O  O     . GLN A 1 387 ? -25.877 -4.900  -10.116 1.00 18.43 ? 379 GLN A O     1 
ATOM   2908 C  CB    . GLN A 1 387 ? -23.857 -6.680  -8.751  1.00 18.10 ? 379 GLN A CB    1 
ATOM   2909 C  CG    . GLN A 1 387 ? -24.687 -7.064  -7.521  1.00 18.44 ? 379 GLN A CG    1 
ATOM   2910 C  CD    . GLN A 1 387 ? -23.907 -6.954  -6.215  1.00 18.00 ? 379 GLN A CD    1 
ATOM   2911 O  OE1   . GLN A 1 387 ? -22.795 -6.453  -6.185  1.00 16.88 ? 379 GLN A OE1   1 
ATOM   2912 N  NE2   . GLN A 1 387 ? -24.501 -7.424  -5.135  1.00 18.90 ? 379 GLN A NE2   1 
ATOM   2913 N  N     . GLY A 1 388 ? -26.998 -6.844  -10.161 1.00 18.50 ? 380 GLY A N     1 
ATOM   2914 C  CA    . GLY A 1 388 ? -28.299 -6.186  -10.149 1.00 18.74 ? 380 GLY A CA    1 
ATOM   2915 C  C     . GLY A 1 388 ? -29.488 -7.104  -10.316 1.00 18.85 ? 380 GLY A C     1 
ATOM   2916 O  O     . GLY A 1 388 ? -29.340 -8.276  -10.671 1.00 18.76 ? 380 GLY A O     1 
ATOM   2917 N  N     . PHE A 1 389 ? -30.680 -6.550  -10.083 1.00 19.07 ? 381 PHE A N     1 
ATOM   2918 C  CA    . PHE A 1 389 ? -31.933 -7.306  -10.153 1.00 19.24 ? 381 PHE A CA    1 
ATOM   2919 C  C     . PHE A 1 389 ? -32.201 -7.860  -11.550 1.00 19.56 ? 381 PHE A C     1 
ATOM   2920 O  O     . PHE A 1 389 ? -32.932 -8.840  -11.702 1.00 19.60 ? 381 PHE A O     1 
ATOM   2921 C  CB    . PHE A 1 389 ? -33.113 -6.439  -9.713  1.00 19.15 ? 381 PHE A CB    1 
ATOM   2922 C  CG    . PHE A 1 389 ? -33.138 -6.136  -8.237  1.00 19.03 ? 381 PHE A CG    1 
ATOM   2923 C  CD1   . PHE A 1 389 ? -32.346 -6.852  -7.346  1.00 18.68 ? 381 PHE A CD1   1 
ATOM   2924 C  CD2   . PHE A 1 389 ? -33.984 -5.154  -7.736  1.00 18.73 ? 381 PHE A CD2   1 
ATOM   2925 C  CE1   . PHE A 1 389 ? -32.380 -6.575  -5.985  1.00 18.28 ? 381 PHE A CE1   1 
ATOM   2926 C  CE2   . PHE A 1 389 ? -34.029 -4.881  -6.374  1.00 18.93 ? 381 PHE A CE2   1 
ATOM   2927 C  CZ    . PHE A 1 389 ? -33.224 -5.594  -5.499  1.00 18.59 ? 381 PHE A CZ    1 
ATOM   2928 N  N     . LEU A 1 390 ? -31.613 -7.222  -12.566 1.00 19.95 ? 382 LEU A N     1 
ATOM   2929 C  CA    . LEU A 1 390 ? -31.712 -7.697  -13.939 1.00 20.30 ? 382 LEU A CA    1 
ATOM   2930 C  C     . LEU A 1 390 ? -31.163 -9.113  -14.084 1.00 20.86 ? 382 LEU A C     1 
ATOM   2931 O  O     . LEU A 1 390 ? -31.779 -9.959  -14.722 1.00 21.13 ? 382 LEU A O     1 
ATOM   2932 C  CB    . LEU A 1 390 ? -30.979 -6.755  -14.889 1.00 20.08 ? 382 LEU A CB    1 
ATOM   2933 C  CG    . LEU A 1 390 ? -31.027 -7.127  -16.378 1.00 19.99 ? 382 LEU A CG    1 
ATOM   2934 C  CD1   . LEU A 1 390 ? -32.410 -6.851  -16.972 1.00 19.23 ? 382 LEU A CD1   1 
ATOM   2935 C  CD2   . LEU A 1 390 ? -29.949 -6.401  -17.161 1.00 19.31 ? 382 LEU A CD2   1 
ATOM   2936 N  N     . PHE A 1 391 ? -30.007 -9.365  -13.483 1.00 21.47 ? 383 PHE A N     1 
ATOM   2937 C  CA    . PHE A 1 391 ? -29.368 -10.671 -13.580 1.00 21.99 ? 383 PHE A CA    1 
ATOM   2938 C  C     . PHE A 1 391 ? -29.815 -11.612 -12.466 1.00 22.67 ? 383 PHE A C     1 
ATOM   2939 O  O     . PHE A 1 391 ? -30.158 -12.764 -12.717 1.00 22.67 ? 383 PHE A O     1 
ATOM   2940 C  CB    . PHE A 1 391 ? -27.847 -10.525 -13.555 1.00 21.82 ? 383 PHE A CB    1 
ATOM   2941 C  CG    . PHE A 1 391 ? -27.321 -9.523  -14.534 1.00 21.63 ? 383 PHE A CG    1 
ATOM   2942 C  CD1   . PHE A 1 391 ? -27.169 -9.855  -15.875 1.00 21.57 ? 383 PHE A CD1   1 
ATOM   2943 C  CD2   . PHE A 1 391 ? -26.970 -8.247  -14.118 1.00 21.37 ? 383 PHE A CD2   1 
ATOM   2944 C  CE1   . PHE A 1 391 ? -26.689 -8.927  -16.784 1.00 21.16 ? 383 PHE A CE1   1 
ATOM   2945 C  CE2   . PHE A 1 391 ? -26.491 -7.316  -15.020 1.00 20.92 ? 383 PHE A CE2   1 
ATOM   2946 C  CZ    . PHE A 1 391 ? -26.346 -7.657  -16.354 1.00 21.52 ? 383 PHE A CZ    1 
ATOM   2947 N  N     . SER A 1 392 ? -29.811 -11.111 -11.233 1.00 23.58 ? 384 SER A N     1 
ATOM   2948 C  CA    . SER A 1 392 ? -29.936 -11.971 -10.058 1.00 24.38 ? 384 SER A CA    1 
ATOM   2949 C  C     . SER A 1 392 ? -30.429 -11.198 -8.846  1.00 24.67 ? 384 SER A C     1 
ATOM   2950 O  O     . SER A 1 392 ? -29.866 -10.171 -8.483  1.00 24.73 ? 384 SER A O     1 
ATOM   2951 C  CB    . SER A 1 392 ? -28.587 -12.634 -9.743  1.00 24.42 ? 384 SER A CB    1 
ATOM   2952 O  OG    . SER A 1 392 ? -28.652 -13.401 -8.551  1.00 25.56 ? 384 SER A OG    1 
ATOM   2953 N  N     . ARG A 1 393 ? -31.481 -11.704 -8.221  1.00 25.31 ? 385 ARG A N     1 
ATOM   2954 C  CA    . ARG A 1 393 ? -31.999 -11.116 -6.991  1.00 25.80 ? 385 ARG A CA    1 
ATOM   2955 C  C     . ARG A 1 393 ? -31.434 -11.832 -5.770  1.00 25.97 ? 385 ARG A C     1 
ATOM   2956 O  O     . ARG A 1 393 ? -31.135 -13.022 -5.838  1.00 25.87 ? 385 ARG A O     1 
ATOM   2957 C  CB    . ARG A 1 393 ? -33.529 -11.171 -6.977  1.00 25.83 ? 385 ARG A CB    1 
ATOM   2958 C  CG    . ARG A 1 393 ? -34.177 -10.161 -7.895  1.00 26.33 ? 385 ARG A CG    1 
ATOM   2959 C  CD    . ARG A 1 393 ? -35.689 -10.203 -7.801  1.00 26.61 ? 385 ARG A CD    1 
ATOM   2960 N  NE    . ARG A 1 393 ? -36.295 -9.211  -8.683  1.00 27.32 ? 385 ARG A NE    1 
ATOM   2961 C  CZ    . ARG A 1 393 ? -36.504 -7.940  -8.349  1.00 27.52 ? 385 ARG A CZ    1 
ATOM   2962 N  NH1   . ARG A 1 393 ? -36.172 -7.501  -7.137  1.00 27.72 ? 385 ARG A NH1   1 
ATOM   2963 N  NH2   . ARG A 1 393 ? -37.051 -7.109  -9.223  1.00 27.04 ? 385 ARG A NH2   1 
ATOM   2964 N  N     . PRO A 1 394 ? -31.260 -11.092 -4.654  1.00 26.29 ? 386 PRO A N     1 
ATOM   2965 C  CA    . PRO A 1 394 ? -30.916 -11.663 -3.361  1.00 26.60 ? 386 PRO A CA    1 
ATOM   2966 C  C     . PRO A 1 394 ? -31.781 -12.862 -3.028  1.00 26.95 ? 386 PRO A C     1 
ATOM   2967 O  O     . PRO A 1 394 ? -33.010 -12.803 -3.153  1.00 27.08 ? 386 PRO A O     1 
ATOM   2968 C  CB    . PRO A 1 394 ? -31.219 -10.522 -2.390  1.00 26.59 ? 386 PRO A CB    1 
ATOM   2969 C  CG    . PRO A 1 394 ? -30.964 -9.301  -3.172  1.00 26.40 ? 386 PRO A CG    1 
ATOM   2970 C  CD    . PRO A 1 394 ? -31.353 -9.621  -4.593  1.00 26.44 ? 386 PRO A CD    1 
ATOM   2971 N  N     . CYS A 1 395 ? -31.140 -13.947 -2.614  1.00 27.28 ? 387 CYS A N     1 
ATOM   2972 C  CA    . CYS A 1 395 ? -31.844 -15.176 -2.306  1.00 27.42 ? 387 CYS A CA    1 
ATOM   2973 C  C     . CYS A 1 395 ? -31.507 -15.646 -0.904  1.00 27.44 ? 387 CYS A C     1 
ATOM   2974 O  O     . CYS A 1 395 ? -30.364 -15.994 -0.617  1.00 27.57 ? 387 CYS A O     1 
ATOM   2975 C  CB    . CYS A 1 395 ? -31.490 -16.247 -3.325  1.00 27.42 ? 387 CYS A CB    1 
ATOM   2976 S  SG    . CYS A 1 395 ? -32.167 -17.858 -2.973  1.00 27.74 ? 387 CYS A SG    1 
ATOM   2977 N  N     . LEU A 1 396 ? -32.512 -15.651 -0.034  1.00 27.61 ? 388 LEU A N     1 
ATOM   2978 C  CA    . LEU A 1 396 ? -32.329 -15.978 1.376   1.00 27.75 ? 388 LEU A CA    1 
ATOM   2979 C  C     . LEU A 1 396 ? -31.747 -17.380 1.571   1.00 27.91 ? 388 LEU A C     1 
ATOM   2980 O  O     . LEU A 1 396 ? -32.385 -18.377 1.236   1.00 27.98 ? 388 LEU A O     1 
ATOM   2981 C  CB    . LEU A 1 396 ? -33.660 -15.847 2.127   1.00 27.77 ? 388 LEU A CB    1 
ATOM   2982 C  CG    . LEU A 1 396 ? -33.635 -15.930 3.656   1.00 27.60 ? 388 LEU A CG    1 
ATOM   2983 C  CD1   . LEU A 1 396 ? -32.638 -14.941 4.245   1.00 26.84 ? 388 LEU A CD1   1 
ATOM   2984 C  CD2   . LEU A 1 396 ? -35.027 -15.696 4.219   1.00 27.78 ? 388 LEU A CD2   1 
ATOM   2985 N  N     . ASN A 1 397 ? -30.520 -17.432 2.094   1.00 28.08 ? 389 ASN A N     1 
ATOM   2986 C  CA    . ASN A 1 397 ? -29.836 -18.694 2.433   1.00 28.29 ? 389 ASN A CA    1 
ATOM   2987 C  C     . ASN A 1 397 ? -29.628 -19.655 1.264   1.00 28.59 ? 389 ASN A C     1 
ATOM   2988 O  O     . ASN A 1 397 ? -29.620 -20.871 1.449   1.00 28.60 ? 389 ASN A O     1 
ATOM   2989 C  CB    . ASN A 1 397 ? -30.542 -19.413 3.589   1.00 28.29 ? 389 ASN A CB    1 
ATOM   2990 C  CG    . ASN A 1 397 ? -30.580 -18.583 4.854   1.00 28.09 ? 389 ASN A CG    1 
ATOM   2991 O  OD1   . ASN A 1 397 ? -29.539 -18.200 5.392   1.00 27.97 ? 389 ASN A OD1   1 
ATOM   2992 N  ND2   . ASN A 1 397 ? -31.783 -18.303 5.340   1.00 27.47 ? 389 ASN A ND2   1 
ATOM   2993 N  N     . GLY A 1 398 ? -29.442 -19.108 0.066   1.00 28.91 ? 390 GLY A N     1 
ATOM   2994 C  CA    . GLY A 1 398 ? -29.210 -19.936 -1.109  1.00 29.36 ? 390 GLY A CA    1 
ATOM   2995 C  C     . GLY A 1 398 ? -28.875 -19.159 -2.364  1.00 29.71 ? 390 GLY A C     1 
ATOM   2996 O  O     . GLY A 1 398 ? -28.914 -17.931 -2.377  1.00 29.61 ? 390 GLY A O     1 
ATOM   2997 N  N     . ILE A 1 399 ? -28.530 -19.889 -3.419  1.00 30.13 ? 391 ILE A N     1 
ATOM   2998 C  CA    . ILE A 1 399 ? -28.267 -19.298 -4.724  1.00 30.50 ? 391 ILE A CA    1 
ATOM   2999 C  C     . ILE A 1 399 ? -29.569 -19.138 -5.491  1.00 30.55 ? 391 ILE A C     1 
ATOM   3000 O  O     . ILE A 1 399 ? -30.271 -20.115 -5.744  1.00 30.66 ? 391 ILE A O     1 
ATOM   3001 C  CB    . ILE A 1 399 ? -27.300 -20.173 -5.554  1.00 30.61 ? 391 ILE A CB    1 
ATOM   3002 C  CG1   . ILE A 1 399 ? -25.994 -20.398 -4.791  1.00 30.94 ? 391 ILE A CG1   1 
ATOM   3003 C  CG2   . ILE A 1 399 ? -27.034 -19.540 -6.924  1.00 30.72 ? 391 ILE A CG2   1 
ATOM   3004 C  CD1   . ILE A 1 399 ? -25.165 -21.556 -5.323  1.00 32.14 ? 391 ILE A CD1   1 
ATOM   3005 N  N     . GLY A 1 400 ? -29.889 -17.899 -5.852  1.00 30.80 ? 392 GLY A N     1 
ATOM   3006 C  CA    . GLY A 1 400 ? -31.097 -17.601 -6.619  1.00 30.98 ? 392 GLY A CA    1 
ATOM   3007 C  C     . GLY A 1 400 ? -30.929 -17.903 -8.093  1.00 31.28 ? 392 GLY A C     1 
ATOM   3008 O  O     . GLY A 1 400 ? -29.846 -18.307 -8.539  1.00 31.29 ? 392 GLY A O     1 
ATOM   3009 N  N     . GLU A 1 401 ? -31.996 -17.712 -8.860  1.00 31.39 ? 393 GLU A N     1 
ATOM   3010 C  CA    . GLU A 1 401 ? -31.935 -17.956 -10.291 1.00 31.52 ? 393 GLU A CA    1 
ATOM   3011 C  C     . GLU A 1 401 ? -31.235 -16.803 -11.006 1.00 31.09 ? 393 GLU A C     1 
ATOM   3012 O  O     . GLU A 1 401 ? -31.277 -15.664 -10.552 1.00 31.08 ? 393 GLU A O     1 
ATOM   3013 C  CB    . GLU A 1 401 ? -33.335 -18.241 -10.871 1.00 31.76 ? 393 GLU A CB    1 
ATOM   3014 C  CG    . GLU A 1 401 ? -33.938 -17.139 -11.729 1.00 32.81 ? 393 GLU A CG    1 
ATOM   3015 C  CD    . GLU A 1 401 ? -34.803 -17.696 -12.857 1.00 34.48 ? 393 GLU A CD    1 
ATOM   3016 O  OE1   . GLU A 1 401 ? -34.237 -18.149 -13.878 1.00 34.54 ? 393 GLU A OE1   1 
ATOM   3017 O  OE2   . GLU A 1 401 ? -36.046 -17.681 -12.721 1.00 35.92 ? 393 GLU A OE2   1 
ATOM   3018 N  N     . ILE A 1 402 ? -30.542 -17.124 -12.088 1.00 30.78 ? 394 ILE A N     1 
ATOM   3019 C  CA    . ILE A 1 402 ? -29.747 -16.142 -12.807 1.00 30.58 ? 394 ILE A CA    1 
ATOM   3020 C  C     . ILE A 1 402 ? -30.255 -15.965 -14.240 1.00 30.47 ? 394 ILE A C     1 
ATOM   3021 O  O     . ILE A 1 402 ? -30.493 -16.940 -14.951 1.00 30.52 ? 394 ILE A O     1 
ATOM   3022 C  CB    . ILE A 1 402 ? -28.243 -16.533 -12.812 1.00 30.54 ? 394 ILE A CB    1 
ATOM   3023 C  CG1   . ILE A 1 402 ? -27.684 -16.484 -11.389 1.00 30.32 ? 394 ILE A CG1   1 
ATOM   3024 C  CG2   . ILE A 1 402 ? -27.450 -15.606 -13.702 1.00 30.40 ? 394 ILE A CG2   1 
ATOM   3025 C  CD1   . ILE A 1 402 ? -26.550 -17.435 -11.146 1.00 30.43 ? 394 ILE A CD1   1 
ATOM   3026 N  N     . CYS A 1 403 ? -30.446 -14.713 -14.643 1.00 30.33 ? 395 CYS A N     1 
ATOM   3027 C  CA    . CYS A 1 403 ? -30.868 -14.403 -15.999 1.00 30.14 ? 395 CYS A CA    1 
ATOM   3028 C  C     . CYS A 1 403 ? -29.714 -13.848 -16.808 1.00 29.96 ? 395 CYS A C     1 
ATOM   3029 O  O     . CYS A 1 403 ? -28.972 -12.989 -16.338 1.00 29.81 ? 395 CYS A O     1 
ATOM   3030 C  CB    . CYS A 1 403 ? -32.027 -13.415 -15.986 1.00 30.13 ? 395 CYS A CB    1 
ATOM   3031 S  SG    . CYS A 1 403 ? -33.419 -13.955 -15.003 1.00 30.68 ? 395 CYS A SG    1 
ATOM   3032 N  N     . TRP A 1 404 ? -29.564 -14.353 -18.027 1.00 29.96 ? 396 TRP A N     1 
ATOM   3033 C  CA    . TRP A 1 404 ? -28.472 -13.951 -18.898 1.00 29.83 ? 396 TRP A CA    1 
ATOM   3034 C  C     . TRP A 1 404 ? -29.003 -13.170 -20.095 1.00 29.93 ? 396 TRP A C     1 
ATOM   3035 O  O     . TRP A 1 404 ? -30.095 -13.450 -20.584 1.00 30.07 ? 396 TRP A O     1 
ATOM   3036 C  CB    . TRP A 1 404 ? -27.697 -15.180 -19.383 1.00 29.62 ? 396 TRP A CB    1 
ATOM   3037 C  CG    . TRP A 1 404 ? -27.063 -15.991 -18.281 1.00 29.43 ? 396 TRP A CG    1 
ATOM   3038 C  CD1   . TRP A 1 404 ? -27.401 -17.258 -17.895 1.00 28.98 ? 396 TRP A CD1   1 
ATOM   3039 C  CD2   . TRP A 1 404 ? -25.970 -15.597 -17.443 1.00 29.21 ? 396 TRP A CD2   1 
ATOM   3040 N  NE1   . TRP A 1 404 ? -26.594 -17.672 -16.864 1.00 28.57 ? 396 TRP A NE1   1 
ATOM   3041 C  CE2   . TRP A 1 404 ? -25.705 -16.672 -16.569 1.00 28.96 ? 396 TRP A CE2   1 
ATOM   3042 C  CE3   . TRP A 1 404 ? -25.190 -14.439 -17.344 1.00 29.03 ? 396 TRP A CE3   1 
ATOM   3043 C  CZ2   . TRP A 1 404 ? -24.694 -16.624 -15.611 1.00 28.81 ? 396 TRP A CZ2   1 
ATOM   3044 C  CZ3   . TRP A 1 404 ? -24.190 -14.393 -16.390 1.00 28.73 ? 396 TRP A CZ3   1 
ATOM   3045 C  CH2   . TRP A 1 404 ? -23.955 -15.476 -15.533 1.00 28.90 ? 396 TRP A CH2   1 
ATOM   3046 N  N     . PRO A 1 405 ? -28.236 -12.171 -20.558 1.00 29.98 ? 397 PRO A N     1 
ATOM   3047 C  CA    . PRO A 1 405 ? -28.526 -11.508 -21.827 1.00 30.16 ? 397 PRO A CA    1 
ATOM   3048 C  C     . PRO A 1 405 ? -28.161 -12.394 -23.016 1.00 30.31 ? 397 PRO A C     1 
ATOM   3049 O  O     . PRO A 1 405 ? -27.014 -12.824 -23.141 1.00 30.33 ? 397 PRO A O     1 
ATOM   3050 C  CB    . PRO A 1 405 ? -27.616 -10.265 -21.791 1.00 30.18 ? 397 PRO A CB    1 
ATOM   3051 C  CG    . PRO A 1 405 ? -27.094 -10.189 -20.374 1.00 29.92 ? 397 PRO A CG    1 
ATOM   3052 C  CD    . PRO A 1 405 ? -27.075 -11.576 -19.885 1.00 29.95 ? 397 PRO A CD    1 
ATOM   3053 N  N     . VAL A 1 406 ? -29.138 -12.673 -23.872 1.00 30.57 ? 398 VAL A N     1 
ATOM   3054 C  CA    . VAL A 1 406 ? -28.914 -13.516 -25.045 1.00 30.92 ? 398 VAL A CA    1 
ATOM   3055 C  C     . VAL A 1 406 ? -29.096 -12.703 -26.332 1.00 31.04 ? 398 VAL A C     1 
ATOM   3056 O  O     . VAL A 1 406 ? -30.047 -11.934 -26.460 1.00 31.07 ? 398 VAL A O     1 
ATOM   3057 C  CB    . VAL A 1 406 ? -29.851 -14.759 -25.040 1.00 30.95 ? 398 VAL A CB    1 
ATOM   3058 C  CG1   . VAL A 1 406 ? -29.563 -15.662 -26.235 1.00 31.05 ? 398 VAL A CG1   1 
ATOM   3059 C  CG2   . VAL A 1 406 ? -29.690 -15.542 -23.733 1.00 31.04 ? 398 VAL A CG2   1 
ATOM   3060 N  N     . ALA A 1 407 ? -28.164 -12.866 -27.269 1.00 31.26 ? 399 ALA A N     1 
ATOM   3061 C  CA    . ALA A 1 407 ? -28.081 -11.997 -28.452 1.00 31.61 ? 399 ALA A CA    1 
ATOM   3062 C  C     . ALA A 1 407 ? -29.193 -12.241 -29.477 1.00 31.75 ? 399 ALA A C     1 
ATOM   3063 O  O     . ALA A 1 407 ? -29.807 -13.308 -29.504 1.00 31.89 ? 399 ALA A O     1 
ATOM   3064 C  CB    . ALA A 1 407 ? -26.708 -12.121 -29.109 1.00 31.50 ? 399 ALA A CB    1 
ATOM   3065 N  N     . ARG A 1 408 ? -29.432 -11.239 -30.321 1.00 32.02 ? 400 ARG A N     1 
ATOM   3066 C  CA    . ARG A 1 408 ? -30.479 -11.298 -31.338 1.00 32.24 ? 400 ARG A CA    1 
ATOM   3067 C  C     . ARG A 1 408 ? -29.955 -10.838 -32.697 1.00 32.35 ? 400 ARG A C     1 
ATOM   3068 O  O     . ARG A 1 408 ? -29.772 -11.646 -33.612 1.00 32.39 ? 400 ARG A O     1 
ATOM   3069 C  CB    . ARG A 1 408 ? -31.674 -10.438 -30.920 1.00 32.38 ? 400 ARG A CB    1 
ATOM   3070 C  CG    . ARG A 1 408 ? -32.715 -11.185 -30.117 1.00 32.91 ? 400 ARG A CG    1 
ATOM   3071 C  CD    . ARG A 1 408 ? -33.506 -10.262 -29.199 1.00 33.84 ? 400 ARG A CD    1 
ATOM   3072 N  NE    . ARG A 1 408 ? -34.518 -9.470  -29.907 1.00 35.46 ? 400 ARG A NE    1 
ATOM   3073 C  CZ    . ARG A 1 408 ? -35.685 -9.947  -30.349 1.00 36.15 ? 400 ARG A CZ    1 
ATOM   3074 N  NH1   . ARG A 1 408 ? -35.987 -11.229 -30.201 1.00 36.38 ? 400 ARG A NH1   1 
ATOM   3075 N  NH2   . ARG A 1 408 ? -36.543 -9.141  -30.961 1.00 36.47 ? 400 ARG A NH2   1 
ATOM   3076 N  N     . MET B 1 9   ? 8.536   -10.411 6.170   1.00 35.16 ? 1   MET B N     1 
ATOM   3077 C  CA    . MET B 1 9   ? 7.210   -10.793 5.596   1.00 35.27 ? 1   MET B CA    1 
ATOM   3078 C  C     . MET B 1 9   ? 7.151   -10.528 4.093   1.00 34.61 ? 1   MET B C     1 
ATOM   3079 O  O     . MET B 1 9   ? 7.880   -9.683  3.572   1.00 34.47 ? 1   MET B O     1 
ATOM   3080 C  CB    . MET B 1 9   ? 6.074   -10.055 6.314   1.00 35.33 ? 1   MET B CB    1 
ATOM   3081 C  CG    . MET B 1 9   ? 6.284   -8.548  6.449   1.00 36.07 ? 1   MET B CG    1 
ATOM   3082 S  SD    . MET B 1 9   ? 4.915   -7.713  7.298   1.00 36.98 ? 1   MET B SD    1 
ATOM   3083 C  CE    . MET B 1 9   ? 4.791   -8.691  8.804   1.00 37.39 ? 1   MET B CE    1 
ATOM   3084 N  N     . LEU B 1 10  ? 6.267   -11.248 3.408   1.00 34.02 ? 2   LEU B N     1 
ATOM   3085 C  CA    . LEU B 1 10  ? 6.249   -11.274 1.947   1.00 33.39 ? 2   LEU B CA    1 
ATOM   3086 C  C     . LEU B 1 10  ? 5.722   -9.973  1.337   1.00 32.95 ? 2   LEU B C     1 
ATOM   3087 O  O     . LEU B 1 10  ? 4.767   -9.384  1.835   1.00 32.99 ? 2   LEU B O     1 
ATOM   3088 C  CB    . LEU B 1 10  ? 5.428   -12.463 1.451   1.00 33.34 ? 2   LEU B CB    1 
ATOM   3089 C  CG    . LEU B 1 10  ? 5.652   -12.931 0.010   1.00 33.43 ? 2   LEU B CG    1 
ATOM   3090 C  CD1   . LEU B 1 10  ? 7.122   -13.208 -0.260  1.00 32.96 ? 2   LEU B CD1   1 
ATOM   3091 C  CD2   . LEU B 1 10  ? 4.820   -14.162 -0.269  1.00 33.45 ? 2   LEU B CD2   1 
ATOM   3092 N  N     . THR B 1 11  ? 6.360   -9.542  0.254   1.00 32.36 ? 3   THR B N     1 
ATOM   3093 C  CA    . THR B 1 11  ? 6.008   -8.301  -0.423  1.00 31.80 ? 3   THR B CA    1 
ATOM   3094 C  C     . THR B 1 11  ? 5.943   -8.535  -1.930  1.00 31.38 ? 3   THR B C     1 
ATOM   3095 O  O     . THR B 1 11  ? 6.623   -9.415  -2.459  1.00 31.36 ? 3   THR B O     1 
ATOM   3096 C  CB    . THR B 1 11  ? 7.047   -7.182  -0.116  1.00 31.90 ? 3   THR B CB    1 
ATOM   3097 O  OG1   . THR B 1 11  ? 7.149   -6.994  1.300   1.00 32.35 ? 3   THR B OG1   1 
ATOM   3098 C  CG2   . THR B 1 11  ? 6.643   -5.861  -0.762  1.00 32.02 ? 3   THR B CG2   1 
ATOM   3099 N  N     . THR B 1 12  ? 5.093   -7.771  -2.607  1.00 30.81 ? 4   THR B N     1 
ATOM   3100 C  CA    . THR B 1 12  ? 5.087   -7.720  -4.060  1.00 30.20 ? 4   THR B CA    1 
ATOM   3101 C  C     . THR B 1 12  ? 5.632   -6.376  -4.509  1.00 29.76 ? 4   THR B C     1 
ATOM   3102 O  O     . THR B 1 12  ? 5.338   -5.348  -3.907  1.00 29.86 ? 4   THR B O     1 
ATOM   3103 C  CB    . THR B 1 12  ? 3.660   -7.874  -4.625  1.00 30.32 ? 4   THR B CB    1 
ATOM   3104 O  OG1   . THR B 1 12  ? 2.996   -8.971  -3.982  1.00 30.92 ? 4   THR B OG1   1 
ATOM   3105 C  CG2   . THR B 1 12  ? 3.699   -8.115  -6.127  1.00 30.03 ? 4   THR B CG2   1 
ATOM   3106 N  N     . LEU B 1 13  ? 6.430   -6.382  -5.565  1.00 29.00 ? 5   LEU B N     1 
ATOM   3107 C  CA    . LEU B 1 13  ? 6.862   -5.148  -6.176  1.00 28.36 ? 5   LEU B CA    1 
ATOM   3108 C  C     . LEU B 1 13  ? 6.804   -5.272  -7.683  1.00 27.95 ? 5   LEU B C     1 
ATOM   3109 O  O     . LEU B 1 13  ? 7.532   -6.062  -8.280  1.00 27.95 ? 5   LEU B O     1 
ATOM   3110 C  CB    . LEU B 1 13  ? 8.272   -4.779  -5.712  1.00 28.46 ? 5   LEU B CB    1 
ATOM   3111 C  CG    . LEU B 1 13  ? 8.930   -3.540  -6.331  1.00 28.56 ? 5   LEU B CG    1 
ATOM   3112 C  CD1   . LEU B 1 13  ? 8.284   -2.258  -5.831  1.00 28.23 ? 5   LEU B CD1   1 
ATOM   3113 C  CD2   . LEU B 1 13  ? 10.413  -3.541  -6.024  1.00 28.56 ? 5   LEU B CD2   1 
ATOM   3114 N  N     . ILE B 1 14  ? 5.904   -4.512  -8.292  1.00 27.31 ? 6   ILE B N     1 
ATOM   3115 C  CA    . ILE B 1 14  ? 5.731   -4.533  -9.731  1.00 26.65 ? 6   ILE B CA    1 
ATOM   3116 C  C     . ILE B 1 14  ? 6.078   -3.173  -10.316 1.00 26.43 ? 6   ILE B C     1 
ATOM   3117 O  O     . ILE B 1 14  ? 5.648   -2.143  -9.806  1.00 26.38 ? 6   ILE B O     1 
ATOM   3118 C  CB    . ILE B 1 14  ? 4.278   -4.906  -10.119 1.00 26.69 ? 6   ILE B CB    1 
ATOM   3119 C  CG1   . ILE B 1 14  ? 3.930   -6.308  -9.609  1.00 26.35 ? 6   ILE B CG1   1 
ATOM   3120 C  CG2   . ILE B 1 14  ? 4.077   -4.807  -11.631 1.00 26.05 ? 6   ILE B CG2   1 
ATOM   3121 C  CD1   . ILE B 1 14  ? 2.507   -6.732  -9.902  1.00 26.42 ? 6   ILE B CD1   1 
ATOM   3122 N  N     . TYR B 1 15  ? 6.875   -3.175  -11.376 1.00 26.04 ? 7   TYR B N     1 
ATOM   3123 C  CA    . TYR B 1 15  ? 7.171   -1.954  -12.098 1.00 25.95 ? 7   TYR B CA    1 
ATOM   3124 C  C     . TYR B 1 15  ? 7.185   -2.206  -13.601 1.00 26.02 ? 7   TYR B C     1 
ATOM   3125 O  O     . TYR B 1 15  ? 7.198   -3.350  -14.047 1.00 25.73 ? 7   TYR B O     1 
ATOM   3126 C  CB    . TYR B 1 15  ? 8.519   -1.372  -11.647 1.00 25.77 ? 7   TYR B CB    1 
ATOM   3127 C  CG    . TYR B 1 15  ? 9.698   -2.202  -12.067 1.00 25.47 ? 7   TYR B CG    1 
ATOM   3128 C  CD1   . TYR B 1 15  ? 10.342  -1.968  -13.280 1.00 25.49 ? 7   TYR B CD1   1 
ATOM   3129 C  CD2   . TYR B 1 15  ? 10.156  -3.240  -11.270 1.00 25.32 ? 7   TYR B CD2   1 
ATOM   3130 C  CE1   . TYR B 1 15  ? 11.410  -2.744  -13.680 1.00 25.83 ? 7   TYR B CE1   1 
ATOM   3131 C  CE2   . TYR B 1 15  ? 11.226  -4.018  -11.657 1.00 25.61 ? 7   TYR B CE2   1 
ATOM   3132 C  CZ    . TYR B 1 15  ? 11.849  -3.769  -12.862 1.00 25.54 ? 7   TYR B CZ    1 
ATOM   3133 O  OH    . TYR B 1 15  ? 12.909  -4.545  -13.250 1.00 25.59 ? 7   TYR B OH    1 
ATOM   3134 N  N     . ARG B 1 16  ? 7.173   -1.129  -14.374 1.00 26.31 ? 8   ARG B N     1 
ATOM   3135 C  CA    . ARG B 1 16  ? 7.510   -1.201  -15.782 1.00 26.77 ? 8   ARG B CA    1 
ATOM   3136 C  C     . ARG B 1 16  ? 8.608   -0.197  -16.091 1.00 27.19 ? 8   ARG B C     1 
ATOM   3137 O  O     . ARG B 1 16  ? 8.820   0.753   -15.339 1.00 27.18 ? 8   ARG B O     1 
ATOM   3138 C  CB    . ARG B 1 16  ? 6.280   -0.943  -16.656 1.00 26.63 ? 8   ARG B CB    1 
ATOM   3139 C  CG    . ARG B 1 16  ? 5.791   0.493   -16.643 1.00 27.01 ? 8   ARG B CG    1 
ATOM   3140 C  CD    . ARG B 1 16  ? 4.795   0.750   -17.757 1.00 27.30 ? 8   ARG B CD    1 
ATOM   3141 N  NE    . ARG B 1 16  ? 3.431   0.412   -17.359 1.00 27.76 ? 8   ARG B NE    1 
ATOM   3142 C  CZ    . ARG B 1 16  ? 2.570   1.272   -16.823 1.00 27.38 ? 8   ARG B CZ    1 
ATOM   3143 N  NH1   . ARG B 1 16  ? 2.929   2.530   -16.604 1.00 27.15 ? 8   ARG B NH1   1 
ATOM   3144 N  NH2   . ARG B 1 16  ? 1.351   0.871   -16.497 1.00 27.81 ? 8   ARG B NH2   1 
ATOM   3145 N  N     . SER B 1 17  ? 9.327   -0.426  -17.181 1.00 27.82 ? 9   SER B N     1 
ATOM   3146 C  CA    . SER B 1 17  ? 10.355  0.505   -17.621 1.00 28.49 ? 9   SER B CA    1 
ATOM   3147 C  C     . SER B 1 17  ? 10.518  0.471   -19.125 1.00 29.25 ? 9   SER B C     1 
ATOM   3148 O  O     . SER B 1 17  ? 9.865   -0.311  -19.815 1.00 29.27 ? 9   SER B O     1 
ATOM   3149 C  CB    . SER B 1 17  ? 11.694  0.213   -16.936 1.00 28.30 ? 9   SER B CB    1 
ATOM   3150 O  OG    . SER B 1 17  ? 12.234  -1.021  -17.368 1.00 27.48 ? 9   SER B OG    1 
ATOM   3151 N  N     . GLN B 1 18  ? 11.405  1.318   -19.624 1.00 30.27 ? 10  GLN B N     1 
ATOM   3152 C  CA    . GLN B 1 18  ? 11.603  1.488   -21.046 1.00 31.44 ? 10  GLN B CA    1 
ATOM   3153 C  C     . GLN B 1 18  ? 13.096  1.410   -21.357 1.00 31.86 ? 10  GLN B C     1 
ATOM   3154 O  O     . GLN B 1 18  ? 13.916  1.990   -20.642 1.00 31.76 ? 10  GLN B O     1 
ATOM   3155 C  CB    . GLN B 1 18  ? 11.038  2.844   -21.478 1.00 31.34 ? 10  GLN B CB    1 
ATOM   3156 C  CG    . GLN B 1 18  ? 11.058  3.102   -22.974 1.00 32.21 ? 10  GLN B CG    1 
ATOM   3157 C  CD    . GLN B 1 18  ? 10.614  4.512   -23.319 1.00 32.53 ? 10  GLN B CD    1 
ATOM   3158 O  OE1   . GLN B 1 18  ? 9.534   4.956   -22.912 1.00 33.24 ? 10  GLN B OE1   1 
ATOM   3159 N  NE2   . GLN B 1 18  ? 11.454  5.234   -24.059 1.00 33.39 ? 10  GLN B NE2   1 
ATOM   3160 N  N     . VAL B 1 19  ? 13.446  0.667   -22.405 1.00 32.61 ? 11  VAL B N     1 
ATOM   3161 C  CA    . VAL B 1 19  ? 14.837  0.583   -22.849 1.00 33.41 ? 11  VAL B CA    1 
ATOM   3162 C  C     . VAL B 1 19  ? 15.223  1.833   -23.625 1.00 34.05 ? 11  VAL B C     1 
ATOM   3163 O  O     . VAL B 1 19  ? 14.356  2.556   -24.114 1.00 34.06 ? 11  VAL B O     1 
ATOM   3164 C  CB    . VAL B 1 19  ? 15.101  -0.677  -23.729 1.00 33.39 ? 11  VAL B CB    1 
ATOM   3165 C  CG1   . VAL B 1 19  ? 14.692  -1.930  -22.996 1.00 33.28 ? 11  VAL B CG1   1 
ATOM   3166 C  CG2   . VAL B 1 19  ? 14.376  -0.574  -25.074 1.00 33.09 ? 11  VAL B CG2   1 
ATOM   3167 N  N     . HIS B 1 20  ? 16.523  2.099   -23.710 1.00 34.96 ? 12  HIS B N     1 
ATOM   3168 C  CA    . HIS B 1 20  ? 17.033  3.137   -24.596 1.00 35.91 ? 12  HIS B CA    1 
ATOM   3169 C  C     . HIS B 1 20  ? 17.068  2.616   -26.027 1.00 36.76 ? 12  HIS B C     1 
ATOM   3170 O  O     . HIS B 1 20  ? 17.793  1.664   -26.323 1.00 36.82 ? 12  HIS B O     1 
ATOM   3171 C  CB    . HIS B 1 20  ? 18.431  3.570   -24.165 1.00 35.78 ? 12  HIS B CB    1 
ATOM   3172 C  CG    . HIS B 1 20  ? 18.492  4.115   -22.775 1.00 35.90 ? 12  HIS B CG    1 
ATOM   3173 N  ND1   . HIS B 1 20  ? 18.275  5.446   -22.488 1.00 35.90 ? 12  HIS B ND1   1 
ATOM   3174 C  CD2   . HIS B 1 20  ? 18.740  3.510   -21.590 1.00 35.88 ? 12  HIS B CD2   1 
ATOM   3175 C  CE1   . HIS B 1 20  ? 18.390  5.637   -21.186 1.00 36.11 ? 12  HIS B CE1   1 
ATOM   3176 N  NE2   . HIS B 1 20  ? 18.673  4.478   -20.618 1.00 36.05 ? 12  HIS B NE2   1 
ATOM   3177 N  N     . PRO B 1 21  ? 16.267  3.228   -26.921 1.00 37.61 ? 13  PRO B N     1 
ATOM   3178 C  CA    . PRO B 1 21  ? 16.187  2.786   -28.318 1.00 38.35 ? 13  PRO B CA    1 
ATOM   3179 C  C     . PRO B 1 21  ? 17.424  3.205   -29.105 1.00 39.03 ? 13  PRO B C     1 
ATOM   3180 O  O     . PRO B 1 21  ? 17.781  2.560   -30.095 1.00 39.10 ? 13  PRO B O     1 
ATOM   3181 C  CB    . PRO B 1 21  ? 14.949  3.519   -28.844 1.00 38.36 ? 13  PRO B CB    1 
ATOM   3182 C  CG    . PRO B 1 21  ? 14.872  4.759   -28.020 1.00 38.05 ? 13  PRO B CG    1 
ATOM   3183 C  CD    . PRO B 1 21  ? 15.394  4.389   -26.653 1.00 37.67 ? 13  PRO B CD    1 
ATOM   3184 N  N     . ASP B 1 22  ? 18.063  4.283   -28.653 1.00 39.72 ? 14  ASP B N     1 
ATOM   3185 C  CA    . ASP B 1 22  ? 19.300  4.779   -29.235 1.00 40.45 ? 14  ASP B CA    1 
ATOM   3186 C  C     . ASP B 1 22  ? 20.409  3.730   -29.109 1.00 40.57 ? 14  ASP B C     1 
ATOM   3187 O  O     . ASP B 1 22  ? 21.095  3.408   -30.085 1.00 40.62 ? 14  ASP B O     1 
ATOM   3188 C  CB    . ASP B 1 22  ? 19.722  6.060   -28.505 1.00 40.72 ? 14  ASP B CB    1 
ATOM   3189 C  CG    . ASP B 1 22  ? 20.220  7.133   -29.444 1.00 41.55 ? 14  ASP B CG    1 
ATOM   3190 O  OD1   . ASP B 1 22  ? 20.679  6.793   -30.556 1.00 42.96 ? 14  ASP B OD1   1 
ATOM   3191 O  OD2   . ASP B 1 22  ? 20.158  8.324   -29.064 1.00 42.42 ? 14  ASP B OD2   1 
ATOM   3192 N  N     . ARG B 1 23  ? 20.554  3.186   -27.902 1.00 40.60 ? 15  ARG B N     1 
ATOM   3193 C  CA    . ARG B 1 23  ? 21.657  2.289   -27.563 1.00 40.67 ? 15  ARG B CA    1 
ATOM   3194 C  C     . ARG B 1 23  ? 21.448  0.876   -28.149 1.00 40.41 ? 15  ARG B C     1 
ATOM   3195 O  O     . ARG B 1 23  ? 20.347  0.551   -28.606 1.00 40.44 ? 15  ARG B O     1 
ATOM   3196 C  CB    . ARG B 1 23  ? 21.824  2.227   -26.036 1.00 40.68 ? 15  ARG B CB    1 
ATOM   3197 C  CG    . ARG B 1 23  ? 22.044  3.588   -25.384 1.00 40.89 ? 15  ARG B CG    1 
ATOM   3198 C  CD    . ARG B 1 23  ? 22.234  3.467   -23.882 1.00 41.41 ? 15  ARG B CD    1 
ATOM   3199 N  NE    . ARG B 1 23  ? 22.273  4.778   -23.232 1.00 43.32 ? 15  ARG B NE    1 
ATOM   3200 C  CZ    . ARG B 1 23  ? 22.451  4.966   -21.924 1.00 43.88 ? 15  ARG B CZ    1 
ATOM   3201 N  NH1   . ARG B 1 23  ? 22.610  3.927   -21.113 1.00 44.20 ? 15  ARG B NH1   1 
ATOM   3202 N  NH2   . ARG B 1 23  ? 22.471  6.198   -21.427 1.00 44.08 ? 15  ARG B NH2   1 
ATOM   3203 N  N     . PRO B 1 24  ? 22.522  0.045   -28.160 1.00 40.15 ? 16  PRO B N     1 
ATOM   3204 C  CA    . PRO B 1 24  ? 22.431  -1.361  -28.588 1.00 39.87 ? 16  PRO B CA    1 
ATOM   3205 C  C     . PRO B 1 24  ? 21.393  -2.150  -27.784 1.00 39.54 ? 16  PRO B C     1 
ATOM   3206 O  O     . PRO B 1 24  ? 21.201  -1.877  -26.598 1.00 39.63 ? 16  PRO B O     1 
ATOM   3207 C  CB    . PRO B 1 24  ? 23.835  -1.907  -28.290 1.00 39.86 ? 16  PRO B CB    1 
ATOM   3208 C  CG    . PRO B 1 24  ? 24.716  -0.720  -28.313 1.00 40.09 ? 16  PRO B CG    1 
ATOM   3209 C  CD    . PRO B 1 24  ? 23.903  0.414   -27.785 1.00 40.09 ? 16  PRO B CD    1 
ATOM   3210 N  N     . PRO B 1 25  ? 20.727  -3.129  -28.428 1.00 39.16 ? 17  PRO B N     1 
ATOM   3211 C  CA    . PRO B 1 25  ? 19.765  -3.995  -27.738 1.00 38.72 ? 17  PRO B CA    1 
ATOM   3212 C  C     . PRO B 1 25  ? 20.396  -4.703  -26.540 1.00 38.34 ? 17  PRO B C     1 
ATOM   3213 O  O     . PRO B 1 25  ? 21.568  -5.085  -26.591 1.00 38.37 ? 17  PRO B O     1 
ATOM   3214 C  CB    . PRO B 1 25  ? 19.366  -5.016  -28.817 1.00 38.72 ? 17  PRO B CB    1 
ATOM   3215 C  CG    . PRO B 1 25  ? 20.399  -4.879  -29.898 1.00 38.98 ? 17  PRO B CG    1 
ATOM   3216 C  CD    . PRO B 1 25  ? 20.847  -3.467  -29.855 1.00 39.10 ? 17  PRO B CD    1 
ATOM   3217 N  N     . VAL B 1 26  ? 19.622  -4.856  -25.468 1.00 37.83 ? 18  VAL B N     1 
ATOM   3218 C  CA    . VAL B 1 26  ? 20.141  -5.376  -24.203 1.00 37.22 ? 18  VAL B CA    1 
ATOM   3219 C  C     . VAL B 1 26  ? 20.355  -6.889  -24.260 1.00 36.91 ? 18  VAL B C     1 
ATOM   3220 O  O     . VAL B 1 26  ? 19.508  -7.628  -24.768 1.00 36.93 ? 18  VAL B O     1 
ATOM   3221 C  CB    . VAL B 1 26  ? 19.198  -5.025  -23.016 1.00 37.20 ? 18  VAL B CB    1 
ATOM   3222 C  CG1   . VAL B 1 26  ? 19.791  -5.492  -21.695 1.00 37.09 ? 18  VAL B CG1   1 
ATOM   3223 C  CG2   . VAL B 1 26  ? 18.926  -3.527  -22.976 1.00 37.08 ? 18  VAL B CG2   1 
ATOM   3224 N  N     . ASP B 1 27  ? 21.507  -7.336  -23.762 1.00 36.44 ? 19  ASP B N     1 
ATOM   3225 C  CA    . ASP B 1 27  ? 21.774  -8.758  -23.585 1.00 35.84 ? 19  ASP B CA    1 
ATOM   3226 C  C     . ASP B 1 27  ? 20.850  -9.333  -22.503 1.00 35.49 ? 19  ASP B C     1 
ATOM   3227 O  O     . ASP B 1 27  ? 21.125  -9.218  -21.304 1.00 35.41 ? 19  ASP B O     1 
ATOM   3228 C  CB    . ASP B 1 27  ? 23.248  -8.979  -23.214 1.00 35.80 ? 19  ASP B CB    1 
ATOM   3229 C  CG    . ASP B 1 27  ? 23.675  -10.442 -23.324 1.00 35.85 ? 19  ASP B CG    1 
ATOM   3230 O  OD1   . ASP B 1 27  ? 22.830  -11.298 -23.661 1.00 36.22 ? 19  ASP B OD1   1 
ATOM   3231 O  OD2   . ASP B 1 27  ? 24.863  -10.731 -23.074 1.00 35.75 ? 19  ASP B OD2   1 
ATOM   3232 N  N     . LEU B 1 28  ? 19.751  -9.941  -22.939 1.00 34.92 ? 20  LEU B N     1 
ATOM   3233 C  CA    . LEU B 1 28  ? 18.754  -10.485 -22.025 1.00 34.48 ? 20  LEU B CA    1 
ATOM   3234 C  C     . LEU B 1 28  ? 19.235  -11.767 -21.364 1.00 34.17 ? 20  LEU B C     1 
ATOM   3235 O  O     . LEU B 1 28  ? 18.848  -12.076 -20.235 1.00 34.17 ? 20  LEU B O     1 
ATOM   3236 C  CB    . LEU B 1 28  ? 17.441  -10.742 -22.760 1.00 34.47 ? 20  LEU B CB    1 
ATOM   3237 C  CG    . LEU B 1 28  ? 16.812  -9.541  -23.469 1.00 34.73 ? 20  LEU B CG    1 
ATOM   3238 C  CD1   . LEU B 1 28  ? 15.675  -9.992  -24.372 1.00 35.10 ? 20  LEU B CD1   1 
ATOM   3239 C  CD2   . LEU B 1 28  ? 16.332  -8.499  -22.463 1.00 34.62 ? 20  LEU B CD2   1 
ATOM   3240 N  N     . ASP B 1 29  ? 20.077  -12.512 -22.076 1.00 33.72 ? 21  ASP B N     1 
ATOM   3241 C  CA    . ASP B 1 29  ? 20.617  -13.765 -21.568 1.00 33.28 ? 21  ASP B CA    1 
ATOM   3242 C  C     . ASP B 1 29  ? 21.497  -13.529 -20.348 1.00 32.94 ? 21  ASP B C     1 
ATOM   3243 O  O     . ASP B 1 29  ? 21.378  -14.229 -19.345 1.00 33.05 ? 21  ASP B O     1 
ATOM   3244 C  CB    . ASP B 1 29  ? 21.411  -14.488 -22.659 1.00 33.29 ? 21  ASP B CB    1 
ATOM   3245 C  CG    . ASP B 1 29  ? 22.162  -15.698 -22.130 1.00 33.45 ? 21  ASP B CG    1 
ATOM   3246 O  OD1   . ASP B 1 29  ? 21.508  -16.698 -21.764 1.00 34.11 ? 21  ASP B OD1   1 
ATOM   3247 O  OD2   . ASP B 1 29  ? 23.407  -15.648 -22.080 1.00 33.32 ? 21  ASP B OD2   1 
ATOM   3248 N  N     . ALA B 1 30  ? 22.380  -12.539 -20.443 1.00 32.56 ? 22  ALA B N     1 
ATOM   3249 C  CA    . ALA B 1 30  ? 23.244  -12.173 -19.329 1.00 32.34 ? 22  ALA B CA    1 
ATOM   3250 C  C     . ALA B 1 30  ? 22.421  -11.588 -18.199 1.00 32.22 ? 22  ALA B C     1 
ATOM   3251 O  O     . ALA B 1 30  ? 22.663  -11.875 -17.026 1.00 32.39 ? 22  ALA B O     1 
ATOM   3252 C  CB    . ALA B 1 30  ? 24.308  -11.180 -19.782 1.00 32.26 ? 22  ALA B CB    1 
ATOM   3253 N  N     . LEU B 1 31  ? 21.439  -10.772 -18.566 1.00 32.08 ? 23  LEU B N     1 
ATOM   3254 C  CA    . LEU B 1 31  ? 20.534  -10.160 -17.609 1.00 31.87 ? 23  LEU B CA    1 
ATOM   3255 C  C     . LEU B 1 31  ? 19.839  -11.206 -16.747 1.00 31.79 ? 23  LEU B C     1 
ATOM   3256 O  O     . LEU B 1 31  ? 19.878  -11.133 -15.524 1.00 31.64 ? 23  LEU B O     1 
ATOM   3257 C  CB    . LEU B 1 31  ? 19.492  -9.318  -18.342 1.00 31.87 ? 23  LEU B CB    1 
ATOM   3258 C  CG    . LEU B 1 31  ? 18.442  -8.619  -17.482 1.00 31.81 ? 23  LEU B CG    1 
ATOM   3259 C  CD1   . LEU B 1 31  ? 19.035  -7.393  -16.831 1.00 31.49 ? 23  LEU B CD1   1 
ATOM   3260 C  CD2   . LEU B 1 31  ? 17.235  -8.249  -18.324 1.00 31.89 ? 23  LEU B CD2   1 
ATOM   3261 N  N     . VAL B 1 32  ? 19.225  -12.189 -17.399 1.00 31.82 ? 24  VAL B N     1 
ATOM   3262 C  CA    . VAL B 1 32  ? 18.368  -13.157 -16.715 1.00 31.84 ? 24  VAL B CA    1 
ATOM   3263 C  C     . VAL B 1 32  ? 19.160  -14.182 -15.879 1.00 31.72 ? 24  VAL B C     1 
ATOM   3264 O  O     . VAL B 1 32  ? 18.685  -14.640 -14.834 1.00 31.56 ? 24  VAL B O     1 
ATOM   3265 C  CB    . VAL B 1 32  ? 17.399  -13.875 -17.713 1.00 31.91 ? 24  VAL B CB    1 
ATOM   3266 C  CG1   . VAL B 1 32  ? 18.146  -14.904 -18.568 1.00 32.06 ? 24  VAL B CG1   1 
ATOM   3267 C  CG2   . VAL B 1 32  ? 16.242  -14.520 -16.969 1.00 32.11 ? 24  VAL B CG2   1 
ATOM   3268 N  N     . HIS B 1 33  ? 20.373  -14.513 -16.333 1.00 31.69 ? 25  HIS B N     1 
ATOM   3269 C  CA    . HIS B 1 33  ? 21.245  -15.458 -15.624 1.00 31.50 ? 25  HIS B CA    1 
ATOM   3270 C  C     . HIS B 1 33  ? 21.751  -14.883 -14.314 1.00 31.53 ? 25  HIS B C     1 
ATOM   3271 O  O     . HIS B 1 33  ? 21.702  -15.544 -13.281 1.00 31.44 ? 25  HIS B O     1 
ATOM   3272 C  CB    . HIS B 1 33  ? 22.432  -15.859 -16.498 1.00 31.46 ? 25  HIS B CB    1 
ATOM   3273 C  CG    . HIS B 1 33  ? 22.243  -17.155 -17.215 1.00 31.93 ? 25  HIS B CG    1 
ATOM   3274 N  ND1   . HIS B 1 33  ? 21.819  -17.226 -18.525 1.00 32.01 ? 25  HIS B ND1   1 
ATOM   3275 C  CD2   . HIS B 1 33  ? 22.422  -18.434 -16.807 1.00 32.22 ? 25  HIS B CD2   1 
ATOM   3276 C  CE1   . HIS B 1 33  ? 21.743  -18.494 -18.892 1.00 32.26 ? 25  HIS B CE1   1 
ATOM   3277 N  NE2   . HIS B 1 33  ? 22.103  -19.247 -17.868 1.00 31.87 ? 25  HIS B NE2   1 
ATOM   3278 N  N     . ARG B 1 34  ? 22.246  -13.648 -14.363 1.00 31.56 ? 26  ARG B N     1 
ATOM   3279 C  CA    . ARG B 1 34  ? 22.784  -12.995 -13.178 1.00 31.84 ? 26  ARG B CA    1 
ATOM   3280 C  C     . ARG B 1 34  ? 21.675  -12.557 -12.225 1.00 31.39 ? 26  ARG B C     1 
ATOM   3281 O  O     . ARG B 1 34  ? 21.875  -12.504 -11.012 1.00 31.31 ? 26  ARG B O     1 
ATOM   3282 C  CB    . ARG B 1 34  ? 23.685  -11.813 -13.564 1.00 31.77 ? 26  ARG B CB    1 
ATOM   3283 C  CG    . ARG B 1 34  ? 25.087  -12.238 -14.032 1.00 32.71 ? 26  ARG B CG    1 
ATOM   3284 C  CD    . ARG B 1 34  ? 25.923  -11.052 -14.536 1.00 33.37 ? 26  ARG B CD    1 
ATOM   3285 N  NE    . ARG B 1 34  ? 26.748  -10.453 -13.480 1.00 35.72 ? 26  ARG B NE    1 
ATOM   3286 C  CZ    . ARG B 1 34  ? 27.953  -10.900 -13.117 1.00 36.60 ? 26  ARG B CZ    1 
ATOM   3287 N  NH1   . ARG B 1 34  ? 28.484  -11.962 -13.715 1.00 36.87 ? 26  ARG B NH1   1 
ATOM   3288 N  NH2   . ARG B 1 34  ? 28.625  -10.287 -12.150 1.00 37.21 ? 26  ARG B NH2   1 
ATOM   3289 N  N     . ALA B 1 35  ? 20.498  -12.273 -12.780 1.00 31.03 ? 27  ALA B N     1 
ATOM   3290 C  CA    . ALA B 1 35  ? 19.327  -11.956 -11.972 1.00 30.75 ? 27  ALA B CA    1 
ATOM   3291 C  C     . ALA B 1 35  ? 18.884  -13.159 -11.149 1.00 30.57 ? 27  ALA B C     1 
ATOM   3292 O  O     . ALA B 1 35  ? 18.808  -13.086 -9.928  1.00 30.65 ? 27  ALA B O     1 
ATOM   3293 C  CB    . ALA B 1 35  ? 18.188  -11.461 -12.848 1.00 30.61 ? 27  ALA B CB    1 
ATOM   3294 N  N     . SER B 1 36  ? 18.618  -14.273 -11.823 1.00 30.29 ? 28  SER B N     1 
ATOM   3295 C  CA    . SER B 1 36  ? 18.094  -15.456 -11.157 1.00 30.11 ? 28  SER B CA    1 
ATOM   3296 C  C     . SER B 1 36  ? 19.109  -16.071 -10.189 1.00 29.97 ? 28  SER B C     1 
ATOM   3297 O  O     . SER B 1 36  ? 18.728  -16.681 -9.189  1.00 30.08 ? 28  SER B O     1 
ATOM   3298 C  CB    . SER B 1 36  ? 17.634  -16.494 -12.179 1.00 29.92 ? 28  SER B CB    1 
ATOM   3299 O  OG    . SER B 1 36  ? 18.735  -17.162 -12.752 1.00 30.44 ? 28  SER B OG    1 
ATOM   3300 N  N     . SER B 1 37  ? 20.397  -15.894 -10.485 1.00 29.66 ? 29  SER B N     1 
ATOM   3301 C  CA    . SER B 1 37  ? 21.462  -16.425 -9.632  1.00 29.42 ? 29  SER B CA    1 
ATOM   3302 C  C     . SER B 1 37  ? 21.634  -15.597 -8.370  1.00 29.35 ? 29  SER B C     1 
ATOM   3303 O  O     . SER B 1 37  ? 21.956  -16.128 -7.312  1.00 29.26 ? 29  SER B O     1 
ATOM   3304 C  CB    . SER B 1 37  ? 22.784  -16.488 -10.394 1.00 29.48 ? 29  SER B CB    1 
ATOM   3305 O  OG    . SER B 1 37  ? 23.871  -16.694 -9.510  1.00 29.53 ? 29  SER B OG    1 
ATOM   3306 N  N     . LYS B 1 38  ? 21.436  -14.288 -8.496  1.00 29.28 ? 30  LYS B N     1 
ATOM   3307 C  CA    . LYS B 1 38  ? 21.523  -13.382 -7.358  1.00 28.98 ? 30  LYS B CA    1 
ATOM   3308 C  C     . LYS B 1 38  ? 20.235  -13.419 -6.535  1.00 28.93 ? 30  LYS B C     1 
ATOM   3309 O  O     . LYS B 1 38  ? 20.265  -13.261 -5.313  1.00 29.06 ? 30  LYS B O     1 
ATOM   3310 C  CB    . LYS B 1 38  ? 21.811  -11.959 -7.835  1.00 28.82 ? 30  LYS B CB    1 
ATOM   3311 C  CG    . LYS B 1 38  ? 22.176  -10.992 -6.734  1.00 28.87 ? 30  LYS B CG    1 
ATOM   3312 C  CD    . LYS B 1 38  ? 22.238  -9.579  -7.260  1.00 28.96 ? 30  LYS B CD    1 
ATOM   3313 C  CE    . LYS B 1 38  ? 22.182  -8.568  -6.136  1.00 29.42 ? 30  LYS B CE    1 
ATOM   3314 N  NZ    . LYS B 1 38  ? 22.416  -7.185  -6.635  1.00 29.43 ? 30  LYS B NZ    1 
ATOM   3315 N  N     . ASN B 1 39  ? 19.109  -13.641 -7.210  1.00 28.78 ? 31  ASN B N     1 
ATOM   3316 C  CA    . ASN B 1 39  ? 17.807  -13.679 -6.549  1.00 28.70 ? 31  ASN B CA    1 
ATOM   3317 C  C     . ASN B 1 39  ? 17.621  -14.920 -5.690  1.00 28.71 ? 31  ASN B C     1 
ATOM   3318 O  O     . ASN B 1 39  ? 16.980  -14.866 -4.641  1.00 28.86 ? 31  ASN B O     1 
ATOM   3319 C  CB    . ASN B 1 39  ? 16.676  -13.593 -7.581  1.00 28.64 ? 31  ASN B CB    1 
ATOM   3320 C  CG    . ASN B 1 39  ? 16.438  -12.175 -8.077  1.00 28.51 ? 31  ASN B CG    1 
ATOM   3321 O  OD1   . ASN B 1 39  ? 17.238  -11.272 -7.829  1.00 27.95 ? 31  ASN B OD1   1 
ATOM   3322 N  ND2   . ASN B 1 39  ? 15.334  -11.978 -8.790  1.00 28.49 ? 31  ASN B ND2   1 
ATOM   3323 N  N     . LEU B 1 40  ? 18.196  -16.033 -6.140  1.00 28.72 ? 32  LEU B N     1 
ATOM   3324 C  CA    . LEU B 1 40  ? 17.976  -17.346 -5.522  1.00 28.67 ? 32  LEU B CA    1 
ATOM   3325 C  C     . LEU B 1 40  ? 18.367  -17.448 -4.026  1.00 28.56 ? 32  LEU B C     1 
ATOM   3326 O  O     . LEU B 1 40  ? 17.581  -17.952 -3.222  1.00 28.66 ? 32  LEU B O     1 
ATOM   3327 C  CB    . LEU B 1 40  ? 18.647  -18.454 -6.354  1.00 28.72 ? 32  LEU B CB    1 
ATOM   3328 C  CG    . LEU B 1 40  ? 18.717  -19.884 -5.801  1.00 29.11 ? 32  LEU B CG    1 
ATOM   3329 C  CD1   . LEU B 1 40  ? 17.321  -20.461 -5.508  1.00 29.07 ? 32  LEU B CD1   1 
ATOM   3330 C  CD2   . LEU B 1 40  ? 19.479  -20.775 -6.772  1.00 28.90 ? 32  LEU B CD2   1 
ATOM   3331 N  N     . PRO B 1 41  ? 19.578  -16.970 -3.652  1.00 28.46 ? 33  PRO B N     1 
ATOM   3332 C  CA    . PRO B 1 41  ? 19.957  -17.010 -2.233  1.00 28.27 ? 33  PRO B CA    1 
ATOM   3333 C  C     . PRO B 1 41  ? 19.198  -15.990 -1.379  1.00 28.16 ? 33  PRO B C     1 
ATOM   3334 O  O     . PRO B 1 41  ? 19.125  -16.143 -0.157  1.00 28.30 ? 33  PRO B O     1 
ATOM   3335 C  CB    . PRO B 1 41  ? 21.459  -16.659 -2.254  1.00 28.27 ? 33  PRO B CB    1 
ATOM   3336 C  CG    . PRO B 1 41  ? 21.872  -16.729 -3.708  1.00 28.46 ? 33  PRO B CG    1 
ATOM   3337 C  CD    . PRO B 1 41  ? 20.657  -16.411 -4.485  1.00 28.47 ? 33  PRO B CD    1 
ATOM   3338 N  N     . LEU B 1 42  ? 18.642  -14.962 -2.017  1.00 27.94 ? 34  LEU B N     1 
ATOM   3339 C  CA    . LEU B 1 42  ? 17.989  -13.871 -1.291  1.00 27.54 ? 34  LEU B CA    1 
ATOM   3340 C  C     . LEU B 1 42  ? 16.497  -14.113 -1.092  1.00 27.07 ? 34  LEU B C     1 
ATOM   3341 O  O     . LEU B 1 42  ? 15.832  -13.379 -0.358  1.00 27.17 ? 34  LEU B O     1 
ATOM   3342 C  CB    . LEU B 1 42  ? 18.223  -12.529 -1.998  1.00 27.68 ? 34  LEU B CB    1 
ATOM   3343 C  CG    . LEU B 1 42  ? 19.678  -12.073 -2.177  1.00 27.94 ? 34  LEU B CG    1 
ATOM   3344 C  CD1   . LEU B 1 42  ? 19.727  -10.692 -2.801  1.00 28.36 ? 34  LEU B CD1   1 
ATOM   3345 C  CD2   . LEU B 1 42  ? 20.438  -12.091 -0.851  1.00 28.80 ? 34  LEU B CD2   1 
ATOM   3346 N  N     . GLY B 1 43  ? 15.978  -15.150 -1.736  1.00 26.60 ? 35  GLY B N     1 
ATOM   3347 C  CA    . GLY B 1 43  ? 14.560  -15.483 -1.630  1.00 26.26 ? 35  GLY B CA    1 
ATOM   3348 C  C     . GLY B 1 43  ? 13.684  -14.566 -2.466  1.00 25.94 ? 35  GLY B C     1 
ATOM   3349 O  O     . GLY B 1 43  ? 12.604  -14.165 -2.038  1.00 25.65 ? 35  GLY B O     1 
ATOM   3350 N  N     . ILE B 1 44  ? 14.160  -14.229 -3.661  1.00 25.70 ? 36  ILE B N     1 
ATOM   3351 C  CA    . ILE B 1 44  ? 13.410  -13.382 -4.568  1.00 25.45 ? 36  ILE B CA    1 
ATOM   3352 C  C     . ILE B 1 44  ? 12.941  -14.183 -5.765  1.00 25.33 ? 36  ILE B C     1 
ATOM   3353 O  O     . ILE B 1 44  ? 13.745  -14.764 -6.492  1.00 25.59 ? 36  ILE B O     1 
ATOM   3354 C  CB    . ILE B 1 44  ? 14.242  -12.168 -5.053  1.00 25.43 ? 36  ILE B CB    1 
ATOM   3355 C  CG1   . ILE B 1 44  ? 14.749  -11.351 -3.861  1.00 25.64 ? 36  ILE B CG1   1 
ATOM   3356 C  CG2   . ILE B 1 44  ? 13.410  -11.288 -5.977  1.00 25.83 ? 36  ILE B CG2   1 
ATOM   3357 C  CD1   . ILE B 1 44  ? 15.788  -10.297 -4.227  1.00 25.35 ? 36  ILE B CD1   1 
ATOM   3358 N  N     . THR B 1 45  ? 11.632  -14.227 -5.958  1.00 25.11 ? 37  THR B N     1 
ATOM   3359 C  CA    . THR B 1 45  ? 11.055  -14.885 -7.118  1.00 24.86 ? 37  THR B CA    1 
ATOM   3360 C  C     . THR B 1 45  ? 10.373  -13.856 -8.002  1.00 24.71 ? 37  THR B C     1 
ATOM   3361 O  O     . THR B 1 45  ? 10.440  -12.653 -7.728  1.00 24.82 ? 37  THR B O     1 
ATOM   3362 C  CB    . THR B 1 45  ? 10.025  -15.944 -6.703  1.00 24.81 ? 37  THR B CB    1 
ATOM   3363 O  OG1   . THR B 1 45  ? 8.970   -15.320 -5.969  1.00 23.98 ? 37  THR B OG1   1 
ATOM   3364 C  CG2   . THR B 1 45  ? 10.674  -17.022 -5.839  1.00 24.74 ? 37  THR B CG2   1 
ATOM   3365 N  N     . GLY B 1 46  ? 9.711   -14.325 -9.056  1.00 24.34 ? 38  GLY B N     1 
ATOM   3366 C  CA    . GLY B 1 46  ? 8.916   -13.446 -9.907  1.00 24.25 ? 38  GLY B CA    1 
ATOM   3367 C  C     . GLY B 1 46  ? 9.034   -13.751 -11.388 1.00 24.18 ? 38  GLY B C     1 
ATOM   3368 O  O     . GLY B 1 46  ? 9.269   -14.899 -11.783 1.00 24.44 ? 38  GLY B O     1 
ATOM   3369 N  N     . ILE B 1 47  ? 8.876   -12.715 -12.209 1.00 23.79 ? 39  ILE B N     1 
ATOM   3370 C  CA    . ILE B 1 47  ? 8.820   -12.874 -13.659 1.00 23.41 ? 39  ILE B CA    1 
ATOM   3371 C  C     . ILE B 1 47  ? 9.185   -11.569 -14.354 1.00 23.04 ? 39  ILE B C     1 
ATOM   3372 O  O     . ILE B 1 47  ? 9.019   -10.489 -13.790 1.00 23.10 ? 39  ILE B O     1 
ATOM   3373 C  CB    . ILE B 1 47  ? 7.412   -13.324 -14.120 1.00 23.38 ? 39  ILE B CB    1 
ATOM   3374 C  CG1   . ILE B 1 47  ? 7.476   -13.968 -15.509 1.00 23.89 ? 39  ILE B CG1   1 
ATOM   3375 C  CG2   . ILE B 1 47  ? 6.423   -12.155 -14.082 1.00 22.88 ? 39  ILE B CG2   1 
ATOM   3376 C  CD1   . ILE B 1 47  ? 6.126   -14.452 -16.030 1.00 24.16 ? 39  ILE B CD1   1 
ATOM   3377 N  N     . LEU B 1 48  ? 9.688   -11.675 -15.577 1.00 22.65 ? 40  LEU B N     1 
ATOM   3378 C  CA    . LEU B 1 48  ? 10.063  -10.505 -16.353 1.00 22.27 ? 40  LEU B CA    1 
ATOM   3379 C  C     . LEU B 1 48  ? 9.492   -10.602 -17.763 1.00 22.03 ? 40  LEU B C     1 
ATOM   3380 O  O     . LEU B 1 48  ? 9.725   -11.576 -18.473 1.00 21.94 ? 40  LEU B O     1 
ATOM   3381 C  CB    . LEU B 1 48  ? 11.594  -10.355 -16.388 1.00 22.28 ? 40  LEU B CB    1 
ATOM   3382 C  CG    . LEU B 1 48  ? 12.224  -9.164  -17.129 1.00 22.18 ? 40  LEU B CG    1 
ATOM   3383 C  CD1   . LEU B 1 48  ? 11.754  -7.836  -16.568 1.00 21.65 ? 40  LEU B CD1   1 
ATOM   3384 C  CD2   . LEU B 1 48  ? 13.742  -9.253  -17.078 1.00 22.18 ? 40  LEU B CD2   1 
ATOM   3385 N  N     . LEU B 1 49  ? 8.711   -9.600  -18.143 1.00 21.81 ? 41  LEU B N     1 
ATOM   3386 C  CA    . LEU B 1 49  ? 8.127   -9.535  -19.470 1.00 21.60 ? 41  LEU B CA    1 
ATOM   3387 C  C     . LEU B 1 49  ? 8.865   -8.497  -20.294 1.00 21.67 ? 41  LEU B C     1 
ATOM   3388 O  O     . LEU B 1 49  ? 9.351   -7.509  -19.759 1.00 21.67 ? 41  LEU B O     1 
ATOM   3389 C  CB    . LEU B 1 49  ? 6.644   -9.172  -19.379 1.00 21.54 ? 41  LEU B CB    1 
ATOM   3390 C  CG    . LEU B 1 49  ? 5.607   -10.301 -19.250 1.00 21.58 ? 41  LEU B CG    1 
ATOM   3391 C  CD1   . LEU B 1 49  ? 5.888   -11.212 -18.068 1.00 21.32 ? 41  LEU B CD1   1 
ATOM   3392 C  CD2   . LEU B 1 49  ? 4.206   -9.716  -19.144 1.00 21.29 ? 41  LEU B CD2   1 
ATOM   3393 N  N     . PHE B 1 50  ? 8.957   -8.733  -21.596 1.00 21.91 ? 42  PHE B N     1 
ATOM   3394 C  CA    . PHE B 1 50  ? 9.659   -7.819  -22.497 1.00 22.16 ? 42  PHE B CA    1 
ATOM   3395 C  C     . PHE B 1 50  ? 8.968   -7.788  -23.850 1.00 22.26 ? 42  PHE B C     1 
ATOM   3396 O  O     . PHE B 1 50  ? 8.711   -8.834  -24.444 1.00 22.50 ? 42  PHE B O     1 
ATOM   3397 C  CB    . PHE B 1 50  ? 11.124  -8.253  -22.655 1.00 22.20 ? 42  PHE B CB    1 
ATOM   3398 C  CG    . PHE B 1 50  ? 11.966  -7.299  -23.468 1.00 22.34 ? 42  PHE B CG    1 
ATOM   3399 C  CD1   . PHE B 1 50  ? 12.060  -5.954  -23.119 1.00 22.67 ? 42  PHE B CD1   1 
ATOM   3400 C  CD2   . PHE B 1 50  ? 12.693  -7.755  -24.561 1.00 21.83 ? 42  PHE B CD2   1 
ATOM   3401 C  CE1   . PHE B 1 50  ? 12.848  -5.076  -23.860 1.00 22.57 ? 42  PHE B CE1   1 
ATOM   3402 C  CE2   . PHE B 1 50  ? 13.482  -6.887  -25.300 1.00 22.29 ? 42  PHE B CE2   1 
ATOM   3403 C  CZ    . PHE B 1 50  ? 13.561  -5.543  -24.946 1.00 22.26 ? 42  PHE B CZ    1 
ATOM   3404 N  N     . ASN B 1 51  ? 8.646   -6.590  -24.329 1.00 22.38 ? 43  ASN B N     1 
ATOM   3405 C  CA    . ASN B 1 51  ? 7.948   -6.451  -25.611 1.00 22.54 ? 43  ASN B CA    1 
ATOM   3406 C  C     . ASN B 1 51  ? 8.828   -5.913  -26.743 1.00 22.76 ? 43  ASN B C     1 
ATOM   3407 O  O     . ASN B 1 51  ? 8.373   -5.761  -27.878 1.00 23.02 ? 43  ASN B O     1 
ATOM   3408 C  CB    . ASN B 1 51  ? 6.659   -5.615  -25.460 1.00 22.30 ? 43  ASN B CB    1 
ATOM   3409 C  CG    . ASN B 1 51  ? 6.930   -4.163  -25.062 1.00 21.90 ? 43  ASN B CG    1 
ATOM   3410 O  OD1   . ASN B 1 51  ? 8.040   -3.649  -25.230 1.00 21.42 ? 43  ASN B OD1   1 
ATOM   3411 N  ND2   . ASN B 1 51  ? 5.902   -3.493  -24.547 1.00 20.86 ? 43  ASN B ND2   1 
ATOM   3412 N  N     . GLY B 1 52  ? 10.085  -5.624  -26.424 1.00 22.87 ? 44  GLY B N     1 
ATOM   3413 C  CA    . GLY B 1 52  ? 11.010  -5.056  -27.395 1.00 23.11 ? 44  GLY B CA    1 
ATOM   3414 C  C     . GLY B 1 52  ? 11.444  -3.658  -27.012 1.00 23.33 ? 44  GLY B C     1 
ATOM   3415 O  O     . GLY B 1 52  ? 12.603  -3.280  -27.206 1.00 23.29 ? 44  GLY B O     1 
ATOM   3416 N  N     . LEU B 1 53  ? 10.509  -2.889  -26.456 1.00 23.47 ? 45  LEU B N     1 
ATOM   3417 C  CA    . LEU B 1 53  ? 10.788  -1.528  -26.016 1.00 23.48 ? 45  LEU B CA    1 
ATOM   3418 C  C     . LEU B 1 53  ? 10.646  -1.378  -24.504 1.00 23.23 ? 45  LEU B C     1 
ATOM   3419 O  O     . LEU B 1 53  ? 11.199  -0.451  -23.910 1.00 23.24 ? 45  LEU B O     1 
ATOM   3420 C  CB    . LEU B 1 53  ? 9.854   -0.539  -26.717 1.00 23.77 ? 45  LEU B CB    1 
ATOM   3421 C  CG    . LEU B 1 53  ? 10.028  -0.337  -28.226 1.00 24.61 ? 45  LEU B CG    1 
ATOM   3422 C  CD1   . LEU B 1 53  ? 8.936   0.594   -28.760 1.00 24.45 ? 45  LEU B CD1   1 
ATOM   3423 C  CD2   . LEU B 1 53  ? 11.422  0.211   -28.555 1.00 24.55 ? 45  LEU B CD2   1 
ATOM   3424 N  N     . GLN B 1 54  ? 9.888   -2.280  -23.887 1.00 22.78 ? 46  GLN B N     1 
ATOM   3425 C  CA    . GLN B 1 54  ? 9.498   -2.114  -22.495 1.00 22.51 ? 46  GLN B CA    1 
ATOM   3426 C  C     . GLN B 1 54  ? 9.714   -3.350  -21.669 1.00 22.07 ? 46  GLN B C     1 
ATOM   3427 O  O     . GLN B 1 54  ? 9.434   -4.461  -22.113 1.00 22.08 ? 46  GLN B O     1 
ATOM   3428 C  CB    . GLN B 1 54  ? 8.035   -1.714  -22.394 1.00 22.71 ? 46  GLN B CB    1 
ATOM   3429 C  CG    . GLN B 1 54  ? 7.712   -0.396  -23.001 1.00 23.30 ? 46  GLN B CG    1 
ATOM   3430 C  CD    . GLN B 1 54  ? 6.244   -0.232  -23.210 1.00 25.18 ? 46  GLN B CD    1 
ATOM   3431 O  OE1   . GLN B 1 54  ? 5.723   -0.529  -24.288 1.00 26.46 ? 46  GLN B OE1   1 
ATOM   3432 N  NE2   . GLN B 1 54  ? 5.542   0.201   -22.165 1.00 25.10 ? 46  GLN B NE2   1 
ATOM   3433 N  N     . PHE B 1 55  ? 10.168  -3.144  -20.437 1.00 21.56 ? 47  PHE B N     1 
ATOM   3434 C  CA    . PHE B 1 55  ? 10.232  -4.202  -19.445 1.00 20.96 ? 47  PHE B CA    1 
ATOM   3435 C  C     . PHE B 1 55  ? 9.050   -4.124  -18.497 1.00 20.59 ? 47  PHE B C     1 
ATOM   3436 O  O     . PHE B 1 55  ? 8.482   -3.056  -18.288 1.00 20.71 ? 47  PHE B O     1 
ATOM   3437 C  CB    . PHE B 1 55  ? 11.519  -4.095  -18.642 1.00 21.12 ? 47  PHE B CB    1 
ATOM   3438 C  CG    . PHE B 1 55  ? 12.721  -4.610  -19.354 1.00 21.29 ? 47  PHE B CG    1 
ATOM   3439 C  CD1   . PHE B 1 55  ? 12.866  -5.967  -19.606 1.00 21.46 ? 47  PHE B CD1   1 
ATOM   3440 C  CD2   . PHE B 1 55  ? 13.737  -3.744  -19.741 1.00 21.78 ? 47  PHE B CD2   1 
ATOM   3441 C  CE1   . PHE B 1 55  ? 13.991  -6.450  -20.251 1.00 21.91 ? 47  PHE B CE1   1 
ATOM   3442 C  CE2   . PHE B 1 55  ? 14.871  -4.222  -20.376 1.00 21.82 ? 47  PHE B CE2   1 
ATOM   3443 C  CZ    . PHE B 1 55  ? 14.995  -5.577  -20.637 1.00 21.94 ? 47  PHE B CZ    1 
ATOM   3444 N  N     . PHE B 1 56  ? 8.703   -5.264  -17.913 1.00 20.09 ? 48  PHE B N     1 
ATOM   3445 C  CA    . PHE B 1 56  ? 7.669   -5.351  -16.895 1.00 19.45 ? 48  PHE B CA    1 
ATOM   3446 C  C     . PHE B 1 56  ? 8.063   -6.484  -15.975 1.00 19.22 ? 48  PHE B C     1 
ATOM   3447 O  O     . PHE B 1 56  ? 8.118   -7.635  -16.398 1.00 19.19 ? 48  PHE B O     1 
ATOM   3448 C  CB    . PHE B 1 56  ? 6.319   -5.656  -17.554 1.00 19.49 ? 48  PHE B CB    1 
ATOM   3449 C  CG    . PHE B 1 56  ? 5.157   -5.747  -16.589 1.00 18.93 ? 48  PHE B CG    1 
ATOM   3450 C  CD1   . PHE B 1 56  ? 4.944   -6.893  -15.835 1.00 18.77 ? 48  PHE B CD1   1 
ATOM   3451 C  CD2   . PHE B 1 56  ? 4.241   -4.707  -16.489 1.00 18.96 ? 48  PHE B CD2   1 
ATOM   3452 C  CE1   . PHE B 1 56  ? 3.865   -6.982  -14.970 1.00 19.12 ? 48  PHE B CE1   1 
ATOM   3453 C  CE2   . PHE B 1 56  ? 3.150   -4.796  -15.632 1.00 18.41 ? 48  PHE B CE2   1 
ATOM   3454 C  CZ    . PHE B 1 56  ? 2.963   -5.929  -14.875 1.00 18.87 ? 48  PHE B CZ    1 
ATOM   3455 N  N     . GLN B 1 57  ? 8.361   -6.162  -14.721 1.00 18.94 ? 49  GLN B N     1 
ATOM   3456 C  CA    . GLN B 1 57  ? 8.845   -7.170  -13.791 1.00 18.93 ? 49  GLN B CA    1 
ATOM   3457 C  C     . GLN B 1 57  ? 8.008   -7.263  -12.531 1.00 19.10 ? 49  GLN B C     1 
ATOM   3458 O  O     . GLN B 1 57  ? 7.691   -6.250  -11.904 1.00 18.85 ? 49  GLN B O     1 
ATOM   3459 C  CB    . GLN B 1 57  ? 10.316  -6.932  -13.435 1.00 18.82 ? 49  GLN B CB    1 
ATOM   3460 C  CG    . GLN B 1 57  ? 10.916  -8.008  -12.535 1.00 18.82 ? 49  GLN B CG    1 
ATOM   3461 C  CD    . GLN B 1 57  ? 12.431  -7.963  -12.480 1.00 19.65 ? 49  GLN B CD    1 
ATOM   3462 O  OE1   . GLN B 1 57  ? 13.038  -6.890  -12.429 1.00 19.98 ? 49  GLN B OE1   1 
ATOM   3463 N  NE2   . GLN B 1 57  ? 13.050  -9.130  -12.477 1.00 19.92 ? 49  GLN B NE2   1 
ATOM   3464 N  N     . VAL B 1 58  ? 7.646   -8.491  -12.173 1.00 19.41 ? 50  VAL B N     1 
ATOM   3465 C  CA    . VAL B 1 58  ? 7.081   -8.781  -10.869 1.00 19.93 ? 50  VAL B CA    1 
ATOM   3466 C  C     . VAL B 1 58  ? 8.179   -9.335  -9.975  1.00 20.55 ? 50  VAL B C     1 
ATOM   3467 O  O     . VAL B 1 58  ? 8.944   -10.207 -10.389 1.00 20.86 ? 50  VAL B O     1 
ATOM   3468 C  CB    . VAL B 1 58  ? 5.937   -9.813  -10.965 1.00 19.82 ? 50  VAL B CB    1 
ATOM   3469 C  CG1   . VAL B 1 58  ? 5.337   -10.072 -9.594  1.00 19.30 ? 50  VAL B CG1   1 
ATOM   3470 C  CG2   . VAL B 1 58  ? 4.872   -9.337  -11.935 1.00 19.67 ? 50  VAL B CG2   1 
ATOM   3471 N  N     . LEU B 1 59  ? 8.271   -8.810  -8.760  1.00 20.90 ? 51  LEU B N     1 
ATOM   3472 C  CA    . LEU B 1 59  ? 9.247   -9.286  -7.799  1.00 21.46 ? 51  LEU B CA    1 
ATOM   3473 C  C     . LEU B 1 59  ? 8.559   -9.670  -6.505  1.00 21.94 ? 51  LEU B C     1 
ATOM   3474 O  O     . LEU B 1 59  ? 7.779   -8.894  -5.959  1.00 21.99 ? 51  LEU B O     1 
ATOM   3475 C  CB    . LEU B 1 59  ? 10.305  -8.210  -7.530  1.00 21.37 ? 51  LEU B CB    1 
ATOM   3476 C  CG    . LEU B 1 59  ? 11.286  -7.877  -8.657  1.00 21.36 ? 51  LEU B CG    1 
ATOM   3477 C  CD1   . LEU B 1 59  ? 12.004  -6.576  -8.359  1.00 21.98 ? 51  LEU B CD1   1 
ATOM   3478 C  CD2   . LEU B 1 59  ? 12.288  -9.002  -8.864  1.00 21.23 ? 51  LEU B CD2   1 
ATOM   3479 N  N     . GLU B 1 60  ? 8.833   -10.878 -6.026  1.00 22.68 ? 52  GLU B N     1 
ATOM   3480 C  CA    . GLU B 1 60  ? 8.292   -11.334 -4.747  1.00 23.65 ? 52  GLU B CA    1 
ATOM   3481 C  C     . GLU B 1 60  ? 9.410   -11.655 -3.764  1.00 24.13 ? 52  GLU B C     1 
ATOM   3482 O  O     . GLU B 1 60  ? 10.384  -12.310 -4.112  1.00 24.12 ? 52  GLU B O     1 
ATOM   3483 C  CB    . GLU B 1 60  ? 7.396   -12.561 -4.941  1.00 23.50 ? 52  GLU B CB    1 
ATOM   3484 C  CG    . GLU B 1 60  ? 6.270   -12.362 -5.935  1.00 23.79 ? 52  GLU B CG    1 
ATOM   3485 C  CD    . GLU B 1 60  ? 5.362   -13.575 -6.046  1.00 24.05 ? 52  GLU B CD    1 
ATOM   3486 O  OE1   . GLU B 1 60  ? 5.867   -14.684 -6.335  1.00 24.43 ? 52  GLU B OE1   1 
ATOM   3487 O  OE2   . GLU B 1 60  ? 4.138   -13.417 -5.853  1.00 24.31 ? 52  GLU B OE2   1 
ATOM   3488 N  N     . GLY B 1 61  ? 9.260   -11.186 -2.534  1.00 25.01 ? 53  GLY B N     1 
ATOM   3489 C  CA    . GLY B 1 61  ? 10.255  -11.426 -1.494  1.00 26.04 ? 53  GLY B CA    1 
ATOM   3490 C  C     . GLY B 1 61  ? 9.974   -10.601 -0.258  1.00 26.76 ? 53  GLY B C     1 
ATOM   3491 O  O     . GLY B 1 61  ? 8.881   -10.059 -0.100  1.00 26.71 ? 53  GLY B O     1 
ATOM   3492 N  N     . THR B 1 62  ? 10.961  -10.506 0.625   1.00 27.55 ? 54  THR B N     1 
ATOM   3493 C  CA    . THR B 1 62  ? 10.822  -9.696  1.830   1.00 28.22 ? 54  THR B CA    1 
ATOM   3494 C  C     . THR B 1 62  ? 10.918  -8.204  1.501   1.00 28.77 ? 54  THR B C     1 
ATOM   3495 O  O     . THR B 1 62  ? 11.471  -7.820  0.461   1.00 28.95 ? 54  THR B O     1 
ATOM   3496 C  CB    . THR B 1 62  ? 11.871  -10.070 2.888   1.00 28.18 ? 54  THR B CB    1 
ATOM   3497 O  OG1   . THR B 1 62  ? 13.179  -9.761  2.399   1.00 28.15 ? 54  THR B OG1   1 
ATOM   3498 C  CG2   . THR B 1 62  ? 11.791  -11.557 3.215   1.00 28.13 ? 54  THR B CG2   1 
ATOM   3499 N  N     . GLU B 1 63  ? 10.363  -7.371  2.379   1.00 29.30 ? 55  GLU B N     1 
ATOM   3500 C  CA    . GLU B 1 63  ? 10.316  -5.930  2.148   1.00 29.95 ? 55  GLU B CA    1 
ATOM   3501 C  C     . GLU B 1 63  ? 11.718  -5.348  2.012   1.00 30.13 ? 55  GLU B C     1 
ATOM   3502 O  O     . GLU B 1 63  ? 11.974  -4.526  1.136   1.00 30.20 ? 55  GLU B O     1 
ATOM   3503 C  CB    . GLU B 1 63  ? 9.562   -5.228  3.279   1.00 30.08 ? 55  GLU B CB    1 
ATOM   3504 C  CG    . GLU B 1 63  ? 9.140   -3.805  2.950   1.00 31.21 ? 55  GLU B CG    1 
ATOM   3505 C  CD    . GLU B 1 63  ? 8.663   -3.037  4.170   1.00 32.44 ? 55  GLU B CD    1 
ATOM   3506 O  OE1   . GLU B 1 63  ? 9.398   -3.014  5.182   1.00 33.38 ? 55  GLU B OE1   1 
ATOM   3507 O  OE2   . GLU B 1 63  ? 7.558   -2.444  4.111   1.00 32.64 ? 55  GLU B OE2   1 
ATOM   3508 N  N     . GLU B 1 64  ? 12.625  -5.805  2.869   1.00 30.44 ? 56  GLU B N     1 
ATOM   3509 C  CA    . GLU B 1 64  ? 14.002  -5.322  2.872   1.00 30.92 ? 56  GLU B CA    1 
ATOM   3510 C  C     . GLU B 1 64  ? 14.791  -5.811  1.655   1.00 30.53 ? 56  GLU B C     1 
ATOM   3511 O  O     . GLU B 1 64  ? 15.662  -5.101  1.153   1.00 30.74 ? 56  GLU B O     1 
ATOM   3512 C  CB    . GLU B 1 64  ? 14.712  -5.733  4.164   1.00 30.85 ? 56  GLU B CB    1 
ATOM   3513 C  CG    . GLU B 1 64  ? 13.976  -5.308  5.439   1.00 32.02 ? 56  GLU B CG    1 
ATOM   3514 C  CD    . GLU B 1 64  ? 14.511  -5.997  6.694   1.00 32.71 ? 56  GLU B CD    1 
ATOM   3515 O  OE1   . GLU B 1 64  ? 15.539  -6.719  6.598   1.00 34.44 ? 56  GLU B OE1   1 
ATOM   3516 O  OE2   . GLU B 1 64  ? 13.903  -5.814  7.778   1.00 34.13 ? 56  GLU B OE2   1 
ATOM   3517 N  N     . ALA B 1 65  ? 14.486  -7.019  1.184   1.00 30.16 ? 57  ALA B N     1 
ATOM   3518 C  CA    . ALA B 1 65  ? 15.144  -7.563  -0.009  1.00 30.06 ? 57  ALA B CA    1 
ATOM   3519 C  C     . ALA B 1 65  ? 14.721  -6.820  -1.278  1.00 30.07 ? 57  ALA B C     1 
ATOM   3520 O  O     . ALA B 1 65  ? 15.561  -6.445  -2.098  1.00 29.98 ? 57  ALA B O     1 
ATOM   3521 C  CB    . ALA B 1 65  ? 14.874  -9.050  -0.145  1.00 29.86 ? 57  ALA B CB    1 
ATOM   3522 N  N     . LEU B 1 66  ? 13.418  -6.592  -1.420  1.00 30.22 ? 58  LEU B N     1 
ATOM   3523 C  CA    . LEU B 1 66  ? 12.880  -5.899  -2.592  1.00 30.27 ? 58  LEU B CA    1 
ATOM   3524 C  C     . LEU B 1 66  ? 13.262  -4.417  -2.645  1.00 30.33 ? 58  LEU B C     1 
ATOM   3525 O  O     . LEU B 1 66  ? 13.428  -3.856  -3.726  1.00 30.13 ? 58  LEU B O     1 
ATOM   3526 C  CB    . LEU B 1 66  ? 11.361  -6.067  -2.671  1.00 30.23 ? 58  LEU B CB    1 
ATOM   3527 C  CG    . LEU B 1 66  ? 10.858  -7.490  -2.926  1.00 29.96 ? 58  LEU B CG    1 
ATOM   3528 C  CD1   . LEU B 1 66  ? 9.370   -7.485  -3.237  1.00 29.89 ? 58  LEU B CD1   1 
ATOM   3529 C  CD2   . LEU B 1 66  ? 11.637  -8.142  -4.051  1.00 29.83 ? 58  LEU B CD2   1 
ATOM   3530 N  N     . GLU B 1 67  ? 13.403  -3.793  -1.476  1.00 30.53 ? 59  GLU B N     1 
ATOM   3531 C  CA    . GLU B 1 67  ? 13.872  -2.402  -1.392  1.00 30.86 ? 59  GLU B CA    1 
ATOM   3532 C  C     . GLU B 1 67  ? 15.313  -2.270  -1.887  1.00 30.51 ? 59  GLU B C     1 
ATOM   3533 O  O     . GLU B 1 67  ? 15.636  -1.363  -2.659  1.00 30.64 ? 59  GLU B O     1 
ATOM   3534 C  CB    . GLU B 1 67  ? 13.783  -1.890  0.048   1.00 31.08 ? 59  GLU B CB    1 
ATOM   3535 C  CG    . GLU B 1 67  ? 12.425  -1.349  0.454   1.00 31.62 ? 59  GLU B CG    1 
ATOM   3536 C  CD    . GLU B 1 67  ? 12.386  -0.936  1.918   1.00 31.96 ? 59  GLU B CD    1 
ATOM   3537 O  OE1   . GLU B 1 67  ? 12.711  -1.780  2.785   1.00 33.12 ? 59  GLU B OE1   1 
ATOM   3538 O  OE2   . GLU B 1 67  ? 12.038  0.234   2.201   1.00 33.26 ? 59  GLU B OE2   1 
ATOM   3539 N  N     . SER B 1 68  ? 16.174  -3.175  -1.428  1.00 30.12 ? 60  SER B N     1 
ATOM   3540 C  CA    . SER B 1 68  ? 17.580  -3.174  -1.817  1.00 29.76 ? 60  SER B CA    1 
ATOM   3541 C  C     . SER B 1 68  ? 17.744  -3.431  -3.313  1.00 29.50 ? 60  SER B C     1 
ATOM   3542 O  O     . SER B 1 68  ? 18.575  -2.803  -3.970  1.00 29.42 ? 60  SER B O     1 
ATOM   3543 C  CB    . SER B 1 68  ? 18.359  -4.219  -1.014  1.00 29.78 ? 60  SER B CB    1 
ATOM   3544 O  OG    . SER B 1 68  ? 19.705  -4.304  -1.452  1.00 29.93 ? 60  SER B OG    1 
ATOM   3545 N  N     . LEU B 1 69  ? 16.942  -4.352  -3.844  1.00 29.22 ? 61  LEU B N     1 
ATOM   3546 C  CA    . LEU B 1 69  ? 17.005  -4.695  -5.261  1.00 29.07 ? 61  LEU B CA    1 
ATOM   3547 C  C     . LEU B 1 69  ? 16.499  -3.551  -6.133  1.00 28.91 ? 61  LEU B C     1 
ATOM   3548 O  O     . LEU B 1 69  ? 17.103  -3.228  -7.151  1.00 28.86 ? 61  LEU B O     1 
ATOM   3549 C  CB    . LEU B 1 69  ? 16.222  -5.985  -5.551  1.00 28.94 ? 61  LEU B CB    1 
ATOM   3550 C  CG    . LEU B 1 69  ? 16.189  -6.466  -7.013  1.00 28.97 ? 61  LEU B CG    1 
ATOM   3551 C  CD1   . LEU B 1 69  ? 17.586  -6.525  -7.618  1.00 29.02 ? 61  LEU B CD1   1 
ATOM   3552 C  CD2   . LEU B 1 69  ? 15.503  -7.813  -7.130  1.00 28.98 ? 61  LEU B CD2   1 
ATOM   3553 N  N     . PHE B 1 70  ? 15.405  -2.923  -5.709  1.00 28.90 ? 62  PHE B N     1 
ATOM   3554 C  CA    . PHE B 1 70  ? 14.800  -1.835  -6.473  1.00 28.80 ? 62  PHE B CA    1 
ATOM   3555 C  C     . PHE B 1 70  ? 15.719  -0.627  -6.575  1.00 28.74 ? 62  PHE B C     1 
ATOM   3556 O  O     . PHE B 1 70  ? 15.705  0.079   -7.578  1.00 28.70 ? 62  PHE B O     1 
ATOM   3557 C  CB    . PHE B 1 70  ? 13.462  -1.426  -5.866  1.00 28.87 ? 62  PHE B CB    1 
ATOM   3558 C  CG    . PHE B 1 70  ? 12.552  -0.720  -6.827  1.00 28.91 ? 62  PHE B CG    1 
ATOM   3559 C  CD1   . PHE B 1 70  ? 11.898  0.447   -6.455  1.00 29.09 ? 62  PHE B CD1   1 
ATOM   3560 C  CD2   . PHE B 1 70  ? 12.352  -1.219  -8.111  1.00 28.63 ? 62  PHE B CD2   1 
ATOM   3561 C  CE1   . PHE B 1 70  ? 11.056  1.102   -7.341  1.00 28.96 ? 62  PHE B CE1   1 
ATOM   3562 C  CE2   . PHE B 1 70  ? 11.516  -0.571  -8.998  1.00 28.74 ? 62  PHE B CE2   1 
ATOM   3563 C  CZ    . PHE B 1 70  ? 10.866  0.595   -8.612  1.00 28.90 ? 62  PHE B CZ    1 
ATOM   3564 N  N     . SER B 1 71  ? 16.515  -0.395  -5.529  1.00 28.75 ? 63  SER B N     1 
ATOM   3565 C  CA    . SER B 1 71  ? 17.571  0.625   -5.564  1.00 28.75 ? 63  SER B CA    1 
ATOM   3566 C  C     . SER B 1 71  ? 18.504  0.396   -6.735  1.00 28.54 ? 63  SER B C     1 
ATOM   3567 O  O     . SER B 1 71  ? 18.749  1.303   -7.527  1.00 28.56 ? 63  SER B O     1 
ATOM   3568 C  CB    . SER B 1 71  ? 18.377  0.620   -4.264  1.00 28.85 ? 63  SER B CB    1 
ATOM   3569 O  OG    . SER B 1 71  ? 17.723  1.357   -3.250  1.00 29.82 ? 63  SER B OG    1 
ATOM   3570 N  N     . GLU B 1 72  ? 19.020  -0.826  -6.841  1.00 28.33 ? 64  GLU B N     1 
ATOM   3571 C  CA    . GLU B 1 72  ? 19.930  -1.193  -7.921  1.00 28.36 ? 64  GLU B CA    1 
ATOM   3572 C  C     . GLU B 1 72  ? 19.238  -1.153  -9.285  1.00 28.04 ? 64  GLU B C     1 
ATOM   3573 O  O     . GLU B 1 72  ? 19.811  -0.662  -10.261 1.00 27.73 ? 64  GLU B O     1 
ATOM   3574 C  CB    . GLU B 1 72  ? 20.527  -2.579  -7.670  1.00 28.58 ? 64  GLU B CB    1 
ATOM   3575 C  CG    . GLU B 1 72  ? 21.576  -2.611  -6.565  1.00 29.82 ? 64  GLU B CG    1 
ATOM   3576 C  CD    . GLU B 1 72  ? 21.500  -3.875  -5.728  1.00 31.71 ? 64  GLU B CD    1 
ATOM   3577 O  OE1   . GLU B 1 72  ? 21.560  -4.982  -6.307  1.00 32.06 ? 64  GLU B OE1   1 
ATOM   3578 O  OE2   . GLU B 1 72  ? 21.374  -3.761  -4.488  1.00 32.65 ? 64  GLU B OE2   1 
ATOM   3579 N  N     . ILE B 1 73  ? 18.000  -1.657  -9.335  1.00 27.77 ? 65  ILE B N     1 
ATOM   3580 C  CA    . ILE B 1 73  ? 17.220  -1.709  -10.581 1.00 27.64 ? 65  ILE B CA    1 
ATOM   3581 C  C     . ILE B 1 73  ? 16.883  -0.310  -11.113 1.00 27.75 ? 65  ILE B C     1 
ATOM   3582 O  O     . ILE B 1 73  ? 16.914  -0.078  -12.321 1.00 27.72 ? 65  ILE B O     1 
ATOM   3583 C  CB    . ILE B 1 73  ? 15.914  -2.543  -10.417 1.00 27.54 ? 65  ILE B CB    1 
ATOM   3584 C  CG1   . ILE B 1 73  ? 16.246  -4.023  -10.231 1.00 27.22 ? 65  ILE B CG1   1 
ATOM   3585 C  CG2   . ILE B 1 73  ? 14.994  -2.357  -11.624 1.00 27.00 ? 65  ILE B CG2   1 
ATOM   3586 C  CD1   . ILE B 1 73  ? 15.038  -4.929  -10.251 1.00 27.52 ? 65  ILE B CD1   1 
ATOM   3587 N  N     . GLN B 1 74  ? 16.587  0.619   -10.206 1.00 27.86 ? 66  GLN B N     1 
ATOM   3588 C  CA    . GLN B 1 74  ? 16.326  2.014   -10.590 1.00 28.20 ? 66  GLN B CA    1 
ATOM   3589 C  C     . GLN B 1 74  ? 17.596  2.722   -11.050 1.00 28.25 ? 66  GLN B C     1 
ATOM   3590 O  O     . GLN B 1 74  ? 17.540  3.693   -11.804 1.00 28.27 ? 66  GLN B O     1 
ATOM   3591 C  CB    . GLN B 1 74  ? 15.692  2.783   -9.434  1.00 28.23 ? 66  GLN B CB    1 
ATOM   3592 C  CG    . GLN B 1 74  ? 14.199  2.560   -9.289  1.00 28.48 ? 66  GLN B CG    1 
ATOM   3593 C  CD    . GLN B 1 74  ? 13.608  3.337   -8.136  1.00 29.32 ? 66  GLN B CD    1 
ATOM   3594 O  OE1   . GLN B 1 74  ? 12.768  4.214   -8.332  1.00 29.72 ? 66  GLN B OE1   1 
ATOM   3595 N  NE2   . GLN B 1 74  ? 14.052  3.026   -6.919  1.00 29.32 ? 66  GLN B NE2   1 
ATOM   3596 N  N     . SER B 1 75  ? 18.737  2.215   -10.598 1.00 28.42 ? 67  SER B N     1 
ATOM   3597 C  CA    . SER B 1 75  ? 20.026  2.825   -10.878 1.00 28.46 ? 67  SER B CA    1 
ATOM   3598 C  C     . SER B 1 75  ? 20.618  2.270   -12.177 1.00 28.47 ? 67  SER B C     1 
ATOM   3599 O  O     . SER B 1 75  ? 21.622  2.774   -12.680 1.00 28.63 ? 67  SER B O     1 
ATOM   3600 C  CB    . SER B 1 75  ? 20.981  2.565   -9.712  1.00 28.39 ? 67  SER B CB    1 
ATOM   3601 O  OG    . SER B 1 75  ? 21.744  3.712   -9.410  1.00 29.09 ? 67  SER B OG    1 
ATOM   3602 N  N     . ASP B 1 76  ? 19.979  1.235   -12.715 1.00 28.44 ? 68  ASP B N     1 
ATOM   3603 C  CA    . ASP B 1 76  ? 20.512  0.488   -13.855 1.00 28.24 ? 68  ASP B CA    1 
ATOM   3604 C  C     . ASP B 1 76  ? 20.457  1.315   -15.148 1.00 27.94 ? 68  ASP B C     1 
ATOM   3605 O  O     . ASP B 1 76  ? 19.402  1.818   -15.521 1.00 28.07 ? 68  ASP B O     1 
ATOM   3606 C  CB    . ASP B 1 76  ? 19.736  -0.821  -14.023 1.00 28.18 ? 68  ASP B CB    1 
ATOM   3607 C  CG    . ASP B 1 76  ? 20.519  -1.878  -14.779 1.00 29.03 ? 68  ASP B CG    1 
ATOM   3608 O  OD1   . ASP B 1 76  ? 21.044  -1.574  -15.870 1.00 29.64 ? 68  ASP B OD1   1 
ATOM   3609 O  OD2   . ASP B 1 76  ? 20.582  -3.029  -14.294 1.00 29.32 ? 68  ASP B OD2   1 
ATOM   3610 N  N     . PRO B 1 77  ? 21.612  1.471   -15.820 1.00 27.80 ? 69  PRO B N     1 
ATOM   3611 C  CA    . PRO B 1 77  ? 21.708  2.197   -17.096 1.00 27.53 ? 69  PRO B CA    1 
ATOM   3612 C  C     . PRO B 1 77  ? 21.118  1.444   -18.302 1.00 27.29 ? 69  PRO B C     1 
ATOM   3613 O  O     . PRO B 1 77  ? 20.980  2.021   -19.381 1.00 27.15 ? 69  PRO B O     1 
ATOM   3614 C  CB    . PRO B 1 77  ? 23.221  2.382   -17.276 1.00 27.56 ? 69  PRO B CB    1 
ATOM   3615 C  CG    . PRO B 1 77  ? 23.828  1.244   -16.535 1.00 27.51 ? 69  PRO B CG    1 
ATOM   3616 C  CD    . PRO B 1 77  ? 22.933  0.999   -15.352 1.00 27.81 ? 69  PRO B CD    1 
ATOM   3617 N  N     . ARG B 1 78  ? 20.781  0.171   -18.119 1.00 27.16 ? 70  ARG B N     1 
ATOM   3618 C  CA    . ARG B 1 78  ? 20.248  -0.643  -19.214 1.00 27.04 ? 70  ARG B CA    1 
ATOM   3619 C  C     . ARG B 1 78  ? 18.787  -0.320  -19.520 1.00 26.87 ? 70  ARG B C     1 
ATOM   3620 O  O     . ARG B 1 78  ? 18.246  -0.773  -20.527 1.00 26.86 ? 70  ARG B O     1 
ATOM   3621 C  CB    . ARG B 1 78  ? 20.401  -2.133  -18.908 1.00 27.11 ? 70  ARG B CB    1 
ATOM   3622 C  CG    . ARG B 1 78  ? 21.798  -2.683  -19.147 1.00 27.40 ? 70  ARG B CG    1 
ATOM   3623 C  CD    . ARG B 1 78  ? 21.911  -4.127  -18.657 1.00 27.83 ? 70  ARG B CD    1 
ATOM   3624 N  NE    . ARG B 1 78  ? 21.799  -4.221  -17.200 1.00 28.31 ? 70  ARG B NE    1 
ATOM   3625 C  CZ    . ARG B 1 78  ? 22.035  -5.326  -16.498 1.00 28.41 ? 70  ARG B CZ    1 
ATOM   3626 N  NH1   . ARG B 1 78  ? 22.392  -6.445  -17.113 1.00 28.66 ? 70  ARG B NH1   1 
ATOM   3627 N  NH2   . ARG B 1 78  ? 21.916  -5.311  -15.179 1.00 28.61 ? 70  ARG B NH2   1 
ATOM   3628 N  N     . HIS B 1 79  ? 18.149  0.445   -18.636 1.00 26.71 ? 71  HIS B N     1 
ATOM   3629 C  CA    . HIS B 1 79  ? 16.783  0.918   -18.868 1.00 26.59 ? 71  HIS B CA    1 
ATOM   3630 C  C     . HIS B 1 79  ? 16.528  2.277   -18.210 1.00 26.72 ? 71  HIS B C     1 
ATOM   3631 O  O     . HIS B 1 79  ? 17.359  2.777   -17.451 1.00 26.81 ? 71  HIS B O     1 
ATOM   3632 C  CB    . HIS B 1 79  ? 15.749  -0.123  -18.401 1.00 26.41 ? 71  HIS B CB    1 
ATOM   3633 C  CG    . HIS B 1 79  ? 15.716  -0.332  -16.916 1.00 26.02 ? 71  HIS B CG    1 
ATOM   3634 N  ND1   . HIS B 1 79  ? 14.731  -1.066  -16.293 1.00 25.35 ? 71  HIS B ND1   1 
ATOM   3635 C  CD2   . HIS B 1 79  ? 16.543  0.097   -15.931 1.00 25.26 ? 71  HIS B CD2   1 
ATOM   3636 C  CE1   . HIS B 1 79  ? 14.956  -1.088  -14.992 1.00 24.77 ? 71  HIS B CE1   1 
ATOM   3637 N  NE2   . HIS B 1 79  ? 16.048  -0.388  -14.747 1.00 24.59 ? 71  HIS B NE2   1 
ATOM   3638 N  N     . ARG B 1 80  ? 15.380  2.867   -18.516 1.00 26.89 ? 72  ARG B N     1 
ATOM   3639 C  CA    . ARG B 1 80  ? 15.015  4.170   -17.981 1.00 27.16 ? 72  ARG B CA    1 
ATOM   3640 C  C     . ARG B 1 80  ? 13.517  4.231   -17.735 1.00 27.17 ? 72  ARG B C     1 
ATOM   3641 O  O     . ARG B 1 80  ? 12.792  3.277   -18.030 1.00 27.00 ? 72  ARG B O     1 
ATOM   3642 C  CB    . ARG B 1 80  ? 15.421  5.282   -18.951 1.00 27.32 ? 72  ARG B CB    1 
ATOM   3643 C  CG    . ARG B 1 80  ? 14.639  5.270   -20.257 1.00 27.97 ? 72  ARG B CG    1 
ATOM   3644 C  CD    . ARG B 1 80  ? 14.943  6.478   -21.094 1.00 29.05 ? 72  ARG B CD    1 
ATOM   3645 N  NE    . ARG B 1 80  ? 14.396  6.345   -22.438 1.00 30.44 ? 72  ARG B NE    1 
ATOM   3646 C  CZ    . ARG B 1 80  ? 14.735  7.120   -23.464 1.00 31.73 ? 72  ARG B CZ    1 
ATOM   3647 N  NH1   . ARG B 1 80  ? 15.628  8.093   -23.300 1.00 31.77 ? 72  ARG B NH1   1 
ATOM   3648 N  NH2   . ARG B 1 80  ? 14.177  6.928   -24.653 1.00 32.08 ? 72  ARG B NH2   1 
ATOM   3649 N  N     . ASP B 1 81  ? 13.060  5.365   -17.200 1.00 27.27 ? 73  ASP B N     1 
ATOM   3650 C  CA    . ASP B 1 81  ? 11.641  5.595   -16.939 1.00 27.21 ? 73  ASP B CA    1 
ATOM   3651 C  C     . ASP B 1 81  ? 11.015  4.451   -16.148 1.00 26.96 ? 73  ASP B C     1 
ATOM   3652 O  O     . ASP B 1 81  ? 9.988   3.900   -16.544 1.00 26.89 ? 73  ASP B O     1 
ATOM   3653 C  CB    . ASP B 1 81  ? 10.879  5.834   -18.250 1.00 27.36 ? 73  ASP B CB    1 
ATOM   3654 C  CG    . ASP B 1 81  ? 11.342  7.087   -18.974 1.00 28.04 ? 73  ASP B CG    1 
ATOM   3655 O  OD1   . ASP B 1 81  ? 11.550  8.121   -18.300 1.00 28.89 ? 73  ASP B OD1   1 
ATOM   3656 O  OD2   . ASP B 1 81  ? 11.501  7.039   -20.214 1.00 29.06 ? 73  ASP B OD2   1 
ATOM   3657 N  N     . VAL B 1 82  ? 11.665  4.084   -15.042 1.00 26.73 ? 74  VAL B N     1 
ATOM   3658 C  CA    . VAL B 1 82  ? 11.140  3.074   -14.133 1.00 26.51 ? 74  VAL B CA    1 
ATOM   3659 C  C     . VAL B 1 82  ? 9.883   3.602   -13.462 1.00 26.39 ? 74  VAL B C     1 
ATOM   3660 O  O     . VAL B 1 82  ? 9.912   4.634   -12.800 1.00 26.38 ? 74  VAL B O     1 
ATOM   3661 C  CB    . VAL B 1 82  ? 12.179  2.690   -13.047 1.00 26.58 ? 74  VAL B CB    1 
ATOM   3662 C  CG1   . VAL B 1 82  ? 11.626  1.603   -12.133 1.00 26.13 ? 74  VAL B CG1   1 
ATOM   3663 C  CG2   . VAL B 1 82  ? 13.480  2.238   -13.690 1.00 26.65 ? 74  VAL B CG2   1 
ATOM   3664 N  N     . VAL B 1 83  ? 8.774   2.904   -13.667 1.00 26.43 ? 75  VAL B N     1 
ATOM   3665 C  CA    . VAL B 1 83  ? 7.487   3.339   -13.148 1.00 26.63 ? 75  VAL B CA    1 
ATOM   3666 C  C     . VAL B 1 83  ? 6.905   2.281   -12.216 1.00 26.78 ? 75  VAL B C     1 
ATOM   3667 O  O     . VAL B 1 83  ? 6.572   1.181   -12.645 1.00 26.87 ? 75  VAL B O     1 
ATOM   3668 C  CB    . VAL B 1 83  ? 6.477   3.638   -14.295 1.00 26.73 ? 75  VAL B CB    1 
ATOM   3669 C  CG1   . VAL B 1 83  ? 5.145   4.063   -13.732 1.00 26.39 ? 75  VAL B CG1   1 
ATOM   3670 C  CG2   . VAL B 1 83  ? 7.022   4.716   -15.231 1.00 26.78 ? 75  VAL B CG2   1 
ATOM   3671 N  N     . GLU B 1 84  ? 6.796   2.624   -10.938 1.00 27.02 ? 76  GLU B N     1 
ATOM   3672 C  CA    . GLU B 1 84  ? 6.244   1.717   -9.941  1.00 27.33 ? 76  GLU B CA    1 
ATOM   3673 C  C     . GLU B 1 84  ? 4.722   1.593   -10.087 1.00 27.54 ? 76  GLU B C     1 
ATOM   3674 O  O     . GLU B 1 84  ? 4.004   2.598   -10.121 1.00 27.40 ? 76  GLU B O     1 
ATOM   3675 C  CB    . GLU B 1 84  ? 6.605   2.201   -8.541  1.00 27.34 ? 76  GLU B CB    1 
ATOM   3676 C  CG    . GLU B 1 84  ? 6.367   1.187   -7.449  1.00 28.07 ? 76  GLU B CG    1 
ATOM   3677 C  CD    . GLU B 1 84  ? 6.864   1.666   -6.101  1.00 29.62 ? 76  GLU B CD    1 
ATOM   3678 O  OE1   . GLU B 1 84  ? 7.850   2.437   -6.064  1.00 30.21 ? 76  GLU B OE1   1 
ATOM   3679 O  OE2   . GLU B 1 84  ? 6.267   1.279   -5.077  1.00 30.41 ? 76  GLU B OE2   1 
ATOM   3680 N  N     . LEU B 1 85  ? 4.241   0.357   -10.171 1.00 27.83 ? 77  LEU B N     1 
ATOM   3681 C  CA    . LEU B 1 85  ? 2.828   0.098   -10.432 1.00 28.19 ? 77  LEU B CA    1 
ATOM   3682 C  C     . LEU B 1 85  ? 2.127   -0.482  -9.215  1.00 28.54 ? 77  LEU B C     1 
ATOM   3683 O  O     . LEU B 1 85  ? 0.980   -0.142  -8.926  1.00 28.33 ? 77  LEU B O     1 
ATOM   3684 C  CB    . LEU B 1 85  ? 2.667   -0.849  -11.625 1.00 28.19 ? 77  LEU B CB    1 
ATOM   3685 C  CG    . LEU B 1 85  ? 3.348   -0.438  -12.931 1.00 27.89 ? 77  LEU B CG    1 
ATOM   3686 C  CD1   . LEU B 1 85  ? 3.061   -1.459  -14.023 1.00 27.61 ? 77  LEU B CD1   1 
ATOM   3687 C  CD2   . LEU B 1 85  ? 2.897   0.952   -13.352 1.00 27.45 ? 77  LEU B CD2   1 
ATOM   3688 N  N     . MET B 1 86  ? 2.821   -1.366  -8.510  1.00 29.13 ? 78  MET B N     1 
ATOM   3689 C  CA    . MET B 1 86  ? 2.254   -2.036  -7.351  1.00 29.80 ? 78  MET B CA    1 
ATOM   3690 C  C     . MET B 1 86  ? 3.324   -2.339  -6.315  1.00 29.91 ? 78  MET B C     1 
ATOM   3691 O  O     . MET B 1 86  ? 4.409   -2.813  -6.648  1.00 29.87 ? 78  MET B O     1 
ATOM   3692 C  CB    . MET B 1 86  ? 1.552   -3.329  -7.776  1.00 29.76 ? 78  MET B CB    1 
ATOM   3693 C  CG    . MET B 1 86  ? 0.939   -4.104  -6.635  1.00 29.82 ? 78  MET B CG    1 
ATOM   3694 S  SD    . MET B 1 86  ? 0.177   -5.638  -7.179  1.00 30.86 ? 78  MET B SD    1 
ATOM   3695 C  CE    . MET B 1 86  ? -0.382  -6.311  -5.605  1.00 30.48 ? 78  MET B CE    1 
ATOM   3696 N  N     . ARG B 1 87  ? 3.014   -2.048  -5.059  1.00 30.48 ? 79  ARG B N     1 
ATOM   3697 C  CA    . ARG B 1 87  ? 3.861   -2.445  -3.945  1.00 31.07 ? 79  ARG B CA    1 
ATOM   3698 C  C     . ARG B 1 87  ? 3.006   -2.677  -2.721  1.00 31.31 ? 79  ARG B C     1 
ATOM   3699 O  O     . ARG B 1 87  ? 2.469   -1.733  -2.145  1.00 31.50 ? 79  ARG B O     1 
ATOM   3700 C  CB    . ARG B 1 87  ? 4.918   -1.377  -3.652  1.00 31.13 ? 79  ARG B CB    1 
ATOM   3701 C  CG    . ARG B 1 87  ? 5.881   -1.750  -2.529  1.00 31.90 ? 79  ARG B CG    1 
ATOM   3702 C  CD    . ARG B 1 87  ? 6.505   -0.517  -1.898  1.00 32.85 ? 79  ARG B CD    1 
ATOM   3703 N  NE    . ARG B 1 87  ? 7.360   0.209   -2.835  1.00 33.93 ? 79  ARG B NE    1 
ATOM   3704 C  CZ    . ARG B 1 87  ? 8.669   0.008   -2.972  1.00 34.10 ? 79  ARG B CZ    1 
ATOM   3705 N  NH1   . ARG B 1 87  ? 9.285   -0.906  -2.232  1.00 34.15 ? 79  ARG B NH1   1 
ATOM   3706 N  NH2   . ARG B 1 87  ? 9.362   0.724   -3.852  1.00 34.24 ? 79  ARG B NH2   1 
ATOM   3707 N  N     . ASP B 1 88  ? 2.871   -3.938  -2.330  1.00 31.65 ? 80  ASP B N     1 
ATOM   3708 C  CA    . ASP B 1 88  ? 2.032   -4.294  -1.198  1.00 32.02 ? 80  ASP B CA    1 
ATOM   3709 C  C     . ASP B 1 88  ? 2.494   -5.599  -0.551  1.00 32.09 ? 80  ASP B C     1 
ATOM   3710 O  O     . ASP B 1 88  ? 3.302   -6.336  -1.121  1.00 32.03 ? 80  ASP B O     1 
ATOM   3711 C  CB    . ASP B 1 88  ? 0.569   -4.408  -1.639  1.00 32.23 ? 80  ASP B CB    1 
ATOM   3712 C  CG    . ASP B 1 88  ? -0.386  -3.704  -0.686  1.00 33.34 ? 80  ASP B CG    1 
ATOM   3713 O  OD1   . ASP B 1 88  ? -0.035  -3.527  0.503   1.00 34.75 ? 80  ASP B OD1   1 
ATOM   3714 O  OD2   . ASP B 1 88  ? -1.491  -3.324  -1.128  1.00 34.51 ? 80  ASP B OD2   1 
ATOM   3715 N  N     . TYR B 1 89  ? 1.984   -5.871  0.646   1.00 32.11 ? 81  TYR B N     1 
ATOM   3716 C  CA    . TYR B 1 89  ? 2.255   -7.129  1.324   1.00 32.20 ? 81  TYR B CA    1 
ATOM   3717 C  C     . TYR B 1 89  ? 1.480   -8.270  0.671   1.00 32.25 ? 81  TYR B C     1 
ATOM   3718 O  O     . TYR B 1 89  ? 0.316   -8.109  0.297   1.00 32.33 ? 81  TYR B O     1 
ATOM   3719 C  CB    . TYR B 1 89  ? 1.904   -7.024  2.811   1.00 32.26 ? 81  TYR B CB    1 
ATOM   3720 C  CG    . TYR B 1 89  ? 2.681   -5.949  3.537   1.00 32.51 ? 81  TYR B CG    1 
ATOM   3721 C  CD1   . TYR B 1 89  ? 3.996   -6.169  3.941   1.00 33.18 ? 81  TYR B CD1   1 
ATOM   3722 C  CD2   . TYR B 1 89  ? 2.108   -4.706  3.806   1.00 32.66 ? 81  TYR B CD2   1 
ATOM   3723 C  CE1   . TYR B 1 89  ? 4.723   -5.180  4.600   1.00 32.87 ? 81  TYR B CE1   1 
ATOM   3724 C  CE2   . TYR B 1 89  ? 2.824   -3.712  4.465   1.00 32.61 ? 81  TYR B CE2   1 
ATOM   3725 C  CZ    . TYR B 1 89  ? 4.133   -3.958  4.860   1.00 32.66 ? 81  TYR B CZ    1 
ATOM   3726 O  OH    . TYR B 1 89  ? 4.853   -2.984  5.511   1.00 33.04 ? 81  TYR B OH    1 
ATOM   3727 N  N     . SER B 1 90  ? 2.137   -9.414  0.523   1.00 32.13 ? 82  SER B N     1 
ATOM   3728 C  CA    . SER B 1 90  ? 1.525   -10.572 -0.108  1.00 32.12 ? 82  SER B CA    1 
ATOM   3729 C  C     . SER B 1 90  ? 1.363   -11.719 0.889   1.00 32.08 ? 82  SER B C     1 
ATOM   3730 O  O     . SER B 1 90  ? 2.107   -11.815 1.863   1.00 32.24 ? 82  SER B O     1 
ATOM   3731 C  CB    . SER B 1 90  ? 2.357   -11.024 -1.308  1.00 32.12 ? 82  SER B CB    1 
ATOM   3732 O  OG    . SER B 1 90  ? 1.803   -12.182 -1.908  1.00 32.59 ? 82  SER B OG    1 
ATOM   3733 N  N     . ALA B 1 91  ? 0.385   -12.586 0.633   1.00 31.99 ? 83  ALA B N     1 
ATOM   3734 C  CA    . ALA B 1 91  ? 0.091   -13.712 1.520   1.00 31.79 ? 83  ALA B CA    1 
ATOM   3735 C  C     . ALA B 1 91  ? 0.773   -14.997 1.049   1.00 31.69 ? 83  ALA B C     1 
ATOM   3736 O  O     . ALA B 1 91  ? 1.064   -15.888 1.848   1.00 31.58 ? 83  ALA B O     1 
ATOM   3737 C  CB    . ALA B 1 91  ? -1.398  -13.918 1.621   1.00 31.78 ? 83  ALA B CB    1 
ATOM   3738 N  N     . TYR B 1 92  ? 1.006   -15.088 -0.258  1.00 31.56 ? 84  TYR B N     1 
ATOM   3739 C  CA    . TYR B 1 92  ? 1.621   -16.265 -0.862  1.00 31.32 ? 84  TYR B CA    1 
ATOM   3740 C  C     . TYR B 1 92  ? 2.373   -15.861 -2.119  1.00 31.23 ? 84  TYR B C     1 
ATOM   3741 O  O     . TYR B 1 92  ? 2.012   -14.886 -2.778  1.00 31.32 ? 84  TYR B O     1 
ATOM   3742 C  CB    . TYR B 1 92  ? 0.556   -17.327 -1.195  1.00 31.14 ? 84  TYR B CB    1 
ATOM   3743 C  CG    . TYR B 1 92  ? -0.424  -16.913 -2.279  1.00 30.91 ? 84  TYR B CG    1 
ATOM   3744 C  CD1   . TYR B 1 92  ? -1.550  -16.145 -1.975  1.00 30.67 ? 84  TYR B CD1   1 
ATOM   3745 C  CD2   . TYR B 1 92  ? -0.230  -17.302 -3.606  1.00 30.74 ? 84  TYR B CD2   1 
ATOM   3746 C  CE1   . TYR B 1 92  ? -2.450  -15.761 -2.965  1.00 30.60 ? 84  TYR B CE1   1 
ATOM   3747 C  CE2   . TYR B 1 92  ? -1.124  -16.927 -4.604  1.00 30.75 ? 84  TYR B CE2   1 
ATOM   3748 C  CZ    . TYR B 1 92  ? -2.232  -16.155 -4.278  1.00 31.08 ? 84  TYR B CZ    1 
ATOM   3749 O  OH    . TYR B 1 92  ? -3.121  -15.781 -5.265  1.00 30.89 ? 84  TYR B OH    1 
ATOM   3750 N  N     . ARG B 1 93  ? 3.432   -16.597 -2.437  1.00 31.12 ? 85  ARG B N     1 
ATOM   3751 C  CA    . ARG B 1 93  ? 4.166   -16.375 -3.677  1.00 30.98 ? 85  ARG B CA    1 
ATOM   3752 C  C     . ARG B 1 93  ? 3.378   -16.893 -4.869  1.00 31.03 ? 85  ARG B C     1 
ATOM   3753 O  O     . ARG B 1 93  ? 3.034   -18.068 -4.930  1.00 30.95 ? 85  ARG B O     1 
ATOM   3754 C  CB    . ARG B 1 93  ? 5.537   -17.051 -3.623  1.00 30.86 ? 85  ARG B CB    1 
ATOM   3755 C  CG    . ARG B 1 93  ? 6.536   -16.328 -2.763  1.00 30.35 ? 85  ARG B CG    1 
ATOM   3756 C  CD    . ARG B 1 93  ? 7.791   -17.147 -2.563  1.00 29.58 ? 85  ARG B CD    1 
ATOM   3757 N  NE    . ARG B 1 93  ? 8.663   -16.550 -1.554  1.00 29.26 ? 85  ARG B NE    1 
ATOM   3758 C  CZ    . ARG B 1 93  ? 9.579   -15.617 -1.808  1.00 28.75 ? 85  ARG B CZ    1 
ATOM   3759 N  NH1   . ARG B 1 93  ? 9.752   -15.163 -3.046  1.00 27.84 ? 85  ARG B NH1   1 
ATOM   3760 N  NH2   . ARG B 1 93  ? 10.318  -15.134 -0.822  1.00 28.80 ? 85  ARG B NH2   1 
ATOM   3761 N  N     . ARG B 1 94  ? 3.078   -16.002 -5.805  1.00 31.33 ? 86  ARG B N     1 
ATOM   3762 C  CA    . ARG B 1 94  ? 2.448   -16.390 -7.060  1.00 31.76 ? 86  ARG B CA    1 
ATOM   3763 C  C     . ARG B 1 94  ? 3.448   -17.131 -7.936  1.00 32.02 ? 86  ARG B C     1 
ATOM   3764 O  O     . ARG B 1 94  ? 3.100   -18.096 -8.606  1.00 32.25 ? 86  ARG B O     1 
ATOM   3765 C  CB    . ARG B 1 94  ? 1.907   -15.162 -7.796  1.00 31.69 ? 86  ARG B CB    1 
ATOM   3766 C  CG    . ARG B 1 94  ? 0.535   -14.692 -7.326  1.00 32.08 ? 86  ARG B CG    1 
ATOM   3767 C  CD    . ARG B 1 94  ? 0.594   -14.032 -5.956  1.00 32.57 ? 86  ARG B CD    1 
ATOM   3768 N  NE    . ARG B 1 94  ? -0.627  -13.288 -5.654  1.00 33.33 ? 86  ARG B NE    1 
ATOM   3769 C  CZ    . ARG B 1 94  ? -0.989  -12.904 -4.432  1.00 33.52 ? 86  ARG B CZ    1 
ATOM   3770 N  NH1   . ARG B 1 94  ? -0.231  -13.207 -3.383  1.00 33.80 ? 86  ARG B NH1   1 
ATOM   3771 N  NH2   . ARG B 1 94  ? -2.117  -12.230 -4.254  1.00 33.00 ? 86  ARG B NH2   1 
ATOM   3772 N  N     . PHE B 1 95  ? 4.696   -16.676 -7.915  1.00 32.48 ? 87  PHE B N     1 
ATOM   3773 C  CA    . PHE B 1 95  ? 5.776   -17.360 -8.609  1.00 33.02 ? 87  PHE B CA    1 
ATOM   3774 C  C     . PHE B 1 95  ? 6.662   -18.105 -7.626  1.00 33.64 ? 87  PHE B C     1 
ATOM   3775 O  O     . PHE B 1 95  ? 7.344   -17.498 -6.805  1.00 33.69 ? 87  PHE B O     1 
ATOM   3776 C  CB    . PHE B 1 95  ? 6.589   -16.371 -9.442  1.00 32.84 ? 87  PHE B CB    1 
ATOM   3777 C  CG    . PHE B 1 95  ? 5.837   -15.818 -10.609 1.00 32.36 ? 87  PHE B CG    1 
ATOM   3778 C  CD1   . PHE B 1 95  ? 5.846   -16.479 -11.831 1.00 32.03 ? 87  PHE B CD1   1 
ATOM   3779 C  CD2   . PHE B 1 95  ? 5.079   -14.660 -10.479 1.00 31.71 ? 87  PHE B CD2   1 
ATOM   3780 C  CE1   . PHE B 1 95  ? 5.129   -15.990 -12.905 1.00 32.22 ? 87  PHE B CE1   1 
ATOM   3781 C  CE2   . PHE B 1 95  ? 4.360   -14.160 -11.549 1.00 31.67 ? 87  PHE B CE2   1 
ATOM   3782 C  CZ    . PHE B 1 95  ? 4.381   -14.826 -12.765 1.00 32.33 ? 87  PHE B CZ    1 
ATOM   3783 N  N     . HIS B 1 96  ? 6.625   -19.430 -7.703  1.00 34.37 ? 88  HIS B N     1 
ATOM   3784 C  CA    . HIS B 1 96  ? 7.235   -20.285 -6.687  1.00 35.17 ? 88  HIS B CA    1 
ATOM   3785 C  C     . HIS B 1 96  ? 8.575   -20.842 -7.145  1.00 35.44 ? 88  HIS B C     1 
ATOM   3786 O  O     . HIS B 1 96  ? 9.402   -21.238 -6.323  1.00 35.57 ? 88  HIS B O     1 
ATOM   3787 C  CB    . HIS B 1 96  ? 6.283   -21.425 -6.308  1.00 35.19 ? 88  HIS B CB    1 
ATOM   3788 C  CG    . HIS B 1 96  ? 5.104   -21.553 -7.223  1.00 36.22 ? 88  HIS B CG    1 
ATOM   3789 N  ND1   . HIS B 1 96  ? 5.205   -22.057 -8.504  1.00 36.90 ? 88  HIS B ND1   1 
ATOM   3790 C  CD2   . HIS B 1 96  ? 3.803   -21.217 -7.052  1.00 36.58 ? 88  HIS B CD2   1 
ATOM   3791 C  CE1   . HIS B 1 96  ? 4.015   -22.033 -9.079  1.00 36.91 ? 88  HIS B CE1   1 
ATOM   3792 N  NE2   . HIS B 1 96  ? 3.147   -21.530 -8.219  1.00 37.34 ? 88  HIS B NE2   1 
ATOM   3793 N  N     . GLY B 1 97  ? 8.793   -20.845 -8.460  1.00 35.68 ? 89  GLY B N     1 
ATOM   3794 C  CA    . GLY B 1 97  ? 10.027  -21.371 -9.041  1.00 36.00 ? 89  GLY B CA    1 
ATOM   3795 C  C     . GLY B 1 97  ? 11.275  -20.589 -8.658  1.00 36.28 ? 89  GLY B C     1 
ATOM   3796 O  O     . GLY B 1 97  ? 11.194  -19.482 -8.118  1.00 36.43 ? 89  GLY B O     1 
ATOM   3797 N  N     . THR B 1 98  ? 12.433  -21.170 -8.952  1.00 36.45 ? 90  THR B N     1 
ATOM   3798 C  CA    . THR B 1 98  ? 13.721  -20.572 -8.606  1.00 36.54 ? 90  THR B CA    1 
ATOM   3799 C  C     . THR B 1 98  ? 14.054  -19.354 -9.477  1.00 36.40 ? 90  THR B C     1 
ATOM   3800 O  O     . THR B 1 98  ? 14.001  -19.418 -10.712 1.00 36.33 ? 90  THR B O     1 
ATOM   3801 C  CB    . THR B 1 98  ? 14.866  -21.621 -8.720  1.00 36.68 ? 90  THR B CB    1 
ATOM   3802 O  OG1   . THR B 1 98  ? 14.859  -22.469 -7.563  1.00 37.08 ? 90  THR B OG1   1 
ATOM   3803 C  CG2   . THR B 1 98  ? 16.231  -20.940 -8.848  1.00 36.77 ? 90  THR B CG2   1 
ATOM   3804 N  N     . GLY B 1 99  ? 14.368  -18.241 -8.820  1.00 36.37 ? 91  GLY B N     1 
ATOM   3805 C  CA    . GLY B 1 99  ? 15.051  -17.124 -9.470  1.00 36.18 ? 91  GLY B CA    1 
ATOM   3806 C  C     . GLY B 1 99  ? 14.165  -16.213 -10.298 1.00 36.09 ? 91  GLY B C     1 
ATOM   3807 O  O     . GLY B 1 99  ? 13.312  -15.494 -9.761  1.00 36.04 ? 91  GLY B O     1 
ATOM   3808 N  N     . MET B 1 100 ? 14.374  -16.242 -11.615 1.00 35.81 ? 92  MET B N     1 
ATOM   3809 C  CA    . MET B 1 100 ? 13.836  -15.224 -12.506 1.00 35.36 ? 92  MET B CA    1 
ATOM   3810 C  C     . MET B 1 100 ? 13.639  -15.767 -13.911 1.00 35.09 ? 92  MET B C     1 
ATOM   3811 O  O     . MET B 1 100 ? 14.597  -16.152 -14.579 1.00 34.95 ? 92  MET B O     1 
ATOM   3812 C  CB    . MET B 1 100 ? 14.763  -13.997 -12.532 1.00 35.40 ? 92  MET B CB    1 
ATOM   3813 C  CG    . MET B 1 100 ? 14.217  -12.787 -13.300 1.00 35.39 ? 92  MET B CG    1 
ATOM   3814 S  SD    . MET B 1 100 ? 12.508  -12.356 -12.888 1.00 36.11 ? 92  MET B SD    1 
ATOM   3815 C  CE    . MET B 1 100 ? 12.606  -12.119 -11.110 1.00 35.84 ? 92  MET B CE    1 
ATOM   3816 N  N     . ARG B 1 101 ? 12.386  -15.803 -14.349 1.00 34.87 ? 93  ARG B N     1 
ATOM   3817 C  CA    . ARG B 1 101 ? 12.052  -16.226 -15.700 1.00 34.70 ? 93  ARG B CA    1 
ATOM   3818 C  C     . ARG B 1 101 ? 11.838  -15.011 -16.580 1.00 34.39 ? 93  ARG B C     1 
ATOM   3819 O  O     . ARG B 1 101 ? 11.352  -13.980 -16.119 1.00 34.51 ? 93  ARG B O     1 
ATOM   3820 C  CB    . ARG B 1 101 ? 10.788  -17.081 -15.691 1.00 34.91 ? 93  ARG B CB    1 
ATOM   3821 C  CG    . ARG B 1 101 ? 10.763  -18.142 -14.610 1.00 35.77 ? 93  ARG B CG    1 
ATOM   3822 C  CD    . ARG B 1 101 ? 9.495   -18.974 -14.685 1.00 37.14 ? 93  ARG B CD    1 
ATOM   3823 N  NE    . ARG B 1 101 ? 9.714   -20.341 -14.216 1.00 37.76 ? 93  ARG B NE    1 
ATOM   3824 C  CZ    . ARG B 1 101 ? 10.067  -21.356 -15.002 1.00 38.26 ? 93  ARG B CZ    1 
ATOM   3825 N  NH1   . ARG B 1 101 ? 10.237  -21.165 -16.308 1.00 38.58 ? 93  ARG B NH1   1 
ATOM   3826 N  NH2   . ARG B 1 101 ? 10.247  -22.564 -14.485 1.00 38.30 ? 93  ARG B NH2   1 
ATOM   3827 N  N     . ILE B 1 102 ? 12.204  -15.132 -17.850 1.00 33.99 ? 94  ILE B N     1 
ATOM   3828 C  CA    . ILE B 1 102 ? 11.985  -14.057 -18.806 1.00 33.74 ? 94  ILE B CA    1 
ATOM   3829 C  C     . ILE B 1 102 ? 11.043  -14.493 -19.932 1.00 33.58 ? 94  ILE B C     1 
ATOM   3830 O  O     . ILE B 1 102 ? 11.153  -15.605 -20.458 1.00 33.60 ? 94  ILE B O     1 
ATOM   3831 C  CB    . ILE B 1 102 ? 13.319  -13.519 -19.385 1.00 33.85 ? 94  ILE B CB    1 
ATOM   3832 C  CG1   . ILE B 1 102 ? 13.059  -12.405 -20.404 1.00 33.60 ? 94  ILE B CG1   1 
ATOM   3833 C  CG2   . ILE B 1 102 ? 14.133  -14.643 -19.995 1.00 34.06 ? 94  ILE B CG2   1 
ATOM   3834 C  CD1   . ILE B 1 102 ? 14.301  -11.684 -20.850 1.00 34.08 ? 94  ILE B CD1   1 
ATOM   3835 N  N     . LEU B 1 103 ? 10.111  -13.612 -20.281 1.00 33.22 ? 95  LEU B N     1 
ATOM   3836 C  CA    . LEU B 1 103 ? 9.070   -13.929 -21.234 1.00 32.99 ? 95  LEU B CA    1 
ATOM   3837 C  C     . LEU B 1 103 ? 9.018   -12.864 -22.328 1.00 32.84 ? 95  LEU B C     1 
ATOM   3838 O  O     . LEU B 1 103 ? 8.389   -11.816 -22.156 1.00 32.92 ? 95  LEU B O     1 
ATOM   3839 C  CB    . LEU B 1 103 ? 7.726   -14.012 -20.512 1.00 33.11 ? 95  LEU B CB    1 
ATOM   3840 C  CG    . LEU B 1 103 ? 6.768   -15.143 -20.883 1.00 33.33 ? 95  LEU B CG    1 
ATOM   3841 C  CD1   . LEU B 1 103 ? 6.063   -15.661 -19.634 1.00 33.35 ? 95  LEU B CD1   1 
ATOM   3842 C  CD2   . LEU B 1 103 ? 5.759   -14.676 -21.916 1.00 33.41 ? 95  LEU B CD2   1 
ATOM   3843 N  N     . ASP B 1 104 ? 9.705   -13.124 -23.442 1.00 32.57 ? 96  ASP B N     1 
ATOM   3844 C  CA    . ASP B 1 104 ? 9.708   -12.205 -24.586 1.00 32.33 ? 96  ASP B CA    1 
ATOM   3845 C  C     . ASP B 1 104 ? 8.374   -12.267 -25.329 1.00 32.20 ? 96  ASP B C     1 
ATOM   3846 O  O     . ASP B 1 104 ? 8.064   -13.264 -25.983 1.00 32.10 ? 96  ASP B O     1 
ATOM   3847 C  CB    . ASP B 1 104 ? 10.861  -12.538 -25.539 1.00 32.26 ? 96  ASP B CB    1 
ATOM   3848 C  CG    . ASP B 1 104 ? 11.176  -11.399 -26.509 1.00 32.26 ? 96  ASP B CG    1 
ATOM   3849 O  OD1   . ASP B 1 104 ? 10.318  -10.513 -26.707 1.00 31.23 ? 96  ASP B OD1   1 
ATOM   3850 O  OD2   . ASP B 1 104 ? 12.292  -11.397 -27.077 1.00 33.13 ? 96  ASP B OD2   1 
ATOM   3851 N  N     . LEU B 1 105 ? 7.604   -11.184 -25.241 1.00 32.12 ? 97  LEU B N     1 
ATOM   3852 C  CA    . LEU B 1 105 ? 6.228   -11.158 -25.742 1.00 32.34 ? 97  LEU B CA    1 
ATOM   3853 C  C     . LEU B 1 105 ? 6.142   -11.124 -27.269 1.00 32.49 ? 97  LEU B C     1 
ATOM   3854 O  O     . LEU B 1 105 ? 5.102   -11.455 -27.846 1.00 32.56 ? 97  LEU B O     1 
ATOM   3855 C  CB    . LEU B 1 105 ? 5.462   -9.973  -25.151 1.00 32.20 ? 97  LEU B CB    1 
ATOM   3856 C  CG    . LEU B 1 105 ? 5.281   -9.940  -23.632 1.00 32.21 ? 97  LEU B CG    1 
ATOM   3857 C  CD1   . LEU B 1 105 ? 4.451   -8.734  -23.226 1.00 32.26 ? 97  LEU B CD1   1 
ATOM   3858 C  CD2   . LEU B 1 105 ? 4.639   -11.219 -23.137 1.00 31.85 ? 97  LEU B CD2   1 
ATOM   3859 N  N     . ARG B 1 106 ? 7.235   -10.720 -27.915 1.00 32.73 ? 98  ARG B N     1 
ATOM   3860 C  CA    . ARG B 1 106 ? 7.295   -10.650 -29.379 1.00 32.93 ? 98  ARG B CA    1 
ATOM   3861 C  C     . ARG B 1 106 ? 7.125   -12.023 -30.021 1.00 33.15 ? 98  ARG B C     1 
ATOM   3862 O  O     . ARG B 1 106 ? 6.771   -12.129 -31.196 1.00 33.09 ? 98  ARG B O     1 
ATOM   3863 C  CB    . ARG B 1 106 ? 8.616   -10.019 -29.834 1.00 32.70 ? 98  ARG B CB    1 
ATOM   3864 C  CG    . ARG B 1 106 ? 8.615   -8.500  -29.829 1.00 32.52 ? 98  ARG B CG    1 
ATOM   3865 C  CD    . ARG B 1 106 ? 10.006  -7.942  -30.095 1.00 31.62 ? 98  ARG B CD    1 
ATOM   3866 N  NE    . ARG B 1 106 ? 10.985  -8.453  -29.138 1.00 31.54 ? 98  ARG B NE    1 
ATOM   3867 C  CZ    . ARG B 1 106 ? 12.262  -8.083  -29.097 1.00 31.54 ? 98  ARG B CZ    1 
ATOM   3868 N  NH1   . ARG B 1 106 ? 12.726  -7.192  -29.964 1.00 31.60 ? 98  ARG B NH1   1 
ATOM   3869 N  NH2   . ARG B 1 106 ? 13.078  -8.609  -28.191 1.00 31.35 ? 98  ARG B NH2   1 
ATOM   3870 N  N     . LEU B 1 107 ? 7.364   -13.070 -29.237 1.00 33.49 ? 99  LEU B N     1 
ATOM   3871 C  CA    . LEU B 1 107 ? 7.344   -14.436 -29.743 1.00 34.12 ? 99  LEU B CA    1 
ATOM   3872 C  C     . LEU B 1 107 ? 6.069   -15.182 -29.339 1.00 34.64 ? 99  LEU B C     1 
ATOM   3873 O  O     . LEU B 1 107 ? 6.056   -16.411 -29.263 1.00 34.56 ? 99  LEU B O     1 
ATOM   3874 C  CB    . LEU B 1 107 ? 8.584   -15.194 -29.260 1.00 33.99 ? 99  LEU B CB    1 
ATOM   3875 C  CG    . LEU B 1 107 ? 9.924   -14.471 -29.440 1.00 33.88 ? 99  LEU B CG    1 
ATOM   3876 C  CD1   . LEU B 1 107 ? 11.002  -15.111 -28.580 1.00 33.79 ? 99  LEU B CD1   1 
ATOM   3877 C  CD2   . LEU B 1 107 ? 10.345  -14.432 -30.909 1.00 33.67 ? 99  LEU B CD2   1 
ATOM   3878 N  N     . PHE B 1 108 ? 4.999   -14.427 -29.093 1.00 35.52 ? 100 PHE B N     1 
ATOM   3879 C  CA    . PHE B 1 108 ? 3.709   -15.001 -28.708 1.00 36.38 ? 100 PHE B CA    1 
ATOM   3880 C  C     . PHE B 1 108 ? 2.571   -14.306 -29.433 1.00 37.21 ? 100 PHE B C     1 
ATOM   3881 O  O     . PHE B 1 108 ? 2.552   -13.078 -29.545 1.00 37.25 ? 100 PHE B O     1 
ATOM   3882 C  CB    . PHE B 1 108 ? 3.493   -14.873 -27.198 1.00 36.29 ? 100 PHE B CB    1 
ATOM   3883 C  CG    . PHE B 1 108 ? 4.238   -15.891 -26.387 1.00 36.21 ? 100 PHE B CG    1 
ATOM   3884 C  CD1   . PHE B 1 108 ? 5.447   -15.569 -25.784 1.00 35.94 ? 100 PHE B CD1   1 
ATOM   3885 C  CD2   . PHE B 1 108 ? 3.724   -17.170 -26.213 1.00 35.91 ? 100 PHE B CD2   1 
ATOM   3886 C  CE1   . PHE B 1 108 ? 6.135   -16.508 -25.030 1.00 36.00 ? 100 PHE B CE1   1 
ATOM   3887 C  CE2   . PHE B 1 108 ? 4.405   -18.111 -25.458 1.00 35.92 ? 100 PHE B CE2   1 
ATOM   3888 C  CZ    . PHE B 1 108 ? 5.611   -17.780 -24.866 1.00 36.13 ? 100 PHE B CZ    1 
ATOM   3889 N  N     . GLU B 1 109 ? 1.612   -15.090 -29.912 1.00 38.32 ? 101 GLU B N     1 
ATOM   3890 C  CA    . GLU B 1 109 ? 0.396   -14.529 -30.488 1.00 39.41 ? 101 GLU B CA    1 
ATOM   3891 C  C     . GLU B 1 109 ? -0.678  -14.385 -29.414 1.00 39.74 ? 101 GLU B C     1 
ATOM   3892 O  O     . GLU B 1 109 ? -0.474  -14.790 -28.271 1.00 39.95 ? 101 GLU B O     1 
ATOM   3893 C  CB    . GLU B 1 109 ? -0.104  -15.393 -31.646 1.00 39.61 ? 101 GLU B CB    1 
ATOM   3894 C  CG    . GLU B 1 109 ? -0.888  -14.615 -32.702 1.00 40.91 ? 101 GLU B CG    1 
ATOM   3895 C  CD    . GLU B 1 109 ? -0.729  -15.194 -34.093 1.00 42.64 ? 101 GLU B CD    1 
ATOM   3896 O  OE1   . GLU B 1 109 ? 0.425   -15.289 -34.573 1.00 43.15 ? 101 GLU B OE1   1 
ATOM   3897 O  OE2   . GLU B 1 109 ? -1.759  -15.549 -34.710 1.00 43.70 ? 101 GLU B OE2   1 
ATOM   3898 N  N     . THR B 1 110 ? -1.815  -13.802 -29.791 1.00 40.16 ? 102 THR B N     1 
ATOM   3899 C  CA    . THR B 1 110 ? -2.880  -13.465 -28.845 1.00 40.58 ? 102 THR B CA    1 
ATOM   3900 C  C     . THR B 1 110 ? -3.224  -14.628 -27.911 1.00 40.69 ? 102 THR B C     1 
ATOM   3901 O  O     . THR B 1 110 ? -3.377  -15.772 -28.357 1.00 40.68 ? 102 THR B O     1 
ATOM   3902 C  CB    . THR B 1 110 ? -4.162  -13.004 -29.580 1.00 40.74 ? 102 THR B CB    1 
ATOM   3903 O  OG1   . THR B 1 110 ? -3.805  -12.247 -30.745 1.00 40.90 ? 102 THR B OG1   1 
ATOM   3904 C  CG2   . THR B 1 110 ? -5.035  -12.140 -28.658 1.00 41.14 ? 102 THR B CG2   1 
ATOM   3905 N  N     . ASP B 1 111 ? -3.318  -14.319 -26.610 1.00 40.74 ? 103 ASP B N     1 
ATOM   3906 C  CA    . ASP B 1 111 ? -3.671  -15.296 -25.559 1.00 40.71 ? 103 ASP B CA    1 
ATOM   3907 C  C     . ASP B 1 111 ? -2.519  -16.232 -25.188 1.00 40.44 ? 103 ASP B C     1 
ATOM   3908 O  O     . ASP B 1 111 ? -2.570  -16.910 -24.161 1.00 40.50 ? 103 ASP B O     1 
ATOM   3909 C  CB    . ASP B 1 111 ? -4.919  -16.118 -25.941 1.00 40.97 ? 103 ASP B CB    1 
ATOM   3910 C  CG    . ASP B 1 111 ? -6.059  -15.252 -26.458 1.00 41.85 ? 103 ASP B CG    1 
ATOM   3911 O  OD1   . ASP B 1 111 ? -6.524  -14.362 -25.709 1.00 42.53 ? 103 ASP B OD1   1 
ATOM   3912 O  OD2   . ASP B 1 111 ? -6.491  -15.467 -27.615 1.00 42.59 ? 103 ASP B OD2   1 
ATOM   3913 N  N     . GLY B 1 112 ? -1.482  -16.258 -26.021 1.00 40.17 ? 104 GLY B N     1 
ATOM   3914 C  CA    . GLY B 1 112 ? -0.378  -17.202 -25.856 1.00 39.74 ? 104 GLY B CA    1 
ATOM   3915 C  C     . GLY B 1 112 ? 0.545   -16.864 -24.701 1.00 39.57 ? 104 GLY B C     1 
ATOM   3916 O  O     . GLY B 1 112 ? 1.146   -17.756 -24.096 1.00 39.50 ? 104 GLY B O     1 
ATOM   3917 N  N     . ALA B 1 113 ? 0.660   -15.574 -24.395 1.00 39.32 ? 105 ALA B N     1 
ATOM   3918 C  CA    . ALA B 1 113 ? 1.539   -15.115 -23.322 1.00 39.18 ? 105 ALA B CA    1 
ATOM   3919 C  C     . ALA B 1 113 ? 0.965   -15.445 -21.948 1.00 39.06 ? 105 ALA B C     1 
ATOM   3920 O  O     . ALA B 1 113 ? 1.696   -15.818 -21.034 1.00 39.01 ? 105 ALA B O     1 
ATOM   3921 C  CB    . ALA B 1 113 ? 1.796   -13.623 -23.447 1.00 39.22 ? 105 ALA B CB    1 
ATOM   3922 N  N     . LEU B 1 114 ? -0.350  -15.309 -21.816 1.00 38.96 ? 106 LEU B N     1 
ATOM   3923 C  CA    . LEU B 1 114 ? -1.035  -15.637 -20.572 1.00 38.93 ? 106 LEU B CA    1 
ATOM   3924 C  C     . LEU B 1 114 ? -1.008  -17.133 -20.292 1.00 38.98 ? 106 LEU B C     1 
ATOM   3925 O  O     . LEU B 1 114 ? -0.859  -17.552 -19.141 1.00 39.05 ? 106 LEU B O     1 
ATOM   3926 C  CB    . LEU B 1 114 ? -2.479  -15.126 -20.601 1.00 38.90 ? 106 LEU B CB    1 
ATOM   3927 C  CG    . LEU B 1 114 ? -2.649  -13.615 -20.440 1.00 38.83 ? 106 LEU B CG    1 
ATOM   3928 C  CD1   . LEU B 1 114 ? -4.092  -13.206 -20.665 1.00 38.85 ? 106 LEU B CD1   1 
ATOM   3929 C  CD2   . LEU B 1 114 ? -2.163  -13.163 -19.065 1.00 39.10 ? 106 LEU B CD2   1 
ATOM   3930 N  N     . GLU B 1 115 ? -1.157  -17.935 -21.349 1.00 38.98 ? 107 GLU B N     1 
ATOM   3931 C  CA    . GLU B 1 115 ? -0.957  -19.385 -21.259 1.00 39.06 ? 107 GLU B CA    1 
ATOM   3932 C  C     . GLU B 1 115 ? 0.375   -19.702 -20.582 1.00 38.88 ? 107 GLU B C     1 
ATOM   3933 O  O     . GLU B 1 115 ? 0.415   -20.409 -19.573 1.00 38.91 ? 107 GLU B O     1 
ATOM   3934 C  CB    . GLU B 1 115 ? -0.982  -20.021 -22.653 1.00 39.11 ? 107 GLU B CB    1 
ATOM   3935 C  CG    . GLU B 1 115 ? -2.367  -20.391 -23.171 1.00 39.19 ? 107 GLU B CG    1 
ATOM   3936 C  CD    . GLU B 1 115 ? -2.305  -21.295 -24.407 1.00 39.51 ? 107 GLU B CD    1 
ATOM   3937 O  OE1   . GLU B 1 115 ? -1.682  -22.381 -24.326 1.00 39.40 ? 107 GLU B OE1   1 
ATOM   3938 O  OE2   . GLU B 1 115 ? -2.879  -20.918 -25.456 1.00 40.33 ? 107 GLU B OE2   1 
ATOM   3939 N  N     . GLU B 1 116 ? 1.456   -19.153 -21.135 1.00 38.71 ? 108 GLU B N     1 
ATOM   3940 C  CA    . GLU B 1 116 ? 2.806   -19.404 -20.634 1.00 38.65 ? 108 GLU B CA    1 
ATOM   3941 C  C     . GLU B 1 116 ? 2.967   -18.960 -19.179 1.00 38.59 ? 108 GLU B C     1 
ATOM   3942 O  O     . GLU B 1 116 ? 3.598   -19.648 -18.384 1.00 38.58 ? 108 GLU B O     1 
ATOM   3943 C  CB    . GLU B 1 116 ? 3.846   -18.712 -21.523 1.00 38.63 ? 108 GLU B CB    1 
ATOM   3944 C  CG    . GLU B 1 116 ? 5.301   -19.049 -21.184 1.00 38.95 ? 108 GLU B CG    1 
ATOM   3945 C  CD    . GLU B 1 116 ? 5.765   -20.380 -21.772 1.00 39.56 ? 108 GLU B CD    1 
ATOM   3946 O  OE1   . GLU B 1 116 ? 5.022   -20.981 -22.580 1.00 40.18 ? 108 GLU B OE1   1 
ATOM   3947 O  OE2   . GLU B 1 116 ? 6.881   -20.820 -21.428 1.00 39.51 ? 108 GLU B OE2   1 
ATOM   3948 N  N     . ILE B 1 117 ? 2.375   -17.818 -18.838 1.00 38.47 ? 109 ILE B N     1 
ATOM   3949 C  CA    . ILE B 1 117 ? 2.417   -17.308 -17.468 1.00 38.44 ? 109 ILE B CA    1 
ATOM   3950 C  C     . ILE B 1 117 ? 1.787   -18.297 -16.490 1.00 38.51 ? 109 ILE B C     1 
ATOM   3951 O  O     . ILE B 1 117 ? 2.378   -18.624 -15.458 1.00 38.47 ? 109 ILE B O     1 
ATOM   3952 C  CB    . ILE B 1 117 ? 1.731   -15.916 -17.354 1.00 38.38 ? 109 ILE B CB    1 
ATOM   3953 C  CG1   . ILE B 1 117 ? 2.627   -14.836 -17.967 1.00 38.45 ? 109 ILE B CG1   1 
ATOM   3954 C  CG2   . ILE B 1 117 ? 1.414   -15.577 -15.898 1.00 38.24 ? 109 ILE B CG2   1 
ATOM   3955 C  CD1   . ILE B 1 117 ? 2.034   -13.448 -17.932 1.00 38.44 ? 109 ILE B CD1   1 
ATOM   3956 N  N     . LEU B 1 118 ? 0.620   -18.823 -16.856 1.00 38.73 ? 110 LEU B N     1 
ATOM   3957 C  CA    . LEU B 1 118 ? -0.125  -19.740 -15.992 1.00 39.01 ? 110 LEU B CA    1 
ATOM   3958 C  C     . LEU B 1 118 ? 0.594   -21.078 -15.766 1.00 39.26 ? 110 LEU B C     1 
ATOM   3959 O  O     . LEU B 1 118 ? 0.205   -21.861 -14.897 1.00 39.36 ? 110 LEU B O     1 
ATOM   3960 C  CB    . LEU B 1 118 ? -1.529  -19.981 -16.549 1.00 38.96 ? 110 LEU B CB    1 
ATOM   3961 C  CG    . LEU B 1 118 ? -2.512  -18.806 -16.490 1.00 38.88 ? 110 LEU B CG    1 
ATOM   3962 C  CD1   . LEU B 1 118 ? -3.711  -19.076 -17.383 1.00 38.80 ? 110 LEU B CD1   1 
ATOM   3963 C  CD2   . LEU B 1 118 ? -2.954  -18.523 -15.054 1.00 38.77 ? 110 LEU B CD2   1 
ATOM   3964 N  N     . ARG B 1 119 ? 1.644   -21.328 -16.541 1.00 39.56 ? 111 ARG B N     1 
ATOM   3965 C  CA    . ARG B 1 119 ? 2.470   -22.513 -16.344 1.00 39.86 ? 111 ARG B CA    1 
ATOM   3966 C  C     . ARG B 1 119 ? 3.356   -22.399 -15.105 1.00 39.89 ? 111 ARG B C     1 
ATOM   3967 O  O     . ARG B 1 119 ? 3.714   -23.408 -14.501 1.00 40.11 ? 111 ARG B O     1 
ATOM   3968 C  CB    . ARG B 1 119 ? 3.331   -22.785 -17.576 1.00 39.89 ? 111 ARG B CB    1 
ATOM   3969 C  CG    . ARG B 1 119 ? 2.618   -23.545 -18.686 1.00 40.63 ? 111 ARG B CG    1 
ATOM   3970 C  CD    . ARG B 1 119 ? 3.592   -23.912 -19.802 1.00 41.84 ? 111 ARG B CD    1 
ATOM   3971 N  NE    . ARG B 1 119 ? 4.747   -24.651 -19.293 1.00 42.79 ? 111 ARG B NE    1 
ATOM   3972 C  CZ    . ARG B 1 119 ? 5.985   -24.536 -19.770 1.00 43.17 ? 111 ARG B CZ    1 
ATOM   3973 N  NH1   . ARG B 1 119 ? 6.968   -25.249 -19.238 1.00 43.41 ? 111 ARG B NH1   1 
ATOM   3974 N  NH2   . ARG B 1 119 ? 6.242   -23.703 -20.774 1.00 43.04 ? 111 ARG B NH2   1 
ATOM   3975 N  N     . PHE B 1 120 ? 3.706   -21.168 -14.730 1.00 39.90 ? 112 PHE B N     1 
ATOM   3976 C  CA    . PHE B 1 120 ? 4.666   -20.945 -13.644 1.00 39.91 ? 112 PHE B CA    1 
ATOM   3977 C  C     . PHE B 1 120 ? 4.033   -20.312 -12.416 1.00 39.83 ? 112 PHE B C     1 
ATOM   3978 O  O     . PHE B 1 120 ? 4.737   -19.773 -11.561 1.00 39.86 ? 112 PHE B O     1 
ATOM   3979 C  CB    . PHE B 1 120 ? 5.824   -20.063 -14.117 1.00 39.96 ? 112 PHE B CB    1 
ATOM   3980 C  CG    . PHE B 1 120 ? 6.210   -20.282 -15.541 1.00 40.23 ? 112 PHE B CG    1 
ATOM   3981 C  CD1   . PHE B 1 120 ? 6.652   -21.529 -15.975 1.00 40.53 ? 112 PHE B CD1   1 
ATOM   3982 C  CD2   . PHE B 1 120 ? 6.161   -19.235 -16.452 1.00 40.37 ? 112 PHE B CD2   1 
ATOM   3983 C  CE1   . PHE B 1 120 ? 7.015   -21.731 -17.299 1.00 41.09 ? 112 PHE B CE1   1 
ATOM   3984 C  CE2   . PHE B 1 120 ? 6.531   -19.426 -17.773 1.00 40.56 ? 112 PHE B CE2   1 
ATOM   3985 C  CZ    . PHE B 1 120 ? 6.952   -20.676 -18.200 1.00 40.67 ? 112 PHE B CZ    1 
ATOM   3986 N  N     . SER B 1 121 ? 2.710   -20.379 -12.320 1.00 39.78 ? 113 SER B N     1 
ATOM   3987 C  CA    . SER B 1 121 ? 1.997   -19.583 -11.334 1.00 39.77 ? 113 SER B CA    1 
ATOM   3988 C  C     . SER B 1 121 ? 0.670   -20.186 -10.894 1.00 39.82 ? 113 SER B C     1 
ATOM   3989 O  O     . SER B 1 121 ? -0.035  -20.817 -11.683 1.00 39.74 ? 113 SER B O     1 
ATOM   3990 C  CB    . SER B 1 121 ? 1.764   -18.176 -11.873 1.00 39.87 ? 113 SER B CB    1 
ATOM   3991 O  OG    . SER B 1 121 ? 1.103   -18.223 -13.127 1.00 39.92 ? 113 SER B OG    1 
ATOM   3992 N  N     . THR B 1 122 ? 0.343   -19.985 -9.621  1.00 39.83 ? 114 THR B N     1 
ATOM   3993 C  CA    . THR B 1 122 ? -1.002  -20.225 -9.114  1.00 39.90 ? 114 THR B CA    1 
ATOM   3994 C  C     . THR B 1 122 ? -1.560  -18.931 -8.556  1.00 39.82 ? 114 THR B C     1 
ATOM   3995 O  O     . THR B 1 122 ? -0.817  -18.099 -8.036  1.00 39.82 ? 114 THR B O     1 
ATOM   3996 C  CB    . THR B 1 122 ? -1.010  -21.271 -7.989  1.00 39.94 ? 114 THR B CB    1 
ATOM   3997 O  OG1   . THR B 1 122 ? -0.225  -20.797 -6.886  1.00 40.17 ? 114 THR B OG1   1 
ATOM   3998 C  CG2   . THR B 1 122 ? -0.449  -22.588 -8.478  1.00 40.29 ? 114 THR B CG2   1 
ATOM   3999 N  N     . PHE B 1 123 ? -2.872  -18.764 -8.657  1.00 39.81 ? 115 PHE B N     1 
ATOM   4000 C  CA    . PHE B 1 123 ? -3.525  -17.580 -8.123  1.00 39.84 ? 115 PHE B CA    1 
ATOM   4001 C  C     . PHE B 1 123 ? -4.678  -17.955 -7.196  1.00 39.91 ? 115 PHE B C     1 
ATOM   4002 O  O     . PHE B 1 123 ? -5.804  -17.460 -7.347  1.00 40.01 ? 115 PHE B O     1 
ATOM   4003 C  CB    . PHE B 1 123 ? -4.002  -16.673 -9.258  1.00 39.78 ? 115 PHE B CB    1 
ATOM   4004 C  CG    . PHE B 1 123 ? -2.884  -16.088 -10.075 1.00 39.78 ? 115 PHE B CG    1 
ATOM   4005 C  CD1   . PHE B 1 123 ? -2.305  -14.877 -9.719  1.00 39.84 ? 115 PHE B CD1   1 
ATOM   4006 C  CD2   . PHE B 1 123 ? -2.396  -16.755 -11.192 1.00 39.76 ? 115 PHE B CD2   1 
ATOM   4007 C  CE1   . PHE B 1 123 ? -1.268  -14.337 -10.468 1.00 39.95 ? 115 PHE B CE1   1 
ATOM   4008 C  CE2   . PHE B 1 123 ? -1.359  -16.221 -11.941 1.00 39.69 ? 115 PHE B CE2   1 
ATOM   4009 C  CZ    . PHE B 1 123 ? -0.795  -15.011 -11.579 1.00 39.73 ? 115 PHE B CZ    1 
ATOM   4010 N  N     . GLY B 1 124 ? -4.388  -18.837 -6.239  1.00 39.76 ? 116 GLY B N     1 
ATOM   4011 C  CA    . GLY B 1 124 ? -5.375  -19.276 -5.258  1.00 39.60 ? 116 GLY B CA    1 
ATOM   4012 C  C     . GLY B 1 124 ? -6.391  -20.250 -5.823  1.00 39.45 ? 116 GLY B C     1 
ATOM   4013 O  O     . GLY B 1 124 ? -6.188  -20.822 -6.894  1.00 39.42 ? 116 GLY B O     1 
ATOM   4014 N  N     . VAL B 1 125 ? -7.490  -20.435 -5.098  1.00 39.39 ? 117 VAL B N     1 
ATOM   4015 C  CA    . VAL B 1 125 ? -8.568  -21.325 -5.532  1.00 39.28 ? 117 VAL B CA    1 
ATOM   4016 C  C     . VAL B 1 125 ? -9.421  -20.692 -6.631  1.00 39.18 ? 117 VAL B C     1 
ATOM   4017 O  O     . VAL B 1 125 ? -10.021 -21.396 -7.450  1.00 39.23 ? 117 VAL B O     1 
ATOM   4018 C  CB    . VAL B 1 125 ? -9.487  -21.737 -4.349  1.00 39.34 ? 117 VAL B CB    1 
ATOM   4019 C  CG1   . VAL B 1 125 ? -8.830  -22.828 -3.514  1.00 39.54 ? 117 VAL B CG1   1 
ATOM   4020 C  CG2   . VAL B 1 125 ? -9.842  -20.525 -3.490  1.00 38.93 ? 117 VAL B CG2   1 
ATOM   4021 N  N     . THR B 1 126 ? -9.469  -19.363 -6.642  1.00 39.01 ? 118 THR B N     1 
ATOM   4022 C  CA    . THR B 1 126 ? -10.323 -18.628 -7.569  1.00 38.78 ? 118 THR B CA    1 
ATOM   4023 C  C     . THR B 1 126 ? -9.621  -18.391 -8.907  1.00 38.67 ? 118 THR B C     1 
ATOM   4024 O  O     . THR B 1 126 ? -8.418  -18.641 -9.046  1.00 38.71 ? 118 THR B O     1 
ATOM   4025 C  CB    . THR B 1 126 ? -10.776 -17.275 -6.970  1.00 38.74 ? 118 THR B CB    1 
ATOM   4026 O  OG1   . THR B 1 126 ? -9.628  -16.474 -6.668  1.00 38.71 ? 118 THR B OG1   1 
ATOM   4027 C  CG2   . THR B 1 126 ? -11.577 -17.498 -5.695  1.00 38.58 ? 118 THR B CG2   1 
ATOM   4028 N  N     . GLU B 1 127 ? -10.383 -17.921 -9.889  1.00 38.42 ? 119 GLU B N     1 
ATOM   4029 C  CA    . GLU B 1 127 ? -9.843  -17.612 -11.205 1.00 38.29 ? 119 GLU B CA    1 
ATOM   4030 C  C     . GLU B 1 127 ? -8.704  -16.587 -11.096 1.00 37.92 ? 119 GLU B C     1 
ATOM   4031 O  O     . GLU B 1 127 ? -8.822  -15.600 -10.365 1.00 38.02 ? 119 GLU B O     1 
ATOM   4032 C  CB    . GLU B 1 127 ? -10.952 -17.078 -12.114 1.00 38.37 ? 119 GLU B CB    1 
ATOM   4033 C  CG    . GLU B 1 127 ? -10.744 -17.360 -13.596 1.00 39.50 ? 119 GLU B CG    1 
ATOM   4034 C  CD    . GLU B 1 127 ? -10.951 -18.823 -13.950 1.00 40.20 ? 119 GLU B CD    1 
ATOM   4035 O  OE1   . GLU B 1 127 ? -11.835 -19.467 -13.343 1.00 40.68 ? 119 GLU B OE1   1 
ATOM   4036 O  OE2   . GLU B 1 127 ? -10.233 -19.325 -14.840 1.00 40.27 ? 119 GLU B OE2   1 
ATOM   4037 N  N     . PRO B 1 128 ? -7.581  -16.846 -11.799 1.00 37.49 ? 120 PRO B N     1 
ATOM   4038 C  CA    . PRO B 1 128 ? -6.421  -15.946 -11.858 1.00 37.13 ? 120 PRO B CA    1 
ATOM   4039 C  C     . PRO B 1 128 ? -6.782  -14.485 -12.129 1.00 36.76 ? 120 PRO B C     1 
ATOM   4040 O  O     . PRO B 1 128 ? -6.113  -13.581 -11.624 1.00 36.85 ? 120 PRO B O     1 
ATOM   4041 C  CB    . PRO B 1 128 ? -5.590  -16.514 -13.026 1.00 37.17 ? 120 PRO B CB    1 
ATOM   4042 C  CG    . PRO B 1 128 ? -6.436  -17.621 -13.633 1.00 37.42 ? 120 PRO B CG    1 
ATOM   4043 C  CD    . PRO B 1 128 ? -7.345  -18.076 -12.565 1.00 37.41 ? 120 PRO B CD    1 
ATOM   4044 N  N     . VAL B 1 129 ? -7.843  -14.262 -12.902 1.00 36.24 ? 121 VAL B N     1 
ATOM   4045 C  CA    . VAL B 1 129 ? -8.279  -12.909 -13.255 1.00 35.63 ? 121 VAL B CA    1 
ATOM   4046 C  C     . VAL B 1 129 ? -8.766  -12.104 -12.032 1.00 35.22 ? 121 VAL B C     1 
ATOM   4047 O  O     . VAL B 1 129 ? -8.922  -10.885 -12.103 1.00 35.19 ? 121 VAL B O     1 
ATOM   4048 C  CB    . VAL B 1 129 ? -9.370  -12.929 -14.378 1.00 35.70 ? 121 VAL B CB    1 
ATOM   4049 C  CG1   . VAL B 1 129 ? -10.768 -13.133 -13.785 1.00 35.37 ? 121 VAL B CG1   1 
ATOM   4050 C  CG2   . VAL B 1 129 ? -9.308  -11.655 -15.215 1.00 35.68 ? 121 VAL B CG2   1 
ATOM   4051 N  N     . ASN B 1 130 ? -8.970  -12.788 -10.909 1.00 34.72 ? 122 ASN B N     1 
ATOM   4052 C  CA    . ASN B 1 130 ? -9.344  -12.113 -9.665  1.00 34.16 ? 122 ASN B CA    1 
ATOM   4053 C  C     . ASN B 1 130 ? -8.144  -11.585 -8.875  1.00 33.48 ? 122 ASN B C     1 
ATOM   4054 O  O     . ASN B 1 130 ? -8.312  -10.977 -7.821  1.00 33.64 ? 122 ASN B O     1 
ATOM   4055 C  CB    . ASN B 1 130 ? -10.203 -13.023 -8.784  1.00 34.26 ? 122 ASN B CB    1 
ATOM   4056 C  CG    . ASN B 1 130 ? -11.552 -13.330 -9.402  1.00 34.66 ? 122 ASN B CG    1 
ATOM   4057 O  OD1   . ASN B 1 130 ? -12.170 -12.473 -10.036 1.00 35.30 ? 122 ASN B OD1   1 
ATOM   4058 N  ND2   . ASN B 1 130 ? -12.018 -14.558 -9.218  1.00 35.01 ? 122 ASN B ND2   1 
ATOM   4059 N  N     . ASP B 1 131 ? -6.941  -11.791 -9.408  1.00 32.62 ? 123 ASP B N     1 
ATOM   4060 C  CA    . ASP B 1 131 ? -5.719  -11.329 -8.749  1.00 31.73 ? 123 ASP B CA    1 
ATOM   4061 C  C     . ASP B 1 131 ? -5.106  -10.101 -9.441  1.00 30.93 ? 123 ASP B C     1 
ATOM   4062 O  O     . ASP B 1 131 ? -4.909  -10.093 -10.658 1.00 30.65 ? 123 ASP B O     1 
ATOM   4063 C  CB    . ASP B 1 131 ? -4.694  -12.459 -8.669  1.00 31.90 ? 123 ASP B CB    1 
ATOM   4064 C  CG    . ASP B 1 131 ? -3.635  -12.211 -7.611  1.00 32.57 ? 123 ASP B CG    1 
ATOM   4065 O  OD1   . ASP B 1 131 ? -2.825  -11.270 -7.778  1.00 32.98 ? 123 ASP B OD1   1 
ATOM   4066 O  OD2   . ASP B 1 131 ? -3.610  -12.962 -6.612  1.00 33.77 ? 123 ASP B OD2   1 
ATOM   4067 N  N     . ARG B 1 132 ? -4.777  -9.088  -8.639  1.00 30.01 ? 124 ARG B N     1 
ATOM   4068 C  CA    . ARG B 1 132 ? -4.295  -7.797  -9.144  1.00 29.09 ? 124 ARG B CA    1 
ATOM   4069 C  C     . ARG B 1 132 ? -3.014  -7.928  -9.966  1.00 28.49 ? 124 ARG B C     1 
ATOM   4070 O  O     . ARG B 1 132 ? -2.852  -7.258  -10.984 1.00 28.24 ? 124 ARG B O     1 
ATOM   4071 C  CB    . ARG B 1 132 ? -4.090  -6.814  -7.980  1.00 29.08 ? 124 ARG B CB    1 
ATOM   4072 C  CG    . ARG B 1 132 ? -3.726  -5.402  -8.407  1.00 29.09 ? 124 ARG B CG    1 
ATOM   4073 C  CD    . ARG B 1 132 ? -4.102  -4.369  -7.351  1.00 29.53 ? 124 ARG B CD    1 
ATOM   4074 N  NE    . ARG B 1 132 ? -3.908  -3.008  -7.850  1.00 29.82 ? 124 ARG B NE    1 
ATOM   4075 C  CZ    . ARG B 1 132 ? -2.925  -2.199  -7.467  1.00 30.36 ? 124 ARG B CZ    1 
ATOM   4076 N  NH1   . ARG B 1 132 ? -2.054  -2.594  -6.551  1.00 31.20 ? 124 ARG B NH1   1 
ATOM   4077 N  NH2   . ARG B 1 132 ? -2.822  -0.986  -7.991  1.00 30.71 ? 124 ARG B NH2   1 
ATOM   4078 N  N     . MET B 1 133 ? -2.116  -8.799  -9.519  1.00 27.74 ? 125 MET B N     1 
ATOM   4079 C  CA    . MET B 1 133 ? -0.878  -9.079  -10.239 1.00 27.22 ? 125 MET B CA    1 
ATOM   4080 C  C     . MET B 1 133 ? -1.158  -9.619  -11.651 1.00 26.74 ? 125 MET B C     1 
ATOM   4081 O  O     . MET B 1 133 ? -0.559  -9.167  -12.631 1.00 26.61 ? 125 MET B O     1 
ATOM   4082 C  CB    . MET B 1 133 ? -0.030  -10.077 -9.450  1.00 27.11 ? 125 MET B CB    1 
ATOM   4083 C  CG    . MET B 1 133 ? 1.331   -10.357 -10.050 1.00 27.35 ? 125 MET B CG    1 
ATOM   4084 S  SD    . MET B 1 133 ? 2.149   -11.761 -9.272  1.00 27.76 ? 125 MET B SD    1 
ATOM   4085 C  CE    . MET B 1 133 ? 2.281   -11.185 -7.579  1.00 27.58 ? 125 MET B CE    1 
ATOM   4086 N  N     . PHE B 1 134 ? -2.088  -10.567 -11.744 1.00 26.06 ? 126 PHE B N     1 
ATOM   4087 C  CA    . PHE B 1 134 ? -2.437  -11.181 -13.019 1.00 25.46 ? 126 PHE B CA    1 
ATOM   4088 C  C     . PHE B 1 134 ? -3.118  -10.181 -13.951 1.00 25.15 ? 126 PHE B C     1 
ATOM   4089 O  O     . PHE B 1 134 ? -2.933  -10.230 -15.169 1.00 24.97 ? 126 PHE B O     1 
ATOM   4090 C  CB    . PHE B 1 134 ? -3.337  -12.400 -12.797 1.00 25.36 ? 126 PHE B CB    1 
ATOM   4091 C  CG    . PHE B 1 134 ? -3.608  -13.187 -14.045 1.00 25.15 ? 126 PHE B CG    1 
ATOM   4092 C  CD1   . PHE B 1 134 ? -2.659  -14.072 -14.544 1.00 24.89 ? 126 PHE B CD1   1 
ATOM   4093 C  CD2   . PHE B 1 134 ? -4.809  -13.042 -14.728 1.00 24.44 ? 126 PHE B CD2   1 
ATOM   4094 C  CE1   . PHE B 1 134 ? -2.905  -14.794 -15.699 1.00 24.69 ? 126 PHE B CE1   1 
ATOM   4095 C  CE2   . PHE B 1 134 ? -5.059  -13.762 -15.882 1.00 24.18 ? 126 PHE B CE2   1 
ATOM   4096 C  CZ    . PHE B 1 134 ? -4.110  -14.640 -16.366 1.00 24.63 ? 126 PHE B CZ    1 
ATOM   4097 N  N     . ARG B 1 135 ? -3.897  -9.272  -13.370 1.00 24.74 ? 127 ARG B N     1 
ATOM   4098 C  CA    . ARG B 1 135 ? -4.560  -8.222  -14.136 1.00 24.39 ? 127 ARG B CA    1 
ATOM   4099 C  C     . ARG B 1 135 ? -3.559  -7.211  -14.701 1.00 23.94 ? 127 ARG B C     1 
ATOM   4100 O  O     . ARG B 1 135 ? -3.680  -6.778  -15.846 1.00 23.74 ? 127 ARG B O     1 
ATOM   4101 C  CB    . ARG B 1 135 ? -5.617  -7.518  -13.284 1.00 24.44 ? 127 ARG B CB    1 
ATOM   4102 C  CG    . ARG B 1 135 ? -6.817  -8.397  -12.947 1.00 24.64 ? 127 ARG B CG    1 
ATOM   4103 C  CD    . ARG B 1 135 ? -7.936  -7.600  -12.308 1.00 25.58 ? 127 ARG B CD    1 
ATOM   4104 N  NE    . ARG B 1 135 ? -7.567  -7.082  -10.988 1.00 27.73 ? 127 ARG B NE    1 
ATOM   4105 C  CZ    . ARG B 1 135 ? -7.898  -7.654  -9.828  1.00 28.17 ? 127 ARG B CZ    1 
ATOM   4106 N  NH1   . ARG B 1 135 ? -8.602  -8.774  -9.814  1.00 28.24 ? 127 ARG B NH1   1 
ATOM   4107 N  NH2   . ARG B 1 135 ? -7.526  -7.097  -8.680  1.00 28.20 ? 127 ARG B NH2   1 
ATOM   4108 N  N     . LEU B 1 136 ? -2.560  -6.863  -13.900 1.00 23.55 ? 128 LEU B N     1 
ATOM   4109 C  CA    . LEU B 1 136 ? -1.497  -5.969  -14.348 1.00 23.23 ? 128 LEU B CA    1 
ATOM   4110 C  C     . LEU B 1 136 ? -0.644  -6.632  -15.424 1.00 23.04 ? 128 LEU B C     1 
ATOM   4111 O  O     . LEU B 1 136 ? -0.198  -5.976  -16.365 1.00 22.78 ? 128 LEU B O     1 
ATOM   4112 C  CB    . LEU B 1 136 ? -0.628  -5.523  -13.166 1.00 22.96 ? 128 LEU B CB    1 
ATOM   4113 C  CG    . LEU B 1 136 ? -1.302  -4.576  -12.162 1.00 22.86 ? 128 LEU B CG    1 
ATOM   4114 C  CD1   . LEU B 1 136 ? -0.477  -4.439  -10.886 1.00 22.42 ? 128 LEU B CD1   1 
ATOM   4115 C  CD2   . LEU B 1 136 ? -1.563  -3.218  -12.786 1.00 21.94 ? 128 LEU B CD2   1 
ATOM   4116 N  N     . LEU B 1 137 ? -0.438  -7.940  -15.284 1.00 22.99 ? 129 LEU B N     1 
ATOM   4117 C  CA    . LEU B 1 137 ? 0.259   -8.722  -16.296 1.00 23.04 ? 129 LEU B CA    1 
ATOM   4118 C  C     . LEU B 1 137 ? -0.521  -8.732  -17.605 1.00 23.14 ? 129 LEU B C     1 
ATOM   4119 O  O     . LEU B 1 137 ? 0.037   -8.463  -18.664 1.00 23.14 ? 129 LEU B O     1 
ATOM   4120 C  CB    . LEU B 1 137 ? 0.494   -10.153 -15.806 1.00 22.90 ? 129 LEU B CB    1 
ATOM   4121 C  CG    . LEU B 1 137 ? 1.681   -10.358 -14.863 1.00 22.97 ? 129 LEU B CG    1 
ATOM   4122 C  CD1   . LEU B 1 137 ? 1.450   -11.547 -13.955 1.00 22.65 ? 129 LEU B CD1   1 
ATOM   4123 C  CD2   . LEU B 1 137 ? 2.981   -10.517 -15.646 1.00 23.14 ? 129 LEU B CD2   1 
ATOM   4124 N  N     . SER B 1 138 ? -1.820  -9.016  -17.514 1.00 23.29 ? 130 SER B N     1 
ATOM   4125 C  CA    . SER B 1 138 ? -2.701  -9.017  -18.679 1.00 23.44 ? 130 SER B CA    1 
ATOM   4126 C  C     . SER B 1 138 ? -2.733  -7.653  -19.357 1.00 23.60 ? 130 SER B C     1 
ATOM   4127 O  O     . SER B 1 138 ? -2.723  -7.564  -20.583 1.00 23.71 ? 130 SER B O     1 
ATOM   4128 C  CB    . SER B 1 138 ? -4.122  -9.432  -18.280 1.00 23.50 ? 130 SER B CB    1 
ATOM   4129 O  OG    . SER B 1 138 ? -4.150  -10.761 -17.787 1.00 23.38 ? 130 SER B OG    1 
ATOM   4130 N  N     . ALA B 1 139 ? -2.764  -6.596  -18.553 1.00 23.74 ? 131 ALA B N     1 
ATOM   4131 C  CA    . ALA B 1 139 ? -2.807  -5.234  -19.075 1.00 23.98 ? 131 ALA B CA    1 
ATOM   4132 C  C     . ALA B 1 139 ? -1.536  -4.866  -19.848 1.00 24.16 ? 131 ALA B C     1 
ATOM   4133 O  O     . ALA B 1 139 ? -1.603  -4.161  -20.859 1.00 24.14 ? 131 ALA B O     1 
ATOM   4134 C  CB    . ALA B 1 139 ? -3.055  -4.237  -17.951 1.00 23.80 ? 131 ALA B CB    1 
ATOM   4135 N  N     . PHE B 1 140 ? -0.385  -5.344  -19.372 1.00 24.19 ? 132 PHE B N     1 
ATOM   4136 C  CA    . PHE B 1 140 ? 0.881   -5.101  -20.065 1.00 24.42 ? 132 PHE B CA    1 
ATOM   4137 C  C     . PHE B 1 140 ? 0.931   -5.842  -21.399 1.00 24.82 ? 132 PHE B C     1 
ATOM   4138 O  O     . PHE B 1 140 ? 1.356   -5.287  -22.412 1.00 24.81 ? 132 PHE B O     1 
ATOM   4139 C  CB    . PHE B 1 140 ? 2.075   -5.498  -19.191 1.00 24.05 ? 132 PHE B CB    1 
ATOM   4140 C  CG    . PHE B 1 140 ? 3.415   -5.191  -19.816 1.00 23.74 ? 132 PHE B CG    1 
ATOM   4141 C  CD1   . PHE B 1 140 ? 3.897   -3.887  -19.857 1.00 23.57 ? 132 PHE B CD1   1 
ATOM   4142 C  CD2   . PHE B 1 140 ? 4.192   -6.204  -20.367 1.00 23.70 ? 132 PHE B CD2   1 
ATOM   4143 C  CE1   . PHE B 1 140 ? 5.131   -3.599  -20.439 1.00 23.42 ? 132 PHE B CE1   1 
ATOM   4144 C  CE2   . PHE B 1 140 ? 5.432   -5.921  -20.952 1.00 23.53 ? 132 PHE B CE2   1 
ATOM   4145 C  CZ    . PHE B 1 140 ? 5.897   -4.619  -20.986 1.00 23.56 ? 132 PHE B CZ    1 
ATOM   4146 N  N     . ILE B 1 141 ? 0.497   -7.097  -21.389 1.00 25.34 ? 133 ILE B N     1 
ATOM   4147 C  CA    . ILE B 1 141 ? 0.479   -7.910  -22.592 1.00 26.02 ? 133 ILE B CA    1 
ATOM   4148 C  C     . ILE B 1 141 ? -0.474  -7.319  -23.634 1.00 26.73 ? 133 ILE B C     1 
ATOM   4149 O  O     . ILE B 1 141 ? -0.134  -7.230  -24.819 1.00 26.71 ? 133 ILE B O     1 
ATOM   4150 C  CB    . ILE B 1 141 ? 0.096   -9.366  -22.272 1.00 26.05 ? 133 ILE B CB    1 
ATOM   4151 C  CG1   . ILE B 1 141 ? 1.130   -9.979  -21.324 1.00 25.56 ? 133 ILE B CG1   1 
ATOM   4152 C  CG2   . ILE B 1 141 ? -0.016  -10.199 -23.559 1.00 25.96 ? 133 ILE B CG2   1 
ATOM   4153 C  CD1   . ILE B 1 141 ? 0.650   -11.199 -20.607 1.00 24.89 ? 133 ILE B CD1   1 
ATOM   4154 N  N     . ALA B 1 142 ? -1.646  -6.880  -23.173 1.00 27.50 ? 134 ALA B N     1 
ATOM   4155 C  CA    . ALA B 1 142 ? -2.635  -6.246  -24.035 1.00 28.37 ? 134 ALA B CA    1 
ATOM   4156 C  C     . ALA B 1 142 ? -2.123  -4.933  -24.630 1.00 29.01 ? 134 ALA B C     1 
ATOM   4157 O  O     . ALA B 1 142 ? -2.093  -4.770  -25.847 1.00 29.14 ? 134 ALA B O     1 
ATOM   4158 C  CB    . ALA B 1 142 ? -3.937  -6.015  -23.272 1.00 28.29 ? 134 ALA B CB    1 
ATOM   4159 N  N     . ASP B 1 143 ? -1.729  -4.001  -23.767 1.00 29.82 ? 135 ASP B N     1 
ATOM   4160 C  CA    . ASP B 1 143 ? -1.239  -2.701  -24.219 1.00 30.83 ? 135 ASP B CA    1 
ATOM   4161 C  C     . ASP B 1 143 ? -0.229  -2.110  -23.241 1.00 31.34 ? 135 ASP B C     1 
ATOM   4162 O  O     . ASP B 1 143 ? -0.560  -1.232  -22.441 1.00 31.37 ? 135 ASP B O     1 
ATOM   4163 C  CB    . ASP B 1 143 ? -2.404  -1.724  -24.434 1.00 31.08 ? 135 ASP B CB    1 
ATOM   4164 C  CG    . ASP B 1 143 ? -2.005  -0.500  -25.268 1.00 31.95 ? 135 ASP B CG    1 
ATOM   4165 O  OD1   . ASP B 1 143 ? -0.877  -0.483  -25.821 1.00 32.77 ? 135 ASP B OD1   1 
ATOM   4166 O  OD2   . ASP B 1 143 ? -2.825  0.441   -25.374 1.00 32.71 ? 135 ASP B OD2   1 
ATOM   4167 N  N     . GLY B 1 144 ? 1.009   -2.589  -23.322 1.00 31.94 ? 136 GLY B N     1 
ATOM   4168 C  CA    . GLY B 1 144 ? 2.081   -2.088  -22.478 1.00 32.77 ? 136 GLY B CA    1 
ATOM   4169 C  C     . GLY B 1 144 ? 2.559   -0.715  -22.897 1.00 33.40 ? 136 GLY B C     1 
ATOM   4170 O  O     . GLY B 1 144 ? 3.020   0.069   -22.067 1.00 33.55 ? 136 GLY B O     1 
ATOM   4171 N  N     . GLY B 1 145 ? 2.430   -0.413  -24.186 1.00 33.87 ? 137 GLY B N     1 
ATOM   4172 C  CA    . GLY B 1 145 ? 2.908   0.853   -24.733 1.00 34.68 ? 137 GLY B CA    1 
ATOM   4173 C  C     . GLY B 1 145 ? 2.045   2.052   -24.387 1.00 35.31 ? 137 GLY B C     1 
ATOM   4174 O  O     . GLY B 1 145 ? 2.342   3.172   -24.802 1.00 35.43 ? 137 GLY B O     1 
ATOM   4175 N  N     . ARG B 1 146 ? 0.982   1.821   -23.615 1.00 35.94 ? 138 ARG B N     1 
ATOM   4176 C  CA    . ARG B 1 146 ? 0.006   2.869   -23.298 1.00 36.47 ? 138 ARG B CA    1 
ATOM   4177 C  C     . ARG B 1 146 ? 0.626   4.036   -22.524 1.00 36.88 ? 138 ARG B C     1 
ATOM   4178 O  O     . ARG B 1 146 ? 0.505   5.192   -22.933 1.00 36.91 ? 138 ARG B O     1 
ATOM   4179 C  CB    . ARG B 1 146 ? -1.186  2.291   -22.526 1.00 36.42 ? 138 ARG B CB    1 
ATOM   4180 C  CG    . ARG B 1 146 ? -2.384  3.232   -22.452 1.00 36.31 ? 138 ARG B CG    1 
ATOM   4181 C  CD    . ARG B 1 146 ? -3.427  2.736   -21.474 1.00 36.15 ? 138 ARG B CD    1 
ATOM   4182 N  NE    . ARG B 1 146 ? -4.085  1.521   -21.941 1.00 36.15 ? 138 ARG B NE    1 
ATOM   4183 C  CZ    . ARG B 1 146 ? -5.238  1.066   -21.464 1.00 36.36 ? 138 ARG B CZ    1 
ATOM   4184 N  NH1   . ARG B 1 146 ? -5.765  -0.048  -21.951 1.00 36.36 ? 138 ARG B NH1   1 
ATOM   4185 N  NH2   . ARG B 1 146 ? -5.871  1.729   -20.506 1.00 37.35 ? 138 ARG B NH2   1 
ATOM   4186 N  N     . TYR B 1 147 ? 1.287   3.730   -21.409 1.00 37.45 ? 139 TYR B N     1 
ATOM   4187 C  CA    . TYR B 1 147 ? 1.963   4.760   -20.618 1.00 37.93 ? 139 TYR B CA    1 
ATOM   4188 C  C     . TYR B 1 147 ? 3.455   4.766   -20.877 1.00 38.32 ? 139 TYR B C     1 
ATOM   4189 O  O     . TYR B 1 147 ? 4.246   5.173   -20.024 1.00 38.49 ? 139 TYR B O     1 
ATOM   4190 C  CB    . TYR B 1 147 ? 1.673   4.590   -19.128 1.00 37.83 ? 139 TYR B CB    1 
ATOM   4191 C  CG    . TYR B 1 147 ? 0.244   4.881   -18.770 1.00 37.93 ? 139 TYR B CG    1 
ATOM   4192 C  CD1   . TYR B 1 147 ? -0.224  6.194   -18.698 1.00 37.83 ? 139 TYR B CD1   1 
ATOM   4193 C  CD2   . TYR B 1 147 ? -0.655  3.850   -18.534 1.00 37.90 ? 139 TYR B CD2   1 
ATOM   4194 C  CE1   . TYR B 1 147 ? -1.544  6.467   -18.387 1.00 37.43 ? 139 TYR B CE1   1 
ATOM   4195 C  CE2   . TYR B 1 147 ? -1.972  4.111   -18.221 1.00 37.87 ? 139 TYR B CE2   1 
ATOM   4196 C  CZ    . TYR B 1 147 ? -2.413  5.421   -18.149 1.00 37.72 ? 139 TYR B CZ    1 
ATOM   4197 O  OH    . TYR B 1 147 ? -3.726  5.678   -17.840 1.00 38.45 ? 139 TYR B OH    1 
ATOM   4198 N  N     . CYS B 1 148 ? 3.834   4.302   -22.062 1.00 38.77 ? 140 CYS B N     1 
ATOM   4199 C  CA    . CYS B 1 148 ? 5.185   4.472   -22.550 1.00 39.00 ? 140 CYS B CA    1 
ATOM   4200 C  C     . CYS B 1 148 ? 5.390   5.915   -22.990 1.00 39.08 ? 140 CYS B C     1 
ATOM   4201 O  O     . CYS B 1 148 ? 4.647   6.431   -23.831 1.00 39.22 ? 140 CYS B O     1 
ATOM   4202 C  CB    . CYS B 1 148 ? 5.447   3.528   -23.717 1.00 39.02 ? 140 CYS B CB    1 
ATOM   4203 S  SG    . CYS B 1 148 ? 7.171   3.106   -23.934 1.00 39.58 ? 140 CYS B SG    1 
ATOM   4204 N  N     . LEU B 1 149 ? 6.387   6.570   -22.404 1.00 39.09 ? 141 LEU B N     1 
ATOM   4205 C  CA    . LEU B 1 149 ? 6.667   7.970   -22.696 1.00 39.13 ? 141 LEU B CA    1 
ATOM   4206 C  C     . LEU B 1 149 ? 7.305   8.118   -24.077 1.00 39.28 ? 141 LEU B C     1 
ATOM   4207 O  O     . LEU B 1 149 ? 8.360   7.540   -24.336 1.00 39.37 ? 141 LEU B O     1 
ATOM   4208 C  CB    . LEU B 1 149 ? 7.586   8.560   -21.627 1.00 39.01 ? 141 LEU B CB    1 
ATOM   4209 C  CG    . LEU B 1 149 ? 7.685   10.083  -21.583 1.00 39.01 ? 141 LEU B CG    1 
ATOM   4210 C  CD1   . LEU B 1 149 ? 6.454   10.682  -20.908 1.00 38.99 ? 141 LEU B CD1   1 
ATOM   4211 C  CD2   . LEU B 1 149 ? 8.952   10.507  -20.867 1.00 38.74 ? 141 LEU B CD2   1 
ATOM   4212 N  N     . PRO B 1 150 ? 6.659   8.900   -24.968 1.00 39.40 ? 142 PRO B N     1 
ATOM   4213 C  CA    . PRO B 1 150 ? 7.104   9.074   -26.356 1.00 39.49 ? 142 PRO B CA    1 
ATOM   4214 C  C     . PRO B 1 150 ? 8.486   9.713   -26.451 1.00 39.73 ? 142 PRO B C     1 
ATOM   4215 O  O     . PRO B 1 150 ? 8.961   10.310  -25.486 1.00 39.75 ? 142 PRO B O     1 
ATOM   4216 C  CB    . PRO B 1 150 ? 6.047   10.017  -26.949 1.00 39.44 ? 142 PRO B CB    1 
ATOM   4217 C  CG    . PRO B 1 150 ? 4.873   9.899   -26.044 1.00 39.39 ? 142 PRO B CG    1 
ATOM   4218 C  CD    . PRO B 1 150 ? 5.436   9.669   -24.688 1.00 39.36 ? 142 PRO B CD    1 
ATOM   4219 N  N     . GLU B 1 151 ? 9.118   9.584   -27.615 1.00 40.05 ? 143 GLU B N     1 
ATOM   4220 C  CA    . GLU B 1 151 ? 10.462  10.125  -27.832 1.00 40.24 ? 143 GLU B CA    1 
ATOM   4221 C  C     . GLU B 1 151 ? 10.553  11.658  -27.748 1.00 40.03 ? 143 GLU B C     1 
ATOM   4222 O  O     . GLU B 1 151 ? 11.459  12.180  -27.101 1.00 40.03 ? 143 GLU B O     1 
ATOM   4223 C  CB    . GLU B 1 151 ? 11.060  9.618   -29.156 1.00 40.45 ? 143 GLU B CB    1 
ATOM   4224 C  CG    . GLU B 1 151 ? 11.772  8.274   -29.043 1.00 41.25 ? 143 GLU B CG    1 
ATOM   4225 C  CD    . GLU B 1 151 ? 12.839  8.263   -27.956 1.00 42.69 ? 143 GLU B CD    1 
ATOM   4226 O  OE1   . GLU B 1 151 ? 13.680  9.192   -27.929 1.00 43.02 ? 143 GLU B OE1   1 
ATOM   4227 O  OE2   . GLU B 1 151 ? 12.834  7.326   -27.128 1.00 43.25 ? 143 GLU B OE2   1 
ATOM   4228 N  N     . PRO B 1 152 ? 9.614   12.386  -28.404 1.00 39.96 ? 144 PRO B N     1 
ATOM   4229 C  CA    . PRO B 1 152 ? 9.690   13.849  -28.369 1.00 39.85 ? 144 PRO B CA    1 
ATOM   4230 C  C     . PRO B 1 152 ? 9.448   14.431  -26.977 1.00 39.81 ? 144 PRO B C     1 
ATOM   4231 O  O     . PRO B 1 152 ? 9.715   15.610  -26.753 1.00 39.97 ? 144 PRO B O     1 
ATOM   4232 C  CB    . PRO B 1 152 ? 8.564   14.284  -29.323 1.00 39.72 ? 144 PRO B CB    1 
ATOM   4233 C  CG    . PRO B 1 152 ? 8.246   13.075  -30.132 1.00 39.95 ? 144 PRO B CG    1 
ATOM   4234 C  CD    . PRO B 1 152 ? 8.480   11.926  -29.224 1.00 40.05 ? 144 PRO B CD    1 
ATOM   4235 N  N     . LEU B 1 153 ? 8.951   13.609  -26.054 1.00 39.71 ? 145 LEU B N     1 
ATOM   4236 C  CA    . LEU B 1 153 ? 8.635   14.076  -24.706 1.00 39.58 ? 145 LEU B CA    1 
ATOM   4237 C  C     . LEU B 1 153 ? 9.603   13.554  -23.646 1.00 39.77 ? 145 LEU B C     1 
ATOM   4238 O  O     . LEU B 1 153 ? 9.277   13.524  -22.466 1.00 39.80 ? 145 LEU B O     1 
ATOM   4239 C  CB    . LEU B 1 153 ? 7.193   13.722  -24.334 1.00 39.38 ? 145 LEU B CB    1 
ATOM   4240 C  CG    . LEU B 1 153 ? 6.101   14.530  -25.032 1.00 38.68 ? 145 LEU B CG    1 
ATOM   4241 C  CD1   . LEU B 1 153 ? 4.739   13.957  -24.722 1.00 37.82 ? 145 LEU B CD1   1 
ATOM   4242 C  CD2   . LEU B 1 153 ? 6.172   16.002  -24.637 1.00 38.25 ? 145 LEU B CD2   1 
ATOM   4243 N  N     . GLN B 1 154 ? 10.792  13.143  -24.074 1.00 40.10 ? 146 GLN B N     1 
ATOM   4244 C  CA    . GLN B 1 154 ? 11.868  12.816  -23.143 1.00 40.47 ? 146 GLN B CA    1 
ATOM   4245 C  C     . GLN B 1 154 ? 12.473  14.099  -22.571 1.00 40.76 ? 146 GLN B C     1 
ATOM   4246 O  O     . GLN B 1 154 ? 12.789  15.022  -23.322 1.00 40.86 ? 146 GLN B O     1 
ATOM   4247 C  CB    . GLN B 1 154 ? 12.954  11.996  -23.844 1.00 40.52 ? 146 GLN B CB    1 
ATOM   4248 C  CG    . GLN B 1 154 ? 12.537  10.578  -24.208 1.00 40.79 ? 146 GLN B CG    1 
ATOM   4249 C  CD    . GLN B 1 154 ? 12.532  9.643   -23.014 1.00 41.09 ? 146 GLN B CD    1 
ATOM   4250 O  OE1   . GLN B 1 154 ? 13.197  9.895   -22.005 1.00 41.64 ? 146 GLN B OE1   1 
ATOM   4251 N  NE2   . GLN B 1 154 ? 11.788  8.548   -23.126 1.00 41.58 ? 146 GLN B NE2   1 
ATOM   4252 N  N     . PRO B 1 155 ? 12.633  14.159  -21.233 1.00 41.01 ? 147 PRO B N     1 
ATOM   4253 C  CA    . PRO B 1 155 ? 13.171  15.340  -20.534 1.00 41.21 ? 147 PRO B CA    1 
ATOM   4254 C  C     . PRO B 1 155 ? 14.523  15.822  -21.087 1.00 41.42 ? 147 PRO B C     1 
ATOM   4255 O  O     . PRO B 1 155 ? 14.769  17.027  -21.153 1.00 41.39 ? 147 PRO B O     1 
ATOM   4256 C  CB    . PRO B 1 155 ? 13.333  14.846  -19.092 1.00 41.23 ? 147 PRO B CB    1 
ATOM   4257 C  CG    . PRO B 1 155 ? 12.328  13.758  -18.954 1.00 41.14 ? 147 PRO B CG    1 
ATOM   4258 C  CD    . PRO B 1 155 ? 12.278  13.079  -20.293 1.00 41.06 ? 147 PRO B CD    1 
ATOM   4259 N  N     . SER B 1 156 ? 15.373  14.883  -21.497 1.00 41.79 ? 148 SER B N     1 
ATOM   4260 C  CA    . SER B 1 156 ? 16.710  15.207  -22.009 1.00 42.12 ? 148 SER B CA    1 
ATOM   4261 C  C     . SER B 1 156 ? 16.664  15.908  -23.373 1.00 42.39 ? 148 SER B C     1 
ATOM   4262 O  O     . SER B 1 156 ? 17.676  16.435  -23.845 1.00 42.51 ? 148 SER B O     1 
ATOM   4263 C  CB    . SER B 1 156 ? 17.557  13.941  -22.107 1.00 42.07 ? 148 SER B CB    1 
ATOM   4264 O  OG    . SER B 1 156 ? 16.952  13.000  -22.977 1.00 42.27 ? 148 SER B OG    1 
ATOM   4265 N  N     . ARG B 1 157 ? 15.491  15.908  -23.998 1.00 42.54 ? 149 ARG B N     1 
ATOM   4266 C  CA    . ARG B 1 157 ? 15.306  16.561  -25.289 1.00 42.87 ? 149 ARG B CA    1 
ATOM   4267 C  C     . ARG B 1 157 ? 14.748  17.983  -25.115 1.00 43.00 ? 149 ARG B C     1 
ATOM   4268 O  O     . ARG B 1 157 ? 14.397  18.652  -26.094 1.00 42.87 ? 149 ARG B O     1 
ATOM   4269 C  CB    . ARG B 1 157 ? 14.375  15.727  -26.170 1.00 42.96 ? 149 ARG B CB    1 
ATOM   4270 C  CG    . ARG B 1 157 ? 14.639  15.844  -27.661 1.00 43.56 ? 149 ARG B CG    1 
ATOM   4271 C  CD    . ARG B 1 157 ? 13.817  14.823  -28.443 1.00 44.49 ? 149 ARG B CD    1 
ATOM   4272 N  NE    . ARG B 1 157 ? 14.069  13.455  -27.987 1.00 44.75 ? 149 ARG B NE    1 
ATOM   4273 C  CZ    . ARG B 1 157 ? 15.056  12.683  -28.437 1.00 45.00 ? 149 ARG B CZ    1 
ATOM   4274 N  NH1   . ARG B 1 157 ? 15.895  13.138  -29.361 1.00 45.02 ? 149 ARG B NH1   1 
ATOM   4275 N  NH2   . ARG B 1 157 ? 15.206  11.454  -27.960 1.00 44.93 ? 149 ARG B NH2   1 
ATOM   4276 N  N     . TRP B 1 158 ? 14.673  18.434  -23.861 1.00 43.16 ? 150 TRP B N     1 
ATOM   4277 C  CA    . TRP B 1 158 ? 14.148  19.761  -23.540 1.00 43.37 ? 150 TRP B CA    1 
ATOM   4278 C  C     . TRP B 1 158 ? 15.034  20.478  -22.533 1.00 43.82 ? 150 TRP B C     1 
ATOM   4279 O  O     . TRP B 1 158 ? 15.759  19.839  -21.766 1.00 43.90 ? 150 TRP B O     1 
ATOM   4280 C  CB    . TRP B 1 158 ? 12.730  19.655  -22.976 1.00 43.04 ? 150 TRP B CB    1 
ATOM   4281 C  CG    . TRP B 1 158 ? 11.744  19.091  -23.930 1.00 42.62 ? 150 TRP B CG    1 
ATOM   4282 C  CD1   . TRP B 1 158 ? 11.429  17.779  -24.095 1.00 42.10 ? 150 TRP B CD1   1 
ATOM   4283 C  CD2   . TRP B 1 158 ? 10.932  19.820  -24.855 1.00 42.07 ? 150 TRP B CD2   1 
ATOM   4284 N  NE1   . TRP B 1 158 ? 10.472  17.641  -25.066 1.00 42.18 ? 150 TRP B NE1   1 
ATOM   4285 C  CE2   . TRP B 1 158 ? 10.148  18.880  -25.550 1.00 42.09 ? 150 TRP B CE2   1 
ATOM   4286 C  CE3   . TRP B 1 158 ? 10.792  21.177  -25.164 1.00 42.23 ? 150 TRP B CE3   1 
ATOM   4287 C  CZ2   . TRP B 1 158 ? 9.235   19.251  -26.543 1.00 42.41 ? 150 TRP B CZ2   1 
ATOM   4288 C  CZ3   . TRP B 1 158 ? 9.881   21.547  -26.149 1.00 42.44 ? 150 TRP B CZ3   1 
ATOM   4289 C  CH2   . TRP B 1 158 ? 9.116   20.585  -26.826 1.00 42.38 ? 150 TRP B CH2   1 
ATOM   4290 N  N     . MET B 1 159 ? 14.967  21.810  -22.532 1.00 44.28 ? 151 MET B N     1 
ATOM   4291 C  CA    . MET B 1 159 ? 15.539  22.610  -21.448 1.00 44.95 ? 151 MET B CA    1 
ATOM   4292 C  C     . MET B 1 159 ? 14.766  23.910  -21.240 1.00 45.17 ? 151 MET B C     1 
ATOM   4293 O  O     . MET B 1 159 ? 14.009  24.338  -22.116 1.00 45.23 ? 151 MET B O     1 
ATOM   4294 C  CB    . MET B 1 159 ? 17.027  22.890  -21.692 1.00 44.85 ? 151 MET B CB    1 
ATOM   4295 C  CG    . MET B 1 159 ? 17.315  23.955  -22.739 1.00 45.05 ? 151 MET B CG    1 
ATOM   4296 S  SD    . MET B 1 159 ? 19.092  24.233  -22.951 1.00 45.85 ? 151 MET B SD    1 
ATOM   4297 C  CE    . MET B 1 159 ? 19.601  24.597  -21.264 1.00 45.30 ? 151 MET B CE    1 
ATOM   4298 N  N     . MET B 1 160 ? 14.958  24.532  -20.075 1.00 45.52 ? 152 MET B N     1 
ATOM   4299 C  CA    . MET B 1 160 ? 14.214  25.741  -19.706 1.00 45.92 ? 152 MET B CA    1 
ATOM   4300 C  C     . MET B 1 160 ? 14.917  27.020  -20.147 1.00 46.07 ? 152 MET B C     1 
ATOM   4301 O  O     . MET B 1 160 ? 16.112  27.202  -19.902 1.00 46.12 ? 152 MET B O     1 
ATOM   4302 C  CB    . MET B 1 160 ? 13.956  25.782  -18.195 1.00 45.98 ? 152 MET B CB    1 
ATOM   4303 C  CG    . MET B 1 160 ? 12.925  24.779  -17.714 1.00 46.48 ? 152 MET B CG    1 
ATOM   4304 S  SD    . MET B 1 160 ? 11.497  24.637  -18.819 1.00 47.96 ? 152 MET B SD    1 
ATOM   4305 C  CE    . MET B 1 160 ? 10.614  26.149  -18.457 1.00 47.37 ? 152 MET B CE    1 
ATOM   4306 N  N     . MET B 1 161 ? 14.159  27.911  -20.784 1.00 46.21 ? 153 MET B N     1 
ATOM   4307 C  CA    . MET B 1 161 ? 14.695  29.174  -21.281 1.00 46.40 ? 153 MET B CA    1 
ATOM   4308 C  C     . MET B 1 161 ? 13.844  30.357  -20.833 1.00 46.41 ? 153 MET B C     1 
ATOM   4309 O  O     . MET B 1 161 ? 14.368  31.425  -20.512 1.00 46.45 ? 153 MET B O     1 
ATOM   4310 C  CB    . MET B 1 161 ? 14.796  29.145  -22.807 1.00 46.51 ? 153 MET B CB    1 
ATOM   4311 C  CG    . MET B 1 161 ? 15.847  28.176  -23.346 1.00 47.13 ? 153 MET B CG    1 
ATOM   4312 S  SD    . MET B 1 161 ? 17.459  28.942  -23.633 1.00 49.16 ? 153 MET B SD    1 
ATOM   4313 C  CE    . MET B 1 161 ? 18.217  28.821  -22.007 1.00 48.69 ? 153 MET B CE    1 
ATOM   4314 N  N     . ALA B 1 168 ? 10.708  42.735  -10.405 1.00 44.29 ? 160 ALA B N     1 
ATOM   4315 C  CA    . ALA B 1 168 ? 10.781  44.171  -10.669 1.00 44.27 ? 160 ALA B CA    1 
ATOM   4316 C  C     . ALA B 1 168 ? 9.665   44.995  -9.988  1.00 44.27 ? 160 ALA B C     1 
ATOM   4317 O  O     . ALA B 1 168 ? 9.942   46.068  -9.447  1.00 44.41 ? 160 ALA B O     1 
ATOM   4318 C  CB    . ALA B 1 168 ? 10.824  44.449  -12.178 1.00 44.23 ? 160 ALA B CB    1 
ATOM   4319 N  N     . PRO B 1 169 ? 8.395   44.505  -10.030 1.00 44.12 ? 161 PRO B N     1 
ATOM   4320 C  CA    . PRO B 1 169 ? 7.315   45.262  -9.367  1.00 43.77 ? 161 PRO B CA    1 
ATOM   4321 C  C     . PRO B 1 169 ? 7.391   45.162  -7.836  1.00 43.23 ? 161 PRO B C     1 
ATOM   4322 O  O     . PRO B 1 169 ? 7.891   44.164  -7.298  1.00 43.30 ? 161 PRO B O     1 
ATOM   4323 C  CB    . PRO B 1 169 ? 6.029   44.589  -9.895  1.00 43.84 ? 161 PRO B CB    1 
ATOM   4324 C  CG    . PRO B 1 169 ? 6.484   43.686  -11.033 1.00 44.21 ? 161 PRO B CG    1 
ATOM   4325 C  CD    . PRO B 1 169 ? 7.876   43.293  -10.687 1.00 44.19 ? 161 PRO B CD    1 
ATOM   4326 N  N     . GLN B 1 170 ? 6.881   46.184  -7.150  1.00 42.33 ? 162 GLN B N     1 
ATOM   4327 C  CA    . GLN B 1 170 ? 7.226   46.417  -5.744  1.00 41.36 ? 162 GLN B CA    1 
ATOM   4328 C  C     . GLN B 1 170 ? 6.105   46.039  -4.774  1.00 40.26 ? 162 GLN B C     1 
ATOM   4329 O  O     . GLN B 1 170 ? 5.059   45.528  -5.179  1.00 40.03 ? 162 GLN B O     1 
ATOM   4330 C  CB    . GLN B 1 170 ? 7.638   47.886  -5.527  1.00 41.46 ? 162 GLN B CB    1 
ATOM   4331 C  CG    . GLN B 1 170 ? 8.641   48.429  -6.559  1.00 42.56 ? 162 GLN B CG    1 
ATOM   4332 C  CD    . GLN B 1 170 ? 7.971   49.183  -7.715  1.00 43.53 ? 162 GLN B CD    1 
ATOM   4333 O  OE1   . GLN B 1 170 ? 6.834   48.886  -8.101  1.00 44.33 ? 162 GLN B OE1   1 
ATOM   4334 N  NE2   . GLN B 1 170 ? 8.683   50.154  -8.272  1.00 43.92 ? 162 GLN B NE2   1 
ATOM   4335 N  N     . HIS B 1 171 ? 6.348   46.291  -3.490  1.00 38.96 ? 163 HIS B N     1 
ATOM   4336 C  CA    . HIS B 1 171 ? 5.359   46.082  -2.445  1.00 37.58 ? 163 HIS B CA    1 
ATOM   4337 C  C     . HIS B 1 171 ? 4.346   47.227  -2.445  1.00 36.45 ? 163 HIS B C     1 
ATOM   4338 O  O     . HIS B 1 171 ? 4.589   48.275  -3.025  1.00 36.14 ? 163 HIS B O     1 
ATOM   4339 C  CB    . HIS B 1 171 ? 6.047   46.016  -1.074  1.00 37.80 ? 163 HIS B CB    1 
ATOM   4340 C  CG    . HIS B 1 171 ? 6.981   44.851  -0.910  1.00 38.49 ? 163 HIS B CG    1 
ATOM   4341 N  ND1   . HIS B 1 171 ? 7.931   44.514  -1.852  1.00 38.73 ? 163 HIS B ND1   1 
ATOM   4342 C  CD2   . HIS B 1 171 ? 7.140   43.976  0.112   1.00 38.90 ? 163 HIS B CD2   1 
ATOM   4343 C  CE1   . HIS B 1 171 ? 8.612   43.463  -1.431  1.00 38.69 ? 163 HIS B CE1   1 
ATOM   4344 N  NE2   . HIS B 1 171 ? 8.154   43.119  -0.241  1.00 38.64 ? 163 HIS B NE2   1 
ATOM   4345 N  N     . LEU B 1 172 ? 3.208   47.009  -1.796  1.00 35.21 ? 164 LEU B N     1 
ATOM   4346 C  CA    . LEU B 1 172 ? 2.272   48.088  -1.487  1.00 33.97 ? 164 LEU B CA    1 
ATOM   4347 C  C     . LEU B 1 172 ? 1.794   47.963  -0.043  1.00 33.09 ? 164 LEU B C     1 
ATOM   4348 O  O     . LEU B 1 172 ? 0.649   47.580  0.203   1.00 32.93 ? 164 LEU B O     1 
ATOM   4349 C  CB    . LEU B 1 172 ? 1.076   48.059  -2.439  1.00 33.98 ? 164 LEU B CB    1 
ATOM   4350 C  CG    . LEU B 1 172 ? 1.305   48.543  -3.871  1.00 34.04 ? 164 LEU B CG    1 
ATOM   4351 C  CD1   . LEU B 1 172 ? 0.086   48.260  -4.730  1.00 33.85 ? 164 LEU B CD1   1 
ATOM   4352 C  CD2   . LEU B 1 172 ? 1.648   50.022  -3.895  1.00 33.87 ? 164 LEU B CD2   1 
ATOM   4353 N  N     . PRO B 1 173 ? 2.680   48.282  0.920   1.00 32.28 ? 165 PRO B N     1 
ATOM   4354 C  CA    . PRO B 1 173 ? 2.432   48.030  2.344   1.00 31.62 ? 165 PRO B CA    1 
ATOM   4355 C  C     . PRO B 1 173 ? 1.300   48.876  2.914   1.00 30.86 ? 165 PRO B C     1 
ATOM   4356 O  O     . PRO B 1 173 ? 0.691   48.492  3.904   1.00 31.00 ? 165 PRO B O     1 
ATOM   4357 C  CB    . PRO B 1 173 ? 3.764   48.417  3.007   1.00 31.48 ? 165 PRO B CB    1 
ATOM   4358 C  CG    . PRO B 1 173 ? 4.759   48.458  1.891   1.00 31.91 ? 165 PRO B CG    1 
ATOM   4359 C  CD    . PRO B 1 173 ? 3.997   48.898  0.703   1.00 32.09 ? 165 PRO B CD    1 
ATOM   4360 N  N     . GLY B 1 174 ? 1.016   50.009  2.277   1.00 30.00 ? 166 GLY B N     1 
ATOM   4361 C  CA    . GLY B 1 174 ? -0.016  50.929  2.753   1.00 28.94 ? 166 GLY B CA    1 
ATOM   4362 C  C     . GLY B 1 174 ? -1.426  50.424  2.522   1.00 28.29 ? 166 GLY B C     1 
ATOM   4363 O  O     . GLY B 1 174 ? -2.388  50.983  3.049   1.00 28.38 ? 166 GLY B O     1 
ATOM   4364 N  N     . GLN B 1 175 ? -1.547  49.371  1.718   1.00 27.53 ? 167 GLN B N     1 
ATOM   4365 C  CA    . GLN B 1 175 ? -2.825  48.704  1.497   1.00 26.62 ? 167 GLN B CA    1 
ATOM   4366 C  C     . GLN B 1 175 ? -3.068  47.669  2.588   1.00 25.99 ? 167 GLN B C     1 
ATOM   4367 O  O     . GLN B 1 175 ? -2.118  47.210  3.227   1.00 25.84 ? 167 GLN B O     1 
ATOM   4368 C  CB    . GLN B 1 175 ? -2.838  48.036  0.121   1.00 26.68 ? 167 GLN B CB    1 
ATOM   4369 C  CG    . GLN B 1 175 ? -2.900  49.020  -1.036  1.00 26.74 ? 167 GLN B CG    1 
ATOM   4370 C  CD    . GLN B 1 175 ? -2.935  48.341  -2.393  1.00 26.63 ? 167 GLN B CD    1 
ATOM   4371 O  OE1   . GLN B 1 175 ? -2.997  49.007  -3.424  1.00 27.30 ? 167 GLN B OE1   1 
ATOM   4372 N  NE2   . GLN B 1 175 ? -2.895  47.013  -2.399  1.00 26.21 ? 167 GLN B NE2   1 
ATOM   4373 N  N     . PRO B 1 176 ? -4.349  47.303  2.820   1.00 25.31 ? 168 PRO B N     1 
ATOM   4374 C  CA    . PRO B 1 176 ? -4.676  46.256  3.790   1.00 24.76 ? 168 PRO B CA    1 
ATOM   4375 C  C     . PRO B 1 176 ? -4.114  44.909  3.359   1.00 24.37 ? 168 PRO B C     1 
ATOM   4376 O  O     . PRO B 1 176 ? -3.762  44.087  4.202   1.00 24.52 ? 168 PRO B O     1 
ATOM   4377 C  CB    . PRO B 1 176 ? -6.210  46.212  3.760   1.00 24.74 ? 168 PRO B CB    1 
ATOM   4378 C  CG    . PRO B 1 176 ? -6.630  47.495  3.145   1.00 24.97 ? 168 PRO B CG    1 
ATOM   4379 C  CD    . PRO B 1 176 ? -5.557  47.865  2.193   1.00 25.28 ? 168 PRO B CD    1 
ATOM   4380 N  N     . CYS B 1 177 ? -4.032  44.698  2.048   1.00 23.76 ? 169 CYS B N     1 
ATOM   4381 C  CA    . CYS B 1 177 ? -3.501  43.463  1.484   1.00 23.33 ? 169 CYS B CA    1 
ATOM   4382 C  C     . CYS B 1 177 ? -3.060  43.703  0.052   1.00 22.88 ? 169 CYS B C     1 
ATOM   4383 O  O     . CYS B 1 177 ? -3.576  44.594  -0.632  1.00 22.80 ? 169 CYS B O     1 
ATOM   4384 C  CB    . CYS B 1 177 ? -4.564  42.373  1.500   1.00 23.47 ? 169 CYS B CB    1 
ATOM   4385 S  SG    . CYS B 1 177 ? -6.053  42.819  0.583   1.00 24.06 ? 169 CYS B SG    1 
ATOM   4386 N  N     . GLN B 1 178 ? -2.110  42.903  -0.403  1.00 22.22 ? 170 GLN B N     1 
ATOM   4387 C  CA    . GLN B 1 178 ? -1.696  42.937  -1.790  1.00 21.72 ? 170 GLN B CA    1 
ATOM   4388 C  C     . GLN B 1 178 ? -1.803  41.554  -2.406  1.00 21.35 ? 170 GLN B C     1 
ATOM   4389 O  O     . GLN B 1 178 ? -2.137  40.587  -1.722  1.00 21.26 ? 170 GLN B O     1 
ATOM   4390 C  CB    . GLN B 1 178 ? -0.272  43.481  -1.921  1.00 21.63 ? 170 GLN B CB    1 
ATOM   4391 C  CG    . GLN B 1 178 ? 0.673   43.022  -0.839  1.00 21.62 ? 170 GLN B CG    1 
ATOM   4392 C  CD    . GLN B 1 178 ? 1.881   43.917  -0.716  1.00 22.21 ? 170 GLN B CD    1 
ATOM   4393 O  OE1   . GLN B 1 178 ? 2.328   44.516  -1.697  1.00 21.64 ? 170 GLN B OE1   1 
ATOM   4394 N  NE2   . GLN B 1 178 ? 2.420   44.019  0.494   1.00 22.50 ? 170 GLN B NE2   1 
ATOM   4395 N  N     . PHE B 1 179 ? -1.539  41.465  -3.704  1.00 20.84 ? 171 PHE B N     1 
ATOM   4396 C  CA    . PHE B 1 179 ? -1.659  40.207  -4.411  1.00 20.43 ? 171 PHE B CA    1 
ATOM   4397 C  C     . PHE B 1 179 ? -0.435  39.907  -5.263  1.00 20.44 ? 171 PHE B C     1 
ATOM   4398 O  O     . PHE B 1 179 ? 0.130   40.801  -5.895  1.00 20.46 ? 171 PHE B O     1 
ATOM   4399 C  CB    . PHE B 1 179 ? -2.920  40.197  -5.270  1.00 20.32 ? 171 PHE B CB    1 
ATOM   4400 C  CG    . PHE B 1 179 ? -4.189  40.067  -4.479  1.00 19.78 ? 171 PHE B CG    1 
ATOM   4401 C  CD1   . PHE B 1 179 ? -4.827  41.189  -3.976  1.00 19.12 ? 171 PHE B CD1   1 
ATOM   4402 C  CD2   . PHE B 1 179 ? -4.744  38.819  -4.233  1.00 19.21 ? 171 PHE B CD2   1 
ATOM   4403 C  CE1   . PHE B 1 179 ? -5.984  41.069  -3.243  1.00 19.34 ? 171 PHE B CE1   1 
ATOM   4404 C  CE2   . PHE B 1 179 ? -5.905  38.695  -3.502  1.00 18.83 ? 171 PHE B CE2   1 
ATOM   4405 C  CZ    . PHE B 1 179 ? -6.528  39.820  -3.008  1.00 19.31 ? 171 PHE B CZ    1 
ATOM   4406 N  N     . ALA B 1 180 ? -0.015  38.646  -5.250  1.00 20.25 ? 172 ALA B N     1 
ATOM   4407 C  CA    . ALA B 1 180 ? 0.962   38.156  -6.198  1.00 20.19 ? 172 ALA B CA    1 
ATOM   4408 C  C     . ALA B 1 180 ? 0.247   37.488  -7.361  1.00 20.29 ? 172 ALA B C     1 
ATOM   4409 O  O     . ALA B 1 180 ? -0.775  36.824  -7.172  1.00 20.32 ? 172 ALA B O     1 
ATOM   4410 C  CB    . ALA B 1 180 ? 1.915   37.177  -5.524  1.00 20.14 ? 172 ALA B CB    1 
ATOM   4411 N  N     . LEU B 1 181 ? 0.776   37.677  -8.566  1.00 20.38 ? 173 LEU B N     1 
ATOM   4412 C  CA    . LEU B 1 181 ? 0.216   37.035  -9.756  1.00 20.42 ? 173 LEU B CA    1 
ATOM   4413 C  C     . LEU B 1 181 ? 1.094   35.884  -10.252 1.00 20.47 ? 173 LEU B C     1 
ATOM   4414 O  O     . LEU B 1 181 ? 2.322   36.012  -10.324 1.00 20.51 ? 173 LEU B O     1 
ATOM   4415 C  CB    . LEU B 1 181 ? 0.002   38.058  -10.872 1.00 20.26 ? 173 LEU B CB    1 
ATOM   4416 C  CG    . LEU B 1 181 ? -1.123  39.075  -10.645 1.00 20.31 ? 173 LEU B CG    1 
ATOM   4417 C  CD1   . LEU B 1 181 ? -1.206  40.035  -11.804 1.00 20.05 ? 173 LEU B CD1   1 
ATOM   4418 C  CD2   . LEU B 1 181 ? -2.461  38.377  -10.432 1.00 19.93 ? 173 LEU B CD2   1 
ATOM   4419 N  N     . GLN B 1 182 ? 0.460   34.759  -10.578 1.00 20.35 ? 174 GLN B N     1 
ATOM   4420 C  CA    . GLN B 1 182 ? 1.163   33.641  -11.203 1.00 20.35 ? 174 GLN B CA    1 
ATOM   4421 C  C     . GLN B 1 182 ? 0.497   33.217  -12.513 1.00 20.66 ? 174 GLN B C     1 
ATOM   4422 O  O     . GLN B 1 182 ? -0.724  33.008  -12.568 1.00 20.66 ? 174 GLN B O     1 
ATOM   4423 C  CB    . GLN B 1 182 ? 1.263   32.454  -10.249 1.00 20.16 ? 174 GLN B CB    1 
ATOM   4424 C  CG    . GLN B 1 182 ? 2.230   31.383  -10.718 1.00 19.35 ? 174 GLN B CG    1 
ATOM   4425 C  CD    . GLN B 1 182 ? 2.324   30.213  -9.764  1.00 19.15 ? 174 GLN B CD    1 
ATOM   4426 O  OE1   . GLN B 1 182 ? 1.436   29.994  -8.935  1.00 19.65 ? 174 GLN B OE1   1 
ATOM   4427 N  NE2   . GLN B 1 182 ? 3.401   29.444  -9.879  1.00 17.98 ? 174 GLN B NE2   1 
ATOM   4428 N  N     . ALA B 1 183 ? 1.308   33.084  -13.560 1.00 20.70 ? 175 ALA B N     1 
ATOM   4429 C  CA    . ALA B 1 183 ? 0.811   32.756  -14.886 1.00 20.93 ? 175 ALA B CA    1 
ATOM   4430 C  C     . ALA B 1 183 ? 0.424   31.284  -15.003 1.00 21.36 ? 175 ALA B C     1 
ATOM   4431 O  O     . ALA B 1 183 ? 1.191   30.396  -14.625 1.00 21.21 ? 175 ALA B O     1 
ATOM   4432 C  CB    . ALA B 1 183 ? 1.842   33.113  -15.936 1.00 20.63 ? 175 ALA B CB    1 
ATOM   4433 N  N     . ILE B 1 184 ? -0.776  31.037  -15.510 1.00 21.78 ? 176 ILE B N     1 
ATOM   4434 C  CA    . ILE B 1 184 ? -1.132  29.726  -16.007 1.00 22.62 ? 176 ILE B CA    1 
ATOM   4435 C  C     . ILE B 1 184 ? -0.847  29.677  -17.506 1.00 23.45 ? 176 ILE B C     1 
ATOM   4436 O  O     . ILE B 1 184 ? -1.377  30.484  -18.272 1.00 23.54 ? 176 ILE B O     1 
ATOM   4437 C  CB    . ILE B 1 184 ? -2.605  29.397  -15.724 1.00 22.56 ? 176 ILE B CB    1 
ATOM   4438 C  CG1   . ILE B 1 184 ? -2.834  29.295  -14.210 1.00 22.48 ? 176 ILE B CG1   1 
ATOM   4439 C  CG2   . ILE B 1 184 ? -3.010  28.108  -16.431 1.00 22.12 ? 176 ILE B CG2   1 
ATOM   4440 C  CD1   . ILE B 1 184 ? -4.264  29.076  -13.809 1.00 22.46 ? 176 ILE B CD1   1 
ATOM   4441 N  N     . VAL B 1 185 ? 0.025   28.759  -17.913 1.00 24.35 ? 177 VAL B N     1 
ATOM   4442 C  CA    . VAL B 1 185 ? 0.617   28.814  -19.248 1.00 25.40 ? 177 VAL B CA    1 
ATOM   4443 C  C     . VAL B 1 185 ? 0.241   27.627  -20.134 1.00 26.24 ? 177 VAL B C     1 
ATOM   4444 O  O     . VAL B 1 185 ? -0.185  26.575  -19.643 1.00 26.22 ? 177 VAL B O     1 
ATOM   4445 C  CB    . VAL B 1 185 ? 2.164   28.934  -19.185 1.00 25.35 ? 177 VAL B CB    1 
ATOM   4446 C  CG1   . VAL B 1 185 ? 2.573   30.143  -18.357 1.00 25.29 ? 177 VAL B CG1   1 
ATOM   4447 C  CG2   . VAL B 1 185 ? 2.777   27.663  -18.622 1.00 25.30 ? 177 VAL B CG2   1 
ATOM   4448 N  N     . GLU B 1 186 ? 0.393   27.820  -21.445 1.00 27.32 ? 178 GLU B N     1 
ATOM   4449 C  CA    . GLU B 1 186 ? 0.253   26.748  -22.426 1.00 28.54 ? 178 GLU B CA    1 
ATOM   4450 C  C     . GLU B 1 186 ? 1.505   26.695  -23.303 1.00 29.04 ? 178 GLU B C     1 
ATOM   4451 O  O     . GLU B 1 186 ? 1.601   27.415  -24.301 1.00 29.31 ? 178 GLU B O     1 
ATOM   4452 C  CB    . GLU B 1 186 ? -0.986  26.975  -23.293 1.00 28.37 ? 178 GLU B CB    1 
ATOM   4453 C  CG    . GLU B 1 186 ? -1.221  25.892  -24.341 1.00 29.27 ? 178 GLU B CG    1 
ATOM   4454 C  CD    . GLU B 1 186 ? -2.544  26.058  -25.080 1.00 29.68 ? 178 GLU B CD    1 
ATOM   4455 O  OE1   . GLU B 1 186 ? -3.231  27.089  -24.871 1.00 30.49 ? 178 GLU B OE1   1 
ATOM   4456 O  OE2   . GLU B 1 186 ? -2.897  25.153  -25.870 1.00 30.78 ? 178 GLU B OE2   1 
ATOM   4457 N  N     . PRO B 1 187 ? 2.478   25.855  -22.915 1.00 29.59 ? 179 PRO B N     1 
ATOM   4458 C  CA    . PRO B 1 187 ? 3.796   25.765  -23.557 1.00 30.12 ? 179 PRO B CA    1 
ATOM   4459 C  C     . PRO B 1 187 ? 3.739   25.506  -25.072 1.00 30.71 ? 179 PRO B C     1 
ATOM   4460 O  O     . PRO B 1 187 ? 4.547   26.060  -25.822 1.00 30.80 ? 179 PRO B O     1 
ATOM   4461 C  CB    . PRO B 1 187 ? 4.451   24.586  -22.836 1.00 30.04 ? 179 PRO B CB    1 
ATOM   4462 C  CG    . PRO B 1 187 ? 3.781   24.551  -21.503 1.00 29.73 ? 179 PRO B CG    1 
ATOM   4463 C  CD    . PRO B 1 187 ? 2.364   24.934  -21.771 1.00 29.57 ? 179 PRO B CD    1 
ATOM   4464 N  N     . ALA B 1 188 ? 2.781   24.690  -25.506 1.00 31.35 ? 180 ALA B N     1 
ATOM   4465 C  CA    . ALA B 1 188 ? 2.677   24.290  -26.914 1.00 31.98 ? 180 ALA B CA    1 
ATOM   4466 C  C     . ALA B 1 188 ? 2.456   25.484  -27.845 1.00 32.39 ? 180 ALA B C     1 
ATOM   4467 O  O     . ALA B 1 188 ? 3.030   25.544  -28.937 1.00 32.61 ? 180 ALA B O     1 
ATOM   4468 C  CB    . ALA B 1 188 ? 1.569   23.258  -27.094 1.00 31.92 ? 180 ALA B CB    1 
ATOM   4469 N  N     . LYS B 1 189 ? 1.625   26.427  -27.408 1.00 32.75 ? 181 LYS B N     1 
ATOM   4470 C  CA    . LYS B 1 189 ? 1.347   27.633  -28.184 1.00 33.16 ? 181 LYS B CA    1 
ATOM   4471 C  C     . LYS B 1 189 ? 2.059   28.848  -27.586 1.00 33.29 ? 181 LYS B C     1 
ATOM   4472 O  O     . LYS B 1 189 ? 1.743   29.993  -27.928 1.00 33.40 ? 181 LYS B O     1 
ATOM   4473 C  CB    . LYS B 1 189 ? -0.164  27.891  -28.259 1.00 33.15 ? 181 LYS B CB    1 
ATOM   4474 C  CG    . LYS B 1 189 ? -0.964  26.739  -28.847 1.00 33.56 ? 181 LYS B CG    1 
ATOM   4475 C  CD    . LYS B 1 189 ? -2.462  26.954  -28.684 1.00 33.94 ? 181 LYS B CD    1 
ATOM   4476 C  CE    . LYS B 1 189 ? -2.979  28.046  -29.611 1.00 34.69 ? 181 LYS B CE    1 
ATOM   4477 N  NZ    . LYS B 1 189 ? -4.458  28.228  -29.477 1.00 35.03 ? 181 LYS B NZ    1 
ATOM   4478 N  N     . LYS B 1 190 ? 3.017   28.586  -26.692 1.00 33.43 ? 182 LYS B N     1 
ATOM   4479 C  CA    . LYS B 1 190 ? 3.786   29.643  -26.011 1.00 33.49 ? 182 LYS B CA    1 
ATOM   4480 C  C     . LYS B 1 190 ? 2.891   30.811  -25.560 1.00 33.39 ? 182 LYS B C     1 
ATOM   4481 O  O     . LYS B 1 190 ? 3.160   31.976  -25.868 1.00 33.14 ? 182 LYS B O     1 
ATOM   4482 C  CB    . LYS B 1 190 ? 4.925   30.136  -26.907 1.00 33.63 ? 182 LYS B CB    1 
ATOM   4483 C  CG    . LYS B 1 190 ? 6.178   30.554  -26.150 1.00 34.19 ? 182 LYS B CG    1 
ATOM   4484 C  CD    . LYS B 1 190 ? 7.438   29.961  -26.785 1.00 34.94 ? 182 LYS B CD    1 
ATOM   4485 C  CE    . LYS B 1 190 ? 7.503   28.451  -26.570 1.00 35.18 ? 182 LYS B CE    1 
ATOM   4486 N  NZ    . LYS B 1 190 ? 8.742   27.856  -27.127 1.00 35.34 ? 182 LYS B NZ    1 
ATOM   4487 N  N     . ARG B 1 191 ? 1.833   30.476  -24.815 1.00 33.29 ? 183 ARG B N     1 
ATOM   4488 C  CA    . ARG B 1 191 ? 0.735   31.406  -24.541 1.00 33.05 ? 183 ARG B CA    1 
ATOM   4489 C  C     . ARG B 1 191 ? 0.356   31.389  -23.056 1.00 32.46 ? 183 ARG B C     1 
ATOM   4490 O  O     . ARG B 1 191 ? 0.224   30.324  -22.455 1.00 32.46 ? 183 ARG B O     1 
ATOM   4491 C  CB    . ARG B 1 191 ? -0.485  31.033  -25.399 1.00 33.02 ? 183 ARG B CB    1 
ATOM   4492 C  CG    . ARG B 1 191 ? -1.728  31.885  -25.157 1.00 33.76 ? 183 ARG B CG    1 
ATOM   4493 C  CD    . ARG B 1 191 ? -2.962  31.269  -25.818 1.00 34.10 ? 183 ARG B CD    1 
ATOM   4494 N  NE    . ARG B 1 191 ? -3.582  30.228  -24.989 1.00 35.79 ? 183 ARG B NE    1 
ATOM   4495 C  CZ    . ARG B 1 191 ? -4.782  30.337  -24.413 1.00 36.30 ? 183 ARG B CZ    1 
ATOM   4496 N  NH1   . ARG B 1 191 ? -5.506  31.442  -24.571 1.00 36.32 ? 183 ARG B NH1   1 
ATOM   4497 N  NH2   . ARG B 1 191 ? -5.265  29.334  -23.685 1.00 35.64 ? 183 ARG B NH2   1 
ATOM   4498 N  N     . VAL B 1 192 ? 0.182   32.575  -22.474 1.00 31.87 ? 184 VAL B N     1 
ATOM   4499 C  CA    . VAL B 1 192 ? -0.318  32.697  -21.103 1.00 31.14 ? 184 VAL B CA    1 
ATOM   4500 C  C     . VAL B 1 192 ? -1.845  32.610  -21.078 1.00 30.71 ? 184 VAL B C     1 
ATOM   4501 O  O     . VAL B 1 192 ? -2.536  33.520  -21.537 1.00 30.83 ? 184 VAL B O     1 
ATOM   4502 C  CB    . VAL B 1 192 ? 0.138   34.026  -20.438 1.00 31.06 ? 184 VAL B CB    1 
ATOM   4503 C  CG1   . VAL B 1 192 ? -0.456  34.158  -19.044 1.00 31.24 ? 184 VAL B CG1   1 
ATOM   4504 C  CG2   . VAL B 1 192 ? 1.649   34.099  -20.375 1.00 31.17 ? 184 VAL B CG2   1 
ATOM   4505 N  N     . SER B 1 193 ? -2.365  31.511  -20.542 1.00 30.02 ? 185 SER B N     1 
ATOM   4506 C  CA    . SER B 1 193 ? -3.803  31.271  -20.532 1.00 29.39 ? 185 SER B CA    1 
ATOM   4507 C  C     . SER B 1 193 ? -4.537  32.174  -19.536 1.00 29.05 ? 185 SER B C     1 
ATOM   4508 O  O     . SER B 1 193 ? -5.539  32.802  -19.883 1.00 29.02 ? 185 SER B O     1 
ATOM   4509 C  CB    . SER B 1 193 ? -4.095  29.806  -20.230 1.00 29.50 ? 185 SER B CB    1 
ATOM   4510 O  OG    . SER B 1 193 ? -5.475  29.524  -20.372 1.00 29.73 ? 185 SER B OG    1 
ATOM   4511 N  N     . SER B 1 194 ? -4.038  32.228  -18.299 1.00 28.34 ? 186 SER B N     1 
ATOM   4512 C  CA    . SER B 1 194 ? -4.622  33.094  -17.271 1.00 27.60 ? 186 SER B CA    1 
ATOM   4513 C  C     . SER B 1 194 ? -3.617  33.497  -16.184 1.00 26.86 ? 186 SER B C     1 
ATOM   4514 O  O     . SER B 1 194 ? -2.471  33.048  -16.180 1.00 26.83 ? 186 SER B O     1 
ATOM   4515 C  CB    . SER B 1 194 ? -5.843  32.425  -16.633 1.00 27.72 ? 186 SER B CB    1 
ATOM   4516 O  OG    . SER B 1 194 ? -5.461  31.380  -15.759 1.00 28.32 ? 186 SER B OG    1 
ATOM   4517 N  N     . PHE B 1 195 ? -4.063  34.357  -15.274 1.00 25.99 ? 187 PHE B N     1 
ATOM   4518 C  CA    . PHE B 1 195 ? -3.287  34.719  -14.092 1.00 25.21 ? 187 PHE B CA    1 
ATOM   4519 C  C     . PHE B 1 195 ? -4.094  34.426  -12.840 1.00 24.75 ? 187 PHE B C     1 
ATOM   4520 O  O     . PHE B 1 195 ? -5.271  34.772  -12.762 1.00 24.75 ? 187 PHE B O     1 
ATOM   4521 C  CB    . PHE B 1 195 ? -2.932  36.206  -14.122 1.00 25.14 ? 187 PHE B CB    1 
ATOM   4522 C  CG    . PHE B 1 195 ? -1.928  36.569  -15.168 1.00 24.74 ? 187 PHE B CG    1 
ATOM   4523 C  CD1   . PHE B 1 195 ? -2.338  37.043  -16.407 1.00 24.68 ? 187 PHE B CD1   1 
ATOM   4524 C  CD2   . PHE B 1 195 ? -0.566  36.459  -14.911 1.00 24.61 ? 187 PHE B CD2   1 
ATOM   4525 C  CE1   . PHE B 1 195 ? -1.409  37.390  -17.375 1.00 24.87 ? 187 PHE B CE1   1 
ATOM   4526 C  CE2   . PHE B 1 195 ? 0.369   36.803  -15.876 1.00 24.52 ? 187 PHE B CE2   1 
ATOM   4527 C  CZ    . PHE B 1 195 ? -0.052  37.271  -17.107 1.00 24.62 ? 187 PHE B CZ    1 
ATOM   4528 N  N     . GLU B 1 196 ? -3.466  33.791  -11.859 1.00 24.20 ? 188 GLU B N     1 
ATOM   4529 C  CA    . GLU B 1 196 ? -4.104  33.588  -10.566 1.00 23.72 ? 188 GLU B CA    1 
ATOM   4530 C  C     . GLU B 1 196 ? -3.641  34.646  -9.579  1.00 23.64 ? 188 GLU B C     1 
ATOM   4531 O  O     . GLU B 1 196 ? -2.452  34.962  -9.506  1.00 23.85 ? 188 GLU B O     1 
ATOM   4532 C  CB    . GLU B 1 196 ? -3.817  32.183  -10.020 1.00 23.69 ? 188 GLU B CB    1 
ATOM   4533 C  CG    . GLU B 1 196 ? -4.532  31.869  -8.697  1.00 23.54 ? 188 GLU B CG    1 
ATOM   4534 C  CD    . GLU B 1 196 ? -4.189  30.494  -8.145  1.00 23.61 ? 188 GLU B CD    1 
ATOM   4535 O  OE1   . GLU B 1 196 ? -3.145  29.929  -8.538  1.00 24.50 ? 188 GLU B OE1   1 
ATOM   4536 O  OE2   . GLU B 1 196 ? -4.962  29.980  -7.312  1.00 22.37 ? 188 GLU B OE2   1 
ATOM   4537 N  N     . ALA B 1 197 ? -4.586  35.203  -8.830  1.00 23.33 ? 189 ALA B N     1 
ATOM   4538 C  CA    . ALA B 1 197 ? -4.268  36.185  -7.807  1.00 23.01 ? 189 ALA B CA    1 
ATOM   4539 C  C     . ALA B 1 197 ? -4.113  35.518  -6.439  1.00 22.77 ? 189 ALA B C     1 
ATOM   4540 O  O     . ALA B 1 197 ? -5.059  34.929  -5.910  1.00 22.98 ? 189 ALA B O     1 
ATOM   4541 C  CB    . ALA B 1 197 ? -5.336  37.272  -7.761  1.00 23.00 ? 189 ALA B CB    1 
ATOM   4542 N  N     . LEU B 1 198 ? -2.912  35.609  -5.879  1.00 22.26 ? 190 LEU B N     1 
ATOM   4543 C  CA    . LEU B 1 198 ? -2.625  35.038  -4.569  1.00 21.70 ? 190 LEU B CA    1 
ATOM   4544 C  C     . LEU B 1 198 ? -2.414  36.134  -3.544  1.00 21.43 ? 190 LEU B C     1 
ATOM   4545 O  O     . LEU B 1 198 ? -1.506  36.960  -3.683  1.00 20.95 ? 190 LEU B O     1 
ATOM   4546 C  CB    . LEU B 1 198 ? -1.386  34.152  -4.639  1.00 21.56 ? 190 LEU B CB    1 
ATOM   4547 C  CG    . LEU B 1 198 ? -1.457  33.027  -5.664  1.00 21.41 ? 190 LEU B CG    1 
ATOM   4548 C  CD1   . LEU B 1 198 ? -0.076  32.455  -5.933  1.00 20.42 ? 190 LEU B CD1   1 
ATOM   4549 C  CD2   . LEU B 1 198 ? -2.425  31.948  -5.198  1.00 20.84 ? 190 LEU B CD2   1 
ATOM   4550 N  N     . ILE B 1 199 ? -3.244  36.130  -2.505  1.00 21.16 ? 191 ILE B N     1 
ATOM   4551 C  CA    . ILE B 1 199 ? -3.218  37.187  -1.500  1.00 21.02 ? 191 ILE B CA    1 
ATOM   4552 C  C     . ILE B 1 199 ? -1.905  37.232  -0.726  1.00 20.94 ? 191 ILE B C     1 
ATOM   4553 O  O     . ILE B 1 199 ? -1.277  36.204  -0.481  1.00 20.71 ? 191 ILE B O     1 
ATOM   4554 C  CB    . ILE B 1 199 ? -4.422  37.097  -0.531  1.00 20.95 ? 191 ILE B CB    1 
ATOM   4555 C  CG1   . ILE B 1 199 ? -4.661  38.447  0.157   1.00 20.91 ? 191 ILE B CG1   1 
ATOM   4556 C  CG2   . ILE B 1 199 ? -4.224  35.985  0.479   1.00 20.81 ? 191 ILE B CG2   1 
ATOM   4557 C  CD1   . ILE B 1 199 ? -5.958  38.522  0.930   1.00 21.00 ? 191 ILE B CD1   1 
ATOM   4558 N  N     . ARG B 1 200 ? -1.475  38.443  -0.398  1.00 21.12 ? 192 ARG B N     1 
ATOM   4559 C  CA    . ARG B 1 200 ? -0.279  38.653  0.394   1.00 21.42 ? 192 ARG B CA    1 
ATOM   4560 C  C     . ARG B 1 200 ? -0.558  39.678  1.478   1.00 21.73 ? 192 ARG B C     1 
ATOM   4561 O  O     . ARG B 1 200 ? -1.328  40.626  1.267   1.00 21.76 ? 192 ARG B O     1 
ATOM   4562 C  CB    . ARG B 1 200 ? 0.871   39.138  -0.491  1.00 21.32 ? 192 ARG B CB    1 
ATOM   4563 C  CG    . ARG B 1 200 ? 1.355   38.123  -1.524  1.00 21.23 ? 192 ARG B CG    1 
ATOM   4564 C  CD    . ARG B 1 200 ? 2.008   36.924  -0.868  1.00 20.59 ? 192 ARG B CD    1 
ATOM   4565 N  NE    . ARG B 1 200 ? 2.708   36.092  -1.840  1.00 20.63 ? 192 ARG B NE    1 
ATOM   4566 C  CZ    . ARG B 1 200 ? 2.216   34.977  -2.371  1.00 20.45 ? 192 ARG B CZ    1 
ATOM   4567 N  NH1   . ARG B 1 200 ? 1.008   34.540  -2.027  1.00 19.61 ? 192 ARG B NH1   1 
ATOM   4568 N  NH2   . ARG B 1 200 ? 2.939   34.292  -3.243  1.00 21.05 ? 192 ARG B NH2   1 
ATOM   4569 N  N     . SER B 1 201 ? 0.069   39.489  2.638   1.00 22.11 ? 193 SER B N     1 
ATOM   4570 C  CA    . SER B 1 201 ? -0.066  40.425  3.752   1.00 22.69 ? 193 SER B CA    1 
ATOM   4571 C  C     . SER B 1 201 ? 0.649   41.739  3.424   1.00 23.13 ? 193 SER B C     1 
ATOM   4572 O  O     . SER B 1 201 ? 1.442   41.792  2.484   1.00 23.29 ? 193 SER B O     1 
ATOM   4573 C  CB    . SER B 1 201 ? 0.503   39.809  5.037   1.00 22.69 ? 193 SER B CB    1 
ATOM   4574 O  OG    . SER B 1 201 ? 1.918   39.870  5.053   1.00 22.90 ? 193 SER B OG    1 
ATOM   4575 N  N     . PRO B 1 202 ? 0.351   42.811  4.185   1.00 23.65 ? 194 PRO B N     1 
ATOM   4576 C  CA    . PRO B 1 202 ? 1.019   44.106  3.997   1.00 24.00 ? 194 PRO B CA    1 
ATOM   4577 C  C     . PRO B 1 202 ? 2.553   44.021  4.000   1.00 24.46 ? 194 PRO B C     1 
ATOM   4578 O  O     . PRO B 1 202 ? 3.213   44.854  3.386   1.00 24.69 ? 194 PRO B O     1 
ATOM   4579 C  CB    . PRO B 1 202 ? 0.537   44.921  5.195   1.00 24.02 ? 194 PRO B CB    1 
ATOM   4580 C  CG    . PRO B 1 202 ? -0.779  44.343  5.533   1.00 23.69 ? 194 PRO B CG    1 
ATOM   4581 C  CD    . PRO B 1 202 ? -0.677  42.876  5.242   1.00 23.68 ? 194 PRO B CD    1 
ATOM   4582 N  N     . THR B 1 203 ? 3.103   43.018  4.677   1.00 25.06 ? 195 THR B N     1 
ATOM   4583 C  CA    . THR B 1 203 ? 4.559   42.852  4.761   1.00 25.63 ? 195 THR B CA    1 
ATOM   4584 C  C     . THR B 1 203 ? 5.107   41.908  3.678   1.00 26.00 ? 195 THR B C     1 
ATOM   4585 O  O     . THR B 1 203 ? 6.322   41.672  3.601   1.00 26.18 ? 195 THR B O     1 
ATOM   4586 C  CB    . THR B 1 203 ? 4.989   42.338  6.147   1.00 25.64 ? 195 THR B CB    1 
ATOM   4587 O  OG1   . THR B 1 203 ? 4.505   41.003  6.336   1.00 26.03 ? 195 THR B OG1   1 
ATOM   4588 C  CG2   . THR B 1 203 ? 4.434   43.234  7.242   1.00 25.54 ? 195 THR B CG2   1 
ATOM   4589 N  N     . GLY B 1 204 ? 4.209   41.375  2.849   1.00 26.25 ? 196 GLY B N     1 
ATOM   4590 C  CA    . GLY B 1 204 ? 4.596   40.501  1.740   1.00 26.35 ? 196 GLY B CA    1 
ATOM   4591 C  C     . GLY B 1 204 ? 4.476   39.024  2.078   1.00 26.62 ? 196 GLY B C     1 
ATOM   4592 O  O     . GLY B 1 204 ? 4.803   38.161  1.256   1.00 26.39 ? 196 GLY B O     1 
ATOM   4593 N  N     . GLY B 1 205 ? 3.998   38.736  3.290   1.00 26.76 ? 197 GLY B N     1 
ATOM   4594 C  CA    . GLY B 1 205 ? 3.916   37.369  3.787   1.00 26.97 ? 197 GLY B CA    1 
ATOM   4595 C  C     . GLY B 1 205 ? 2.754   36.581  3.213   1.00 27.34 ? 197 GLY B C     1 
ATOM   4596 O  O     . GLY B 1 205 ? 1.901   37.131  2.514   1.00 27.38 ? 197 GLY B O     1 
ATOM   4597 N  N     . SER B 1 206 ? 2.713   35.291  3.537   1.00 27.61 ? 198 SER B N     1 
ATOM   4598 C  CA    . SER B 1 206 ? 1.765   34.347  2.933   1.00 27.89 ? 198 SER B CA    1 
ATOM   4599 C  C     . SER B 1 206 ? 0.296   34.618  3.323   1.00 27.99 ? 198 SER B C     1 
ATOM   4600 O  O     . SER B 1 206 ? 0.029   35.300  4.318   1.00 28.08 ? 198 SER B O     1 
ATOM   4601 C  CB    . SER B 1 206 ? 2.148   32.909  3.312   1.00 27.90 ? 198 SER B CB    1 
ATOM   4602 O  OG    . SER B 1 206 ? 1.857   32.646  4.675   1.00 27.93 ? 198 SER B OG    1 
ATOM   4603 N  N     . PRO B 1 207 ? -0.657  34.081  2.525   1.00 28.02 ? 199 PRO B N     1 
ATOM   4604 C  CA    . PRO B 1 207 ? -2.084  34.060  2.851   1.00 28.13 ? 199 PRO B CA    1 
ATOM   4605 C  C     . PRO B 1 207 ? -2.378  33.697  4.314   1.00 28.35 ? 199 PRO B C     1 
ATOM   4606 O  O     . PRO B 1 207 ? -3.233  34.323  4.948   1.00 28.21 ? 199 PRO B O     1 
ATOM   4607 C  CB    . PRO B 1 207 ? -2.627  32.974  1.927   1.00 27.93 ? 199 PRO B CB    1 
ATOM   4608 C  CG    . PRO B 1 207 ? -1.759  33.043  0.733   1.00 27.93 ? 199 PRO B CG    1 
ATOM   4609 C  CD    . PRO B 1 207 ? -0.394  33.481  1.202   1.00 27.87 ? 199 PRO B CD    1 
ATOM   4610 N  N     . VAL B 1 208 ? -1.680  32.685  4.829   1.00 28.68 ? 200 VAL B N     1 
ATOM   4611 C  CA    . VAL B 1 208 ? -1.857  32.241  6.210   1.00 29.02 ? 200 VAL B CA    1 
ATOM   4612 C  C     . VAL B 1 208 ? -1.648  33.396  7.191   1.00 29.24 ? 200 VAL B C     1 
ATOM   4613 O  O     . VAL B 1 208 ? -2.511  33.675  8.024   1.00 29.21 ? 200 VAL B O     1 
ATOM   4614 C  CB    . VAL B 1 208 ? -0.890  31.093  6.560   1.00 29.12 ? 200 VAL B CB    1 
ATOM   4615 C  CG1   . VAL B 1 208 ? -1.219  30.514  7.946   1.00 29.08 ? 200 VAL B CG1   1 
ATOM   4616 C  CG2   . VAL B 1 208 ? -0.942  30.011  5.491   1.00 29.07 ? 200 VAL B CG2   1 
ATOM   4617 N  N     . GLU B 1 209 ? -0.511  34.080  7.059   1.00 29.41 ? 201 GLU B N     1 
ATOM   4618 C  CA    . GLU B 1 209 ? -0.187  35.231  7.897   1.00 29.77 ? 201 GLU B CA    1 
ATOM   4619 C  C     . GLU B 1 209 ? -1.218  36.345  7.746   1.00 29.71 ? 201 GLU B C     1 
ATOM   4620 O  O     . GLU B 1 209 ? -1.585  37.001  8.726   1.00 29.73 ? 201 GLU B O     1 
ATOM   4621 C  CB    . GLU B 1 209 ? 1.201   35.763  7.555   1.00 29.68 ? 201 GLU B CB    1 
ATOM   4622 C  CG    . GLU B 1 209 ? 2.297   34.707  7.577   1.00 30.57 ? 201 GLU B CG    1 
ATOM   4623 C  CD    . GLU B 1 209 ? 3.624   35.233  7.049   1.00 30.96 ? 201 GLU B CD    1 
ATOM   4624 O  OE1   . GLU B 1 209 ? 3.803   36.471  7.005   1.00 31.89 ? 201 GLU B OE1   1 
ATOM   4625 O  OE2   . GLU B 1 209 ? 4.489   34.408  6.684   1.00 32.21 ? 201 GLU B OE2   1 
ATOM   4626 N  N     . MET B 1 210 ? -1.682  36.557  6.515   1.00 29.78 ? 202 MET B N     1 
ATOM   4627 C  CA    . MET B 1 210 ? -2.704  37.561  6.245   1.00 29.57 ? 202 MET B CA    1 
ATOM   4628 C  C     . MET B 1 210 ? -3.990  37.274  7.017   1.00 29.74 ? 202 MET B C     1 
ATOM   4629 O  O     . MET B 1 210 ? -4.440  38.096  7.814   1.00 29.79 ? 202 MET B O     1 
ATOM   4630 C  CB    . MET B 1 210 ? -2.995  37.652  4.747   1.00 29.41 ? 202 MET B CB    1 
ATOM   4631 C  CG    . MET B 1 210 ? -4.169  38.561  4.394   1.00 28.54 ? 202 MET B CG    1 
ATOM   4632 S  SD    . MET B 1 210 ? -3.737  40.308  4.404   1.00 26.96 ? 202 MET B SD    1 
ATOM   4633 C  CE    . MET B 1 210 ? -4.217  40.805  6.062   1.00 26.34 ? 202 MET B CE    1 
ATOM   4634 N  N     . PHE B 1 211 ? -4.563  36.096  6.790   1.00 29.90 ? 203 PHE B N     1 
ATOM   4635 C  CA    . PHE B 1 211 ? -5.824  35.721  7.425   1.00 30.11 ? 203 PHE B CA    1 
ATOM   4636 C  C     . PHE B 1 211 ? -5.696  35.569  8.946   1.00 30.42 ? 203 PHE B C     1 
ATOM   4637 O  O     . PHE B 1 211 ? -6.668  35.767  9.678   1.00 30.58 ? 203 PHE B O     1 
ATOM   4638 C  CB    . PHE B 1 211 ? -6.389  34.446  6.795   1.00 29.90 ? 203 PHE B CB    1 
ATOM   4639 C  CG    . PHE B 1 211 ? -7.105  34.680  5.493   1.00 29.89 ? 203 PHE B CG    1 
ATOM   4640 C  CD1   . PHE B 1 211 ? -8.450  35.024  5.478   1.00 29.97 ? 203 PHE B CD1   1 
ATOM   4641 C  CD2   . PHE B 1 211 ? -6.434  34.565  4.284   1.00 29.66 ? 203 PHE B CD2   1 
ATOM   4642 C  CE1   . PHE B 1 211 ? -9.110  35.246  4.281   1.00 30.04 ? 203 PHE B CE1   1 
ATOM   4643 C  CE2   . PHE B 1 211 ? -7.092  34.785  3.082   1.00 29.22 ? 203 PHE B CE2   1 
ATOM   4644 C  CZ    . PHE B 1 211 ? -8.427  35.123  3.080   1.00 29.56 ? 203 PHE B CZ    1 
ATOM   4645 N  N     . ALA B 1 212 ? -4.487  35.252  9.413   1.00 30.68 ? 204 ALA B N     1 
ATOM   4646 C  CA    . ALA B 1 212 ? -4.210  35.153  10.850  1.00 30.92 ? 204 ALA B CA    1 
ATOM   4647 C  C     . ALA B 1 212 ? -4.278  36.514  11.536  1.00 31.08 ? 204 ALA B C     1 
ATOM   4648 O  O     . ALA B 1 212 ? -4.519  36.597  12.743  1.00 31.28 ? 204 ALA B O     1 
ATOM   4649 C  CB    . ALA B 1 212 ? -2.850  34.507  11.090  1.00 30.83 ? 204 ALA B CB    1 
ATOM   4650 N  N     . ALA B 1 213 ? -4.058  37.575  10.762  1.00 31.10 ? 205 ALA B N     1 
ATOM   4651 C  CA    . ALA B 1 213 ? -4.097  38.939  11.284  1.00 31.16 ? 205 ALA B CA    1 
ATOM   4652 C  C     . ALA B 1 213 ? -5.521  39.474  11.302  1.00 31.29 ? 205 ALA B C     1 
ATOM   4653 O  O     . ALA B 1 213 ? -5.810  40.480  11.949  1.00 31.44 ? 205 ALA B O     1 
ATOM   4654 C  CB    . ALA B 1 213 ? -3.200  39.848  10.454  1.00 31.13 ? 205 ALA B CB    1 
ATOM   4655 N  N     . ILE B 1 214 ? -6.403  38.804  10.572  1.00 31.37 ? 206 ILE B N     1 
ATOM   4656 C  CA    . ILE B 1 214 ? -7.803  39.180  10.527  1.00 31.20 ? 206 ILE B CA    1 
ATOM   4657 C  C     . ILE B 1 214 ? -8.570  38.377  11.564  1.00 31.53 ? 206 ILE B C     1 
ATOM   4658 O  O     . ILE B 1 214 ? -8.336  37.177  11.728  1.00 31.51 ? 206 ILE B O     1 
ATOM   4659 C  CB    . ILE B 1 214 ? -8.405  38.945  9.109   1.00 31.10 ? 206 ILE B CB    1 
ATOM   4660 C  CG1   . ILE B 1 214 ? -7.567  39.663  8.046   1.00 30.60 ? 206 ILE B CG1   1 
ATOM   4661 C  CG2   . ILE B 1 214 ? -9.859  39.411  9.042   1.00 30.68 ? 206 ILE B CG2   1 
ATOM   4662 C  CD1   . ILE B 1 214 ? -7.494  41.178  8.233   1.00 30.15 ? 206 ILE B CD1   1 
ATOM   4663 N  N     . ALA B 1 215 ? -9.463  39.050  12.284  1.00 31.91 ? 207 ALA B N     1 
ATOM   4664 C  CA    . ALA B 1 215 ? -10.320 38.396  13.267  1.00 32.38 ? 207 ALA B CA    1 
ATOM   4665 C  C     . ALA B 1 215 ? -11.128 37.274  12.623  1.00 32.71 ? 207 ALA B C     1 
ATOM   4666 O  O     . ALA B 1 215 ? -11.521 37.370  11.458  1.00 32.83 ? 207 ALA B O     1 
ATOM   4667 C  CB    . ALA B 1 215 ? -11.246 39.411  13.919  1.00 32.37 ? 207 ALA B CB    1 
ATOM   4668 N  N     . ALA B 1 216 ? -11.359 36.207  13.381  1.00 33.07 ? 208 ALA B N     1 
ATOM   4669 C  CA    . ALA B 1 216 ? -12.057 35.030  12.863  1.00 33.54 ? 208 ALA B CA    1 
ATOM   4670 C  C     . ALA B 1 216 ? -13.488 35.355  12.423  1.00 33.79 ? 208 ALA B C     1 
ATOM   4671 O  O     . ALA B 1 216 ? -13.975 34.815  11.431  1.00 33.96 ? 208 ALA B O     1 
ATOM   4672 C  CB    . ALA B 1 216 ? -12.052 33.909  13.896  1.00 33.43 ? 208 ALA B CB    1 
ATOM   4673 N  N     . GLU B 1 217 ? -14.143 36.258  13.153  1.00 34.03 ? 209 GLU B N     1 
ATOM   4674 C  CA    . GLU B 1 217 ? -15.508 36.686  12.822  1.00 34.49 ? 209 GLU B CA    1 
ATOM   4675 C  C     . GLU B 1 217 ? -15.558 37.500  11.520  1.00 34.13 ? 209 GLU B C     1 
ATOM   4676 O  O     . GLU B 1 217 ? -16.624 37.675  10.929  1.00 33.94 ? 209 GLU B O     1 
ATOM   4677 C  CB    . GLU B 1 217 ? -16.116 37.502  13.979  1.00 34.54 ? 209 GLU B CB    1 
ATOM   4678 C  CG    . GLU B 1 217 ? -15.227 38.666  14.474  1.00 35.53 ? 209 GLU B CG    1 
ATOM   4679 C  CD    . GLU B 1 217 ? -16.030 39.811  15.099  1.00 35.87 ? 209 GLU B CD    1 
ATOM   4680 O  OE1   . GLU B 1 217 ? -17.101 39.536  15.688  1.00 37.17 ? 209 GLU B OE1   1 
ATOM   4681 O  OE2   . GLU B 1 217 ? -15.582 40.984  15.005  1.00 36.66 ? 209 GLU B OE2   1 
ATOM   4682 N  N     . ASP B 1 218 ? -14.393 37.975  11.077  1.00 33.93 ? 210 ASP B N     1 
ATOM   4683 C  CA    . ASP B 1 218 ? -14.312 38.925  9.972   1.00 33.62 ? 210 ASP B CA    1 
ATOM   4684 C  C     . ASP B 1 218 ? -13.621 38.351  8.729   1.00 33.35 ? 210 ASP B C     1 
ATOM   4685 O  O     . ASP B 1 218 ? -13.495 39.039  7.714   1.00 33.16 ? 210 ASP B O     1 
ATOM   4686 C  CB    . ASP B 1 218 ? -13.589 40.197  10.425  1.00 33.71 ? 210 ASP B CB    1 
ATOM   4687 C  CG    . ASP B 1 218 ? -14.406 41.017  11.410  1.00 33.99 ? 210 ASP B CG    1 
ATOM   4688 O  OD1   . ASP B 1 218 ? -15.655 40.922  11.382  1.00 33.95 ? 210 ASP B OD1   1 
ATOM   4689 O  OD2   . ASP B 1 218 ? -13.797 41.771  12.202  1.00 34.38 ? 210 ASP B OD2   1 
ATOM   4690 N  N     . ARG B 1 219 ? -13.190 37.092  8.810   1.00 33.16 ? 211 ARG B N     1 
ATOM   4691 C  CA    . ARG B 1 219 ? -12.360 36.482  7.757   1.00 33.02 ? 211 ARG B CA    1 
ATOM   4692 C  C     . ARG B 1 219 ? -13.075 36.318  6.412   1.00 32.73 ? 211 ARG B C     1 
ATOM   4693 O  O     . ARG B 1 219 ? -12.509 36.633  5.368   1.00 32.57 ? 211 ARG B O     1 
ATOM   4694 C  CB    . ARG B 1 219 ? -11.777 35.147  8.225   1.00 33.15 ? 211 ARG B CB    1 
ATOM   4695 C  CG    . ARG B 1 219 ? -10.354 35.261  8.740   1.00 34.19 ? 211 ARG B CG    1 
ATOM   4696 C  CD    . ARG B 1 219 ? -10.024 34.175  9.747   1.00 35.63 ? 211 ARG B CD    1 
ATOM   4697 N  NE    . ARG B 1 219 ? -8.833  34.513  10.525  1.00 36.31 ? 211 ARG B NE    1 
ATOM   4698 C  CZ    . ARG B 1 219 ? -8.473  33.907  11.654  1.00 36.59 ? 211 ARG B CZ    1 
ATOM   4699 N  NH1   . ARG B 1 219 ? -9.213  32.926  12.149  1.00 36.45 ? 211 ARG B NH1   1 
ATOM   4700 N  NH2   . ARG B 1 219 ? -7.371  34.287  12.288  1.00 36.62 ? 211 ARG B NH2   1 
ATOM   4701 N  N     . TYR B 1 220 ? -14.315 35.825  6.447   1.00 32.53 ? 212 TYR B N     1 
ATOM   4702 C  CA    . TYR B 1 220 ? -15.118 35.653  5.231   1.00 32.29 ? 212 TYR B CA    1 
ATOM   4703 C  C     . TYR B 1 220 ? -15.313 36.974  4.489   1.00 31.96 ? 212 TYR B C     1 
ATOM   4704 O  O     . TYR B 1 220 ? -15.114 37.048  3.270   1.00 32.11 ? 212 TYR B O     1 
ATOM   4705 C  CB    . TYR B 1 220 ? -16.488 35.032  5.555   1.00 32.60 ? 212 TYR B CB    1 
ATOM   4706 C  CG    . TYR B 1 220 ? -16.445 33.570  5.956   1.00 32.99 ? 212 TYR B CG    1 
ATOM   4707 C  CD1   . TYR B 1 220 ? -15.516 32.696  5.392   1.00 33.34 ? 212 TYR B CD1   1 
ATOM   4708 C  CD2   . TYR B 1 220 ? -17.354 33.056  6.879   1.00 33.35 ? 212 TYR B CD2   1 
ATOM   4709 C  CE1   . TYR B 1 220 ? -15.477 31.354  5.758   1.00 33.46 ? 212 TYR B CE1   1 
ATOM   4710 C  CE2   . TYR B 1 220 ? -17.327 31.715  7.248   1.00 33.41 ? 212 TYR B CE2   1 
ATOM   4711 C  CZ    . TYR B 1 220 ? -16.388 30.870  6.681   1.00 33.52 ? 212 TYR B CZ    1 
ATOM   4712 O  OH    . TYR B 1 220 ? -16.356 29.542  7.043   1.00 34.00 ? 212 TYR B OH    1 
ATOM   4713 N  N     . ARG B 1 221 ? -15.699 38.013  5.226   1.00 31.23 ? 213 ARG B N     1 
ATOM   4714 C  CA    . ARG B 1 221 ? -15.920 39.328  4.637   1.00 30.78 ? 213 ARG B CA    1 
ATOM   4715 C  C     . ARG B 1 221 ? -14.625 39.892  4.068   1.00 30.20 ? 213 ARG B C     1 
ATOM   4716 O  O     . ARG B 1 221 ? -14.607 40.423  2.959   1.00 30.08 ? 213 ARG B O     1 
ATOM   4717 C  CB    . ARG B 1 221 ? -16.522 40.289  5.663   1.00 30.84 ? 213 ARG B CB    1 
ATOM   4718 C  CG    . ARG B 1 221 ? -16.866 41.668  5.103   1.00 31.78 ? 213 ARG B CG    1 
ATOM   4719 C  CD    . ARG B 1 221 ? -17.835 42.426  6.011   1.00 33.48 ? 213 ARG B CD    1 
ATOM   4720 N  NE    . ARG B 1 221 ? -17.550 42.206  7.430   1.00 34.82 ? 213 ARG B NE    1 
ATOM   4721 C  CZ    . ARG B 1 221 ? -16.669 42.908  8.139   1.00 35.45 ? 213 ARG B CZ    1 
ATOM   4722 N  NH1   . ARG B 1 221 ? -15.976 43.889  7.569   1.00 35.47 ? 213 ARG B NH1   1 
ATOM   4723 N  NH2   . ARG B 1 221 ? -16.478 42.626  9.418   1.00 35.93 ? 213 ARG B NH2   1 
ATOM   4724 N  N     . PHE B 1 222 ? -13.538 39.745  4.820   1.00 29.61 ? 214 PHE B N     1 
ATOM   4725 C  CA    . PHE B 1 222 ? -12.225 40.174  4.354   1.00 29.11 ? 214 PHE B CA    1 
ATOM   4726 C  C     . PHE B 1 222 ? -11.824 39.451  3.069   1.00 28.70 ? 214 PHE B C     1 
ATOM   4727 O  O     . PHE B 1 222 ? -11.304 40.066  2.144   1.00 28.45 ? 214 PHE B O     1 
ATOM   4728 C  CB    . PHE B 1 222 ? -11.164 39.952  5.434   1.00 29.13 ? 214 PHE B CB    1 
ATOM   4729 C  CG    . PHE B 1 222 ? -9.803  40.473  5.061   1.00 29.25 ? 214 PHE B CG    1 
ATOM   4730 C  CD1   . PHE B 1 222 ? -8.827  39.618  4.564   1.00 29.39 ? 214 PHE B CD1   1 
ATOM   4731 C  CD2   . PHE B 1 222 ? -9.501  41.823  5.194   1.00 29.72 ? 214 PHE B CD2   1 
ATOM   4732 C  CE1   . PHE B 1 222 ? -7.578  40.097  4.212   1.00 29.50 ? 214 PHE B CE1   1 
ATOM   4733 C  CE2   . PHE B 1 222 ? -8.253  42.307  4.845   1.00 29.81 ? 214 PHE B CE2   1 
ATOM   4734 C  CZ    . PHE B 1 222 ? -7.290  41.441  4.353   1.00 29.68 ? 214 PHE B CZ    1 
ATOM   4735 N  N     . ASP B 1 223 ? -12.071 38.145  3.027   1.00 28.30 ? 215 ASP B N     1 
ATOM   4736 C  CA    . ASP B 1 223 ? -11.712 37.326  1.876   1.00 28.02 ? 215 ASP B CA    1 
ATOM   4737 C  C     . ASP B 1 223 ? -12.375 37.841  0.604   1.00 27.80 ? 215 ASP B C     1 
ATOM   4738 O  O     . ASP B 1 223 ? -11.734 37.947  -0.438  1.00 27.66 ? 215 ASP B O     1 
ATOM   4739 C  CB    . ASP B 1 223 ? -12.097 35.865  2.117   1.00 27.96 ? 215 ASP B CB    1 
ATOM   4740 C  CG    . ASP B 1 223 ? -11.550 34.931  1.048   1.00 28.07 ? 215 ASP B CG    1 
ATOM   4741 O  OD1   . ASP B 1 223 ? -10.520 35.271  0.428   1.00 27.97 ? 215 ASP B OD1   1 
ATOM   4742 O  OD2   . ASP B 1 223 ? -12.148 33.854  0.833   1.00 27.69 ? 215 ASP B OD2   1 
ATOM   4743 N  N     . LEU B 1 224 ? -13.654 38.180  0.706   1.00 27.64 ? 216 LEU B N     1 
ATOM   4744 C  CA    . LEU B 1 224 ? -14.397 38.706  -0.429  1.00 27.54 ? 216 LEU B CA    1 
ATOM   4745 C  C     . LEU B 1 224 ? -13.971 40.138  -0.787  1.00 27.26 ? 216 LEU B C     1 
ATOM   4746 O  O     . LEU B 1 224 ? -13.772 40.456  -1.957  1.00 27.39 ? 216 LEU B O     1 
ATOM   4747 C  CB    . LEU B 1 224 ? -15.904 38.644  -0.159  1.00 27.66 ? 216 LEU B CB    1 
ATOM   4748 C  CG    . LEU B 1 224 ? -16.825 38.993  -1.332  1.00 27.93 ? 216 LEU B CG    1 
ATOM   4749 C  CD1   . LEU B 1 224 ? -16.890 37.848  -2.338  1.00 27.42 ? 216 LEU B CD1   1 
ATOM   4750 C  CD2   . LEU B 1 224 ? -18.207 39.342  -0.828  1.00 27.73 ? 216 LEU B CD2   1 
ATOM   4751 N  N     . GLU B 1 225 ? -13.807 40.984  0.227   1.00 26.89 ? 217 GLU B N     1 
ATOM   4752 C  CA    . GLU B 1 225 ? -13.519 42.406  0.004   1.00 26.67 ? 217 GLU B CA    1 
ATOM   4753 C  C     . GLU B 1 225 ? -12.060 42.698  -0.364  1.00 26.33 ? 217 GLU B C     1 
ATOM   4754 O  O     . GLU B 1 225 ? -11.736 43.793  -0.834  1.00 26.21 ? 217 GLU B O     1 
ATOM   4755 C  CB    . GLU B 1 225 ? -13.935 43.232  1.211   1.00 26.67 ? 217 GLU B CB    1 
ATOM   4756 C  CG    . GLU B 1 225 ? -15.425 43.437  1.312   1.00 27.90 ? 217 GLU B CG    1 
ATOM   4757 C  CD    . GLU B 1 225 ? -15.834 44.097  2.603   1.00 29.45 ? 217 GLU B CD    1 
ATOM   4758 O  OE1   . GLU B 1 225 ? -14.935 44.497  3.380   1.00 30.41 ? 217 GLU B OE1   1 
ATOM   4759 O  OE2   . GLU B 1 225 ? -17.053 44.216  2.848   1.00 30.04 ? 217 GLU B OE2   1 
ATOM   4760 N  N     . SER B 1 226 ? -11.188 41.719  -0.150  1.00 25.99 ? 218 SER B N     1 
ATOM   4761 C  CA    . SER B 1 226 ? -9.791  41.839  -0.549  1.00 25.72 ? 218 SER B CA    1 
ATOM   4762 C  C     . SER B 1 226 ? -9.662  41.820  -2.062  1.00 25.61 ? 218 SER B C     1 
ATOM   4763 O  O     . SER B 1 226 ? -8.719  42.380  -2.618  1.00 25.75 ? 218 SER B O     1 
ATOM   4764 C  CB    . SER B 1 226 ? -8.965  40.705  0.051   1.00 25.70 ? 218 SER B CB    1 
ATOM   4765 O  OG    . SER B 1 226 ? -9.497  39.444  -0.315  1.00 25.65 ? 218 SER B OG    1 
ATOM   4766 N  N     . LYS B 1 227 ? -10.631 41.193  -2.723  1.00 25.36 ? 219 LYS B N     1 
ATOM   4767 C  CA    . LYS B 1 227 ? -10.557 40.936  -4.160  1.00 25.23 ? 219 LYS B CA    1 
ATOM   4768 C  C     . LYS B 1 227 ? -10.678 42.204  -4.996  1.00 25.31 ? 219 LYS B C     1 
ATOM   4769 O  O     . LYS B 1 227 ? -10.348 42.202  -6.180  1.00 25.28 ? 219 LYS B O     1 
ATOM   4770 C  CB    . LYS B 1 227 ? -11.625 39.924  -4.580  1.00 25.11 ? 219 LYS B CB    1 
ATOM   4771 C  CG    . LYS B 1 227 ? -11.522 38.587  -3.869  1.00 24.71 ? 219 LYS B CG    1 
ATOM   4772 C  CD    . LYS B 1 227 ? -10.115 38.022  -3.970  1.00 24.32 ? 219 LYS B CD    1 
ATOM   4773 C  CE    . LYS B 1 227 ? -10.053 36.602  -3.467  1.00 23.84 ? 219 LYS B CE    1 
ATOM   4774 N  NZ    . LYS B 1 227 ? -9.966  36.515  -1.984  1.00 23.02 ? 219 LYS B NZ    1 
ATOM   4775 N  N     . ALA B 1 228 ? -11.154 43.282  -4.374  1.00 25.38 ? 220 ALA B N     1 
ATOM   4776 C  CA    . ALA B 1 228 ? -11.184 44.595  -5.018  1.00 25.57 ? 220 ALA B CA    1 
ATOM   4777 C  C     . ALA B 1 228 ? -9.770  45.059  -5.376  1.00 25.68 ? 220 ALA B C     1 
ATOM   4778 O  O     . ALA B 1 228 ? -9.558  45.686  -6.410  1.00 25.66 ? 220 ALA B O     1 
ATOM   4779 C  CB    . ALA B 1 228 ? -11.878 45.622  -4.118  1.00 25.28 ? 220 ALA B CB    1 
ATOM   4780 N  N     . TYR B 1 229 ? -8.807  44.723  -4.522  1.00 25.92 ? 221 TYR B N     1 
ATOM   4781 C  CA    . TYR B 1 229 ? -7.416  45.084  -4.749  1.00 26.22 ? 221 TYR B CA    1 
ATOM   4782 C  C     . TYR B 1 229 ? -6.793  44.204  -5.822  1.00 26.39 ? 221 TYR B C     1 
ATOM   4783 O  O     . TYR B 1 229 ? -5.891  44.636  -6.546  1.00 26.51 ? 221 TYR B O     1 
ATOM   4784 C  CB    . TYR B 1 229 ? -6.619  44.992  -3.448  1.00 26.23 ? 221 TYR B CB    1 
ATOM   4785 C  CG    . TYR B 1 229 ? -7.068  45.981  -2.408  1.00 26.56 ? 221 TYR B CG    1 
ATOM   4786 C  CD1   . TYR B 1 229 ? -6.473  47.237  -2.312  1.00 27.01 ? 221 TYR B CD1   1 
ATOM   4787 C  CD2   . TYR B 1 229 ? -8.111  45.677  -1.533  1.00 26.84 ? 221 TYR B CD2   1 
ATOM   4788 C  CE1   . TYR B 1 229 ? -6.895  48.166  -1.356  1.00 26.81 ? 221 TYR B CE1   1 
ATOM   4789 C  CE2   . TYR B 1 229 ? -8.543  46.598  -0.577  1.00 27.01 ? 221 TYR B CE2   1 
ATOM   4790 C  CZ    . TYR B 1 229 ? -7.930  47.838  -0.495  1.00 27.02 ? 221 TYR B CZ    1 
ATOM   4791 O  OH    . TYR B 1 229 ? -8.351  48.747  0.448   1.00 27.67 ? 221 TYR B OH    1 
ATOM   4792 N  N     . ALA B 1 230 ? -7.284  42.973  -5.928  1.00 26.47 ? 222 ALA B N     1 
ATOM   4793 C  CA    . ALA B 1 230 ? -6.874  42.074  -6.997  1.00 26.69 ? 222 ALA B CA    1 
ATOM   4794 C  C     . ALA B 1 230 ? -7.445  42.538  -8.332  1.00 26.88 ? 222 ALA B C     1 
ATOM   4795 O  O     . ALA B 1 230 ? -6.762  42.488  -9.358  1.00 26.71 ? 222 ALA B O     1 
ATOM   4796 C  CB    . ALA B 1 230 ? -7.314  40.646  -6.693  1.00 26.66 ? 222 ALA B CB    1 
ATOM   4797 N  N     . PHE B 1 231 ? -8.698  43.000  -8.305  1.00 27.20 ? 223 PHE B N     1 
ATOM   4798 C  CA    . PHE B 1 231 ? -9.369  43.505  -9.504  1.00 27.53 ? 223 PHE B CA    1 
ATOM   4799 C  C     . PHE B 1 231 ? -8.739  44.803  -9.989  1.00 27.85 ? 223 PHE B C     1 
ATOM   4800 O  O     . PHE B 1 231 ? -8.601  45.020  -11.190 1.00 27.78 ? 223 PHE B O     1 
ATOM   4801 C  CB    . PHE B 1 231 ? -10.863 43.723  -9.244  1.00 27.51 ? 223 PHE B CB    1 
ATOM   4802 C  CG    . PHE B 1 231 ? -11.645 42.453  -9.077  1.00 27.04 ? 223 PHE B CG    1 
ATOM   4803 C  CD1   . PHE B 1 231 ? -11.279 41.298  -9.755  1.00 27.31 ? 223 PHE B CD1   1 
ATOM   4804 C  CD2   . PHE B 1 231 ? -12.773 42.420  -8.262  1.00 27.37 ? 223 PHE B CD2   1 
ATOM   4805 C  CE1   . PHE B 1 231 ? -12.010 40.118  -9.604  1.00 27.30 ? 223 PHE B CE1   1 
ATOM   4806 C  CE2   . PHE B 1 231 ? -13.511 41.248  -8.106  1.00 27.25 ? 223 PHE B CE2   1 
ATOM   4807 C  CZ    . PHE B 1 231 ? -13.128 40.096  -8.778  1.00 27.35 ? 223 PHE B CZ    1 
ATOM   4808 N  N     . ALA B 1 232 ? -8.358  45.662  -9.047  1.00 28.40 ? 224 ALA B N     1 
ATOM   4809 C  CA    . ALA B 1 232 ? -7.703  46.926  -9.379  1.00 29.03 ? 224 ALA B CA    1 
ATOM   4810 C  C     . ALA B 1 232 ? -6.315  46.690  -9.960  1.00 29.61 ? 224 ALA B C     1 
ATOM   4811 O  O     . ALA B 1 232 ? -5.868  47.431  -10.837 1.00 29.70 ? 224 ALA B O     1 
ATOM   4812 C  CB    . ALA B 1 232 ? -7.622  47.820  -8.159  1.00 28.83 ? 224 ALA B CB    1 
ATOM   4813 N  N     . LEU B 1 233 ? -5.641  45.652  -9.468  1.00 30.29 ? 225 LEU B N     1 
ATOM   4814 C  CA    . LEU B 1 233 ? -4.324  45.283  -9.966  1.00 31.04 ? 225 LEU B CA    1 
ATOM   4815 C  C     . LEU B 1 233 ? -4.381  44.854  -11.431 1.00 31.68 ? 225 LEU B C     1 
ATOM   4816 O  O     . LEU B 1 233 ? -3.600  45.333  -12.255 1.00 31.83 ? 225 LEU B O     1 
ATOM   4817 C  CB    . LEU B 1 233 ? -3.720  44.167  -9.109  1.00 30.92 ? 225 LEU B CB    1 
ATOM   4818 C  CG    . LEU B 1 233 ? -2.395  43.557  -9.579  1.00 30.97 ? 225 LEU B CG    1 
ATOM   4819 C  CD1   . LEU B 1 233 ? -1.287  44.606  -9.622  1.00 31.06 ? 225 LEU B CD1   1 
ATOM   4820 C  CD2   . LEU B 1 233 ? -1.999  42.390  -8.688  1.00 31.23 ? 225 LEU B CD2   1 
ATOM   4821 N  N     . ALA B 1 234 ? -5.319  43.962  -11.749 1.00 32.40 ? 226 ALA B N     1 
ATOM   4822 C  CA    . ALA B 1 234 ? -5.444  43.415  -13.101 1.00 33.14 ? 226 ALA B CA    1 
ATOM   4823 C  C     . ALA B 1 234 ? -5.952  44.458  -14.096 1.00 33.67 ? 226 ALA B C     1 
ATOM   4824 O  O     . ALA B 1 234 ? -5.689  44.366  -15.298 1.00 33.64 ? 226 ALA B O     1 
ATOM   4825 C  CB    . ALA B 1 234 ? -6.350  42.197  -13.097 1.00 33.02 ? 226 ALA B CB    1 
ATOM   4826 N  N     . GLY B 1 235 ? -6.683  45.446  -13.585 1.00 34.35 ? 227 GLY B N     1 
ATOM   4827 C  CA    . GLY B 1 235 ? -7.159  46.558  -14.399 1.00 35.21 ? 227 GLY B CA    1 
ATOM   4828 C  C     . GLY B 1 235 ? -6.045  47.518  -14.759 1.00 35.86 ? 227 GLY B C     1 
ATOM   4829 O  O     . GLY B 1 235 ? -6.065  48.127  -15.827 1.00 35.90 ? 227 GLY B O     1 
ATOM   4830 N  N     . GLN B 1 236 ? -5.068  47.651  -13.862 1.00 36.64 ? 228 GLN B N     1 
ATOM   4831 C  CA    . GLN B 1 236 ? -3.886  48.481  -14.110 1.00 37.42 ? 228 GLN B CA    1 
ATOM   4832 C  C     . GLN B 1 236 ? -2.881  47.760  -15.006 1.00 37.92 ? 228 GLN B C     1 
ATOM   4833 O  O     . GLN B 1 236 ? -1.979  48.381  -15.570 1.00 38.03 ? 228 GLN B O     1 
ATOM   4834 C  CB    . GLN B 1 236 ? -3.215  48.873  -12.790 1.00 37.39 ? 228 GLN B CB    1 
ATOM   4835 C  CG    . GLN B 1 236 ? -3.928  49.981  -12.028 1.00 37.95 ? 228 GLN B CG    1 
ATOM   4836 C  CD    . GLN B 1 236 ? -3.485  50.071  -10.574 1.00 38.77 ? 228 GLN B CD    1 
ATOM   4837 O  OE1   . GLN B 1 236 ? -3.060  49.081  -9.976  1.00 38.98 ? 228 GLN B OE1   1 
ATOM   4838 N  NE2   . GLN B 1 236 ? -3.594  51.259  -9.997  1.00 39.24 ? 228 GLN B NE2   1 
ATOM   4839 N  N     . LEU B 1 237 ? -3.036  46.447  -15.122 1.00 38.52 ? 229 LEU B N     1 
ATOM   4840 C  CA    . LEU B 1 237 ? -2.138  45.644  -15.932 1.00 39.28 ? 229 LEU B CA    1 
ATOM   4841 C  C     . LEU B 1 237 ? -2.715  45.402  -17.322 1.00 39.81 ? 229 LEU B C     1 
ATOM   4842 O  O     . LEU B 1 237 ? -3.921  45.542  -17.526 1.00 39.74 ? 229 LEU B O     1 
ATOM   4843 C  CB    . LEU B 1 237 ? -1.838  44.313  -15.237 1.00 39.23 ? 229 LEU B CB    1 
ATOM   4844 C  CG    . LEU B 1 237 ? -0.941  44.399  -14.000 1.00 39.57 ? 229 LEU B CG    1 
ATOM   4845 C  CD1   . LEU B 1 237 ? -0.408  43.035  -13.644 1.00 39.58 ? 229 LEU B CD1   1 
ATOM   4846 C  CD2   . LEU B 1 237 ? 0.208   45.387  -14.214 1.00 39.97 ? 229 LEU B CD2   1 
ATOM   4847 N  N     . PRO B 1 238 ? -1.841  45.082  -18.298 1.00 40.50 ? 230 PRO B N     1 
ATOM   4848 C  CA    . PRO B 1 238 ? -2.284  44.607  -19.616 1.00 40.95 ? 230 PRO B CA    1 
ATOM   4849 C  C     . PRO B 1 238 ? -3.138  43.329  -19.526 1.00 41.30 ? 230 PRO B C     1 
ATOM   4850 O  O     . PRO B 1 238 ? -2.616  42.216  -19.652 1.00 41.32 ? 230 PRO B O     1 
ATOM   4851 C  CB    . PRO B 1 238 ? -0.964  44.319  -20.347 1.00 40.98 ? 230 PRO B CB    1 
ATOM   4852 C  CG    . PRO B 1 238 ? 0.043   45.178  -19.662 1.00 40.91 ? 230 PRO B CG    1 
ATOM   4853 C  CD    . PRO B 1 238 ? -0.372  45.217  -18.226 1.00 40.56 ? 230 PRO B CD    1 
ATOM   4854 N  N     . LEU B 1 239 ? -4.443  43.506  -19.318 1.00 41.61 ? 231 LEU B N     1 
ATOM   4855 C  CA    . LEU B 1 239 ? -5.397  42.395  -19.312 1.00 41.83 ? 231 LEU B CA    1 
ATOM   4856 C  C     . LEU B 1 239 ? -5.721  41.941  -20.745 1.00 41.86 ? 231 LEU B C     1 
ATOM   4857 O  O     . LEU B 1 239 ? -6.891  41.759  -21.103 1.00 41.88 ? 231 LEU B O     1 
ATOM   4858 C  CB    . LEU B 1 239 ? -6.687  42.807  -18.583 1.00 42.01 ? 231 LEU B CB    1 
ATOM   4859 C  CG    . LEU B 1 239 ? -7.411  44.070  -19.094 1.00 42.25 ? 231 LEU B CG    1 
ATOM   4860 C  CD1   . LEU B 1 239 ? -8.913  43.828  -19.238 1.00 42.41 ? 231 LEU B CD1   1 
ATOM   4861 C  CD2   . LEU B 1 239 ? -7.134  45.276  -18.209 1.00 42.23 ? 231 LEU B CD2   1 
ATOM   4862 N  N     . GLY B 1 240 ? -4.677  41.748  -21.551 1.00 41.86 ? 232 GLY B N     1 
ATOM   4863 C  CA    . GLY B 1 240 ? -4.831  41.510  -22.991 1.00 41.71 ? 232 GLY B CA    1 
ATOM   4864 C  C     . GLY B 1 240 ? -5.569  40.227  -23.318 1.00 41.47 ? 232 GLY B C     1 
ATOM   4865 O  O     . GLY B 1 240 ? -4.955  39.233  -23.720 1.00 41.65 ? 232 GLY B O     1 
ATOM   4866 N  N     . LYS B 1 241 ? -6.895  40.260  -23.162 1.00 41.08 ? 233 LYS B N     1 
ATOM   4867 C  CA    . LYS B 1 241 ? -7.744  39.078  -23.344 1.00 40.70 ? 233 LYS B CA    1 
ATOM   4868 C  C     . LYS B 1 241 ? -7.196  37.863  -22.588 1.00 40.02 ? 233 LYS B C     1 
ATOM   4869 O  O     . LYS B 1 241 ? -7.117  36.757  -23.131 1.00 40.10 ? 233 LYS B O     1 
ATOM   4870 C  CB    . LYS B 1 241 ? -7.935  38.759  -24.839 1.00 40.82 ? 233 LYS B CB    1 
ATOM   4871 C  CG    . LYS B 1 241 ? -8.856  39.740  -25.577 1.00 41.28 ? 233 LYS B CG    1 
ATOM   4872 C  CD    . LYS B 1 241 ? -9.026  39.353  -27.048 1.00 41.49 ? 233 LYS B CD    1 
ATOM   4873 C  CE    . LYS B 1 241 ? -9.865  40.386  -27.802 1.00 42.64 ? 233 LYS B CE    1 
ATOM   4874 N  NZ    . LYS B 1 241 ? -10.068 40.019  -29.242 1.00 42.77 ? 233 LYS B NZ    1 
ATOM   4875 N  N     . HIS B 1 242 ? -6.790  38.090  -21.341 1.00 39.09 ? 234 HIS B N     1 
ATOM   4876 C  CA    . HIS B 1 242 ? -6.413  37.009  -20.442 1.00 38.05 ? 234 HIS B CA    1 
ATOM   4877 C  C     . HIS B 1 242 ? -7.425  36.908  -19.316 1.00 37.02 ? 234 HIS B C     1 
ATOM   4878 O  O     . HIS B 1 242 ? -8.130  37.872  -19.014 1.00 36.94 ? 234 HIS B O     1 
ATOM   4879 C  CB    . HIS B 1 242 ? -5.020  37.248  -19.864 1.00 38.39 ? 234 HIS B CB    1 
ATOM   4880 C  CG    . HIS B 1 242 ? -3.940  37.310  -20.896 1.00 39.14 ? 234 HIS B CG    1 
ATOM   4881 N  ND1   . HIS B 1 242 ? -3.508  36.199  -21.589 1.00 40.19 ? 234 HIS B ND1   1 
ATOM   4882 C  CD2   . HIS B 1 242 ? -3.193  38.346  -21.343 1.00 39.88 ? 234 HIS B CD2   1 
ATOM   4883 C  CE1   . HIS B 1 242 ? -2.548  36.550  -22.427 1.00 40.43 ? 234 HIS B CE1   1 
ATOM   4884 N  NE2   . HIS B 1 242 ? -2.337  37.848  -22.296 1.00 40.75 ? 234 HIS B NE2   1 
ATOM   4885 N  N     . GLN B 1 243 ? -7.495  35.739  -18.694 1.00 35.68 ? 235 GLN B N     1 
ATOM   4886 C  CA    . GLN B 1 243 ? -8.440  35.504  -17.615 1.00 34.38 ? 235 GLN B CA    1 
ATOM   4887 C  C     . GLN B 1 243 ? -7.787  35.810  -16.270 1.00 33.13 ? 235 GLN B C     1 
ATOM   4888 O  O     . GLN B 1 243 ? -6.578  35.658  -16.110 1.00 32.95 ? 235 GLN B O     1 
ATOM   4889 C  CB    . GLN B 1 243 ? -8.926  34.055  -17.649 1.00 34.40 ? 235 GLN B CB    1 
ATOM   4890 C  CG    . GLN B 1 243 ? -10.429 33.898  -17.790 1.00 34.75 ? 235 GLN B CG    1 
ATOM   4891 C  CD    . GLN B 1 243 ? -10.869 32.442  -17.754 1.00 35.13 ? 235 GLN B CD    1 
ATOM   4892 O  OE1   . GLN B 1 243 ? -10.187 31.590  -17.181 1.00 35.79 ? 235 GLN B OE1   1 
ATOM   4893 N  NE2   . GLN B 1 243 ? -12.019 32.151  -18.362 1.00 35.56 ? 235 GLN B NE2   1 
ATOM   4894 N  N     . LEU B 1 244 ? -8.587  36.261  -15.313 1.00 31.74 ? 236 LEU B N     1 
ATOM   4895 C  CA    . LEU B 1 244 ? -8.111  36.439  -13.951 1.00 30.46 ? 236 LEU B CA    1 
ATOM   4896 C  C     . LEU B 1 244 ? -8.741  35.422  -13.012 1.00 29.80 ? 236 LEU B C     1 
ATOM   4897 O  O     . LEU B 1 244 ? -9.963  35.377  -12.856 1.00 29.73 ? 236 LEU B O     1 
ATOM   4898 C  CB    . LEU B 1 244 ? -8.397  37.857  -13.457 1.00 30.30 ? 236 LEU B CB    1 
ATOM   4899 C  CG    . LEU B 1 244 ? -7.998  38.149  -12.006 1.00 29.62 ? 236 LEU B CG    1 
ATOM   4900 C  CD1   . LEU B 1 244 ? -6.486  38.172  -11.854 1.00 29.26 ? 236 LEU B CD1   1 
ATOM   4901 C  CD2   . LEU B 1 244 ? -8.603  39.455  -11.531 1.00 29.09 ? 236 LEU B CD2   1 
ATOM   4902 N  N     . ALA B 1 245 ? -7.900  34.609  -12.387 1.00 28.94 ? 237 ALA B N     1 
ATOM   4903 C  CA    . ALA B 1 245 ? -8.354  33.660  -11.380 1.00 28.34 ? 237 ALA B CA    1 
ATOM   4904 C  C     . ALA B 1 245 ? -8.148  34.215  -9.969  1.00 27.92 ? 237 ALA B C     1 
ATOM   4905 O  O     . ALA B 1 245 ? -7.097  34.774  -9.660  1.00 27.62 ? 237 ALA B O     1 
ATOM   4906 C  CB    . ALA B 1 245 ? -7.628  32.340  -11.540 1.00 28.34 ? 237 ALA B CB    1 
ATOM   4907 N  N     . ILE B 1 246 ? -9.164  34.065  -9.122  1.00 27.53 ? 238 ILE B N     1 
ATOM   4908 C  CA    . ILE B 1 246 ? -9.069  34.465  -7.717  1.00 27.06 ? 238 ILE B CA    1 
ATOM   4909 C  C     . ILE B 1 246 ? -9.601  33.367  -6.788  1.00 26.96 ? 238 ILE B C     1 
ATOM   4910 O  O     . ILE B 1 246 ? -10.513 32.625  -7.149  1.00 26.95 ? 238 ILE B O     1 
ATOM   4911 C  CB    . ILE B 1 246 ? -9.817  35.800  -7.438  1.00 27.03 ? 238 ILE B CB    1 
ATOM   4912 C  CG1   . ILE B 1 246 ? -11.275 35.720  -7.901  1.00 26.65 ? 238 ILE B CG1   1 
ATOM   4913 C  CG2   . ILE B 1 246 ? -9.107  36.965  -8.110  1.00 26.79 ? 238 ILE B CG2   1 
ATOM   4914 C  CD1   . ILE B 1 246 ? -12.157 36.812  -7.332  1.00 26.33 ? 238 ILE B CD1   1 
ATOM   4915 N  N     . ASN B 1 247 ? -9.017  33.269  -5.596  1.00 26.88 ? 239 ASN B N     1 
ATOM   4916 C  CA    . ASN B 1 247 ? -9.362  32.212  -4.643  1.00 26.76 ? 239 ASN B CA    1 
ATOM   4917 C  C     . ASN B 1 247 ? -10.363 32.684  -3.605  1.00 26.90 ? 239 ASN B C     1 
ATOM   4918 O  O     . ASN B 1 247 ? -10.139 33.684  -2.930  1.00 27.05 ? 239 ASN B O     1 
ATOM   4919 C  CB    . ASN B 1 247 ? -8.109  31.702  -3.932  1.00 26.48 ? 239 ASN B CB    1 
ATOM   4920 C  CG    . ASN B 1 247 ? -7.162  30.981  -4.862  1.00 26.21 ? 239 ASN B CG    1 
ATOM   4921 O  OD1   . ASN B 1 247 ? -7.500  29.943  -5.429  1.00 25.33 ? 239 ASN B OD1   1 
ATOM   4922 N  ND2   . ASN B 1 247 ? -5.951  31.512  -5.001  1.00 25.66 ? 239 ASN B ND2   1 
ATOM   4923 N  N     . LEU B 1 248 ? -11.458 31.948  -3.460  1.00 26.90 ? 240 LEU B N     1 
ATOM   4924 C  CA    . LEU B 1 248 ? -12.440 32.250  -2.429  1.00 27.02 ? 240 LEU B CA    1 
ATOM   4925 C  C     . LEU B 1 248 ? -12.846 31.009  -1.657  1.00 27.24 ? 240 LEU B C     1 
ATOM   4926 O  O     . LEU B 1 248 ? -13.007 29.931  -2.230  1.00 27.16 ? 240 LEU B O     1 
ATOM   4927 C  CB    . LEU B 1 248 ? -13.674 32.918  -3.036  1.00 26.98 ? 240 LEU B CB    1 
ATOM   4928 C  CG    . LEU B 1 248 ? -13.516 34.387  -3.434  1.00 27.20 ? 240 LEU B CG    1 
ATOM   4929 C  CD1   . LEU B 1 248 ? -14.678 34.843  -4.290  1.00 27.19 ? 240 LEU B CD1   1 
ATOM   4930 C  CD2   . LEU B 1 248 ? -13.379 35.268  -2.201  1.00 27.53 ? 240 LEU B CD2   1 
ATOM   4931 N  N     . LEU B 1 249 ? -12.998 31.160  -0.348  1.00 27.59 ? 241 LEU B N     1 
ATOM   4932 C  CA    . LEU B 1 249 ? -13.639 30.138  0.459   1.00 28.04 ? 241 LEU B CA    1 
ATOM   4933 C  C     . LEU B 1 249 ? -15.131 30.106  0.142   1.00 28.23 ? 241 LEU B C     1 
ATOM   4934 O  O     . LEU B 1 249 ? -15.717 31.138  -0.190  1.00 28.15 ? 241 LEU B O     1 
ATOM   4935 C  CB    . LEU B 1 249 ? -13.423 30.414  1.951   1.00 28.08 ? 241 LEU B CB    1 
ATOM   4936 C  CG    . LEU B 1 249 ? -11.975 30.442  2.445   1.00 28.51 ? 241 LEU B CG    1 
ATOM   4937 C  CD1   . LEU B 1 249 ? -11.928 30.598  3.956   1.00 28.43 ? 241 LEU B CD1   1 
ATOM   4938 C  CD2   . LEU B 1 249 ? -11.222 29.190  2.005   1.00 28.43 ? 241 LEU B CD2   1 
ATOM   4939 N  N     . PRO B 1 250 ? -15.745 28.912  0.212   1.00 28.53 ? 242 PRO B N     1 
ATOM   4940 C  CA    . PRO B 1 250 ? -17.195 28.790  0.090   1.00 28.77 ? 242 PRO B CA    1 
ATOM   4941 C  C     . PRO B 1 250 ? -17.937 29.747  1.023   1.00 29.14 ? 242 PRO B C     1 
ATOM   4942 O  O     . PRO B 1 250 ? -18.846 30.452  0.585   1.00 29.21 ? 242 PRO B O     1 
ATOM   4943 C  CB    . PRO B 1 250 ? -17.454 27.341  0.501   1.00 28.80 ? 242 PRO B CB    1 
ATOM   4944 C  CG    . PRO B 1 250 ? -16.207 26.629  0.139   1.00 28.53 ? 242 PRO B CG    1 
ATOM   4945 C  CD    . PRO B 1 250 ? -15.093 27.599  0.379   1.00 28.47 ? 242 PRO B CD    1 
ATOM   4946 N  N     . GLY B 1 251 ? -17.516 29.795  2.287   1.00 29.59 ? 243 GLY B N     1 
ATOM   4947 C  CA    . GLY B 1 251 ? -18.148 30.655  3.290   1.00 30.11 ? 243 GLY B CA    1 
ATOM   4948 C  C     . GLY B 1 251 ? -18.122 32.132  2.937   1.00 30.46 ? 243 GLY B C     1 
ATOM   4949 O  O     . GLY B 1 251 ? -19.067 32.864  3.235   1.00 30.39 ? 243 GLY B O     1 
ATOM   4950 N  N     . SER B 1 252 ? -17.041 32.564  2.290   1.00 30.88 ? 244 SER B N     1 
ATOM   4951 C  CA    . SER B 1 252 ? -16.890 33.960  1.854   1.00 31.45 ? 244 SER B CA    1 
ATOM   4952 C  C     . SER B 1 252 ? -17.965 34.374  0.847   1.00 31.76 ? 244 SER B C     1 
ATOM   4953 O  O     . SER B 1 252 ? -18.358 35.539  0.789   1.00 31.76 ? 244 SER B O     1 
ATOM   4954 C  CB    . SER B 1 252 ? -15.507 34.178  1.247   1.00 31.27 ? 244 SER B CB    1 
ATOM   4955 O  OG    . SER B 1 252 ? -14.508 33.565  2.038   1.00 31.75 ? 244 SER B OG    1 
ATOM   4956 N  N     . LEU B 1 253 ? -18.426 33.415  0.052   1.00 32.36 ? 245 LEU B N     1 
ATOM   4957 C  CA    . LEU B 1 253 ? -19.490 33.663  -0.915  1.00 32.94 ? 245 LEU B CA    1 
ATOM   4958 C  C     . LEU B 1 253 ? -20.858 33.402  -0.296  1.00 33.45 ? 245 LEU B C     1 
ATOM   4959 O  O     . LEU B 1 253 ? -21.834 34.088  -0.606  1.00 33.46 ? 245 LEU B O     1 
ATOM   4960 C  CB    . LEU B 1 253 ? -19.301 32.778  -2.144  1.00 32.77 ? 245 LEU B CB    1 
ATOM   4961 C  CG    . LEU B 1 253 ? -18.113 33.101  -3.044  1.00 32.41 ? 245 LEU B CG    1 
ATOM   4962 C  CD1   . LEU B 1 253 ? -17.723 31.883  -3.860  1.00 32.30 ? 245 LEU B CD1   1 
ATOM   4963 C  CD2   . LEU B 1 253 ? -18.437 34.280  -3.945  1.00 32.08 ? 245 LEU B CD2   1 
ATOM   4964 N  N     . TYR B 1 254 ? -20.910 32.415  0.591   1.00 34.12 ? 246 TYR B N     1 
ATOM   4965 C  CA    . TYR B 1 254 ? -22.161 31.941  1.163   1.00 34.82 ? 246 TYR B CA    1 
ATOM   4966 C  C     . TYR B 1 254 ? -22.708 32.898  2.229   1.00 35.18 ? 246 TYR B C     1 
ATOM   4967 O  O     . TYR B 1 254 ? -23.903 33.202  2.243   1.00 35.06 ? 246 TYR B O     1 
ATOM   4968 C  CB    . TYR B 1 254 ? -21.961 30.534  1.746   1.00 34.94 ? 246 TYR B CB    1 
ATOM   4969 C  CG    . TYR B 1 254 ? -23.199 29.906  2.346   1.00 35.25 ? 246 TYR B CG    1 
ATOM   4970 C  CD1   . TYR B 1 254 ? -23.188 29.415  3.651   1.00 35.40 ? 246 TYR B CD1   1 
ATOM   4971 C  CD2   . TYR B 1 254 ? -24.373 29.779  1.606   1.00 35.43 ? 246 TYR B CD2   1 
ATOM   4972 C  CE1   . TYR B 1 254 ? -24.313 28.829  4.207   1.00 35.27 ? 246 TYR B CE1   1 
ATOM   4973 C  CE2   . TYR B 1 254 ? -25.506 29.193  2.154   1.00 35.55 ? 246 TYR B CE2   1 
ATOM   4974 C  CZ    . TYR B 1 254 ? -25.469 28.721  3.456   1.00 35.44 ? 246 TYR B CZ    1 
ATOM   4975 O  OH    . TYR B 1 254 ? -26.586 28.141  4.003   1.00 35.43 ? 246 TYR B OH    1 
ATOM   4976 N  N     . HIS B 1 255 ? -21.823 33.387  3.098   1.00 35.71 ? 247 HIS B N     1 
ATOM   4977 C  CA    . HIS B 1 255 ? -22.239 34.158  4.276   1.00 36.21 ? 247 HIS B CA    1 
ATOM   4978 C  C     . HIS B 1 255 ? -22.281 35.671  4.027   1.00 36.46 ? 247 HIS B C     1 
ATOM   4979 O  O     . HIS B 1 255 ? -22.312 36.462  4.971   1.00 36.64 ? 247 HIS B O     1 
ATOM   4980 C  CB    . HIS B 1 255 ? -21.338 33.843  5.479   1.00 36.29 ? 247 HIS B CB    1 
ATOM   4981 C  CG    . HIS B 1 255 ? -21.413 32.419  5.939   1.00 36.62 ? 247 HIS B CG    1 
ATOM   4982 N  ND1   . HIS B 1 255 ? -22.558 31.867  6.473   1.00 36.93 ? 247 HIS B ND1   1 
ATOM   4983 C  CD2   . HIS B 1 255 ? -20.480 31.438  5.959   1.00 36.94 ? 247 HIS B CD2   1 
ATOM   4984 C  CE1   . HIS B 1 255 ? -22.329 30.606  6.794   1.00 37.13 ? 247 HIS B CE1   1 
ATOM   4985 N  NE2   . HIS B 1 255 ? -21.076 30.320  6.491   1.00 37.08 ? 247 HIS B NE2   1 
ATOM   4986 N  N     . HIS B 1 256 ? -22.285 36.063  2.757   1.00 36.67 ? 248 HIS B N     1 
ATOM   4987 C  CA    . HIS B 1 256 ? -22.473 37.461  2.384   1.00 36.90 ? 248 HIS B CA    1 
ATOM   4988 C  C     . HIS B 1 256 ? -23.914 37.667  1.907   1.00 37.10 ? 248 HIS B C     1 
ATOM   4989 O  O     . HIS B 1 256 ? -24.509 36.752  1.330   1.00 37.38 ? 248 HIS B O     1 
ATOM   4990 C  CB    . HIS B 1 256 ? -21.489 37.846  1.276   1.00 36.98 ? 248 HIS B CB    1 
ATOM   4991 C  CG    . HIS B 1 256 ? -21.267 39.322  1.148   1.00 37.24 ? 248 HIS B CG    1 
ATOM   4992 N  ND1   . HIS B 1 256 ? -21.969 40.107  0.257   1.00 37.47 ? 248 HIS B ND1   1 
ATOM   4993 C  CD2   . HIS B 1 256 ? -20.425 40.158  1.802   1.00 37.26 ? 248 HIS B CD2   1 
ATOM   4994 C  CE1   . HIS B 1 256 ? -21.564 41.361  0.363   1.00 37.19 ? 248 HIS B CE1   1 
ATOM   4995 N  NE2   . HIS B 1 256 ? -20.628 41.419  1.293   1.00 37.23 ? 248 HIS B NE2   1 
ATOM   4996 N  N     . PRO B 1 257 ? -24.498 38.856  2.189   1.00 37.05 ? 249 PRO B N     1 
ATOM   4997 C  CA    . PRO B 1 257 ? -25.826 39.218  1.668   1.00 36.74 ? 249 PRO B CA    1 
ATOM   4998 C  C     . PRO B 1 257 ? -25.982 38.908  0.175   1.00 36.47 ? 249 PRO B C     1 
ATOM   4999 O  O     . PRO B 1 257 ? -26.863 38.131  -0.210  1.00 36.53 ? 249 PRO B O     1 
ATOM   5000 C  CB    . PRO B 1 257 ? -25.901 40.742  1.910   1.00 36.83 ? 249 PRO B CB    1 
ATOM   5001 C  CG    . PRO B 1 257 ? -24.527 41.142  2.480   1.00 36.95 ? 249 PRO B CG    1 
ATOM   5002 C  CD    . PRO B 1 257 ? -23.956 39.907  3.065   1.00 37.01 ? 249 PRO B CD    1 
ATOM   5003 N  N     . ASP B 1 258 ? -25.124 39.507  -0.650  1.00 36.01 ? 250 ASP B N     1 
ATOM   5004 C  CA    . ASP B 1 258 ? -25.089 39.213  -2.083  1.00 35.43 ? 250 ASP B CA    1 
ATOM   5005 C  C     . ASP B 1 258 ? -23.651 39.301  -2.615  1.00 35.06 ? 250 ASP B C     1 
ATOM   5006 O  O     . ASP B 1 258 ? -23.247 40.312  -3.196  1.00 35.03 ? 250 ASP B O     1 
ATOM   5007 C  CB    . ASP B 1 258 ? -26.013 40.164  -2.850  1.00 35.33 ? 250 ASP B CB    1 
ATOM   5008 C  CG    . ASP B 1 258 ? -26.072 39.853  -4.341  1.00 35.81 ? 250 ASP B CG    1 
ATOM   5009 O  OD1   . ASP B 1 258 ? -25.845 38.684  -4.727  1.00 36.24 ? 250 ASP B OD1   1 
ATOM   5010 O  OD2   . ASP B 1 258 ? -26.347 40.781  -5.128  1.00 36.31 ? 250 ASP B OD2   1 
ATOM   5011 N  N     . ALA B 1 259 ? -22.888 38.232  -2.404  1.00 34.64 ? 251 ALA B N     1 
ATOM   5012 C  CA    . ALA B 1 259 ? -21.473 38.197  -2.770  1.00 34.16 ? 251 ALA B CA    1 
ATOM   5013 C  C     . ALA B 1 259 ? -21.259 38.346  -4.277  1.00 33.90 ? 251 ALA B C     1 
ATOM   5014 O  O     . ALA B 1 259 ? -20.363 39.068  -4.716  1.00 33.70 ? 251 ALA B O     1 
ATOM   5015 C  CB    . ALA B 1 259 ? -20.838 36.917  -2.274  1.00 34.15 ? 251 ALA B CB    1 
ATOM   5016 N  N     . VAL B 1 260 ? -22.085 37.656  -5.060  1.00 33.61 ? 252 VAL B N     1 
ATOM   5017 C  CA    . VAL B 1 260 ? -21.988 37.695  -6.518  1.00 33.24 ? 252 VAL B CA    1 
ATOM   5018 C  C     . VAL B 1 260 ? -22.200 39.112  -7.031  1.00 33.01 ? 252 VAL B C     1 
ATOM   5019 O  O     . VAL B 1 260 ? -21.437 39.599  -7.868  1.00 32.82 ? 252 VAL B O     1 
ATOM   5020 C  CB    . VAL B 1 260 ? -23.012 36.744  -7.179  1.00 33.25 ? 252 VAL B CB    1 
ATOM   5021 C  CG1   . VAL B 1 260 ? -22.813 36.709  -8.686  1.00 33.01 ? 252 VAL B CG1   1 
ATOM   5022 C  CG2   . VAL B 1 260 ? -22.884 35.349  -6.595  1.00 33.27 ? 252 VAL B CG2   1 
ATOM   5023 N  N     . GLY B 1 261 ? -23.225 39.776  -6.502  1.00 32.85 ? 253 GLY B N     1 
ATOM   5024 C  CA    . GLY B 1 261 ? -23.477 41.176  -6.809  1.00 32.71 ? 253 GLY B CA    1 
ATOM   5025 C  C     . GLY B 1 261 ? -22.314 42.077  -6.433  1.00 32.69 ? 253 GLY B C     1 
ATOM   5026 O  O     . GLY B 1 261 ? -21.947 42.970  -7.194  1.00 32.82 ? 253 GLY B O     1 
ATOM   5027 N  N     . TRP B 1 262 ? -21.729 41.841  -5.259  1.00 32.54 ? 254 TRP B N     1 
ATOM   5028 C  CA    . TRP B 1 262 ? -20.587 42.631  -4.813  1.00 32.40 ? 254 TRP B CA    1 
ATOM   5029 C  C     . TRP B 1 262 ? -19.396 42.452  -5.744  1.00 32.37 ? 254 TRP B C     1 
ATOM   5030 O  O     . TRP B 1 262 ? -18.759 43.428  -6.139  1.00 32.21 ? 254 TRP B O     1 
ATOM   5031 C  CB    . TRP B 1 262 ? -20.190 42.285  -3.372  1.00 32.29 ? 254 TRP B CB    1 
ATOM   5032 C  CG    . TRP B 1 262 ? -19.249 43.300  -2.772  1.00 32.30 ? 254 TRP B CG    1 
ATOM   5033 C  CD1   . TRP B 1 262 ? -19.589 44.391  -2.026  1.00 32.37 ? 254 TRP B CD1   1 
ATOM   5034 C  CD2   . TRP B 1 262 ? -17.819 43.341  -2.910  1.00 32.03 ? 254 TRP B CD2   1 
ATOM   5035 N  NE1   . TRP B 1 262 ? -18.463 45.099  -1.678  1.00 32.27 ? 254 TRP B NE1   1 
ATOM   5036 C  CE2   . TRP B 1 262 ? -17.364 44.478  -2.209  1.00 31.95 ? 254 TRP B CE2   1 
ATOM   5037 C  CE3   . TRP B 1 262 ? -16.879 42.521  -3.550  1.00 31.89 ? 254 TRP B CE3   1 
ATOM   5038 C  CZ2   . TRP B 1 262 ? -16.012 44.820  -2.131  1.00 31.88 ? 254 TRP B CZ2   1 
ATOM   5039 C  CZ3   . TRP B 1 262 ? -15.534 42.866  -3.475  1.00 31.86 ? 254 TRP B CZ3   1 
ATOM   5040 C  CH2   . TRP B 1 262 ? -15.116 44.005  -2.771  1.00 31.77 ? 254 TRP B CH2   1 
ATOM   5041 N  N     . LEU B 1 263 ? -19.101 41.200  -6.088  1.00 32.54 ? 255 LEU B N     1 
ATOM   5042 C  CA    . LEU B 1 263 ? -18.029 40.888  -7.035  1.00 32.71 ? 255 LEU B CA    1 
ATOM   5043 C  C     . LEU B 1 263 ? -18.316 41.499  -8.395  1.00 33.13 ? 255 LEU B C     1 
ATOM   5044 O  O     . LEU B 1 263 ? -17.409 41.995  -9.064  1.00 33.10 ? 255 LEU B O     1 
ATOM   5045 C  CB    . LEU B 1 263 ? -17.856 39.375  -7.178  1.00 32.53 ? 255 LEU B CB    1 
ATOM   5046 C  CG    . LEU B 1 263 ? -17.136 38.636  -6.055  1.00 31.62 ? 255 LEU B CG    1 
ATOM   5047 C  CD1   . LEU B 1 263 ? -17.312 37.147  -6.226  1.00 31.18 ? 255 LEU B CD1   1 
ATOM   5048 C  CD2   . LEU B 1 263 ? -15.661 39.003  -6.020  1.00 31.12 ? 255 LEU B CD2   1 
ATOM   5049 N  N     . MET B 1 264 ? -19.585 41.459  -8.795  1.00 33.65 ? 256 MET B N     1 
ATOM   5050 C  CA    . MET B 1 264 ? -20.023 42.058  -10.048 1.00 34.30 ? 256 MET B CA    1 
ATOM   5051 C  C     . MET B 1 264 ? -19.748 43.559  -10.045 1.00 34.47 ? 256 MET B C     1 
ATOM   5052 O  O     . MET B 1 264 ? -19.181 44.094  -10.998 1.00 34.66 ? 256 MET B O     1 
ATOM   5053 C  CB    . MET B 1 264 ? -21.518 41.786  -10.275 1.00 34.52 ? 256 MET B CB    1 
ATOM   5054 C  CG    . MET B 1 264 ? -21.938 41.629  -11.743 1.00 35.62 ? 256 MET B CG    1 
ATOM   5055 S  SD    . MET B 1 264 ? -21.109 40.268  -12.612 1.00 37.93 ? 256 MET B SD    1 
ATOM   5056 C  CE    . MET B 1 264 ? -19.964 41.190  -13.632 1.00 37.96 ? 256 MET B CE    1 
ATOM   5057 N  N     . ASP B 1 265 ? -20.118 44.225  -8.952  1.00 34.74 ? 257 ASP B N     1 
ATOM   5058 C  CA    . ASP B 1 265 ? -19.902 45.669  -8.808  1.00 34.96 ? 257 ASP B CA    1 
ATOM   5059 C  C     . ASP B 1 265 ? -18.413 46.022  -8.802  1.00 34.91 ? 257 ASP B C     1 
ATOM   5060 O  O     . ASP B 1 265 ? -18.003 47.037  -9.370  1.00 35.06 ? 257 ASP B O     1 
ATOM   5061 C  CB    . ASP B 1 265 ? -20.575 46.195  -7.530  1.00 35.02 ? 257 ASP B CB    1 
ATOM   5062 C  CG    . ASP B 1 265 ? -22.062 46.491  -7.724  1.00 35.78 ? 257 ASP B CG    1 
ATOM   5063 O  OD1   . ASP B 1 265 ? -22.764 45.667  -8.354  1.00 36.14 ? 257 ASP B OD1   1 
ATOM   5064 O  OD2   . ASP B 1 265 ? -22.530 47.547  -7.236  1.00 36.98 ? 257 ASP B OD2   1 
ATOM   5065 N  N     . SER B 1 266 ? -17.608 45.163  -8.183  1.00 34.81 ? 258 SER B N     1 
ATOM   5066 C  CA    . SER B 1 266 ? -16.190 45.439  -7.988  1.00 34.63 ? 258 SER B CA    1 
ATOM   5067 C  C     . SER B 1 266 ? -15.361 45.199  -9.246  1.00 34.50 ? 258 SER B C     1 
ATOM   5068 O  O     . SER B 1 266 ? -14.421 45.942  -9.524  1.00 34.63 ? 258 SER B O     1 
ATOM   5069 C  CB    . SER B 1 266 ? -15.637 44.611  -6.829  1.00 34.63 ? 258 SER B CB    1 
ATOM   5070 O  OG    . SER B 1 266 ? -14.482 45.218  -6.285  1.00 34.95 ? 258 SER B OG    1 
ATOM   5071 N  N     . LEU B 1 267 ? -15.704 44.160  -10.002 1.00 34.38 ? 259 LEU B N     1 
ATOM   5072 C  CA    . LEU B 1 267 ? -14.951 43.829  -11.208 1.00 34.18 ? 259 LEU B CA    1 
ATOM   5073 C  C     . LEU B 1 267 ? -15.339 44.721  -12.390 1.00 34.24 ? 259 LEU B C     1 
ATOM   5074 O  O     . LEU B 1 267 ? -14.509 45.016  -13.245 1.00 34.27 ? 259 LEU B O     1 
ATOM   5075 C  CB    . LEU B 1 267 ? -15.087 42.337  -11.560 1.00 34.06 ? 259 LEU B CB    1 
ATOM   5076 C  CG    . LEU B 1 267 ? -16.326 41.844  -12.317 1.00 33.84 ? 259 LEU B CG    1 
ATOM   5077 C  CD1   . LEU B 1 267 ? -16.094 41.887  -13.824 1.00 33.13 ? 259 LEU B CD1   1 
ATOM   5078 C  CD2   . LEU B 1 267 ? -16.681 40.438  -11.883 1.00 33.71 ? 259 LEU B CD2   1 
ATOM   5079 N  N     . LEU B 1 268 ? -16.602 45.145  -12.432 1.00 34.28 ? 260 LEU B N     1 
ATOM   5080 C  CA    . LEU B 1 268 ? -17.064 46.052  -13.483 1.00 34.28 ? 260 LEU B CA    1 
ATOM   5081 C  C     . LEU B 1 268 ? -16.458 47.434  -13.308 1.00 34.31 ? 260 LEU B C     1 
ATOM   5082 O  O     . LEU B 1 268 ? -16.079 48.078  -14.281 1.00 34.29 ? 260 LEU B O     1 
ATOM   5083 C  CB    . LEU B 1 268 ? -18.593 46.141  -13.508 1.00 34.23 ? 260 LEU B CB    1 
ATOM   5084 C  CG    . LEU B 1 268 ? -19.350 44.967  -14.147 1.00 34.22 ? 260 LEU B CG    1 
ATOM   5085 C  CD1   . LEU B 1 268 ? -20.857 45.182  -14.053 1.00 34.04 ? 260 LEU B CD1   1 
ATOM   5086 C  CD2   . LEU B 1 268 ? -18.923 44.743  -15.598 1.00 33.68 ? 260 LEU B CD2   1 
ATOM   5087 N  N     . ALA B 1 269 ? -16.338 47.869  -12.056 1.00 34.47 ? 261 ALA B N     1 
ATOM   5088 C  CA    . ALA B 1 269 ? -15.743 49.167  -11.738 1.00 34.69 ? 261 ALA B CA    1 
ATOM   5089 C  C     . ALA B 1 269 ? -14.262 49.231  -12.105 1.00 34.79 ? 261 ALA B C     1 
ATOM   5090 O  O     . ALA B 1 269 ? -13.727 50.308  -12.348 1.00 35.03 ? 261 ALA B O     1 
ATOM   5091 C  CB    . ALA B 1 269 ? -15.937 49.495  -10.261 1.00 34.68 ? 261 ALA B CB    1 
ATOM   5092 N  N     . ALA B 1 270 ? -13.611 48.071  -12.149 1.00 34.97 ? 262 ALA B N     1 
ATOM   5093 C  CA    . ALA B 1 270 ? -12.167 48.001  -12.381 1.00 35.04 ? 262 ALA B CA    1 
ATOM   5094 C  C     . ALA B 1 270 ? -11.811 47.775  -13.855 1.00 34.97 ? 262 ALA B C     1 
ATOM   5095 O  O     . ALA B 1 270 ? -10.651 47.520  -14.189 1.00 35.15 ? 262 ALA B O     1 
ATOM   5096 C  CB    . ALA B 1 270 ? -11.538 46.918  -11.505 1.00 34.95 ? 262 ALA B CB    1 
ATOM   5097 N  N     . GLY B 1 271 ? -12.808 47.877  -14.729 1.00 34.86 ? 263 GLY B N     1 
ATOM   5098 C  CA    . GLY B 1 271 ? -12.585 47.736  -16.168 1.00 34.74 ? 263 GLY B CA    1 
ATOM   5099 C  C     . GLY B 1 271 ? -12.404 46.293  -16.601 1.00 34.76 ? 263 GLY B C     1 
ATOM   5100 O  O     . GLY B 1 271 ? -11.553 45.987  -17.445 1.00 34.81 ? 263 GLY B O     1 
ATOM   5101 N  N     . LEU B 1 272 ? -13.211 45.404  -16.024 1.00 34.60 ? 264 LEU B N     1 
ATOM   5102 C  CA    . LEU B 1 272 ? -13.160 43.980  -16.347 1.00 34.51 ? 264 LEU B CA    1 
ATOM   5103 C  C     . LEU B 1 272 ? -14.515 43.483  -16.845 1.00 34.44 ? 264 LEU B C     1 
ATOM   5104 O  O     . LEU B 1 272 ? -15.553 44.074  -16.543 1.00 34.39 ? 264 LEU B O     1 
ATOM   5105 C  CB    . LEU B 1 272 ? -12.731 43.168  -15.115 1.00 34.56 ? 264 LEU B CB    1 
ATOM   5106 C  CG    . LEU B 1 272 ? -11.303 42.614  -14.997 1.00 34.43 ? 264 LEU B CG    1 
ATOM   5107 C  CD1   . LEU B 1 272 ? -10.271 43.527  -15.627 1.00 34.22 ? 264 LEU B CD1   1 
ATOM   5108 C  CD2   . LEU B 1 272 ? -10.969 42.354  -13.533 1.00 34.31 ? 264 LEU B CD2   1 
ATOM   5109 N  N     . ARG B 1 273 ? -14.493 42.400  -17.615 1.00 34.39 ? 265 ARG B N     1 
ATOM   5110 C  CA    . ARG B 1 273 ? -15.712 41.703  -18.016 1.00 34.53 ? 265 ARG B CA    1 
ATOM   5111 C  C     . ARG B 1 273 ? -15.981 40.545  -17.051 1.00 34.25 ? 265 ARG B C     1 
ATOM   5112 O  O     . ARG B 1 273 ? -15.040 39.924  -16.557 1.00 34.36 ? 265 ARG B O     1 
ATOM   5113 C  CB    . ARG B 1 273 ? -15.572 41.162  -19.449 1.00 34.73 ? 265 ARG B CB    1 
ATOM   5114 C  CG    . ARG B 1 273 ? -15.316 42.229  -20.514 1.00 35.86 ? 265 ARG B CG    1 
ATOM   5115 C  CD    . ARG B 1 273 ? -16.612 42.939  -20.930 1.00 38.61 ? 265 ARG B CD    1 
ATOM   5116 N  NE    . ARG B 1 273 ? -17.593 42.016  -21.511 1.00 39.71 ? 265 ARG B NE    1 
ATOM   5117 C  CZ    . ARG B 1 273 ? -18.684 42.396  -22.176 1.00 40.11 ? 265 ARG B CZ    1 
ATOM   5118 N  NH1   . ARG B 1 273 ? -18.944 43.686  -22.356 1.00 40.14 ? 265 ARG B NH1   1 
ATOM   5119 N  NH2   . ARG B 1 273 ? -19.514 41.484  -22.667 1.00 40.50 ? 265 ARG B NH2   1 
ATOM   5120 N  N     . PRO B 1 274 ? -17.271 40.261  -16.768 1.00 33.96 ? 266 PRO B N     1 
ATOM   5121 C  CA    . PRO B 1 274 ? -17.683 39.104  -15.955 1.00 33.67 ? 266 PRO B CA    1 
ATOM   5122 C  C     . PRO B 1 274 ? -17.008 37.797  -16.374 1.00 33.46 ? 266 PRO B C     1 
ATOM   5123 O  O     . PRO B 1 274 ? -16.607 37.004  -15.519 1.00 33.12 ? 266 PRO B O     1 
ATOM   5124 C  CB    . PRO B 1 274 ? -19.201 39.011  -16.209 1.00 33.66 ? 266 PRO B CB    1 
ATOM   5125 C  CG    . PRO B 1 274 ? -19.508 40.057  -17.265 1.00 33.99 ? 266 PRO B CG    1 
ATOM   5126 C  CD    . PRO B 1 274 ? -18.428 41.065  -17.184 1.00 33.96 ? 266 PRO B CD    1 
ATOM   5127 N  N     . ASP B 1 275 ? -16.879 37.587  -17.682 1.00 33.29 ? 267 ASP B N     1 
ATOM   5128 C  CA    . ASP B 1 275 ? -16.345 36.340  -18.211 1.00 33.29 ? 267 ASP B CA    1 
ATOM   5129 C  C     . ASP B 1 275 ? -14.825 36.253  -18.091 1.00 33.14 ? 267 ASP B C     1 
ATOM   5130 O  O     . ASP B 1 275 ? -14.244 35.186  -18.279 1.00 33.14 ? 267 ASP B O     1 
ATOM   5131 C  CB    . ASP B 1 275 ? -16.777 36.144  -19.665 1.00 33.47 ? 267 ASP B CB    1 
ATOM   5132 C  CG    . ASP B 1 275 ? -16.589 37.389  -20.498 1.00 34.07 ? 267 ASP B CG    1 
ATOM   5133 O  OD1   . ASP B 1 275 ? -17.436 38.307  -20.397 1.00 34.99 ? 267 ASP B OD1   1 
ATOM   5134 O  OD2   . ASP B 1 275 ? -15.593 37.453  -21.252 1.00 34.25 ? 267 ASP B OD2   1 
ATOM   5135 N  N     . GLN B 1 276 ? -14.187 37.373  -17.765 1.00 32.99 ? 268 GLN B N     1 
ATOM   5136 C  CA    . GLN B 1 276 ? -12.742 37.391  -17.546 1.00 32.93 ? 268 GLN B CA    1 
ATOM   5137 C  C     . GLN B 1 276 ? -12.390 36.903  -16.154 1.00 32.46 ? 268 GLN B C     1 
ATOM   5138 O  O     . GLN B 1 276 ? -11.234 36.587  -15.874 1.00 32.43 ? 268 GLN B O     1 
ATOM   5139 C  CB    . GLN B 1 276 ? -12.182 38.793  -17.748 1.00 33.18 ? 268 GLN B CB    1 
ATOM   5140 C  CG    . GLN B 1 276 ? -12.020 39.195  -19.193 1.00 34.38 ? 268 GLN B CG    1 
ATOM   5141 C  CD    . GLN B 1 276 ? -11.555 40.626  -19.343 1.00 35.56 ? 268 GLN B CD    1 
ATOM   5142 O  OE1   . GLN B 1 276 ? -12.216 41.563  -18.877 1.00 35.76 ? 268 GLN B OE1   1 
ATOM   5143 N  NE2   . GLN B 1 276 ? -10.411 40.810  -19.996 1.00 36.37 ? 268 GLN B NE2   1 
ATOM   5144 N  N     . VAL B 1 277 ? -13.386 36.855  -15.279 1.00 31.92 ? 269 VAL B N     1 
ATOM   5145 C  CA    . VAL B 1 277 ? -13.155 36.503  -13.889 1.00 31.56 ? 269 VAL B CA    1 
ATOM   5146 C  C     . VAL B 1 277 ? -13.566 35.069  -13.604 1.00 31.55 ? 269 VAL B C     1 
ATOM   5147 O  O     . VAL B 1 277 ? -14.684 34.652  -13.916 1.00 31.41 ? 269 VAL B O     1 
ATOM   5148 C  CB    . VAL B 1 277 ? -13.880 37.465  -12.925 1.00 31.42 ? 269 VAL B CB    1 
ATOM   5149 C  CG1   . VAL B 1 277 ? -13.538 37.134  -11.480 1.00 31.02 ? 269 VAL B CG1   1 
ATOM   5150 C  CG2   . VAL B 1 277 ? -13.507 38.899  -13.238 1.00 31.40 ? 269 VAL B CG2   1 
ATOM   5151 N  N     . LEU B 1 278 ? -12.639 34.312  -13.031 1.00 31.60 ? 270 LEU B N     1 
ATOM   5152 C  CA    . LEU B 1 278 ? -12.896 32.948  -12.632 1.00 31.67 ? 270 LEU B CA    1 
ATOM   5153 C  C     . LEU B 1 278 ? -12.666 32.769  -11.127 1.00 31.85 ? 270 LEU B C     1 
ATOM   5154 O  O     . LEU B 1 278 ? -11.628 33.165  -10.592 1.00 31.52 ? 270 LEU B O     1 
ATOM   5155 C  CB    . LEU B 1 278 ? -12.020 31.987  -13.440 1.00 31.62 ? 270 LEU B CB    1 
ATOM   5156 C  CG    . LEU B 1 278 ? -11.948 30.531  -12.990 1.00 31.45 ? 270 LEU B CG    1 
ATOM   5157 C  CD1   . LEU B 1 278 ? -12.040 29.597  -14.178 1.00 31.17 ? 270 LEU B CD1   1 
ATOM   5158 C  CD2   . LEU B 1 278 ? -10.671 30.292  -12.225 1.00 32.17 ? 270 LEU B CD2   1 
ATOM   5159 N  N     . ILE B 1 279 ? -13.649 32.182  -10.455 1.00 32.22 ? 271 ILE B N     1 
ATOM   5160 C  CA    . ILE B 1 279 ? -13.555 31.922  -9.025  1.00 32.61 ? 271 ILE B CA    1 
ATOM   5161 C  C     . ILE B 1 279 ? -13.021 30.518  -8.771  1.00 32.98 ? 271 ILE B C     1 
ATOM   5162 O  O     . ILE B 1 279 ? -13.555 29.536  -9.291  1.00 32.86 ? 271 ILE B O     1 
ATOM   5163 C  CB    . ILE B 1 279 ? -14.933 32.067  -8.325  1.00 32.60 ? 271 ILE B CB    1 
ATOM   5164 C  CG1   . ILE B 1 279 ? -15.640 33.362  -8.762  1.00 32.33 ? 271 ILE B CG1   1 
ATOM   5165 C  CG2   . ILE B 1 279 ? -14.777 31.993  -6.800  1.00 32.56 ? 271 ILE B CG2   1 
ATOM   5166 C  CD1   . ILE B 1 279 ? -14.961 34.637  -8.290  1.00 31.61 ? 271 ILE B CD1   1 
ATOM   5167 N  N     . GLU B 1 280 ? -11.968 30.430  -7.966  1.00 33.47 ? 272 GLU B N     1 
ATOM   5168 C  CA    . GLU B 1 280 ? -11.429 29.147  -7.553  1.00 34.18 ? 272 GLU B CA    1 
ATOM   5169 C  C     . GLU B 1 280 ? -11.921 28.766  -6.160  1.00 34.84 ? 272 GLU B C     1 
ATOM   5170 O  O     . GLU B 1 280 ? -11.747 29.519  -5.200  1.00 34.74 ? 272 GLU B O     1 
ATOM   5171 C  CB    . GLU B 1 280 ? -9.901  29.173  -7.576  1.00 34.09 ? 272 GLU B CB    1 
ATOM   5172 C  CG    . GLU B 1 280 ? -9.299  29.381  -8.948  1.00 33.89 ? 272 GLU B CG    1 
ATOM   5173 C  CD    . GLU B 1 280 ? -7.811  29.091  -8.982  1.00 34.11 ? 272 GLU B CD    1 
ATOM   5174 O  OE1   . GLU B 1 280 ? -7.160  29.434  -9.988  1.00 34.61 ? 272 GLU B OE1   1 
ATOM   5175 O  OE2   . GLU B 1 280 ? -7.292  28.507  -8.011  1.00 34.22 ? 272 GLU B OE2   1 
ATOM   5176 N  N     . VAL B 1 281 ? -12.542 27.596  -6.060  1.00 35.79 ? 273 VAL B N     1 
ATOM   5177 C  CA    . VAL B 1 281 ? -12.919 27.032  -4.769  1.00 36.89 ? 273 VAL B CA    1 
ATOM   5178 C  C     . VAL B 1 281 ? -12.249 25.669  -4.563  1.00 37.66 ? 273 VAL B C     1 
ATOM   5179 O  O     . VAL B 1 281 ? -12.211 24.846  -5.478  1.00 37.74 ? 273 VAL B O     1 
ATOM   5180 C  CB    . VAL B 1 281 ? -14.463 26.897  -4.627  1.00 36.85 ? 273 VAL B CB    1 
ATOM   5181 C  CG1   . VAL B 1 281 ? -15.076 28.219  -4.227  1.00 37.03 ? 273 VAL B CG1   1 
ATOM   5182 C  CG2   . VAL B 1 281 ? -15.088 26.393  -5.927  1.00 37.08 ? 273 VAL B CG2   1 
ATOM   5183 N  N     . THR B 1 282 ? -11.705 25.451  -3.368  1.00 38.80 ? 274 THR B N     1 
ATOM   5184 C  CA    . THR B 1 282 ? -10.991 24.204  -3.053  1.00 39.93 ? 274 THR B CA    1 
ATOM   5185 C  C     . THR B 1 282 ? -11.929 23.001  -3.012  1.00 40.93 ? 274 THR B C     1 
ATOM   5186 O  O     . THR B 1 282 ? -13.040 23.085  -2.486  1.00 40.91 ? 274 THR B O     1 
ATOM   5187 C  CB    . THR B 1 282 ? -10.254 24.299  -1.715  1.00 39.82 ? 274 THR B CB    1 
ATOM   5188 O  OG1   . THR B 1 282 ? -11.077 24.993  -0.771  1.00 40.06 ? 274 THR B OG1   1 
ATOM   5189 C  CG2   . THR B 1 282 ? -8.943  25.044  -1.880  1.00 39.54 ? 274 THR B CG2   1 
ATOM   5190 N  N     . GLU B 1 283 ? -11.452 21.876  -3.543  1.00 42.29 ? 275 GLU B N     1 
ATOM   5191 C  CA    . GLU B 1 283 ? -12.279 20.685  -3.761  1.00 43.66 ? 275 GLU B CA    1 
ATOM   5192 C  C     . GLU B 1 283 ? -12.900 20.136  -2.473  1.00 44.49 ? 275 GLU B C     1 
ATOM   5193 O  O     . GLU B 1 283 ? -14.090 19.809  -2.441  1.00 44.54 ? 275 GLU B O     1 
ATOM   5194 C  CB    . GLU B 1 283 ? -11.460 19.591  -4.449  1.00 43.54 ? 275 GLU B CB    1 
ATOM   5195 C  CG    . GLU B 1 283 ? -12.298 18.469  -5.042  1.00 44.15 ? 275 GLU B CG    1 
ATOM   5196 C  CD    . GLU B 1 283 ? -11.469 17.255  -5.436  1.00 44.42 ? 275 GLU B CD    1 
ATOM   5197 O  OE1   . GLU B 1 283 ? -10.335 17.108  -4.926  1.00 44.43 ? 275 GLU B OE1   1 
ATOM   5198 O  OE2   . GLU B 1 283 ? -11.966 16.432  -6.235  1.00 45.65 ? 275 GLU B OE2   1 
ATOM   5199 N  N     . THR B 1 284 ? -12.084 20.035  -1.421  1.00 45.63 ? 276 THR B N     1 
ATOM   5200 C  CA    . THR B 1 284 ? -12.516 19.446  -0.149  1.00 46.79 ? 276 THR B CA    1 
ATOM   5201 C  C     . THR B 1 284 ? -13.618 20.270  0.510   1.00 47.52 ? 276 THR B C     1 
ATOM   5202 O  O     . THR B 1 284 ? -14.547 19.722  1.104   1.00 47.66 ? 276 THR B O     1 
ATOM   5203 C  CB    . THR B 1 284 ? -11.338 19.312  0.851   1.00 46.79 ? 276 THR B CB    1 
ATOM   5204 O  OG1   . THR B 1 284 ? -10.860 20.615  1.211   1.00 47.07 ? 276 THR B OG1   1 
ATOM   5205 C  CG2   . THR B 1 284 ? -10.197 18.504  0.241   1.00 47.05 ? 276 THR B CG2   1 
ATOM   5206 N  N     . GLU B 1 285 ? -13.515 21.587  0.392   1.00 48.38 ? 277 GLU B N     1 
ATOM   5207 C  CA    . GLU B 1 285 ? -14.405 22.484  1.106   1.00 49.32 ? 277 GLU B CA    1 
ATOM   5208 C  C     . GLU B 1 285 ? -15.731 22.680  0.383   1.00 49.89 ? 277 GLU B C     1 
ATOM   5209 O  O     . GLU B 1 285 ? -16.628 23.343  0.895   1.00 50.02 ? 277 GLU B O     1 
ATOM   5210 C  CB    . GLU B 1 285 ? -13.719 23.825  1.349   1.00 49.34 ? 277 GLU B CB    1 
ATOM   5211 C  CG    . GLU B 1 285 ? -12.503 23.728  2.254   1.00 50.00 ? 277 GLU B CG    1 
ATOM   5212 C  CD    . GLU B 1 285 ? -11.664 24.983  2.244   1.00 51.04 ? 277 GLU B CD    1 
ATOM   5213 O  OE1   . GLU B 1 285 ? -12.042 25.945  1.543   1.00 51.74 ? 277 GLU B OE1   1 
ATOM   5214 O  OE2   . GLU B 1 285 ? -10.617 25.007  2.928   1.00 51.53 ? 277 GLU B OE2   1 
ATOM   5215 N  N     . VAL B 1 286 ? -15.854 22.084  -0.800  1.00 50.66 ? 278 VAL B N     1 
ATOM   5216 C  CA    . VAL B 1 286 ? -17.067 22.202  -1.605  1.00 51.42 ? 278 VAL B CA    1 
ATOM   5217 C  C     . VAL B 1 286 ? -17.980 20.979  -1.440  1.00 52.02 ? 278 VAL B C     1 
ATOM   5218 O  O     . VAL B 1 286 ? -19.208 21.113  -1.386  1.00 52.10 ? 278 VAL B O     1 
ATOM   5219 C  CB    . VAL B 1 286 ? -16.729 22.417  -3.108  1.00 51.37 ? 278 VAL B CB    1 
ATOM   5220 C  CG1   . VAL B 1 286 ? -17.984 22.304  -3.976  1.00 51.54 ? 278 VAL B CG1   1 
ATOM   5221 C  CG2   . VAL B 1 286 ? -16.073 23.759  -3.309  1.00 51.38 ? 278 VAL B CG2   1 
ATOM   5222 N  N     . ILE B 1 287 ? -17.372 19.797  -1.339  1.00 52.74 ? 279 ILE B N     1 
ATOM   5223 C  CA    . ILE B 1 287 ? -18.124 18.535  -1.317  1.00 53.46 ? 279 ILE B CA    1 
ATOM   5224 C  C     . ILE B 1 287 ? -19.038 18.394  -0.088  1.00 53.98 ? 279 ILE B C     1 
ATOM   5225 O  O     . ILE B 1 287 ? -20.184 17.945  -0.206  1.00 53.98 ? 279 ILE B O     1 
ATOM   5226 C  CB    . ILE B 1 287 ? -17.191 17.292  -1.438  1.00 53.48 ? 279 ILE B CB    1 
ATOM   5227 C  CG1   . ILE B 1 287 ? -16.058 17.360  -0.409  1.00 53.61 ? 279 ILE B CG1   1 
ATOM   5228 C  CG2   . ILE B 1 287 ? -16.628 17.178  -2.856  1.00 53.43 ? 279 ILE B CG2   1 
ATOM   5229 C  CD1   . ILE B 1 287 ? -15.654 16.013  0.152   1.00 53.87 ? 279 ILE B CD1   1 
ATOM   5230 N  N     . THR B 1 288 ? -18.531 18.791  1.082   1.00 54.56 ? 280 THR B N     1 
ATOM   5231 C  CA    . THR B 1 288 ? -19.329 18.789  2.312   1.00 55.10 ? 280 THR B CA    1 
ATOM   5232 C  C     . THR B 1 288 ? -19.921 20.175  2.571   1.00 55.42 ? 280 THR B C     1 
ATOM   5233 O  O     . THR B 1 288 ? -19.791 20.730  3.670   1.00 55.52 ? 280 THR B O     1 
ATOM   5234 C  CB    . THR B 1 288 ? -18.501 18.329  3.536   1.00 55.18 ? 280 THR B CB    1 
ATOM   5235 O  OG1   . THR B 1 288 ? -17.162 18.832  3.428   1.00 55.12 ? 280 THR B OG1   1 
ATOM   5236 C  CG2   . THR B 1 288 ? -18.467 16.799  3.620   1.00 55.26 ? 280 THR B CG2   1 
ATOM   5237 N  N     . CYS B 1 289 ? -20.588 20.713  1.552   1.00 55.75 ? 281 CYS B N     1 
ATOM   5238 C  CA    . CYS B 1 289 ? -21.047 22.095  1.551   1.00 55.86 ? 281 CYS B CA    1 
ATOM   5239 C  C     . CYS B 1 289 ? -22.016 22.304  0.393   1.00 55.97 ? 281 CYS B C     1 
ATOM   5240 O  O     . CYS B 1 289 ? -22.784 23.266  0.379   1.00 55.95 ? 281 CYS B O     1 
ATOM   5241 C  CB    . CYS B 1 289 ? -19.849 23.042  1.402   1.00 55.83 ? 281 CYS B CB    1 
ATOM   5242 S  SG    . CYS B 1 289 ? -20.231 24.810  1.481   1.00 56.17 ? 281 CYS B SG    1 
ATOM   5243 N  N     . PHE B 1 290 ? -22.006 21.360  -0.551  1.00 56.17 ? 282 PHE B N     1 
ATOM   5244 C  CA    . PHE B 1 290 ? -22.563 21.575  -1.891  1.00 56.31 ? 282 PHE B CA    1 
ATOM   5245 C  C     . PHE B 1 290 ? -24.017 22.061  -1.927  1.00 56.32 ? 282 PHE B C     1 
ATOM   5246 O  O     . PHE B 1 290 ? -24.301 23.113  -2.490  1.00 56.43 ? 282 PHE B O     1 
ATOM   5247 C  CB    . PHE B 1 290 ? -22.401 20.325  -2.765  1.00 56.41 ? 282 PHE B CB    1 
ATOM   5248 C  CG    . PHE B 1 290 ? -23.060 20.445  -4.112  1.00 56.81 ? 282 PHE B CG    1 
ATOM   5249 C  CD1   . PHE B 1 290 ? -24.253 19.779  -4.382  1.00 57.21 ? 282 PHE B CD1   1 
ATOM   5250 C  CD2   . PHE B 1 290 ? -22.509 21.259  -5.101  1.00 57.11 ? 282 PHE B CD2   1 
ATOM   5251 C  CE1   . PHE B 1 290 ? -24.874 19.904  -5.620  1.00 57.44 ? 282 PHE B CE1   1 
ATOM   5252 C  CE2   . PHE B 1 290 ? -23.124 21.388  -6.341  1.00 57.16 ? 282 PHE B CE2   1 
ATOM   5253 C  CZ    . PHE B 1 290 ? -24.308 20.710  -6.601  1.00 57.33 ? 282 PHE B CZ    1 
ATOM   5254 N  N     . ASP B 1 291 ? -24.932 21.278  -1.354  1.00 56.23 ? 283 ASP B N     1 
ATOM   5255 C  CA    . ASP B 1 291 ? -26.375 21.577  -1.445  1.00 56.05 ? 283 ASP B CA    1 
ATOM   5256 C  C     . ASP B 1 291 ? -26.722 22.990  -0.950  1.00 55.75 ? 283 ASP B C     1 
ATOM   5257 O  O     . ASP B 1 291 ? -27.593 23.661  -1.514  1.00 55.69 ? 283 ASP B O     1 
ATOM   5258 C  CB    . ASP B 1 291 ? -27.207 20.518  -0.705  1.00 56.18 ? 283 ASP B CB    1 
ATOM   5259 C  CG    . ASP B 1 291 ? -26.527 20.017  0.567   1.00 56.73 ? 283 ASP B CG    1 
ATOM   5260 O  OD1   . ASP B 1 291 ? -26.730 20.633  1.639   1.00 56.91 ? 283 ASP B OD1   1 
ATOM   5261 O  OD2   . ASP B 1 291 ? -25.805 18.997  0.493   1.00 56.86 ? 283 ASP B OD2   1 
ATOM   5262 N  N     . GLN B 1 292 ? -26.009 23.440  0.083   1.00 55.33 ? 284 GLN B N     1 
ATOM   5263 C  CA    . GLN B 1 292 ? -26.171 24.794  0.623   1.00 54.86 ? 284 GLN B CA    1 
ATOM   5264 C  C     . GLN B 1 292 ? -25.532 25.829  -0.304  1.00 54.39 ? 284 GLN B C     1 
ATOM   5265 O  O     . GLN B 1 292 ? -25.937 26.994  -0.337  1.00 54.41 ? 284 GLN B O     1 
ATOM   5266 C  CB    . GLN B 1 292 ? -25.525 24.884  2.011   1.00 54.93 ? 284 GLN B CB    1 
ATOM   5267 C  CG    . GLN B 1 292 ? -25.607 23.596  2.828   1.00 54.89 ? 284 GLN B CG    1 
ATOM   5268 C  CD    . GLN B 1 292 ? -24.485 23.471  3.843   1.00 54.67 ? 284 GLN B CD    1 
ATOM   5269 O  OE1   . GLN B 1 292 ? -24.272 24.362  4.666   1.00 54.55 ? 284 GLN B OE1   1 
ATOM   5270 N  NE2   . GLN B 1 292 ? -23.765 22.356  3.793   1.00 54.67 ? 284 GLN B NE2   1 
ATOM   5271 N  N     . PHE B 1 293 ? -24.539 25.382  -1.062  1.00 53.74 ? 285 PHE B N     1 
ATOM   5272 C  CA    . PHE B 1 293 ? -23.684 26.258  -1.842  1.00 53.12 ? 285 PHE B CA    1 
ATOM   5273 C  C     . PHE B 1 293 ? -24.229 26.442  -3.264  1.00 52.57 ? 285 PHE B C     1 
ATOM   5274 O  O     . PHE B 1 293 ? -23.722 27.263  -4.028  1.00 52.52 ? 285 PHE B O     1 
ATOM   5275 C  CB    . PHE B 1 293 ? -22.270 25.662  -1.888  1.00 53.32 ? 285 PHE B CB    1 
ATOM   5276 C  CG    . PHE B 1 293 ? -21.197 26.652  -2.214  1.00 53.55 ? 285 PHE B CG    1 
ATOM   5277 C  CD1   . PHE B 1 293 ? -21.238 27.941  -1.700  1.00 53.85 ? 285 PHE B CD1   1 
ATOM   5278 C  CD2   . PHE B 1 293 ? -20.116 26.280  -3.004  1.00 54.02 ? 285 PHE B CD2   1 
ATOM   5279 C  CE1   . PHE B 1 293 ? -20.235 28.853  -1.996  1.00 54.21 ? 285 PHE B CE1   1 
ATOM   5280 C  CE2   . PHE B 1 293 ? -19.107 27.184  -3.301  1.00 54.17 ? 285 PHE B CE2   1 
ATOM   5281 C  CZ    . PHE B 1 293 ? -19.167 28.472  -2.799  1.00 54.16 ? 285 PHE B CZ    1 
ATOM   5282 N  N     . ARG B 1 294 ? -25.279 25.688  -3.597  1.00 51.80 ? 286 ARG B N     1 
ATOM   5283 C  CA    . ARG B 1 294 ? -25.807 25.631  -4.970  1.00 51.14 ? 286 ARG B CA    1 
ATOM   5284 C  C     . ARG B 1 294 ? -26.261 26.990  -5.495  1.00 50.31 ? 286 ARG B C     1 
ATOM   5285 O  O     . ARG B 1 294 ? -25.989 27.342  -6.643  1.00 50.21 ? 286 ARG B O     1 
ATOM   5286 C  CB    . ARG B 1 294 ? -26.967 24.633  -5.066  1.00 51.30 ? 286 ARG B CB    1 
ATOM   5287 C  CG    . ARG B 1 294 ? -26.583 23.191  -4.800  1.00 51.90 ? 286 ARG B CG    1 
ATOM   5288 C  CD    . ARG B 1 294 ? -27.716 22.237  -5.157  1.00 52.66 ? 286 ARG B CD    1 
ATOM   5289 N  NE    . ARG B 1 294 ? -27.568 21.694  -6.508  1.00 54.08 ? 286 ARG B NE    1 
ATOM   5290 C  CZ    . ARG B 1 294 ? -28.151 22.200  -7.594  1.00 54.56 ? 286 ARG B CZ    1 
ATOM   5291 N  NH1   . ARG B 1 294 ? -28.934 23.270  -7.499  1.00 54.38 ? 286 ARG B NH1   1 
ATOM   5292 N  NH2   . ARG B 1 294 ? -27.950 21.634  -8.778  1.00 54.89 ? 286 ARG B NH2   1 
ATOM   5293 N  N     . LYS B 1 295 ? -26.954 27.746  -4.646  1.00 49.35 ? 287 LYS B N     1 
ATOM   5294 C  CA    . LYS B 1 295 ? -27.558 29.023  -5.044  1.00 48.43 ? 287 LYS B CA    1 
ATOM   5295 C  C     . LYS B 1 295 ? -26.495 30.042  -5.460  1.00 47.52 ? 287 LYS B C     1 
ATOM   5296 O  O     . LYS B 1 295 ? -26.743 30.903  -6.306  1.00 47.40 ? 287 LYS B O     1 
ATOM   5297 C  CB    . LYS B 1 295 ? -28.406 29.590  -3.900  1.00 48.59 ? 287 LYS B CB    1 
ATOM   5298 C  CG    . LYS B 1 295 ? -29.022 28.525  -2.996  1.00 49.17 ? 287 LYS B CG    1 
ATOM   5299 C  CD    . LYS B 1 295 ? -29.232 29.051  -1.578  1.00 50.00 ? 287 LYS B CD    1 
ATOM   5300 C  CE    . LYS B 1 295 ? -29.276 27.915  -0.560  1.00 50.26 ? 287 LYS B CE    1 
ATOM   5301 N  NZ    . LYS B 1 295 ? -30.436 27.002  -0.780  1.00 50.45 ? 287 LYS B NZ    1 
ATOM   5302 N  N     . VAL B 1 296 ? -25.313 29.931  -4.860  1.00 46.38 ? 288 VAL B N     1 
ATOM   5303 C  CA    . VAL B 1 296 ? -24.208 30.830  -5.156  1.00 45.30 ? 288 VAL B CA    1 
ATOM   5304 C  C     . VAL B 1 296 ? -23.550 30.463  -6.485  1.00 44.47 ? 288 VAL B C     1 
ATOM   5305 O  O     . VAL B 1 296 ? -23.210 31.340  -7.281  1.00 44.29 ? 288 VAL B O     1 
ATOM   5306 C  CB    . VAL B 1 296 ? -23.151 30.814  -4.026  1.00 45.36 ? 288 VAL B CB    1 
ATOM   5307 C  CG1   . VAL B 1 296 ? -22.080 31.852  -4.284  1.00 45.39 ? 288 VAL B CG1   1 
ATOM   5308 C  CG2   . VAL B 1 296 ? -23.811 31.060  -2.677  1.00 45.48 ? 288 VAL B CG2   1 
ATOM   5309 N  N     . LEU B 1 297 ? -23.387 29.163  -6.721  1.00 43.50 ? 289 LEU B N     1 
ATOM   5310 C  CA    . LEU B 1 297 ? -22.824 28.671  -7.976  1.00 42.65 ? 289 LEU B CA    1 
ATOM   5311 C  C     . LEU B 1 297 ? -23.719 29.052  -9.145  1.00 41.93 ? 289 LEU B C     1 
ATOM   5312 O  O     . LEU B 1 297 ? -23.236 29.423  -10.213 1.00 41.77 ? 289 LEU B O     1 
ATOM   5313 C  CB    . LEU B 1 297 ? -22.655 27.149  -7.931  1.00 42.79 ? 289 LEU B CB    1 
ATOM   5314 C  CG    . LEU B 1 297 ? -22.040 26.526  -6.674  1.00 43.15 ? 289 LEU B CG    1 
ATOM   5315 C  CD1   . LEU B 1 297 ? -22.428 25.057  -6.559  1.00 43.55 ? 289 LEU B CD1   1 
ATOM   5316 C  CD2   . LEU B 1 297 ? -20.530 26.682  -6.658  1.00 43.45 ? 289 LEU B CD2   1 
ATOM   5317 N  N     . LYS B 1 298 ? -25.031 28.957  -8.925  1.00 41.08 ? 290 LYS B N     1 
ATOM   5318 C  CA    . LYS B 1 298 ? -26.025 29.338  -9.922  1.00 40.20 ? 290 LYS B CA    1 
ATOM   5319 C  C     . LYS B 1 298 ? -25.912 30.811  -10.272 1.00 39.64 ? 290 LYS B C     1 
ATOM   5320 O  O     . LYS B 1 298 ? -25.896 31.177  -11.450 1.00 39.76 ? 290 LYS B O     1 
ATOM   5321 C  CB    . LYS B 1 298 ? -27.435 29.027  -9.409  1.00 40.28 ? 290 LYS B CB    1 
ATOM   5322 C  CG    . LYS B 1 298 ? -28.568 29.447  -10.346 1.00 40.05 ? 290 LYS B CG    1 
ATOM   5323 C  CD    . LYS B 1 298 ? -29.909 28.929  -9.837  1.00 40.18 ? 290 LYS B CD    1 
ATOM   5324 C  CE    . LYS B 1 298 ? -31.077 29.545  -10.591 1.00 40.07 ? 290 LYS B CE    1 
ATOM   5325 N  NZ    . LYS B 1 298 ? -31.279 30.977  -10.240 1.00 39.96 ? 290 LYS B NZ    1 
ATOM   5326 N  N     . ALA B 1 299 ? -25.813 31.653  -9.246  1.00 38.74 ? 291 ALA B N     1 
ATOM   5327 C  CA    . ALA B 1 299 ? -25.767 33.098  -9.439  1.00 38.05 ? 291 ALA B CA    1 
ATOM   5328 C  C     . ALA B 1 299 ? -24.508 33.534  -10.184 1.00 37.58 ? 291 ALA B C     1 
ATOM   5329 O  O     . ALA B 1 299 ? -24.548 34.466  -10.987 1.00 37.50 ? 291 ALA B O     1 
ATOM   5330 C  CB    . ALA B 1 299 ? -25.877 33.814  -8.109  1.00 38.04 ? 291 ALA B CB    1 
ATOM   5331 N  N     . LEU B 1 300 ? -23.397 32.842  -9.924  1.00 36.93 ? 292 LEU B N     1 
ATOM   5332 C  CA    . LEU B 1 300 ? -22.134 33.115  -10.609 1.00 36.30 ? 292 LEU B CA    1 
ATOM   5333 C  C     . LEU B 1 300 ? -22.213 32.790  -12.094 1.00 35.92 ? 292 LEU B C     1 
ATOM   5334 O  O     . LEU B 1 300 ? -21.662 33.514  -12.923 1.00 35.86 ? 292 LEU B O     1 
ATOM   5335 C  CB    . LEU B 1 300 ? -20.986 32.334  -9.966  1.00 36.34 ? 292 LEU B CB    1 
ATOM   5336 C  CG    . LEU B 1 300 ? -20.448 32.840  -8.625  1.00 36.50 ? 292 LEU B CG    1 
ATOM   5337 C  CD1   . LEU B 1 300 ? -19.474 31.830  -8.030  1.00 36.79 ? 292 LEU B CD1   1 
ATOM   5338 C  CD2   . LEU B 1 300 ? -19.783 34.205  -8.772  1.00 36.09 ? 292 LEU B CD2   1 
ATOM   5339 N  N     . ARG B 1 301 ? -22.891 31.689  -12.424 1.00 35.46 ? 293 ARG B N     1 
ATOM   5340 C  CA    . ARG B 1 301 ? -23.124 31.314  -13.821 1.00 35.05 ? 293 ARG B CA    1 
ATOM   5341 C  C     . ARG B 1 301 ? -23.894 32.397  -14.555 1.00 34.45 ? 293 ARG B C     1 
ATOM   5342 O  O     . ARG B 1 301 ? -23.443 32.895  -15.584 1.00 34.40 ? 293 ARG B O     1 
ATOM   5343 C  CB    . ARG B 1 301 ? -23.880 29.986  -13.912 1.00 35.15 ? 293 ARG B CB    1 
ATOM   5344 C  CG    . ARG B 1 301 ? -23.007 28.764  -13.746 1.00 35.56 ? 293 ARG B CG    1 
ATOM   5345 C  CD    . ARG B 1 301 ? -22.415 28.305  -15.075 1.00 36.10 ? 293 ARG B CD    1 
ATOM   5346 N  NE    . ARG B 1 301 ? -21.084 27.720  -14.898 1.00 37.04 ? 293 ARG B NE    1 
ATOM   5347 C  CZ    . ARG B 1 301 ? -20.856 26.479  -14.469 1.00 37.34 ? 293 ARG B CZ    1 
ATOM   5348 N  NH1   . ARG B 1 301 ? -21.869 25.674  -14.177 1.00 37.55 ? 293 ARG B NH1   1 
ATOM   5349 N  NH2   . ARG B 1 301 ? -19.610 26.043  -14.333 1.00 37.28 ? 293 ARG B NH2   1 
ATOM   5350 N  N     . VAL B 1 302 ? -25.045 32.775  -13.998 1.00 33.72 ? 294 VAL B N     1 
ATOM   5351 C  CA    . VAL B 1 302 ? -25.907 33.802  -14.590 1.00 33.04 ? 294 VAL B CA    1 
ATOM   5352 C  C     . VAL B 1 302 ? -25.183 35.141  -14.718 1.00 32.56 ? 294 VAL B C     1 
ATOM   5353 O  O     . VAL B 1 302 ? -25.335 35.843  -15.722 1.00 32.66 ? 294 VAL B O     1 
ATOM   5354 C  CB    . VAL B 1 302 ? -27.211 33.995  -13.769 1.00 33.00 ? 294 VAL B CB    1 
ATOM   5355 C  CG1   . VAL B 1 302 ? -28.145 34.977  -14.461 1.00 32.79 ? 294 VAL B CG1   1 
ATOM   5356 C  CG2   . VAL B 1 302 ? -27.904 32.665  -13.562 1.00 33.16 ? 294 VAL B CG2   1 
ATOM   5357 N  N     . ALA B 1 303 ? -24.382 35.479  -13.709 1.00 31.87 ? 295 ALA B N     1 
ATOM   5358 C  CA    . ALA B 1 303 ? -23.590 36.709  -13.734 1.00 31.32 ? 295 ALA B CA    1 
ATOM   5359 C  C     . ALA B 1 303 ? -22.601 36.715  -14.896 1.00 30.89 ? 295 ALA B C     1 
ATOM   5360 O  O     . ALA B 1 303 ? -22.365 37.755  -15.515 1.00 30.97 ? 295 ALA B O     1 
ATOM   5361 C  CB    . ALA B 1 303 ? -22.864 36.899  -12.423 1.00 31.24 ? 295 ALA B CB    1 
ATOM   5362 N  N     . GLY B 1 304 ? -22.029 35.549  -15.189 1.00 30.38 ? 296 GLY B N     1 
ATOM   5363 C  CA    . GLY B 1 304 ? -21.096 35.409  -16.303 1.00 29.85 ? 296 GLY B CA    1 
ATOM   5364 C  C     . GLY B 1 304 ? -19.700 35.000  -15.880 1.00 29.38 ? 296 GLY B C     1 
ATOM   5365 O  O     . GLY B 1 304 ? -18.840 34.756  -16.721 1.00 29.21 ? 296 GLY B O     1 
ATOM   5366 N  N     . MET B 1 305 ? -19.476 34.932  -14.570 1.00 28.94 ? 297 MET B N     1 
ATOM   5367 C  CA    . MET B 1 305 ? -18.189 34.514  -14.034 1.00 28.49 ? 297 MET B CA    1 
ATOM   5368 C  C     . MET B 1 305 ? -17.986 33.009  -14.175 1.00 28.13 ? 297 MET B C     1 
ATOM   5369 O  O     . MET B 1 305 ? -18.951 32.240  -14.218 1.00 27.85 ? 297 MET B O     1 
ATOM   5370 C  CB    . MET B 1 305 ? -18.049 34.942  -12.576 1.00 28.48 ? 297 MET B CB    1 
ATOM   5371 C  CG    . MET B 1 305 ? -17.604 36.383  -12.401 1.00 28.56 ? 297 MET B CG    1 
ATOM   5372 S  SD    . MET B 1 305 ? -17.759 36.962  -10.701 1.00 28.80 ? 297 MET B SD    1 
ATOM   5373 C  CE    . MET B 1 305 ? -19.473 37.469  -10.669 1.00 27.72 ? 297 MET B CE    1 
ATOM   5374 N  N     . LYS B 1 306 ? -16.727 32.599  -14.271 1.00 27.82 ? 298 LYS B N     1 
ATOM   5375 C  CA    . LYS B 1 306 ? -16.388 31.192  -14.435 1.00 27.64 ? 298 LYS B CA    1 
ATOM   5376 C  C     . LYS B 1 306 ? -16.007 30.565  -13.103 1.00 27.53 ? 298 LYS B C     1 
ATOM   5377 O  O     . LYS B 1 306 ? -15.663 31.270  -12.153 1.00 27.33 ? 298 LYS B O     1 
ATOM   5378 C  CB    . LYS B 1 306 ? -15.255 31.027  -15.450 1.00 27.55 ? 298 LYS B CB    1 
ATOM   5379 C  CG    . LYS B 1 306 ? -15.727 30.762  -16.876 1.00 27.95 ? 298 LYS B CG    1 
ATOM   5380 C  CD    . LYS B 1 306 ? -16.248 32.025  -17.543 1.00 29.35 ? 298 LYS B CD    1 
ATOM   5381 C  CE    . LYS B 1 306 ? -16.915 31.715  -18.871 1.00 30.31 ? 298 LYS B CE    1 
ATOM   5382 N  NZ    . LYS B 1 306 ? -18.148 30.883  -18.699 1.00 31.28 ? 298 LYS B NZ    1 
ATOM   5383 N  N     . LEU B 1 307 ? -16.089 29.240  -13.026 1.00 27.59 ? 299 LEU B N     1 
ATOM   5384 C  CA    . LEU B 1 307 ? -15.791 28.541  -11.784 1.00 27.91 ? 299 LEU B CA    1 
ATOM   5385 C  C     . LEU B 1 307 ? -14.776 27.421  -11.961 1.00 27.89 ? 299 LEU B C     1 
ATOM   5386 O  O     . LEU B 1 307 ? -14.886 26.606  -12.877 1.00 27.92 ? 299 LEU B O     1 
ATOM   5387 C  CB    . LEU B 1 307 ? -17.070 28.003  -11.140 1.00 27.91 ? 299 LEU B CB    1 
ATOM   5388 C  CG    . LEU B 1 307 ? -16.932 27.719  -9.642  1.00 28.54 ? 299 LEU B CG    1 
ATOM   5389 C  CD1   . LEU B 1 307 ? -18.094 28.306  -8.873  1.00 29.34 ? 299 LEU B CD1   1 
ATOM   5390 C  CD2   . LEU B 1 307 ? -16.780 26.228  -9.362  1.00 28.91 ? 299 LEU B CD2   1 
ATOM   5391 N  N     . ALA B 1 308 ? -13.796 27.381  -11.063 1.00 27.98 ? 300 ALA B N     1 
ATOM   5392 C  CA    . ALA B 1 308 ? -12.796 26.322  -11.055 1.00 28.06 ? 300 ALA B CA    1 
ATOM   5393 C  C     . ALA B 1 308 ? -12.820 25.543  -9.745  1.00 28.25 ? 300 ALA B C     1 
ATOM   5394 O  O     . ALA B 1 308 ? -13.013 26.116  -8.669  1.00 28.25 ? 300 ALA B O     1 
ATOM   5395 C  CB    . ALA B 1 308 ? -11.420 26.893  -11.298 1.00 27.78 ? 300 ALA B CB    1 
ATOM   5396 N  N     . ILE B 1 309 ? -12.636 24.234  -9.842  1.00 28.43 ? 301 ILE B N     1 
ATOM   5397 C  CA    . ILE B 1 309 ? -12.357 23.431  -8.674  1.00 28.69 ? 301 ILE B CA    1 
ATOM   5398 C  C     . ILE B 1 309 ? -10.853 23.429  -8.424  1.00 29.15 ? 301 ILE B C     1 
ATOM   5399 O  O     . ILE B 1 309 ? -10.084 22.803  -9.163  1.00 28.80 ? 301 ILE B O     1 
ATOM   5400 C  CB    . ILE B 1 309 ? -12.880 21.984  -8.825  1.00 28.63 ? 301 ILE B CB    1 
ATOM   5401 C  CG1   . ILE B 1 309 ? -14.406 21.975  -8.979  1.00 28.78 ? 301 ILE B CG1   1 
ATOM   5402 C  CG2   . ILE B 1 309 ? -12.469 21.143  -7.635  1.00 28.31 ? 301 ILE B CG2   1 
ATOM   5403 C  CD1   . ILE B 1 309 ? -15.162 22.565  -7.795  1.00 29.20 ? 301 ILE B CD1   1 
ATOM   5404 N  N     . ASP B 1 310 ? -10.441 24.176  -7.405  1.00 29.79 ? 302 ASP B N     1 
ATOM   5405 C  CA    . ASP B 1 310 ? -9.044  24.270  -7.026  1.00 30.42 ? 302 ASP B CA    1 
ATOM   5406 C  C     . ASP B 1 310 ? -8.643  23.035  -6.242  1.00 31.19 ? 302 ASP B C     1 
ATOM   5407 O  O     . ASP B 1 310 ? -9.454  22.470  -5.498  1.00 30.96 ? 302 ASP B O     1 
ATOM   5408 C  CB    . ASP B 1 310 ? -8.812  25.525  -6.180  1.00 30.33 ? 302 ASP B CB    1 
ATOM   5409 C  CG    . ASP B 1 310 ? -7.340  25.907  -6.079  1.00 29.92 ? 302 ASP B CG    1 
ATOM   5410 O  OD1   . ASP B 1 310 ? -7.049  26.980  -5.515  1.00 29.35 ? 302 ASP B OD1   1 
ATOM   5411 O  OD2   . ASP B 1 310 ? -6.477  25.145  -6.565  1.00 29.87 ? 302 ASP B OD2   1 
ATOM   5412 N  N     . ASP B 1 311 ? -7.390  22.611  -6.428  1.00 32.21 ? 303 ASP B N     1 
ATOM   5413 C  CA    . ASP B 1 311 ? -6.810  21.494  -5.679  1.00 33.37 ? 303 ASP B CA    1 
ATOM   5414 C  C     . ASP B 1 311 ? -7.623  20.205  -5.822  1.00 34.23 ? 303 ASP B C     1 
ATOM   5415 O  O     . ASP B 1 311 ? -7.990  19.573  -4.827  1.00 34.38 ? 303 ASP B O     1 
ATOM   5416 C  CB    . ASP B 1 311 ? -6.625  21.871  -4.203  1.00 33.31 ? 303 ASP B CB    1 
ATOM   5417 C  CG    . ASP B 1 311 ? -5.791  23.130  -4.023  1.00 33.74 ? 303 ASP B CG    1 
ATOM   5418 O  OD1   . ASP B 1 311 ? -4.866  23.355  -4.835  1.00 33.86 ? 303 ASP B OD1   1 
ATOM   5419 O  OD2   . ASP B 1 311 ? -6.061  23.894  -3.073  1.00 33.94 ? 303 ASP B OD2   1 
ATOM   5420 N  N     . PHE B 1 312 ? -7.908  19.833  -7.069  1.00 35.35 ? 304 PHE B N     1 
ATOM   5421 C  CA    . PHE B 1 312 ? -8.581  18.576  -7.374  1.00 36.47 ? 304 PHE B CA    1 
ATOM   5422 C  C     . PHE B 1 312 ? -7.628  17.411  -7.138  1.00 37.50 ? 304 PHE B C     1 
ATOM   5423 O  O     . PHE B 1 312 ? -6.519  17.391  -7.665  1.00 37.48 ? 304 PHE B O     1 
ATOM   5424 C  CB    . PHE B 1 312 ? -9.065  18.575  -8.828  1.00 36.32 ? 304 PHE B CB    1 
ATOM   5425 C  CG    . PHE B 1 312 ? -10.050 17.481  -9.148  1.00 36.17 ? 304 PHE B CG    1 
ATOM   5426 C  CD1   . PHE B 1 312 ? -11.411 17.744  -9.172  1.00 36.12 ? 304 PHE B CD1   1 
ATOM   5427 C  CD2   . PHE B 1 312 ? -9.614  16.199  -9.455  1.00 35.91 ? 304 PHE B CD2   1 
ATOM   5428 C  CE1   . PHE B 1 312 ? -12.321 16.746  -9.477  1.00 35.84 ? 304 PHE B CE1   1 
ATOM   5429 C  CE2   . PHE B 1 312 ? -10.519 15.199  -9.754  1.00 35.89 ? 304 PHE B CE2   1 
ATOM   5430 C  CZ    . PHE B 1 312 ? -11.875 15.476  -9.768  1.00 36.11 ? 304 PHE B CZ    1 
ATOM   5431 N  N     . GLY B 1 313 ? -8.066  16.443  -6.343  1.00 38.86 ? 305 GLY B N     1 
ATOM   5432 C  CA    . GLY B 1 313 ? -7.212  15.332  -5.959  1.00 40.60 ? 305 GLY B CA    1 
ATOM   5433 C  C     . GLY B 1 313 ? -6.705  15.455  -4.536  1.00 41.94 ? 305 GLY B C     1 
ATOM   5434 O  O     . GLY B 1 313 ? -6.461  14.451  -3.870  1.00 42.08 ? 305 GLY B O     1 
ATOM   5435 N  N     . ALA B 1 314 ? -6.539  16.691  -4.068  1.00 43.38 ? 306 ALA B N     1 
ATOM   5436 C  CA    . ALA B 1 314 ? -6.131  16.938  -2.682  1.00 44.96 ? 306 ALA B CA    1 
ATOM   5437 C  C     . ALA B 1 314 ? -7.185  16.434  -1.709  1.00 46.10 ? 306 ALA B C     1 
ATOM   5438 O  O     . ALA B 1 314 ? -8.390  16.602  -1.938  1.00 46.36 ? 306 ALA B O     1 
ATOM   5439 C  CB    . ALA B 1 314 ? -5.873  18.417  -2.456  1.00 44.86 ? 306 ALA B CB    1 
ATOM   5440 N  N     . GLY B 1 315 ? -6.728  15.803  -0.629  1.00 47.29 ? 307 GLY B N     1 
ATOM   5441 C  CA    . GLY B 1 315 ? -7.618  15.349  0.434   1.00 48.83 ? 307 GLY B CA    1 
ATOM   5442 C  C     . GLY B 1 315 ? -8.545  14.222  0.010   1.00 49.87 ? 307 GLY B C     1 
ATOM   5443 O  O     . GLY B 1 315 ? -8.104  13.221  -0.565  1.00 50.05 ? 307 GLY B O     1 
ATOM   5444 N  N     . TYR B 1 316 ? -9.837  14.395  0.283   1.00 50.81 ? 308 TYR B N     1 
ATOM   5445 C  CA    . TYR B 1 316 ? -10.809 13.314  0.125   1.00 51.81 ? 308 TYR B CA    1 
ATOM   5446 C  C     . TYR B 1 316 ? -11.966 13.683  -0.815  1.00 52.16 ? 308 TYR B C     1 
ATOM   5447 O  O     . TYR B 1 316 ? -13.112 13.837  -0.380  1.00 52.31 ? 308 TYR B O     1 
ATOM   5448 C  CB    . TYR B 1 316 ? -11.336 12.832  1.505   1.00 52.07 ? 308 TYR B CB    1 
ATOM   5449 C  CG    . TYR B 1 316 ? -11.821 13.940  2.447   1.00 52.63 ? 308 TYR B CG    1 
ATOM   5450 C  CD1   . TYR B 1 316 ? -10.913 14.716  3.177   1.00 53.30 ? 308 TYR B CD1   1 
ATOM   5451 C  CD2   . TYR B 1 316 ? -13.187 14.173  2.640   1.00 52.88 ? 308 TYR B CD2   1 
ATOM   5452 C  CE1   . TYR B 1 316 ? -11.352 15.720  4.045   1.00 53.31 ? 308 TYR B CE1   1 
ATOM   5453 C  CE2   . TYR B 1 316 ? -13.635 15.172  3.507   1.00 53.17 ? 308 TYR B CE2   1 
ATOM   5454 C  CZ    . TYR B 1 316 ? -12.712 15.940  4.206   1.00 52.99 ? 308 TYR B CZ    1 
ATOM   5455 O  OH    . TYR B 1 316 ? -13.147 16.925  5.065   1.00 52.46 ? 308 TYR B OH    1 
ATOM   5456 N  N     . SER B 1 317 ? -11.656 13.825  -2.107  1.00 52.47 ? 309 SER B N     1 
ATOM   5457 C  CA    . SER B 1 317 ? -12.682 14.094  -3.130  1.00 52.67 ? 309 SER B CA    1 
ATOM   5458 C  C     . SER B 1 317 ? -12.201 13.696  -4.534  1.00 52.76 ? 309 SER B C     1 
ATOM   5459 O  O     . SER B 1 317 ? -11.006 13.469  -4.752  1.00 52.60 ? 309 SER B O     1 
ATOM   5460 C  CB    . SER B 1 317 ? -13.104 15.573  -3.115  1.00 52.74 ? 309 SER B CB    1 
ATOM   5461 O  OG    . SER B 1 317 ? -12.713 16.226  -1.914  1.00 52.89 ? 309 SER B OG    1 
ATOM   5462 N  N     . GLY B 1 318 ? -13.136 13.621  -5.481  1.00 52.86 ? 310 GLY B N     1 
ATOM   5463 C  CA    . GLY B 1 318 ? -12.811 13.195  -6.846  1.00 52.99 ? 310 GLY B CA    1 
ATOM   5464 C  C     . GLY B 1 318 ? -13.919 13.436  -7.862  1.00 53.01 ? 310 GLY B C     1 
ATOM   5465 O  O     . GLY B 1 318 ? -14.668 14.414  -7.761  1.00 53.04 ? 310 GLY B O     1 
ATOM   5466 N  N     . LEU B 1 319 ? -14.022 12.531  -8.840  1.00 52.89 ? 311 LEU B N     1 
ATOM   5467 C  CA    . LEU B 1 319 ? -14.923 12.711  -9.994  1.00 52.68 ? 311 LEU B CA    1 
ATOM   5468 C  C     . LEU B 1 319 ? -16.403 12.574  -9.622  1.00 52.52 ? 311 LEU B C     1 
ATOM   5469 O  O     . LEU B 1 319 ? -17.283 12.970  -10.389 1.00 52.45 ? 311 LEU B O     1 
ATOM   5470 C  CB    . LEU B 1 319 ? -14.574 11.717  -11.117 1.00 52.68 ? 311 LEU B CB    1 
ATOM   5471 C  CG    . LEU B 1 319 ? -13.163 11.746  -11.725 1.00 52.57 ? 311 LEU B CG    1 
ATOM   5472 C  CD1   . LEU B 1 319 ? -12.883 10.462  -12.490 1.00 52.39 ? 311 LEU B CD1   1 
ATOM   5473 C  CD2   . LEU B 1 319 ? -12.969 12.954  -12.626 1.00 52.45 ? 311 LEU B CD2   1 
ATOM   5474 N  N     . SER B 1 320 ? -16.668 12.005  -8.446  1.00 52.31 ? 312 SER B N     1 
ATOM   5475 C  CA    . SER B 1 320 ? -18.037 11.834  -7.951  1.00 52.03 ? 312 SER B CA    1 
ATOM   5476 C  C     . SER B 1 320 ? -18.720 13.181  -7.728  1.00 51.70 ? 312 SER B C     1 
ATOM   5477 O  O     . SER B 1 320 ? -19.950 13.286  -7.789  1.00 51.68 ? 312 SER B O     1 
ATOM   5478 C  CB    . SER B 1 320 ? -18.035 11.017  -6.655  1.00 52.18 ? 312 SER B CB    1 
ATOM   5479 O  OG    . SER B 1 320 ? -16.851 11.244  -5.905  1.00 52.36 ? 312 SER B OG    1 
ATOM   5480 N  N     . LEU B 1 321 ? -17.907 14.206  -7.470  1.00 51.19 ? 313 LEU B N     1 
ATOM   5481 C  CA    . LEU B 1 321 ? -18.369 15.593  -7.418  1.00 50.63 ? 313 LEU B CA    1 
ATOM   5482 C  C     . LEU B 1 321 ? -18.961 16.046  -8.761  1.00 50.05 ? 313 LEU B C     1 
ATOM   5483 O  O     . LEU B 1 321 ? -19.951 16.781  -8.796  1.00 50.03 ? 313 LEU B O     1 
ATOM   5484 C  CB    . LEU B 1 321 ? -17.207 16.517  -7.007  1.00 50.71 ? 313 LEU B CB    1 
ATOM   5485 C  CG    . LEU B 1 321 ? -17.386 18.039  -7.097  1.00 50.98 ? 313 LEU B CG    1 
ATOM   5486 C  CD1   . LEU B 1 321 ? -18.365 18.541  -6.041  1.00 51.52 ? 313 LEU B CD1   1 
ATOM   5487 C  CD2   . LEU B 1 321 ? -16.042 18.745  -6.960  1.00 50.83 ? 313 LEU B CD2   1 
ATOM   5488 N  N     . LEU B 1 322 ? -18.365 15.580  -9.860  1.00 49.29 ? 314 LEU B N     1 
ATOM   5489 C  CA    . LEU B 1 322 ? -18.757 16.020  -11.205 1.00 48.52 ? 314 LEU B CA    1 
ATOM   5490 C  C     . LEU B 1 322 ? -20.129 15.499  -11.620 1.00 48.00 ? 314 LEU B C     1 
ATOM   5491 O  O     . LEU B 1 322 ? -20.700 15.958  -12.611 1.00 48.05 ? 314 LEU B O     1 
ATOM   5492 C  CB    . LEU B 1 322 ? -17.705 15.617  -12.242 1.00 48.53 ? 314 LEU B CB    1 
ATOM   5493 C  CG    . LEU B 1 322 ? -16.254 16.019  -11.960 1.00 48.59 ? 314 LEU B CG    1 
ATOM   5494 C  CD1   . LEU B 1 322 ? -15.371 15.647  -13.132 1.00 48.70 ? 314 LEU B CD1   1 
ATOM   5495 C  CD2   . LEU B 1 322 ? -16.141 17.510  -11.656 1.00 48.72 ? 314 LEU B CD2   1 
ATOM   5496 N  N     . THR B 1 323 ? -20.651 14.539  -10.863 1.00 47.27 ? 315 THR B N     1 
ATOM   5497 C  CA    . THR B 1 323 ? -22.022 14.078  -11.049 1.00 46.55 ? 315 THR B CA    1 
ATOM   5498 C  C     . THR B 1 323 ? -23.007 15.176  -10.654 1.00 45.93 ? 315 THR B C     1 
ATOM   5499 O  O     . THR B 1 323 ? -24.019 15.389  -11.330 1.00 45.87 ? 315 THR B O     1 
ATOM   5500 C  CB    . THR B 1 323 ? -22.318 12.810  -10.211 1.00 46.77 ? 315 THR B CB    1 
ATOM   5501 O  OG1   . THR B 1 323 ? -21.150 11.976  -10.157 1.00 46.75 ? 315 THR B OG1   1 
ATOM   5502 C  CG2   . THR B 1 323 ? -23.486 12.024  -10.818 1.00 46.73 ? 315 THR B CG2   1 
ATOM   5503 N  N     . ARG B 1 324 ? -22.695 15.877  -9.562  1.00 45.04 ? 316 ARG B N     1 
ATOM   5504 C  CA    . ARG B 1 324 ? -23.575 16.914  -9.027  1.00 44.11 ? 316 ARG B CA    1 
ATOM   5505 C  C     . ARG B 1 324 ? -23.628 18.113  -9.972  1.00 43.13 ? 316 ARG B C     1 
ATOM   5506 O  O     . ARG B 1 324 ? -24.573 18.265  -10.751 1.00 43.24 ? 316 ARG B O     1 
ATOM   5507 C  CB    . ARG B 1 324 ? -23.107 17.361  -7.632  1.00 44.32 ? 316 ARG B CB    1 
ATOM   5508 C  CG    . ARG B 1 324 ? -22.411 16.278  -6.802  1.00 45.16 ? 316 ARG B CG    1 
ATOM   5509 C  CD    . ARG B 1 324 ? -23.400 15.278  -6.219  1.00 46.74 ? 316 ARG B CD    1 
ATOM   5510 N  NE    . ARG B 1 324 ? -22.720 14.098  -5.684  1.00 48.21 ? 316 ARG B NE    1 
ATOM   5511 C  CZ    . ARG B 1 324 ? -23.333 12.962  -5.356  1.00 48.94 ? 316 ARG B CZ    1 
ATOM   5512 N  NH1   . ARG B 1 324 ? -24.648 12.845  -5.507  1.00 49.37 ? 316 ARG B NH1   1 
ATOM   5513 N  NH2   . ARG B 1 324 ? -22.632 11.942  -4.878  1.00 48.98 ? 316 ARG B NH2   1 
ATOM   5514 N  N     . PHE B 1 325 ? -22.605 18.957  -9.902  1.00 41.70 ? 317 PHE B N     1 
ATOM   5515 C  CA    . PHE B 1 325 ? -22.484 20.090  -10.801 1.00 40.12 ? 317 PHE B CA    1 
ATOM   5516 C  C     . PHE B 1 325 ? -21.180 19.983  -11.583 1.00 38.91 ? 317 PHE B C     1 
ATOM   5517 O  O     . PHE B 1 325 ? -20.289 19.211  -11.216 1.00 38.75 ? 317 PHE B O     1 
ATOM   5518 C  CB    . PHE B 1 325 ? -22.537 21.408  -10.014 1.00 40.18 ? 317 PHE B CB    1 
ATOM   5519 C  CG    . PHE B 1 325 ? -21.182 21.948  -9.634  1.00 40.21 ? 317 PHE B CG    1 
ATOM   5520 C  CD1   . PHE B 1 325 ? -20.393 21.296  -8.685  1.00 40.33 ? 317 PHE B CD1   1 
ATOM   5521 C  CD2   . PHE B 1 325 ? -20.698 23.117  -10.216 1.00 39.81 ? 317 PHE B CD2   1 
ATOM   5522 C  CE1   . PHE B 1 325 ? -19.142 21.792  -8.338  1.00 40.06 ? 317 PHE B CE1   1 
ATOM   5523 C  CE2   . PHE B 1 325 ? -19.452 23.619  -9.871  1.00 39.79 ? 317 PHE B CE2   1 
ATOM   5524 C  CZ    . PHE B 1 325 ? -18.673 22.956  -8.929  1.00 40.08 ? 317 PHE B CZ    1 
ATOM   5525 N  N     . GLN B 1 326 ? -21.068 20.759  -12.656 1.00 37.25 ? 318 GLN B N     1 
ATOM   5526 C  CA    . GLN B 1 326 ? -19.876 20.731  -13.486 1.00 35.53 ? 318 GLN B CA    1 
ATOM   5527 C  C     . GLN B 1 326 ? -19.218 22.101  -13.546 1.00 34.09 ? 318 GLN B C     1 
ATOM   5528 O  O     . GLN B 1 326 ? -19.830 23.071  -13.999 1.00 33.89 ? 318 GLN B O     1 
ATOM   5529 C  CB    . GLN B 1 326 ? -20.206 20.228  -14.893 1.00 35.70 ? 318 GLN B CB    1 
ATOM   5530 C  CG    . GLN B 1 326 ? -20.654 18.762  -14.951 1.00 36.28 ? 318 GLN B CG    1 
ATOM   5531 C  CD    . GLN B 1 326 ? -22.150 18.591  -14.725 1.00 37.33 ? 318 GLN B CD    1 
ATOM   5532 O  OE1   . GLN B 1 326 ? -22.968 19.245  -15.376 1.00 38.14 ? 318 GLN B OE1   1 
ATOM   5533 N  NE2   . GLN B 1 326 ? -22.513 17.707  -13.801 1.00 37.67 ? 318 GLN B NE2   1 
ATOM   5534 N  N     . PRO B 1 327 ? -17.964 22.188  -13.073 1.00 32.64 ? 319 PRO B N     1 
ATOM   5535 C  CA    . PRO B 1 327 ? -17.190 23.418  -13.118 1.00 31.53 ? 319 PRO B CA    1 
ATOM   5536 C  C     . PRO B 1 327 ? -16.700 23.707  -14.529 1.00 30.58 ? 319 PRO B C     1 
ATOM   5537 O  O     . PRO B 1 327 ? -16.771 22.840  -15.397 1.00 30.31 ? 319 PRO B O     1 
ATOM   5538 C  CB    . PRO B 1 327 ? -16.005 23.109  -12.207 1.00 31.40 ? 319 PRO B CB    1 
ATOM   5539 C  CG    . PRO B 1 327 ? -15.822 21.654  -12.332 1.00 31.65 ? 319 PRO B CG    1 
ATOM   5540 C  CD    . PRO B 1 327 ? -17.201 21.084  -12.465 1.00 32.37 ? 319 PRO B CD    1 
ATOM   5541 N  N     . ASP B 1 328 ? -16.217 24.924  -14.750 1.00 29.67 ? 320 ASP B N     1 
ATOM   5542 C  CA    . ASP B 1 328 ? -15.648 25.310  -16.036 1.00 28.82 ? 320 ASP B CA    1 
ATOM   5543 C  C     . ASP B 1 328 ? -14.205 24.839  -16.148 1.00 28.10 ? 320 ASP B C     1 
ATOM   5544 O  O     . ASP B 1 328 ? -13.710 24.570  -17.245 1.00 27.79 ? 320 ASP B O     1 
ATOM   5545 C  CB    . ASP B 1 328 ? -15.713 26.830  -16.211 1.00 29.03 ? 320 ASP B CB    1 
ATOM   5546 C  CG    . ASP B 1 328 ? -17.142 27.347  -16.311 1.00 29.39 ? 320 ASP B CG    1 
ATOM   5547 O  OD1   . ASP B 1 328 ? -17.799 27.092  -17.349 1.00 30.23 ? 320 ASP B OD1   1 
ATOM   5548 O  OD2   . ASP B 1 328 ? -17.603 28.011  -15.354 1.00 28.95 ? 320 ASP B OD2   1 
ATOM   5549 N  N     . LYS B 1 329 ? -13.537 24.734  -15.002 1.00 27.23 ? 321 LYS B N     1 
ATOM   5550 C  CA    . LYS B 1 329 ? -12.128 24.384  -14.961 1.00 26.49 ? 321 LYS B CA    1 
ATOM   5551 C  C     . LYS B 1 329 ? -11.822 23.489  -13.769 1.00 26.16 ? 321 LYS B C     1 
ATOM   5552 O  O     . LYS B 1 329 ? -12.450 23.600  -12.717 1.00 26.06 ? 321 LYS B O     1 
ATOM   5553 C  CB    . LYS B 1 329 ? -11.266 25.649  -14.904 1.00 26.42 ? 321 LYS B CB    1 
ATOM   5554 C  CG    . LYS B 1 329 ? -9.767  25.393  -15.001 1.00 26.20 ? 321 LYS B CG    1 
ATOM   5555 C  CD    . LYS B 1 329 ? -8.963  26.629  -14.649 1.00 26.19 ? 321 LYS B CD    1 
ATOM   5556 C  CE    . LYS B 1 329 ? -8.697  27.491  -15.868 1.00 26.52 ? 321 LYS B CE    1 
ATOM   5557 N  NZ    . LYS B 1 329 ? -7.776  28.621  -15.544 1.00 27.72 ? 321 LYS B NZ    1 
ATOM   5558 N  N     . ILE B 1 330 ? -10.858 22.597  -13.945 1.00 25.75 ? 322 ILE B N     1 
ATOM   5559 C  CA    . ILE B 1 330 ? -10.386 21.758  -12.862 1.00 25.48 ? 322 ILE B CA    1 
ATOM   5560 C  C     . ILE B 1 330 ? -8.874  21.893  -12.707 1.00 25.33 ? 322 ILE B C     1 
ATOM   5561 O  O     . ILE B 1 330 ? -8.129  21.779  -13.676 1.00 25.27 ? 322 ILE B O     1 
ATOM   5562 C  CB    . ILE B 1 330 ? -10.790 20.279  -13.086 1.00 25.54 ? 322 ILE B CB    1 
ATOM   5563 C  CG1   . ILE B 1 330 ? -12.245 20.065  -12.649 1.00 25.67 ? 322 ILE B CG1   1 
ATOM   5564 C  CG2   . ILE B 1 330 ? -9.855  19.330  -12.342 1.00 25.40 ? 322 ILE B CG2   1 
ATOM   5565 C  CD1   . ILE B 1 330 ? -12.739 18.647  -12.815 1.00 26.21 ? 322 ILE B CD1   1 
ATOM   5566 N  N     . LYS B 1 331 ? -8.433  22.187  -11.490 1.00 25.18 ? 323 LYS B N     1 
ATOM   5567 C  CA    . LYS B 1 331 ? -7.012  22.281  -11.198 1.00 25.03 ? 323 LYS B CA    1 
ATOM   5568 C  C     . LYS B 1 331 ? -6.543  21.059  -10.428 1.00 25.14 ? 323 LYS B C     1 
ATOM   5569 O  O     . LYS B 1 331 ? -6.845  20.908  -9.249  1.00 25.06 ? 323 LYS B O     1 
ATOM   5570 C  CB    . LYS B 1 331 ? -6.702  23.550  -10.402 1.00 24.90 ? 323 LYS B CB    1 
ATOM   5571 C  CG    . LYS B 1 331 ? -7.224  24.823  -11.032 1.00 24.46 ? 323 LYS B CG    1 
ATOM   5572 C  CD    . LYS B 1 331 ? -6.747  26.042  -10.278 1.00 23.80 ? 323 LYS B CD    1 
ATOM   5573 C  CE    . LYS B 1 331 ? -5.460  26.588  -10.864 1.00 23.40 ? 323 LYS B CE    1 
ATOM   5574 N  NZ    . LYS B 1 331 ? -4.991  27.802  -10.144 1.00 23.05 ? 323 LYS B NZ    1 
ATOM   5575 N  N     . VAL B 1 332 ? -5.810  20.186  -11.107 1.00 25.36 ? 324 VAL B N     1 
ATOM   5576 C  CA    . VAL B 1 332 ? -5.218  19.016  -10.469 1.00 25.56 ? 324 VAL B CA    1 
ATOM   5577 C  C     . VAL B 1 332 ? -4.174  19.436  -9.430  1.00 25.69 ? 324 VAL B C     1 
ATOM   5578 O  O     . VAL B 1 332 ? -3.223  20.153  -9.744  1.00 25.49 ? 324 VAL B O     1 
ATOM   5579 C  CB    . VAL B 1 332 ? -4.568  18.067  -11.508 1.00 25.56 ? 324 VAL B CB    1 
ATOM   5580 C  CG1   . VAL B 1 332 ? -4.025  16.822  -10.824 1.00 25.81 ? 324 VAL B CG1   1 
ATOM   5581 C  CG2   . VAL B 1 332 ? -5.570  17.689  -12.586 1.00 25.24 ? 324 VAL B CG2   1 
ATOM   5582 N  N     . ASP B 1 333 ? -4.372  18.986  -8.193  1.00 26.11 ? 325 ASP B N     1 
ATOM   5583 C  CA    . ASP B 1 333 ? -3.528  19.377  -7.072  1.00 26.62 ? 325 ASP B CA    1 
ATOM   5584 C  C     . ASP B 1 333 ? -2.091  18.916  -7.262  1.00 26.88 ? 325 ASP B C     1 
ATOM   5585 O  O     . ASP B 1 333 ? -1.828  17.962  -7.995  1.00 27.02 ? 325 ASP B O     1 
ATOM   5586 C  CB    . ASP B 1 333 ? -4.084  18.809  -5.769  1.00 26.71 ? 325 ASP B CB    1 
ATOM   5587 C  CG    . ASP B 1 333 ? -3.432  19.415  -4.545  1.00 27.44 ? 325 ASP B CG    1 
ATOM   5588 O  OD1   . ASP B 1 333 ? -3.668  20.612  -4.271  1.00 27.58 ? 325 ASP B OD1   1 
ATOM   5589 O  OD2   . ASP B 1 333 ? -2.684  18.694  -3.852  1.00 28.27 ? 325 ASP B OD2   1 
ATOM   5590 N  N     . ALA B 1 334 ? -1.167  19.597  -6.588  1.00 27.25 ? 326 ALA B N     1 
ATOM   5591 C  CA    . ALA B 1 334 ? 0.257   19.284  -6.685  1.00 27.68 ? 326 ALA B CA    1 
ATOM   5592 C  C     . ALA B 1 334 ? 0.586   17.890  -6.141  1.00 27.94 ? 326 ALA B C     1 
ATOM   5593 O  O     . ALA B 1 334 ? 1.534   17.258  -6.590  1.00 27.98 ? 326 ALA B O     1 
ATOM   5594 C  CB    . ALA B 1 334 ? 1.083   20.345  -5.975  1.00 27.56 ? 326 ALA B CB    1 
ATOM   5595 N  N     . GLU B 1 335 ? -0.220  17.415  -5.194  1.00 28.39 ? 327 GLU B N     1 
ATOM   5596 C  CA    . GLU B 1 335 ? -0.046  16.077  -4.619  1.00 28.88 ? 327 GLU B CA    1 
ATOM   5597 C  C     . GLU B 1 335 ? -0.079  14.984  -5.686  1.00 28.79 ? 327 GLU B C     1 
ATOM   5598 O  O     . GLU B 1 335 ? 0.606   13.972  -5.567  1.00 28.92 ? 327 GLU B O     1 
ATOM   5599 C  CB    . GLU B 1 335 ? -1.128  15.803  -3.576  1.00 29.18 ? 327 GLU B CB    1 
ATOM   5600 C  CG    . GLU B 1 335 ? -0.632  15.083  -2.330  1.00 30.79 ? 327 GLU B CG    1 
ATOM   5601 C  CD    . GLU B 1 335 ? -0.335  16.040  -1.181  1.00 33.15 ? 327 GLU B CD    1 
ATOM   5602 O  OE1   . GLU B 1 335 ? 0.434   17.011  -1.388  1.00 33.52 ? 327 GLU B OE1   1 
ATOM   5603 O  OE2   . GLU B 1 335 ? -0.871  15.818  -0.068  1.00 33.90 ? 327 GLU B OE2   1 
ATOM   5604 N  N     . LEU B 1 336 ? -0.885  15.192  -6.723  1.00 28.83 ? 328 LEU B N     1 
ATOM   5605 C  CA    . LEU B 1 336 ? -0.968  14.247  -7.834  1.00 28.73 ? 328 LEU B CA    1 
ATOM   5606 C  C     . LEU B 1 336 ? 0.129   14.485  -8.865  1.00 28.71 ? 328 LEU B C     1 
ATOM   5607 O  O     . LEU B 1 336 ? 0.573   13.558  -9.535  1.00 28.88 ? 328 LEU B O     1 
ATOM   5608 C  CB    . LEU B 1 336 ? -2.342  14.320  -8.502  1.00 28.64 ? 328 LEU B CB    1 
ATOM   5609 C  CG    . LEU B 1 336 ? -3.484  13.605  -7.782  1.00 28.19 ? 328 LEU B CG    1 
ATOM   5610 C  CD1   . LEU B 1 336 ? -4.798  13.846  -8.503  1.00 28.02 ? 328 LEU B CD1   1 
ATOM   5611 C  CD2   . LEU B 1 336 ? -3.199  12.117  -7.668  1.00 27.69 ? 328 LEU B CD2   1 
ATOM   5612 N  N     . VAL B 1 337 ? 0.553   15.735  -8.994  1.00 28.76 ? 329 VAL B N     1 
ATOM   5613 C  CA    . VAL B 1 337 ? 1.630   16.090  -9.912  1.00 28.88 ? 329 VAL B CA    1 
ATOM   5614 C  C     . VAL B 1 337 ? 3.004   15.673  -9.349  1.00 28.95 ? 329 VAL B C     1 
ATOM   5615 O  O     . VAL B 1 337 ? 3.918   15.335  -10.107 1.00 28.96 ? 329 VAL B O     1 
ATOM   5616 C  CB    . VAL B 1 337 ? 1.603   17.607  -10.246 1.00 29.04 ? 329 VAL B CB    1 
ATOM   5617 C  CG1   . VAL B 1 337 ? 2.814   18.010  -11.083 1.00 28.77 ? 329 VAL B CG1   1 
ATOM   5618 C  CG2   . VAL B 1 337 ? 0.309   17.964  -10.970 1.00 28.72 ? 329 VAL B CG2   1 
ATOM   5619 N  N     . ARG B 1 338 ? 3.122   15.666  -8.019  1.00 28.97 ? 330 ARG B N     1 
ATOM   5620 C  CA    . ARG B 1 338 ? 4.346   15.226  -7.340  1.00 29.03 ? 330 ARG B CA    1 
ATOM   5621 C  C     . ARG B 1 338 ? 4.769   13.831  -7.779  1.00 28.87 ? 330 ARG B C     1 
ATOM   5622 O  O     . ARG B 1 338 ? 4.008   12.870  -7.638  1.00 28.84 ? 330 ARG B O     1 
ATOM   5623 C  CB    . ARG B 1 338 ? 4.158   15.233  -5.816  1.00 29.20 ? 330 ARG B CB    1 
ATOM   5624 C  CG    . ARG B 1 338 ? 4.304   16.584  -5.158  1.00 29.92 ? 330 ARG B CG    1 
ATOM   5625 C  CD    . ARG B 1 338 ? 5.580   17.309  -5.586  1.00 31.13 ? 330 ARG B CD    1 
ATOM   5626 N  NE    . ARG B 1 338 ? 5.368   18.754  -5.573  1.00 31.57 ? 330 ARG B NE    1 
ATOM   5627 C  CZ    . ARG B 1 338 ? 5.289   19.512  -6.661  1.00 31.44 ? 330 ARG B CZ    1 
ATOM   5628 N  NH1   . ARG B 1 338 ? 5.458   18.976  -7.868  1.00 30.58 ? 330 ARG B NH1   1 
ATOM   5629 N  NH2   . ARG B 1 338 ? 5.057   20.815  -6.543  1.00 31.49 ? 330 ARG B NH2   1 
ATOM   5630 N  N     . ASP B 1 339 ? 5.991   13.727  -8.298  1.00 28.69 ? 331 ASP B N     1 
ATOM   5631 C  CA    . ASP B 1 339 ? 6.592   12.436  -8.647  1.00 28.60 ? 331 ASP B CA    1 
ATOM   5632 C  C     . ASP B 1 339 ? 5.660   11.567  -9.496  1.00 28.09 ? 331 ASP B C     1 
ATOM   5633 O  O     . ASP B 1 339 ? 5.543   10.356  -9.281  1.00 27.99 ? 331 ASP B O     1 
ATOM   5634 C  CB    . ASP B 1 339 ? 7.040   11.686  -7.385  1.00 28.96 ? 331 ASP B CB    1 
ATOM   5635 C  CG    . ASP B 1 339 ? 8.226   12.359  -6.690  1.00 30.04 ? 331 ASP B CG    1 
ATOM   5636 O  OD1   . ASP B 1 339 ? 8.891   13.221  -7.322  1.00 29.74 ? 331 ASP B OD1   1 
ATOM   5637 O  OD2   . ASP B 1 339 ? 8.489   12.023  -5.509  1.00 31.18 ? 331 ASP B OD2   1 
ATOM   5638 N  N     . ILE B 1 340 ? 4.999   12.203  -10.459 1.00 27.41 ? 332 ILE B N     1 
ATOM   5639 C  CA    . ILE B 1 340 ? 4.135   11.508  -11.396 1.00 26.73 ? 332 ILE B CA    1 
ATOM   5640 C  C     . ILE B 1 340 ? 4.968   10.668  -12.370 1.00 26.50 ? 332 ILE B C     1 
ATOM   5641 O  O     . ILE B 1 340 ? 4.468   9.725   -12.977 1.00 26.58 ? 332 ILE B O     1 
ATOM   5642 C  CB    . ILE B 1 340 ? 3.230   12.511  -12.174 1.00 26.54 ? 332 ILE B CB    1 
ATOM   5643 C  CG1   . ILE B 1 340 ? 2.155   11.772  -12.973 1.00 25.97 ? 332 ILE B CG1   1 
ATOM   5644 C  CG2   . ILE B 1 340 ? 4.067   13.420  -13.065 1.00 26.25 ? 332 ILE B CG2   1 
ATOM   5645 C  CD1   . ILE B 1 340 ? 1.084   12.663  -13.515 1.00 25.24 ? 332 ILE B CD1   1 
ATOM   5646 N  N     . HIS B 1 341 ? 6.254   10.993  -12.473 1.00 26.12 ? 333 HIS B N     1 
ATOM   5647 C  CA    . HIS B 1 341 ? 7.148   10.329  -13.411 1.00 25.89 ? 333 HIS B CA    1 
ATOM   5648 C  C     . HIS B 1 341 ? 7.534   8.919   -12.963 1.00 25.27 ? 333 HIS B C     1 
ATOM   5649 O  O     . HIS B 1 341 ? 7.942   8.097   -13.779 1.00 25.27 ? 333 HIS B O     1 
ATOM   5650 C  CB    . HIS B 1 341 ? 8.402   11.182  -13.657 1.00 26.26 ? 333 HIS B CB    1 
ATOM   5651 C  CG    . HIS B 1 341 ? 9.258   11.372  -12.443 1.00 27.36 ? 333 HIS B CG    1 
ATOM   5652 N  ND1   . HIS B 1 341 ? 8.830   12.063  -11.328 1.00 28.39 ? 333 HIS B ND1   1 
ATOM   5653 C  CD2   . HIS B 1 341 ? 10.528  10.984  -12.179 1.00 28.41 ? 333 HIS B CD2   1 
ATOM   5654 C  CE1   . HIS B 1 341 ? 9.793   12.075  -10.423 1.00 29.01 ? 333 HIS B CE1   1 
ATOM   5655 N  NE2   . HIS B 1 341 ? 10.835  11.428  -10.915 1.00 29.38 ? 333 HIS B NE2   1 
ATOM   5656 N  N     . ILE B 1 342 ? 7.390   8.643   -11.668 1.00 24.56 ? 334 ILE B N     1 
ATOM   5657 C  CA    . ILE B 1 342 ? 7.720   7.324   -11.123 1.00 24.00 ? 334 ILE B CA    1 
ATOM   5658 C  C     . ILE B 1 342 ? 6.490   6.571   -10.605 1.00 23.83 ? 334 ILE B C     1 
ATOM   5659 O  O     . ILE B 1 342 ? 6.594   5.417   -10.183 1.00 23.75 ? 334 ILE B O     1 
ATOM   5660 C  CB    . ILE B 1 342 ? 8.757   7.417   -9.986  1.00 23.97 ? 334 ILE B CB    1 
ATOM   5661 C  CG1   . ILE B 1 342 ? 8.188   8.203   -8.803  1.00 23.69 ? 334 ILE B CG1   1 
ATOM   5662 C  CG2   . ILE B 1 342 ? 10.056  8.036   -10.492 1.00 23.90 ? 334 ILE B CG2   1 
ATOM   5663 C  CD1   . ILE B 1 342 ? 8.930   7.983   -7.515  1.00 23.57 ? 334 ILE B CD1   1 
ATOM   5664 N  N     . SER B 1 343 ? 5.333   7.225   -10.635 1.00 23.41 ? 335 SER B N     1 
ATOM   5665 C  CA    . SER B 1 343 ? 4.120   6.651   -10.057 1.00 23.20 ? 335 SER B CA    1 
ATOM   5666 C  C     . SER B 1 343 ? 3.085   6.316   -11.123 1.00 23.05 ? 335 SER B C     1 
ATOM   5667 O  O     . SER B 1 343 ? 2.481   7.207   -11.712 1.00 23.09 ? 335 SER B O     1 
ATOM   5668 C  CB    . SER B 1 343 ? 3.519   7.597   -9.014  1.00 23.09 ? 335 SER B CB    1 
ATOM   5669 O  OG    . SER B 1 343 ? 2.337   7.054   -8.460  1.00 23.04 ? 335 SER B OG    1 
ATOM   5670 N  N     . GLY B 1 344 ? 2.880   5.020   -11.355 1.00 22.87 ? 336 GLY B N     1 
ATOM   5671 C  CA    . GLY B 1 344 ? 1.904   4.553   -12.334 1.00 22.50 ? 336 GLY B CA    1 
ATOM   5672 C  C     . GLY B 1 344 ? 0.490   4.759   -11.854 1.00 22.42 ? 336 GLY B C     1 
ATOM   5673 O  O     . GLY B 1 344 ? -0.438  4.886   -12.656 1.00 22.53 ? 336 GLY B O     1 
ATOM   5674 N  N     . THR B 1 345 ? 0.329   4.798   -10.536 1.00 22.27 ? 337 THR B N     1 
ATOM   5675 C  CA    . THR B 1 345 ? -0.955  5.069   -9.916  1.00 22.10 ? 337 THR B CA    1 
ATOM   5676 C  C     . THR B 1 345 ? -1.413  6.491   -10.223 1.00 22.03 ? 337 THR B C     1 
ATOM   5677 O  O     . THR B 1 345 ? -2.554  6.710   -10.639 1.00 22.20 ? 337 THR B O     1 
ATOM   5678 C  CB    . THR B 1 345 ? -0.883  4.865   -8.400  1.00 22.19 ? 337 THR B CB    1 
ATOM   5679 O  OG1   . THR B 1 345 ? -0.237  3.617   -8.119  1.00 22.43 ? 337 THR B OG1   1 
ATOM   5680 C  CG2   . THR B 1 345 ? -2.281  4.861   -7.790  1.00 22.34 ? 337 THR B CG2   1 
ATOM   5681 N  N     . LYS B 1 346 ? -0.510  7.451   -10.039 1.00 21.64 ? 338 LYS B N     1 
ATOM   5682 C  CA    . LYS B 1 346 ? -0.801  8.846   -10.343 1.00 21.35 ? 338 LYS B CA    1 
ATOM   5683 C  C     . LYS B 1 346 ? -0.978  9.048   -11.835 1.00 20.90 ? 338 LYS B C     1 
ATOM   5684 O  O     . LYS B 1 346 ? -1.856  9.784   -12.269 1.00 20.70 ? 338 LYS B O     1 
ATOM   5685 C  CB    . LYS B 1 346 ? 0.306   9.756   -9.810  1.00 21.44 ? 338 LYS B CB    1 
ATOM   5686 C  CG    . LYS B 1 346 ? 0.344   9.844   -8.291  1.00 21.79 ? 338 LYS B CG    1 
ATOM   5687 C  CD    . LYS B 1 346 ? 1.509   10.693  -7.816  1.00 22.72 ? 338 LYS B CD    1 
ATOM   5688 C  CE    . LYS B 1 346 ? 1.519   10.810  -6.303  1.00 22.71 ? 338 LYS B CE    1 
ATOM   5689 N  NZ    . LYS B 1 346 ? 2.515   11.815  -5.843  1.00 24.03 ? 338 LYS B NZ    1 
ATOM   5690 N  N     . GLN B 1 347 ? -0.150  8.367   -12.617 1.00 20.61 ? 339 GLN B N     1 
ATOM   5691 C  CA    . GLN B 1 347 ? -0.268  8.390   -14.066 1.00 20.16 ? 339 GLN B CA    1 
ATOM   5692 C  C     . GLN B 1 347 ? -1.670  7.993   -14.510 1.00 20.12 ? 339 GLN B C     1 
ATOM   5693 O  O     . GLN B 1 347 ? -2.313  8.715   -15.266 1.00 19.85 ? 339 GLN B O     1 
ATOM   5694 C  CB    . GLN B 1 347 ? 0.776   7.475   -14.694 1.00 20.00 ? 339 GLN B CB    1 
ATOM   5695 C  CG    . GLN B 1 347 ? 2.169   8.087   -14.733 1.00 19.35 ? 339 GLN B CG    1 
ATOM   5696 C  CD    . GLN B 1 347 ? 3.251   7.074   -15.038 1.00 18.40 ? 339 GLN B CD    1 
ATOM   5697 O  OE1   . GLN B 1 347 ? 2.984   6.008   -15.590 1.00 18.07 ? 339 GLN B OE1   1 
ATOM   5698 N  NE2   . GLN B 1 347 ? 4.489   7.410   -14.688 1.00 18.26 ? 339 GLN B NE2   1 
ATOM   5699 N  N     . ALA B 1 348 ? -2.153  6.867   -13.989 1.00 20.24 ? 340 ALA B N     1 
ATOM   5700 C  CA    . ALA B 1 348 ? -3.483  6.358   -14.322 1.00 20.20 ? 340 ALA B CA    1 
ATOM   5701 C  C     . ALA B 1 348 ? -4.598  7.296   -13.848 1.00 20.30 ? 340 ALA B C     1 
ATOM   5702 O  O     . ALA B 1 348 ? -5.554  7.551   -14.581 1.00 20.10 ? 340 ALA B O     1 
ATOM   5703 C  CB    . ALA B 1 348 ? -3.675  4.968   -13.745 1.00 20.11 ? 340 ALA B CB    1 
ATOM   5704 N  N     . ILE B 1 349 ? -4.465  7.799   -12.619 1.00 20.39 ? 341 ILE B N     1 
ATOM   5705 C  CA    . ILE B 1 349 ? -5.438  8.732   -12.050 1.00 20.32 ? 341 ILE B CA    1 
ATOM   5706 C  C     . ILE B 1 349 ? -5.550  9.998   -12.894 1.00 20.36 ? 341 ILE B C     1 
ATOM   5707 O  O     . ILE B 1 349 ? -6.649  10.406  -13.270 1.00 20.78 ? 341 ILE B O     1 
ATOM   5708 C  CB    . ILE B 1 349 ? -5.078  9.119   -10.584 1.00 20.30 ? 341 ILE B CB    1 
ATOM   5709 C  CG1   . ILE B 1 349 ? -5.300  7.936   -9.640  1.00 20.31 ? 341 ILE B CG1   1 
ATOM   5710 C  CG2   . ILE B 1 349 ? -5.898  10.327  -10.124 1.00 19.88 ? 341 ILE B CG2   1 
ATOM   5711 C  CD1   . ILE B 1 349 ? -4.861  8.203   -8.196  1.00 20.17 ? 341 ILE B CD1   1 
ATOM   5712 N  N     . VAL B 1 350 ? -4.408  10.606  -13.198 1.00 20.29 ? 342 VAL B N     1 
ATOM   5713 C  CA    . VAL B 1 350 ? -4.380  11.876  -13.919 1.00 20.33 ? 342 VAL B CA    1 
ATOM   5714 C  C     . VAL B 1 350 ? -4.847  11.717  -15.364 1.00 20.35 ? 342 VAL B C     1 
ATOM   5715 O  O     . VAL B 1 350 ? -5.640  12.518  -15.854 1.00 20.80 ? 342 VAL B O     1 
ATOM   5716 C  CB    . VAL B 1 350 ? -2.968  12.528  -13.881 1.00 20.30 ? 342 VAL B CB    1 
ATOM   5717 C  CG1   . VAL B 1 350 ? -2.904  13.744  -14.805 1.00 19.99 ? 342 VAL B CG1   1 
ATOM   5718 C  CG2   . VAL B 1 350 ? -2.603  12.915  -12.454 1.00 20.13 ? 342 VAL B CG2   1 
ATOM   5719 N  N     . ALA B 1 351 ? -4.381  10.662  -16.027 1.00 20.35 ? 343 ALA B N     1 
ATOM   5720 C  CA    . ALA B 1 351 ? -4.808  10.369  -17.398 1.00 20.58 ? 343 ALA B CA    1 
ATOM   5721 C  C     . ALA B 1 351 ? -6.317  10.209  -17.473 1.00 20.79 ? 343 ALA B C     1 
ATOM   5722 O  O     . ALA B 1 351 ? -6.942  10.586  -18.460 1.00 20.78 ? 343 ALA B O     1 
ATOM   5723 C  CB    . ALA B 1 351 ? -4.121  9.121   -17.915 1.00 20.35 ? 343 ALA B CB    1 
ATOM   5724 N  N     . SER B 1 352 ? -6.896  9.661   -16.412 1.00 21.21 ? 344 SER B N     1 
ATOM   5725 C  CA    . SER B 1 352 ? -8.325  9.407   -16.360 1.00 21.63 ? 344 SER B CA    1 
ATOM   5726 C  C     . SER B 1 352 ? -9.101  10.708  -16.208 1.00 21.63 ? 344 SER B C     1 
ATOM   5727 O  O     . SER B 1 352 ? -10.104 10.925  -16.893 1.00 21.82 ? 344 SER B O     1 
ATOM   5728 C  CB    . SER B 1 352 ? -8.653  8.462   -15.207 1.00 21.63 ? 344 SER B CB    1 
ATOM   5729 O  OG    . SER B 1 352 ? -9.913  7.850   -15.398 1.00 22.42 ? 344 SER B OG    1 
ATOM   5730 N  N     . VAL B 1 353 ? -8.623  11.571  -15.314 1.00 21.49 ? 345 VAL B N     1 
ATOM   5731 C  CA    . VAL B 1 353 ? -9.239  12.877  -15.069 1.00 21.29 ? 345 VAL B CA    1 
ATOM   5732 C  C     . VAL B 1 353 ? -9.189  13.749  -16.321 1.00 21.17 ? 345 VAL B C     1 
ATOM   5733 O  O     . VAL B 1 353 ? -10.166 14.403  -16.666 1.00 21.12 ? 345 VAL B O     1 
ATOM   5734 C  CB    . VAL B 1 353 ? -8.549  13.610  -13.884 1.00 21.25 ? 345 VAL B CB    1 
ATOM   5735 C  CG1   . VAL B 1 353 ? -8.967  15.061  -13.825 1.00 21.14 ? 345 VAL B CG1   1 
ATOM   5736 C  CG2   . VAL B 1 353 ? -8.863  12.907  -12.570 1.00 21.56 ? 345 VAL B CG2   1 
ATOM   5737 N  N     . VAL B 1 354 ? -8.050  13.732  -17.004 1.00 21.27 ? 346 VAL B N     1 
ATOM   5738 C  CA    . VAL B 1 354 ? -7.886  14.466  -18.258 1.00 21.49 ? 346 VAL B CA    1 
ATOM   5739 C  C     . VAL B 1 354 ? -8.918  14.028  -19.297 1.00 21.57 ? 346 VAL B C     1 
ATOM   5740 O  O     . VAL B 1 354 ? -9.579  14.863  -19.921 1.00 21.71 ? 346 VAL B O     1 
ATOM   5741 C  CB    . VAL B 1 354 ? -6.461  14.283  -18.834 1.00 21.42 ? 346 VAL B CB    1 
ATOM   5742 C  CG1   . VAL B 1 354 ? -6.400  14.745  -20.288 1.00 21.55 ? 346 VAL B CG1   1 
ATOM   5743 C  CG2   . VAL B 1 354 ? -5.460  15.032  -17.995 1.00 21.15 ? 346 VAL B CG2   1 
ATOM   5744 N  N     . ARG B 1 355 ? -9.069  12.717  -19.457 1.00 21.72 ? 347 ARG B N     1 
ATOM   5745 C  CA    . ARG B 1 355 ? -10.016 12.162  -20.409 1.00 22.07 ? 347 ARG B CA    1 
ATOM   5746 C  C     . ARG B 1 355 ? -11.450 12.490  -20.006 1.00 21.86 ? 347 ARG B C     1 
ATOM   5747 O  O     . ARG B 1 355 ? -12.274 12.850  -20.850 1.00 21.69 ? 347 ARG B O     1 
ATOM   5748 C  CB    . ARG B 1 355 ? -9.826  10.651  -20.526 1.00 22.25 ? 347 ARG B CB    1 
ATOM   5749 C  CG    . ARG B 1 355 ? -10.344 10.051  -21.821 1.00 24.01 ? 347 ARG B CG    1 
ATOM   5750 C  CD    . ARG B 1 355 ? -9.865  10.833  -23.023 1.00 26.70 ? 347 ARG B CD    1 
ATOM   5751 N  NE    . ARG B 1 355 ? -9.565  9.963   -24.158 1.00 29.21 ? 347 ARG B NE    1 
ATOM   5752 C  CZ    . ARG B 1 355 ? -9.177  10.401  -25.355 1.00 30.14 ? 347 ARG B CZ    1 
ATOM   5753 N  NH1   . ARG B 1 355 ? -9.065  11.707  -25.586 1.00 30.62 ? 347 ARG B NH1   1 
ATOM   5754 N  NH2   . ARG B 1 355 ? -8.915  9.535   -26.326 1.00 30.51 ? 347 ARG B NH2   1 
ATOM   5755 N  N     . CYS B 1 356 ? -11.730 12.388  -18.707 1.00 21.86 ? 348 CYS B N     1 
ATOM   5756 C  CA    . CYS B 1 356 ? -13.056 12.671  -18.167 1.00 21.98 ? 348 CYS B CA    1 
ATOM   5757 C  C     . CYS B 1 356 ? -13.473 14.109  -18.451 1.00 22.16 ? 348 CYS B C     1 
ATOM   5758 O  O     . CYS B 1 356 ? -14.592 14.365  -18.893 1.00 22.02 ? 348 CYS B O     1 
ATOM   5759 C  CB    . CYS B 1 356 ? -13.087 12.407  -16.660 1.00 22.03 ? 348 CYS B CB    1 
ATOM   5760 S  SG    . CYS B 1 356 ? -14.745 12.395  -15.931 1.00 21.77 ? 348 CYS B SG    1 
ATOM   5761 N  N     . CYS B 1 357 ? -12.556 15.039  -18.217 1.00 22.35 ? 349 CYS B N     1 
ATOM   5762 C  CA    . CYS B 1 357 ? -12.843 16.455  -18.378 1.00 22.69 ? 349 CYS B CA    1 
ATOM   5763 C  C     . CYS B 1 357 ? -12.976 16.858  -19.842 1.00 22.79 ? 349 CYS B C     1 
ATOM   5764 O  O     . CYS B 1 357 ? -13.702 17.799  -20.171 1.00 22.78 ? 349 CYS B O     1 
ATOM   5765 C  CB    . CYS B 1 357 ? -11.773 17.284  -17.701 1.00 22.67 ? 349 CYS B CB    1 
ATOM   5766 S  SG    . CYS B 1 357 ? -11.770 17.134  -15.917 1.00 23.22 ? 349 CYS B SG    1 
ATOM   5767 N  N     . GLU B 1 358 ? -12.273 16.141  -20.715 1.00 22.82 ? 350 GLU B N     1 
ATOM   5768 C  CA    . GLU B 1 358 ? -12.421 16.320  -22.151 1.00 22.74 ? 350 GLU B CA    1 
ATOM   5769 C  C     . GLU B 1 358 ? -13.837 15.943  -22.590 1.00 22.57 ? 350 GLU B C     1 
ATOM   5770 O  O     . GLU B 1 358 ? -14.465 16.663  -23.366 1.00 22.79 ? 350 GLU B O     1 
ATOM   5771 C  CB    . GLU B 1 358 ? -11.389 15.479  -22.899 1.00 22.96 ? 350 GLU B CB    1 
ATOM   5772 C  CG    . GLU B 1 358 ? -11.359 15.703  -24.398 1.00 23.98 ? 350 GLU B CG    1 
ATOM   5773 C  CD    . GLU B 1 358 ? -10.526 14.664  -25.116 1.00 26.07 ? 350 GLU B CD    1 
ATOM   5774 O  OE1   . GLU B 1 358 ? -9.278  14.738  -25.039 1.00 27.22 ? 350 GLU B OE1   1 
ATOM   5775 O  OE2   . GLU B 1 358 ? -11.116 13.766  -25.754 1.00 26.60 ? 350 GLU B OE2   1 
ATOM   5776 N  N     . ASP B 1 359 ? -14.349 14.833  -22.054 1.00 22.04 ? 351 ASP B N     1 
ATOM   5777 C  CA    . ASP B 1 359 ? -15.709 14.385  -22.356 1.00 21.66 ? 351 ASP B CA    1 
ATOM   5778 C  C     . ASP B 1 359 ? -16.769 15.312  -21.759 1.00 21.22 ? 351 ASP B C     1 
ATOM   5779 O  O     . ASP B 1 359 ? -17.912 15.333  -22.212 1.00 21.25 ? 351 ASP B O     1 
ATOM   5780 C  CB    . ASP B 1 359 ? -15.932 12.957  -21.853 1.00 21.68 ? 351 ASP B CB    1 
ATOM   5781 C  CG    . ASP B 1 359 ? -15.019 11.948  -22.525 1.00 22.57 ? 351 ASP B CG    1 
ATOM   5782 O  OD1   . ASP B 1 359 ? -14.738 12.101  -23.734 1.00 23.25 ? 351 ASP B OD1   1 
ATOM   5783 O  OD2   . ASP B 1 359 ? -14.589 10.992  -21.844 1.00 23.42 ? 351 ASP B OD2   1 
ATOM   5784 N  N     . LEU B 1 360 ? -16.387 16.069  -20.737 1.00 20.74 ? 352 LEU B N     1 
ATOM   5785 C  CA    . LEU B 1 360 ? -17.330 16.940  -20.047 1.00 20.21 ? 352 LEU B CA    1 
ATOM   5786 C  C     . LEU B 1 360 ? -17.173 18.401  -20.458 1.00 20.15 ? 352 LEU B C     1 
ATOM   5787 O  O     . LEU B 1 360 ? -17.988 19.247  -20.088 1.00 20.33 ? 352 LEU B O     1 
ATOM   5788 C  CB    . LEU B 1 360 ? -17.194 16.791  -18.528 1.00 19.97 ? 352 LEU B CB    1 
ATOM   5789 C  CG    . LEU B 1 360 ? -17.573 15.439  -17.913 1.00 19.35 ? 352 LEU B CG    1 
ATOM   5790 C  CD1   . LEU B 1 360 ? -17.415 15.479  -16.401 1.00 18.54 ? 352 LEU B CD1   1 
ATOM   5791 C  CD2   . LEU B 1 360 ? -18.989 15.035  -18.295 1.00 19.02 ? 352 LEU B CD2   1 
ATOM   5792 N  N     . GLY B 1 361 ? -16.131 18.688  -21.234 1.00 19.97 ? 353 GLY B N     1 
ATOM   5793 C  CA    . GLY B 1 361 ? -15.882 20.039  -21.718 1.00 20.01 ? 353 GLY B CA    1 
ATOM   5794 C  C     . GLY B 1 361 ? -15.255 20.911  -20.651 1.00 20.21 ? 353 GLY B C     1 
ATOM   5795 O  O     . GLY B 1 361 ? -15.381 22.137  -20.679 1.00 20.37 ? 353 GLY B O     1 
ATOM   5796 N  N     . ILE B 1 362 ? -14.576 20.270  -19.706 1.00 20.18 ? 354 ILE B N     1 
ATOM   5797 C  CA    . ILE B 1 362 ? -13.984 20.962  -18.570 1.00 19.91 ? 354 ILE B CA    1 
ATOM   5798 C  C     . ILE B 1 362 ? -12.495 21.173  -18.797 1.00 19.89 ? 354 ILE B C     1 
ATOM   5799 O  O     . ILE B 1 362 ? -11.767 20.237  -19.130 1.00 19.88 ? 354 ILE B O     1 
ATOM   5800 C  CB    . ILE B 1 362 ? -14.201 20.170  -17.257 1.00 19.93 ? 354 ILE B CB    1 
ATOM   5801 C  CG1   . ILE B 1 362 ? -15.699 19.959  -17.003 1.00 19.90 ? 354 ILE B CG1   1 
ATOM   5802 C  CG2   . ILE B 1 362 ? -13.538 20.881  -16.076 1.00 19.65 ? 354 ILE B CG2   1 
ATOM   5803 C  CD1   . ILE B 1 362 ? -16.007 19.036  -15.834 1.00 20.07 ? 354 ILE B CD1   1 
ATOM   5804 N  N     . THR B 1 363 ? -12.051 22.411  -18.633 1.00 19.82 ? 355 THR B N     1 
ATOM   5805 C  CA    . THR B 1 363 ? -10.646 22.742  -18.754 1.00 19.76 ? 355 THR B CA    1 
ATOM   5806 C  C     . THR B 1 363 ? -9.854  22.145  -17.580 1.00 19.76 ? 355 THR B C     1 
ATOM   5807 O  O     . THR B 1 363 ? -10.363 22.045  -16.464 1.00 19.55 ? 355 THR B O     1 
ATOM   5808 C  CB    . THR B 1 363 ? -10.445 24.270  -18.805 1.00 19.91 ? 355 THR B CB    1 
ATOM   5809 O  OG1   . THR B 1 363 ? -11.446 24.856  -19.649 1.00 19.92 ? 355 THR B OG1   1 
ATOM   5810 C  CG2   . THR B 1 363 ? -9.080  24.612  -19.350 1.00 19.86 ? 355 THR B CG2   1 
ATOM   5811 N  N     . VAL B 1 364 ? -8.624  21.715  -17.854 1.00 19.73 ? 356 VAL B N     1 
ATOM   5812 C  CA    . VAL B 1 364 ? -7.778  21.114  -16.834 1.00 19.74 ? 356 VAL B CA    1 
ATOM   5813 C  C     . VAL B 1 364 ? -6.445  21.831  -16.738 1.00 20.09 ? 356 VAL B C     1 
ATOM   5814 O  O     . VAL B 1 364 ? -5.764  22.035  -17.746 1.00 20.45 ? 356 VAL B O     1 
ATOM   5815 C  CB    . VAL B 1 364 ? -7.524  19.616  -17.106 1.00 19.71 ? 356 VAL B CB    1 
ATOM   5816 C  CG1   . VAL B 1 364 ? -6.585  19.037  -16.065 1.00 19.77 ? 356 VAL B CG1   1 
ATOM   5817 C  CG2   . VAL B 1 364 ? -8.816  18.858  -17.104 1.00 19.57 ? 356 VAL B CG2   1 
ATOM   5818 N  N     . VAL B 1 365 ? -6.086  22.233  -15.522 1.00 20.17 ? 357 VAL B N     1 
ATOM   5819 C  CA    . VAL B 1 365 ? -4.764  22.761  -15.250 1.00 20.10 ? 357 VAL B CA    1 
ATOM   5820 C  C     . VAL B 1 365 ? -4.036  21.846  -14.275 1.00 20.39 ? 357 VAL B C     1 
ATOM   5821 O  O     . VAL B 1 365 ? -4.594  21.440  -13.253 1.00 20.57 ? 357 VAL B O     1 
ATOM   5822 C  CB    . VAL B 1 365 ? -4.824  24.195  -14.657 1.00 20.05 ? 357 VAL B CB    1 
ATOM   5823 C  CG1   . VAL B 1 365 ? -3.421  24.792  -14.552 1.00 19.57 ? 357 VAL B CG1   1 
ATOM   5824 C  CG2   . VAL B 1 365 ? -5.713  25.090  -15.506 1.00 20.17 ? 357 VAL B CG2   1 
ATOM   5825 N  N     . ALA B 1 366 ? -2.801  21.498  -14.609 1.00 20.40 ? 358 ALA B N     1 
ATOM   5826 C  CA    . ALA B 1 366 ? -1.917  20.862  -13.664 1.00 20.41 ? 358 ALA B CA    1 
ATOM   5827 C  C     . ALA B 1 366 ? -1.141  21.936  -12.936 1.00 20.58 ? 358 ALA B C     1 
ATOM   5828 O  O     . ALA B 1 366 ? -0.513  22.785  -13.562 1.00 20.60 ? 358 ALA B O     1 
ATOM   5829 C  CB    . ALA B 1 366 ? -0.980  19.928  -14.375 1.00 20.43 ? 358 ALA B CB    1 
ATOM   5830 N  N     . GLU B 1 367 ? -1.194  21.913  -11.611 1.00 20.80 ? 359 GLU B N     1 
ATOM   5831 C  CA    . GLU B 1 367 ? -0.526  22.935  -10.826 1.00 21.03 ? 359 GLU B CA    1 
ATOM   5832 C  C     . GLU B 1 367 ? 0.567   22.381  -9.918  1.00 20.93 ? 359 GLU B C     1 
ATOM   5833 O  O     . GLU B 1 367 ? 0.592   21.189  -9.610  1.00 20.88 ? 359 GLU B O     1 
ATOM   5834 C  CB    . GLU B 1 367 ? -1.532  23.753  -10.030 1.00 21.14 ? 359 GLU B CB    1 
ATOM   5835 C  CG    . GLU B 1 367 ? -2.013  23.099  -8.780  1.00 22.26 ? 359 GLU B CG    1 
ATOM   5836 C  CD    . GLU B 1 367 ? -2.889  24.008  -7.976  1.00 24.22 ? 359 GLU B CD    1 
ATOM   5837 O  OE1   . GLU B 1 367 ? -2.573  24.241  -6.788  1.00 25.39 ? 359 GLU B OE1   1 
ATOM   5838 O  OE2   . GLU B 1 367 ? -3.889  24.519  -8.532  1.00 23.96 ? 359 GLU B OE2   1 
ATOM   5839 N  N     . GLY B 1 368 ? 1.477   23.257  -9.506  1.00 20.86 ? 360 GLY B N     1 
ATOM   5840 C  CA    . GLY B 1 368 ? 2.641   22.848  -8.742  1.00 21.13 ? 360 GLY B CA    1 
ATOM   5841 C  C     . GLY B 1 368 ? 3.669   22.121  -9.586  1.00 21.29 ? 360 GLY B C     1 
ATOM   5842 O  O     . GLY B 1 368 ? 4.384   21.263  -9.091  1.00 21.08 ? 360 GLY B O     1 
ATOM   5843 N  N     . VAL B 1 369 ? 3.736   22.467  -10.871 1.00 21.84 ? 361 VAL B N     1 
ATOM   5844 C  CA    . VAL B 1 369 ? 4.693   21.841  -11.792 1.00 22.36 ? 361 VAL B CA    1 
ATOM   5845 C  C     . VAL B 1 369 ? 6.094   22.418  -11.588 1.00 22.82 ? 361 VAL B C     1 
ATOM   5846 O  O     . VAL B 1 369 ? 6.325   23.609  -11.819 1.00 22.88 ? 361 VAL B O     1 
ATOM   5847 C  CB    . VAL B 1 369 ? 4.264   22.020  -13.277 1.00 22.40 ? 361 VAL B CB    1 
ATOM   5848 C  CG1   . VAL B 1 369 ? 5.327   21.459  -14.217 1.00 22.32 ? 361 VAL B CG1   1 
ATOM   5849 C  CG2   . VAL B 1 369 ? 2.920   21.348  -13.529 1.00 22.14 ? 361 VAL B CG2   1 
ATOM   5850 N  N     . GLU B 1 370 ? 7.027   21.568  -11.160 1.00 23.27 ? 362 GLU B N     1 
ATOM   5851 C  CA    . GLU B 1 370 ? 8.342   22.034  -10.721 1.00 23.83 ? 362 GLU B CA    1 
ATOM   5852 C  C     . GLU B 1 370 ? 9.484   21.579  -11.623 1.00 24.23 ? 362 GLU B C     1 
ATOM   5853 O  O     . GLU B 1 370 ? 10.475  22.294  -11.788 1.00 24.41 ? 362 GLU B O     1 
ATOM   5854 C  CB    . GLU B 1 370 ? 8.607   21.595  -9.286  1.00 23.74 ? 362 GLU B CB    1 
ATOM   5855 C  CG    . GLU B 1 370 ? 7.698   22.246  -8.270  1.00 23.80 ? 362 GLU B CG    1 
ATOM   5856 C  CD    . GLU B 1 370 ? 7.980   21.782  -6.860  1.00 23.86 ? 362 GLU B CD    1 
ATOM   5857 O  OE1   . GLU B 1 370 ? 8.828   20.882  -6.692  1.00 25.14 ? 362 GLU B OE1   1 
ATOM   5858 O  OE2   . GLU B 1 370 ? 7.344   22.304  -5.920  1.00 22.94 ? 362 GLU B OE2   1 
ATOM   5859 N  N     . THR B 1 371 ? 9.354   20.385  -12.189 1.00 24.60 ? 363 THR B N     1 
ATOM   5860 C  CA    . THR B 1 371 ? 10.425  19.797  -12.990 1.00 25.15 ? 363 THR B CA    1 
ATOM   5861 C  C     . THR B 1 371 ? 9.992   19.587  -14.436 1.00 25.64 ? 363 THR B C     1 
ATOM   5862 O  O     . THR B 1 371 ? 8.809   19.377  -14.714 1.00 25.86 ? 363 THR B O     1 
ATOM   5863 C  CB    . THR B 1 371 ? 10.869  18.446  -12.415 1.00 25.15 ? 363 THR B CB    1 
ATOM   5864 O  OG1   . THR B 1 371 ? 9.760   17.540  -12.415 1.00 25.37 ? 363 THR B OG1   1 
ATOM   5865 C  CG2   . THR B 1 371 ? 11.389  18.610  -10.986 1.00 25.16 ? 363 THR B CG2   1 
ATOM   5866 N  N     . LEU B 1 372 ? 10.957  19.640  -15.355 1.00 26.07 ? 364 LEU B N     1 
ATOM   5867 C  CA    . LEU B 1 372 ? 10.722  19.271  -16.756 1.00 26.38 ? 364 LEU B CA    1 
ATOM   5868 C  C     . LEU B 1 372 ? 10.119  17.867  -16.867 1.00 26.57 ? 364 LEU B C     1 
ATOM   5869 O  O     . LEU B 1 372 ? 9.320   17.593  -17.758 1.00 26.62 ? 364 LEU B O     1 
ATOM   5870 C  CB    . LEU B 1 372 ? 12.029  19.341  -17.552 1.00 26.42 ? 364 LEU B CB    1 
ATOM   5871 C  CG    . LEU B 1 372 ? 12.412  20.696  -18.155 1.00 27.04 ? 364 LEU B CG    1 
ATOM   5872 C  CD1   . LEU B 1 372 ? 13.932  20.823  -18.304 1.00 27.30 ? 364 LEU B CD1   1 
ATOM   5873 C  CD2   . LEU B 1 372 ? 11.716  20.908  -19.492 1.00 27.06 ? 364 LEU B CD2   1 
ATOM   5874 N  N     . GLU B 1 373 ? 10.511  16.994  -15.945 1.00 26.84 ? 365 GLU B N     1 
ATOM   5875 C  CA    . GLU B 1 373 ? 10.011  15.627  -15.880 1.00 27.31 ? 365 GLU B CA    1 
ATOM   5876 C  C     . GLU B 1 373 ? 8.491   15.601  -15.722 1.00 27.23 ? 365 GLU B C     1 
ATOM   5877 O  O     . GLU B 1 373 ? 7.791   14.883  -16.445 1.00 27.24 ? 365 GLU B O     1 
ATOM   5878 C  CB    . GLU B 1 373 ? 10.659  14.906  -14.700 1.00 27.52 ? 365 GLU B CB    1 
ATOM   5879 C  CG    . GLU B 1 373 ? 11.285  13.578  -15.040 1.00 29.23 ? 365 GLU B CG    1 
ATOM   5880 C  CD    . GLU B 1 373 ? 12.549  13.317  -14.233 1.00 31.93 ? 365 GLU B CD    1 
ATOM   5881 O  OE1   . GLU B 1 373 ? 13.238  14.302  -13.873 1.00 32.58 ? 365 GLU B OE1   1 
ATOM   5882 O  OE2   . GLU B 1 373 ? 12.859  12.131  -13.966 1.00 32.88 ? 365 GLU B OE2   1 
ATOM   5883 N  N     . GLU B 1 374 ? 7.988   16.386  -14.773 1.00 27.03 ? 366 GLU B N     1 
ATOM   5884 C  CA    . GLU B 1 374 ? 6.559   16.449  -14.514 1.00 26.80 ? 366 GLU B CA    1 
ATOM   5885 C  C     . GLU B 1 374 ? 5.806   16.987  -15.719 1.00 26.54 ? 366 GLU B C     1 
ATOM   5886 O  O     . GLU B 1 374 ? 4.806   16.415  -16.130 1.00 26.40 ? 366 GLU B O     1 
ATOM   5887 C  CB    . GLU B 1 374 ? 6.267   17.295  -13.275 1.00 26.75 ? 366 GLU B CB    1 
ATOM   5888 C  CG    . GLU B 1 374 ? 6.652   16.619  -11.964 1.00 26.85 ? 366 GLU B CG    1 
ATOM   5889 C  CD    . GLU B 1 374 ? 6.814   17.605  -10.819 1.00 26.55 ? 366 GLU B CD    1 
ATOM   5890 O  OE1   . GLU B 1 374 ? 6.578   18.811  -11.031 1.00 26.69 ? 366 GLU B OE1   1 
ATOM   5891 O  OE2   . GLU B 1 374 ? 7.172   17.172  -9.705  1.00 26.69 ? 366 GLU B OE2   1 
ATOM   5892 N  N     . TRP B 1 375 ? 6.309   18.068  -16.303 1.00 26.48 ? 367 TRP B N     1 
ATOM   5893 C  CA    . TRP B 1 375 ? 5.689   18.645  -17.491 1.00 26.80 ? 367 TRP B CA    1 
ATOM   5894 C  C     . TRP B 1 375 ? 5.598   17.622  -18.622 1.00 26.73 ? 367 TRP B C     1 
ATOM   5895 O  O     . TRP B 1 375 ? 4.576   17.513  -19.283 1.00 26.62 ? 367 TRP B O     1 
ATOM   5896 C  CB    . TRP B 1 375 ? 6.451   19.890  -17.970 1.00 26.97 ? 367 TRP B CB    1 
ATOM   5897 C  CG    . TRP B 1 375 ? 5.979   20.369  -19.315 1.00 27.04 ? 367 TRP B CG    1 
ATOM   5898 C  CD1   . TRP B 1 375 ? 4.784   20.954  -19.596 1.00 27.01 ? 367 TRP B CD1   1 
ATOM   5899 C  CD2   . TRP B 1 375 ? 6.674   20.257  -20.562 1.00 27.29 ? 367 TRP B CD2   1 
ATOM   5900 N  NE1   . TRP B 1 375 ? 4.689   21.225  -20.937 1.00 27.44 ? 367 TRP B NE1   1 
ATOM   5901 C  CE2   . TRP B 1 375 ? 5.836   20.809  -21.556 1.00 27.69 ? 367 TRP B CE2   1 
ATOM   5902 C  CE3   . TRP B 1 375 ? 7.926   19.753  -20.936 1.00 27.59 ? 367 TRP B CE3   1 
ATOM   5903 C  CZ2   . TRP B 1 375 ? 6.212   20.877  -22.906 1.00 27.60 ? 367 TRP B CZ2   1 
ATOM   5904 C  CZ3   . TRP B 1 375 ? 8.299   19.816  -22.281 1.00 27.57 ? 367 TRP B CZ3   1 
ATOM   5905 C  CH2   . TRP B 1 375 ? 7.442   20.376  -23.246 1.00 27.54 ? 367 TRP B CH2   1 
ATOM   5906 N  N     . CYS B 1 376 ? 6.673   16.870  -18.818 1.00 26.98 ? 368 CYS B N     1 
ATOM   5907 C  CA    . CYS B 1 376 ? 6.728   15.848  -19.851 1.00 27.29 ? 368 CYS B CA    1 
ATOM   5908 C  C     . CYS B 1 376 ? 5.674   14.759  -19.663 1.00 27.42 ? 368 CYS B C     1 
ATOM   5909 O  O     . CYS B 1 376 ? 4.924   14.450  -20.591 1.00 27.51 ? 368 CYS B O     1 
ATOM   5910 C  CB    . CYS B 1 376 ? 8.121   15.231  -19.910 1.00 27.15 ? 368 CYS B CB    1 
ATOM   5911 S  SG    . CYS B 1 376 ? 9.345   16.285  -20.706 1.00 28.24 ? 368 CYS B SG    1 
ATOM   5912 N  N     . TRP B 1 377 ? 5.622   14.178  -18.464 1.00 27.52 ? 369 TRP B N     1 
ATOM   5913 C  CA    . TRP B 1 377 ? 4.692   13.081  -18.186 1.00 27.78 ? 369 TRP B CA    1 
ATOM   5914 C  C     . TRP B 1 377 ? 3.236   13.545  -18.182 1.00 27.61 ? 369 TRP B C     1 
ATOM   5915 O  O     . TRP B 1 377 ? 2.344   12.817  -18.620 1.00 27.75 ? 369 TRP B O     1 
ATOM   5916 C  CB    . TRP B 1 377 ? 5.041   12.386  -16.861 1.00 28.15 ? 369 TRP B CB    1 
ATOM   5917 C  CG    . TRP B 1 377 ? 6.210   11.428  -16.969 1.00 28.79 ? 369 TRP B CG    1 
ATOM   5918 C  CD1   . TRP B 1 377 ? 7.534   11.724  -16.795 1.00 29.41 ? 369 TRP B CD1   1 
ATOM   5919 C  CD2   . TRP B 1 377 ? 6.152   10.028  -17.287 1.00 29.41 ? 369 TRP B CD2   1 
ATOM   5920 N  NE1   . TRP B 1 377 ? 8.304   10.596  -16.979 1.00 29.66 ? 369 TRP B NE1   1 
ATOM   5921 C  CE2   . TRP B 1 377 ? 7.483   9.541   -17.282 1.00 29.53 ? 369 TRP B CE2   1 
ATOM   5922 C  CE3   . TRP B 1 377 ? 5.108   9.138   -17.578 1.00 29.58 ? 369 TRP B CE3   1 
ATOM   5923 C  CZ2   . TRP B 1 377 ? 7.795   8.204   -17.554 1.00 28.97 ? 369 TRP B CZ2   1 
ATOM   5924 C  CZ3   . TRP B 1 377 ? 5.423   7.806   -17.853 1.00 29.31 ? 369 TRP B CZ3   1 
ATOM   5925 C  CH2   . TRP B 1 377 ? 6.756   7.356   -17.837 1.00 29.06 ? 369 TRP B CH2   1 
ATOM   5926 N  N     . LEU B 1 378 ? 3.004   14.762  -17.695 1.00 27.44 ? 370 LEU B N     1 
ATOM   5927 C  CA    . LEU B 1 378 ? 1.663   15.333  -17.656 1.00 27.24 ? 370 LEU B CA    1 
ATOM   5928 C  C     . LEU B 1 378 ? 1.155   15.618  -19.053 1.00 27.41 ? 370 LEU B C     1 
ATOM   5929 O  O     . LEU B 1 378 ? -0.007  15.365  -19.364 1.00 27.38 ? 370 LEU B O     1 
ATOM   5930 C  CB    . LEU B 1 378 ? 1.649   16.619  -16.838 1.00 27.07 ? 370 LEU B CB    1 
ATOM   5931 C  CG    . LEU B 1 378 ? 1.655   16.480  -15.322 1.00 26.63 ? 370 LEU B CG    1 
ATOM   5932 C  CD1   . LEU B 1 378 ? 2.067   17.789  -14.693 1.00 26.19 ? 370 LEU B CD1   1 
ATOM   5933 C  CD2   . LEU B 1 378 ? 0.292   16.042  -14.818 1.00 26.74 ? 370 LEU B CD2   1 
ATOM   5934 N  N     . GLN B 1 379 ? 2.032   16.150  -19.895 1.00 27.55 ? 371 GLN B N     1 
ATOM   5935 C  CA    . GLN B 1 379 ? 1.675   16.474  -21.265 1.00 27.87 ? 371 GLN B CA    1 
ATOM   5936 C  C     . GLN B 1 379 ? 1.354   15.202  -22.041 1.00 27.81 ? 371 GLN B C     1 
ATOM   5937 O  O     . GLN B 1 379 ? 0.474   15.198  -22.897 1.00 28.03 ? 371 GLN B O     1 
ATOM   5938 C  CB    . GLN B 1 379 ? 2.812   17.243  -21.945 1.00 27.97 ? 371 GLN B CB    1 
ATOM   5939 C  CG    . GLN B 1 379 ? 2.387   18.566  -22.573 1.00 29.05 ? 371 GLN B CG    1 
ATOM   5940 C  CD    . GLN B 1 379 ? 2.358   18.519  -24.094 1.00 30.58 ? 371 GLN B CD    1 
ATOM   5941 O  OE1   . GLN B 1 379 ? 2.975   17.651  -24.714 1.00 31.39 ? 371 GLN B OE1   1 
ATOM   5942 N  NE2   . GLN B 1 379 ? 1.651   19.466  -24.700 1.00 31.09 ? 371 GLN B NE2   1 
ATOM   5943 N  N     . SER B 1 380 ? 2.049   14.114  -21.707 1.00 27.75 ? 372 SER B N     1 
ATOM   5944 C  CA    . SER B 1 380 ? 1.890   12.850  -22.423 1.00 27.84 ? 372 SER B CA    1 
ATOM   5945 C  C     . SER B 1 380 ? 0.545   12.209  -22.125 1.00 27.89 ? 372 SER B C     1 
ATOM   5946 O  O     . SER B 1 380 ? -0.010  11.495  -22.960 1.00 28.12 ? 372 SER B O     1 
ATOM   5947 C  CB    . SER B 1 380 ? 3.030   11.881  -22.086 1.00 27.75 ? 372 SER B CB    1 
ATOM   5948 O  OG    . SER B 1 380 ? 2.765   11.156  -20.900 1.00 27.75 ? 372 SER B OG    1 
ATOM   5949 N  N     . VAL B 1 381 ? 0.022   12.473  -20.931 1.00 27.84 ? 373 VAL B N     1 
ATOM   5950 C  CA    . VAL B 1 381 ? -1.276  11.947  -20.534 1.00 27.64 ? 373 VAL B CA    1 
ATOM   5951 C  C     . VAL B 1 381 ? -2.417  12.939  -20.816 1.00 27.49 ? 373 VAL B C     1 
ATOM   5952 O  O     . VAL B 1 381 ? -3.570  12.690  -20.452 1.00 27.68 ? 373 VAL B O     1 
ATOM   5953 C  CB    . VAL B 1 381 ? -1.289  11.497  -19.045 1.00 27.75 ? 373 VAL B CB    1 
ATOM   5954 C  CG1   . VAL B 1 381 ? -0.192  10.462  -18.791 1.00 27.75 ? 373 VAL B CG1   1 
ATOM   5955 C  CG2   . VAL B 1 381 ? -1.130  12.691  -18.112 1.00 27.76 ? 373 VAL B CG2   1 
ATOM   5956 N  N     . GLY B 1 382 ? -2.084  14.062  -21.458 1.00 27.13 ? 374 GLY B N     1 
ATOM   5957 C  CA    . GLY B 1 382 ? -3.099  14.934  -22.072 1.00 26.59 ? 374 GLY B CA    1 
ATOM   5958 C  C     . GLY B 1 382 ? -3.311  16.304  -21.432 1.00 26.22 ? 374 GLY B C     1 
ATOM   5959 O  O     . GLY B 1 382 ? -4.264  17.011  -21.777 1.00 26.51 ? 374 GLY B O     1 
ATOM   5960 N  N     . ILE B 1 383 ? -2.439  16.681  -20.500 1.00 25.51 ? 375 ILE B N     1 
ATOM   5961 C  CA    . ILE B 1 383 ? -2.487  18.018  -19.908 1.00 24.86 ? 375 ILE B CA    1 
ATOM   5962 C  C     . ILE B 1 383 ? -1.868  19.036  -20.863 1.00 24.62 ? 375 ILE B C     1 
ATOM   5963 O  O     . ILE B 1 383 ? -0.770  18.827  -21.370 1.00 24.63 ? 375 ILE B O     1 
ATOM   5964 C  CB    . ILE B 1 383 ? -1.728  18.075  -18.556 1.00 24.95 ? 375 ILE B CB    1 
ATOM   5965 C  CG1   . ILE B 1 383 ? -2.272  17.025  -17.579 1.00 24.58 ? 375 ILE B CG1   1 
ATOM   5966 C  CG2   . ILE B 1 383 ? -1.804  19.475  -17.953 1.00 24.50 ? 375 ILE B CG2   1 
ATOM   5967 C  CD1   . ILE B 1 383 ? -3.263  17.558  -16.594 1.00 24.32 ? 375 ILE B CD1   1 
ATOM   5968 N  N     . ARG B 1 384 ? -2.571  20.139  -21.100 1.00 24.16 ? 376 ARG B N     1 
ATOM   5969 C  CA    . ARG B 1 384 ? -2.064  21.184  -21.984 1.00 24.09 ? 376 ARG B CA    1 
ATOM   5970 C  C     . ARG B 1 384 ? -1.821  22.506  -21.254 1.00 23.76 ? 376 ARG B C     1 
ATOM   5971 O  O     . ARG B 1 384 ? -1.103  23.376  -21.751 1.00 23.94 ? 376 ARG B O     1 
ATOM   5972 C  CB    . ARG B 1 384 ? -3.015  21.396  -23.165 1.00 24.21 ? 376 ARG B CB    1 
ATOM   5973 C  CG    . ARG B 1 384 ? -3.157  20.174  -24.078 1.00 25.06 ? 376 ARG B CG    1 
ATOM   5974 C  CD    . ARG B 1 384 ? -1.870  19.899  -24.852 1.00 26.17 ? 376 ARG B CD    1 
ATOM   5975 N  NE    . ARG B 1 384 ? -1.934  18.638  -25.586 1.00 27.18 ? 376 ARG B NE    1 
ATOM   5976 C  CZ    . ARG B 1 384 ? -1.397  17.497  -25.164 1.00 28.07 ? 376 ARG B CZ    1 
ATOM   5977 N  NH1   . ARG B 1 384 ? -0.745  17.453  -24.008 1.00 28.28 ? 376 ARG B NH1   1 
ATOM   5978 N  NH2   . ARG B 1 384 ? -1.512  16.397  -25.896 1.00 28.66 ? 376 ARG B NH2   1 
ATOM   5979 N  N     . LEU B 1 385 ? -2.420  22.650  -20.078 1.00 23.21 ? 377 LEU B N     1 
ATOM   5980 C  CA    . LEU B 1 385 ? -2.331  23.888  -19.320 1.00 22.81 ? 377 LEU B CA    1 
ATOM   5981 C  C     . LEU B 1 385 ? -1.613  23.675  -17.994 1.00 22.78 ? 377 LEU B C     1 
ATOM   5982 O  O     . LEU B 1 385 ? -1.905  22.730  -17.257 1.00 22.51 ? 377 LEU B O     1 
ATOM   5983 C  CB    . LEU B 1 385 ? -3.725  24.477  -19.085 1.00 22.84 ? 377 LEU B CB    1 
ATOM   5984 C  CG    . LEU B 1 385 ? -4.455  25.014  -20.319 1.00 22.19 ? 377 LEU B CG    1 
ATOM   5985 C  CD1   . LEU B 1 385 ? -5.822  25.474  -19.947 1.00 21.57 ? 377 LEU B CD1   1 
ATOM   5986 C  CD2   . LEU B 1 385 ? -3.676  26.148  -20.957 1.00 22.22 ? 377 LEU B CD2   1 
ATOM   5987 N  N     . PHE B 1 386 ? -0.673  24.562  -17.694 1.00 22.69 ? 378 PHE B N     1 
ATOM   5988 C  CA    . PHE B 1 386 ? 0.258   24.330  -16.605 1.00 22.71 ? 378 PHE B CA    1 
ATOM   5989 C  C     . PHE B 1 386 ? 0.406   25.550  -15.704 1.00 22.74 ? 378 PHE B C     1 
ATOM   5990 O  O     . PHE B 1 386 ? 0.276   26.689  -16.156 1.00 22.79 ? 378 PHE B O     1 
ATOM   5991 C  CB    . PHE B 1 386 ? 1.625   23.918  -17.157 1.00 22.56 ? 378 PHE B CB    1 
ATOM   5992 C  CG    . PHE B 1 386 ? 1.615   22.603  -17.884 1.00 22.37 ? 378 PHE B CG    1 
ATOM   5993 C  CD1   . PHE B 1 386 ? 1.819   21.414  -17.197 1.00 22.22 ? 378 PHE B CD1   1 
ATOM   5994 C  CD2   . PHE B 1 386 ? 1.410   22.555  -19.260 1.00 22.06 ? 378 PHE B CD2   1 
ATOM   5995 C  CE1   . PHE B 1 386 ? 1.814   20.198  -17.867 1.00 22.78 ? 378 PHE B CE1   1 
ATOM   5996 C  CE2   . PHE B 1 386 ? 1.396   21.343  -19.937 1.00 22.16 ? 378 PHE B CE2   1 
ATOM   5997 C  CZ    . PHE B 1 386 ? 1.599   20.163  -19.242 1.00 22.48 ? 378 PHE B CZ    1 
ATOM   5998 N  N     . GLN B 1 387 ? 0.685   25.298  -14.429 1.00 22.63 ? 379 GLN B N     1 
ATOM   5999 C  CA    . GLN B 1 387 ? 1.005   26.352  -13.480 1.00 22.79 ? 379 GLN B CA    1 
ATOM   6000 C  C     . GLN B 1 387 ? 2.032   25.837  -12.482 1.00 22.79 ? 379 GLN B C     1 
ATOM   6001 O  O     . GLN B 1 387 ? 1.804   24.832  -11.819 1.00 22.89 ? 379 GLN B O     1 
ATOM   6002 C  CB    . GLN B 1 387 ? -0.257  26.802  -12.747 1.00 22.81 ? 379 GLN B CB    1 
ATOM   6003 C  CG    . GLN B 1 387 ? -0.008  27.775  -11.607 1.00 22.96 ? 379 GLN B CG    1 
ATOM   6004 C  CD    . GLN B 1 387 ? -1.297  28.297  -10.995 1.00 22.98 ? 379 GLN B CD    1 
ATOM   6005 O  OE1   . GLN B 1 387 ? -2.257  27.551  -10.812 1.00 22.46 ? 379 GLN B OE1   1 
ATOM   6006 N  NE2   . GLN B 1 387 ? -1.320  29.583  -10.675 1.00 23.39 ? 379 GLN B NE2   1 
ATOM   6007 N  N     . GLY B 1 388 ? 3.169   26.516  -12.385 1.00 22.69 ? 380 GLY B N     1 
ATOM   6008 C  CA    . GLY B 1 388 ? 4.197   26.103  -11.439 1.00 22.76 ? 380 GLY B CA    1 
ATOM   6009 C  C     . GLY B 1 388 ? 5.498   26.869  -11.533 1.00 22.89 ? 380 GLY B C     1 
ATOM   6010 O  O     . GLY B 1 388 ? 5.698   27.670  -12.454 1.00 22.87 ? 380 GLY B O     1 
ATOM   6011 N  N     . PHE B 1 389 ? 6.401   26.592  -10.588 1.00 22.84 ? 381 PHE B N     1 
ATOM   6012 C  CA    . PHE B 1 389 ? 7.670   27.317  -10.472 1.00 22.81 ? 381 PHE B CA    1 
ATOM   6013 C  C     . PHE B 1 389 ? 8.593   27.076  -11.664 1.00 22.89 ? 381 PHE B C     1 
ATOM   6014 O  O     . PHE B 1 389 ? 9.514   27.855  -11.911 1.00 22.88 ? 381 PHE B O     1 
ATOM   6015 C  CB    . PHE B 1 389 ? 8.395   26.947  -9.171  1.00 22.75 ? 381 PHE B CB    1 
ATOM   6016 C  CG    . PHE B 1 389 ? 7.702   27.431  -7.923  1.00 22.53 ? 381 PHE B CG    1 
ATOM   6017 C  CD1   . PHE B 1 389 ? 6.687   28.383  -7.989  1.00 22.97 ? 381 PHE B CD1   1 
ATOM   6018 C  CD2   . PHE B 1 389 ? 8.088   26.956  -6.676  1.00 22.51 ? 381 PHE B CD2   1 
ATOM   6019 C  CE1   . PHE B 1 389 ? 6.050   28.831  -6.828  1.00 23.17 ? 381 PHE B CE1   1 
ATOM   6020 C  CE2   . PHE B 1 389 ? 7.462   27.405  -5.512  1.00 22.69 ? 381 PHE B CE2   1 
ATOM   6021 C  CZ    . PHE B 1 389 ? 6.444   28.344  -5.591  1.00 22.84 ? 381 PHE B CZ    1 
ATOM   6022 N  N     . LEU B 1 390 ? 8.343   25.997  -12.399 1.00 23.18 ? 382 LEU B N     1 
ATOM   6023 C  CA    . LEU B 1 390 ? 9.081   25.722  -13.627 1.00 23.55 ? 382 LEU B CA    1 
ATOM   6024 C  C     . LEU B 1 390 ? 8.880   26.833  -14.658 1.00 23.87 ? 382 LEU B C     1 
ATOM   6025 O  O     . LEU B 1 390 ? 9.810   27.209  -15.367 1.00 23.85 ? 382 LEU B O     1 
ATOM   6026 C  CB    . LEU B 1 390 ? 8.654   24.378  -14.219 1.00 23.53 ? 382 LEU B CB    1 
ATOM   6027 C  CG    . LEU B 1 390 ? 9.491   23.849  -15.386 1.00 23.29 ? 382 LEU B CG    1 
ATOM   6028 C  CD1   . LEU B 1 390 ? 10.885  23.475  -14.919 1.00 22.85 ? 382 LEU B CD1   1 
ATOM   6029 C  CD2   . LEU B 1 390 ? 8.804   22.661  -16.036 1.00 23.45 ? 382 LEU B CD2   1 
ATOM   6030 N  N     . PHE B 1 391 ? 7.664   27.370  -14.712 1.00 24.25 ? 383 PHE B N     1 
ATOM   6031 C  CA    . PHE B 1 391 ? 7.308   28.363  -15.712 1.00 24.51 ? 383 PHE B CA    1 
ATOM   6032 C  C     . PHE B 1 391 ? 7.353   29.767  -15.140 1.00 24.88 ? 383 PHE B C     1 
ATOM   6033 O  O     . PHE B 1 391 ? 8.073   30.628  -15.639 1.00 25.16 ? 383 PHE B O     1 
ATOM   6034 C  CB    . PHE B 1 391 ? 5.916   28.073  -16.276 1.00 24.22 ? 383 PHE B CB    1 
ATOM   6035 C  CG    . PHE B 1 391 ? 5.765   26.690  -16.823 1.00 23.90 ? 383 PHE B CG    1 
ATOM   6036 C  CD1   . PHE B 1 391 ? 6.197   26.385  -18.109 1.00 24.19 ? 383 PHE B CD1   1 
ATOM   6037 C  CD2   . PHE B 1 391 ? 5.191   25.685  -16.055 1.00 23.48 ? 383 PHE B CD2   1 
ATOM   6038 C  CE1   . PHE B 1 391 ? 6.058   25.102  -18.621 1.00 23.83 ? 383 PHE B CE1   1 
ATOM   6039 C  CE2   . PHE B 1 391 ? 5.057   24.406  -16.555 1.00 23.63 ? 383 PHE B CE2   1 
ATOM   6040 C  CZ    . PHE B 1 391 ? 5.488   24.114  -17.847 1.00 23.96 ? 383 PHE B CZ    1 
ATOM   6041 N  N     . SER B 1 392 ? 6.577   29.994  -14.089 1.00 25.26 ? 384 SER B N     1 
ATOM   6042 C  CA    . SER B 1 392 ? 6.397   31.326  -13.551 1.00 25.63 ? 384 SER B CA    1 
ATOM   6043 C  C     . SER B 1 392 ? 6.163   31.256  -12.061 1.00 25.86 ? 384 SER B C     1 
ATOM   6044 O  O     . SER B 1 392 ? 5.314   30.506  -11.598 1.00 26.04 ? 384 SER B O     1 
ATOM   6045 C  CB    . SER B 1 392 ? 5.214   32.019  -14.237 1.00 25.61 ? 384 SER B CB    1 
ATOM   6046 O  OG    . SER B 1 392 ? 4.839   33.204  -13.550 1.00 25.83 ? 384 SER B OG    1 
ATOM   6047 N  N     . ARG B 1 393 ? 6.934   32.027  -11.310 1.00 26.29 ? 385 ARG B N     1 
ATOM   6048 C  CA    . ARG B 1 393 ? 6.715   32.157  -9.877  1.00 26.82 ? 385 ARG B CA    1 
ATOM   6049 C  C     . ARG B 1 393 ? 5.718   33.281  -9.603  1.00 26.88 ? 385 ARG B C     1 
ATOM   6050 O  O     . ARG B 1 393 ? 5.487   34.135  -10.468 1.00 26.85 ? 385 ARG B O     1 
ATOM   6051 C  CB    . ARG B 1 393 ? 8.039   32.422  -9.155  1.00 27.05 ? 385 ARG B CB    1 
ATOM   6052 C  CG    . ARG B 1 393 ? 8.926   31.200  -9.052  1.00 28.17 ? 385 ARG B CG    1 
ATOM   6053 C  CD    . ARG B 1 393 ? 10.288  31.531  -8.470  1.00 30.13 ? 385 ARG B CD    1 
ATOM   6054 N  NE    . ARG B 1 393 ? 11.245  30.461  -8.734  1.00 32.09 ? 385 ARG B NE    1 
ATOM   6055 C  CZ    . ARG B 1 393 ? 11.468  29.434  -7.919  1.00 33.11 ? 385 ARG B CZ    1 
ATOM   6056 N  NH1   . ARG B 1 393 ? 10.821  29.343  -6.761  1.00 33.20 ? 385 ARG B NH1   1 
ATOM   6057 N  NH2   . ARG B 1 393 ? 12.347  28.498  -8.257  1.00 33.69 ? 385 ARG B NH2   1 
ATOM   6058 N  N     . PRO B 1 394 ? 5.081   33.256  -8.418  1.00 26.80 ? 386 PRO B N     1 
ATOM   6059 C  CA    . PRO B 1 394 ? 4.244   34.363  -7.986  1.00 26.90 ? 386 PRO B CA    1 
ATOM   6060 C  C     . PRO B 1 394 ? 5.016   35.682  -7.974  1.00 27.10 ? 386 PRO B C     1 
ATOM   6061 O  O     . PRO B 1 394 ? 6.131   35.749  -7.453  1.00 26.92 ? 386 PRO B O     1 
ATOM   6062 C  CB    . PRO B 1 394 ? 3.853   33.964  -6.565  1.00 26.77 ? 386 PRO B CB    1 
ATOM   6063 C  CG    . PRO B 1 394 ? 3.908   32.495  -6.574  1.00 26.77 ? 386 PRO B CG    1 
ATOM   6064 C  CD    . PRO B 1 394 ? 5.065   32.152  -7.447  1.00 26.71 ? 386 PRO B CD    1 
ATOM   6065 N  N     . CYS B 1 395 ? 4.422   36.712  -8.562  1.00 27.33 ? 387 CYS B N     1 
ATOM   6066 C  CA    . CYS B 1 395 ? 5.069   38.002  -8.678  1.00 27.61 ? 387 CYS B CA    1 
ATOM   6067 C  C     . CYS B 1 395 ? 4.231   39.081  -8.009  1.00 27.90 ? 387 CYS B C     1 
ATOM   6068 O  O     . CYS B 1 395 ? 3.107   39.367  -8.437  1.00 27.70 ? 387 CYS B O     1 
ATOM   6069 C  CB    . CYS B 1 395 ? 5.302   38.344  -10.148 1.00 27.55 ? 387 CYS B CB    1 
ATOM   6070 S  SG    . CYS B 1 395 ? 5.919   39.993  -10.426 1.00 27.41 ? 387 CYS B SG    1 
ATOM   6071 N  N     . LEU B 1 396 ? 4.785   39.676  -6.956  1.00 28.31 ? 388 LEU B N     1 
ATOM   6072 C  CA    . LEU B 1 396 ? 4.067   40.668  -6.160  1.00 28.76 ? 388 LEU B CA    1 
ATOM   6073 C  C     . LEU B 1 396 ? 3.704   41.907  -6.978  1.00 28.96 ? 388 LEU B C     1 
ATOM   6074 O  O     . LEU B 1 396 ? 4.581   42.602  -7.499  1.00 29.05 ? 388 LEU B O     1 
ATOM   6075 C  CB    . LEU B 1 396 ? 4.888   41.063  -4.927  1.00 28.76 ? 388 LEU B CB    1 
ATOM   6076 C  CG    . LEU B 1 396 ? 4.194   41.915  -3.862  1.00 28.74 ? 388 LEU B CG    1 
ATOM   6077 C  CD1   . LEU B 1 396 ? 2.902   41.260  -3.391  1.00 28.77 ? 388 LEU B CD1   1 
ATOM   6078 C  CD2   . LEU B 1 396 ? 5.133   42.157  -2.690  1.00 28.99 ? 388 LEU B CD2   1 
ATOM   6079 N  N     . ASN B 1 397 ? 2.401   42.145  -7.117  1.00 29.24 ? 389 ASN B N     1 
ATOM   6080 C  CA    . ASN B 1 397 ? 1.870   43.351  -7.767  1.00 29.51 ? 389 ASN B CA    1 
ATOM   6081 C  C     . ASN B 1 397 ? 2.219   43.511  -9.258  1.00 29.81 ? 389 ASN B C     1 
ATOM   6082 O  O     . ASN B 1 397 ? 2.110   44.606  -9.812  1.00 29.76 ? 389 ASN B O     1 
ATOM   6083 C  CB    . ASN B 1 397 ? 2.262   44.608  -6.978  1.00 29.40 ? 389 ASN B CB    1 
ATOM   6084 C  CG    . ASN B 1 397 ? 1.612   44.661  -5.610  1.00 29.43 ? 389 ASN B CG    1 
ATOM   6085 O  OD1   . ASN B 1 397 ? 0.396   44.499  -5.482  1.00 30.05 ? 389 ASN B OD1   1 
ATOM   6086 N  ND2   . ASN B 1 397 ? 2.418   44.889  -4.578  1.00 28.03 ? 389 ASN B ND2   1 
ATOM   6087 N  N     . GLY B 1 398 ? 2.609   42.417  -9.907  1.00 30.21 ? 390 GLY B N     1 
ATOM   6088 C  CA    . GLY B 1 398 ? 2.969   42.476  -11.319 1.00 30.69 ? 390 GLY B CA    1 
ATOM   6089 C  C     . GLY B 1 398 ? 2.997   41.140  -12.037 1.00 31.19 ? 390 GLY B C     1 
ATOM   6090 O  O     . GLY B 1 398 ? 2.671   40.101  -11.459 1.00 31.03 ? 390 GLY B O     1 
ATOM   6091 N  N     . ILE B 1 399 ? 3.382   41.180  -13.312 1.00 31.69 ? 391 ILE B N     1 
ATOM   6092 C  CA    . ILE B 1 399 ? 3.538   39.979  -14.124 1.00 32.18 ? 391 ILE B CA    1 
ATOM   6093 C  C     . ILE B 1 399 ? 5.005   39.546  -14.128 1.00 32.67 ? 391 ILE B C     1 
ATOM   6094 O  O     . ILE B 1 399 ? 5.891   40.328  -14.479 1.00 32.70 ? 391 ILE B O     1 
ATOM   6095 C  CB    . ILE B 1 399 ? 3.052   40.221  -15.582 1.00 32.15 ? 391 ILE B CB    1 
ATOM   6096 C  CG1   . ILE B 1 399 ? 1.543   40.485  -15.600 1.00 32.38 ? 391 ILE B CG1   1 
ATOM   6097 C  CG2   . ILE B 1 399 ? 3.390   39.032  -16.475 1.00 31.92 ? 391 ILE B CG2   1 
ATOM   6098 C  CD1   . ILE B 1 399 ? 1.071   41.312  -16.777 1.00 32.12 ? 391 ILE B CD1   1 
ATOM   6099 N  N     . GLY B 1 400 ? 5.255   38.307  -13.715 1.00 33.30 ? 392 GLY B N     1 
ATOM   6100 C  CA    . GLY B 1 400 ? 6.616   37.780  -13.631 1.00 34.13 ? 392 GLY B CA    1 
ATOM   6101 C  C     . GLY B 1 400 ? 7.141   37.276  -14.960 1.00 34.79 ? 392 GLY B C     1 
ATOM   6102 O  O     . GLY B 1 400 ? 6.401   37.201  -15.943 1.00 34.66 ? 392 GLY B O     1 
ATOM   6103 N  N     . GLU B 1 401 ? 8.427   36.935  -14.991 1.00 35.56 ? 393 GLU B N     1 
ATOM   6104 C  CA    . GLU B 1 401 ? 9.038   36.360  -16.186 1.00 36.41 ? 393 GLU B CA    1 
ATOM   6105 C  C     . GLU B 1 401 ? 8.630   34.901  -16.351 1.00 36.44 ? 393 GLU B C     1 
ATOM   6106 O  O     . GLU B 1 401 ? 8.763   34.101  -15.422 1.00 36.41 ? 393 GLU B O     1 
ATOM   6107 C  CB    . GLU B 1 401 ? 10.568  36.482  -16.127 1.00 36.49 ? 393 GLU B CB    1 
ATOM   6108 C  CG    . GLU B 1 401 ? 11.096  37.903  -16.379 1.00 37.23 ? 393 GLU B CG    1 
ATOM   6109 C  CD    . GLU B 1 401 ? 12.605  37.941  -16.660 1.00 37.69 ? 393 GLU B CD    1 
ATOM   6110 O  OE1   . GLU B 1 401 ? 13.201  36.864  -16.911 1.00 38.46 ? 393 GLU B OE1   1 
ATOM   6111 O  OE2   . GLU B 1 401 ? 13.190  39.053  -16.635 1.00 38.61 ? 393 GLU B OE2   1 
ATOM   6112 N  N     . ILE B 1 402 ? 8.119   34.563  -17.532 1.00 36.76 ? 394 ILE B N     1 
ATOM   6113 C  CA    . ILE B 1 402 ? 7.697   33.195  -17.823 1.00 37.06 ? 394 ILE B CA    1 
ATOM   6114 C  C     . ILE B 1 402 ? 8.761   32.438  -18.623 1.00 37.35 ? 394 ILE B C     1 
ATOM   6115 O  O     . ILE B 1 402 ? 9.160   32.870  -19.711 1.00 37.47 ? 394 ILE B O     1 
ATOM   6116 C  CB    . ILE B 1 402 ? 6.346   33.154  -18.586 1.00 37.02 ? 394 ILE B CB    1 
ATOM   6117 C  CG1   . ILE B 1 402 ? 5.218   33.731  -17.724 1.00 37.03 ? 394 ILE B CG1   1 
ATOM   6118 C  CG2   . ILE B 1 402 ? 6.005   31.730  -18.995 1.00 37.29 ? 394 ILE B CG2   1 
ATOM   6119 C  CD1   . ILE B 1 402 ? 4.770   35.107  -18.146 1.00 37.53 ? 394 ILE B CD1   1 
ATOM   6120 N  N     . CYS B 1 403 ? 9.214   31.311  -18.075 1.00 37.55 ? 395 CYS B N     1 
ATOM   6121 C  CA    . CYS B 1 403 ? 10.199  30.465  -18.741 1.00 37.87 ? 395 CYS B CA    1 
ATOM   6122 C  C     . CYS B 1 403 ? 9.533   29.397  -19.598 1.00 37.85 ? 395 CYS B C     1 
ATOM   6123 O  O     . CYS B 1 403 ? 8.571   28.759  -19.171 1.00 37.96 ? 395 CYS B O     1 
ATOM   6124 C  CB    . CYS B 1 403 ? 11.116  29.809  -17.714 1.00 37.87 ? 395 CYS B CB    1 
ATOM   6125 S  SG    . CYS B 1 403 ? 12.258  30.945  -16.925 1.00 39.12 ? 395 CYS B SG    1 
ATOM   6126 N  N     . TRP B 1 404 ? 10.060  29.198  -20.804 1.00 37.91 ? 396 TRP B N     1 
ATOM   6127 C  CA    . TRP B 1 404 ? 9.502   28.222  -21.739 1.00 37.99 ? 396 TRP B CA    1 
ATOM   6128 C  C     . TRP B 1 404 ? 10.484  27.081  -22.001 1.00 38.24 ? 396 TRP B C     1 
ATOM   6129 O  O     . TRP B 1 404 ? 11.691  27.302  -22.073 1.00 38.24 ? 396 TRP B O     1 
ATOM   6130 C  CB    . TRP B 1 404 ? 9.130   28.897  -23.061 1.00 37.83 ? 396 TRP B CB    1 
ATOM   6131 C  CG    . TRP B 1 404 ? 8.149   30.029  -22.922 1.00 37.62 ? 396 TRP B CG    1 
ATOM   6132 C  CD1   . TRP B 1 404 ? 8.421   31.366  -23.004 1.00 37.35 ? 396 TRP B CD1   1 
ATOM   6133 C  CD2   . TRP B 1 404 ? 6.739   29.920  -22.687 1.00 37.34 ? 396 TRP B CD2   1 
ATOM   6134 N  NE1   . TRP B 1 404 ? 7.268   32.097  -22.835 1.00 37.39 ? 396 TRP B NE1   1 
ATOM   6135 C  CE2   . TRP B 1 404 ? 6.221   31.234  -22.638 1.00 37.48 ? 396 TRP B CE2   1 
ATOM   6136 C  CE3   . TRP B 1 404 ? 5.863   28.843  -22.513 1.00 37.02 ? 396 TRP B CE3   1 
ATOM   6137 C  CZ2   . TRP B 1 404 ? 4.867   31.496  -22.426 1.00 37.25 ? 396 TRP B CZ2   1 
ATOM   6138 C  CZ3   . TRP B 1 404 ? 4.519   29.107  -22.299 1.00 37.29 ? 396 TRP B CZ3   1 
ATOM   6139 C  CH2   . TRP B 1 404 ? 4.035   30.424  -22.256 1.00 37.27 ? 396 TRP B CH2   1 
ATOM   6140 N  N     . PRO B 1 405 ? 9.965   25.850  -22.131 1.00 38.56 ? 397 PRO B N     1 
ATOM   6141 C  CA    . PRO B 1 405 ? 10.801  24.720  -22.506 1.00 38.82 ? 397 PRO B CA    1 
ATOM   6142 C  C     . PRO B 1 405 ? 10.989  24.630  -24.017 1.00 39.17 ? 397 PRO B C     1 
ATOM   6143 O  O     . PRO B 1 405 ? 10.007  24.675  -24.768 1.00 39.21 ? 397 PRO B O     1 
ATOM   6144 C  CB    . PRO B 1 405 ? 10.005  23.501  -21.995 1.00 38.73 ? 397 PRO B CB    1 
ATOM   6145 C  CG    . PRO B 1 405 ? 8.723   24.068  -21.379 1.00 38.57 ? 397 PRO B CG    1 
ATOM   6146 C  CD    . PRO B 1 405 ? 8.573   25.444  -21.894 1.00 38.61 ? 397 PRO B CD    1 
ATOM   6147 N  N     . VAL B 1 406 ? 12.246  24.524  -24.454 1.00 39.53 ? 398 VAL B N     1 
ATOM   6148 C  CA    . VAL B 1 406 ? 12.560  24.284  -25.872 1.00 39.91 ? 398 VAL B CA    1 
ATOM   6149 C  C     . VAL B 1 406 ? 13.592  23.166  -26.040 1.00 40.10 ? 398 VAL B C     1 
ATOM   6150 O  O     . VAL B 1 406 ? 14.032  22.569  -25.057 1.00 40.09 ? 398 VAL B O     1 
ATOM   6151 C  CB    . VAL B 1 406 ? 13.061  25.568  -26.594 1.00 39.99 ? 398 VAL B CB    1 
ATOM   6152 C  CG1   . VAL B 1 406 ? 11.893  26.500  -26.912 1.00 39.90 ? 398 VAL B CG1   1 
ATOM   6153 C  CG2   . VAL B 1 406 ? 14.125  26.273  -25.767 1.00 39.81 ? 398 VAL B CG2   1 
ATOM   6154 N  N     . ALA B 1 407 ? 13.995  22.920  -27.291 1.00 40.29 ? 399 ALA B N     1 
ATOM   6155 C  CA    . ALA B 1 407 ? 14.755  21.714  -27.667 1.00 40.47 ? 399 ALA B CA    1 
ATOM   6156 C  C     . ALA B 1 407 ? 16.126  21.571  -26.981 1.00 40.57 ? 399 ALA B C     1 
ATOM   6157 O  O     . ALA B 1 407 ? 16.683  22.547  -26.469 1.00 40.64 ? 399 ALA B O     1 
ATOM   6158 C  CB    . ALA B 1 407 ? 14.905  21.635  -29.186 1.00 40.44 ? 399 ALA B CB    1 
ATOM   6159 N  N     . ARG B 1 408 ? 16.664  20.342  -27.017 1.00 40.68 ? 400 ARG B N     1 
ATOM   6160 C  CA    . ARG B 1 408 ? 17.915  19.956  -26.314 1.00 40.60 ? 400 ARG B CA    1 
ATOM   6161 C  C     . ARG B 1 408 ? 18.179  20.683  -24.996 1.00 40.53 ? 400 ARG B C     1 
ATOM   6162 O  O     . ARG B 1 408 ? 18.580  20.064  -24.006 1.00 40.33 ? 400 ARG B O     1 
ATOM   6163 C  CB    . ARG B 1 408 ? 19.150  20.023  -27.242 1.00 40.68 ? 400 ARG B CB    1 
ATOM   6164 C  CG    . ARG B 1 408 ? 19.185  21.200  -28.214 1.00 41.06 ? 400 ARG B CG    1 
ATOM   6165 C  CD    . ARG B 1 408 ? 18.622  20.808  -29.582 1.00 41.57 ? 400 ARG B CD    1 
ATOM   6166 N  NE    . ARG B 1 408 ? 18.384  21.973  -30.430 1.00 41.92 ? 400 ARG B NE    1 
ATOM   6167 C  CZ    . ARG B 1 408 ? 17.733  21.937  -31.590 1.00 42.29 ? 400 ARG B CZ    1 
ATOM   6168 N  NH1   . ARG B 1 408 ? 17.246  20.788  -32.049 1.00 42.11 ? 400 ARG B NH1   1 
ATOM   6169 N  NH2   . ARG B 1 408 ? 17.566  23.051  -32.294 1.00 42.14 ? 400 ARG B NH2   1 
HETATM 6170 P  P1    . C2E C 2 .   ? -24.937 -2.716  -0.411  1.00 19.91 ? 501 C2E A P1    1 
HETATM 6171 O  O2P   . C2E C 2 .   ? -24.185 -3.890  0.147   1.00 19.82 ? 501 C2E A O2P   1 
HETATM 6172 O  O1P   . C2E C 2 .   ? -23.964 -1.598  -0.671  1.00 20.76 ? 501 C2E A O1P   1 
HETATM 6173 O  "O5'" . C2E C 2 .   ? -25.624 -3.157  -1.796  1.00 20.33 ? 501 C2E A "O5'" 1 
HETATM 6174 C  "C5'" . C2E C 2 .   ? -26.509 -4.276  -1.846  1.00 19.54 ? 501 C2E A "C5'" 1 
HETATM 6175 C  "C4'" . C2E C 2 .   ? -27.951 -3.785  -1.757  1.00 19.54 ? 501 C2E A "C4'" 1 
HETATM 6176 O  "O4'" . C2E C 2 .   ? -28.389 -3.339  -3.036  1.00 19.44 ? 501 C2E A "O4'" 1 
HETATM 6177 C  "C3'" . C2E C 2 .   ? -28.901 -4.908  -1.416  1.00 19.10 ? 501 C2E A "C3'" 1 
HETATM 6178 O  "O3'" . C2E C 2 .   ? -29.948 -4.367  -0.619  1.00 19.46 ? 501 C2E A "O3'" 1 
HETATM 6179 C  "C2'" . C2E C 2 .   ? -29.476 -5.289  -2.741  1.00 18.87 ? 501 C2E A "C2'" 1 
HETATM 6180 O  "O2'" . C2E C 2 .   ? -30.688 -5.818  -2.585  1.00 19.57 ? 501 C2E A "O2'" 1 
HETATM 6181 C  "C1'" . C2E C 2 .   ? -29.549 -4.139  -3.422  1.00 18.96 ? 501 C2E A "C1'" 1 
HETATM 6182 N  N9    . C2E C 2 .   ? -29.602 -4.323  -4.781  1.00 19.02 ? 501 C2E A N9    1 
HETATM 6183 C  C8    . C2E C 2 .   ? -28.911 -5.182  -5.421  1.00 18.96 ? 501 C2E A C8    1 
HETATM 6184 N  N7    . C2E C 2 .   ? -29.209 -5.083  -6.666  1.00 19.22 ? 501 C2E A N7    1 
HETATM 6185 C  C5    . C2E C 2 .   ? -30.133 -4.110  -6.863  1.00 19.08 ? 501 C2E A C5    1 
HETATM 6186 C  C6    . C2E C 2 .   ? -30.807 -3.580  -7.961  1.00 18.91 ? 501 C2E A C6    1 
HETATM 6187 O  O6    . C2E C 2 .   ? -30.602 -4.001  -9.121  1.00 18.46 ? 501 C2E A O6    1 
HETATM 6188 N  N1    . C2E C 2 .   ? -31.690 -2.582  -7.754  1.00 19.13 ? 501 C2E A N1    1 
HETATM 6189 C  C2    . C2E C 2 .   ? -31.928 -2.100  -6.502  1.00 19.07 ? 501 C2E A C2    1 
HETATM 6190 N  N2    . C2E C 2 .   ? -32.822 -1.100  -6.340  1.00 18.75 ? 501 C2E A N2    1 
HETATM 6191 N  N3    . C2E C 2 .   ? -31.283 -2.609  -5.418  1.00 19.16 ? 501 C2E A N3    1 
HETATM 6192 C  C4    . C2E C 2 .   ? -30.389 -3.605  -5.587  1.00 18.83 ? 501 C2E A C4    1 
HETATM 6193 P  P11   . C2E C 2 .   ? -29.814 -4.776  0.928   1.00 19.11 ? 501 C2E A P11   1 
HETATM 6194 O  O21   . C2E C 2 .   ? -31.264 -4.834  1.593   1.00 19.28 ? 501 C2E A O21   1 
HETATM 6195 O  O11   . C2E C 2 .   ? -29.194 -6.238  1.100   1.00 19.73 ? 501 C2E A O11   1 
HETATM 6196 O  O5A   . C2E C 2 .   ? -28.647 -3.928  1.643   1.00 20.04 ? 501 C2E A O5A   1 
HETATM 6197 C  C5A   . C2E C 2 .   ? -28.865 -2.690  2.313   1.00 20.42 ? 501 C2E A C5A   1 
HETATM 6198 C  C4A   . C2E C 2 .   ? -27.404 -2.384  2.640   1.00 20.51 ? 501 C2E A C4A   1 
HETATM 6199 O  O4A   . C2E C 2 .   ? -27.062 -2.869  3.950   1.00 21.08 ? 501 C2E A O4A   1 
HETATM 6200 C  C3A   . C2E C 2 .   ? -26.375 -3.022  1.704   1.00 20.57 ? 501 C2E A C3A   1 
HETATM 6201 O  O3A   . C2E C 2 .   ? -26.072 -2.151  0.612   1.00 20.66 ? 501 C2E A O3A   1 
HETATM 6202 C  C2A   . C2E C 2 .   ? -25.207 -3.225  2.624   1.00 20.72 ? 501 C2E A C2A   1 
HETATM 6203 O  O2A   . C2E C 2 .   ? -24.616 -2.054  2.819   1.00 19.70 ? 501 C2E A O2A   1 
HETATM 6204 C  C1A   . C2E C 2 .   ? -25.815 -3.562  3.743   1.00 21.38 ? 501 C2E A C1A   1 
HETATM 6205 N  N91   . C2E C 2 .   ? -25.463 -4.698  4.406   1.00 21.68 ? 501 C2E A N91   1 
HETATM 6206 C  C81   . C2E C 2 .   ? -25.843 -5.887  3.959   1.00 21.77 ? 501 C2E A C81   1 
HETATM 6207 N  N71   . C2E C 2 .   ? -25.256 -6.782  4.795   1.00 21.85 ? 501 C2E A N71   1 
HETATM 6208 C  C51   . C2E C 2 .   ? -24.503 -6.092  5.701   1.00 21.81 ? 501 C2E A C51   1 
HETATM 6209 C  C61   . C2E C 2 .   ? -23.706 -6.495  6.756   1.00 21.75 ? 501 C2E A C61   1 
HETATM 6210 O  O61   . C2E C 2 .   ? -23.578 -7.711  7.024   1.00 21.44 ? 501 C2E A O61   1 
HETATM 6211 N  N11   . C2E C 2 .   ? -23.060 -5.560  7.490   1.00 21.79 ? 501 C2E A N11   1 
HETATM 6212 C  C21   . C2E C 2 .   ? -23.190 -4.241  7.212   1.00 21.73 ? 501 C2E A C21   1 
HETATM 6213 N  N21   . C2E C 2 .   ? -22.534 -3.339  7.976   1.00 21.63 ? 501 C2E A N21   1 
HETATM 6214 N  N31   . C2E C 2 .   ? -23.970 -3.820  6.177   1.00 22.31 ? 501 C2E A N31   1 
HETATM 6215 C  C41   . C2E C 2 .   ? -24.619 -4.738  5.418   1.00 22.05 ? 501 C2E A C41   1 
HETATM 6216 MN MN    . MN  D 3 .   ? -22.040 -4.345  -0.536  1.00 16.90 ? 502 MN  A MN    1 
HETATM 6217 MN MN    . MN  E 3 .   ? -23.116 -1.541  -2.869  1.00 17.00 ? 503 MN  A MN    1 
HETATM 6218 N  N1    . FMN F 4 .   ? -38.008 20.656  -33.384 1.00 14.01 ? 504 FMN A N1    1 
HETATM 6219 C  C2    . FMN F 4 .   ? -38.003 21.989  -33.058 1.00 14.32 ? 504 FMN A C2    1 
HETATM 6220 O  O2    . FMN F 4 .   ? -39.075 22.586  -32.948 1.00 14.82 ? 504 FMN A O2    1 
HETATM 6221 N  N3    . FMN F 4 .   ? -36.809 22.653  -32.851 1.00 14.12 ? 504 FMN A N3    1 
HETATM 6222 C  C4    . FMN F 4 .   ? -35.622 21.974  -32.966 1.00 14.13 ? 504 FMN A C4    1 
HETATM 6223 O  O4    . FMN F 4 .   ? -34.569 22.543  -32.700 1.00 14.09 ? 504 FMN A O4    1 
HETATM 6224 C  C4A   . FMN F 4 .   ? -35.627 20.624  -33.299 1.00 14.25 ? 504 FMN A C4A   1 
HETATM 6225 N  N5    . FMN F 4 .   ? -34.444 19.934  -33.420 1.00 14.25 ? 504 FMN A N5    1 
HETATM 6226 C  C5A   . FMN F 4 .   ? -34.444 18.595  -33.751 1.00 14.16 ? 504 FMN A C5A   1 
HETATM 6227 C  C6    . FMN F 4 .   ? -33.233 17.915  -33.878 1.00 14.30 ? 504 FMN A C6    1 
HETATM 6228 C  C7    . FMN F 4 .   ? -33.218 16.563  -34.207 1.00 14.22 ? 504 FMN A C7    1 
HETATM 6229 C  C7M   . FMN F 4 .   ? -31.911 15.902  -34.532 1.00 13.78 ? 504 FMN A C7M   1 
HETATM 6230 C  C8    . FMN F 4 .   ? -34.420 15.887  -34.413 1.00 14.15 ? 504 FMN A C8    1 
HETATM 6231 C  C8M   . FMN F 4 .   ? -34.407 14.525  -35.045 1.00 14.01 ? 504 FMN A C8M   1 
HETATM 6232 C  C9    . FMN F 4 .   ? -35.630 16.572  -34.287 1.00 14.20 ? 504 FMN A C9    1 
HETATM 6233 C  C9A   . FMN F 4 .   ? -35.645 17.929  -33.958 1.00 14.41 ? 504 FMN A C9A   1 
HETATM 6234 N  N10   . FMN F 4 .   ? -36.845 18.619  -33.827 1.00 15.22 ? 504 FMN A N10   1 
HETATM 6235 C  C10   . FMN F 4 .   ? -36.829 19.965  -33.505 1.00 14.33 ? 504 FMN A C10   1 
HETATM 6236 C  "C1'" . FMN F 4 .   ? -38.137 17.979  -34.258 1.00 18.28 ? 504 FMN A "C1'" 1 
HETATM 6237 C  "C2'" . FMN F 4 .   ? -38.985 17.612  -33.044 1.00 21.51 ? 504 FMN A "C2'" 1 
HETATM 6238 O  "O2'" . FMN F 4 .   ? -38.560 16.365  -32.535 1.00 21.84 ? 504 FMN A "O2'" 1 
HETATM 6239 C  "C3'" . FMN F 4 .   ? -40.471 17.543  -33.398 1.00 23.57 ? 504 FMN A "C3'" 1 
HETATM 6240 O  "O3'" . FMN F 4 .   ? -40.666 16.592  -34.416 1.00 23.59 ? 504 FMN A "O3'" 1 
HETATM 6241 C  "C4'" . FMN F 4 .   ? -41.020 18.886  -33.867 1.00 26.39 ? 504 FMN A "C4'" 1 
HETATM 6242 O  "O4'" . FMN F 4 .   ? -40.706 19.899  -32.936 1.00 26.23 ? 504 FMN A "O4'" 1 
HETATM 6243 C  "C5'" . FMN F 4 .   ? -42.530 18.807  -34.043 1.00 29.54 ? 504 FMN A "C5'" 1 
HETATM 6244 O  "O5'" . FMN F 4 .   ? -43.058 20.108  -34.143 1.00 33.29 ? 504 FMN A "O5'" 1 
HETATM 6245 P  P     . FMN F 4 .   ? -44.383 20.385  -35.015 1.00 35.81 ? 504 FMN A P     1 
HETATM 6246 O  O1P   . FMN F 4 .   ? -45.343 19.222  -34.821 1.00 35.56 ? 504 FMN A O1P   1 
HETATM 6247 O  O2P   . FMN F 4 .   ? -45.030 21.672  -34.547 1.00 35.73 ? 504 FMN A O2P   1 
HETATM 6248 O  O3P   . FMN F 4 .   ? -44.009 20.507  -36.474 1.00 35.14 ? 504 FMN A O3P   1 
HETATM 6249 P  P1    . C2E G 2 .   ? -3.616  27.543  -4.249  1.00 25.57 ? 501 C2E B P1    1 
HETATM 6250 O  O2P   . C2E G 2 .   ? -4.285  28.783  -4.779  1.00 25.03 ? 501 C2E B O2P   1 
HETATM 6251 O  O1P   . C2E G 2 .   ? -4.404  26.332  -4.661  1.00 27.15 ? 501 C2E B O1P   1 
HETATM 6252 O  "O5'" . C2E G 2 .   ? -2.158  27.384  -4.897  1.00 26.83 ? 501 C2E B "O5'" 1 
HETATM 6253 C  "C5'" . C2E G 2 .   ? -1.271  28.483  -5.004  1.00 26.35 ? 501 C2E B "C5'" 1 
HETATM 6254 C  "C4'" . C2E G 2 .   ? -0.172  28.298  -3.977  1.00 26.48 ? 501 C2E B "C4'" 1 
HETATM 6255 O  "O4'" . C2E G 2 .   ? 0.740   27.314  -4.445  1.00 25.99 ? 501 C2E B "O4'" 1 
HETATM 6256 C  "C3'" . C2E G 2 .   ? 0.653   29.556  -3.853  1.00 26.38 ? 501 C2E B "C3'" 1 
HETATM 6257 O  "O3'" . C2E G 2 .   ? 1.179   29.631  -2.527  1.00 25.85 ? 501 C2E B "O3'" 1 
HETATM 6258 C  "C2'" . C2E G 2 .   ? 1.786   29.288  -4.789  1.00 26.44 ? 501 C2E B "C2'" 1 
HETATM 6259 O  "O2'" . C2E G 2 .   ? 2.852   29.987  -4.412  1.00 27.74 ? 501 C2E B "O2'" 1 
HETATM 6260 C  "C1'" . C2E G 2 .   ? 2.017   27.968  -4.687  1.00 25.78 ? 501 C2E B "C1'" 1 
HETATM 6261 N  N9    . C2E G 2 .   ? 2.610   27.436  -5.795  1.00 25.81 ? 501 C2E B N9    1 
HETATM 6262 C  C8    . C2E G 2 .   ? 2.331   27.756  -7.000  1.00 25.58 ? 501 C2E B C8    1 
HETATM 6263 N  N7    . C2E G 2 .   ? 3.069   27.046  -7.778  1.00 25.60 ? 501 C2E B N7    1 
HETATM 6264 C  C5    . C2E G 2 .   ? 3.861   26.216  -7.050  1.00 25.64 ? 501 C2E B C5    1 
HETATM 6265 C  C6    . C2E G 2 .   ? 4.822   25.263  -7.335  1.00 25.53 ? 501 C2E B C6    1 
HETATM 6266 O  O6    . C2E G 2 .   ? 5.124   25.007  -8.514  1.00 25.76 ? 501 C2E B O6    1 
HETATM 6267 N  N1    . C2E G 2 .   ? 5.424   24.605  -6.313  1.00 25.45 ? 501 C2E B N1    1 
HETATM 6268 C  C2    . C2E G 2 .   ? 5.097   24.879  -5.016  1.00 25.61 ? 501 C2E B C2    1 
HETATM 6269 N  N2    . C2E G 2 .   ? 5.715   24.211  -4.015  1.00 25.54 ? 501 C2E B N2    1 
HETATM 6270 N  N3    . C2E G 2 .   ? 4.160   25.816  -4.716  1.00 25.79 ? 501 C2E B N3    1 
HETATM 6271 C  C4    . C2E G 2 .   ? 3.541   26.484  -5.721  1.00 25.86 ? 501 C2E B C4    1 
HETATM 6272 P  P11   . C2E G 2 .   ? 0.287   30.557  -1.557  1.00 25.62 ? 501 C2E B P11   1 
HETATM 6273 O  O21   . C2E G 2 .   ? 1.165   30.989  -0.286  1.00 26.37 ? 501 C2E B O21   1 
HETATM 6274 O  O11   . C2E G 2 .   ? -0.143  31.904  -2.323  1.00 24.80 ? 501 C2E B O11   1 
HETATM 6275 O  O5A   . C2E G 2 .   ? -1.198  29.984  -1.267  1.00 25.26 ? 501 C2E B O5A   1 
HETATM 6276 C  C5A   . C2E G 2 .   ? -1.498  28.914  -0.369  1.00 25.13 ? 501 C2E B C5A   1 
HETATM 6277 C  C4A   . C2E G 2 .   ? -3.010  28.874  -0.617  1.00 24.45 ? 501 C2E B C4A   1 
HETATM 6278 O  O4A   . C2E G 2 .   ? -3.688  30.001  -0.038  1.00 23.10 ? 501 C2E B O4A   1 
HETATM 6279 C  C3A   . C2E G 2 .   ? -3.407  28.888  -2.093  1.00 24.34 ? 501 C2E B C3A   1 
HETATM 6280 O  O3A   . C2E G 2 .   ? -3.514  27.562  -2.623  1.00 25.85 ? 501 C2E B O3A   1 
HETATM 6281 C  C2A   . C2E G 2 .   ? -4.734  29.577  -2.076  1.00 23.66 ? 501 C2E B C2A   1 
HETATM 6282 O  O2A   . C2E G 2 .   ? -5.677  28.693  -1.763  1.00 23.76 ? 501 C2E B O2A   1 
HETATM 6283 C  C1A   . C2E G 2 .   ? -4.589  30.439  -1.080  1.00 21.87 ? 501 C2E B C1A   1 
HETATM 6284 N  N91   . C2E G 2 .   ? -5.006  31.731  -1.224  1.00 21.04 ? 501 C2E B N91   1 
HETATM 6285 C  C81   . C2E G 2 .   ? -4.264  32.612  -1.880  1.00 20.53 ? 501 C2E B C81   1 
HETATM 6286 N  N71   . C2E G 2 .   ? -5.010  33.746  -1.910  1.00 20.53 ? 501 C2E B N71   1 
HETATM 6287 C  C51   . C2E G 2 .   ? -6.204  33.491  -1.298  1.00 20.56 ? 501 C2E B C51   1 
HETATM 6288 C  C61   . C2E G 2 .   ? -7.314  34.271  -1.055  1.00 20.29 ? 501 C2E B C61   1 
HETATM 6289 O  O61   . C2E G 2 .   ? -7.331  35.461  -1.426  1.00 20.20 ? 501 C2E B O61   1 
HETATM 6290 N  N11   . C2E G 2 .   ? -8.374  33.732  -0.419  1.00 20.28 ? 501 C2E B N11   1 
HETATM 6291 C  C21   . C2E G 2 .   ? -8.360  32.438  -0.016  1.00 20.19 ? 501 C2E B C21   1 
HETATM 6292 N  N21   . C2E G 2 .   ? -9.440  31.934  0.616   1.00 20.63 ? 501 C2E B N21   1 
HETATM 6293 N  N31   . C2E G 2 .   ? -7.280  31.649  -0.241  1.00 19.98 ? 501 C2E B N31   1 
HETATM 6294 C  C41   . C2E G 2 .   ? -6.206  32.166  -0.887  1.00 20.61 ? 501 C2E B C41   1 
HETATM 6295 MN MN    . MN  H 3 .   ? -6.020  28.536  -6.312  1.00 23.14 ? 502 MN  B MN    1 
HETATM 6296 MN MN    . MN  I 3 .   ? -4.364  25.181  -6.180  1.00 29.37 ? 503 MN  B MN    1 
HETATM 6297 N  N1    . FMN J 4 .   ? 18.989  -7.902  -10.676 1.00 23.12 ? 504 FMN B N1    1 
HETATM 6298 C  C2    . FMN J 4 .   ? 18.606  -8.876  -9.782  1.00 23.20 ? 504 FMN B C2    1 
HETATM 6299 O  O2    . FMN J 4 .   ? 19.398  -9.248  -8.921  1.00 23.41 ? 504 FMN B O2    1 
HETATM 6300 N  N3    . FMN J 4 .   ? 17.330  -9.414  -9.842  1.00 23.18 ? 504 FMN B N3    1 
HETATM 6301 C  C4    . FMN J 4 .   ? 16.444  -8.986  -10.808 1.00 22.70 ? 504 FMN B C4    1 
HETATM 6302 O  O4    . FMN J 4 .   ? 15.329  -9.487  -10.875 1.00 21.91 ? 504 FMN B O4    1 
HETATM 6303 C  C4A   . FMN J 4 .   ? 16.830  -8.007  -11.716 1.00 22.96 ? 504 FMN B C4A   1 
HETATM 6304 N  N5    . FMN J 4 .   ? 15.950  -7.571  -12.688 1.00 23.11 ? 504 FMN B N5    1 
HETATM 6305 C  C5A   . FMN J 4 .   ? 16.345  -6.595  -13.588 1.00 23.12 ? 504 FMN B C5A   1 
HETATM 6306 C  C6    . FMN J 4 .   ? 15.460  -6.158  -14.566 1.00 22.87 ? 504 FMN B C6    1 
HETATM 6307 C  C7    . FMN J 4 .   ? 15.849  -5.179  -15.473 1.00 22.86 ? 504 FMN B C7    1 
HETATM 6308 C  C7M   . FMN J 4 .   ? 14.841  -4.642  -16.442 1.00 22.16 ? 504 FMN B C7M   1 
HETATM 6309 C  C8    . FMN J 4 .   ? 17.133  -4.629  -15.404 1.00 22.85 ? 504 FMN B C8    1 
HETATM 6310 C  C8M   . FMN J 4 .   ? 17.484  -3.416  -16.215 1.00 21.88 ? 504 FMN B C8M   1 
HETATM 6311 C  C9    . FMN J 4 .   ? 18.017  -5.067  -14.422 1.00 22.95 ? 504 FMN B C9    1 
HETATM 6312 C  C9A   . FMN J 4 .   ? 17.626  -6.051  -13.516 1.00 23.26 ? 504 FMN B C9A   1 
HETATM 6313 N  N10   . FMN J 4 .   ? 18.504  -6.483  -12.542 1.00 23.89 ? 504 FMN B N10   1 
HETATM 6314 C  C10   . FMN J 4 .   ? 18.111  -7.464  -11.646 1.00 23.29 ? 504 FMN B C10   1 
HETATM 6315 C  "C1'" . FMN J 4 .   ? 19.939  -6.043  -12.588 1.00 26.88 ? 504 FMN B "C1'" 1 
HETATM 6316 C  "C2'" . FMN J 4 .   ? 20.217  -5.016  -11.492 1.00 29.19 ? 504 FMN B "C2'" 1 
HETATM 6317 O  "O2'" . FMN J 4 .   ? 19.781  -3.749  -11.917 1.00 28.98 ? 504 FMN B "O2'" 1 
HETATM 6318 C  "C3'" . FMN J 4 .   ? 21.704  -4.958  -11.164 1.00 31.23 ? 504 FMN B "C3'" 1 
HETATM 6319 O  "O3'" . FMN J 4 .   ? 22.440  -4.784  -12.353 1.00 31.14 ? 504 FMN B "O3'" 1 
HETATM 6320 C  "C4'" . FMN J 4 .   ? 22.150  -6.233  -10.457 1.00 33.62 ? 504 FMN B "C4'" 1 
HETATM 6321 O  "O4'" . FMN J 4 .   ? 21.982  -6.072  -9.068  1.00 34.20 ? 504 FMN B "O4'" 1 
HETATM 6322 C  "C5'" . FMN J 4 .   ? 23.605  -6.575  -10.773 1.00 36.34 ? 504 FMN B "C5'" 1 
HETATM 6323 O  "O5'" . FMN J 4 .   ? 24.452  -6.078  -9.758  1.00 39.36 ? 504 FMN B "O5'" 1 
HETATM 6324 P  P     . FMN J 4 .   ? 25.673  -6.972  -9.200  1.00 41.66 ? 504 FMN B P     1 
HETATM 6325 O  O1P   . FMN J 4 .   ? 26.974  -6.276  -9.549  1.00 41.15 ? 504 FMN B O1P   1 
HETATM 6326 O  O2P   . FMN J 4 .   ? 25.557  -7.116  -7.698  1.00 41.12 ? 504 FMN B O2P   1 
HETATM 6327 O  O3P   . FMN J 4 .   ? 25.629  -8.344  -9.846  1.00 41.14 ? 504 FMN B O3P   1 
HETATM 6328 O  O     . HOH K 5 .   ? -22.671 26.931  -44.829 1.00 12.51 ? 406 HOH A O     1 
HETATM 6329 O  O     . HOH K 5 .   ? -5.593  -18.314 14.622  1.00 19.18 ? 407 HOH A O     1 
HETATM 6330 O  O     . HOH K 5 .   ? -23.189 -0.829  1.791   1.00 10.32 ? 408 HOH A O     1 
HETATM 6331 O  O     . HOH K 5 .   ? -22.668 -3.881  -2.758  1.00 12.47 ? 409 HOH A O     1 
HETATM 6332 O  O     . HOH K 5 .   ? -26.031 1.707   -1.128  1.00 28.80 ? 410 HOH A O     1 
HETATM 6333 O  O     . HOH K 5 .   ? -39.900 18.078  -38.087 1.00 19.06 ? 411 HOH A O     1 
HETATM 6334 O  O     . HOH K 5 .   ? -11.889 7.689   -20.025 1.00 16.46 ? 412 HOH A O     1 
HETATM 6335 O  O     . HOH K 5 .   ? -42.036 25.075  -37.934 1.00 22.15 ? 413 HOH A O     1 
HETATM 6336 O  O     . HOH K 5 .   ? -6.450  26.167  -36.469 1.00 36.95 ? 414 HOH A O     1 
HETATM 6337 O  O     . HOH K 5 .   ? -39.853 -10.002 8.285   1.00 35.90 ? 415 HOH A O     1 
HETATM 6338 O  O     . HOH K 5 .   ? -47.385 21.077  -33.730 1.00 28.06 ? 416 HOH A O     1 
HETATM 6339 O  O     . HOH K 5 .   ? -32.903 -13.256 -12.121 1.00 14.97 ? 417 HOH A O     1 
HETATM 6340 O  O     . HOH K 5 .   ? -30.878 27.578  -40.729 1.00 13.86 ? 418 HOH A O     1 
HETATM 6341 O  O     . HOH K 5 .   ? -22.802 -8.984  4.800   1.00 10.85 ? 419 HOH A O     1 
HETATM 6342 O  O     . HOH K 5 .   ? -20.338 -1.968  2.806   1.00 15.78 ? 420 HOH A O     1 
HETATM 6343 O  O     . HOH K 5 .   ? -35.380 24.585  -11.697 1.00 21.92 ? 421 HOH A O     1 
HETATM 6344 O  O     . HOH K 5 .   ? -27.248 32.168  -38.118 1.00 15.09 ? 422 HOH A O     1 
HETATM 6345 O  O     . HOH K 5 .   ? -29.963 12.519  -43.402 1.00 12.93 ? 423 HOH A O     1 
HETATM 6346 O  O     . HOH K 5 .   ? -26.349 -5.202  25.265  1.00 32.75 ? 424 HOH A O     1 
HETATM 6347 O  O     . HOH K 5 .   ? -36.257 -11.473 2.768   1.00 34.19 ? 425 HOH A O     1 
HETATM 6348 O  O     . HOH K 5 .   ? -25.485 8.941   -28.530 1.00 46.60 ? 426 HOH A O     1 
HETATM 6349 O  O     . HOH K 5 .   ? -21.488 27.173  -21.915 1.00 28.44 ? 427 HOH A O     1 
HETATM 6350 O  O     . HOH K 5 .   ? -23.191 22.007  -43.598 1.00 19.94 ? 428 HOH A O     1 
HETATM 6351 O  O     . HOH K 5 .   ? -14.582 -15.186 -10.122 1.00 22.63 ? 429 HOH A O     1 
HETATM 6352 O  O     . HOH K 5 .   ? -19.816 -2.826  19.241  1.00 37.57 ? 430 HOH A O     1 
HETATM 6353 O  O     . HOH K 5 .   ? -28.755 1.492   -45.197 1.00 23.90 ? 431 HOH A O     1 
HETATM 6354 O  O     . HOH K 5 .   ? -10.661 -3.468  -14.475 1.00 11.20 ? 432 HOH A O     1 
HETATM 6355 O  O     . HOH K 5 .   ? -42.021 14.296  -31.502 1.00 17.47 ? 433 HOH A O     1 
HETATM 6356 O  O     . HOH K 5 .   ? -32.569 -1.615  20.150  1.00 26.06 ? 434 HOH A O     1 
HETATM 6357 O  O     . HOH K 5 .   ? -13.651 24.439  -44.617 1.00 31.50 ? 435 HOH A O     1 
HETATM 6358 O  O     . HOH K 5 .   ? -28.644 -23.693 12.283  1.00 27.82 ? 436 HOH A O     1 
HETATM 6359 O  O     . HOH K 5 .   ? -15.606 19.128  -39.866 1.00 24.57 ? 437 HOH A O     1 
HETATM 6360 O  O     . HOH K 5 .   ? -17.261 -25.388 1.276   1.00 34.07 ? 438 HOH A O     1 
HETATM 6361 O  O     . HOH K 5 .   ? -33.973 -4.983  2.307   1.00 10.36 ? 439 HOH A O     1 
HETATM 6362 O  O     . HOH K 5 .   ? -35.400 -8.564  -22.338 1.00 11.17 ? 440 HOH A O     1 
HETATM 6363 O  O     . HOH K 5 .   ? -27.825 -15.693 -5.381  1.00 22.97 ? 441 HOH A O     1 
HETATM 6364 O  O     . HOH K 5 .   ? -6.932  -4.519  -15.254 1.00 33.09 ? 442 HOH A O     1 
HETATM 6365 O  O     . HOH K 5 .   ? -27.718 -1.638  -5.176  1.00 28.44 ? 443 HOH A O     1 
HETATM 6366 O  O     . HOH K 5 .   ? -9.761  -16.534 16.400  1.00 21.02 ? 444 HOH A O     1 
HETATM 6367 O  O     . HOH K 5 .   ? -20.293 27.037  -45.260 1.00 17.88 ? 445 HOH A O     1 
HETATM 6368 O  O     . HOH K 5 .   ? -13.112 -14.976 -16.272 1.00 40.03 ? 446 HOH A O     1 
HETATM 6369 O  O     . HOH K 5 .   ? -21.156 10.939  -23.156 1.00 16.63 ? 447 HOH A O     1 
HETATM 6370 O  O     . HOH K 5 .   ? -6.351  13.778  3.206   1.00 32.81 ? 448 HOH A O     1 
HETATM 6371 O  O     . HOH K 5 .   ? -28.498 -23.182 3.232   1.00 38.62 ? 449 HOH A O     1 
HETATM 6372 O  O     . HOH K 5 .   ? -25.933 -14.273 -26.546 1.00 13.86 ? 450 HOH A O     1 
HETATM 6373 O  O     . HOH K 5 .   ? -28.304 -22.702 -2.677  1.00 23.73 ? 451 HOH A O     1 
HETATM 6374 O  O     . HOH K 5 .   ? -5.544  -10.136 13.645  1.00 35.08 ? 452 HOH A O     1 
HETATM 6375 O  O     . HOH K 5 .   ? -29.148 25.609  -41.690 1.00 16.64 ? 453 HOH A O     1 
HETATM 6376 O  O     . HOH K 5 .   ? -13.936 21.541  -38.913 1.00 38.25 ? 454 HOH A O     1 
HETATM 6377 O  O     . HOH K 5 .   ? -36.790 -2.440  6.490   1.00 25.89 ? 455 HOH A O     1 
HETATM 6378 O  O     . HOH K 5 .   ? -4.413  -10.064 -0.125  1.00 29.88 ? 456 HOH A O     1 
HETATM 6379 O  O     . HOH K 5 .   ? -26.176 33.150  -34.098 1.00 17.25 ? 457 HOH A O     1 
HETATM 6380 O  O     . HOH K 5 .   ? -18.834 34.797  -31.505 1.00 43.45 ? 458 HOH A O     1 
HETATM 6381 O  O     . HOH K 5 .   ? -33.773 -11.824 0.997   1.00 21.16 ? 459 HOH A O     1 
HETATM 6382 O  O     . HOH K 5 .   ? -29.206 35.285  -37.784 1.00 24.95 ? 460 HOH A O     1 
HETATM 6383 O  O     . HOH K 5 .   ? -12.855 -5.080  -14.033 1.00 19.47 ? 461 HOH A O     1 
HETATM 6384 O  O     . HOH K 5 .   ? -26.110 -8.849  -29.923 1.00 35.77 ? 462 HOH A O     1 
HETATM 6385 O  O     . HOH K 5 .   ? -8.880  -5.410  14.404  1.00 29.82 ? 463 HOH A O     1 
HETATM 6386 O  O     . HOH K 5 .   ? -24.894 26.390  -12.121 1.00 28.01 ? 464 HOH A O     1 
HETATM 6387 O  O     . HOH K 5 .   ? -23.182 30.610  -19.437 1.00 21.00 ? 465 HOH A O     1 
HETATM 6388 O  O     . HOH K 5 .   ? -36.160 -2.077  -8.577  1.00 16.75 ? 466 HOH A O     1 
HETATM 6389 O  O     . HOH K 5 .   ? -9.329  22.694  -33.156 1.00 24.71 ? 467 HOH A O     1 
HETATM 6390 O  O     . HOH K 5 .   ? -14.437 27.986  -42.264 1.00 28.26 ? 468 HOH A O     1 
HETATM 6391 O  O     . HOH K 5 .   ? -32.127 11.497  -23.097 1.00 29.46 ? 469 HOH A O     1 
HETATM 6392 O  O     . HOH K 5 .   ? -30.549 16.364  -45.520 1.00 15.63 ? 470 HOH A O     1 
HETATM 6393 O  O     . HOH K 5 .   ? -1.439  -4.768  10.557  1.00 36.23 ? 471 HOH A O     1 
HETATM 6394 O  O     . HOH K 5 .   ? -22.071 -23.984 -4.814  1.00 29.72 ? 472 HOH A O     1 
HETATM 6395 O  O     . HOH K 5 .   ? -7.542  -7.161  13.152  1.00 19.53 ? 473 HOH A O     1 
HETATM 6396 O  O     . HOH K 5 .   ? -39.669 21.927  -35.671 1.00 19.80 ? 474 HOH A O     1 
HETATM 6397 O  O     . HOH K 5 .   ? -17.459 12.190  -27.714 1.00 13.20 ? 475 HOH A O     1 
HETATM 6398 O  O     . HOH K 5 .   ? -7.508  28.594  -36.662 1.00 21.46 ? 476 HOH A O     1 
HETATM 6399 O  O     . HOH K 5 .   ? -19.210 10.232  -28.216 1.00 39.18 ? 477 HOH A O     1 
HETATM 6400 O  O     . HOH K 5 .   ? -38.283 19.953  -37.228 1.00 26.67 ? 478 HOH A O     1 
HETATM 6401 O  O     . HOH L 5 .   ? -2.263  22.407  -4.963  1.00 29.46 ? 406 HOH B O     1 
HETATM 6402 O  O     . HOH L 5 .   ? -4.502  27.201  -7.304  1.00 15.07 ? 407 HOH B O     1 
HETATM 6403 O  O     . HOH L 5 .   ? -25.206 45.191  -8.982  1.00 24.48 ? 408 HOH B O     1 
HETATM 6404 O  O     . HOH L 5 .   ? 5.341   35.581  -3.652  1.00 17.07 ? 409 HOH B O     1 
HETATM 6405 O  O     . HOH L 5 .   ? 8.897   42.280  2.558   1.00 29.39 ? 410 HOH B O     1 
HETATM 6406 O  O     . HOH L 5 .   ? 7.827   3.382   -18.302 1.00 23.49 ? 411 HOH B O     1 
HETATM 6407 O  O     . HOH L 5 .   ? 25.760  -6.197  -5.485  1.00 25.92 ? 412 HOH B O     1 
HETATM 6408 O  O     . HOH L 5 .   ? 11.134  29.767  -12.951 1.00 23.71 ? 413 HOH B O     1 
HETATM 6409 O  O     . HOH L 5 .   ? -3.336  21.896  -1.790  1.00 20.89 ? 414 HOH B O     1 
HETATM 6410 O  O     . HOH L 5 .   ? -5.945  10.924  -20.875 1.00 15.72 ? 415 HOH B O     1 
HETATM 6411 O  O     . HOH L 5 .   ? -14.225 39.569  -22.290 1.00 33.79 ? 416 HOH B O     1 
HETATM 6412 O  O     . HOH L 5 .   ? 11.327  34.733  -20.846 1.00 27.81 ? 417 HOH B O     1 
HETATM 6413 O  O     . HOH L 5 .   ? 8.816   -6.081  7.441   1.00 31.17 ? 418 HOH B O     1 
HETATM 6414 O  O     . HOH L 5 .   ? -1.986  47.475  6.344   1.00 16.11 ? 419 HOH B O     1 
HETATM 6415 O  O     . HOH L 5 .   ? -8.029  21.612  -20.849 1.00 10.59 ? 420 HOH B O     1 
HETATM 6416 O  O     . HOH L 5 .   ? 16.644  -2.792  2.099   1.00 22.86 ? 421 HOH B O     1 
HETATM 6417 O  O     . HOH L 5 .   ? -1.694  7.574   -21.679 1.00 33.90 ? 422 HOH B O     1 
HETATM 6418 O  O     . HOH L 5 .   ? -16.018 27.805  3.781   1.00 22.07 ? 423 HOH B O     1 
HETATM 6419 O  O     . HOH L 5 .   ? 1.088   34.878  -23.607 1.00 21.86 ? 424 HOH B O     1 
HETATM 6420 O  O     . HOH L 5 .   ? -3.320  -2.389  -27.588 1.00 22.31 ? 425 HOH B O     1 
HETATM 6421 O  O     . HOH L 5 .   ? -9.218  47.838  -17.531 1.00 30.51 ? 426 HOH B O     1 
HETATM 6422 O  O     . HOH L 5 .   ? 4.468   30.303  -2.464  1.00 22.02 ? 427 HOH B O     1 
HETATM 6423 O  O     . HOH L 5 .   ? 7.010   40.612  -17.274 1.00 26.24 ? 428 HOH B O     1 
HETATM 6424 O  O     . HOH L 5 .   ? 18.940  24.125  -25.960 1.00 44.14 ? 429 HOH B O     1 
HETATM 6425 O  O     . HOH L 5 .   ? -2.860  24.438  -3.649  1.00 29.50 ? 430 HOH B O     1 
HETATM 6426 O  O     . HOH L 5 .   ? -7.261  35.229  -4.302  1.00 16.56 ? 431 HOH B O     1 
HETATM 6427 O  O     . HOH L 5 .   ? -15.737 35.048  8.971   1.00 27.40 ? 432 HOH B O     1 
HETATM 6428 O  O     . HOH L 5 .   ? 3.441   29.289  -13.526 1.00 27.69 ? 433 HOH B O     1 
HETATM 6429 O  O     . HOH L 5 .   ? 19.024  5.244   -17.716 1.00 33.27 ? 434 HOH B O     1 
HETATM 6430 O  O     . HOH L 5 .   ? 22.058  -1.169  -24.289 1.00 32.61 ? 435 HOH B O     1 
HETATM 6431 O  O     . HOH L 5 .   ? 18.168  1.197   -0.136  1.00 30.74 ? 436 HOH B O     1 
HETATM 6432 O  O     . HOH L 5 .   ? -16.543 37.568  7.748   1.00 17.12 ? 437 HOH B O     1 
HETATM 6433 O  O     . HOH L 5 .   ? -22.149 42.633  -22.655 1.00 43.56 ? 438 HOH B O     1 
HETATM 6434 O  O     . HOH L 5 .   ? 3.682   43.689  -14.271 1.00 24.71 ? 439 HOH B O     1 
HETATM 6435 O  O     . HOH L 5 .   ? 16.285  23.330  -18.226 1.00 39.41 ? 440 HOH B O     1 
HETATM 6436 O  O     . HOH L 5 .   ? 1.487   51.358  -0.459  1.00 26.47 ? 441 HOH B O     1 
HETATM 6437 O  O     . HOH L 5 .   ? 13.522  6.066   -13.729 1.00 15.00 ? 442 HOH B O     1 
HETATM 6438 O  O     . HOH L 5 .   ? 0.843   3.889   -15.533 1.00 29.19 ? 443 HOH B O     1 
HETATM 6439 O  O     . HOH L 5 .   ? -0.603  45.313  1.339   1.00 36.56 ? 444 HOH B O     1 
HETATM 6440 O  O     . HOH L 5 .   ? 22.509  -7.330  -19.992 1.00 25.48 ? 445 HOH B O     1 
HETATM 6441 O  O     . HOH L 5 .   ? 13.267  6.105   -10.721 1.00 17.65 ? 446 HOH B O     1 
HETATM 6442 O  O     . HOH L 5 .   ? 20.647  7.556   -25.777 1.00 24.86 ? 447 HOH B O     1 
HETATM 6443 O  O     . HOH L 5 .   ? 14.756  -17.160 -6.197  1.00 25.75 ? 448 HOH B O     1 
HETATM 6444 O  O     . HOH L 5 .   ? 11.255  -8.387  6.190   1.00 35.86 ? 449 HOH B O     1 
HETATM 6445 O  O     . HOH L 5 .   ? -20.669 14.551  -21.796 1.00 22.45 ? 450 HOH B O     1 
HETATM 6446 O  O     . HOH L 5 .   ? 22.755  -7.991  -14.795 1.00 29.98 ? 451 HOH B O     1 
HETATM 6447 O  O     . HOH L 5 .   ? -16.076 12.906  -26.003 1.00 20.10 ? 452 HOH B O     1 
HETATM 6448 O  O     . HOH L 5 .   ? 0.110   -8.463  -3.019  1.00 41.98 ? 453 HOH B O     1 
HETATM 6449 O  O     . HOH L 5 .   ? -12.800 14.321  -28.138 1.00 27.90 ? 454 HOH B O     1 
HETATM 6450 O  O     . HOH L 5 .   ? 3.436   -13.892 -34.034 1.00 33.79 ? 455 HOH B O     1 
HETATM 6451 O  O     . HOH L 5 .   ? -11.719 47.291  -7.843  1.00 35.47 ? 456 HOH B O     1 
HETATM 6452 O  O     . HOH L 5 .   ? 9.315   33.809  -12.798 1.00 16.46 ? 457 HOH B O     1 
HETATM 6453 O  O     . HOH L 5 .   ? 10.022  -19.880 -18.784 1.00 35.57 ? 458 HOH B O     1 
HETATM 6454 O  O     . HOH L 5 .   ? 14.662  32.763  -18.438 1.00 29.54 ? 459 HOH B O     1 
HETATM 6455 O  O     . HOH L 5 .   ? -0.173  36.590  11.028  1.00 26.34 ? 460 HOH B O     1 
HETATM 6456 O  O     . HOH L 5 .   ? -9.340  28.408  -4.115  1.00 28.53 ? 461 HOH B O     1 
HETATM 6457 O  O     . HOH L 5 .   ? 7.705   44.122  3.540   1.00 25.86 ? 462 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   -7  ?   ?   ?   A . n 
A 1 2   SER 2   -6  ?   ?   ?   A . n 
A 1 3   GLU 3   -5  ?   ?   ?   A . n 
A 1 4   PHE 4   -4  ?   ?   ?   A . n 
A 1 5   GLY 5   -3  ?   ?   ?   A . n 
A 1 6   SER 6   -2  ?   ?   ?   A . n 
A 1 7   SER 7   -1  ?   ?   ?   A . n 
A 1 8   ARG 8   0   ?   ?   ?   A . n 
A 1 9   MET 9   1   1   MET MET A . n 
A 1 10  LEU 10  2   2   LEU LEU A . n 
A 1 11  THR 11  3   3   THR THR A . n 
A 1 12  THR 12  4   4   THR THR A . n 
A 1 13  LEU 13  5   5   LEU LEU A . n 
A 1 14  ILE 14  6   6   ILE ILE A . n 
A 1 15  TYR 15  7   7   TYR TYR A . n 
A 1 16  ARG 16  8   8   ARG ARG A . n 
A 1 17  SER 17  9   9   SER SER A . n 
A 1 18  GLN 18  10  10  GLN GLN A . n 
A 1 19  VAL 19  11  11  VAL VAL A . n 
A 1 20  HIS 20  12  12  HIS HIS A . n 
A 1 21  PRO 21  13  13  PRO PRO A . n 
A 1 22  ASP 22  14  14  ASP ASP A . n 
A 1 23  ARG 23  15  15  ARG ARG A . n 
A 1 24  PRO 24  16  16  PRO PRO A . n 
A 1 25  PRO 25  17  17  PRO PRO A . n 
A 1 26  VAL 26  18  18  VAL VAL A . n 
A 1 27  ASP 27  19  19  ASP ASP A . n 
A 1 28  LEU 28  20  20  LEU LEU A . n 
A 1 29  ASP 29  21  21  ASP ASP A . n 
A 1 30  ALA 30  22  22  ALA ALA A . n 
A 1 31  LEU 31  23  23  LEU LEU A . n 
A 1 32  VAL 32  24  24  VAL VAL A . n 
A 1 33  HIS 33  25  25  HIS HIS A . n 
A 1 34  ARG 34  26  26  ARG ARG A . n 
A 1 35  ALA 35  27  27  ALA ALA A . n 
A 1 36  SER 36  28  28  SER SER A . n 
A 1 37  SER 37  29  29  SER SER A . n 
A 1 38  LYS 38  30  30  LYS LYS A . n 
A 1 39  ASN 39  31  31  ASN ASN A . n 
A 1 40  LEU 40  32  32  LEU LEU A . n 
A 1 41  PRO 41  33  33  PRO PRO A . n 
A 1 42  LEU 42  34  34  LEU LEU A . n 
A 1 43  GLY 43  35  35  GLY GLY A . n 
A 1 44  ILE 44  36  36  ILE ILE A . n 
A 1 45  THR 45  37  37  THR THR A . n 
A 1 46  GLY 46  38  38  GLY GLY A . n 
A 1 47  ILE 47  39  39  ILE ILE A . n 
A 1 48  LEU 48  40  40  LEU LEU A . n 
A 1 49  LEU 49  41  41  LEU LEU A . n 
A 1 50  PHE 50  42  42  PHE PHE A . n 
A 1 51  ASN 51  43  43  ASN ASN A . n 
A 1 52  GLY 52  44  44  GLY GLY A . n 
A 1 53  LEU 53  45  45  LEU LEU A . n 
A 1 54  GLN 54  46  46  GLN GLN A . n 
A 1 55  PHE 55  47  47  PHE PHE A . n 
A 1 56  PHE 56  48  48  PHE PHE A . n 
A 1 57  GLN 57  49  49  GLN GLN A . n 
A 1 58  VAL 58  50  50  VAL VAL A . n 
A 1 59  LEU 59  51  51  LEU LEU A . n 
A 1 60  GLU 60  52  52  GLU GLU A . n 
A 1 61  GLY 61  53  53  GLY GLY A . n 
A 1 62  THR 62  54  54  THR THR A . n 
A 1 63  GLU 63  55  55  GLU GLU A . n 
A 1 64  GLU 64  56  56  GLU GLU A . n 
A 1 65  ALA 65  57  57  ALA ALA A . n 
A 1 66  LEU 66  58  58  LEU LEU A . n 
A 1 67  GLU 67  59  59  GLU GLU A . n 
A 1 68  SER 68  60  60  SER SER A . n 
A 1 69  LEU 69  61  61  LEU LEU A . n 
A 1 70  PHE 70  62  62  PHE PHE A . n 
A 1 71  SER 71  63  63  SER SER A . n 
A 1 72  GLU 72  64  64  GLU GLU A . n 
A 1 73  ILE 73  65  65  ILE ILE A . n 
A 1 74  GLN 74  66  66  GLN GLN A . n 
A 1 75  SER 75  67  67  SER SER A . n 
A 1 76  ASP 76  68  68  ASP ASP A . n 
A 1 77  PRO 77  69  69  PRO PRO A . n 
A 1 78  ARG 78  70  70  ARG ARG A . n 
A 1 79  HIS 79  71  71  HIS HIS A . n 
A 1 80  ARG 80  72  72  ARG ARG A . n 
A 1 81  ASP 81  73  73  ASP ASP A . n 
A 1 82  VAL 82  74  74  VAL VAL A . n 
A 1 83  VAL 83  75  75  VAL VAL A . n 
A 1 84  GLU 84  76  76  GLU GLU A . n 
A 1 85  LEU 85  77  77  LEU LEU A . n 
A 1 86  MET 86  78  78  MET MET A . n 
A 1 87  ARG 87  79  79  ARG ARG A . n 
A 1 88  ASP 88  80  80  ASP ASP A . n 
A 1 89  TYR 89  81  81  TYR TYR A . n 
A 1 90  SER 90  82  82  SER SER A . n 
A 1 91  ALA 91  83  83  ALA ALA A . n 
A 1 92  TYR 92  84  84  TYR TYR A . n 
A 1 93  ARG 93  85  85  ARG ARG A . n 
A 1 94  ARG 94  86  86  ARG ARG A . n 
A 1 95  PHE 95  87  87  PHE PHE A . n 
A 1 96  HIS 96  88  88  HIS HIS A . n 
A 1 97  GLY 97  89  89  GLY GLY A . n 
A 1 98  THR 98  90  90  THR THR A . n 
A 1 99  GLY 99  91  91  GLY GLY A . n 
A 1 100 MET 100 92  92  MET MET A . n 
A 1 101 ARG 101 93  93  ARG ARG A . n 
A 1 102 ILE 102 94  94  ILE ILE A . n 
A 1 103 LEU 103 95  95  LEU LEU A . n 
A 1 104 ASP 104 96  96  ASP ASP A . n 
A 1 105 LEU 105 97  97  LEU LEU A . n 
A 1 106 ARG 106 98  98  ARG ARG A . n 
A 1 107 LEU 107 99  99  LEU LEU A . n 
A 1 108 PHE 108 100 100 PHE PHE A . n 
A 1 109 GLU 109 101 101 GLU GLU A . n 
A 1 110 THR 110 102 102 THR THR A . n 
A 1 111 ASP 111 103 103 ASP ASP A . n 
A 1 112 GLY 112 104 104 GLY GLY A . n 
A 1 113 ALA 113 105 105 ALA ALA A . n 
A 1 114 LEU 114 106 106 LEU LEU A . n 
A 1 115 GLU 115 107 107 GLU GLU A . n 
A 1 116 GLU 116 108 108 GLU GLU A . n 
A 1 117 ILE 117 109 109 ILE ILE A . n 
A 1 118 LEU 118 110 110 LEU LEU A . n 
A 1 119 ARG 119 111 111 ARG ARG A . n 
A 1 120 PHE 120 112 112 PHE PHE A . n 
A 1 121 SER 121 113 113 SER SER A . n 
A 1 122 THR 122 114 114 THR THR A . n 
A 1 123 PHE 123 115 ?   ?   ?   A . n 
A 1 124 GLY 124 116 ?   ?   ?   A . n 
A 1 125 VAL 125 117 ?   ?   ?   A . n 
A 1 126 THR 126 118 ?   ?   ?   A . n 
A 1 127 GLU 127 119 ?   ?   ?   A . n 
A 1 128 PRO 128 120 120 PRO PRO A . n 
A 1 129 VAL 129 121 121 VAL VAL A . n 
A 1 130 ASN 130 122 122 ASN ASN A . n 
A 1 131 ASP 131 123 123 ASP ASP A . n 
A 1 132 ARG 132 124 124 ARG ARG A . n 
A 1 133 MET 133 125 125 MET MET A . n 
A 1 134 PHE 134 126 126 PHE PHE A . n 
A 1 135 ARG 135 127 127 ARG ARG A . n 
A 1 136 LEU 136 128 128 LEU LEU A . n 
A 1 137 LEU 137 129 129 LEU LEU A . n 
A 1 138 SER 138 130 130 SER SER A . n 
A 1 139 ALA 139 131 131 ALA ALA A . n 
A 1 140 PHE 140 132 132 PHE PHE A . n 
A 1 141 ILE 141 133 133 ILE ILE A . n 
A 1 142 ALA 142 134 134 ALA ALA A . n 
A 1 143 ASP 143 135 135 ASP ASP A . n 
A 1 144 GLY 144 136 136 GLY GLY A . n 
A 1 145 GLY 145 137 137 GLY GLY A . n 
A 1 146 ARG 146 138 138 ARG ARG A . n 
A 1 147 TYR 147 139 139 TYR TYR A . n 
A 1 148 CYS 148 140 140 CYS CYS A . n 
A 1 149 LEU 149 141 141 LEU LEU A . n 
A 1 150 PRO 150 142 142 PRO PRO A . n 
A 1 151 GLU 151 143 143 GLU GLU A . n 
A 1 152 PRO 152 144 144 PRO PRO A . n 
A 1 153 LEU 153 145 145 LEU LEU A . n 
A 1 154 GLN 154 146 146 GLN GLN A . n 
A 1 155 PRO 155 147 147 PRO PRO A . n 
A 1 156 SER 156 148 148 SER SER A . n 
A 1 157 ARG 157 149 149 ARG ARG A . n 
A 1 158 TRP 158 150 150 TRP TRP A . n 
A 1 159 MET 159 151 151 MET MET A . n 
A 1 160 MET 160 152 152 MET MET A . n 
A 1 161 MET 161 153 153 MET MET A . n 
A 1 162 PRO 162 154 154 PRO PRO A . n 
A 1 163 ALA 163 155 ?   ?   ?   A . n 
A 1 164 SER 164 156 ?   ?   ?   A . n 
A 1 165 GLY 165 157 ?   ?   ?   A . n 
A 1 166 THR 166 158 158 THR THR A . n 
A 1 167 ALA 167 159 159 ALA ALA A . n 
A 1 168 ALA 168 160 160 ALA ALA A . n 
A 1 169 PRO 169 161 161 PRO PRO A . n 
A 1 170 GLN 170 162 162 GLN GLN A . n 
A 1 171 HIS 171 163 163 HIS HIS A . n 
A 1 172 LEU 172 164 164 LEU LEU A . n 
A 1 173 PRO 173 165 165 PRO PRO A . n 
A 1 174 GLY 174 166 166 GLY GLY A . n 
A 1 175 GLN 175 167 167 GLN GLN A . n 
A 1 176 PRO 176 168 168 PRO PRO A . n 
A 1 177 CYS 177 169 169 CYS CYS A . n 
A 1 178 GLN 178 170 170 GLN GLN A . n 
A 1 179 PHE 179 171 171 PHE PHE A . n 
A 1 180 ALA 180 172 172 ALA ALA A . n 
A 1 181 LEU 181 173 173 LEU LEU A . n 
A 1 182 GLN 182 174 174 GLN GLN A . n 
A 1 183 ALA 183 175 175 ALA ALA A . n 
A 1 184 ILE 184 176 176 ILE ILE A . n 
A 1 185 VAL 185 177 177 VAL VAL A . n 
A 1 186 GLU 186 178 178 GLU GLU A . n 
A 1 187 PRO 187 179 179 PRO PRO A . n 
A 1 188 ALA 188 180 180 ALA ALA A . n 
A 1 189 LYS 189 181 181 LYS LYS A . n 
A 1 190 LYS 190 182 182 LYS LYS A . n 
A 1 191 ARG 191 183 183 ARG ARG A . n 
A 1 192 VAL 192 184 184 VAL VAL A . n 
A 1 193 SER 193 185 185 SER SER A . n 
A 1 194 SER 194 186 186 SER SER A . n 
A 1 195 PHE 195 187 187 PHE PHE A . n 
A 1 196 GLU 196 188 188 GLU GLU A . n 
A 1 197 ALA 197 189 189 ALA ALA A . n 
A 1 198 LEU 198 190 190 LEU LEU A . n 
A 1 199 ILE 199 191 191 ILE ILE A . n 
A 1 200 ARG 200 192 192 ARG ARG A . n 
A 1 201 SER 201 193 193 SER SER A . n 
A 1 202 PRO 202 194 194 PRO PRO A . n 
A 1 203 THR 203 195 195 THR THR A . n 
A 1 204 GLY 204 196 196 GLY GLY A . n 
A 1 205 GLY 205 197 197 GLY GLY A . n 
A 1 206 SER 206 198 198 SER SER A . n 
A 1 207 PRO 207 199 199 PRO PRO A . n 
A 1 208 VAL 208 200 200 VAL VAL A . n 
A 1 209 GLU 209 201 201 GLU GLU A . n 
A 1 210 MET 210 202 202 MET MET A . n 
A 1 211 PHE 211 203 203 PHE PHE A . n 
A 1 212 ALA 212 204 204 ALA ALA A . n 
A 1 213 ALA 213 205 205 ALA ALA A . n 
A 1 214 ILE 214 206 206 ILE ILE A . n 
A 1 215 ALA 215 207 207 ALA ALA A . n 
A 1 216 ALA 216 208 208 ALA ALA A . n 
A 1 217 GLU 217 209 209 GLU GLU A . n 
A 1 218 ASP 218 210 210 ASP ASP A . n 
A 1 219 ARG 219 211 211 ARG ARG A . n 
A 1 220 TYR 220 212 212 TYR TYR A . n 
A 1 221 ARG 221 213 213 ARG ARG A . n 
A 1 222 PHE 222 214 214 PHE PHE A . n 
A 1 223 ASP 223 215 215 ASP ASP A . n 
A 1 224 LEU 224 216 216 LEU LEU A . n 
A 1 225 GLU 225 217 217 GLU GLU A . n 
A 1 226 SER 226 218 218 SER SER A . n 
A 1 227 LYS 227 219 219 LYS LYS A . n 
A 1 228 ALA 228 220 220 ALA ALA A . n 
A 1 229 TYR 229 221 221 TYR TYR A . n 
A 1 230 ALA 230 222 222 ALA ALA A . n 
A 1 231 PHE 231 223 223 PHE PHE A . n 
A 1 232 ALA 232 224 224 ALA ALA A . n 
A 1 233 LEU 233 225 225 LEU LEU A . n 
A 1 234 ALA 234 226 226 ALA ALA A . n 
A 1 235 GLY 235 227 227 GLY GLY A . n 
A 1 236 GLN 236 228 228 GLN GLN A . n 
A 1 237 LEU 237 229 229 LEU LEU A . n 
A 1 238 PRO 238 230 230 PRO PRO A . n 
A 1 239 LEU 239 231 231 LEU LEU A . n 
A 1 240 GLY 240 232 232 GLY GLY A . n 
A 1 241 LYS 241 233 233 LYS LYS A . n 
A 1 242 HIS 242 234 234 HIS HIS A . n 
A 1 243 GLN 243 235 235 GLN GLN A . n 
A 1 244 LEU 244 236 236 LEU LEU A . n 
A 1 245 ALA 245 237 237 ALA ALA A . n 
A 1 246 ILE 246 238 238 ILE ILE A . n 
A 1 247 ASN 247 239 239 ASN ASN A . n 
A 1 248 LEU 248 240 240 LEU LEU A . n 
A 1 249 LEU 249 241 241 LEU LEU A . n 
A 1 250 PRO 250 242 242 PRO PRO A . n 
A 1 251 GLY 251 243 243 GLY GLY A . n 
A 1 252 SER 252 244 244 SER SER A . n 
A 1 253 LEU 253 245 245 LEU LEU A . n 
A 1 254 TYR 254 246 246 TYR TYR A . n 
A 1 255 HIS 255 247 247 HIS HIS A . n 
A 1 256 HIS 256 248 248 HIS HIS A . n 
A 1 257 PRO 257 249 249 PRO PRO A . n 
A 1 258 ASP 258 250 250 ASP ASP A . n 
A 1 259 ALA 259 251 251 ALA ALA A . n 
A 1 260 VAL 260 252 252 VAL VAL A . n 
A 1 261 GLY 261 253 253 GLY GLY A . n 
A 1 262 TRP 262 254 254 TRP TRP A . n 
A 1 263 LEU 263 255 255 LEU LEU A . n 
A 1 264 MET 264 256 256 MET MET A . n 
A 1 265 ASP 265 257 257 ASP ASP A . n 
A 1 266 SER 266 258 258 SER SER A . n 
A 1 267 LEU 267 259 259 LEU LEU A . n 
A 1 268 LEU 268 260 260 LEU LEU A . n 
A 1 269 ALA 269 261 261 ALA ALA A . n 
A 1 270 ALA 270 262 262 ALA ALA A . n 
A 1 271 GLY 271 263 263 GLY GLY A . n 
A 1 272 LEU 272 264 264 LEU LEU A . n 
A 1 273 ARG 273 265 265 ARG ARG A . n 
A 1 274 PRO 274 266 266 PRO PRO A . n 
A 1 275 ASP 275 267 267 ASP ASP A . n 
A 1 276 GLN 276 268 268 GLN GLN A . n 
A 1 277 VAL 277 269 269 VAL VAL A . n 
A 1 278 LEU 278 270 270 LEU LEU A . n 
A 1 279 ILE 279 271 271 ILE ILE A . n 
A 1 280 GLU 280 272 272 GLU GLU A . n 
A 1 281 VAL 281 273 273 VAL VAL A . n 
A 1 282 THR 282 274 274 THR THR A . n 
A 1 283 GLU 283 275 275 GLU GLU A . n 
A 1 284 THR 284 276 276 THR THR A . n 
A 1 285 GLU 285 277 277 GLU GLU A . n 
A 1 286 VAL 286 278 278 VAL VAL A . n 
A 1 287 ILE 287 279 279 ILE ILE A . n 
A 1 288 THR 288 280 280 THR THR A . n 
A 1 289 CYS 289 281 281 CYS CYS A . n 
A 1 290 PHE 290 282 282 PHE PHE A . n 
A 1 291 ASP 291 283 283 ASP ASP A . n 
A 1 292 GLN 292 284 284 GLN GLN A . n 
A 1 293 PHE 293 285 285 PHE PHE A . n 
A 1 294 ARG 294 286 286 ARG ARG A . n 
A 1 295 LYS 295 287 287 LYS LYS A . n 
A 1 296 VAL 296 288 288 VAL VAL A . n 
A 1 297 LEU 297 289 289 LEU LEU A . n 
A 1 298 LYS 298 290 290 LYS LYS A . n 
A 1 299 ALA 299 291 291 ALA ALA A . n 
A 1 300 LEU 300 292 292 LEU LEU A . n 
A 1 301 ARG 301 293 293 ARG ARG A . n 
A 1 302 VAL 302 294 294 VAL VAL A . n 
A 1 303 ALA 303 295 295 ALA ALA A . n 
A 1 304 GLY 304 296 296 GLY GLY A . n 
A 1 305 MET 305 297 297 MET MET A . n 
A 1 306 LYS 306 298 298 LYS LYS A . n 
A 1 307 LEU 307 299 299 LEU LEU A . n 
A 1 308 ALA 308 300 300 ALA ALA A . n 
A 1 309 ILE 309 301 301 ILE ILE A . n 
A 1 310 ASP 310 302 302 ASP ASP A . n 
A 1 311 ASP 311 303 303 ASP ASP A . n 
A 1 312 PHE 312 304 304 PHE PHE A . n 
A 1 313 GLY 313 305 305 GLY GLY A . n 
A 1 314 ALA 314 306 306 ALA ALA A . n 
A 1 315 GLY 315 307 307 GLY GLY A . n 
A 1 316 TYR 316 308 308 TYR TYR A . n 
A 1 317 SER 317 309 309 SER SER A . n 
A 1 318 GLY 318 310 310 GLY GLY A . n 
A 1 319 LEU 319 311 311 LEU LEU A . n 
A 1 320 SER 320 312 312 SER SER A . n 
A 1 321 LEU 321 313 313 LEU LEU A . n 
A 1 322 LEU 322 314 314 LEU LEU A . n 
A 1 323 THR 323 315 315 THR THR A . n 
A 1 324 ARG 324 316 316 ARG ARG A . n 
A 1 325 PHE 325 317 317 PHE PHE A . n 
A 1 326 GLN 326 318 318 GLN GLN A . n 
A 1 327 PRO 327 319 319 PRO PRO A . n 
A 1 328 ASP 328 320 320 ASP ASP A . n 
A 1 329 LYS 329 321 321 LYS LYS A . n 
A 1 330 ILE 330 322 322 ILE ILE A . n 
A 1 331 LYS 331 323 323 LYS LYS A . n 
A 1 332 VAL 332 324 324 VAL VAL A . n 
A 1 333 ASP 333 325 325 ASP ASP A . n 
A 1 334 ALA 334 326 326 ALA ALA A . n 
A 1 335 GLU 335 327 327 GLU GLU A . n 
A 1 336 LEU 336 328 328 LEU LEU A . n 
A 1 337 VAL 337 329 329 VAL VAL A . n 
A 1 338 ARG 338 330 330 ARG ARG A . n 
A 1 339 ASP 339 331 331 ASP ASP A . n 
A 1 340 ILE 340 332 332 ILE ILE A . n 
A 1 341 HIS 341 333 333 HIS HIS A . n 
A 1 342 ILE 342 334 334 ILE ILE A . n 
A 1 343 SER 343 335 335 SER SER A . n 
A 1 344 GLY 344 336 336 GLY GLY A . n 
A 1 345 THR 345 337 337 THR THR A . n 
A 1 346 LYS 346 338 338 LYS LYS A . n 
A 1 347 GLN 347 339 339 GLN GLN A . n 
A 1 348 ALA 348 340 340 ALA ALA A . n 
A 1 349 ILE 349 341 341 ILE ILE A . n 
A 1 350 VAL 350 342 342 VAL VAL A . n 
A 1 351 ALA 351 343 343 ALA ALA A . n 
A 1 352 SER 352 344 344 SER SER A . n 
A 1 353 VAL 353 345 345 VAL VAL A . n 
A 1 354 VAL 354 346 346 VAL VAL A . n 
A 1 355 ARG 355 347 347 ARG ARG A . n 
A 1 356 CYS 356 348 348 CYS CYS A . n 
A 1 357 CYS 357 349 349 CYS CYS A . n 
A 1 358 GLU 358 350 350 GLU GLU A . n 
A 1 359 ASP 359 351 351 ASP ASP A . n 
A 1 360 LEU 360 352 352 LEU LEU A . n 
A 1 361 GLY 361 353 353 GLY GLY A . n 
A 1 362 ILE 362 354 354 ILE ILE A . n 
A 1 363 THR 363 355 355 THR THR A . n 
A 1 364 VAL 364 356 356 VAL VAL A . n 
A 1 365 VAL 365 357 357 VAL VAL A . n 
A 1 366 ALA 366 358 358 ALA ALA A . n 
A 1 367 GLU 367 359 359 GLU GLU A . n 
A 1 368 GLY 368 360 360 GLY GLY A . n 
A 1 369 VAL 369 361 361 VAL VAL A . n 
A 1 370 GLU 370 362 362 GLU GLU A . n 
A 1 371 THR 371 363 363 THR THR A . n 
A 1 372 LEU 372 364 364 LEU LEU A . n 
A 1 373 GLU 373 365 365 GLU GLU A . n 
A 1 374 GLU 374 366 366 GLU GLU A . n 
A 1 375 TRP 375 367 367 TRP TRP A . n 
A 1 376 CYS 376 368 368 CYS CYS A . n 
A 1 377 TRP 377 369 369 TRP TRP A . n 
A 1 378 LEU 378 370 370 LEU LEU A . n 
A 1 379 GLN 379 371 371 GLN GLN A . n 
A 1 380 SER 380 372 372 SER SER A . n 
A 1 381 VAL 381 373 373 VAL VAL A . n 
A 1 382 GLY 382 374 374 GLY GLY A . n 
A 1 383 ILE 383 375 375 ILE ILE A . n 
A 1 384 ARG 384 376 376 ARG ARG A . n 
A 1 385 LEU 385 377 377 LEU LEU A . n 
A 1 386 PHE 386 378 378 PHE PHE A . n 
A 1 387 GLN 387 379 379 GLN GLN A . n 
A 1 388 GLY 388 380 380 GLY GLY A . n 
A 1 389 PHE 389 381 381 PHE PHE A . n 
A 1 390 LEU 390 382 382 LEU LEU A . n 
A 1 391 PHE 391 383 383 PHE PHE A . n 
A 1 392 SER 392 384 384 SER SER A . n 
A 1 393 ARG 393 385 385 ARG ARG A . n 
A 1 394 PRO 394 386 386 PRO PRO A . n 
A 1 395 CYS 395 387 387 CYS CYS A . n 
A 1 396 LEU 396 388 388 LEU LEU A . n 
A 1 397 ASN 397 389 389 ASN ASN A . n 
A 1 398 GLY 398 390 390 GLY GLY A . n 
A 1 399 ILE 399 391 391 ILE ILE A . n 
A 1 400 GLY 400 392 392 GLY GLY A . n 
A 1 401 GLU 401 393 393 GLU GLU A . n 
A 1 402 ILE 402 394 394 ILE ILE A . n 
A 1 403 CYS 403 395 395 CYS CYS A . n 
A 1 404 TRP 404 396 396 TRP TRP A . n 
A 1 405 PRO 405 397 397 PRO PRO A . n 
A 1 406 VAL 406 398 398 VAL VAL A . n 
A 1 407 ALA 407 399 399 ALA ALA A . n 
A 1 408 ARG 408 400 400 ARG ARG A . n 
A 1 409 GLN 409 401 ?   ?   ?   A . n 
A 1 410 ALA 410 402 ?   ?   ?   A . n 
A 1 411 MET 411 403 ?   ?   ?   A . n 
A 1 412 ASP 412 404 ?   ?   ?   A . n 
A 1 413 LEU 413 405 ?   ?   ?   A . n 
B 1 1   ILE 1   -7  ?   ?   ?   B . n 
B 1 2   SER 2   -6  ?   ?   ?   B . n 
B 1 3   GLU 3   -5  ?   ?   ?   B . n 
B 1 4   PHE 4   -4  ?   ?   ?   B . n 
B 1 5   GLY 5   -3  ?   ?   ?   B . n 
B 1 6   SER 6   -2  ?   ?   ?   B . n 
B 1 7   SER 7   -1  ?   ?   ?   B . n 
B 1 8   ARG 8   0   ?   ?   ?   B . n 
B 1 9   MET 9   1   1   MET MET B . n 
B 1 10  LEU 10  2   2   LEU LEU B . n 
B 1 11  THR 11  3   3   THR THR B . n 
B 1 12  THR 12  4   4   THR THR B . n 
B 1 13  LEU 13  5   5   LEU LEU B . n 
B 1 14  ILE 14  6   6   ILE ILE B . n 
B 1 15  TYR 15  7   7   TYR TYR B . n 
B 1 16  ARG 16  8   8   ARG ARG B . n 
B 1 17  SER 17  9   9   SER SER B . n 
B 1 18  GLN 18  10  10  GLN GLN B . n 
B 1 19  VAL 19  11  11  VAL VAL B . n 
B 1 20  HIS 20  12  12  HIS HIS B . n 
B 1 21  PRO 21  13  13  PRO PRO B . n 
B 1 22  ASP 22  14  14  ASP ASP B . n 
B 1 23  ARG 23  15  15  ARG ARG B . n 
B 1 24  PRO 24  16  16  PRO PRO B . n 
B 1 25  PRO 25  17  17  PRO PRO B . n 
B 1 26  VAL 26  18  18  VAL VAL B . n 
B 1 27  ASP 27  19  19  ASP ASP B . n 
B 1 28  LEU 28  20  20  LEU LEU B . n 
B 1 29  ASP 29  21  21  ASP ASP B . n 
B 1 30  ALA 30  22  22  ALA ALA B . n 
B 1 31  LEU 31  23  23  LEU LEU B . n 
B 1 32  VAL 32  24  24  VAL VAL B . n 
B 1 33  HIS 33  25  25  HIS HIS B . n 
B 1 34  ARG 34  26  26  ARG ARG B . n 
B 1 35  ALA 35  27  27  ALA ALA B . n 
B 1 36  SER 36  28  28  SER SER B . n 
B 1 37  SER 37  29  29  SER SER B . n 
B 1 38  LYS 38  30  30  LYS LYS B . n 
B 1 39  ASN 39  31  31  ASN ASN B . n 
B 1 40  LEU 40  32  32  LEU LEU B . n 
B 1 41  PRO 41  33  33  PRO PRO B . n 
B 1 42  LEU 42  34  34  LEU LEU B . n 
B 1 43  GLY 43  35  35  GLY GLY B . n 
B 1 44  ILE 44  36  36  ILE ILE B . n 
B 1 45  THR 45  37  37  THR THR B . n 
B 1 46  GLY 46  38  38  GLY GLY B . n 
B 1 47  ILE 47  39  39  ILE ILE B . n 
B 1 48  LEU 48  40  40  LEU LEU B . n 
B 1 49  LEU 49  41  41  LEU LEU B . n 
B 1 50  PHE 50  42  42  PHE PHE B . n 
B 1 51  ASN 51  43  43  ASN ASN B . n 
B 1 52  GLY 52  44  44  GLY GLY B . n 
B 1 53  LEU 53  45  45  LEU LEU B . n 
B 1 54  GLN 54  46  46  GLN GLN B . n 
B 1 55  PHE 55  47  47  PHE PHE B . n 
B 1 56  PHE 56  48  48  PHE PHE B . n 
B 1 57  GLN 57  49  49  GLN GLN B . n 
B 1 58  VAL 58  50  50  VAL VAL B . n 
B 1 59  LEU 59  51  51  LEU LEU B . n 
B 1 60  GLU 60  52  52  GLU GLU B . n 
B 1 61  GLY 61  53  53  GLY GLY B . n 
B 1 62  THR 62  54  54  THR THR B . n 
B 1 63  GLU 63  55  55  GLU GLU B . n 
B 1 64  GLU 64  56  56  GLU GLU B . n 
B 1 65  ALA 65  57  57  ALA ALA B . n 
B 1 66  LEU 66  58  58  LEU LEU B . n 
B 1 67  GLU 67  59  59  GLU GLU B . n 
B 1 68  SER 68  60  60  SER SER B . n 
B 1 69  LEU 69  61  61  LEU LEU B . n 
B 1 70  PHE 70  62  62  PHE PHE B . n 
B 1 71  SER 71  63  63  SER SER B . n 
B 1 72  GLU 72  64  64  GLU GLU B . n 
B 1 73  ILE 73  65  65  ILE ILE B . n 
B 1 74  GLN 74  66  66  GLN GLN B . n 
B 1 75  SER 75  67  67  SER SER B . n 
B 1 76  ASP 76  68  68  ASP ASP B . n 
B 1 77  PRO 77  69  69  PRO PRO B . n 
B 1 78  ARG 78  70  70  ARG ARG B . n 
B 1 79  HIS 79  71  71  HIS HIS B . n 
B 1 80  ARG 80  72  72  ARG ARG B . n 
B 1 81  ASP 81  73  73  ASP ASP B . n 
B 1 82  VAL 82  74  74  VAL VAL B . n 
B 1 83  VAL 83  75  75  VAL VAL B . n 
B 1 84  GLU 84  76  76  GLU GLU B . n 
B 1 85  LEU 85  77  77  LEU LEU B . n 
B 1 86  MET 86  78  78  MET MET B . n 
B 1 87  ARG 87  79  79  ARG ARG B . n 
B 1 88  ASP 88  80  80  ASP ASP B . n 
B 1 89  TYR 89  81  81  TYR TYR B . n 
B 1 90  SER 90  82  82  SER SER B . n 
B 1 91  ALA 91  83  83  ALA ALA B . n 
B 1 92  TYR 92  84  84  TYR TYR B . n 
B 1 93  ARG 93  85  85  ARG ARG B . n 
B 1 94  ARG 94  86  86  ARG ARG B . n 
B 1 95  PHE 95  87  87  PHE PHE B . n 
B 1 96  HIS 96  88  88  HIS HIS B . n 
B 1 97  GLY 97  89  89  GLY GLY B . n 
B 1 98  THR 98  90  90  THR THR B . n 
B 1 99  GLY 99  91  91  GLY GLY B . n 
B 1 100 MET 100 92  92  MET MET B . n 
B 1 101 ARG 101 93  93  ARG ARG B . n 
B 1 102 ILE 102 94  94  ILE ILE B . n 
B 1 103 LEU 103 95  95  LEU LEU B . n 
B 1 104 ASP 104 96  96  ASP ASP B . n 
B 1 105 LEU 105 97  97  LEU LEU B . n 
B 1 106 ARG 106 98  98  ARG ARG B . n 
B 1 107 LEU 107 99  99  LEU LEU B . n 
B 1 108 PHE 108 100 100 PHE PHE B . n 
B 1 109 GLU 109 101 101 GLU GLU B . n 
B 1 110 THR 110 102 102 THR THR B . n 
B 1 111 ASP 111 103 103 ASP ASP B . n 
B 1 112 GLY 112 104 104 GLY GLY B . n 
B 1 113 ALA 113 105 105 ALA ALA B . n 
B 1 114 LEU 114 106 106 LEU LEU B . n 
B 1 115 GLU 115 107 107 GLU GLU B . n 
B 1 116 GLU 116 108 108 GLU GLU B . n 
B 1 117 ILE 117 109 109 ILE ILE B . n 
B 1 118 LEU 118 110 110 LEU LEU B . n 
B 1 119 ARG 119 111 111 ARG ARG B . n 
B 1 120 PHE 120 112 112 PHE PHE B . n 
B 1 121 SER 121 113 113 SER SER B . n 
B 1 122 THR 122 114 114 THR THR B . n 
B 1 123 PHE 123 115 115 PHE PHE B . n 
B 1 124 GLY 124 116 116 GLY GLY B . n 
B 1 125 VAL 125 117 117 VAL VAL B . n 
B 1 126 THR 126 118 118 THR THR B . n 
B 1 127 GLU 127 119 119 GLU GLU B . n 
B 1 128 PRO 128 120 120 PRO PRO B . n 
B 1 129 VAL 129 121 121 VAL VAL B . n 
B 1 130 ASN 130 122 122 ASN ASN B . n 
B 1 131 ASP 131 123 123 ASP ASP B . n 
B 1 132 ARG 132 124 124 ARG ARG B . n 
B 1 133 MET 133 125 125 MET MET B . n 
B 1 134 PHE 134 126 126 PHE PHE B . n 
B 1 135 ARG 135 127 127 ARG ARG B . n 
B 1 136 LEU 136 128 128 LEU LEU B . n 
B 1 137 LEU 137 129 129 LEU LEU B . n 
B 1 138 SER 138 130 130 SER SER B . n 
B 1 139 ALA 139 131 131 ALA ALA B . n 
B 1 140 PHE 140 132 132 PHE PHE B . n 
B 1 141 ILE 141 133 133 ILE ILE B . n 
B 1 142 ALA 142 134 134 ALA ALA B . n 
B 1 143 ASP 143 135 135 ASP ASP B . n 
B 1 144 GLY 144 136 136 GLY GLY B . n 
B 1 145 GLY 145 137 137 GLY GLY B . n 
B 1 146 ARG 146 138 138 ARG ARG B . n 
B 1 147 TYR 147 139 139 TYR TYR B . n 
B 1 148 CYS 148 140 140 CYS CYS B . n 
B 1 149 LEU 149 141 141 LEU LEU B . n 
B 1 150 PRO 150 142 142 PRO PRO B . n 
B 1 151 GLU 151 143 143 GLU GLU B . n 
B 1 152 PRO 152 144 144 PRO PRO B . n 
B 1 153 LEU 153 145 145 LEU LEU B . n 
B 1 154 GLN 154 146 146 GLN GLN B . n 
B 1 155 PRO 155 147 147 PRO PRO B . n 
B 1 156 SER 156 148 148 SER SER B . n 
B 1 157 ARG 157 149 149 ARG ARG B . n 
B 1 158 TRP 158 150 150 TRP TRP B . n 
B 1 159 MET 159 151 151 MET MET B . n 
B 1 160 MET 160 152 152 MET MET B . n 
B 1 161 MET 161 153 153 MET MET B . n 
B 1 162 PRO 162 154 ?   ?   ?   B . n 
B 1 163 ALA 163 155 ?   ?   ?   B . n 
B 1 164 SER 164 156 ?   ?   ?   B . n 
B 1 165 GLY 165 157 ?   ?   ?   B . n 
B 1 166 THR 166 158 ?   ?   ?   B . n 
B 1 167 ALA 167 159 ?   ?   ?   B . n 
B 1 168 ALA 168 160 160 ALA ALA B . n 
B 1 169 PRO 169 161 161 PRO PRO B . n 
B 1 170 GLN 170 162 162 GLN GLN B . n 
B 1 171 HIS 171 163 163 HIS HIS B . n 
B 1 172 LEU 172 164 164 LEU LEU B . n 
B 1 173 PRO 173 165 165 PRO PRO B . n 
B 1 174 GLY 174 166 166 GLY GLY B . n 
B 1 175 GLN 175 167 167 GLN GLN B . n 
B 1 176 PRO 176 168 168 PRO PRO B . n 
B 1 177 CYS 177 169 169 CYS CYS B . n 
B 1 178 GLN 178 170 170 GLN GLN B . n 
B 1 179 PHE 179 171 171 PHE PHE B . n 
B 1 180 ALA 180 172 172 ALA ALA B . n 
B 1 181 LEU 181 173 173 LEU LEU B . n 
B 1 182 GLN 182 174 174 GLN GLN B . n 
B 1 183 ALA 183 175 175 ALA ALA B . n 
B 1 184 ILE 184 176 176 ILE ILE B . n 
B 1 185 VAL 185 177 177 VAL VAL B . n 
B 1 186 GLU 186 178 178 GLU GLU B . n 
B 1 187 PRO 187 179 179 PRO PRO B . n 
B 1 188 ALA 188 180 180 ALA ALA B . n 
B 1 189 LYS 189 181 181 LYS LYS B . n 
B 1 190 LYS 190 182 182 LYS LYS B . n 
B 1 191 ARG 191 183 183 ARG ARG B . n 
B 1 192 VAL 192 184 184 VAL VAL B . n 
B 1 193 SER 193 185 185 SER SER B . n 
B 1 194 SER 194 186 186 SER SER B . n 
B 1 195 PHE 195 187 187 PHE PHE B . n 
B 1 196 GLU 196 188 188 GLU GLU B . n 
B 1 197 ALA 197 189 189 ALA ALA B . n 
B 1 198 LEU 198 190 190 LEU LEU B . n 
B 1 199 ILE 199 191 191 ILE ILE B . n 
B 1 200 ARG 200 192 192 ARG ARG B . n 
B 1 201 SER 201 193 193 SER SER B . n 
B 1 202 PRO 202 194 194 PRO PRO B . n 
B 1 203 THR 203 195 195 THR THR B . n 
B 1 204 GLY 204 196 196 GLY GLY B . n 
B 1 205 GLY 205 197 197 GLY GLY B . n 
B 1 206 SER 206 198 198 SER SER B . n 
B 1 207 PRO 207 199 199 PRO PRO B . n 
B 1 208 VAL 208 200 200 VAL VAL B . n 
B 1 209 GLU 209 201 201 GLU GLU B . n 
B 1 210 MET 210 202 202 MET MET B . n 
B 1 211 PHE 211 203 203 PHE PHE B . n 
B 1 212 ALA 212 204 204 ALA ALA B . n 
B 1 213 ALA 213 205 205 ALA ALA B . n 
B 1 214 ILE 214 206 206 ILE ILE B . n 
B 1 215 ALA 215 207 207 ALA ALA B . n 
B 1 216 ALA 216 208 208 ALA ALA B . n 
B 1 217 GLU 217 209 209 GLU GLU B . n 
B 1 218 ASP 218 210 210 ASP ASP B . n 
B 1 219 ARG 219 211 211 ARG ARG B . n 
B 1 220 TYR 220 212 212 TYR TYR B . n 
B 1 221 ARG 221 213 213 ARG ARG B . n 
B 1 222 PHE 222 214 214 PHE PHE B . n 
B 1 223 ASP 223 215 215 ASP ASP B . n 
B 1 224 LEU 224 216 216 LEU LEU B . n 
B 1 225 GLU 225 217 217 GLU GLU B . n 
B 1 226 SER 226 218 218 SER SER B . n 
B 1 227 LYS 227 219 219 LYS LYS B . n 
B 1 228 ALA 228 220 220 ALA ALA B . n 
B 1 229 TYR 229 221 221 TYR TYR B . n 
B 1 230 ALA 230 222 222 ALA ALA B . n 
B 1 231 PHE 231 223 223 PHE PHE B . n 
B 1 232 ALA 232 224 224 ALA ALA B . n 
B 1 233 LEU 233 225 225 LEU LEU B . n 
B 1 234 ALA 234 226 226 ALA ALA B . n 
B 1 235 GLY 235 227 227 GLY GLY B . n 
B 1 236 GLN 236 228 228 GLN GLN B . n 
B 1 237 LEU 237 229 229 LEU LEU B . n 
B 1 238 PRO 238 230 230 PRO PRO B . n 
B 1 239 LEU 239 231 231 LEU LEU B . n 
B 1 240 GLY 240 232 232 GLY GLY B . n 
B 1 241 LYS 241 233 233 LYS LYS B . n 
B 1 242 HIS 242 234 234 HIS HIS B . n 
B 1 243 GLN 243 235 235 GLN GLN B . n 
B 1 244 LEU 244 236 236 LEU LEU B . n 
B 1 245 ALA 245 237 237 ALA ALA B . n 
B 1 246 ILE 246 238 238 ILE ILE B . n 
B 1 247 ASN 247 239 239 ASN ASN B . n 
B 1 248 LEU 248 240 240 LEU LEU B . n 
B 1 249 LEU 249 241 241 LEU LEU B . n 
B 1 250 PRO 250 242 242 PRO PRO B . n 
B 1 251 GLY 251 243 243 GLY GLY B . n 
B 1 252 SER 252 244 244 SER SER B . n 
B 1 253 LEU 253 245 245 LEU LEU B . n 
B 1 254 TYR 254 246 246 TYR TYR B . n 
B 1 255 HIS 255 247 247 HIS HIS B . n 
B 1 256 HIS 256 248 248 HIS HIS B . n 
B 1 257 PRO 257 249 249 PRO PRO B . n 
B 1 258 ASP 258 250 250 ASP ASP B . n 
B 1 259 ALA 259 251 251 ALA ALA B . n 
B 1 260 VAL 260 252 252 VAL VAL B . n 
B 1 261 GLY 261 253 253 GLY GLY B . n 
B 1 262 TRP 262 254 254 TRP TRP B . n 
B 1 263 LEU 263 255 255 LEU LEU B . n 
B 1 264 MET 264 256 256 MET MET B . n 
B 1 265 ASP 265 257 257 ASP ASP B . n 
B 1 266 SER 266 258 258 SER SER B . n 
B 1 267 LEU 267 259 259 LEU LEU B . n 
B 1 268 LEU 268 260 260 LEU LEU B . n 
B 1 269 ALA 269 261 261 ALA ALA B . n 
B 1 270 ALA 270 262 262 ALA ALA B . n 
B 1 271 GLY 271 263 263 GLY GLY B . n 
B 1 272 LEU 272 264 264 LEU LEU B . n 
B 1 273 ARG 273 265 265 ARG ARG B . n 
B 1 274 PRO 274 266 266 PRO PRO B . n 
B 1 275 ASP 275 267 267 ASP ASP B . n 
B 1 276 GLN 276 268 268 GLN GLN B . n 
B 1 277 VAL 277 269 269 VAL VAL B . n 
B 1 278 LEU 278 270 270 LEU LEU B . n 
B 1 279 ILE 279 271 271 ILE ILE B . n 
B 1 280 GLU 280 272 272 GLU GLU B . n 
B 1 281 VAL 281 273 273 VAL VAL B . n 
B 1 282 THR 282 274 274 THR THR B . n 
B 1 283 GLU 283 275 275 GLU GLU B . n 
B 1 284 THR 284 276 276 THR THR B . n 
B 1 285 GLU 285 277 277 GLU GLU B . n 
B 1 286 VAL 286 278 278 VAL VAL B . n 
B 1 287 ILE 287 279 279 ILE ILE B . n 
B 1 288 THR 288 280 280 THR THR B . n 
B 1 289 CYS 289 281 281 CYS CYS B . n 
B 1 290 PHE 290 282 282 PHE PHE B . n 
B 1 291 ASP 291 283 283 ASP ASP B . n 
B 1 292 GLN 292 284 284 GLN GLN B . n 
B 1 293 PHE 293 285 285 PHE PHE B . n 
B 1 294 ARG 294 286 286 ARG ARG B . n 
B 1 295 LYS 295 287 287 LYS LYS B . n 
B 1 296 VAL 296 288 288 VAL VAL B . n 
B 1 297 LEU 297 289 289 LEU LEU B . n 
B 1 298 LYS 298 290 290 LYS LYS B . n 
B 1 299 ALA 299 291 291 ALA ALA B . n 
B 1 300 LEU 300 292 292 LEU LEU B . n 
B 1 301 ARG 301 293 293 ARG ARG B . n 
B 1 302 VAL 302 294 294 VAL VAL B . n 
B 1 303 ALA 303 295 295 ALA ALA B . n 
B 1 304 GLY 304 296 296 GLY GLY B . n 
B 1 305 MET 305 297 297 MET MET B . n 
B 1 306 LYS 306 298 298 LYS LYS B . n 
B 1 307 LEU 307 299 299 LEU LEU B . n 
B 1 308 ALA 308 300 300 ALA ALA B . n 
B 1 309 ILE 309 301 301 ILE ILE B . n 
B 1 310 ASP 310 302 302 ASP ASP B . n 
B 1 311 ASP 311 303 303 ASP ASP B . n 
B 1 312 PHE 312 304 304 PHE PHE B . n 
B 1 313 GLY 313 305 305 GLY GLY B . n 
B 1 314 ALA 314 306 306 ALA ALA B . n 
B 1 315 GLY 315 307 307 GLY GLY B . n 
B 1 316 TYR 316 308 308 TYR TYR B . n 
B 1 317 SER 317 309 309 SER SER B . n 
B 1 318 GLY 318 310 310 GLY GLY B . n 
B 1 319 LEU 319 311 311 LEU LEU B . n 
B 1 320 SER 320 312 312 SER SER B . n 
B 1 321 LEU 321 313 313 LEU LEU B . n 
B 1 322 LEU 322 314 314 LEU LEU B . n 
B 1 323 THR 323 315 315 THR THR B . n 
B 1 324 ARG 324 316 316 ARG ARG B . n 
B 1 325 PHE 325 317 317 PHE PHE B . n 
B 1 326 GLN 326 318 318 GLN GLN B . n 
B 1 327 PRO 327 319 319 PRO PRO B . n 
B 1 328 ASP 328 320 320 ASP ASP B . n 
B 1 329 LYS 329 321 321 LYS LYS B . n 
B 1 330 ILE 330 322 322 ILE ILE B . n 
B 1 331 LYS 331 323 323 LYS LYS B . n 
B 1 332 VAL 332 324 324 VAL VAL B . n 
B 1 333 ASP 333 325 325 ASP ASP B . n 
B 1 334 ALA 334 326 326 ALA ALA B . n 
B 1 335 GLU 335 327 327 GLU GLU B . n 
B 1 336 LEU 336 328 328 LEU LEU B . n 
B 1 337 VAL 337 329 329 VAL VAL B . n 
B 1 338 ARG 338 330 330 ARG ARG B . n 
B 1 339 ASP 339 331 331 ASP ASP B . n 
B 1 340 ILE 340 332 332 ILE ILE B . n 
B 1 341 HIS 341 333 333 HIS HIS B . n 
B 1 342 ILE 342 334 334 ILE ILE B . n 
B 1 343 SER 343 335 335 SER SER B . n 
B 1 344 GLY 344 336 336 GLY GLY B . n 
B 1 345 THR 345 337 337 THR THR B . n 
B 1 346 LYS 346 338 338 LYS LYS B . n 
B 1 347 GLN 347 339 339 GLN GLN B . n 
B 1 348 ALA 348 340 340 ALA ALA B . n 
B 1 349 ILE 349 341 341 ILE ILE B . n 
B 1 350 VAL 350 342 342 VAL VAL B . n 
B 1 351 ALA 351 343 343 ALA ALA B . n 
B 1 352 SER 352 344 344 SER SER B . n 
B 1 353 VAL 353 345 345 VAL VAL B . n 
B 1 354 VAL 354 346 346 VAL VAL B . n 
B 1 355 ARG 355 347 347 ARG ARG B . n 
B 1 356 CYS 356 348 348 CYS CYS B . n 
B 1 357 CYS 357 349 349 CYS CYS B . n 
B 1 358 GLU 358 350 350 GLU GLU B . n 
B 1 359 ASP 359 351 351 ASP ASP B . n 
B 1 360 LEU 360 352 352 LEU LEU B . n 
B 1 361 GLY 361 353 353 GLY GLY B . n 
B 1 362 ILE 362 354 354 ILE ILE B . n 
B 1 363 THR 363 355 355 THR THR B . n 
B 1 364 VAL 364 356 356 VAL VAL B . n 
B 1 365 VAL 365 357 357 VAL VAL B . n 
B 1 366 ALA 366 358 358 ALA ALA B . n 
B 1 367 GLU 367 359 359 GLU GLU B . n 
B 1 368 GLY 368 360 360 GLY GLY B . n 
B 1 369 VAL 369 361 361 VAL VAL B . n 
B 1 370 GLU 370 362 362 GLU GLU B . n 
B 1 371 THR 371 363 363 THR THR B . n 
B 1 372 LEU 372 364 364 LEU LEU B . n 
B 1 373 GLU 373 365 365 GLU GLU B . n 
B 1 374 GLU 374 366 366 GLU GLU B . n 
B 1 375 TRP 375 367 367 TRP TRP B . n 
B 1 376 CYS 376 368 368 CYS CYS B . n 
B 1 377 TRP 377 369 369 TRP TRP B . n 
B 1 378 LEU 378 370 370 LEU LEU B . n 
B 1 379 GLN 379 371 371 GLN GLN B . n 
B 1 380 SER 380 372 372 SER SER B . n 
B 1 381 VAL 381 373 373 VAL VAL B . n 
B 1 382 GLY 382 374 374 GLY GLY B . n 
B 1 383 ILE 383 375 375 ILE ILE B . n 
B 1 384 ARG 384 376 376 ARG ARG B . n 
B 1 385 LEU 385 377 377 LEU LEU B . n 
B 1 386 PHE 386 378 378 PHE PHE B . n 
B 1 387 GLN 387 379 379 GLN GLN B . n 
B 1 388 GLY 388 380 380 GLY GLY B . n 
B 1 389 PHE 389 381 381 PHE PHE B . n 
B 1 390 LEU 390 382 382 LEU LEU B . n 
B 1 391 PHE 391 383 383 PHE PHE B . n 
B 1 392 SER 392 384 384 SER SER B . n 
B 1 393 ARG 393 385 385 ARG ARG B . n 
B 1 394 PRO 394 386 386 PRO PRO B . n 
B 1 395 CYS 395 387 387 CYS CYS B . n 
B 1 396 LEU 396 388 388 LEU LEU B . n 
B 1 397 ASN 397 389 389 ASN ASN B . n 
B 1 398 GLY 398 390 390 GLY GLY B . n 
B 1 399 ILE 399 391 391 ILE ILE B . n 
B 1 400 GLY 400 392 392 GLY GLY B . n 
B 1 401 GLU 401 393 393 GLU GLU B . n 
B 1 402 ILE 402 394 394 ILE ILE B . n 
B 1 403 CYS 403 395 395 CYS CYS B . n 
B 1 404 TRP 404 396 396 TRP TRP B . n 
B 1 405 PRO 405 397 397 PRO PRO B . n 
B 1 406 VAL 406 398 398 VAL VAL B . n 
B 1 407 ALA 407 399 399 ALA ALA B . n 
B 1 408 ARG 408 400 400 ARG ARG B . n 
B 1 409 GLN 409 401 ?   ?   ?   B . n 
B 1 410 ALA 410 402 ?   ?   ?   B . n 
B 1 411 MET 411 403 ?   ?   ?   B . n 
B 1 412 ASP 412 404 ?   ?   ?   B . n 
B 1 413 LEU 413 405 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 C2E 1  501 501 C2E CG2 A . 
D 3 MN  1  502 502 MN  MN3 A . 
E 3 MN  1  503 503 MN  MN3 A . 
F 4 FMN 1  504 504 FMN FMN A . 
G 2 C2E 1  501 501 C2E CG2 B . 
H 3 MN  1  502 502 MN  MN3 B . 
I 3 MN  1  503 503 MN  MN3 B . 
J 4 FMN 1  504 504 FMN FMN B . 
K 5 HOH 1  406 4   HOH HOH A . 
K 5 HOH 2  407 5   HOH HOH A . 
K 5 HOH 3  408 6   HOH HOH A . 
K 5 HOH 4  409 8   HOH HOH A . 
K 5 HOH 5  410 9   HOH HOH A . 
K 5 HOH 6  411 2   HOH HOH A . 
K 5 HOH 7  412 7   HOH HOH A . 
K 5 HOH 8  413 9   HOH HOH A . 
K 5 HOH 9  414 10  HOH HOH A . 
K 5 HOH 10 415 12  HOH HOH A . 
K 5 HOH 11 416 13  HOH HOH A . 
K 5 HOH 12 417 15  HOH HOH A . 
K 5 HOH 13 418 17  HOH HOH A . 
K 5 HOH 14 419 18  HOH HOH A . 
K 5 HOH 15 420 19  HOH HOH A . 
K 5 HOH 16 421 24  HOH HOH A . 
K 5 HOH 17 422 27  HOH HOH A . 
K 5 HOH 18 423 29  HOH HOH A . 
K 5 HOH 19 424 31  HOH HOH A . 
K 5 HOH 20 425 33  HOH HOH A . 
K 5 HOH 21 426 38  HOH HOH A . 
K 5 HOH 22 427 40  HOH HOH A . 
K 5 HOH 23 428 41  HOH HOH A . 
K 5 HOH 24 429 42  HOH HOH A . 
K 5 HOH 25 430 44  HOH HOH A . 
K 5 HOH 26 431 45  HOH HOH A . 
K 5 HOH 27 432 46  HOH HOH A . 
K 5 HOH 28 433 48  HOH HOH A . 
K 5 HOH 29 434 49  HOH HOH A . 
K 5 HOH 30 435 54  HOH HOH A . 
K 5 HOH 31 436 57  HOH HOH A . 
K 5 HOH 32 437 58  HOH HOH A . 
K 5 HOH 33 438 63  HOH HOH A . 
K 5 HOH 34 439 64  HOH HOH A . 
K 5 HOH 35 440 66  HOH HOH A . 
K 5 HOH 36 441 67  HOH HOH A . 
K 5 HOH 37 442 68  HOH HOH A . 
K 5 HOH 38 443 69  HOH HOH A . 
K 5 HOH 39 444 70  HOH HOH A . 
K 5 HOH 40 445 71  HOH HOH A . 
K 5 HOH 41 446 72  HOH HOH A . 
K 5 HOH 42 447 74  HOH HOH A . 
K 5 HOH 43 448 76  HOH HOH A . 
K 5 HOH 44 449 77  HOH HOH A . 
K 5 HOH 45 450 78  HOH HOH A . 
K 5 HOH 46 451 79  HOH HOH A . 
K 5 HOH 47 452 80  HOH HOH A . 
K 5 HOH 48 453 84  HOH HOH A . 
K 5 HOH 49 454 86  HOH HOH A . 
K 5 HOH 50 455 88  HOH HOH A . 
K 5 HOH 51 456 96  HOH HOH A . 
K 5 HOH 52 457 98  HOH HOH A . 
K 5 HOH 53 458 99  HOH HOH A . 
K 5 HOH 54 459 100 HOH HOH A . 
K 5 HOH 55 460 101 HOH HOH A . 
K 5 HOH 56 461 104 HOH HOH A . 
K 5 HOH 57 462 105 HOH HOH A . 
K 5 HOH 58 463 109 HOH HOH A . 
K 5 HOH 59 464 110 HOH HOH A . 
K 5 HOH 60 465 118 HOH HOH A . 
K 5 HOH 61 466 119 HOH HOH A . 
K 5 HOH 62 467 124 HOH HOH A . 
K 5 HOH 63 468 125 HOH HOH A . 
K 5 HOH 64 469 126 HOH HOH A . 
K 5 HOH 65 470 130 HOH HOH A . 
K 5 HOH 66 471 134 HOH HOH A . 
K 5 HOH 67 472 135 HOH HOH A . 
K 5 HOH 68 473 138 HOH HOH A . 
K 5 HOH 69 474 139 HOH HOH A . 
K 5 HOH 70 475 141 HOH HOH A . 
K 5 HOH 71 476 142 HOH HOH A . 
K 5 HOH 72 477 145 HOH HOH A . 
K 5 HOH 73 478 146 HOH HOH A . 
L 5 HOH 1  406 3   HOH HOH B . 
L 5 HOH 2  407 7   HOH HOH B . 
L 5 HOH 3  408 5   HOH HOH B . 
L 5 HOH 4  409 6   HOH HOH B . 
L 5 HOH 5  410 8   HOH HOH B . 
L 5 HOH 6  411 11  HOH HOH B . 
L 5 HOH 7  412 16  HOH HOH B . 
L 5 HOH 8  413 20  HOH HOH B . 
L 5 HOH 9  414 22  HOH HOH B . 
L 5 HOH 10 415 23  HOH HOH B . 
L 5 HOH 11 416 25  HOH HOH B . 
L 5 HOH 12 417 26  HOH HOH B . 
L 5 HOH 13 418 28  HOH HOH B . 
L 5 HOH 14 419 30  HOH HOH B . 
L 5 HOH 15 420 34  HOH HOH B . 
L 5 HOH 16 421 35  HOH HOH B . 
L 5 HOH 17 422 36  HOH HOH B . 
L 5 HOH 18 423 39  HOH HOH B . 
L 5 HOH 19 424 43  HOH HOH B . 
L 5 HOH 20 425 51  HOH HOH B . 
L 5 HOH 21 426 52  HOH HOH B . 
L 5 HOH 22 427 53  HOH HOH B . 
L 5 HOH 23 428 56  HOH HOH B . 
L 5 HOH 24 429 59  HOH HOH B . 
L 5 HOH 25 430 60  HOH HOH B . 
L 5 HOH 26 431 61  HOH HOH B . 
L 5 HOH 27 432 62  HOH HOH B . 
L 5 HOH 28 433 65  HOH HOH B . 
L 5 HOH 29 434 73  HOH HOH B . 
L 5 HOH 30 435 75  HOH HOH B . 
L 5 HOH 31 436 81  HOH HOH B . 
L 5 HOH 32 437 83  HOH HOH B . 
L 5 HOH 33 438 87  HOH HOH B . 
L 5 HOH 34 439 90  HOH HOH B . 
L 5 HOH 35 440 92  HOH HOH B . 
L 5 HOH 36 441 93  HOH HOH B . 
L 5 HOH 37 442 94  HOH HOH B . 
L 5 HOH 38 443 97  HOH HOH B . 
L 5 HOH 39 444 102 HOH HOH B . 
L 5 HOH 40 445 106 HOH HOH B . 
L 5 HOH 41 446 107 HOH HOH B . 
L 5 HOH 42 447 108 HOH HOH B . 
L 5 HOH 43 448 111 HOH HOH B . 
L 5 HOH 44 449 112 HOH HOH B . 
L 5 HOH 45 450 114 HOH HOH B . 
L 5 HOH 46 451 115 HOH HOH B . 
L 5 HOH 47 452 116 HOH HOH B . 
L 5 HOH 48 453 121 HOH HOH B . 
L 5 HOH 49 454 122 HOH HOH B . 
L 5 HOH 50 455 123 HOH HOH B . 
L 5 HOH 51 456 128 HOH HOH B . 
L 5 HOH 52 457 129 HOH HOH B . 
L 5 HOH 53 458 131 HOH HOH B . 
L 5 HOH 54 459 133 HOH HOH B . 
L 5 HOH 55 460 136 HOH HOH B . 
L 5 HOH 56 461 137 HOH HOH B . 
L 5 HOH 57 462 143 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7610  ? 
1 MORE         -43   ? 
1 'SSA (A^2)'  33760 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 196 ? A GLU 188 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 OD1 ? A ASN 247 ? A ASN 239 ? 1_555 93.2  ? 
2  OE2 ? A GLU 196 ? A GLU 188 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 OE2 ? A GLU 280 ? A GLU 272 ? 1_555 89.8  ? 
3  OD1 ? A ASN 247 ? A ASN 239 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 OE2 ? A GLU 280 ? A GLU 272 ? 1_555 93.1  ? 
4  OE2 ? A GLU 196 ? A GLU 188 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 OD2 ? A ASP 310 ? A ASP 302 ? 1_555 178.5 ? 
5  OD1 ? A ASN 247 ? A ASN 239 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 OD2 ? A ASP 310 ? A ASP 302 ? 1_555 88.2  ? 
6  OE2 ? A GLU 280 ? A GLU 272 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 OD2 ? A ASP 310 ? A ASP 302 ? 1_555 90.3  ? 
7  OE2 ? A GLU 196 ? A GLU 188 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O   ? K HOH .   ? A HOH 409 ? 1_555 90.7  ? 
8  OD1 ? A ASN 247 ? A ASN 239 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O   ? K HOH .   ? A HOH 409 ? 1_555 172.3 ? 
9  OE2 ? A GLU 280 ? A GLU 272 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O   ? K HOH .   ? A HOH 409 ? 1_555 93.6  ? 
10 OD2 ? A ASP 310 ? A ASP 302 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O   ? K HOH .   ? A HOH 409 ? 1_555 87.9  ? 
11 OE2 ? A GLU 196 ? A GLU 188 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O2P ? C C2E .   ? A C2E 501 ? 1_555 83.4  ? 
12 OD1 ? A ASN 247 ? A ASN 239 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O2P ? C C2E .   ? A C2E 501 ? 1_555 84.3  ? 
13 OE2 ? A GLU 280 ? A GLU 272 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O2P ? C C2E .   ? A C2E 501 ? 1_555 172.6 ? 
14 OD2 ? A ASP 310 ? A ASP 302 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O2P ? C C2E .   ? A C2E 501 ? 1_555 96.6  ? 
15 O   ? K HOH .   ? A HOH 409 ? 1_555 MN ? D MN . ? A MN 502 ? 1_555 O2P ? C C2E .   ? A C2E 501 ? 1_555 89.6  ? 
16 OD1 ? A ASP 310 ? A ASP 302 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 OD1 ? A ASP 311 ? A ASP 303 ? 1_555 89.5  ? 
17 OD1 ? A ASP 310 ? A ASP 302 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 OE1 ? A GLU 367 ? A GLU 359 ? 1_555 116.3 ? 
18 OD1 ? A ASP 311 ? A ASP 303 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 OE1 ? A GLU 367 ? A GLU 359 ? 1_555 118.2 ? 
19 OD1 ? A ASP 310 ? A ASP 302 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 O   ? K HOH .   ? A HOH 409 ? 1_555 74.4  ? 
20 OD1 ? A ASP 311 ? A ASP 303 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 O   ? K HOH .   ? A HOH 409 ? 1_555 163.9 ? 
21 OE1 ? A GLU 367 ? A GLU 359 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 O   ? K HOH .   ? A HOH 409 ? 1_555 71.0  ? 
22 OD1 ? A ASP 310 ? A ASP 302 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 O1P ? C C2E .   ? A C2E 501 ? 1_555 101.3 ? 
23 OD1 ? A ASP 311 ? A ASP 303 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 O1P ? C C2E .   ? A C2E 501 ? 1_555 92.7  ? 
24 OE1 ? A GLU 367 ? A GLU 359 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 O1P ? C C2E .   ? A C2E 501 ? 1_555 129.9 ? 
25 O   ? K HOH .   ? A HOH 409 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 O1P ? C C2E .   ? A C2E 501 ? 1_555 90.0  ? 
26 OD1 ? A ASP 310 ? A ASP 302 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 OE2 ? A GLU 367 ? A GLU 359 ? 1_555 83.2  ? 
27 OD1 ? A ASP 311 ? A ASP 303 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 OE2 ? A GLU 367 ? A GLU 359 ? 1_555 78.2  ? 
28 OE1 ? A GLU 367 ? A GLU 359 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 OE2 ? A GLU 367 ? A GLU 359 ? 1_555 53.5  ? 
29 O   ? K HOH .   ? A HOH 409 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 OE2 ? A GLU 367 ? A GLU 359 ? 1_555 99.9  ? 
30 O1P ? C C2E .   ? A C2E 501 ? 1_555 MN ? E MN . ? A MN 503 ? 1_555 OE2 ? A GLU 367 ? A GLU 359 ? 1_555 169.9 ? 
31 OE2 ? B GLU 196 ? B GLU 188 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 OD1 ? B ASN 247 ? B ASN 239 ? 1_555 95.2  ? 
32 OE2 ? B GLU 196 ? B GLU 188 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 OE2 ? B GLU 280 ? B GLU 272 ? 1_555 85.9  ? 
33 OD1 ? B ASN 247 ? B ASN 239 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 OE2 ? B GLU 280 ? B GLU 272 ? 1_555 85.9  ? 
34 OE2 ? B GLU 196 ? B GLU 188 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 OD1 ? B ASP 310 ? B ASP 302 ? 1_555 173.5 ? 
35 OD1 ? B ASN 247 ? B ASN 239 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 OD1 ? B ASP 310 ? B ASP 302 ? 1_555 89.5  ? 
36 OE2 ? B GLU 280 ? B GLU 272 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 OD1 ? B ASP 310 ? B ASP 302 ? 1_555 90.0  ? 
37 OE2 ? B GLU 196 ? B GLU 188 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O   ? L HOH .   ? B HOH 407 ? 1_555 81.7  ? 
38 OD1 ? B ASN 247 ? B ASN 239 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O   ? L HOH .   ? B HOH 407 ? 1_555 176.6 ? 
39 OE2 ? B GLU 280 ? B GLU 272 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O   ? L HOH .   ? B HOH 407 ? 1_555 92.5  ? 
40 OD1 ? B ASP 310 ? B ASP 302 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O   ? L HOH .   ? B HOH 407 ? 1_555 93.5  ? 
41 OE2 ? B GLU 196 ? B GLU 188 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O2P ? G C2E .   ? B C2E 501 ? 1_555 82.1  ? 
42 OD1 ? B ASN 247 ? B ASN 239 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O2P ? G C2E .   ? B C2E 501 ? 1_555 99.6  ? 
43 OE2 ? B GLU 280 ? B GLU 272 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O2P ? G C2E .   ? B C2E 501 ? 1_555 167.2 ? 
44 OD1 ? B ASP 310 ? B ASP 302 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O2P ? G C2E .   ? B C2E 501 ? 1_555 101.6 ? 
45 O   ? L HOH .   ? B HOH 407 ? 1_555 MN ? H MN . ? B MN 502 ? 1_555 O2P ? G C2E .   ? B C2E 501 ? 1_555 81.4  ? 
46 OD2 ? B ASP 310 ? B ASP 302 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 OD1 ? B ASP 311 ? B ASP 303 ? 1_555 83.0  ? 
47 OD2 ? B ASP 310 ? B ASP 302 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 OE1 ? B GLU 367 ? B GLU 359 ? 1_555 140.8 ? 
48 OD1 ? B ASP 311 ? B ASP 303 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 OE1 ? B GLU 367 ? B GLU 359 ? 1_555 90.0  ? 
49 OD2 ? B ASP 310 ? B ASP 302 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 OE2 ? B GLU 367 ? B GLU 359 ? 1_555 90.8  ? 
50 OD1 ? B ASP 311 ? B ASP 303 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 OE2 ? B GLU 367 ? B GLU 359 ? 1_555 112.3 ? 
51 OE1 ? B GLU 367 ? B GLU 359 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 OE2 ? B GLU 367 ? B GLU 359 ? 1_555 56.5  ? 
52 OD2 ? B ASP 310 ? B ASP 302 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O   ? L HOH .   ? B HOH 407 ? 1_555 82.5  ? 
53 OD1 ? B ASP 311 ? B ASP 303 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O   ? L HOH .   ? B HOH 407 ? 1_555 162.5 ? 
54 OE1 ? B GLU 367 ? B GLU 359 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O   ? L HOH .   ? B HOH 407 ? 1_555 107.4 ? 
55 OE2 ? B GLU 367 ? B GLU 359 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O   ? L HOH .   ? B HOH 407 ? 1_555 77.6  ? 
56 OD2 ? B ASP 310 ? B ASP 302 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O1P ? G C2E .   ? B C2E 501 ? 1_555 97.6  ? 
57 OD1 ? B ASP 311 ? B ASP 303 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O1P ? G C2E .   ? B C2E 501 ? 1_555 90.5  ? 
58 OE1 ? B GLU 367 ? B GLU 359 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O1P ? G C2E .   ? B C2E 501 ? 1_555 121.1 ? 
59 OE2 ? B GLU 367 ? B GLU 359 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O1P ? G C2E .   ? B C2E 501 ? 1_555 156.6 ? 
60 O   ? L HOH .   ? B HOH 407 ? 1_555 MN ? I MN . ? B MN 503 ? 1_555 O1P ? G C2E .   ? B C2E 501 ? 1_555 81.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-23 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2013-06-19 
4 'Structure model' 1 3 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345 'data collection' .        ? 1 
REFMAC refinement        5.2.0005 ? 2 
XDS    'data reduction'  .        ? 3 
XSCALE 'data scaling'    .        ? 4 
REFMAC phasing           5.2.0005 ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O2A 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   C2E 
_pdbx_validate_close_contact.auth_seq_id_1    501 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    408 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 103 ? ? 67.78   -16.17 
2  1 ASP A 135 ? ? -153.20 73.22  
3  1 LEU A 231 ? ? 70.18   -56.59 
4  1 ASP A 250 ? ? -105.80 42.73  
5  1 TYR A 308 ? ? 64.47   -45.36 
6  1 ASP B 19  ? ? -66.91  97.18  
7  1 ASP B 103 ? ? 76.47   -14.14 
8  1 ASP B 135 ? ? -150.71 79.60  
9  1 PRO B 230 ? ? -58.59  86.05  
10 1 LEU B 231 ? ? -77.50  48.02  
11 1 THR B 280 ? ? -96.16  51.91  
12 1 CYS B 281 ? ? -168.06 -15.88 
13 1 ARG B 316 ? ? -68.65  -79.86 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1A ? A C2E 501 ? PLANAR . 
2 1 C1A ? B C2E 501 ? PLANAR . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ILE -7  ? A ILE 1   
2  1 Y 1 A SER -6  ? A SER 2   
3  1 Y 1 A GLU -5  ? A GLU 3   
4  1 Y 1 A PHE -4  ? A PHE 4   
5  1 Y 1 A GLY -3  ? A GLY 5   
6  1 Y 1 A SER -2  ? A SER 6   
7  1 Y 1 A SER -1  ? A SER 7   
8  1 Y 1 A ARG 0   ? A ARG 8   
9  1 Y 1 A PHE 115 ? A PHE 123 
10 1 Y 1 A GLY 116 ? A GLY 124 
11 1 Y 1 A VAL 117 ? A VAL 125 
12 1 Y 1 A THR 118 ? A THR 126 
13 1 Y 1 A GLU 119 ? A GLU 127 
14 1 Y 1 A ALA 155 ? A ALA 163 
15 1 Y 1 A SER 156 ? A SER 164 
16 1 Y 1 A GLY 157 ? A GLY 165 
17 1 Y 1 A GLN 401 ? A GLN 409 
18 1 Y 1 A ALA 402 ? A ALA 410 
19 1 Y 1 A MET 403 ? A MET 411 
20 1 Y 1 A ASP 404 ? A ASP 412 
21 1 Y 1 A LEU 405 ? A LEU 413 
22 1 Y 1 B ILE -7  ? B ILE 1   
23 1 Y 1 B SER -6  ? B SER 2   
24 1 Y 1 B GLU -5  ? B GLU 3   
25 1 Y 1 B PHE -4  ? B PHE 4   
26 1 Y 1 B GLY -3  ? B GLY 5   
27 1 Y 1 B SER -2  ? B SER 6   
28 1 Y 1 B SER -1  ? B SER 7   
29 1 Y 1 B ARG 0   ? B ARG 8   
30 1 Y 1 B PRO 154 ? B PRO 162 
31 1 Y 1 B ALA 155 ? B ALA 163 
32 1 Y 1 B SER 156 ? B SER 164 
33 1 Y 1 B GLY 157 ? B GLY 165 
34 1 Y 1 B THR 158 ? B THR 166 
35 1 Y 1 B ALA 159 ? B ALA 167 
36 1 Y 1 B GLN 401 ? B GLN 409 
37 1 Y 1 B ALA 402 ? B ALA 410 
38 1 Y 1 B MET 403 ? B MET 411 
39 1 Y 1 B ASP 404 ? B ASP 412 
40 1 Y 1 B LEU 405 ? B LEU 413 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one)
;
C2E 
3 'MANGANESE (II) ION' MN  
4 'FLAVIN MONONUCLEOTIDE' FMN 
5 water HOH 
#