data_3GNI
# 
_entry.id   3GNI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GNI         
RCSB  RCSB052081   
WWPDB D_1000052081 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1UPK . unspecified 
PDB 1UPL . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GNI 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zeqiraj, E.'        1 
'Goldie, S.'         2 
'Alessi, D.R.'       3 
'van Aalten, D.M.F.' 4 
# 
_citation.id                        primary 
_citation.title                     
'ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor' 
_citation.journal_abbrev            'Plos Biol.' 
_citation.journal_volume            7 
_citation.page_first                e1000126 
_citation.page_last                 e1000126 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1544-9173 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19513107 
_citation.pdbx_database_id_DOI      10.1371/journal.pbio.1000126 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zeqiraj, E.'      1 
primary 'Filippi, B.M.'    2 
primary 'Goldie, S.'       3 
primary 'Navratilova, I.'  4 
primary 'Boudeau, J.'      5 
primary 'Deak, M.'         6 
primary 'Alessi, D.R.'     7 
primary 'van Aalten, D.M.' 8 
# 
_cell.entry_id           3GNI 
_cell.length_a           73.678 
_cell.length_b           82.874 
_cell.length_c           134.292 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3GNI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein Mo25'              39922.934 1  ? ? ?                       ? 
2 polymer     man 'STRAD alpha'               43762.617 1  ? ? 'Protein kinase domain' ? 
3 non-polymer syn 'CITRIC ACID'               192.124   1  ? ? ?                       ? 
4 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181   1  ? ? ?                       ? 
5 water       nat water                       18.015    77 ? ? ?                       ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Calcium-binding protein 39' 
2 
'STE20-related kinase adapter protein alpha, STE20-related adapter protein, Serologically defined breast cancer antigen NY-BR-96' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLL
STLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKII
LWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFN
DEKTYLVKQIRDLKRPAQQEA
;
;MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLL
STLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKII
LWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFN
DEKTYLVKQIRDLKRPAQQEA
;
A ? 
2 'polypeptide(L)' no no 
;MAHHHHHHMENLYFQGMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVS
KLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHIL
ISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDM
PATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQR
NPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF
;
;MAHHHHHHMENLYFQGMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVS
KLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHIL
ISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDM
PATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQR
NPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   PHE n 
1 4   PRO n 
1 5   PHE n 
1 6   GLY n 
1 7   LYS n 
1 8   SER n 
1 9   HIS n 
1 10  LYS n 
1 11  SER n 
1 12  PRO n 
1 13  ALA n 
1 14  ASP n 
1 15  ILE n 
1 16  VAL n 
1 17  LYS n 
1 18  ASN n 
1 19  LEU n 
1 20  LYS n 
1 21  GLU n 
1 22  SER n 
1 23  MET n 
1 24  ALA n 
1 25  VAL n 
1 26  LEU n 
1 27  GLU n 
1 28  LYS n 
1 29  GLN n 
1 30  ASP n 
1 31  ILE n 
1 32  SER n 
1 33  ASP n 
1 34  LYS n 
1 35  LYS n 
1 36  ALA n 
1 37  GLU n 
1 38  LYS n 
1 39  ALA n 
1 40  THR n 
1 41  GLU n 
1 42  GLU n 
1 43  VAL n 
1 44  SER n 
1 45  LYS n 
1 46  ASN n 
1 47  LEU n 
1 48  VAL n 
1 49  ALA n 
1 50  MET n 
1 51  LYS n 
1 52  GLU n 
1 53  ILE n 
1 54  LEU n 
1 55  TYR n 
1 56  GLY n 
1 57  THR n 
1 58  ASN n 
1 59  GLU n 
1 60  LYS n 
1 61  GLU n 
1 62  PRO n 
1 63  GLN n 
1 64  THR n 
1 65  GLU n 
1 66  ALA n 
1 67  VAL n 
1 68  ALA n 
1 69  GLN n 
1 70  LEU n 
1 71  ALA n 
1 72  GLN n 
1 73  GLU n 
1 74  LEU n 
1 75  TYR n 
1 76  ASN n 
1 77  SER n 
1 78  GLY n 
1 79  LEU n 
1 80  LEU n 
1 81  SER n 
1 82  THR n 
1 83  LEU n 
1 84  VAL n 
1 85  ALA n 
1 86  ASP n 
1 87  LEU n 
1 88  GLN n 
1 89  LEU n 
1 90  ILE n 
1 91  ASP n 
1 92  PHE n 
1 93  GLU n 
1 94  GLY n 
1 95  LYS n 
1 96  LYS n 
1 97  ASP n 
1 98  VAL n 
1 99  ALA n 
1 100 GLN n 
1 101 ILE n 
1 102 PHE n 
1 103 ASN n 
1 104 ASN n 
1 105 ILE n 
1 106 LEU n 
1 107 ARG n 
1 108 ARG n 
1 109 GLN n 
1 110 ILE n 
1 111 GLY n 
1 112 THR n 
1 113 ARG n 
1 114 THR n 
1 115 PRO n 
1 116 THR n 
1 117 VAL n 
1 118 GLU n 
1 119 TYR n 
1 120 ILE n 
1 121 CYS n 
1 122 THR n 
1 123 GLN n 
1 124 GLN n 
1 125 ASN n 
1 126 ILE n 
1 127 LEU n 
1 128 PHE n 
1 129 MET n 
1 130 LEU n 
1 131 LEU n 
1 132 LYS n 
1 133 GLY n 
1 134 TYR n 
1 135 GLU n 
1 136 SER n 
1 137 PRO n 
1 138 GLU n 
1 139 ILE n 
1 140 ALA n 
1 141 LEU n 
1 142 ASN n 
1 143 CYS n 
1 144 GLY n 
1 145 ILE n 
1 146 MET n 
1 147 LEU n 
1 148 ARG n 
1 149 GLU n 
1 150 CYS n 
1 151 ILE n 
1 152 ARG n 
1 153 HIS n 
1 154 GLU n 
1 155 PRO n 
1 156 LEU n 
1 157 ALA n 
1 158 LYS n 
1 159 ILE n 
1 160 ILE n 
1 161 LEU n 
1 162 TRP n 
1 163 SER n 
1 164 GLU n 
1 165 GLN n 
1 166 PHE n 
1 167 TYR n 
1 168 ASP n 
1 169 PHE n 
1 170 PHE n 
1 171 ARG n 
1 172 TYR n 
1 173 VAL n 
1 174 GLU n 
1 175 MET n 
1 176 SER n 
1 177 THR n 
1 178 PHE n 
1 179 ASP n 
1 180 ILE n 
1 181 ALA n 
1 182 SER n 
1 183 ASP n 
1 184 ALA n 
1 185 PHE n 
1 186 ALA n 
1 187 THR n 
1 188 PHE n 
1 189 LYS n 
1 190 ASP n 
1 191 LEU n 
1 192 LEU n 
1 193 THR n 
1 194 ARG n 
1 195 HIS n 
1 196 LYS n 
1 197 LEU n 
1 198 LEU n 
1 199 SER n 
1 200 ALA n 
1 201 GLU n 
1 202 PHE n 
1 203 LEU n 
1 204 GLU n 
1 205 GLN n 
1 206 HIS n 
1 207 TYR n 
1 208 ASP n 
1 209 ARG n 
1 210 PHE n 
1 211 PHE n 
1 212 SER n 
1 213 GLU n 
1 214 TYR n 
1 215 GLU n 
1 216 LYS n 
1 217 LEU n 
1 218 LEU n 
1 219 HIS n 
1 220 SER n 
1 221 GLU n 
1 222 ASN n 
1 223 TYR n 
1 224 VAL n 
1 225 THR n 
1 226 LYS n 
1 227 ARG n 
1 228 GLN n 
1 229 SER n 
1 230 LEU n 
1 231 LYS n 
1 232 LEU n 
1 233 LEU n 
1 234 GLY n 
1 235 GLU n 
1 236 LEU n 
1 237 LEU n 
1 238 LEU n 
1 239 ASP n 
1 240 ARG n 
1 241 HIS n 
1 242 ASN n 
1 243 PHE n 
1 244 THR n 
1 245 ILE n 
1 246 MET n 
1 247 THR n 
1 248 LYS n 
1 249 TYR n 
1 250 ILE n 
1 251 SER n 
1 252 LYS n 
1 253 PRO n 
1 254 GLU n 
1 255 ASN n 
1 256 LEU n 
1 257 LYS n 
1 258 LEU n 
1 259 MET n 
1 260 MET n 
1 261 ASN n 
1 262 LEU n 
1 263 LEU n 
1 264 ARG n 
1 265 ASP n 
1 266 LYS n 
1 267 SER n 
1 268 ARG n 
1 269 ASN n 
1 270 ILE n 
1 271 GLN n 
1 272 PHE n 
1 273 GLU n 
1 274 ALA n 
1 275 PHE n 
1 276 HIS n 
1 277 VAL n 
1 278 PHE n 
1 279 LYS n 
1 280 VAL n 
1 281 PHE n 
1 282 VAL n 
1 283 ALA n 
1 284 ASN n 
1 285 PRO n 
1 286 ASN n 
1 287 LYS n 
1 288 THR n 
1 289 GLN n 
1 290 PRO n 
1 291 ILE n 
1 292 LEU n 
1 293 ASP n 
1 294 ILE n 
1 295 LEU n 
1 296 LEU n 
1 297 LYS n 
1 298 ASN n 
1 299 GLN n 
1 300 ALA n 
1 301 LYS n 
1 302 LEU n 
1 303 ILE n 
1 304 GLU n 
1 305 PHE n 
1 306 LEU n 
1 307 SER n 
1 308 LYS n 
1 309 PHE n 
1 310 GLN n 
1 311 ASN n 
1 312 ASP n 
1 313 ARG n 
1 314 THR n 
1 315 GLU n 
1 316 ASP n 
1 317 GLU n 
1 318 GLN n 
1 319 PHE n 
1 320 ASN n 
1 321 ASP n 
1 322 GLU n 
1 323 LYS n 
1 324 THR n 
1 325 TYR n 
1 326 LEU n 
1 327 VAL n 
1 328 LYS n 
1 329 GLN n 
1 330 ILE n 
1 331 ARG n 
1 332 ASP n 
1 333 LEU n 
1 334 LYS n 
1 335 ARG n 
1 336 PRO n 
1 337 ALA n 
1 338 GLN n 
1 339 GLN n 
1 340 GLU n 
1 341 ALA n 
2 1   MET n 
2 2   ALA n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   MET n 
2 10  GLU n 
2 11  ASN n 
2 12  LEU n 
2 13  TYR n 
2 14  PHE n 
2 15  GLN n 
2 16  GLY n 
2 17  MET n 
2 18  SER n 
2 19  SER n 
2 20  PHE n 
2 21  LEU n 
2 22  PRO n 
2 23  GLU n 
2 24  GLY n 
2 25  GLY n 
2 26  CYS n 
2 27  TYR n 
2 28  GLU n 
2 29  LEU n 
2 30  LEU n 
2 31  THR n 
2 32  VAL n 
2 33  ILE n 
2 34  GLY n 
2 35  LYS n 
2 36  GLY n 
2 37  PHE n 
2 38  GLU n 
2 39  ASP n 
2 40  LEU n 
2 41  MET n 
2 42  THR n 
2 43  VAL n 
2 44  ASN n 
2 45  LEU n 
2 46  ALA n 
2 47  ARG n 
2 48  TYR n 
2 49  LYS n 
2 50  PRO n 
2 51  THR n 
2 52  GLY n 
2 53  GLU n 
2 54  TYR n 
2 55  VAL n 
2 56  THR n 
2 57  VAL n 
2 58  ARG n 
2 59  ARG n 
2 60  ILE n 
2 61  ASN n 
2 62  LEU n 
2 63  GLU n 
2 64  ALA n 
2 65  CYS n 
2 66  SER n 
2 67  ASN n 
2 68  GLU n 
2 69  MET n 
2 70  VAL n 
2 71  THR n 
2 72  PHE n 
2 73  LEU n 
2 74  GLN n 
2 75  GLY n 
2 76  GLU n 
2 77  LEU n 
2 78  HIS n 
2 79  VAL n 
2 80  SER n 
2 81  LYS n 
2 82  LEU n 
2 83  PHE n 
2 84  ASN n 
2 85  HIS n 
2 86  PRO n 
2 87  ASN n 
2 88  ILE n 
2 89  VAL n 
2 90  PRO n 
2 91  TYR n 
2 92  ARG n 
2 93  ALA n 
2 94  THR n 
2 95  PHE n 
2 96  ILE n 
2 97  ALA n 
2 98  ASP n 
2 99  ASN n 
2 100 GLU n 
2 101 LEU n 
2 102 TRP n 
2 103 VAL n 
2 104 VAL n 
2 105 THR n 
2 106 SER n 
2 107 PHE n 
2 108 MET n 
2 109 ALA n 
2 110 TYR n 
2 111 GLY n 
2 112 SER n 
2 113 ALA n 
2 114 LYS n 
2 115 ASP n 
2 116 LEU n 
2 117 ILE n 
2 118 CYS n 
2 119 THR n 
2 120 HIS n 
2 121 PHE n 
2 122 MET n 
2 123 ASP n 
2 124 GLY n 
2 125 MET n 
2 126 ASN n 
2 127 GLU n 
2 128 LEU n 
2 129 ALA n 
2 130 ILE n 
2 131 ALA n 
2 132 TYR n 
2 133 ILE n 
2 134 LEU n 
2 135 GLN n 
2 136 GLY n 
2 137 VAL n 
2 138 LEU n 
2 139 LYS n 
2 140 ALA n 
2 141 LEU n 
2 142 ASP n 
2 143 TYR n 
2 144 ILE n 
2 145 HIS n 
2 146 HIS n 
2 147 MET n 
2 148 GLY n 
2 149 TYR n 
2 150 VAL n 
2 151 HIS n 
2 152 ARG n 
2 153 SER n 
2 154 VAL n 
2 155 LYS n 
2 156 ALA n 
2 157 SER n 
2 158 HIS n 
2 159 ILE n 
2 160 LEU n 
2 161 ILE n 
2 162 SER n 
2 163 VAL n 
2 164 ASP n 
2 165 GLY n 
2 166 LYS n 
2 167 VAL n 
2 168 TYR n 
2 169 LEU n 
2 170 SER n 
2 171 GLY n 
2 172 LEU n 
2 173 ARG n 
2 174 SER n 
2 175 ASN n 
2 176 LEU n 
2 177 SER n 
2 178 MET n 
2 179 ILE n 
2 180 SER n 
2 181 HIS n 
2 182 GLY n 
2 183 GLN n 
2 184 ARG n 
2 185 GLN n 
2 186 ARG n 
2 187 VAL n 
2 188 VAL n 
2 189 HIS n 
2 190 ASP n 
2 191 PHE n 
2 192 PRO n 
2 193 LYS n 
2 194 TYR n 
2 195 SER n 
2 196 VAL n 
2 197 LYS n 
2 198 VAL n 
2 199 LEU n 
2 200 PRO n 
2 201 TRP n 
2 202 LEU n 
2 203 SER n 
2 204 PRO n 
2 205 GLU n 
2 206 VAL n 
2 207 LEU n 
2 208 GLN n 
2 209 GLN n 
2 210 ASN n 
2 211 LEU n 
2 212 GLN n 
2 213 GLY n 
2 214 TYR n 
2 215 ASP n 
2 216 ALA n 
2 217 LYS n 
2 218 SER n 
2 219 ASP n 
2 220 ILE n 
2 221 TYR n 
2 222 SER n 
2 223 VAL n 
2 224 GLY n 
2 225 ILE n 
2 226 THR n 
2 227 ALA n 
2 228 CYS n 
2 229 GLU n 
2 230 LEU n 
2 231 ALA n 
2 232 ASN n 
2 233 GLY n 
2 234 HIS n 
2 235 VAL n 
2 236 PRO n 
2 237 PHE n 
2 238 LYS n 
2 239 ASP n 
2 240 MET n 
2 241 PRO n 
2 242 ALA n 
2 243 THR n 
2 244 GLN n 
2 245 MET n 
2 246 LEU n 
2 247 LEU n 
2 248 GLU n 
2 249 LYS n 
2 250 LEU n 
2 251 ASN n 
2 252 GLY n 
2 253 THR n 
2 254 VAL n 
2 255 PRO n 
2 256 CYS n 
2 257 LEU n 
2 258 LEU n 
2 259 ASP n 
2 260 THR n 
2 261 SER n 
2 262 THR n 
2 263 ILE n 
2 264 PRO n 
2 265 ALA n 
2 266 GLU n 
2 267 GLU n 
2 268 LEU n 
2 269 THR n 
2 270 MET n 
2 271 SER n 
2 272 PRO n 
2 273 SER n 
2 274 ARG n 
2 275 SER n 
2 276 VAL n 
2 277 ALA n 
2 278 ASN n 
2 279 SER n 
2 280 GLY n 
2 281 LEU n 
2 282 SER n 
2 283 ASP n 
2 284 SER n 
2 285 LEU n 
2 286 THR n 
2 287 THR n 
2 288 SER n 
2 289 THR n 
2 290 PRO n 
2 291 ARG n 
2 292 PRO n 
2 293 SER n 
2 294 ASN n 
2 295 GLY n 
2 296 ASP n 
2 297 SER n 
2 298 PRO n 
2 299 SER n 
2 300 HIS n 
2 301 PRO n 
2 302 TYR n 
2 303 HIS n 
2 304 ARG n 
2 305 THR n 
2 306 PHE n 
2 307 SER n 
2 308 PRO n 
2 309 HIS n 
2 310 PHE n 
2 311 HIS n 
2 312 HIS n 
2 313 PHE n 
2 314 VAL n 
2 315 GLU n 
2 316 GLN n 
2 317 CYS n 
2 318 LEU n 
2 319 GLN n 
2 320 ARG n 
2 321 ASN n 
2 322 PRO n 
2 323 ASP n 
2 324 ALA n 
2 325 ARG n 
2 326 PRO n 
2 327 SER n 
2 328 ALA n 
2 329 SER n 
2 330 THR n 
2 331 LEU n 
2 332 LEU n 
2 333 ASN n 
2 334 HIS n 
2 335 SER n 
2 336 PHE n 
2 337 PHE n 
2 338 LYS n 
2 339 GLN n 
2 340 ILE n 
2 341 LYS n 
2 342 ARG n 
2 343 ARG n 
2 344 ALA n 
2 345 SER n 
2 346 GLU n 
2 347 ALA n 
2 348 LEU n 
2 349 PRO n 
2 350 GLU n 
2 351 LEU n 
2 352 LEU n 
2 353 ARG n 
2 354 PRO n 
2 355 VAL n 
2 356 THR n 
2 357 PRO n 
2 358 ILE n 
2 359 THR n 
2 360 ASN n 
2 361 PHE n 
2 362 GLU n 
2 363 GLY n 
2 364 SER n 
2 365 GLN n 
2 366 SER n 
2 367 GLN n 
2 368 ASP n 
2 369 HIS n 
2 370 SER n 
2 371 GLY n 
2 372 ILE n 
2 373 PHE n 
2 374 GLY n 
2 375 LEU n 
2 376 VAL n 
2 377 THR n 
2 378 ASN n 
2 379 LEU n 
2 380 GLU n 
2 381 GLU n 
2 382 LEU n 
2 383 GLU n 
2 384 VAL n 
2 385 ASP n 
2 386 ASP n 
2 387 TRP n 
2 388 GLU n 
2 389 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CAB39, MO25, CGI-66' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? 'BL21(DE3)pLysS' ? ? plasmid ? ? ? pOPC ? ? 
2 1 sample ? ? ? human ? 'STRADA, LYK5, STRAD' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? 'BL21(DE3)pLysS' ? ? plasmid ? ? ? pOPC ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CAB39_HUMAN Q9Y376 1 
;MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLL
STLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKII
LWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFN
DEKTYLVKQIRDLKRPAQQEA
;
1  ? 
2 UNP STRAA_HUMAN Q7RTN6 2 
;MSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFI
ADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNL
SMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPC
LLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSF
FKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF
;
59 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GNI A 1  ? 341 ? Q9Y376 1  ? 341 ? 1  341 
2 2 3GNI B 17 ? 389 ? Q7RTN6 59 ? 431 ? 59 431 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 3GNI MET B 1  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -16 1  
2 3GNI ALA B 2  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -15 2  
2 3GNI HIS B 3  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -14 3  
2 3GNI HIS B 4  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -13 4  
2 3GNI HIS B 5  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -12 5  
2 3GNI HIS B 6  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -11 6  
2 3GNI HIS B 7  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -10 7  
2 3GNI HIS B 8  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -9  8  
2 3GNI MET B 9  ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -8  9  
2 3GNI GLU B 10 ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -7  10 
2 3GNI ASN B 11 ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -6  11 
2 3GNI LEU B 12 ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -5  12 
2 3GNI TYR B 13 ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -4  13 
2 3GNI PHE B 14 ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -3  14 
2 3GNI GLN B 15 ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -2  15 
2 3GNI GLY B 16 ? UNP Q7RTN6 ? ? 'EXPRESSION TAG' -1  16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CIT non-polymer         . 'CITRIC ACID'               ? 'C6 H8 O7'          192.124 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3GNI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.79 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M MES pH 6.4, 10% PEG8000, 0.25 microL of 1 M NDSB-256, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'HORIZONTALLY DIFFRACTING SI (111) MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8730 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             0.8730 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3GNI 
_reflns.observed_criterion_sigma_I   1.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.350 
_reflns.number_obs                   34668 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.0100 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.500 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.35 
_reflns_shell.d_res_low              2.48 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.617 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        5.60 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3GNI 
_refine.ls_number_reflns_obs                     33712 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.82 
_refine.ls_d_res_high                            2.35 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       0.254 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.600 
_refine.ls_number_reflns_R_free                  902 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.B_iso_mean                               28.63 
_refine.aniso_B[1][1]                            2.93000 
_refine.aniso_B[2][2]                            -0.28000 
_refine.aniso_B[3][3]                            -2.64000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRIES 1UPK AND 1U5R' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.321 
_refine.pdbx_overall_ESU_R_Free                  0.240 
_refine.overall_SU_ML                            0.197 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             18.778 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5202 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               5323 
_refine_hist.d_res_high                       2.35 
_refine_hist.d_res_low                        19.82 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 5364 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.277  1.967  ? 7251 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.942  5.000  ? 633  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.767 24.402 ? 259  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.585 15.000 ? 965  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.295 15.000 ? 26   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.088  0.200  ? 800  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 4009 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.196  0.200  ? 2217 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.298  0.200  ? 3643 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.120  0.200  ? 171  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.191  0.200  ? 73   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.207  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.063  1.500  ? 3296 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.685  2.000  ? 5168 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.042  3.000  ? 2343 'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.452  4.500  ? 2083 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.35 
_refine_ls_shell.d_res_low                        2.413 
_refine_ls_shell.number_reflns_R_work             2314 
_refine_ls_shell.R_factor_R_work                  0.2560 
_refine_ls_shell.percent_reflns_obs               95.57 
_refine_ls_shell.R_factor_R_free                  0.3740 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             61 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                4988 
# 
_struct.entry_id                  3GNI 
_struct.title                     'Structure of STRAD and MO25' 
_struct.pdbx_descriptor           'Calcium-binding protein 39, STE20-related kinase adapter protein alpha' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GNI 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/SIGNALING PROTEIN' 
_struct_keywords.text            
;kinase fold, pseudokinase, alpha helical repeat protein, adaptor protein, ATP-binding, Cell cycle, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Transferase, METAL BINDING PROTEIN-TRANSFERASE COMPLEX, SIGNALING PROTEIN-SIGNALING PROTEIN COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 11  ? LYS A 28  ? SER A 11  LYS A 28  1 ? 18 
HELX_P HELX_P2  2  SER A 32  ? GLY A 56  ? SER A 32  GLY A 56  1 ? 25 
HELX_P HELX_P3  3  GLN A 63  ? GLY A 78  ? GLN A 63  GLY A 78  1 ? 16 
HELX_P HELX_P4  4  GLY A 78  ? ASP A 86  ? GLY A 78  ASP A 86  1 ? 9  
HELX_P HELX_P5  5  LEU A 87  ? ILE A 90  ? LEU A 87  ILE A 90  5 ? 4  
HELX_P HELX_P6  6  ASP A 91  ? ARG A 107 ? ASP A 91  ARG A 107 1 ? 17 
HELX_P HELX_P7  7  THR A 114 ? GLN A 123 ? THR A 114 GLN A 123 1 ? 10 
HELX_P HELX_P8  8  GLN A 124 ? GLY A 133 ? GLN A 124 GLY A 133 1 ? 10 
HELX_P HELX_P9  9  TYR A 134 ? SER A 136 ? TYR A 134 SER A 136 5 ? 3  
HELX_P HELX_P10 10 ILE A 139 ? ILE A 151 ? ILE A 139 ILE A 151 1 ? 13 
HELX_P HELX_P11 11 HIS A 153 ? TRP A 162 ? HIS A 153 TRP A 162 1 ? 10 
HELX_P HELX_P12 12 GLU A 164 ? TYR A 167 ? GLU A 164 TYR A 167 5 ? 4  
HELX_P HELX_P13 13 ASP A 168 ? VAL A 173 ? ASP A 168 VAL A 173 1 ? 6  
HELX_P HELX_P14 14 THR A 177 ? ARG A 194 ? THR A 177 ARG A 194 1 ? 18 
HELX_P HELX_P15 15 HIS A 195 ? HIS A 206 ? HIS A 195 HIS A 206 1 ? 12 
HELX_P HELX_P16 16 HIS A 206 ? LEU A 218 ? HIS A 206 LEU A 218 1 ? 13 
HELX_P HELX_P17 17 ASN A 222 ? LEU A 238 ? ASN A 222 LEU A 238 1 ? 17 
HELX_P HELX_P18 18 ASP A 239 ? HIS A 241 ? ASP A 239 HIS A 241 5 ? 3  
HELX_P HELX_P19 19 ASN A 242 ? ILE A 250 ? ASN A 242 ILE A 250 1 ? 9  
HELX_P HELX_P20 20 LYS A 252 ? LEU A 263 ? LYS A 252 LEU A 263 1 ? 12 
HELX_P HELX_P21 21 SER A 267 ? ASN A 284 ? SER A 267 ASN A 284 1 ? 18 
HELX_P HELX_P22 22 THR A 288 ? ASN A 298 ? THR A 288 ASN A 298 1 ? 11 
HELX_P HELX_P23 23 ASN A 298 ? LYS A 308 ? ASN A 298 LYS A 308 1 ? 11 
HELX_P HELX_P24 24 ASP A 316 ? ASP A 332 ? ASP A 316 ASP A 332 1 ? 17 
HELX_P HELX_P25 25 HIS B 7   ? LEU B 12  ? HIS B -10 LEU B -5  1 ? 6  
HELX_P HELX_P26 26 GLU B 23  ? GLY B 25  ? GLU B 65  GLY B 67  5 ? 3  
HELX_P HELX_P27 27 GLU B 63  ? CYS B 65  ? GLU B 105 CYS B 107 5 ? 3  
HELX_P HELX_P28 28 SER B 66  ? PHE B 83  ? SER B 108 PHE B 125 1 ? 18 
HELX_P HELX_P29 29 SER B 112 ? HIS B 120 ? SER B 154 HIS B 162 1 ? 9  
HELX_P HELX_P30 30 ASN B 126 ? MET B 147 ? ASN B 168 MET B 189 1 ? 22 
HELX_P HELX_P31 31 LYS B 155 ? SER B 157 ? LYS B 197 SER B 199 5 ? 3  
HELX_P HELX_P32 32 GLY B 171 ? ASN B 175 ? GLY B 213 ASN B 217 5 ? 5  
HELX_P HELX_P33 33 VAL B 198 ? LEU B 202 ? VAL B 240 LEU B 244 5 ? 5  
HELX_P HELX_P34 34 SER B 203 ? GLN B 208 ? SER B 245 GLN B 250 1 ? 6  
HELX_P HELX_P35 35 ALA B 216 ? GLY B 233 ? ALA B 258 GLY B 275 1 ? 18 
HELX_P HELX_P36 36 GLN B 244 ? LYS B 249 ? GLN B 286 LYS B 291 1 ? 6  
HELX_P HELX_P37 37 SER B 307 ? LEU B 318 ? SER B 349 LEU B 360 1 ? 12 
HELX_P HELX_P38 38 SER B 327 ? LEU B 332 ? SER B 369 LEU B 374 1 ? 6  
HELX_P HELX_P39 39 ASN B 333 ? ILE B 340 ? ASN B 375 ILE B 382 5 ? 8  
HELX_P HELX_P40 40 ALA B 347 ? LEU B 352 ? ALA B 389 LEU B 394 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           353 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            395 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    354 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     396 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       7.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR B 27  ? GLY B 36  ? TYR B 69  GLY B 78  
A 2 MET B 41  ? TYR B 48  ? MET B 83  TYR B 90  
A 3 TYR B 54  ? ASN B 61  ? TYR B 96  ASN B 103 
A 4 GLU B 100 ? SER B 106 ? GLU B 142 SER B 148 
A 5 TYR B 91  ? ALA B 97  ? TYR B 133 ALA B 139 
B 1 TYR B 149 ? VAL B 150 ? TYR B 191 VAL B 192 
B 2 LEU B 176 ? SER B 177 ? LEU B 218 SER B 219 
C 1 ILE B 159 ? ILE B 161 ? ILE B 201 ILE B 203 
C 2 VAL B 167 ? LEU B 169 ? VAL B 209 LEU B 211 
D 1 ILE B 179 ? SER B 180 ? ILE B 221 SER B 222 
D 2 GLN B 183 ? ARG B 184 ? GLN B 225 ARG B 226 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE B 33  ? N ILE B 75  O VAL B 43  ? O VAL B 85  
A 2 3 N ASN B 44  ? N ASN B 86  O VAL B 57  ? O VAL B 99  
A 3 4 N ARG B 58  ? N ARG B 100 O VAL B 103 ? O VAL B 145 
A 4 5 O TRP B 102 ? O TRP B 144 N PHE B 95  ? N PHE B 137 
B 1 2 N VAL B 150 ? N VAL B 192 O LEU B 176 ? O LEU B 218 
C 1 2 N LEU B 160 ? N LEU B 202 O TYR B 168 ? O TYR B 210 
D 1 2 N SER B 180 ? N SER B 222 O GLN B 183 ? O GLN B 225 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE ATP B 1'   
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CIT A 342' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 HOH E .   ? HOH A 346 . ? 1_555 ? 
2  AC1 22 HOH E .   ? HOH A 360 . ? 1_555 ? 
3  AC1 22 HOH E .   ? HOH A 365 . ? 1_555 ? 
4  AC1 22 HOH E .   ? HOH A 370 . ? 1_555 ? 
5  AC1 22 HOH E .   ? HOH A 376 . ? 1_555 ? 
6  AC1 22 HOH E .   ? HOH A 401 . ? 1_555 ? 
7  AC1 22 ILE B 33  ? ILE B 75  . ? 1_555 ? 
8  AC1 22 GLY B 34  ? GLY B 76  . ? 1_555 ? 
9  AC1 22 LYS B 35  ? LYS B 77  . ? 1_555 ? 
10 AC1 22 GLY B 36  ? GLY B 78  . ? 1_555 ? 
11 AC1 22 PHE B 37  ? PHE B 79  . ? 1_555 ? 
12 AC1 22 MET B 41  ? MET B 83  . ? 1_555 ? 
13 AC1 22 THR B 56  ? THR B 98  . ? 1_555 ? 
14 AC1 22 ARG B 58  ? ARG B 100 . ? 1_555 ? 
15 AC1 22 THR B 105 ? THR B 147 . ? 1_555 ? 
16 AC1 22 SER B 106 ? SER B 148 . ? 1_555 ? 
17 AC1 22 MET B 108 ? MET B 150 . ? 1_555 ? 
18 AC1 22 ASP B 115 ? ASP B 157 . ? 1_555 ? 
19 AC1 22 SER B 157 ? SER B 199 . ? 1_555 ? 
20 AC1 22 HIS B 158 ? HIS B 200 . ? 1_555 ? 
21 AC1 22 LEU B 160 ? LEU B 202 . ? 1_555 ? 
22 AC1 22 ARG B 173 ? ARG B 215 . ? 1_555 ? 
23 AC2 4  ARG A 107 ? ARG A 107 . ? 1_555 ? 
24 AC2 4  ARG A 152 ? ARG A 152 . ? 1_555 ? 
25 AC2 4  ARG A 194 ? ARG A 194 . ? 1_555 ? 
26 AC2 4  HIS B 181 ? HIS B 223 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3GNI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GNI 
_atom_sites.fract_transf_matrix[1][1]   0.013572 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012066 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007446 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PRO A 1 2   ? 1.245   12.198  -30.705 1.00 29.07 ? 2   PRO A N     1 
ATOM   2    C CA    . PRO A 1 2   ? 1.554   12.844  -29.423 1.00 29.09 ? 2   PRO A CA    1 
ATOM   3    C C     . PRO A 1 2   ? 2.646   13.907  -29.568 1.00 28.86 ? 2   PRO A C     1 
ATOM   4    O O     . PRO A 1 2   ? 3.810   13.577  -29.832 1.00 28.48 ? 2   PRO A O     1 
ATOM   5    C CB    . PRO A 1 2   ? 2.037   11.681  -28.537 1.00 28.51 ? 2   PRO A CB    1 
ATOM   6    C CG    . PRO A 1 2   ? 1.816   10.427  -29.338 1.00 28.17 ? 2   PRO A CG    1 
ATOM   7    C CD    . PRO A 1 2   ? 1.780   10.830  -30.772 1.00 28.71 ? 2   PRO A CD    1 
ATOM   8    N N     . PHE A 1 3   ? 2.265   15.172  -29.399 1.00 28.36 ? 3   PHE A N     1 
ATOM   9    C CA    . PHE A 1 3   ? 3.198   16.275  -29.588 1.00 27.95 ? 3   PHE A CA    1 
ATOM   10   C C     . PHE A 1 3   ? 4.299   16.265  -28.518 1.00 27.74 ? 3   PHE A C     1 
ATOM   11   O O     . PHE A 1 3   ? 4.014   16.345  -27.316 1.00 27.04 ? 3   PHE A O     1 
ATOM   12   C CB    . PHE A 1 3   ? 2.475   17.624  -29.640 1.00 27.35 ? 3   PHE A CB    1 
ATOM   13   C CG    . PHE A 1 3   ? 3.356   18.769  -30.078 1.00 29.16 ? 3   PHE A CG    1 
ATOM   14   C CD1   . PHE A 1 3   ? 4.066   19.518  -29.146 1.00 28.23 ? 3   PHE A CD1   1 
ATOM   15   C CD2   . PHE A 1 3   ? 3.480   19.093  -31.424 1.00 28.39 ? 3   PHE A CD2   1 
ATOM   16   C CE1   . PHE A 1 3   ? 4.867   20.580  -29.543 1.00 26.84 ? 3   PHE A CE1   1 
ATOM   17   C CE2   . PHE A 1 3   ? 4.281   20.142  -31.829 1.00 26.19 ? 3   PHE A CE2   1 
ATOM   18   C CZ    . PHE A 1 3   ? 4.980   20.887  -30.888 1.00 27.01 ? 3   PHE A CZ    1 
ATOM   19   N N     . PRO A 1 4   ? 5.562   16.183  -28.969 1.00 27.68 ? 4   PRO A N     1 
ATOM   20   C CA    . PRO A 1 4   ? 6.722   15.908  -28.131 1.00 28.69 ? 4   PRO A CA    1 
ATOM   21   C C     . PRO A 1 4   ? 7.297   17.137  -27.422 1.00 29.29 ? 4   PRO A C     1 
ATOM   22   O O     . PRO A 1 4   ? 8.336   17.669  -27.845 1.00 31.25 ? 4   PRO A O     1 
ATOM   23   C CB    . PRO A 1 4   ? 7.728   15.364  -29.143 1.00 28.10 ? 4   PRO A CB    1 
ATOM   24   C CG    . PRO A 1 4   ? 7.426   16.163  -30.372 1.00 26.57 ? 4   PRO A CG    1 
ATOM   25   C CD    . PRO A 1 4   ? 5.948   16.359  -30.383 1.00 26.32 ? 4   PRO A CD    1 
ATOM   26   N N     . PHE A 1 5   ? 6.640   17.567  -26.347 1.00 28.36 ? 5   PHE A N     1 
ATOM   27   C CA    . PHE A 1 5   ? 7.154   18.651  -25.505 1.00 27.97 ? 5   PHE A CA    1 
ATOM   28   C C     . PHE A 1 5   ? 8.444   18.283  -24.751 1.00 29.05 ? 5   PHE A C     1 
ATOM   29   O O     . PHE A 1 5   ? 8.764   17.101  -24.602 1.00 28.91 ? 5   PHE A O     1 
ATOM   30   C CB    . PHE A 1 5   ? 6.090   19.091  -24.515 1.00 25.38 ? 5   PHE A CB    1 
ATOM   31   C CG    . PHE A 1 5   ? 4.884   19.700  -25.162 1.00 26.32 ? 5   PHE A CG    1 
ATOM   32   C CD1   . PHE A 1 5   ? 4.885   21.038  -25.545 1.00 25.62 ? 5   PHE A CD1   1 
ATOM   33   C CD2   . PHE A 1 5   ? 3.744   18.940  -25.396 1.00 22.38 ? 5   PHE A CD2   1 
ATOM   34   C CE1   . PHE A 1 5   ? 3.756   21.611  -26.147 1.00 26.22 ? 5   PHE A CE1   1 
ATOM   35   C CE2   . PHE A 1 5   ? 2.614   19.506  -25.998 1.00 24.98 ? 5   PHE A CE2   1 
ATOM   36   C CZ    . PHE A 1 5   ? 2.619   20.841  -26.365 1.00 23.53 ? 5   PHE A CZ    1 
ATOM   37   N N     . GLY A 1 6   ? 9.182   19.302  -24.297 1.00 29.90 ? 6   GLY A N     1 
ATOM   38   C CA    . GLY A 1 6   ? 10.365  19.107  -23.461 1.00 30.16 ? 6   GLY A CA    1 
ATOM   39   C C     . GLY A 1 6   ? 10.019  18.807  -22.010 1.00 31.43 ? 6   GLY A C     1 
ATOM   40   O O     . GLY A 1 6   ? 8.921   19.124  -21.537 1.00 29.90 ? 6   GLY A O     1 
ATOM   41   N N     . LYS A 1 7   ? 10.956  18.181  -21.301 1.00 33.01 ? 7   LYS A N     1 
ATOM   42   C CA    . LYS A 1 7   ? 10.772  17.891  -19.879 1.00 34.35 ? 7   LYS A CA    1 
ATOM   43   C C     . LYS A 1 7   ? 11.532  18.884  -19.023 1.00 34.80 ? 7   LYS A C     1 
ATOM   44   O O     . LYS A 1 7   ? 12.745  19.030  -19.166 1.00 34.98 ? 7   LYS A O     1 
ATOM   45   C CB    . LYS A 1 7   ? 11.218  16.469  -19.539 1.00 34.67 ? 7   LYS A CB    1 
ATOM   46   C CG    . LYS A 1 7   ? 10.098  15.435  -19.525 1.00 35.57 ? 7   LYS A CG    1 
ATOM   47   C CD    . LYS A 1 7   ? 10.516  14.192  -18.727 1.00 35.73 ? 7   LYS A CD    1 
ATOM   48   C CE    . LYS A 1 7   ? 11.296  13.198  -19.572 1.00 34.36 ? 7   LYS A CE    1 
ATOM   49   N NZ    . LYS A 1 7   ? 10.403  12.445  -20.497 1.00 34.03 ? 7   LYS A NZ    1 
ATOM   50   N N     . SER A 1 8   ? 10.810  19.573  -18.143 1.00 36.20 ? 8   SER A N     1 
ATOM   51   C CA    . SER A 1 8   ? 11.438  20.485  -17.189 1.00 37.88 ? 8   SER A CA    1 
ATOM   52   C C     . SER A 1 8   ? 11.858  19.741  -15.922 1.00 37.38 ? 8   SER A C     1 
ATOM   53   O O     . SER A 1 8   ? 11.076  18.975  -15.352 1.00 37.88 ? 8   SER A O     1 
ATOM   54   C CB    . SER A 1 8   ? 10.519  21.669  -16.856 1.00 38.67 ? 8   SER A CB    1 
ATOM   55   O OG    . SER A 1 8   ? 10.711  22.742  -17.769 1.00 39.64 ? 8   SER A OG    1 
ATOM   56   N N     . HIS A 1 9   ? 13.104  19.969  -15.515 1.00 36.09 ? 9   HIS A N     1 
ATOM   57   C CA    . HIS A 1 9   ? 13.712  19.344  -14.335 1.00 35.08 ? 9   HIS A CA    1 
ATOM   58   C C     . HIS A 1 9   ? 13.016  19.757  -13.029 1.00 33.52 ? 9   HIS A C     1 
ATOM   59   O O     . HIS A 1 9   ? 12.654  20.923  -12.843 1.00 32.79 ? 9   HIS A O     1 
ATOM   60   C CB    . HIS A 1 9   ? 15.223  19.663  -14.314 1.00 35.19 ? 9   HIS A CB    1 
ATOM   61   C CG    . HIS A 1 9   ? 15.857  19.598  -12.956 1.00 36.82 ? 9   HIS A CG    1 
ATOM   62   N ND1   . HIS A 1 9   ? 15.946  18.430  -12.226 1.00 37.26 ? 9   HIS A ND1   1 
ATOM   63   C CD2   . HIS A 1 9   ? 16.458  20.558  -12.209 1.00 38.44 ? 9   HIS A CD2   1 
ATOM   64   C CE1   . HIS A 1 9   ? 16.558  18.676  -11.080 1.00 37.41 ? 9   HIS A CE1   1 
ATOM   65   N NE2   . HIS A 1 9   ? 16.880  19.960  -11.045 1.00 38.16 ? 9   HIS A NE2   1 
ATOM   66   N N     . LYS A 1 10  ? 12.812  18.787  -12.142 1.00 32.39 ? 10  LYS A N     1 
ATOM   67   C CA    . LYS A 1 10  ? 12.174  19.033  -10.848 1.00 32.12 ? 10  LYS A CA    1 
ATOM   68   C C     . LYS A 1 10  ? 12.909  18.355  -9.685  1.00 30.98 ? 10  LYS A C     1 
ATOM   69   O O     . LYS A 1 10  ? 13.369  17.212  -9.800  1.00 30.39 ? 10  LYS A O     1 
ATOM   70   C CB    . LYS A 1 10  ? 10.716  18.582  -10.877 1.00 33.02 ? 10  LYS A CB    1 
ATOM   71   C CG    . LYS A 1 10  ? 9.781   19.524  -11.606 1.00 37.30 ? 10  LYS A CG    1 
ATOM   72   C CD    . LYS A 1 10  ? 8.517   18.799  -12.048 1.00 46.73 ? 10  LYS A CD    1 
ATOM   73   C CE    . LYS A 1 10  ? 7.613   19.739  -12.832 1.00 52.74 ? 10  LYS A CE    1 
ATOM   74   N NZ    . LYS A 1 10  ? 6.607   19.002  -13.652 1.00 57.51 ? 10  LYS A NZ    1 
ATOM   75   N N     . SER A 1 11  ? 13.013  19.076  -8.570  1.00 29.59 ? 11  SER A N     1 
ATOM   76   C CA    . SER A 1 11  ? 13.616  18.560  -7.345  1.00 28.81 ? 11  SER A CA    1 
ATOM   77   C C     . SER A 1 11  ? 12.799  17.392  -6.774  1.00 28.02 ? 11  SER A C     1 
ATOM   78   O O     . SER A 1 11  ? 11.589  17.315  -7.005  1.00 29.55 ? 11  SER A O     1 
ATOM   79   C CB    . SER A 1 11  ? 13.685  19.673  -6.305  1.00 28.83 ? 11  SER A CB    1 
ATOM   80   O OG    . SER A 1 11  ? 12.377  20.051  -5.909  1.00 28.70 ? 11  SER A OG    1 
ATOM   81   N N     . PRO A 1 12  ? 13.452  16.482  -6.023  1.00 26.87 ? 12  PRO A N     1 
ATOM   82   C CA    . PRO A 1 12  ? 12.712  15.439  -5.300  1.00 26.13 ? 12  PRO A CA    1 
ATOM   83   C C     . PRO A 1 12  ? 11.577  15.991  -4.424  1.00 25.57 ? 12  PRO A C     1 
ATOM   84   O O     . PRO A 1 12  ? 10.510  15.403  -4.370  1.00 27.11 ? 12  PRO A O     1 
ATOM   85   C CB    . PRO A 1 12  ? 13.791  14.804  -4.426  1.00 25.01 ? 12  PRO A CB    1 
ATOM   86   C CG    . PRO A 1 12  ? 15.040  15.009  -5.198  1.00 24.68 ? 12  PRO A CG    1 
ATOM   87   C CD    . PRO A 1 12  ? 14.908  16.354  -5.817  1.00 25.71 ? 12  PRO A CD    1 
ATOM   88   N N     . ALA A 1 13  ? 11.821  17.121  -3.763  1.00 26.28 ? 13  ALA A N     1 
ATOM   89   C CA    . ALA A 1 13  ? 10.863  17.759  -2.861  1.00 25.10 ? 13  ALA A CA    1 
ATOM   90   C C     . ALA A 1 13  ? 9.584   18.179  -3.576  1.00 23.83 ? 13  ALA A C     1 
ATOM   91   O O     . ALA A 1 13  ? 8.487   17.946  -3.073  1.00 23.07 ? 13  ALA A O     1 
ATOM   92   C CB    . ALA A 1 13  ? 11.517  18.981  -2.168  1.00 24.01 ? 13  ALA A CB    1 
ATOM   93   N N     . ASP A 1 14  ? 9.744   18.805  -4.741  1.00 24.03 ? 14  ASP A N     1 
ATOM   94   C CA    . ASP A 1 14  ? 8.630   19.249  -5.570  1.00 24.75 ? 14  ASP A CA    1 
ATOM   95   C C     . ASP A 1 14  ? 7.888   18.089  -6.224  1.00 25.01 ? 14  ASP A C     1 
ATOM   96   O O     . ASP A 1 14  ? 6.685   18.173  -6.450  1.00 24.48 ? 14  ASP A O     1 
ATOM   97   C CB    . ASP A 1 14  ? 9.122   20.221  -6.644  1.00 25.32 ? 14  ASP A CB    1 
ATOM   98   C CG    . ASP A 1 14  ? 9.400   21.618  -6.094  1.00 28.69 ? 14  ASP A CG    1 
ATOM   99   O OD1   . ASP A 1 14  ? 9.320   21.826  -4.858  1.00 28.68 ? 14  ASP A OD1   1 
ATOM   100  O OD2   . ASP A 1 14  ? 9.691   22.519  -6.913  1.00 31.81 ? 14  ASP A OD2   1 
ATOM   101  N N     . ILE A 1 15  ? 8.618   17.024  -6.546  1.00 25.78 ? 15  ILE A N     1 
ATOM   102  C CA    . ILE A 1 15  ? 8.029   15.791  -7.061  1.00 26.24 ? 15  ILE A CA    1 
ATOM   103  C C     . ILE A 1 15  ? 7.160   15.121  -5.988  1.00 25.86 ? 15  ILE A C     1 
ATOM   104  O O     . ILE A 1 15  ? 6.029   14.689  -6.274  1.00 23.02 ? 15  ILE A O     1 
ATOM   105  C CB    . ILE A 1 15  ? 9.117   14.810  -7.600  1.00 26.27 ? 15  ILE A CB    1 
ATOM   106  C CG1   . ILE A 1 15  ? 9.821   15.424  -8.813  1.00 29.67 ? 15  ILE A CG1   1 
ATOM   107  C CG2   . ILE A 1 15  ? 8.505   13.486  -8.012  1.00 27.40 ? 15  ILE A CG2   1 
ATOM   108  C CD1   . ILE A 1 15  ? 11.129  14.755  -9.189  1.00 29.05 ? 15  ILE A CD1   1 
ATOM   109  N N     . VAL A 1 16  ? 7.679   15.045  -4.760  1.00 24.91 ? 16  VAL A N     1 
ATOM   110  C CA    . VAL A 1 16  ? 6.909   14.458  -3.656  1.00 26.04 ? 16  VAL A CA    1 
ATOM   111  C C     . VAL A 1 16  ? 5.623   15.268  -3.412  1.00 26.11 ? 16  VAL A C     1 
ATOM   112  O O     . VAL A 1 16  ? 4.535   14.700  -3.303  1.00 26.44 ? 16  VAL A O     1 
ATOM   113  C CB    . VAL A 1 16  ? 7.776   14.281  -2.353  1.00 25.98 ? 16  VAL A CB    1 
ATOM   114  C CG1   . VAL A 1 16  ? 6.902   14.183  -1.110  1.00 25.53 ? 16  VAL A CG1   1 
ATOM   115  C CG2   . VAL A 1 16  ? 8.651   13.036  -2.459  1.00 21.42 ? 16  VAL A CG2   1 
ATOM   116  N N     . LYS A 1 17  ? 5.779   16.590  -3.362  1.00 26.29 ? 17  LYS A N     1 
ATOM   117  C CA    . LYS A 1 17  ? 4.699   17.562  -3.224  1.00 26.91 ? 17  LYS A CA    1 
ATOM   118  C C     . LYS A 1 17  ? 3.633   17.427  -4.317  1.00 28.02 ? 17  LYS A C     1 
ATOM   119  O O     . LYS A 1 17  ? 2.442   17.342  -4.010  1.00 28.52 ? 17  LYS A O     1 
ATOM   120  C CB    . LYS A 1 17  ? 5.306   18.962  -3.268  1.00 27.58 ? 17  LYS A CB    1 
ATOM   121  C CG    . LYS A 1 17  ? 4.527   20.037  -2.549  1.00 28.52 ? 17  LYS A CG    1 
ATOM   122  C CD    . LYS A 1 17  ? 5.457   21.183  -2.153  1.00 31.60 ? 17  LYS A CD    1 
ATOM   123  C CE    . LYS A 1 17  ? 6.396   20.793  -0.998  1.00 32.26 ? 17  LYS A CE    1 
ATOM   124  N NZ    . LYS A 1 17  ? 7.392   21.881  -0.675  1.00 31.68 ? 17  LYS A NZ    1 
ATOM   125  N N     . ASN A 1 18  ? 4.069   17.417  -5.581  1.00 28.26 ? 18  ASN A N     1 
ATOM   126  C CA    . ASN A 1 18  ? 3.188   17.218  -6.739  1.00 30.14 ? 18  ASN A CA    1 
ATOM   127  C C     . ASN A 1 18  ? 2.329   15.952  -6.605  1.00 29.40 ? 18  ASN A C     1 
ATOM   128  O O     . ASN A 1 18  ? 1.117   15.979  -6.846  1.00 29.08 ? 18  ASN A O     1 
ATOM   129  C CB    . ASN A 1 18  ? 4.016   17.061  -8.022  1.00 31.65 ? 18  ASN A CB    1 
ATOM   130  C CG    . ASN A 1 18  ? 4.467   18.379  -8.629  1.00 39.67 ? 18  ASN A CG    1 
ATOM   131  O OD1   . ASN A 1 18  ? 5.045   18.378  -9.725  1.00 48.14 ? 18  ASN A OD1   1 
ATOM   132  N ND2   . ASN A 1 18  ? 4.229   19.501  -7.937  1.00 43.67 ? 18  ASN A ND2   1 
ATOM   133  N N     . LEU A 1 19  ? 2.985   14.850  -6.247  1.00 27.62 ? 19  LEU A N     1 
ATOM   134  C CA    . LEU A 1 19  ? 2.342   13.547  -6.126  1.00 28.81 ? 19  LEU A CA    1 
ATOM   135  C C     . LEU A 1 19  ? 1.340   13.523  -4.969  1.00 28.97 ? 19  LEU A C     1 
ATOM   136  O O     . LEU A 1 19  ? 0.236   13.023  -5.117  1.00 30.49 ? 19  LEU A O     1 
ATOM   137  C CB    . LEU A 1 19  ? 3.401   12.453  -5.985  1.00 27.84 ? 19  LEU A CB    1 
ATOM   138  C CG    . LEU A 1 19  ? 3.023   10.974  -6.142  1.00 30.99 ? 19  LEU A CG    1 
ATOM   139  C CD1   . LEU A 1 19  ? 2.124   10.699  -7.344  1.00 28.17 ? 19  LEU A CD1   1 
ATOM   140  C CD2   . LEU A 1 19  ? 4.283   10.152  -6.240  1.00 30.68 ? 19  LEU A CD2   1 
ATOM   141  N N     . LYS A 1 20  ? 1.727   14.103  -3.837  1.00 29.12 ? 20  LYS A N     1 
ATOM   142  C CA    . LYS A 1 20  ? 0.859   14.260  -2.675  1.00 29.26 ? 20  LYS A CA    1 
ATOM   143  C C     . LYS A 1 20  ? -0.451  14.960  -3.044  1.00 29.06 ? 20  LYS A C     1 
ATOM   144  O O     . LYS A 1 20  ? -1.529  14.484  -2.698  1.00 28.94 ? 20  LYS A O     1 
ATOM   145  C CB    . LYS A 1 20  ? 1.594   15.056  -1.593  1.00 29.06 ? 20  LYS A CB    1 
ATOM   146  C CG    . LYS A 1 20  ? 1.358   14.586  -0.176  1.00 30.26 ? 20  LYS A CG    1 
ATOM   147  C CD    . LYS A 1 20  ? 1.953   15.576  0.830   1.00 30.29 ? 20  LYS A CD    1 
ATOM   148  C CE    . LYS A 1 20  ? 1.512   15.252  2.244   1.00 32.92 ? 20  LYS A CE    1 
ATOM   149  N NZ    . LYS A 1 20  ? 1.749   16.386  3.183   1.00 32.60 ? 20  LYS A NZ    1 
ATOM   150  N N     . GLU A 1 21  ? -0.340  16.077  -3.759  1.00 28.43 ? 21  GLU A N     1 
ATOM   151  C CA    . GLU A 1 21  ? -1.496  16.839  -4.242  1.00 29.19 ? 21  GLU A CA    1 
ATOM   152  C C     . GLU A 1 21  ? -2.310  16.114  -5.303  1.00 28.27 ? 21  GLU A C     1 
ATOM   153  O O     . GLU A 1 21  ? -3.533  16.210  -5.317  1.00 29.10 ? 21  GLU A O     1 
ATOM   154  C CB    . GLU A 1 21  ? -1.065  18.204  -4.786  1.00 29.25 ? 21  GLU A CB    1 
ATOM   155  C CG    . GLU A 1 21  ? -0.650  19.186  -3.707  1.00 33.65 ? 21  GLU A CG    1 
ATOM   156  C CD    . GLU A 1 21  ? -0.353  20.564  -4.259  1.00 41.78 ? 21  GLU A CD    1 
ATOM   157  O OE1   . GLU A 1 21  ? -0.877  21.549  -3.694  1.00 41.60 ? 21  GLU A OE1   1 
ATOM   158  O OE2   . GLU A 1 21  ? 0.395   20.660  -5.262  1.00 45.12 ? 21  GLU A OE2   1 
ATOM   159  N N     . SER A 1 22  ? -1.644  15.397  -6.197  1.00 27.53 ? 22  SER A N     1 
ATOM   160  C CA    . SER A 1 22  ? -2.376  14.621  -7.197  1.00 27.90 ? 22  SER A CA    1 
ATOM   161  C C     . SER A 1 22  ? -3.076  13.385  -6.624  1.00 28.14 ? 22  SER A C     1 
ATOM   162  O O     . SER A 1 22  ? -4.193  13.054  -7.041  1.00 29.48 ? 22  SER A O     1 
ATOM   163  C CB    . SER A 1 22  ? -1.482  14.273  -8.378  1.00 26.77 ? 22  SER A CB    1 
ATOM   164  O OG    . SER A 1 22  ? -1.423  15.396  -9.250  1.00 31.38 ? 22  SER A OG    1 
ATOM   165  N N     . MET A 1 23  ? -2.439  12.703  -5.672  1.00 27.07 ? 23  MET A N     1 
ATOM   166  C CA    . MET A 1 23  ? -3.098  11.584  -4.991  1.00 25.64 ? 23  MET A CA    1 
ATOM   167  C C     . MET A 1 23  ? -4.380  12.038  -4.286  1.00 24.89 ? 23  MET A C     1 
ATOM   168  O O     . MET A 1 23  ? -5.402  11.379  -4.403  1.00 24.59 ? 23  MET A O     1 
ATOM   169  C CB    . MET A 1 23  ? -2.151  10.890  -4.014  1.00 26.47 ? 23  MET A CB    1 
ATOM   170  C CG    . MET A 1 23  ? -1.064  10.055  -4.676  1.00 25.57 ? 23  MET A CG    1 
ATOM   171  S SD    . MET A 1 23  ? -1.699  8.744   -5.770  1.00 34.41 ? 23  MET A SD    1 
ATOM   172  C CE    . MET A 1 23  ? -2.913  7.932   -4.755  1.00 30.95 ? 23  MET A CE    1 
ATOM   173  N N     . ALA A 1 24  ? -4.321  13.181  -3.594  1.00 23.64 ? 24  ALA A N     1 
ATOM   174  C CA    . ALA A 1 24  ? -5.492  13.773  -2.925  1.00 24.10 ? 24  ALA A CA    1 
ATOM   175  C C     . ALA A 1 24  ? -6.702  14.001  -3.846  1.00 24.42 ? 24  ALA A C     1 
ATOM   176  O O     . ALA A 1 24  ? -7.839  13.821  -3.419  1.00 24.57 ? 24  ALA A O     1 
ATOM   177  C CB    . ALA A 1 24  ? -5.117  15.075  -2.193  1.00 22.23 ? 24  ALA A CB    1 
ATOM   178  N N     . VAL A 1 25  ? -6.444  14.397  -5.094  1.00 25.15 ? 25  VAL A N     1 
ATOM   179  C CA    . VAL A 1 25  ? -7.486  14.583  -6.112  1.00 25.98 ? 25  VAL A CA    1 
ATOM   180  C C     . VAL A 1 25  ? -8.150  13.248  -6.507  1.00 26.30 ? 25  VAL A C     1 
ATOM   181  O O     . VAL A 1 25  ? -9.384  13.135  -6.521  1.00 26.43 ? 25  VAL A O     1 
ATOM   182  C CB    . VAL A 1 25  ? -6.934  15.349  -7.363  1.00 26.74 ? 25  VAL A CB    1 
ATOM   183  C CG1   . VAL A 1 25  ? -7.970  15.392  -8.498  1.00 23.68 ? 25  VAL A CG1   1 
ATOM   184  C CG2   . VAL A 1 25  ? -6.497  16.769  -6.976  1.00 23.06 ? 25  VAL A CG2   1 
ATOM   185  N N     . LEU A 1 26  ? -7.320  12.245  -6.791  1.00 26.36 ? 26  LEU A N     1 
ATOM   186  C CA    . LEU A 1 26  ? -7.767  10.880  -7.109  1.00 26.08 ? 26  LEU A CA    1 
ATOM   187  C C     . LEU A 1 26  ? -8.606  10.201  -6.024  1.00 25.45 ? 26  LEU A C     1 
ATOM   188  O O     . LEU A 1 26  ? -9.444  9.350   -6.336  1.00 25.86 ? 26  LEU A O     1 
ATOM   189  C CB    . LEU A 1 26  ? -6.573  9.978   -7.441  1.00 25.31 ? 26  LEU A CB    1 
ATOM   190  C CG    . LEU A 1 26  ? -5.890  10.194  -8.792  1.00 30.22 ? 26  LEU A CG    1 
ATOM   191  C CD1   . LEU A 1 26  ? -5.012  8.990   -9.089  1.00 32.43 ? 26  LEU A CD1   1 
ATOM   192  C CD2   . LEU A 1 26  ? -6.899  10.419  -9.915  1.00 28.53 ? 26  LEU A CD2   1 
ATOM   193  N N     . GLU A 1 27  ? -8.370  10.548  -4.762  1.00 23.93 ? 27  GLU A N     1 
ATOM   194  C CA    . GLU A 1 27  ? -9.119  9.934   -3.666  1.00 24.33 ? 27  GLU A CA    1 
ATOM   195  C C     . GLU A 1 27  ? -10.560 10.432  -3.655  1.00 23.26 ? 27  GLU A C     1 
ATOM   196  O O     . GLU A 1 27  ? -11.442 9.732   -3.191  1.00 21.79 ? 27  GLU A O     1 
ATOM   197  C CB    . GLU A 1 27  ? -8.448  10.197  -2.318  1.00 22.73 ? 27  GLU A CB    1 
ATOM   198  C CG    . GLU A 1 27  ? -6.993  9.737   -2.254  1.00 24.80 ? 27  GLU A CG    1 
ATOM   199  C CD    . GLU A 1 27  ? -6.306  10.084  -0.927  1.00 26.97 ? 27  GLU A CD    1 
ATOM   200  O OE1   . GLU A 1 27  ? -5.266  9.462   -0.608  1.00 28.33 ? 27  GLU A OE1   1 
ATOM   201  O OE2   . GLU A 1 27  ? -6.805  10.973  -0.202  1.00 23.99 ? 27  GLU A OE2   1 
ATOM   202  N N     . LYS A 1 28  ? -10.778 11.635  -4.187  1.00 25.64 ? 28  LYS A N     1 
ATOM   203  C CA    . LYS A 1 28  ? -12.108 12.262  -4.263  1.00 27.68 ? 28  LYS A CA    1 
ATOM   204  C C     . LYS A 1 28  ? -12.998 11.640  -5.347  1.00 27.14 ? 28  LYS A C     1 
ATOM   205  O O     . LYS A 1 28  ? -12.557 11.400  -6.471  1.00 26.52 ? 28  LYS A O     1 
ATOM   206  C CB    . LYS A 1 28  ? -11.984 13.769  -4.529  1.00 26.52 ? 28  LYS A CB    1 
ATOM   207  C CG    . LYS A 1 28  ? -11.433 14.608  -3.373  1.00 30.14 ? 28  LYS A CG    1 
ATOM   208  C CD    . LYS A 1 28  ? -11.454 16.129  -3.695  1.00 30.52 ? 28  LYS A CD    1 
ATOM   209  C CE    . LYS A 1 28  ? -10.453 16.531  -4.814  1.00 38.27 ? 28  LYS A CE    1 
ATOM   210  N NZ    . LYS A 1 28  ? -10.436 18.001  -5.199  1.00 33.74 ? 28  LYS A NZ    1 
ATOM   211  N N     . GLN A 1 29  ? -14.257 11.390  -5.001  1.00 28.24 ? 29  GLN A N     1 
ATOM   212  C CA    . GLN A 1 29  ? -15.255 10.950  -5.979  1.00 29.13 ? 29  GLN A CA    1 
ATOM   213  C C     . GLN A 1 29  ? -15.809 12.076  -6.838  1.00 30.21 ? 29  GLN A C     1 
ATOM   214  O O     . GLN A 1 29  ? -16.015 11.910  -8.047  1.00 30.64 ? 29  GLN A O     1 
ATOM   215  C CB    . GLN A 1 29  ? -16.432 10.299  -5.275  1.00 27.98 ? 29  GLN A CB    1 
ATOM   216  C CG    . GLN A 1 29  ? -16.388 8.813   -5.259  1.00 29.67 ? 29  GLN A CG    1 
ATOM   217  C CD    . GLN A 1 29  ? -17.704 8.219   -4.837  1.00 29.23 ? 29  GLN A CD    1 
ATOM   218  O OE1   . GLN A 1 29  ? -17.782 7.488   -3.848  1.00 29.20 ? 29  GLN A OE1   1 
ATOM   219  N NE2   . GLN A 1 29  ? -18.755 8.535   -5.584  1.00 26.48 ? 29  GLN A NE2   1 
ATOM   220  N N     . ASP A 1 30  ? -16.076 13.214  -6.204  1.00 30.81 ? 30  ASP A N     1 
ATOM   221  C CA    . ASP A 1 30  ? -16.895 14.236  -6.816  1.00 31.63 ? 30  ASP A CA    1 
ATOM   222  C C     . ASP A 1 30  ? -16.053 15.249  -7.566  1.00 31.16 ? 30  ASP A C     1 
ATOM   223  O O     . ASP A 1 30  ? -15.966 16.413  -7.181  1.00 31.66 ? 30  ASP A O     1 
ATOM   224  C CB    . ASP A 1 30  ? -17.756 14.918  -5.757  1.00 32.85 ? 30  ASP A CB    1 
ATOM   225  C CG    . ASP A 1 30  ? -19.186 15.131  -6.218  1.00 36.30 ? 30  ASP A CG    1 
ATOM   226  O OD1   . ASP A 1 30  ? -20.088 14.478  -5.636  1.00 40.78 ? 30  ASP A OD1   1 
ATOM   227  O OD2   . ASP A 1 30  ? -19.405 15.935  -7.157  1.00 33.51 ? 30  ASP A OD2   1 
ATOM   228  N N     . ILE A 1 31  ? -15.427 14.785  -8.639  1.00 30.17 ? 31  ILE A N     1 
ATOM   229  C CA    . ILE A 1 31  ? -14.645 15.642  -9.512  1.00 29.99 ? 31  ILE A CA    1 
ATOM   230  C C     . ILE A 1 31  ? -14.960 15.281  -10.965 1.00 30.31 ? 31  ILE A C     1 
ATOM   231  O O     . ILE A 1 31  ? -15.325 14.131  -11.257 1.00 31.37 ? 31  ILE A O     1 
ATOM   232  C CB    . ILE A 1 31  ? -13.121 15.545  -9.227  1.00 29.81 ? 31  ILE A CB    1 
ATOM   233  C CG1   . ILE A 1 31  ? -12.638 14.104  -9.323  1.00 30.31 ? 31  ILE A CG1   1 
ATOM   234  C CG2   . ILE A 1 31  ? -12.772 16.134  -7.852  1.00 29.22 ? 31  ILE A CG2   1 
ATOM   235  C CD1   . ILE A 1 31  ? -11.144 13.983  -9.372  1.00 36.16 ? 31  ILE A CD1   1 
ATOM   236  N N     . SER A 1 32  ? -14.841 16.262  -11.861 1.00 29.30 ? 32  SER A N     1 
ATOM   237  C CA    . SER A 1 32  ? -15.097 16.050  -13.289 1.00 29.17 ? 32  SER A CA    1 
ATOM   238  C C     . SER A 1 32  ? -14.129 15.038  -13.875 1.00 28.27 ? 32  SER A C     1 
ATOM   239  O O     . SER A 1 32  ? -13.034 14.821  -13.334 1.00 28.49 ? 32  SER A O     1 
ATOM   240  C CB    . SER A 1 32  ? -15.003 17.364  -14.069 1.00 28.62 ? 32  SER A CB    1 
ATOM   241  O OG    . SER A 1 32  ? -13.674 17.857  -14.063 1.00 31.94 ? 32  SER A OG    1 
ATOM   242  N N     . ASP A 1 33  ? -14.540 14.422  -14.978 1.00 27.27 ? 33  ASP A N     1 
ATOM   243  C CA    . ASP A 1 33  ? -13.712 13.441  -15.670 1.00 28.18 ? 33  ASP A CA    1 
ATOM   244  C C     . ASP A 1 33  ? -12.346 14.009  -16.090 1.00 26.57 ? 33  ASP A C     1 
ATOM   245  O O     . ASP A 1 33  ? -11.340 13.315  -16.014 1.00 26.01 ? 33  ASP A O     1 
ATOM   246  C CB    . ASP A 1 33  ? -14.459 12.868  -16.880 1.00 28.66 ? 33  ASP A CB    1 
ATOM   247  C CG    . ASP A 1 33  ? -15.753 12.148  -16.491 1.00 33.66 ? 33  ASP A CG    1 
ATOM   248  O OD1   . ASP A 1 33  ? -15.772 11.413  -15.465 1.00 33.49 ? 33  ASP A OD1   1 
ATOM   249  O OD2   . ASP A 1 33  ? -16.755 12.315  -17.227 1.00 35.26 ? 33  ASP A OD2   1 
ATOM   250  N N     . LYS A 1 34  ? -12.323 15.270  -16.518 1.00 26.20 ? 34  LYS A N     1 
ATOM   251  C CA    . LYS A 1 34  ? -11.082 15.934  -16.921 1.00 26.09 ? 34  LYS A CA    1 
ATOM   252  C C     . LYS A 1 34  ? -10.141 16.195  -15.743 1.00 25.90 ? 34  LYS A C     1 
ATOM   253  O O     . LYS A 1 34  ? -8.940  15.965  -15.858 1.00 26.61 ? 34  LYS A O     1 
ATOM   254  C CB    . LYS A 1 34  ? -11.364 17.208  -17.734 1.00 25.41 ? 34  LYS A CB    1 
ATOM   255  C CG    . LYS A 1 34  ? -11.605 16.949  -19.233 1.00 24.99 ? 34  LYS A CG    1 
ATOM   256  C CD    . LYS A 1 34  ? -10.465 16.129  -19.862 1.00 27.22 ? 34  LYS A CD    1 
ATOM   257  C CE    . LYS A 1 34  ? -10.345 16.293  -21.372 1.00 28.30 ? 34  LYS A CE    1 
ATOM   258  N NZ    . LYS A 1 34  ? -8.902  16.250  -21.806 1.00 26.36 ? 34  LYS A NZ    1 
ATOM   259  N N     . LYS A 1 35  ? -10.689 16.632  -14.610 1.00 26.01 ? 35  LYS A N     1 
ATOM   260  C CA    . LYS A 1 35  ? -9.898  16.801  -13.389 1.00 27.75 ? 35  LYS A CA    1 
ATOM   261  C C     . LYS A 1 35  ? -9.294  15.472  -12.900 1.00 26.60 ? 35  LYS A C     1 
ATOM   262  O O     . LYS A 1 35  ? -8.143  15.438  -12.467 1.00 26.27 ? 35  LYS A O     1 
ATOM   263  C CB    . LYS A 1 35  ? -10.717 17.479  -12.276 1.00 28.33 ? 35  LYS A CB    1 
ATOM   264  C CG    . LYS A 1 35  ? -9.858  18.280  -11.274 1.00 32.72 ? 35  LYS A CG    1 
ATOM   265  C CD    . LYS A 1 35  ? -10.681 19.067  -10.228 1.00 30.49 ? 35  LYS A CD    1 
ATOM   266  C CE    . LYS A 1 35  ? -11.281 20.360  -10.791 1.00 33.86 ? 35  LYS A CE    1 
ATOM   267  N NZ    . LYS A 1 35  ? -10.314 21.507  -10.876 1.00 30.72 ? 35  LYS A NZ    1 
ATOM   268  N N     . ALA A 1 36  ? -10.064 14.386  -12.987 1.00 25.97 ? 36  ALA A N     1 
ATOM   269  C CA    . ALA A 1 36  ? -9.588  13.041  -12.611 1.00 25.72 ? 36  ALA A CA    1 
ATOM   270  C C     . ALA A 1 36  ? -8.507  12.535  -13.572 1.00 25.83 ? 36  ALA A C     1 
ATOM   271  O O     . ALA A 1 36  ? -7.514  11.911  -13.157 1.00 24.63 ? 36  ALA A O     1 
ATOM   272  C CB    . ALA A 1 36  ? -10.749 12.062  -12.576 1.00 23.46 ? 36  ALA A CB    1 
ATOM   273  N N     . GLU A 1 37  ? -8.743  12.808  -14.855 1.00 24.86 ? 37  GLU A N     1 
ATOM   274  C CA    . GLU A 1 37  ? -7.850  12.464  -15.943 1.00 26.60 ? 37  GLU A CA    1 
ATOM   275  C C     . GLU A 1 37  ? -6.523  13.186  -15.766 1.00 24.29 ? 37  GLU A C     1 
ATOM   276  O O     . GLU A 1 37  ? -5.470  12.570  -15.883 1.00 24.79 ? 37  GLU A O     1 
ATOM   277  C CB    . GLU A 1 37  ? -8.506  12.842  -17.279 1.00 25.26 ? 37  GLU A CB    1 
ATOM   278  C CG    . GLU A 1 37  ? -7.849  12.296  -18.530 1.00 27.93 ? 37  GLU A CG    1 
ATOM   279  C CD    . GLU A 1 37  ? -8.488  12.861  -19.812 1.00 31.63 ? 37  GLU A CD    1 
ATOM   280  O OE1   . GLU A 1 37  ? -9.712  12.659  -20.031 1.00 39.44 ? 37  GLU A OE1   1 
ATOM   281  O OE2   . GLU A 1 37  ? -7.769  13.510  -20.602 1.00 34.10 ? 37  GLU A OE2   1 
ATOM   282  N N     . LYS A 1 38  ? -6.593  14.487  -15.476 1.00 24.15 ? 38  LYS A N     1 
ATOM   283  C CA    . LYS A 1 38  ? -5.420  15.327  -15.202 1.00 23.02 ? 38  LYS A CA    1 
ATOM   284  C C     . LYS A 1 38  ? -4.588  14.779  -14.039 1.00 23.46 ? 38  LYS A C     1 
ATOM   285  O O     . LYS A 1 38  ? -3.359  14.656  -14.137 1.00 23.70 ? 38  LYS A O     1 
ATOM   286  C CB    . LYS A 1 38  ? -5.872  16.769  -14.919 1.00 23.97 ? 38  LYS A CB    1 
ATOM   287  C CG    . LYS A 1 38  ? -4.760  17.796  -14.782 1.00 22.47 ? 38  LYS A CG    1 
ATOM   288  C CD    . LYS A 1 38  ? -5.332  19.171  -14.503 1.00 23.50 ? 38  LYS A CD    1 
ATOM   289  C CE    . LYS A 1 38  ? -4.502  19.931  -13.462 1.00 31.34 ? 38  LYS A CE    1 
ATOM   290  N NZ    . LYS A 1 38  ? -3.241  20.516  -14.019 1.00 33.11 ? 38  LYS A NZ    1 
ATOM   291  N N     . ALA A 1 39  ? -5.258  14.444  -12.942 1.00 21.88 ? 39  ALA A N     1 
ATOM   292  C CA    . ALA A 1 39  ? -4.573  13.896  -11.781 1.00 23.41 ? 39  ALA A CA    1 
ATOM   293  C C     . ALA A 1 39  ? -3.982  12.509  -12.081 1.00 23.98 ? 39  ALA A C     1 
ATOM   294  O O     . ALA A 1 39  ? -2.900  12.174  -11.598 1.00 24.12 ? 39  ALA A O     1 
ATOM   295  C CB    . ALA A 1 39  ? -5.510  13.841  -10.588 1.00 21.43 ? 39  ALA A CB    1 
ATOM   296  N N     . THR A 1 40  ? -4.700  11.712  -12.871 1.00 24.70 ? 40  THR A N     1 
ATOM   297  C CA    . THR A 1 40  ? -4.198  10.417  -13.331 1.00 26.32 ? 40  THR A CA    1 
ATOM   298  C C     . THR A 1 40  ? -2.875  10.583  -14.094 1.00 27.06 ? 40  THR A C     1 
ATOM   299  O O     . THR A 1 40  ? -1.909  9.898   -13.784 1.00 24.89 ? 40  THR A O     1 
ATOM   300  C CB    . THR A 1 40  ? -5.250  9.675   -14.174 1.00 27.14 ? 40  THR A CB    1 
ATOM   301  O OG1   . THR A 1 40  ? -6.197  9.052   -13.292 1.00 29.43 ? 40  THR A OG1   1 
ATOM   302  C CG2   . THR A 1 40  ? -4.614  8.605   -15.098 1.00 26.68 ? 40  THR A CG2   1 
ATOM   303  N N     . GLU A 1 41  ? -2.845  11.506  -15.065 1.00 26.94 ? 41  GLU A N     1 
ATOM   304  C CA    . GLU A 1 41  ? -1.641  11.777  -15.833 1.00 28.41 ? 41  GLU A CA    1 
ATOM   305  C C     . GLU A 1 41  ? -0.488  12.270  -14.979 1.00 27.62 ? 41  GLU A C     1 
ATOM   306  O O     . GLU A 1 41  ? 0.643   11.861  -15.204 1.00 28.71 ? 41  GLU A O     1 
ATOM   307  C CB    . GLU A 1 41  ? -1.914  12.742  -16.989 1.00 29.04 ? 41  GLU A CB    1 
ATOM   308  C CG    . GLU A 1 41  ? -2.504  12.054  -18.224 1.00 35.53 ? 41  GLU A CG    1 
ATOM   309  C CD    . GLU A 1 41  ? -1.716  10.819  -18.661 1.00 44.24 ? 41  GLU A CD    1 
ATOM   310  O OE1   . GLU A 1 41  ? -2.334  9.735   -18.731 1.00 45.37 ? 41  GLU A OE1   1 
ATOM   311  O OE2   . GLU A 1 41  ? -0.487  10.928  -18.915 1.00 46.23 ? 41  GLU A OE2   1 
ATOM   312  N N     . GLU A 1 42  ? -0.778  13.133  -14.002 1.00 27.62 ? 42  GLU A N     1 
ATOM   313  C CA    . GLU A 1 42  ? 0.251   13.688  -13.108 1.00 27.58 ? 42  GLU A CA    1 
ATOM   314  C C     . GLU A 1 42  ? 0.857   12.663  -12.148 1.00 26.99 ? 42  GLU A C     1 
ATOM   315  O O     . GLU A 1 42  ? 2.072   12.615  -11.988 1.00 27.86 ? 42  GLU A O     1 
ATOM   316  C CB    . GLU A 1 42  ? -0.277  14.909  -12.352 1.00 26.30 ? 42  GLU A CB    1 
ATOM   317  C CG    . GLU A 1 42  ? -0.257  16.183  -13.202 1.00 31.00 ? 42  GLU A CG    1 
ATOM   318  C CD    . GLU A 1 42  ? -1.254  17.245  -12.743 1.00 33.67 ? 42  GLU A CD    1 
ATOM   319  O OE1   . GLU A 1 42  ? -1.439  18.233  -13.487 1.00 28.67 ? 42  GLU A OE1   1 
ATOM   320  O OE2   . GLU A 1 42  ? -1.855  17.085  -11.650 1.00 39.01 ? 42  GLU A OE2   1 
ATOM   321  N N     . VAL A 1 43  ? 0.012   11.852  -11.515 1.00 26.23 ? 43  VAL A N     1 
ATOM   322  C CA    . VAL A 1 43  ? 0.469   10.743  -10.681 1.00 27.25 ? 43  VAL A CA    1 
ATOM   323  C C     . VAL A 1 43  ? 1.455   9.875   -11.484 1.00 29.05 ? 43  VAL A C     1 
ATOM   324  O O     . VAL A 1 43  ? 2.603   9.662   -11.067 1.00 29.59 ? 43  VAL A O     1 
ATOM   325  C CB    . VAL A 1 43  ? -0.737  9.912   -10.134 1.00 27.90 ? 43  VAL A CB    1 
ATOM   326  C CG1   . VAL A 1 43  ? -0.297  8.551   -9.589  1.00 26.90 ? 43  VAL A CG1   1 
ATOM   327  C CG2   . VAL A 1 43  ? -1.495  10.702  -9.057  1.00 26.84 ? 43  VAL A CG2   1 
ATOM   328  N N     . SER A 1 44  ? 1.003   9.422   -12.651 1.00 29.41 ? 44  SER A N     1 
ATOM   329  C CA    . SER A 1 44  ? 1.800   8.618   -13.581 1.00 29.95 ? 44  SER A CA    1 
ATOM   330  C C     . SER A 1 44  ? 3.193   9.217   -13.879 1.00 28.87 ? 44  SER A C     1 
ATOM   331  O O     . SER A 1 44  ? 4.196   8.513   -13.799 1.00 28.39 ? 44  SER A O     1 
ATOM   332  C CB    . SER A 1 44  ? 0.988   8.388   -14.869 1.00 29.75 ? 44  SER A CB    1 
ATOM   333  O OG    . SER A 1 44  ? 1.805   8.208   -16.024 1.00 33.92 ? 44  SER A OG    1 
ATOM   334  N N     . LYS A 1 45  ? 3.239   10.514  -14.189 1.00 28.30 ? 45  LYS A N     1 
ATOM   335  C CA    . LYS A 1 45  ? 4.470   11.195  -14.596 1.00 28.69 ? 45  LYS A CA    1 
ATOM   336  C C     . LYS A 1 45  ? 5.434   11.400  -13.440 1.00 27.79 ? 45  LYS A C     1 
ATOM   337  O O     . LYS A 1 45  ? 6.645   11.295  -13.618 1.00 28.02 ? 45  LYS A O     1 
ATOM   338  C CB    . LYS A 1 45  ? 4.167   12.532  -15.316 1.00 29.25 ? 45  LYS A CB    1 
ATOM   339  C CG    . LYS A 1 45  ? 3.519   12.372  -16.701 1.00 31.04 ? 45  LYS A CG    1 
ATOM   340  C CD    . LYS A 1 45  ? 3.176   13.716  -17.388 1.00 30.79 ? 45  LYS A CD    1 
ATOM   341  C CE    . LYS A 1 45  ? 2.203   13.483  -18.557 1.00 34.46 ? 45  LYS A CE    1 
ATOM   342  N NZ    . LYS A 1 45  ? 1.964   14.662  -19.461 1.00 35.58 ? 45  LYS A NZ    1 
ATOM   343  N N     . ASN A 1 46  ? 4.886   11.709  -12.265 1.00 29.09 ? 46  ASN A N     1 
ATOM   344  C CA    . ASN A 1 46  ? 5.658   11.826  -11.014 1.00 29.54 ? 46  ASN A CA    1 
ATOM   345  C C     . ASN A 1 46  ? 6.280   10.507  -10.574 1.00 28.92 ? 46  ASN A C     1 
ATOM   346  O O     . ASN A 1 46  ? 7.435   10.485  -10.121 1.00 29.36 ? 46  ASN A O     1 
ATOM   347  C CB    . ASN A 1 46  ? 4.769   12.322  -9.871  1.00 31.83 ? 46  ASN A CB    1 
ATOM   348  C CG    . ASN A 1 46  ? 4.371   13.772  -10.018 1.00 32.33 ? 46  ASN A CG    1 
ATOM   349  O OD1   . ASN A 1 46  ? 5.180   14.614  -10.383 1.00 31.67 ? 46  ASN A OD1   1 
ATOM   350  N ND2   . ASN A 1 46  ? 3.115   14.073  -9.700  1.00 37.90 ? 46  ASN A ND2   1 
ATOM   351  N N     . LEU A 1 47  ? 5.501   9.426   -10.678 1.00 25.83 ? 47  LEU A N     1 
ATOM   352  C CA    . LEU A 1 47  ? 5.980   8.086   -10.360 1.00 24.77 ? 47  LEU A CA    1 
ATOM   353  C C     . LEU A 1 47  ? 7.112   7.670   -11.301 1.00 24.76 ? 47  LEU A C     1 
ATOM   354  O O     . LEU A 1 47  ? 8.106   7.106   -10.842 1.00 25.24 ? 47  LEU A O     1 
ATOM   355  C CB    . LEU A 1 47  ? 4.844   7.047   -10.363 1.00 22.94 ? 47  LEU A CB    1 
ATOM   356  C CG    . LEU A 1 47  ? 3.823   7.110   -9.215  1.00 22.60 ? 47  LEU A CG    1 
ATOM   357  C CD1   . LEU A 1 47  ? 2.694   6.109   -9.431  1.00 17.29 ? 47  LEU A CD1   1 
ATOM   358  C CD2   . LEU A 1 47  ? 4.464   6.906   -7.831  1.00 16.46 ? 47  LEU A CD2   1 
ATOM   359  N N     . VAL A 1 48  ? 6.967   7.951   -12.601 1.00 24.81 ? 48  VAL A N     1 
ATOM   360  C CA    . VAL A 1 48  ? 8.061   7.724   -13.561 1.00 25.04 ? 48  VAL A CA    1 
ATOM   361  C C     . VAL A 1 48  ? 9.311   8.525   -13.163 1.00 26.54 ? 48  VAL A C     1 
ATOM   362  O O     . VAL A 1 48  ? 10.423  7.995   -13.194 1.00 27.69 ? 48  VAL A O     1 
ATOM   363  C CB    . VAL A 1 48  ? 7.666   8.032   -15.035 1.00 25.45 ? 48  VAL A CB    1 
ATOM   364  C CG1   . VAL A 1 48  ? 8.911   8.139   -15.933 1.00 23.25 ? 48  VAL A CG1   1 
ATOM   365  C CG2   . VAL A 1 48  ? 6.714   6.958   -15.591 1.00 25.57 ? 48  VAL A CG2   1 
ATOM   366  N N     . ALA A 1 49  ? 9.113   9.788   -12.775 1.00 26.05 ? 49  ALA A N     1 
ATOM   367  C CA    . ALA A 1 49  ? 10.202  10.652  -12.326 1.00 26.29 ? 49  ALA A CA    1 
ATOM   368  C C     . ALA A 1 49  ? 10.919  10.127  -11.080 1.00 25.89 ? 49  ALA A C     1 
ATOM   369  O O     . ALA A 1 49  ? 12.132  10.190  -10.998 1.00 26.95 ? 49  ALA A O     1 
ATOM   370  C CB    . ALA A 1 49  ? 9.693   12.083  -12.105 1.00 26.11 ? 49  ALA A CB    1 
ATOM   371  N N     . MET A 1 50  ? 10.162  9.603   -10.122 1.00 27.75 ? 50  MET A N     1 
ATOM   372  C CA    . MET A 1 50  ? 10.712  9.050   -8.879  1.00 29.09 ? 50  MET A CA    1 
ATOM   373  C C     . MET A 1 50  ? 11.524  7.786   -9.121  1.00 28.07 ? 50  MET A C     1 
ATOM   374  O O     . MET A 1 50  ? 12.636  7.642   -8.610  1.00 28.21 ? 50  MET A O     1 
ATOM   375  C CB    . MET A 1 50  ? 9.587   8.693   -7.923  1.00 29.88 ? 50  MET A CB    1 
ATOM   376  C CG    . MET A 1 50  ? 8.919   9.859   -7.281  1.00 32.83 ? 50  MET A CG    1 
ATOM   377  S SD    . MET A 1 50  ? 8.152   9.318   -5.755  1.00 34.43 ? 50  MET A SD    1 
ATOM   378  C CE    . MET A 1 50  ? 7.506   10.895  -5.215  1.00 35.08 ? 50  MET A CE    1 
ATOM   379  N N     . LYS A 1 51  ? 10.930  6.863   -9.876  1.00 26.97 ? 51  LYS A N     1 
ATOM   380  C CA    . LYS A 1 51  ? 11.603  5.670   -10.355 1.00 26.59 ? 51  LYS A CA    1 
ATOM   381  C C     . LYS A 1 51  ? 12.955  6.015   -10.996 1.00 26.17 ? 51  LYS A C     1 
ATOM   382  O O     . LYS A 1 51  ? 13.959  5.374   -10.711 1.00 25.31 ? 51  LYS A O     1 
ATOM   383  C CB    . LYS A 1 51  ? 10.718  4.933   -11.367 1.00 25.66 ? 51  LYS A CB    1 
ATOM   384  C CG    . LYS A 1 51  ? 10.968  3.438   -11.428 1.00 24.80 ? 51  LYS A CG    1 
ATOM   385  C CD    . LYS A 1 51  ? 10.985  2.893   -12.855 1.00 29.05 ? 51  LYS A CD    1 
ATOM   386  C CE    . LYS A 1 51  ? 9.804   3.381   -13.683 1.00 31.07 ? 51  LYS A CE    1 
ATOM   387  N NZ    . LYS A 1 51  ? 9.796   2.812   -15.063 1.00 30.62 ? 51  LYS A NZ    1 
ATOM   388  N N     . GLU A 1 52  ? 12.977  7.035   -11.848 1.00 27.27 ? 52  GLU A N     1 
ATOM   389  C CA    . GLU A 1 52  ? 14.207  7.394   -12.555 1.00 29.77 ? 52  GLU A CA    1 
ATOM   390  C C     . GLU A 1 52  ? 15.284  7.995   -11.648 1.00 29.45 ? 52  GLU A C     1 
ATOM   391  O O     . GLU A 1 52  ? 16.473  7.839   -11.914 1.00 29.86 ? 52  GLU A O     1 
ATOM   392  C CB    . GLU A 1 52  ? 13.911  8.301   -13.741 1.00 30.58 ? 52  GLU A CB    1 
ATOM   393  C CG    . GLU A 1 52  ? 13.298  7.555   -14.907 1.00 35.51 ? 52  GLU A CG    1 
ATOM   394  C CD    . GLU A 1 52  ? 13.233  8.383   -16.171 1.00 40.84 ? 52  GLU A CD    1 
ATOM   395  O OE1   . GLU A 1 52  ? 12.637  7.895   -17.153 1.00 45.19 ? 52  GLU A OE1   1 
ATOM   396  O OE2   . GLU A 1 52  ? 13.775  9.511   -16.192 1.00 43.32 ? 52  GLU A OE2   1 
ATOM   397  N N     . ILE A 1 53  ? 14.865  8.668   -10.578 1.00 29.10 ? 53  ILE A N     1 
ATOM   398  C CA    . ILE A 1 53  ? 15.800  9.131   -9.549  1.00 29.26 ? 53  ILE A CA    1 
ATOM   399  C C     . ILE A 1 53  ? 16.464  7.964   -8.798  1.00 28.37 ? 53  ILE A C     1 
ATOM   400  O O     . ILE A 1 53  ? 17.649  8.037   -8.440  1.00 28.88 ? 53  ILE A O     1 
ATOM   401  C CB    . ILE A 1 53  ? 15.125  10.109  -8.548  1.00 29.38 ? 53  ILE A CB    1 
ATOM   402  C CG1   . ILE A 1 53  ? 14.860  11.459  -9.219  1.00 29.15 ? 53  ILE A CG1   1 
ATOM   403  C CG2   . ILE A 1 53  ? 16.007  10.342  -7.326  1.00 29.82 ? 53  ILE A CG2   1 
ATOM   404  C CD1   . ILE A 1 53  ? 13.806  12.290  -8.514  1.00 28.73 ? 53  ILE A CD1   1 
ATOM   405  N N     . LEU A 1 54  ? 15.700  6.897   -8.570  1.00 27.14 ? 54  LEU A N     1 
ATOM   406  C CA    . LEU A 1 54  ? 16.152  5.775   -7.741  1.00 24.58 ? 54  LEU A CA    1 
ATOM   407  C C     . LEU A 1 54  ? 16.919  4.723   -8.532  1.00 25.33 ? 54  LEU A C     1 
ATOM   408  O O     . LEU A 1 54  ? 17.909  4.180   -8.044  1.00 25.27 ? 54  LEU A O     1 
ATOM   409  C CB    . LEU A 1 54  ? 14.976  5.138   -7.009  1.00 22.82 ? 54  LEU A CB    1 
ATOM   410  C CG    . LEU A 1 54  ? 14.250  6.047   -6.012  1.00 21.81 ? 54  LEU A CG    1 
ATOM   411  C CD1   . LEU A 1 54  ? 12.922  5.444   -5.619  1.00 16.66 ? 54  LEU A CD1   1 
ATOM   412  C CD2   . LEU A 1 54  ? 15.098  6.336   -4.762  1.00 19.03 ? 54  LEU A CD2   1 
ATOM   413  N N     . TYR A 1 55  ? 16.469  4.440   -9.752  1.00 25.75 ? 55  TYR A N     1 
ATOM   414  C CA    . TYR A 1 55  ? 17.154  3.476   -10.610 1.00 26.30 ? 55  TYR A CA    1 
ATOM   415  C C     . TYR A 1 55  ? 18.090  4.135   -11.639 1.00 27.95 ? 55  TYR A C     1 
ATOM   416  O O     . TYR A 1 55  ? 18.981  3.478   -12.201 1.00 26.77 ? 55  TYR A O     1 
ATOM   417  C CB    . TYR A 1 55  ? 16.138  2.570   -11.299 1.00 25.27 ? 55  TYR A CB    1 
ATOM   418  C CG    . TYR A 1 55  ? 15.405  1.649   -10.344 1.00 25.96 ? 55  TYR A CG    1 
ATOM   419  C CD1   . TYR A 1 55  ? 14.311  2.098   -9.615  1.00 19.73 ? 55  TYR A CD1   1 
ATOM   420  C CD2   . TYR A 1 55  ? 15.814  0.322   -10.171 1.00 27.59 ? 55  TYR A CD2   1 
ATOM   421  C CE1   . TYR A 1 55  ? 13.638  1.259   -8.734  1.00 23.10 ? 55  TYR A CE1   1 
ATOM   422  C CE2   . TYR A 1 55  ? 15.140  -0.535  -9.296  1.00 25.69 ? 55  TYR A CE2   1 
ATOM   423  C CZ    . TYR A 1 55  ? 14.055  -0.060  -8.578  1.00 26.13 ? 55  TYR A CZ    1 
ATOM   424  O OH    . TYR A 1 55  ? 13.387  -0.903  -7.710  1.00 24.22 ? 55  TYR A OH    1 
ATOM   425  N N     . GLY A 1 56  ? 17.898  5.435   -11.860 1.00 29.07 ? 56  GLY A N     1 
ATOM   426  C CA    . GLY A 1 56  ? 18.572  6.133   -12.947 1.00 30.93 ? 56  GLY A CA    1 
ATOM   427  C C     . GLY A 1 56  ? 17.955  5.745   -14.276 1.00 31.71 ? 56  GLY A C     1 
ATOM   428  O O     . GLY A 1 56  ? 16.774  5.401   -14.347 1.00 32.72 ? 56  GLY A O     1 
ATOM   429  N N     . THR A 1 57  ? 18.757  5.794   -15.332 1.00 33.04 ? 57  THR A N     1 
ATOM   430  C CA    . THR A 1 57  ? 18.291  5.461   -16.672 1.00 33.48 ? 57  THR A CA    1 
ATOM   431  C C     . THR A 1 57  ? 19.292  4.552   -17.391 1.00 34.87 ? 57  THR A C     1 
ATOM   432  O O     . THR A 1 57  ? 20.221  4.022   -16.772 1.00 34.94 ? 57  THR A O     1 
ATOM   433  C CB    . THR A 1 57  ? 18.046  6.736   -17.502 1.00 33.62 ? 57  THR A CB    1 
ATOM   434  O OG1   . THR A 1 57  ? 19.259  7.502   -17.570 1.00 30.87 ? 57  THR A OG1   1 
ATOM   435  C CG2   . THR A 1 57  ? 16.921  7.582   -16.879 1.00 32.59 ? 57  THR A CG2   1 
ATOM   436  N N     . ASN A 1 58  ? 19.087  4.368   -18.694 1.00 35.77 ? 58  ASN A N     1 
ATOM   437  C CA    . ASN A 1 58  ? 20.030  3.641   -19.533 1.00 35.94 ? 58  ASN A CA    1 
ATOM   438  C C     . ASN A 1 58  ? 21.300  4.457   -19.761 1.00 35.20 ? 58  ASN A C     1 
ATOM   439  O O     . ASN A 1 58  ? 22.328  3.920   -20.186 1.00 35.12 ? 58  ASN A O     1 
ATOM   440  C CB    . ASN A 1 58  ? 19.383  3.292   -20.877 1.00 37.21 ? 58  ASN A CB    1 
ATOM   441  C CG    . ASN A 1 58  ? 20.021  2.079   -21.537 1.00 39.26 ? 58  ASN A CG    1 
ATOM   442  O OD1   . ASN A 1 58  ? 19.740  0.936   -21.164 1.00 41.74 ? 58  ASN A OD1   1 
ATOM   443  N ND2   . ASN A 1 58  ? 20.876  2.321   -22.531 1.00 39.88 ? 58  ASN A ND2   1 
ATOM   444  N N     . GLU A 1 59  ? 21.221  5.755   -19.466 1.00 34.16 ? 59  GLU A N     1 
ATOM   445  C CA    . GLU A 1 59  ? 22.339  6.678   -19.674 1.00 32.99 ? 59  GLU A CA    1 
ATOM   446  C C     . GLU A 1 59  ? 23.011  7.103   -18.364 1.00 32.01 ? 59  GLU A C     1 
ATOM   447  O O     . GLU A 1 59  ? 24.238  7.218   -18.304 1.00 31.97 ? 59  GLU A O     1 
ATOM   448  C CB    . GLU A 1 59  ? 21.879  7.914   -20.462 1.00 32.89 ? 59  GLU A CB    1 
ATOM   449  C CG    . GLU A 1 59  ? 21.232  7.614   -21.821 1.00 34.03 ? 59  GLU A CG    1 
ATOM   450  C CD    . GLU A 1 59  ? 22.192  6.965   -22.822 1.00 38.54 ? 59  GLU A CD    1 
ATOM   451  O OE1   . GLU A 1 59  ? 21.860  5.872   -23.334 1.00 40.42 ? 59  GLU A OE1   1 
ATOM   452  O OE2   . GLU A 1 59  ? 23.273  7.541   -23.100 1.00 36.27 ? 59  GLU A OE2   1 
ATOM   453  N N     . LYS A 1 60  ? 22.200  7.332   -17.330 1.00 30.79 ? 60  LYS A N     1 
ATOM   454  C CA    . LYS A 1 60  ? 22.666  7.825   -16.028 1.00 29.79 ? 60  LYS A CA    1 
ATOM   455  C C     . LYS A 1 60  ? 22.387  6.823   -14.908 1.00 29.36 ? 60  LYS A C     1 
ATOM   456  O O     . LYS A 1 60  ? 21.322  6.203   -14.870 1.00 29.20 ? 60  LYS A O     1 
ATOM   457  C CB    . LYS A 1 60  ? 21.972  9.151   -15.677 1.00 29.99 ? 60  LYS A CB    1 
ATOM   458  C CG    . LYS A 1 60  ? 22.387  10.369  -16.505 1.00 29.70 ? 60  LYS A CG    1 
ATOM   459  C CD    . LYS A 1 60  ? 23.702  10.982  -16.020 1.00 29.08 ? 60  LYS A CD    1 
ATOM   460  C CE    . LYS A 1 60  ? 23.972  12.311  -16.715 1.00 27.86 ? 60  LYS A CE    1 
ATOM   461  N NZ    . LYS A 1 60  ? 25.411  12.670  -16.698 1.00 27.09 ? 60  LYS A NZ    1 
ATOM   462  N N     . GLU A 1 61  ? 23.339  6.675   -13.991 1.00 28.65 ? 61  GLU A N     1 
ATOM   463  C CA    . GLU A 1 61  ? 23.104  5.901   -12.774 1.00 28.59 ? 61  GLU A CA    1 
ATOM   464  C C     . GLU A 1 61  ? 22.589  6.834   -11.673 1.00 27.34 ? 61  GLU A C     1 
ATOM   465  O O     . GLU A 1 61  ? 22.819  8.040   -11.735 1.00 26.38 ? 61  GLU A O     1 
ATOM   466  C CB    . GLU A 1 61  ? 24.361  5.135   -12.333 1.00 28.96 ? 61  GLU A CB    1 
ATOM   467  C CG    . GLU A 1 61  ? 25.377  5.954   -11.547 1.00 33.74 ? 61  GLU A CG    1 
ATOM   468  C CD    . GLU A 1 61  ? 25.969  5.189   -10.359 1.00 39.48 ? 61  GLU A CD    1 
ATOM   469  O OE1   . GLU A 1 61  ? 25.613  3.966   -10.163 1.00 39.43 ? 61  GLU A OE1   1 
ATOM   470  O OE2   . GLU A 1 61  ? 26.788  5.822   -9.609  1.00 40.18 ? 61  GLU A OE2   1 
ATOM   471  N N     . PRO A 1 62  ? 21.866  6.285   -10.674 1.00 27.13 ? 62  PRO A N     1 
ATOM   472  C CA    . PRO A 1 62  ? 21.326  7.141   -9.609  1.00 26.98 ? 62  PRO A CA    1 
ATOM   473  C C     . PRO A 1 62  ? 22.414  7.833   -8.777  1.00 26.60 ? 62  PRO A C     1 
ATOM   474  O O     . PRO A 1 62  ? 23.420  7.212   -8.430  1.00 26.60 ? 62  PRO A O     1 
ATOM   475  C CB    . PRO A 1 62  ? 20.521  6.168   -8.741  1.00 26.24 ? 62  PRO A CB    1 
ATOM   476  C CG    . PRO A 1 62  ? 21.082  4.830   -9.041  1.00 26.85 ? 62  PRO A CG    1 
ATOM   477  C CD    . PRO A 1 62  ? 21.498  4.871   -10.478 1.00 26.72 ? 62  PRO A CD    1 
ATOM   478  N N     . GLN A 1 63  ? 22.198  9.112   -8.482  1.00 26.38 ? 63  GLN A N     1 
ATOM   479  C CA    . GLN A 1 63  ? 23.116  9.901   -7.669  1.00 26.98 ? 63  GLN A CA    1 
ATOM   480  C C     . GLN A 1 63  ? 22.610  10.064  -6.237  1.00 27.33 ? 63  GLN A C     1 
ATOM   481  O O     . GLN A 1 63  ? 21.462  10.449  -6.017  1.00 27.38 ? 63  GLN A O     1 
ATOM   482  C CB    . GLN A 1 63  ? 23.379  11.269  -8.322  1.00 27.35 ? 63  GLN A CB    1 
ATOM   483  C CG    . GLN A 1 63  ? 22.125  11.951  -9.001  1.00 28.01 ? 63  GLN A CG    1 
ATOM   484  C CD    . GLN A 1 63  ? 22.491  13.197  -9.886  1.00 26.43 ? 63  GLN A CD    1 
ATOM   485  O OE1   . GLN A 1 63  ? 21.609  13.606  -10.788 1.00 25.27 ? 63  GLN A OE1   1 
ATOM   486  N NE2   . GLN A 1 63  ? 23.858  13.767  -9.625  1.00 28.79 ? 63  GLN A NE2   1 
ATOM   487  N N     . THR A 1 64  ? 23.498  9.794   -5.278  1.00 28.38 ? 64  THR A N     1 
ATOM   488  C CA    . THR A 1 64  ? 23.145  9.597   -3.857  1.00 28.17 ? 64  THR A CA    1 
ATOM   489  C C     . THR A 1 64  ? 22.400  10.755  -3.191  1.00 28.20 ? 64  THR A C     1 
ATOM   490  O O     . THR A 1 64  ? 21.514  10.520  -2.365  1.00 27.03 ? 64  THR A O     1 
ATOM   491  C CB    . THR A 1 64  ? 24.393  9.238   -2.989  1.00 27.84 ? 64  THR A CB    1 
ATOM   492  O OG1   . THR A 1 64  ? 25.192  10.407  -2.781  1.00 26.80 ? 64  THR A OG1   1 
ATOM   493  C CG2   . THR A 1 64  ? 25.236  8.151   -3.648  1.00 27.04 ? 64  THR A CG2   1 
ATOM   494  N N     . GLU A 1 65  ? 22.784  11.990  -3.536  1.00 28.55 ? 65  GLU A N     1 
ATOM   495  C CA    . GLU A 1 65  ? 22.141  13.204  -3.023  1.00 29.09 ? 65  GLU A CA    1 
ATOM   496  C C     . GLU A 1 65  ? 20.659  13.231  -3.377  1.00 29.20 ? 65  GLU A C     1 
ATOM   497  O O     . GLU A 1 65  ? 19.813  13.413  -2.496  1.00 29.85 ? 65  GLU A O     1 
ATOM   498  C CB    . GLU A 1 65  ? 22.819  14.467  -3.565  1.00 29.31 ? 65  GLU A CB    1 
ATOM   499  C CG    . GLU A 1 65  ? 24.086  14.932  -2.770  1.00 30.04 ? 65  GLU A CG    1 
ATOM   500  C CD    . GLU A 1 65  ? 24.353  16.447  -3.039  1.00 31.08 ? 65  GLU A CD    1 
ATOM   501  O OE1   . GLU A 1 65  ? 23.397  17.116  -3.525  1.00 34.88 ? 65  GLU A OE1   1 
ATOM   502  O OE2   . GLU A 1 65  ? 25.510  16.975  -2.759  1.00 29.80 ? 65  GLU A OE2   1 
ATOM   503  N N     . ALA A 1 66  ? 20.354  13.039  -4.663  1.00 28.34 ? 66  ALA A N     1 
ATOM   504  C CA    . ALA A 1 66  ? 18.976  12.991  -5.143  1.00 27.85 ? 66  ALA A CA    1 
ATOM   505  C C     . ALA A 1 66  ? 18.197  11.884  -4.449  1.00 27.54 ? 66  ALA A C     1 
ATOM   506  O O     . ALA A 1 66  ? 17.049  12.090  -4.054  1.00 28.88 ? 66  ALA A O     1 
ATOM   507  C CB    . ALA A 1 66  ? 18.935  12.801  -6.660  1.00 27.98 ? 66  ALA A CB    1 
ATOM   508  N N     . VAL A 1 67  ? 18.833  10.721  -4.294  1.00 25.93 ? 67  VAL A N     1 
ATOM   509  C CA    . VAL A 1 67  ? 18.201  9.549   -3.679  1.00 24.72 ? 67  VAL A CA    1 
ATOM   510  C C     . VAL A 1 67  ? 17.862  9.808   -2.203  1.00 25.21 ? 67  VAL A C     1 
ATOM   511  O O     . VAL A 1 67  ? 16.763  9.465   -1.735  1.00 23.86 ? 67  VAL A O     1 
ATOM   512  C CB    . VAL A 1 67  ? 19.077  8.271   -3.850  1.00 23.60 ? 67  VAL A CB    1 
ATOM   513  C CG1   . VAL A 1 67  ? 18.487  7.085   -3.098  1.00 20.80 ? 67  VAL A CG1   1 
ATOM   514  C CG2   . VAL A 1 67  ? 19.243  7.928   -5.328  1.00 22.78 ? 67  VAL A CG2   1 
ATOM   515  N N     . ALA A 1 68  ? 18.807  10.433  -1.499  1.00 24.35 ? 68  ALA A N     1 
ATOM   516  C CA    . ALA A 1 68  ? 18.679  10.732  -0.072  1.00 25.54 ? 68  ALA A CA    1 
ATOM   517  C C     . ALA A 1 68  ? 17.639  11.809  0.220   1.00 25.55 ? 68  ALA A C     1 
ATOM   518  O O     . ALA A 1 68  ? 16.942  11.730  1.227   1.00 25.91 ? 68  ALA A O     1 
ATOM   519  C CB    . ALA A 1 68  ? 20.039  11.126  0.527   1.00 24.50 ? 68  ALA A CB    1 
ATOM   520  N N     . GLN A 1 69  ? 17.562  12.820  -0.648  1.00 26.36 ? 69  GLN A N     1 
ATOM   521  C CA    . GLN A 1 69  ? 16.513  13.845  -0.578  1.00 27.29 ? 69  GLN A CA    1 
ATOM   522  C C     . GLN A 1 69  ? 15.144  13.196  -0.775  1.00 27.33 ? 69  GLN A C     1 
ATOM   523  O O     . GLN A 1 69  ? 14.200  13.481  -0.035  1.00 27.08 ? 69  GLN A O     1 
ATOM   524  C CB    . GLN A 1 69  ? 16.725  14.926  -1.643  1.00 26.24 ? 69  GLN A CB    1 
ATOM   525  C CG    . GLN A 1 69  ? 17.815  15.950  -1.323  1.00 29.00 ? 69  GLN A CG    1 
ATOM   526  C CD    . GLN A 1 69  ? 18.082  16.917  -2.484  1.00 30.24 ? 69  GLN A CD    1 
ATOM   527  O OE1   . GLN A 1 69  ? 17.336  16.954  -3.471  1.00 34.05 ? 69  GLN A OE1   1 
ATOM   528  N NE2   . GLN A 1 69  ? 19.150  17.706  -2.363  1.00 32.20 ? 69  GLN A NE2   1 
ATOM   529  N N     . LEU A 1 70  ? 15.057  12.309  -1.765  1.00 26.54 ? 70  LEU A N     1 
ATOM   530  C CA    . LEU A 1 70  ? 13.813  11.646  -2.097  1.00 27.05 ? 70  LEU A CA    1 
ATOM   531  C C     . LEU A 1 70  ? 13.309  10.754  -0.962  1.00 27.15 ? 70  LEU A C     1 
ATOM   532  O O     . LEU A 1 70  ? 12.160  10.892  -0.536  1.00 25.97 ? 70  LEU A O     1 
ATOM   533  C CB    . LEU A 1 70  ? 13.951  10.861  -3.405  1.00 27.38 ? 70  LEU A CB    1 
ATOM   534  C CG    . LEU A 1 70  ? 12.713  10.133  -3.929  1.00 26.81 ? 70  LEU A CG    1 
ATOM   535  C CD1   . LEU A 1 70  ? 11.501  11.057  -4.020  1.00 27.59 ? 70  LEU A CD1   1 
ATOM   536  C CD2   . LEU A 1 70  ? 13.026  9.541   -5.280  1.00 30.16 ? 70  LEU A CD2   1 
ATOM   537  N N     . ALA A 1 71  ? 14.165  9.862   -0.467  1.00 27.59 ? 71  ALA A N     1 
ATOM   538  C CA    . ALA A 1 71  ? 13.783  8.973   0.640   1.00 28.31 ? 71  ALA A CA    1 
ATOM   539  C C     . ALA A 1 71  ? 13.307  9.773   1.853   1.00 28.08 ? 71  ALA A C     1 
ATOM   540  O O     . ALA A 1 71  ? 12.247  9.491   2.410   1.00 27.30 ? 71  ALA A O     1 
ATOM   541  C CB    . ALA A 1 71  ? 14.926  8.045   1.014   1.00 27.90 ? 71  ALA A CB    1 
ATOM   542  N N     . GLN A 1 72  ? 14.081  10.789  2.230   1.00 28.74 ? 72  GLN A N     1 
ATOM   543  C CA    . GLN A 1 72  ? 13.712  11.683  3.328   1.00 29.94 ? 72  GLN A CA    1 
ATOM   544  C C     . GLN A 1 72  ? 12.309  12.264  3.127   1.00 29.82 ? 72  GLN A C     1 
ATOM   545  O O     . GLN A 1 72  ? 11.449  12.157  3.996   1.00 29.45 ? 72  GLN A O     1 
ATOM   546  C CB    . GLN A 1 72  ? 14.749  12.804  3.465   1.00 31.01 ? 72  GLN A CB    1 
ATOM   547  C CG    . GLN A 1 72  ? 14.512  13.793  4.603   1.00 32.67 ? 72  GLN A CG    1 
ATOM   548  C CD    . GLN A 1 72  ? 14.866  13.229  5.969   1.00 36.99 ? 72  GLN A CD    1 
ATOM   549  O OE1   . GLN A 1 72  ? 14.555  12.070  6.289   1.00 36.03 ? 72  GLN A OE1   1 
ATOM   550  N NE2   . GLN A 1 72  ? 15.514  14.056  6.795   1.00 38.44 ? 72  GLN A NE2   1 
ATOM   551  N N     . GLU A 1 73  ? 12.094  12.859  1.960   1.00 30.10 ? 73  GLU A N     1 
ATOM   552  C CA    . GLU A 1 73  ? 10.820  13.466  1.604   1.00 30.35 ? 73  GLU A CA    1 
ATOM   553  C C     . GLU A 1 73  ? 9.693   12.445  1.648   1.00 29.94 ? 73  GLU A C     1 
ATOM   554  O O     . GLU A 1 73  ? 8.622   12.723  2.181   1.00 30.40 ? 73  GLU A O     1 
ATOM   555  C CB    . GLU A 1 73  ? 10.906  14.121  0.216   1.00 30.69 ? 73  GLU A CB    1 
ATOM   556  C CG    . GLU A 1 73  ? 11.666  15.441  0.190   1.00 29.50 ? 73  GLU A CG    1 
ATOM   557  C CD    . GLU A 1 73  ? 10.965  16.517  0.989   1.00 34.58 ? 73  GLU A CD    1 
ATOM   558  O OE1   . GLU A 1 73  ? 9.714   16.521  1.014   1.00 35.33 ? 73  GLU A OE1   1 
ATOM   559  O OE2   . GLU A 1 73  ? 11.660  17.361  1.594   1.00 37.13 ? 73  GLU A OE2   1 
ATOM   560  N N     . LEU A 1 74  ? 9.949   11.261  1.099   1.00 29.77 ? 74  LEU A N     1 
ATOM   561  C CA    . LEU A 1 74  ? 8.985   10.171  1.124   1.00 29.20 ? 74  LEU A CA    1 
ATOM   562  C C     . LEU A 1 74  ? 8.549   9.784   2.548   1.00 29.62 ? 74  LEU A C     1 
ATOM   563  O O     . LEU A 1 74  ? 7.356   9.565   2.783   1.00 28.62 ? 74  LEU A O     1 
ATOM   564  C CB    . LEU A 1 74  ? 9.512   8.958   0.347   1.00 28.77 ? 74  LEU A CB    1 
ATOM   565  C CG    . LEU A 1 74  ? 9.187   8.939   -1.162  1.00 30.79 ? 74  LEU A CG    1 
ATOM   566  C CD1   . LEU A 1 74  ? 9.892   7.786   -1.872  1.00 28.37 ? 74  LEU A CD1   1 
ATOM   567  C CD2   . LEU A 1 74  ? 7.668   8.909   -1.459  1.00 25.54 ? 74  LEU A CD2   1 
ATOM   568  N N     . TYR A 1 75  ? 9.506   9.728   3.485   1.00 29.57 ? 75  TYR A N     1 
ATOM   569  C CA    . TYR A 1 75  ? 9.221   9.367   4.880   1.00 29.60 ? 75  TYR A CA    1 
ATOM   570  C C     . TYR A 1 75  ? 8.427   10.459  5.586   1.00 30.14 ? 75  TYR A C     1 
ATOM   571  O O     . TYR A 1 75  ? 7.518   10.164  6.361   1.00 31.14 ? 75  TYR A O     1 
ATOM   572  C CB    . TYR A 1 75  ? 10.498  9.104   5.701   1.00 29.27 ? 75  TYR A CB    1 
ATOM   573  C CG    . TYR A 1 75  ? 11.434  8.007   5.223   1.00 28.62 ? 75  TYR A CG    1 
ATOM   574  C CD1   . TYR A 1 75  ? 10.953  6.807   4.692   1.00 28.81 ? 75  TYR A CD1   1 
ATOM   575  C CD2   . TYR A 1 75  ? 12.819  8.157   5.361   1.00 30.29 ? 75  TYR A CD2   1 
ATOM   576  C CE1   . TYR A 1 75  ? 11.835  5.798   4.271   1.00 26.76 ? 75  TYR A CE1   1 
ATOM   577  C CE2   . TYR A 1 75  ? 13.703  7.161   4.946   1.00 29.96 ? 75  TYR A CE2   1 
ATOM   578  C CZ    . TYR A 1 75  ? 13.206  5.985   4.403   1.00 28.06 ? 75  TYR A CZ    1 
ATOM   579  O OH    . TYR A 1 75  ? 14.093  5.012   3.996   1.00 27.24 ? 75  TYR A OH    1 
ATOM   580  N N     . ASN A 1 76  ? 8.784   11.717  5.332   1.00 30.04 ? 76  ASN A N     1 
ATOM   581  C CA    . ASN A 1 76  ? 8.142   12.844  6.002   1.00 29.97 ? 76  ASN A CA    1 
ATOM   582  C C     . ASN A 1 76  ? 6.700   13.071  5.552   1.00 30.28 ? 76  ASN A C     1 
ATOM   583  O O     . ASN A 1 76  ? 5.873   13.558  6.322   1.00 31.05 ? 76  ASN A O     1 
ATOM   584  C CB    . ASN A 1 76  ? 8.956   14.128  5.814   1.00 30.49 ? 76  ASN A CB    1 
ATOM   585  C CG    . ASN A 1 76  ? 10.293  14.103  6.546   1.00 30.84 ? 76  ASN A CG    1 
ATOM   586  O OD1   . ASN A 1 76  ? 10.695  13.096  7.144   1.00 28.99 ? 76  ASN A OD1   1 
ATOM   587  N ND2   . ASN A 1 76  ? 10.993  15.227  6.497   1.00 32.08 ? 76  ASN A ND2   1 
ATOM   588  N N     . SER A 1 77  ? 6.404   12.703  4.310   1.00 30.00 ? 77  SER A N     1 
ATOM   589  C CA    . SER A 1 77  ? 5.101   12.954  3.707   1.00 30.08 ? 77  SER A CA    1 
ATOM   590  C C     . SER A 1 77  ? 4.046   11.858  3.948   1.00 30.62 ? 77  SER A C     1 
ATOM   591  O O     . SER A 1 77  ? 2.849   12.104  3.774   1.00 31.47 ? 77  SER A O     1 
ATOM   592  C CB    . SER A 1 77  ? 5.279   13.177  2.209   1.00 29.91 ? 77  SER A CB    1 
ATOM   593  O OG    . SER A 1 77  ? 5.941   12.072  1.618   1.00 33.36 ? 77  SER A OG    1 
ATOM   594  N N     . GLY A 1 78  ? 4.486   10.657  4.326   1.00 30.68 ? 78  GLY A N     1 
ATOM   595  C CA    . GLY A 1 78  ? 3.593   9.512   4.542   1.00 30.07 ? 78  GLY A CA    1 
ATOM   596  C C     . GLY A 1 78  ? 3.070   8.911   3.247   1.00 30.59 ? 78  GLY A C     1 
ATOM   597  O O     . GLY A 1 78  ? 2.061   8.197   3.238   1.00 29.36 ? 78  GLY A O     1 
ATOM   598  N N     . LEU A 1 79  ? 3.782   9.198   2.160   1.00 30.82 ? 79  LEU A N     1 
ATOM   599  C CA    . LEU A 1 79  ? 3.381   8.842   0.808   1.00 31.54 ? 79  LEU A CA    1 
ATOM   600  C C     . LEU A 1 79  ? 3.580   7.356   0.549   1.00 32.11 ? 79  LEU A C     1 
ATOM   601  O O     . LEU A 1 79  ? 2.859   6.764   -0.257  1.00 32.98 ? 79  LEU A O     1 
ATOM   602  C CB    . LEU A 1 79  ? 4.176   9.693   -0.189  1.00 32.76 ? 79  LEU A CB    1 
ATOM   603  C CG    . LEU A 1 79  ? 3.698   10.082  -1.596  1.00 34.71 ? 79  LEU A CG    1 
ATOM   604  C CD1   . LEU A 1 79  ? 2.253   10.574  -1.637  1.00 28.98 ? 79  LEU A CD1   1 
ATOM   605  C CD2   . LEU A 1 79  ? 4.651   11.145  -2.164  1.00 31.95 ? 79  LEU A CD2   1 
ATOM   606  N N     . LEU A 1 80  ? 4.538   6.746   1.251   1.00 31.09 ? 80  LEU A N     1 
ATOM   607  C CA    . LEU A 1 80  ? 4.721   5.289   1.226   1.00 30.60 ? 80  LEU A CA    1 
ATOM   608  C C     . LEU A 1 80  ? 3.493   4.546   1.710   1.00 29.83 ? 80  LEU A C     1 
ATOM   609  O O     . LEU A 1 80  ? 3.209   3.436   1.265   1.00 32.39 ? 80  LEU A O     1 
ATOM   610  C CB    . LEU A 1 80  ? 5.909   4.877   2.097   1.00 30.54 ? 80  LEU A CB    1 
ATOM   611  C CG    . LEU A 1 80  ? 7.242   4.520   1.435   1.00 31.41 ? 80  LEU A CG    1 
ATOM   612  C CD1   . LEU A 1 80  ? 7.371   5.059   0.027   1.00 30.69 ? 80  LEU A CD1   1 
ATOM   613  C CD2   . LEU A 1 80  ? 8.391   4.995   2.312   1.00 32.85 ? 80  LEU A CD2   1 
ATOM   614  N N     . SER A 1 81  ? 2.789   5.152   2.652   1.00 28.79 ? 81  SER A N     1 
ATOM   615  C CA    . SER A 1 81  ? 1.539   4.614   3.158   1.00 27.74 ? 81  SER A CA    1 
ATOM   616  C C     . SER A 1 81  ? 0.397   4.928   2.184   1.00 27.09 ? 81  SER A C     1 
ATOM   617  O O     . SER A 1 81  ? -0.404  4.051   1.854   1.00 26.61 ? 81  SER A O     1 
ATOM   618  C CB    . SER A 1 81  ? 1.271   5.209   4.538   1.00 27.05 ? 81  SER A CB    1 
ATOM   619  O OG    . SER A 1 81  ? 0.107   4.674   5.128   1.00 29.76 ? 81  SER A OG    1 
ATOM   620  N N     . THR A 1 82  ? 0.341   6.181   1.725   1.00 26.42 ? 82  THR A N     1 
ATOM   621  C CA    . THR A 1 82  ? -0.716  6.683   0.834   1.00 25.98 ? 82  THR A CA    1 
ATOM   622  C C     . THR A 1 82  ? -0.755  5.940   -0.505  1.00 26.73 ? 82  THR A C     1 
ATOM   623  O O     . THR A 1 82  ? -1.835  5.658   -1.013  1.00 29.16 ? 82  THR A O     1 
ATOM   624  C CB    . THR A 1 82  ? -0.556  8.215   0.586   1.00 26.29 ? 82  THR A CB    1 
ATOM   625  O OG1   . THR A 1 82  ? -0.623  8.911   1.834   1.00 26.85 ? 82  THR A OG1   1 
ATOM   626  C CG2   . THR A 1 82  ? -1.641  8.771   -0.342  1.00 23.75 ? 82  THR A CG2   1 
ATOM   627  N N     . LEU A 1 83  ? 0.420   5.630   -1.060  1.00 26.09 ? 83  LEU A N     1 
ATOM   628  C CA    . LEU A 1 83  ? 0.541   4.953   -2.352  1.00 25.14 ? 83  LEU A CA    1 
ATOM   629  C C     . LEU A 1 83  ? 0.098   3.500   -2.264  1.00 25.67 ? 83  LEU A C     1 
ATOM   630  O O     . LEU A 1 83  ? -0.499  2.986   -3.203  1.00 25.60 ? 83  LEU A O     1 
ATOM   631  C CB    . LEU A 1 83  ? 1.967   5.042   -2.919  1.00 23.67 ? 83  LEU A CB    1 
ATOM   632  C CG    . LEU A 1 83  ? 2.480   6.415   -3.390  1.00 30.44 ? 83  LEU A CG    1 
ATOM   633  C CD1   . LEU A 1 83  ? 3.976   6.383   -3.742  1.00 28.65 ? 83  LEU A CD1   1 
ATOM   634  C CD2   . LEU A 1 83  ? 1.639   7.043   -4.553  1.00 27.53 ? 83  LEU A CD2   1 
ATOM   635  N N     . VAL A 1 84  ? 0.386   2.840   -1.142  1.00 25.77 ? 84  VAL A N     1 
ATOM   636  C CA    . VAL A 1 84  ? -0.115  1.488   -0.910  1.00 23.20 ? 84  VAL A CA    1 
ATOM   637  C C     . VAL A 1 84  ? -1.631  1.538   -0.681  1.00 25.39 ? 84  VAL A C     1 
ATOM   638  O O     . VAL A 1 84  ? -2.381  0.744   -1.270  1.00 25.22 ? 84  VAL A O     1 
ATOM   639  C CB    . VAL A 1 84  ? 0.624   0.786   0.266   1.00 24.07 ? 84  VAL A CB    1 
ATOM   640  C CG1   . VAL A 1 84  ? -0.085  -0.506  0.679   1.00 22.78 ? 84  VAL A CG1   1 
ATOM   641  C CG2   . VAL A 1 84  ? 2.100   0.499   -0.107  1.00 22.11 ? 84  VAL A CG2   1 
ATOM   642  N N     . ALA A 1 85  ? -2.084  2.478   0.153   1.00 24.98 ? 85  ALA A N     1 
ATOM   643  C CA    . ALA A 1 85  ? -3.519  2.596   0.476   1.00 25.79 ? 85  ALA A CA    1 
ATOM   644  C C     . ALA A 1 85  ? -4.394  2.927   -0.751  1.00 26.60 ? 85  ALA A C     1 
ATOM   645  O O     . ALA A 1 85  ? -5.539  2.484   -0.841  1.00 26.29 ? 85  ALA A O     1 
ATOM   646  C CB    . ALA A 1 85  ? -3.741  3.616   1.590   1.00 24.15 ? 85  ALA A CB    1 
ATOM   647  N N     . ASP A 1 86  ? -3.820  3.674   -1.699  1.00 27.68 ? 86  ASP A N     1 
ATOM   648  C CA    . ASP A 1 86  ? -4.546  4.199   -2.853  1.00 26.74 ? 86  ASP A CA    1 
ATOM   649  C C     . ASP A 1 86  ? -4.125  3.490   -4.137  1.00 27.17 ? 86  ASP A C     1 
ATOM   650  O O     . ASP A 1 86  ? -4.525  3.886   -5.222  1.00 27.76 ? 86  ASP A O     1 
ATOM   651  C CB    . ASP A 1 86  ? -4.260  5.685   -3.022  1.00 25.84 ? 86  ASP A CB    1 
ATOM   652  C CG    . ASP A 1 86  ? -4.839  6.551   -1.907  1.00 29.69 ? 86  ASP A CG    1 
ATOM   653  O OD1   . ASP A 1 86  ? -5.823  6.162   -1.218  1.00 26.32 ? 86  ASP A OD1   1 
ATOM   654  O OD2   . ASP A 1 86  ? -4.302  7.667   -1.745  1.00 28.05 ? 86  ASP A OD2   1 
ATOM   655  N N     . LEU A 1 87  ? -3.322  2.437   -4.002  1.00 27.60 ? 87  LEU A N     1 
ATOM   656  C CA    . LEU A 1 87  ? -2.796  1.682   -5.141  1.00 27.00 ? 87  LEU A CA    1 
ATOM   657  C C     . LEU A 1 87  ? -3.830  1.399   -6.226  1.00 27.02 ? 87  LEU A C     1 
ATOM   658  O O     . LEU A 1 87  ? -3.528  1.475   -7.404  1.00 28.46 ? 87  LEU A O     1 
ATOM   659  C CB    . LEU A 1 87  ? -2.178  0.371   -4.649  1.00 28.00 ? 87  LEU A CB    1 
ATOM   660  C CG    . LEU A 1 87  ? -1.370  -0.448  -5.646  1.00 28.36 ? 87  LEU A CG    1 
ATOM   661  C CD1   . LEU A 1 87  ? -0.199  0.384   -6.183  1.00 24.79 ? 87  LEU A CD1   1 
ATOM   662  C CD2   . LEU A 1 87  ? -0.901  -1.698  -4.967  1.00 28.68 ? 87  LEU A CD2   1 
ATOM   663  N N     . GLN A 1 88  ? -5.054  1.088   -5.818  1.00 27.55 ? 88  GLN A N     1 
ATOM   664  C CA    . GLN A 1 88  ? -6.153  0.802   -6.743  1.00 27.69 ? 88  GLN A CA    1 
ATOM   665  C C     . GLN A 1 88  ? -6.517  1.970   -7.675  1.00 26.61 ? 88  GLN A C     1 
ATOM   666  O O     . GLN A 1 88  ? -7.103  1.780   -8.740  1.00 26.62 ? 88  GLN A O     1 
ATOM   667  C CB    . GLN A 1 88  ? -7.370  0.332   -5.928  1.00 28.75 ? 88  GLN A CB    1 
ATOM   668  C CG    . GLN A 1 88  ? -8.724  0.868   -6.376  1.00 33.19 ? 88  GLN A CG    1 
ATOM   669  C CD    . GLN A 1 88  ? -9.754  0.866   -5.259  1.00 39.17 ? 88  GLN A CD    1 
ATOM   670  O OE1   . GLN A 1 88  ? -9.485  0.397   -4.153  1.00 46.00 ? 88  GLN A OE1   1 
ATOM   671  N NE2   . GLN A 1 88  ? -10.937 1.403   -5.541  1.00 37.43 ? 88  GLN A NE2   1 
ATOM   672  N N     . LEU A 1 89  ? -6.172  3.180   -7.267  1.00 26.52 ? 89  LEU A N     1 
ATOM   673  C CA    . LEU A 1 89  ? -6.575  4.370   -8.002  1.00 26.95 ? 89  LEU A CA    1 
ATOM   674  C C     . LEU A 1 89  ? -5.591  4.724   -9.107  1.00 26.97 ? 89  LEU A C     1 
ATOM   675  O O     . LEU A 1 89  ? -5.833  5.640   -9.898  1.00 25.95 ? 89  LEU A O     1 
ATOM   676  C CB    . LEU A 1 89  ? -6.673  5.547   -7.037  1.00 27.50 ? 89  LEU A CB    1 
ATOM   677  C CG    . LEU A 1 89  ? -7.562  5.338   -5.825  1.00 24.76 ? 89  LEU A CG    1 
ATOM   678  C CD1   . LEU A 1 89  ? -7.434  6.533   -4.900  1.00 22.01 ? 89  LEU A CD1   1 
ATOM   679  C CD2   . LEU A 1 89  ? -8.986  5.155   -6.302  1.00 24.55 ? 89  LEU A CD2   1 
ATOM   680  N N     . ILE A 1 90  ? -4.479  3.993   -9.142  1.00 26.38 ? 90  ILE A N     1 
ATOM   681  C CA    . ILE A 1 90  ? -3.363  4.305   -10.019 1.00 25.40 ? 90  ILE A CA    1 
ATOM   682  C C     . ILE A 1 90  ? -3.454  3.459   -11.299 1.00 25.84 ? 90  ILE A C     1 
ATOM   683  O O     . ILE A 1 90  ? -4.018  2.361   -11.284 1.00 26.24 ? 90  ILE A O     1 
ATOM   684  C CB    . ILE A 1 90  ? -2.009  4.153   -9.233  1.00 25.38 ? 90  ILE A CB    1 
ATOM   685  C CG1   . ILE A 1 90  ? -1.941  5.177   -8.075  1.00 25.44 ? 90  ILE A CG1   1 
ATOM   686  C CG2   . ILE A 1 90  ? -0.824  4.369   -10.122 1.00 21.48 ? 90  ILE A CG2   1 
ATOM   687  C CD1   . ILE A 1 90  ? -0.901  4.830   -6.985  1.00 24.81 ? 90  ILE A CD1   1 
ATOM   688  N N     . ASP A 1 91  ? -2.936  3.990   -12.407 1.00 26.33 ? 91  ASP A N     1 
ATOM   689  C CA    . ASP A 1 91  ? -2.914  3.286   -13.715 1.00 28.83 ? 91  ASP A CA    1 
ATOM   690  C C     . ASP A 1 91  ? -2.053  2.003   -13.702 1.00 28.80 ? 91  ASP A C     1 
ATOM   691  O O     . ASP A 1 91  ? -1.244  1.797   -12.790 1.00 31.99 ? 91  ASP A O     1 
ATOM   692  C CB    . ASP A 1 91  ? -2.471  4.240   -14.847 1.00 28.21 ? 91  ASP A CB    1 
ATOM   693  C CG    . ASP A 1 91  ? -1.012  4.743   -14.685 1.00 30.85 ? 91  ASP A CG    1 
ATOM   694  O OD1   . ASP A 1 91  ? -0.165  4.441   -15.550 1.00 39.31 ? 91  ASP A OD1   1 
ATOM   695  O OD2   . ASP A 1 91  ? -0.694  5.443   -13.703 1.00 37.20 ? 91  ASP A OD2   1 
ATOM   696  N N     . PHE A 1 92  ? -2.235  1.146   -14.704 1.00 27.70 ? 92  PHE A N     1 
ATOM   697  C CA    . PHE A 1 92  ? -1.498  -0.118  -14.799 1.00 25.95 ? 92  PHE A CA    1 
ATOM   698  C C     . PHE A 1 92  ? 0.016   0.011   -14.568 1.00 25.72 ? 92  PHE A C     1 
ATOM   699  O O     . PHE A 1 92  ? 0.595   -0.727  -13.777 1.00 26.77 ? 92  PHE A O     1 
ATOM   700  C CB    . PHE A 1 92  ? -1.763  -0.800  -16.151 1.00 25.55 ? 92  PHE A CB    1 
ATOM   701  C CG    . PHE A 1 92  ? -1.113  -2.167  -16.281 1.00 25.91 ? 92  PHE A CG    1 
ATOM   702  C CD1   . PHE A 1 92  ? -1.775  -3.311  -15.839 1.00 20.65 ? 92  PHE A CD1   1 
ATOM   703  C CD2   . PHE A 1 92  ? 0.166   -2.302  -16.835 1.00 24.36 ? 92  PHE A CD2   1 
ATOM   704  C CE1   . PHE A 1 92  ? -1.169  -4.567  -15.948 1.00 20.74 ? 92  PHE A CE1   1 
ATOM   705  C CE2   . PHE A 1 92  ? 0.782   -3.549  -16.941 1.00 21.75 ? 92  PHE A CE2   1 
ATOM   706  C CZ    . PHE A 1 92  ? 0.122   -4.680  -16.499 1.00 21.52 ? 92  PHE A CZ    1 
ATOM   707  N N     . GLU A 1 93  ? 0.643   0.938   -15.279 1.00 25.17 ? 93  GLU A N     1 
ATOM   708  C CA    . GLU A 1 93  ? 2.092   1.088   -15.264 1.00 24.96 ? 93  GLU A CA    1 
ATOM   709  C C     . GLU A 1 93  ? 2.598   1.831   -14.021 1.00 26.16 ? 93  GLU A C     1 
ATOM   710  O O     . GLU A 1 93  ? 3.713   1.582   -13.551 1.00 26.41 ? 93  GLU A O     1 
ATOM   711  C CB    . GLU A 1 93  ? 2.573   1.787   -16.542 1.00 25.28 ? 93  GLU A CB    1 
ATOM   712  C CG    . GLU A 1 93  ? 2.234   1.069   -17.868 1.00 24.39 ? 93  GLU A CG    1 
ATOM   713  C CD    . GLU A 1 93  ? 3.020   -0.237  -18.120 1.00 30.52 ? 93  GLU A CD    1 
ATOM   714  O OE1   . GLU A 1 93  ? 3.997   -0.541  -17.388 1.00 28.97 ? 93  GLU A OE1   1 
ATOM   715  O OE2   . GLU A 1 93  ? 2.651   -0.963  -19.080 1.00 31.45 ? 93  GLU A OE2   1 
ATOM   716  N N     . GLY A 1 94  ? 1.781   2.734   -13.488 1.00 25.97 ? 94  GLY A N     1 
ATOM   717  C CA    . GLY A 1 94  ? 2.088   3.409   -12.233 1.00 25.48 ? 94  GLY A CA    1 
ATOM   718  C C     . GLY A 1 94  ? 2.060   2.469   -11.040 1.00 27.62 ? 94  GLY A C     1 
ATOM   719  O O     . GLY A 1 94  ? 2.834   2.645   -10.096 1.00 29.53 ? 94  GLY A O     1 
ATOM   720  N N     . LYS A 1 95  ? 1.171   1.474   -11.074 1.00 26.58 ? 95  LYS A N     1 
ATOM   721  C CA    . LYS A 1 95  ? 1.106   0.459   -10.022 1.00 26.78 ? 95  LYS A CA    1 
ATOM   722  C C     . LYS A 1 95  ? 2.404   -0.328  -9.939  1.00 27.15 ? 95  LYS A C     1 
ATOM   723  O O     . LYS A 1 95  ? 2.840   -0.674  -8.845  1.00 28.72 ? 95  LYS A O     1 
ATOM   724  C CB    . LYS A 1 95  ? -0.039  -0.518  -10.253 1.00 25.87 ? 95  LYS A CB    1 
ATOM   725  C CG    . LYS A 1 95  ? -1.433  -0.067  -9.821  1.00 25.75 ? 95  LYS A CG    1 
ATOM   726  C CD    . LYS A 1 95  ? -2.421  -1.204  -10.158 1.00 26.72 ? 95  LYS A CD    1 
ATOM   727  C CE    . LYS A 1 95  ? -3.868  -0.813  -9.962  1.00 34.20 ? 95  LYS A CE    1 
ATOM   728  N NZ    . LYS A 1 95  ? -4.485  -0.281  -11.199 1.00 36.81 ? 95  LYS A NZ    1 
ATOM   729  N N     . LYS A 1 96  ? 2.985   -0.631  -11.103 1.00 27.49 ? 96  LYS A N     1 
ATOM   730  C CA    . LYS A 1 96  ? 4.286   -1.297  -11.214 1.00 25.83 ? 96  LYS A CA    1 
ATOM   731  C C     . LYS A 1 96  ? 5.411   -0.357  -10.781 1.00 26.77 ? 96  LYS A C     1 
ATOM   732  O O     . LYS A 1 96  ? 6.396   -0.791  -10.181 1.00 29.03 ? 96  LYS A O     1 
ATOM   733  C CB    . LYS A 1 96  ? 4.545   -1.750  -12.657 1.00 25.55 ? 96  LYS A CB    1 
ATOM   734  C CG    . LYS A 1 96  ? 3.738   -2.946  -13.135 1.00 24.85 ? 96  LYS A CG    1 
ATOM   735  C CD    . LYS A 1 96  ? 3.660   -3.005  -14.666 1.00 23.14 ? 96  LYS A CD    1 
ATOM   736  C CE    . LYS A 1 96  ? 5.032   -3.073  -15.308 1.00 24.01 ? 96  LYS A CE    1 
ATOM   737  N NZ    . LYS A 1 96  ? 4.978   -3.232  -16.796 1.00 22.28 ? 96  LYS A NZ    1 
ATOM   738  N N     . ASP A 1 97  ? 5.284   0.923   -11.124 1.00 26.41 ? 97  ASP A N     1 
ATOM   739  C CA    . ASP A 1 97  ? 6.194   1.961   -10.604 1.00 25.61 ? 97  ASP A CA    1 
ATOM   740  C C     . ASP A 1 97  ? 6.170   2.104   -9.073  1.00 24.89 ? 97  ASP A C     1 
ATOM   741  O O     . ASP A 1 97  ? 7.220   2.251   -8.450  1.00 25.37 ? 97  ASP A O     1 
ATOM   742  C CB    . ASP A 1 97  ? 5.947   3.304   -11.291 1.00 25.04 ? 97  ASP A CB    1 
ATOM   743  C CG    . ASP A 1 97  ? 6.410   3.303   -12.741 1.00 28.72 ? 97  ASP A CG    1 
ATOM   744  O OD1   . ASP A 1 97  ? 7.123   2.358   -13.134 1.00 31.35 ? 97  ASP A OD1   1 
ATOM   745  O OD2   . ASP A 1 97  ? 6.070   4.235   -13.500 1.00 33.67 ? 97  ASP A OD2   1 
ATOM   746  N N     . VAL A 1 98  ? 4.989   2.033   -8.461  1.00 24.40 ? 98  VAL A N     1 
ATOM   747  C CA    . VAL A 1 98  ? 4.917   2.072   -7.003  1.00 23.61 ? 98  VAL A CA    1 
ATOM   748  C C     . VAL A 1 98  ? 5.725   0.921   -6.403  1.00 23.49 ? 98  VAL A C     1 
ATOM   749  O O     . VAL A 1 98  ? 6.574   1.151   -5.545  1.00 24.62 ? 98  VAL A O     1 
ATOM   750  C CB    . VAL A 1 98  ? 3.467   2.095   -6.478  1.00 25.39 ? 98  VAL A CB    1 
ATOM   751  C CG1   . VAL A 1 98  ? 3.427   1.883   -4.947  1.00 24.93 ? 98  VAL A CG1   1 
ATOM   752  C CG2   . VAL A 1 98  ? 2.803   3.412   -6.857  1.00 22.63 ? 98  VAL A CG2   1 
ATOM   753  N N     . ALA A 1 99  ? 5.478   -0.300  -6.874  1.00 22.76 ? 99  ALA A N     1 
ATOM   754  C CA    . ALA A 1 99  ? 6.239   -1.484  -6.453  1.00 23.43 ? 99  ALA A CA    1 
ATOM   755  C C     . ALA A 1 99  ? 7.749   -1.292  -6.552  1.00 24.77 ? 99  ALA A C     1 
ATOM   756  O O     . ALA A 1 99  ? 8.463   -1.556  -5.598  1.00 26.43 ? 99  ALA A O     1 
ATOM   757  C CB    . ALA A 1 99  ? 5.804   -2.717  -7.234  1.00 20.00 ? 99  ALA A CB    1 
ATOM   758  N N     . GLN A 1 100 ? 8.227   -0.799  -7.692  1.00 25.87 ? 100 GLN A N     1 
ATOM   759  C CA    . GLN A 1 100 ? 9.662   -0.588  -7.899  1.00 27.37 ? 100 GLN A CA    1 
ATOM   760  C C     . GLN A 1 100 ? 10.267  0.459   -6.962  1.00 26.55 ? 100 GLN A C     1 
ATOM   761  O O     . GLN A 1 100 ? 11.327  0.215   -6.374  1.00 25.15 ? 100 GLN A O     1 
ATOM   762  C CB    . GLN A 1 100 ? 9.959   -0.263  -9.367  1.00 27.74 ? 100 GLN A CB    1 
ATOM   763  C CG    . GLN A 1 100 ? 9.919   -1.487  -10.267 1.00 33.02 ? 100 GLN A CG    1 
ATOM   764  C CD    . GLN A 1 100 ? 9.320   -1.194  -11.643 1.00 45.28 ? 100 GLN A CD    1 
ATOM   765  O OE1   . GLN A 1 100 ? 9.158   -0.032  -12.038 1.00 46.99 ? 100 GLN A OE1   1 
ATOM   766  N NE2   . GLN A 1 100 ? 8.984   -2.256  -12.380 1.00 49.00 ? 100 GLN A NE2   1 
ATOM   767  N N     . ILE A 1 101 ? 9.597   1.610   -6.842  1.00 26.62 ? 101 ILE A N     1 
ATOM   768  C CA    . ILE A 1 101 ? 9.966   2.678   -5.893  1.00 27.71 ? 101 ILE A CA    1 
ATOM   769  C C     . ILE A 1 101 ? 10.042  2.176   -4.436  1.00 27.97 ? 101 ILE A C     1 
ATOM   770  O O     . ILE A 1 101 ? 11.014  2.431   -3.719  1.00 27.95 ? 101 ILE A O     1 
ATOM   771  C CB    . ILE A 1 101 ? 8.976   3.887   -5.989  1.00 29.73 ? 101 ILE A CB    1 
ATOM   772  C CG1   . ILE A 1 101 ? 9.095   4.567   -7.358  1.00 28.08 ? 101 ILE A CG1   1 
ATOM   773  C CG2   . ILE A 1 101 ? 9.210   4.909   -4.842  1.00 28.31 ? 101 ILE A CG2   1 
ATOM   774  C CD1   . ILE A 1 101 ? 7.889   5.374   -7.768  1.00 25.59 ? 101 ILE A CD1   1 
ATOM   775  N N     . PHE A 1 102 ? 9.018   1.433   -4.040  1.00 27.75 ? 102 PHE A N     1 
ATOM   776  C CA    . PHE A 1 102 ? 8.875   0.895   -2.701  1.00 28.93 ? 102 PHE A CA    1 
ATOM   777  C C     . PHE A 1 102 ? 9.995   -0.078  -2.390  1.00 29.67 ? 102 PHE A C     1 
ATOM   778  O O     . PHE A 1 102 ? 10.633  0.021   -1.341  1.00 29.79 ? 102 PHE A O     1 
ATOM   779  C CB    . PHE A 1 102 ? 7.531   0.175   -2.610  1.00 30.39 ? 102 PHE A CB    1 
ATOM   780  C CG    . PHE A 1 102 ? 7.089   -0.128  -1.221  1.00 29.97 ? 102 PHE A CG    1 
ATOM   781  C CD1   . PHE A 1 102 ? 7.485   -1.299  -0.597  1.00 25.13 ? 102 PHE A CD1   1 
ATOM   782  C CD2   . PHE A 1 102 ? 6.241   0.746   -0.552  1.00 30.93 ? 102 PHE A CD2   1 
ATOM   783  C CE1   . PHE A 1 102 ? 7.076   -1.588  0.684   1.00 25.47 ? 102 PHE A CE1   1 
ATOM   784  C CE2   . PHE A 1 102 ? 5.818   0.464   0.735   1.00 32.11 ? 102 PHE A CE2   1 
ATOM   785  C CZ    . PHE A 1 102 ? 6.234   -0.710  1.353   1.00 31.96 ? 102 PHE A CZ    1 
ATOM   786  N N     . ASN A 1 103 ? 10.218  -1.016  -3.311  1.00 29.92 ? 103 ASN A N     1 
ATOM   787  C CA    . ASN A 1 103 ? 11.255  -2.033  -3.186  1.00 30.31 ? 103 ASN A CA    1 
ATOM   788  C C     . ASN A 1 103 ? 12.646  -1.431  -3.062  1.00 29.67 ? 103 ASN A C     1 
ATOM   789  O O     . ASN A 1 103 ? 13.468  -1.925  -2.299  1.00 30.44 ? 103 ASN A O     1 
ATOM   790  C CB    . ASN A 1 103 ? 11.227  -2.986  -4.385  1.00 30.36 ? 103 ASN A CB    1 
ATOM   791  C CG    . ASN A 1 103 ? 10.057  -3.978  -4.340  1.00 35.98 ? 103 ASN A CG    1 
ATOM   792  O OD1   . ASN A 1 103 ? 9.113   -3.845  -3.537  1.00 35.11 ? 103 ASN A OD1   1 
ATOM   793  N ND2   . ASN A 1 103 ? 10.120  -4.987  -5.217  1.00 35.89 ? 103 ASN A ND2   1 
ATOM   794  N N     . ASN A 1 104 ? 12.902  -0.366  -3.819  1.00 28.55 ? 104 ASN A N     1 
ATOM   795  C CA    . ASN A 1 104 ? 14.210  0.285   -3.825  1.00 26.39 ? 104 ASN A CA    1 
ATOM   796  C C     . ASN A 1 104 ? 14.504  1.059   -2.533  1.00 24.94 ? 104 ASN A C     1 
ATOM   797  O O     . ASN A 1 104 ? 15.612  0.990   -1.999  1.00 25.09 ? 104 ASN A O     1 
ATOM   798  C CB    . ASN A 1 104 ? 14.345  1.188   -5.055  1.00 25.74 ? 104 ASN A CB    1 
ATOM   799  C CG    . ASN A 1 104 ? 15.671  1.917   -5.099  1.00 25.96 ? 104 ASN A CG    1 
ATOM   800  O OD1   . ASN A 1 104 ? 15.862  2.922   -4.403  1.00 24.87 ? 104 ASN A OD1   1 
ATOM   801  N ND2   . ASN A 1 104 ? 16.597  1.423   -5.924  1.00 20.75 ? 104 ASN A ND2   1 
ATOM   802  N N     . ILE A 1 105 ? 13.510  1.799   -2.054  1.00 24.97 ? 105 ILE A N     1 
ATOM   803  C CA    . ILE A 1 105 ? 13.573  2.487   -0.761  1.00 26.00 ? 105 ILE A CA    1 
ATOM   804  C C     . ILE A 1 105 ? 13.812  1.478   0.373   1.00 24.52 ? 105 ILE A C     1 
ATOM   805  O O     . ILE A 1 105 ? 14.666  1.682   1.229   1.00 23.13 ? 105 ILE A O     1 
ATOM   806  C CB    . ILE A 1 105 ? 12.257  3.291   -0.497  1.00 26.32 ? 105 ILE A CB    1 
ATOM   807  C CG1   . ILE A 1 105 ? 12.094  4.435   -1.507  1.00 28.98 ? 105 ILE A CG1   1 
ATOM   808  C CG2   . ILE A 1 105 ? 12.175  3.807   0.947   1.00 26.96 ? 105 ILE A CG2   1 
ATOM   809  C CD1   . ILE A 1 105 ? 13.071  5.580   -1.370  1.00 29.56 ? 105 ILE A CD1   1 
ATOM   810  N N     . LEU A 1 106 ? 13.055  0.386   0.340   1.00 23.90 ? 106 LEU A N     1 
ATOM   811  C CA    . LEU A 1 106 ? 13.104  -0.666  1.347   1.00 25.36 ? 106 LEU A CA    1 
ATOM   812  C C     . LEU A 1 106 ? 14.482  -1.307  1.487   1.00 25.55 ? 106 LEU A C     1 
ATOM   813  O O     . LEU A 1 106 ? 14.886  -1.670  2.595   1.00 25.64 ? 106 LEU A O     1 
ATOM   814  C CB    . LEU A 1 106 ? 12.036  -1.720  1.022   1.00 25.61 ? 106 LEU A CB    1 
ATOM   815  C CG    . LEU A 1 106 ? 11.473  -2.767  1.982   1.00 25.73 ? 106 LEU A CG    1 
ATOM   816  C CD1   . LEU A 1 106 ? 11.151  -2.224  3.347   1.00 24.20 ? 106 LEU A CD1   1 
ATOM   817  C CD2   . LEU A 1 106 ? 10.226  -3.329  1.353   1.00 27.34 ? 106 LEU A CD2   1 
ATOM   818  N N     . ARG A 1 107 ? 15.199  -1.429  0.369   1.00 25.88 ? 107 ARG A N     1 
ATOM   819  C CA    . ARG A 1 107 ? 16.554  -1.986  0.361   1.00 27.12 ? 107 ARG A CA    1 
ATOM   820  C C     . ARG A 1 107 ? 17.584  -0.962  0.806   1.00 26.51 ? 107 ARG A C     1 
ATOM   821  O O     . ARG A 1 107 ? 18.757  -1.293  0.958   1.00 25.44 ? 107 ARG A O     1 
ATOM   822  C CB    . ARG A 1 107 ? 16.940  -2.497  -1.033  1.00 27.68 ? 107 ARG A CB    1 
ATOM   823  C CG    . ARG A 1 107 ? 16.213  -3.748  -1.465  1.00 32.31 ? 107 ARG A CG    1 
ATOM   824  C CD    . ARG A 1 107 ? 16.929  -4.432  -2.620  1.00 37.64 ? 107 ARG A CD    1 
ATOM   825  N NE    . ARG A 1 107 ? 16.301  -5.715  -2.954  1.00 42.01 ? 107 ARG A NE    1 
ATOM   826  C CZ    . ARG A 1 107 ? 16.837  -6.917  -2.738  1.00 41.48 ? 107 ARG A CZ    1 
ATOM   827  N NH1   . ARG A 1 107 ? 18.047  -7.044  -2.192  1.00 42.47 ? 107 ARG A NH1   1 
ATOM   828  N NH2   . ARG A 1 107 ? 16.158  -8.001  -3.086  1.00 40.98 ? 107 ARG A NH2   1 
ATOM   829  N N     . ARG A 1 108 ? 17.144  0.283   0.992   1.00 27.62 ? 108 ARG A N     1 
ATOM   830  C CA    . ARG A 1 108 ? 18.050  1.385   1.312   1.00 28.16 ? 108 ARG A CA    1 
ATOM   831  C C     . ARG A 1 108 ? 18.690  1.113   2.663   1.00 29.30 ? 108 ARG A C     1 
ATOM   832  O O     . ARG A 1 108 ? 18.022  0.685   3.614   1.00 29.47 ? 108 ARG A O     1 
ATOM   833  C CB    . ARG A 1 108 ? 17.311  2.725   1.298   1.00 28.17 ? 108 ARG A CB    1 
ATOM   834  C CG    . ARG A 1 108 ? 18.188  3.944   1.410   1.00 28.68 ? 108 ARG A CG    1 
ATOM   835  C CD    . ARG A 1 108 ? 17.351  5.205   1.351   1.00 31.08 ? 108 ARG A CD    1 
ATOM   836  N NE    . ARG A 1 108 ? 17.939  6.298   2.123   1.00 32.36 ? 108 ARG A NE    1 
ATOM   837  C CZ    . ARG A 1 108 ? 18.906  7.102   1.685   1.00 34.35 ? 108 ARG A CZ    1 
ATOM   838  N NH1   . ARG A 1 108 ? 19.416  6.946   0.470   1.00 35.87 ? 108 ARG A NH1   1 
ATOM   839  N NH2   . ARG A 1 108 ? 19.370  8.068   2.468   1.00 33.91 ? 108 ARG A NH2   1 
ATOM   840  N N     . GLN A 1 109 ? 19.995  1.337   2.725   1.00 30.07 ? 109 GLN A N     1 
ATOM   841  C CA    . GLN A 1 109 ? 20.791  0.887   3.844   1.00 31.98 ? 109 GLN A CA    1 
ATOM   842  C C     . GLN A 1 109 ? 21.873  1.919   4.153   1.00 32.00 ? 109 GLN A C     1 
ATOM   843  O O     . GLN A 1 109 ? 22.805  2.101   3.374   1.00 31.65 ? 109 GLN A O     1 
ATOM   844  C CB    . GLN A 1 109 ? 21.397  -0.473  3.496   1.00 31.69 ? 109 GLN A CB    1 
ATOM   845  C CG    . GLN A 1 109 ? 22.045  -1.216  4.637   1.00 33.42 ? 109 GLN A CG    1 
ATOM   846  C CD    . GLN A 1 109 ? 22.582  -2.561  4.194   1.00 33.63 ? 109 GLN A CD    1 
ATOM   847  O OE1   . GLN A 1 109 ? 21.814  -3.479  3.904   1.00 33.69 ? 109 GLN A OE1   1 
ATOM   848  N NE2   . GLN A 1 109 ? 23.911  -2.683  4.131   1.00 32.65 ? 109 GLN A NE2   1 
ATOM   849  N N     . ILE A 1 110 ? 21.712  2.607   5.282   1.00 33.42 ? 110 ILE A N     1 
ATOM   850  C CA    . ILE A 1 110 ? 22.703  3.559   5.792   1.00 34.74 ? 110 ILE A CA    1 
ATOM   851  C C     . ILE A 1 110 ? 23.513  2.867   6.892   1.00 34.95 ? 110 ILE A C     1 
ATOM   852  O O     . ILE A 1 110 ? 23.037  2.702   8.024   1.00 35.09 ? 110 ILE A O     1 
ATOM   853  C CB    . ILE A 1 110 ? 22.038  4.867   6.325   1.00 34.83 ? 110 ILE A CB    1 
ATOM   854  C CG1   . ILE A 1 110 ? 21.162  5.510   5.239   1.00 36.42 ? 110 ILE A CG1   1 
ATOM   855  C CG2   . ILE A 1 110 ? 23.103  5.858   6.835   1.00 35.48 ? 110 ILE A CG2   1 
ATOM   856  C CD1   . ILE A 1 110 ? 20.101  6.480   5.760   1.00 35.88 ? 110 ILE A CD1   1 
ATOM   857  N N     . GLY A 1 111 ? 24.731  2.454   6.542   1.00 35.03 ? 111 GLY A N     1 
ATOM   858  C CA    . GLY A 1 111 ? 25.570  1.652   7.431   1.00 35.36 ? 111 GLY A CA    1 
ATOM   859  C C     . GLY A 1 111 ? 25.009  0.253   7.614   1.00 35.37 ? 111 GLY A C     1 
ATOM   860  O O     . GLY A 1 111 ? 24.697  -0.437  6.639   1.00 35.85 ? 111 GLY A O     1 
ATOM   861  N N     . THR A 1 112 ? 24.877  -0.163  8.870   1.00 35.35 ? 112 THR A N     1 
ATOM   862  C CA    . THR A 1 112 ? 24.252  -1.444  9.200   1.00 34.88 ? 112 THR A CA    1 
ATOM   863  C C     . THR A 1 112 ? 22.737  -1.289  9.227   1.00 34.16 ? 112 THR A C     1 
ATOM   864  O O     . THR A 1 112 ? 22.001  -2.258  9.036   1.00 34.09 ? 112 THR A O     1 
ATOM   865  C CB    . THR A 1 112 ? 24.723  -1.973  10.568  1.00 34.97 ? 112 THR A CB    1 
ATOM   866  O OG1   . THR A 1 112 ? 26.089  -1.598  10.783  1.00 34.72 ? 112 THR A OG1   1 
ATOM   867  C CG2   . THR A 1 112 ? 24.596  -3.497  10.630  1.00 35.04 ? 112 THR A CG2   1 
ATOM   868  N N     . ARG A 1 113 ? 22.290  -0.057  9.456   1.00 33.38 ? 113 ARG A N     1 
ATOM   869  C CA    . ARG A 1 113 ? 20.872  0.258   9.603   1.00 32.85 ? 113 ARG A CA    1 
ATOM   870  C C     . ARG A 1 113 ? 20.079  0.157   8.299   1.00 32.21 ? 113 ARG A C     1 
ATOM   871  O O     . ARG A 1 113 ? 20.614  0.300   7.195   1.00 31.47 ? 113 ARG A O     1 
ATOM   872  C CB    . ARG A 1 113 ? 20.699  1.654   10.187  1.00 32.65 ? 113 ARG A CB    1 
ATOM   873  C CG    . ARG A 1 113 ? 21.169  1.825   11.627  1.00 34.38 ? 113 ARG A CG    1 
ATOM   874  C CD    . ARG A 1 113 ? 20.987  3.274   12.042  1.00 35.48 ? 113 ARG A CD    1 
ATOM   875  N NE    . ARG A 1 113 ? 19.734  3.810   11.504  1.00 36.80 ? 113 ARG A NE    1 
ATOM   876  C CZ    . ARG A 1 113 ? 19.172  4.956   11.874  1.00 37.31 ? 113 ARG A CZ    1 
ATOM   877  N NH1   . ARG A 1 113 ? 19.737  5.711   12.803  1.00 35.05 ? 113 ARG A NH1   1 
ATOM   878  N NH2   . ARG A 1 113 ? 18.034  5.342   11.312  1.00 39.01 ? 113 ARG A NH2   1 
ATOM   879  N N     . THR A 1 114 ? 18.787  -0.088  8.447   1.00 31.20 ? 114 THR A N     1 
ATOM   880  C CA    . THR A 1 114 ? 17.902  -0.188  7.302   1.00 31.17 ? 114 THR A CA    1 
ATOM   881  C C     . THR A 1 114 ? 16.637  0.648   7.599   1.00 29.94 ? 114 THR A C     1 
ATOM   882  O O     . THR A 1 114 ? 15.656  0.147   8.151   1.00 29.01 ? 114 THR A O     1 
ATOM   883  C CB    . THR A 1 114 ? 17.671  -1.683  6.893   1.00 30.70 ? 114 THR A CB    1 
ATOM   884  O OG1   . THR A 1 114 ? 16.763  -1.763  5.792   1.00 33.44 ? 114 THR A OG1   1 
ATOM   885  C CG2   . THR A 1 114 ? 17.168  -2.524  8.067   1.00 33.18 ? 114 THR A CG2   1 
ATOM   886  N N     . PRO A 1 115 ? 16.692  1.954   7.258   1.00 29.19 ? 115 PRO A N     1 
ATOM   887  C CA    . PRO A 1 115 ? 15.740  2.982   7.704   1.00 28.72 ? 115 PRO A CA    1 
ATOM   888  C C     . PRO A 1 115 ? 14.265  2.782   7.330   1.00 28.41 ? 115 PRO A C     1 
ATOM   889  O O     . PRO A 1 115 ? 13.382  3.301   8.020   1.00 28.37 ? 115 PRO A O     1 
ATOM   890  C CB    . PRO A 1 115 ? 16.279  4.263   7.058   1.00 28.65 ? 115 PRO A CB    1 
ATOM   891  C CG    . PRO A 1 115 ? 17.686  3.970   6.744   1.00 27.87 ? 115 PRO A CG    1 
ATOM   892  C CD    . PRO A 1 115 ? 17.741  2.532   6.402   1.00 28.16 ? 115 PRO A CD    1 
ATOM   893  N N     . THR A 1 116 ? 13.995  2.048   6.256   1.00 27.71 ? 116 THR A N     1 
ATOM   894  C CA    . THR A 1 116 ? 12.632  1.902   5.780   1.00 26.07 ? 116 THR A CA    1 
ATOM   895  C C     . THR A 1 116 ? 11.935  0.859   6.627   1.00 27.10 ? 116 THR A C     1 
ATOM   896  O O     . THR A 1 116 ? 10.737  0.968   6.889   1.00 27.73 ? 116 THR A O     1 
ATOM   897  C CB    . THR A 1 116 ? 12.594  1.532   4.284   1.00 26.43 ? 116 THR A CB    1 
ATOM   898  O OG1   . THR A 1 116 ? 13.293  2.533   3.544   1.00 25.79 ? 116 THR A OG1   1 
ATOM   899  C CG2   . THR A 1 116 ? 11.153  1.432   3.751   1.00 24.47 ? 116 THR A CG2   1 
ATOM   900  N N     . VAL A 1 117 ? 12.697  -0.147  7.054   1.00 27.17 ? 117 VAL A N     1 
ATOM   901  C CA    . VAL A 1 117 ? 12.206  -1.173  7.963   1.00 26.33 ? 117 VAL A CA    1 
ATOM   902  C C     . VAL A 1 117 ? 11.761  -0.505  9.253   1.00 26.86 ? 117 VAL A C     1 
ATOM   903  O O     . VAL A 1 117 ? 10.652  -0.754  9.730   1.00 27.44 ? 117 VAL A O     1 
ATOM   904  C CB    . VAL A 1 117 ? 13.285  -2.251  8.254   1.00 27.69 ? 117 VAL A CB    1 
ATOM   905  C CG1   . VAL A 1 117 ? 12.749  -3.341  9.219   1.00 23.72 ? 117 VAL A CG1   1 
ATOM   906  C CG2   . VAL A 1 117 ? 13.770  -2.878  6.951   1.00 27.23 ? 117 VAL A CG2   1 
ATOM   907  N N     . GLU A 1 118 ? 12.631  0.347   9.797   1.00 26.85 ? 118 GLU A N     1 
ATOM   908  C CA    . GLU A 1 118 ? 12.340  1.153   10.981  1.00 27.49 ? 118 GLU A CA    1 
ATOM   909  C C     . GLU A 1 118 ? 11.026  1.923   10.802  1.00 28.56 ? 118 GLU A C     1 
ATOM   910  O O     . GLU A 1 118 ? 10.193  1.979   11.717  1.00 28.68 ? 118 GLU A O     1 
ATOM   911  C CB    . GLU A 1 118 ? 13.507  2.122   11.276  1.00 26.13 ? 118 GLU A CB    1 
ATOM   912  C CG    . GLU A 1 118 ? 14.849  1.416   11.524  1.00 25.38 ? 118 GLU A CG    1 
ATOM   913  C CD    . GLU A 1 118 ? 16.077  2.339   11.535  1.00 27.72 ? 118 GLU A CD    1 
ATOM   914  O OE1   . GLU A 1 118 ? 15.937  3.586   11.509  1.00 23.94 ? 118 GLU A OE1   1 
ATOM   915  O OE2   . GLU A 1 118 ? 17.208  1.798   11.575  1.00 27.83 ? 118 GLU A OE2   1 
ATOM   916  N N     . TYR A 1 119 ? 10.842  2.497   9.614   1.00 28.65 ? 119 TYR A N     1 
ATOM   917  C CA    . TYR A 1 119 ? 9.681   3.324   9.336   1.00 28.98 ? 119 TYR A CA    1 
ATOM   918  C C     . TYR A 1 119 ? 8.405   2.482   9.246   1.00 29.41 ? 119 TYR A C     1 
ATOM   919  O O     . TYR A 1 119 ? 7.360   2.881   9.751   1.00 30.16 ? 119 TYR A O     1 
ATOM   920  C CB    . TYR A 1 119 ? 9.900   4.148   8.066   1.00 29.16 ? 119 TYR A CB    1 
ATOM   921  C CG    . TYR A 1 119 ? 8.665   4.877   7.576   1.00 30.87 ? 119 TYR A CG    1 
ATOM   922  C CD1   . TYR A 1 119 ? 8.341   6.146   8.061   1.00 30.65 ? 119 TYR A CD1   1 
ATOM   923  C CD2   . TYR A 1 119 ? 7.813   4.293   6.624   1.00 25.22 ? 119 TYR A CD2   1 
ATOM   924  C CE1   . TYR A 1 119 ? 7.195   6.820   7.610   1.00 30.36 ? 119 TYR A CE1   1 
ATOM   925  C CE2   . TYR A 1 119 ? 6.674   4.955   6.174   1.00 27.13 ? 119 TYR A CE2   1 
ATOM   926  C CZ    . TYR A 1 119 ? 6.374   6.216   6.668   1.00 29.58 ? 119 TYR A CZ    1 
ATOM   927  O OH    . TYR A 1 119 ? 5.248   6.871   6.220   1.00 34.91 ? 119 TYR A OH    1 
ATOM   928  N N     . ILE A 1 120 ? 8.486   1.316   8.612   1.00 29.34 ? 120 ILE A N     1 
ATOM   929  C CA    . ILE A 1 120 ? 7.309   0.451   8.509   1.00 28.35 ? 120 ILE A CA    1 
ATOM   930  C C     . ILE A 1 120 ? 6.899   -0.125  9.871   1.00 28.55 ? 120 ILE A C     1 
ATOM   931  O O     . ILE A 1 120 ? 5.732   -0.457  10.075  1.00 28.37 ? 120 ILE A O     1 
ATOM   932  C CB    . ILE A 1 120 ? 7.468   -0.638  7.429   1.00 27.27 ? 120 ILE A CB    1 
ATOM   933  C CG1   . ILE A 1 120 ? 7.596   0.029   6.059   1.00 27.04 ? 120 ILE A CG1   1 
ATOM   934  C CG2   . ILE A 1 120 ? 6.259   -1.568  7.419   1.00 24.65 ? 120 ILE A CG2   1 
ATOM   935  C CD1   . ILE A 1 120 ? 8.086   -0.879  4.976   1.00 27.62 ? 120 ILE A CD1   1 
ATOM   936  N N     . CYS A 1 121 ? 7.850   -0.210  10.800  1.00 28.53 ? 121 CYS A N     1 
ATOM   937  C CA    . CYS A 1 121 ? 7.552   -0.658  12.163  1.00 29.42 ? 121 CYS A CA    1 
ATOM   938  C C     . CYS A 1 121 ? 6.725   0.377   12.914  1.00 29.72 ? 121 CYS A C     1 
ATOM   939  O O     . CYS A 1 121 ? 5.978   0.034   13.823  1.00 31.14 ? 121 CYS A O     1 
ATOM   940  C CB    . CYS A 1 121 ? 8.827   -1.011  12.931  1.00 28.68 ? 121 CYS A CB    1 
ATOM   941  S SG    . CYS A 1 121 ? 9.581   -2.585  12.404  1.00 30.43 ? 121 CYS A SG    1 
ATOM   942  N N     . THR A 1 122 ? 6.849   1.641   12.519  1.00 29.75 ? 122 THR A N     1 
ATOM   943  C CA    . THR A 1 122 ? 6.003   2.693   13.069  1.00 30.35 ? 122 THR A CA    1 
ATOM   944  C C     . THR A 1 122 ? 4.695   2.796   12.267  1.00 30.98 ? 122 THR A C     1 
ATOM   945  O O     . THR A 1 122 ? 3.732   3.415   12.713  1.00 32.60 ? 122 THR A O     1 
ATOM   946  C CB    . THR A 1 122 ? 6.740   4.082   13.149  1.00 30.40 ? 122 THR A CB    1 
ATOM   947  O OG1   . THR A 1 122 ? 6.755   4.718   11.862  1.00 32.66 ? 122 THR A OG1   1 
ATOM   948  C CG2   . THR A 1 122 ? 8.173   3.924   13.654  1.00 27.33 ? 122 THR A CG2   1 
ATOM   949  N N     . GLN A 1 123 ? 4.657   2.161   11.100  1.00 30.90 ? 123 GLN A N     1 
ATOM   950  C CA    . GLN A 1 123 ? 3.513   2.274   10.205  1.00 32.25 ? 123 GLN A CA    1 
ATOM   951  C C     . GLN A 1 123 ? 3.092   0.906   9.673   1.00 31.71 ? 123 GLN A C     1 
ATOM   952  O O     . GLN A 1 123 ? 3.162   0.644   8.468   1.00 32.88 ? 123 GLN A O     1 
ATOM   953  C CB    . GLN A 1 123 ? 3.862   3.225   9.056   1.00 32.79 ? 123 GLN A CB    1 
ATOM   954  C CG    . GLN A 1 123 ? 2.696   4.036   8.535   1.00 35.87 ? 123 GLN A CG    1 
ATOM   955  C CD    . GLN A 1 123 ? 2.214   5.068   9.516   1.00 37.29 ? 123 GLN A CD    1 
ATOM   956  O OE1   . GLN A 1 123 ? 2.999   5.841   10.065  1.00 39.40 ? 123 GLN A OE1   1 
ATOM   957  N NE2   . GLN A 1 123 ? 0.908   5.093   9.743   1.00 39.76 ? 123 GLN A NE2   1 
ATOM   958  N N     . GLN A 1 124 ? 2.651   0.039   10.583  1.00 30.52 ? 124 GLN A N     1 
ATOM   959  C CA    . GLN A 1 124 ? 2.466   -1.391  10.289  1.00 29.51 ? 124 GLN A CA    1 
ATOM   960  C C     . GLN A 1 124 ? 1.289   -1.769  9.403   1.00 29.49 ? 124 GLN A C     1 
ATOM   961  O O     . GLN A 1 124 ? 1.302   -2.835  8.797   1.00 30.62 ? 124 GLN A O     1 
ATOM   962  C CB    . GLN A 1 124 ? 2.419   -2.191  11.582  1.00 29.24 ? 124 GLN A CB    1 
ATOM   963  C CG    . GLN A 1 124 ? 3.678   -2.068  12.406  1.00 29.31 ? 124 GLN A CG    1 
ATOM   964  C CD    . GLN A 1 124 ? 3.593   -2.822  13.703  1.00 33.74 ? 124 GLN A CD    1 
ATOM   965  O OE1   . GLN A 1 124 ? 2.617   -3.539  13.954  1.00 32.62 ? 124 GLN A OE1   1 
ATOM   966  N NE2   . GLN A 1 124 ? 4.616   -2.666  14.548  1.00 32.30 ? 124 GLN A NE2   1 
ATOM   967  N N     . ASN A 1 125 ? 0.280   -0.907  9.316   1.00 30.35 ? 125 ASN A N     1 
ATOM   968  C CA    . ASN A 1 125 ? -0.883  -1.169  8.456   1.00 30.08 ? 125 ASN A CA    1 
ATOM   969  C C     . ASN A 1 125 ? -0.513  -1.255  6.980   1.00 30.84 ? 125 ASN A C     1 
ATOM   970  O O     . ASN A 1 125 ? -1.258  -1.830  6.189   1.00 33.35 ? 125 ASN A O     1 
ATOM   971  C CB    . ASN A 1 125 ? -2.001  -0.137  8.690   1.00 30.17 ? 125 ASN A CB    1 
ATOM   972  C CG    . ASN A 1 125 ? -3.348  -0.578  8.099   1.00 33.16 ? 125 ASN A CG    1 
ATOM   973  O OD1   . ASN A 1 125 ? -3.768  -1.733  8.248   1.00 37.86 ? 125 ASN A OD1   1 
ATOM   974  N ND2   . ASN A 1 125 ? -4.021  0.341   7.421   1.00 30.52 ? 125 ASN A ND2   1 
ATOM   975  N N     . ILE A 1 126 ? 0.646   -0.704  6.609   1.00 31.47 ? 126 ILE A N     1 
ATOM   976  C CA    . ILE A 1 126 ? 1.194   -0.883  5.255   1.00 30.06 ? 126 ILE A CA    1 
ATOM   977  C C     . ILE A 1 126 ? 1.244   -2.370  4.905   1.00 30.29 ? 126 ILE A C     1 
ATOM   978  O O     . ILE A 1 126 ? 0.719   -2.776  3.858   1.00 31.89 ? 126 ILE A O     1 
ATOM   979  C CB    . ILE A 1 126 ? 2.596   -0.222  5.083   1.00 31.22 ? 126 ILE A CB    1 
ATOM   980  C CG1   . ILE A 1 126 ? 2.467   1.300   5.007   1.00 28.70 ? 126 ILE A CG1   1 
ATOM   981  C CG2   . ILE A 1 126 ? 3.325   -0.771  3.836   1.00 28.10 ? 126 ILE A CG2   1 
ATOM   982  C CD1   . ILE A 1 126 ? 3.741   2.065   5.286   1.00 25.87 ? 126 ILE A CD1   1 
ATOM   983  N N     . LEU A 1 127 ? 1.839   -3.167  5.802   1.00 28.44 ? 127 LEU A N     1 
ATOM   984  C CA    . LEU A 1 127 ? 1.907   -4.632  5.664   1.00 26.39 ? 127 LEU A CA    1 
ATOM   985  C C     . LEU A 1 127 ? 0.549   -5.277  5.514   1.00 26.48 ? 127 LEU A C     1 
ATOM   986  O O     . LEU A 1 127 ? 0.362   -6.151  4.682   1.00 28.55 ? 127 LEU A O     1 
ATOM   987  C CB    . LEU A 1 127 ? 2.608   -5.259  6.869   1.00 25.32 ? 127 LEU A CB    1 
ATOM   988  C CG    . LEU A 1 127 ? 4.021   -4.736  7.151   1.00 24.77 ? 127 LEU A CG    1 
ATOM   989  C CD1   . LEU A 1 127 ? 4.593   -5.367  8.410   1.00 23.92 ? 127 LEU A CD1   1 
ATOM   990  C CD2   . LEU A 1 127 ? 4.911   -4.977  5.952   1.00 21.38 ? 127 LEU A CD2   1 
ATOM   991  N N     . PHE A 1 128 ? -0.406  -4.842  6.324   1.00 26.58 ? 128 PHE A N     1 
ATOM   992  C CA    . PHE A 1 128 ? -1.734  -5.438  6.300   1.00 25.66 ? 128 PHE A CA    1 
ATOM   993  C C     . PHE A 1 128 ? -2.537  -5.034  5.054   1.00 25.88 ? 128 PHE A C     1 
ATOM   994  O O     . PHE A 1 128 ? -3.299  -5.846  4.530   1.00 24.70 ? 128 PHE A O     1 
ATOM   995  C CB    . PHE A 1 128 ? -2.446  -5.214  7.641   1.00 26.08 ? 128 PHE A CB    1 
ATOM   996  C CG    . PHE A 1 128 ? -1.676  -5.784  8.806   1.00 25.36 ? 128 PHE A CG    1 
ATOM   997  C CD1   . PHE A 1 128 ? -1.389  -7.143  8.855   1.00 24.84 ? 128 PHE A CD1   1 
ATOM   998  C CD2   . PHE A 1 128 ? -1.182  -4.960  9.812   1.00 30.27 ? 128 PHE A CD2   1 
ATOM   999  C CE1   . PHE A 1 128 ? -0.639  -7.684  9.904   1.00 33.87 ? 128 PHE A CE1   1 
ATOM   1000 C CE2   . PHE A 1 128 ? -0.443  -5.488  10.883  1.00 32.14 ? 128 PHE A CE2   1 
ATOM   1001 C CZ    . PHE A 1 128 ? -0.171  -6.854  10.930  1.00 30.99 ? 128 PHE A CZ    1 
ATOM   1002 N N     . MET A 1 129 ? -2.318  -3.812  4.561   1.00 25.94 ? 129 MET A N     1 
ATOM   1003 C CA    . MET A 1 129 ? -2.906  -3.364  3.283   1.00 28.83 ? 129 MET A CA    1 
ATOM   1004 C C     . MET A 1 129 ? -2.366  -4.147  2.080   1.00 29.03 ? 129 MET A C     1 
ATOM   1005 O O     . MET A 1 129 ? -3.129  -4.498  1.166   1.00 31.12 ? 129 MET A O     1 
ATOM   1006 C CB    . MET A 1 129 ? -2.711  -1.847  3.065   1.00 28.38 ? 129 MET A CB    1 
ATOM   1007 C CG    . MET A 1 129 ? -3.559  -0.961  3.993   1.00 28.06 ? 129 MET A CG    1 
ATOM   1008 S SD    . MET A 1 129 ? -3.443  0.836   3.739   1.00 31.30 ? 129 MET A SD    1 
ATOM   1009 C CE    . MET A 1 129 ? -1.674  1.122   3.935   1.00 24.78 ? 129 MET A CE    1 
ATOM   1010 N N     . LEU A 1 130 ? -1.058  -4.422  2.086   1.00 28.43 ? 130 LEU A N     1 
ATOM   1011 C CA    . LEU A 1 130 ? -0.436  -5.256  1.055   1.00 27.34 ? 130 LEU A CA    1 
ATOM   1012 C C     . LEU A 1 130 ? -1.004  -6.669  1.058   1.00 28.43 ? 130 LEU A C     1 
ATOM   1013 O O     . LEU A 1 130 ? -1.329  -7.204  -0.003  1.00 30.28 ? 130 LEU A O     1 
ATOM   1014 C CB    . LEU A 1 130 ? 1.087   -5.308  1.207   1.00 25.18 ? 130 LEU A CB    1 
ATOM   1015 C CG    . LEU A 1 130 ? 1.866   -4.002  0.957   1.00 23.79 ? 130 LEU A CG    1 
ATOM   1016 C CD1   . LEU A 1 130 ? 3.331   -4.122  1.381   1.00 18.88 ? 130 LEU A CD1   1 
ATOM   1017 C CD2   . LEU A 1 130 ? 1.740   -3.567  -0.497  1.00 22.50 ? 130 LEU A CD2   1 
ATOM   1018 N N     . LEU A 1 131 ? -1.114  -7.266  2.244   1.00 28.19 ? 131 LEU A N     1 
ATOM   1019 C CA    . LEU A 1 131 ? -1.672  -8.614  2.396   1.00 27.59 ? 131 LEU A CA    1 
ATOM   1020 C C     . LEU A 1 131 ? -3.132  -8.645  1.899   1.00 26.45 ? 131 LEU A C     1 
ATOM   1021 O O     . LEU A 1 131 ? -3.515  -9.538  1.134   1.00 27.05 ? 131 LEU A O     1 
ATOM   1022 C CB    . LEU A 1 131 ? -1.590  -9.052  3.861   1.00 25.99 ? 131 LEU A CB    1 
ATOM   1023 C CG    . LEU A 1 131 ? -1.252  -10.490 4.258   1.00 27.83 ? 131 LEU A CG    1 
ATOM   1024 C CD1   . LEU A 1 131 ? -1.778  -10.835 5.662   1.00 24.48 ? 131 LEU A CD1   1 
ATOM   1025 C CD2   . LEU A 1 131 ? -1.724  -11.510 3.259   1.00 29.89 ? 131 LEU A CD2   1 
ATOM   1026 N N     . LYS A 1 132 ? -3.936  -7.672  2.330   1.00 25.77 ? 132 LYS A N     1 
ATOM   1027 C CA    . LYS A 1 132 ? -5.334  -7.541  1.869   1.00 27.13 ? 132 LYS A CA    1 
ATOM   1028 C C     . LYS A 1 132 ? -5.434  -7.347  0.346   1.00 26.68 ? 132 LYS A C     1 
ATOM   1029 O O     . LYS A 1 132 ? -6.465  -7.606  -0.247  1.00 27.43 ? 132 LYS A O     1 
ATOM   1030 C CB    . LYS A 1 132 ? -6.052  -6.385  2.587   1.00 26.10 ? 132 LYS A CB    1 
ATOM   1031 C CG    . LYS A 1 132 ? -7.576  -6.556  2.723   1.00 28.78 ? 132 LYS A CG    1 
ATOM   1032 C CD    . LYS A 1 132 ? -7.896  -7.893  3.414   1.00 33.51 ? 132 LYS A CD    1 
ATOM   1033 C CE    . LYS A 1 132 ? -9.316  -7.991  3.935   1.00 33.00 ? 132 LYS A CE    1 
ATOM   1034 N NZ    . LYS A 1 132 ? -9.466  -9.163  4.879   1.00 29.67 ? 132 LYS A NZ    1 
ATOM   1035 N N     . GLY A 1 133 ? -4.358  -6.873  -0.268  1.00 26.60 ? 133 GLY A N     1 
ATOM   1036 C CA    . GLY A 1 133 ? -4.313  -6.661  -1.708  1.00 26.64 ? 133 GLY A CA    1 
ATOM   1037 C C     . GLY A 1 133 ? -4.531  -7.920  -2.514  1.00 26.46 ? 133 GLY A C     1 
ATOM   1038 O O     . GLY A 1 133 ? -4.934  -7.858  -3.668  1.00 27.64 ? 133 GLY A O     1 
ATOM   1039 N N     . TYR A 1 134 ? -4.278  -9.071  -1.906  1.00 28.27 ? 134 TYR A N     1 
ATOM   1040 C CA    . TYR A 1 134 ? -4.471  -10.358 -2.588  1.00 29.27 ? 134 TYR A CA    1 
ATOM   1041 C C     . TYR A 1 134 ? -5.908  -10.587 -3.025  1.00 27.81 ? 134 TYR A C     1 
ATOM   1042 O O     . TYR A 1 134 ? -6.151  -11.331 -3.969  1.00 28.91 ? 134 TYR A O     1 
ATOM   1043 C CB    . TYR A 1 134 ? -3.994  -11.542 -1.723  1.00 29.05 ? 134 TYR A CB    1 
ATOM   1044 C CG    . TYR A 1 134 ? -2.527  -11.839 -1.847  1.00 29.06 ? 134 TYR A CG    1 
ATOM   1045 C CD1   . TYR A 1 134 ? -1.688  -11.766 -0.735  1.00 28.65 ? 134 TYR A CD1   1 
ATOM   1046 C CD2   . TYR A 1 134 ? -1.963  -12.181 -3.086  1.00 32.06 ? 134 TYR A CD2   1 
ATOM   1047 C CE1   . TYR A 1 134 ? -0.315  -12.030 -0.848  1.00 31.31 ? 134 TYR A CE1   1 
ATOM   1048 C CE2   . TYR A 1 134 ? -0.582  -12.447 -3.212  1.00 31.77 ? 134 TYR A CE2   1 
ATOM   1049 C CZ    . TYR A 1 134 ? 0.226   -12.375 -2.088  1.00 30.48 ? 134 TYR A CZ    1 
ATOM   1050 O OH    . TYR A 1 134 ? 1.565   -12.651 -2.184  1.00 31.85 ? 134 TYR A OH    1 
ATOM   1051 N N     . GLU A 1 135 ? -6.844  -9.941  -2.336  1.00 27.07 ? 135 GLU A N     1 
ATOM   1052 C CA    . GLU A 1 135 ? -8.269  -10.106 -2.576  1.00 27.02 ? 135 GLU A CA    1 
ATOM   1053 C C     . GLU A 1 135 ? -8.797  -9.278  -3.753  1.00 27.80 ? 135 GLU A C     1 
ATOM   1054 O O     . GLU A 1 135 ? -9.993  -9.358  -4.108  1.00 28.60 ? 135 GLU A O     1 
ATOM   1055 C CB    . GLU A 1 135 ? -9.036  -9.749  -1.304  1.00 27.67 ? 135 GLU A CB    1 
ATOM   1056 C CG    . GLU A 1 135 ? -8.759  -10.705 -0.158  1.00 28.99 ? 135 GLU A CG    1 
ATOM   1057 C CD    . GLU A 1 135 ? -9.587  -10.417 1.080   1.00 30.03 ? 135 GLU A CD    1 
ATOM   1058 O OE1   . GLU A 1 135 ? -10.681 -9.822  0.950   1.00 28.86 ? 135 GLU A OE1   1 
ATOM   1059 O OE2   . GLU A 1 135 ? -9.137  -10.802 2.184   1.00 32.01 ? 135 GLU A OE2   1 
ATOM   1060 N N     . SER A 1 136 ? -7.916  -8.488  -4.355  1.00 25.89 ? 136 SER A N     1 
ATOM   1061 C CA    . SER A 1 136 ? -8.306  -7.588  -5.426  1.00 27.70 ? 136 SER A CA    1 
ATOM   1062 C C     . SER A 1 136 ? -7.442  -7.827  -6.648  1.00 26.95 ? 136 SER A C     1 
ATOM   1063 O O     . SER A 1 136 ? -6.258  -7.518  -6.621  1.00 28.36 ? 136 SER A O     1 
ATOM   1064 C CB    . SER A 1 136 ? -8.182  -6.137  -4.955  1.00 27.40 ? 136 SER A CB    1 
ATOM   1065 O OG    . SER A 1 136 ? -8.975  -5.945  -3.801  1.00 29.41 ? 136 SER A OG    1 
ATOM   1066 N N     . PRO A 1 137 ? -8.025  -8.397  -7.720  1.00 27.99 ? 137 PRO A N     1 
ATOM   1067 C CA    . PRO A 1 137 ? -7.215  -8.843  -8.875  1.00 28.37 ? 137 PRO A CA    1 
ATOM   1068 C C     . PRO A 1 137 ? -6.357  -7.732  -9.524  1.00 27.24 ? 137 PRO A C     1 
ATOM   1069 O O     . PRO A 1 137 ? -5.274  -8.011  -10.028 1.00 28.29 ? 137 PRO A O     1 
ATOM   1070 C CB    . PRO A 1 137 ? -8.259  -9.375  -9.865  1.00 27.37 ? 137 PRO A CB    1 
ATOM   1071 C CG    . PRO A 1 137 ? -9.486  -9.638  -9.045  1.00 30.73 ? 137 PRO A CG    1 
ATOM   1072 C CD    . PRO A 1 137 ? -9.465  -8.648  -7.920  1.00 28.46 ? 137 PRO A CD    1 
ATOM   1073 N N     . GLU A 1 138 ? -6.833  -6.494  -9.497  1.00 27.11 ? 138 GLU A N     1 
ATOM   1074 C CA    . GLU A 1 138 ? -6.120  -5.377  -10.121 1.00 28.83 ? 138 GLU A CA    1 
ATOM   1075 C C     . GLU A 1 138 ? -4.816  -4.987  -9.419  1.00 26.98 ? 138 GLU A C     1 
ATOM   1076 O O     . GLU A 1 138 ? -3.883  -4.527  -10.074 1.00 26.48 ? 138 GLU A O     1 
ATOM   1077 C CB    . GLU A 1 138 ? -7.042  -4.162  -10.288 1.00 27.76 ? 138 GLU A CB    1 
ATOM   1078 C CG    . GLU A 1 138 ? -8.119  -4.364  -11.352 1.00 31.94 ? 138 GLU A CG    1 
ATOM   1079 C CD    . GLU A 1 138 ? -9.024  -3.149  -11.545 1.00 35.34 ? 138 GLU A CD    1 
ATOM   1080 O OE1   . GLU A 1 138 ? -9.163  -2.694  -12.703 1.00 42.58 ? 138 GLU A OE1   1 
ATOM   1081 O OE2   . GLU A 1 138 ? -9.602  -2.646  -10.550 1.00 44.19 ? 138 GLU A OE2   1 
ATOM   1082 N N     . ILE A 1 139 ? -4.744  -5.202  -8.105  1.00 25.94 ? 139 ILE A N     1 
ATOM   1083 C CA    . ILE A 1 139 ? -3.579  -4.802  -7.309  1.00 25.22 ? 139 ILE A CA    1 
ATOM   1084 C C     . ILE A 1 139 ? -2.784  -5.966  -6.711  1.00 25.41 ? 139 ILE A C     1 
ATOM   1085 O O     . ILE A 1 139 ? -1.735  -5.752  -6.100  1.00 24.79 ? 139 ILE A O     1 
ATOM   1086 C CB    . ILE A 1 139 ? -3.983  -3.815  -6.159  1.00 25.12 ? 139 ILE A CB    1 
ATOM   1087 C CG1   . ILE A 1 139 ? -4.931  -4.500  -5.179  1.00 24.99 ? 139 ILE A CG1   1 
ATOM   1088 C CG2   . ILE A 1 139 ? -4.617  -2.558  -6.724  1.00 22.99 ? 139 ILE A CG2   1 
ATOM   1089 C CD1   . ILE A 1 139 ? -5.243  -3.690  -3.947  1.00 25.84 ? 139 ILE A CD1   1 
ATOM   1090 N N     . ALA A 1 140 ? -3.292  -7.185  -6.868  1.00 24.54 ? 140 ALA A N     1 
ATOM   1091 C CA    . ALA A 1 140 ? -2.780  -8.337  -6.124  1.00 24.08 ? 140 ALA A CA    1 
ATOM   1092 C C     . ALA A 1 140 ? -1.300  -8.636  -6.402  1.00 24.84 ? 140 ALA A C     1 
ATOM   1093 O O     . ALA A 1 140 ? -0.517  -8.862  -5.475  1.00 23.85 ? 140 ALA A O     1 
ATOM   1094 C CB    . ALA A 1 140 ? -3.643  -9.574  -6.406  1.00 23.85 ? 140 ALA A CB    1 
ATOM   1095 N N     . LEU A 1 141 ? -0.929  -8.632  -7.677  1.00 26.20 ? 141 LEU A N     1 
ATOM   1096 C CA    . LEU A 1 141 ? 0.412   -9.002  -8.101  1.00 28.41 ? 141 LEU A CA    1 
ATOM   1097 C C     . LEU A 1 141 ? 1.432   -7.993  -7.579  1.00 28.04 ? 141 LEU A C     1 
ATOM   1098 O O     . LEU A 1 141 ? 2.456   -8.369  -7.012  1.00 28.96 ? 141 LEU A O     1 
ATOM   1099 C CB    . LEU A 1 141 ? 0.474   -9.076  -9.628  1.00 29.48 ? 141 LEU A CB    1 
ATOM   1100 C CG    . LEU A 1 141 ? 1.641   -9.907  -10.177 1.00 34.52 ? 141 LEU A CG    1 
ATOM   1101 C CD1   . LEU A 1 141 ? 1.157   -11.332 -10.486 1.00 42.80 ? 141 LEU A CD1   1 
ATOM   1102 C CD2   . LEU A 1 141 ? 2.274   -9.266  -11.412 1.00 31.38 ? 141 LEU A CD2   1 
ATOM   1103 N N     . ASN A 1 142 ? 1.135   -6.712  -7.755  1.00 26.71 ? 142 ASN A N     1 
ATOM   1104 C CA    . ASN A 1 142 ? 1.993   -5.651  -7.237  1.00 27.00 ? 142 ASN A CA    1 
ATOM   1105 C C     . ASN A 1 142 ? 2.092   -5.604  -5.719  1.00 26.29 ? 142 ASN A C     1 
ATOM   1106 O O     . ASN A 1 142 ? 3.150   -5.328  -5.181  1.00 27.11 ? 142 ASN A O     1 
ATOM   1107 C CB    . ASN A 1 142 ? 1.557   -4.306  -7.799  1.00 27.23 ? 142 ASN A CB    1 
ATOM   1108 C CG    . ASN A 1 142 ? 1.924   -4.159  -9.254  1.00 28.66 ? 142 ASN A CG    1 
ATOM   1109 O OD1   . ASN A 1 142 ? 3.106   -4.218  -9.620  1.00 25.95 ? 142 ASN A OD1   1 
ATOM   1110 N ND2   . ASN A 1 142 ? 0.914   -4.010  -10.100 1.00 25.91 ? 142 ASN A ND2   1 
ATOM   1111 N N     . CYS A 1 143 ? 0.992   -5.885  -5.033  1.00 25.77 ? 143 CYS A N     1 
ATOM   1112 C CA    . CYS A 1 143 ? 1.018   -6.031  -3.591  1.00 26.34 ? 143 CYS A CA    1 
ATOM   1113 C C     . CYS A 1 143 ? 1.908   -7.183  -3.181  1.00 28.21 ? 143 CYS A C     1 
ATOM   1114 O O     . CYS A 1 143 ? 2.727   -7.037  -2.274  1.00 30.03 ? 143 CYS A O     1 
ATOM   1115 C CB    . CYS A 1 143 ? -0.381  -6.250  -3.048  1.00 26.01 ? 143 CYS A CB    1 
ATOM   1116 S SG    . CYS A 1 143 ? -1.330  -4.748  -2.983  1.00 27.16 ? 143 CYS A SG    1 
ATOM   1117 N N     . GLY A 1 144 ? 1.751   -8.320  -3.862  1.00 28.75 ? 144 GLY A N     1 
ATOM   1118 C CA    . GLY A 1 144 ? 2.555   -9.510  -3.604  1.00 27.42 ? 144 GLY A CA    1 
ATOM   1119 C C     . GLY A 1 144 ? 4.044   -9.238  -3.713  1.00 27.82 ? 144 GLY A C     1 
ATOM   1120 O O     . GLY A 1 144 ? 4.797   -9.604  -2.814  1.00 30.22 ? 144 GLY A O     1 
ATOM   1121 N N     . ILE A 1 145 ? 4.457   -8.598  -4.808  1.00 27.08 ? 145 ILE A N     1 
ATOM   1122 C CA    . ILE A 1 145 ? 5.858   -8.207  -5.055  1.00 28.28 ? 145 ILE A CA    1 
ATOM   1123 C C     . ILE A 1 145 ? 6.400   -7.332  -3.910  1.00 27.68 ? 145 ILE A C     1 
ATOM   1124 O O     . ILE A 1 145 ? 7.487   -7.584  -3.402  1.00 28.13 ? 145 ILE A O     1 
ATOM   1125 C CB    . ILE A 1 145 ? 6.028   -7.483  -6.432  1.00 27.47 ? 145 ILE A CB    1 
ATOM   1126 C CG1   . ILE A 1 145 ? 5.736   -8.439  -7.591  1.00 30.25 ? 145 ILE A CG1   1 
ATOM   1127 C CG2   . ILE A 1 145 ? 7.438   -6.908  -6.614  1.00 28.93 ? 145 ILE A CG2   1 
ATOM   1128 C CD1   . ILE A 1 145 ? 5.683   -7.750  -8.968  1.00 30.11 ? 145 ILE A CD1   1 
ATOM   1129 N N     . MET A 1 146 ? 5.617   -6.339  -3.492  1.00 26.84 ? 146 MET A N     1 
ATOM   1130 C CA    . MET A 1 146 ? 5.997   -5.450  -2.394  1.00 28.09 ? 146 MET A CA    1 
ATOM   1131 C C     . MET A 1 146 ? 6.090   -6.155  -1.041  1.00 28.65 ? 146 MET A C     1 
ATOM   1132 O O     . MET A 1 146 ? 7.040   -5.936  -0.295  1.00 32.21 ? 146 MET A O     1 
ATOM   1133 C CB    . MET A 1 146 ? 5.036   -4.266  -2.305  1.00 26.63 ? 146 MET A CB    1 
ATOM   1134 C CG    . MET A 1 146 ? 5.286   -3.206  -3.365  1.00 28.03 ? 146 MET A CG    1 
ATOM   1135 S SD    . MET A 1 146 ? 4.344   -1.683  -3.138  1.00 28.50 ? 146 MET A SD    1 
ATOM   1136 C CE    . MET A 1 146 ? 2.807   -2.140  -3.935  1.00 24.43 ? 146 MET A CE    1 
ATOM   1137 N N     . LEU A 1 147 ? 5.101   -6.993  -0.741  1.00 28.29 ? 147 LEU A N     1 
ATOM   1138 C CA    . LEU A 1 147 ? 5.044   -7.776  0.488   1.00 29.56 ? 147 LEU A CA    1 
ATOM   1139 C C     . LEU A 1 147 ? 6.191   -8.778  0.592   1.00 27.98 ? 147 LEU A C     1 
ATOM   1140 O O     . LEU A 1 147 ? 6.780   -8.965  1.657   1.00 29.01 ? 147 LEU A O     1 
ATOM   1141 C CB    . LEU A 1 147 ? 3.705   -8.526  0.566   1.00 28.03 ? 147 LEU A CB    1 
ATOM   1142 C CG    . LEU A 1 147 ? 2.992   -8.742  1.906   1.00 31.60 ? 147 LEU A CG    1 
ATOM   1143 C CD1   . LEU A 1 147 ? 2.329   -10.105 1.912   1.00 26.44 ? 147 LEU A CD1   1 
ATOM   1144 C CD2   . LEU A 1 147 ? 3.885   -8.584  3.133   1.00 29.25 ? 147 LEU A CD2   1 
ATOM   1145 N N     . ARG A 1 148 ? 6.514   -9.405  -0.530  1.00 28.25 ? 148 ARG A N     1 
ATOM   1146 C CA    . ARG A 1 148 ? 7.584   -10.388 -0.566  1.00 29.00 ? 148 ARG A CA    1 
ATOM   1147 C C     . ARG A 1 148 ? 8.949   -9.721  -0.328  1.00 28.74 ? 148 ARG A C     1 
ATOM   1148 O O     . ARG A 1 148 ? 9.851   -10.343 0.208   1.00 29.45 ? 148 ARG A O     1 
ATOM   1149 C CB    . ARG A 1 148 ? 7.519   -11.166 -1.885  1.00 27.58 ? 148 ARG A CB    1 
ATOM   1150 C CG    . ARG A 1 148 ? 8.312   -12.454 -1.923  1.00 33.25 ? 148 ARG A CG    1 
ATOM   1151 C CD    . ARG A 1 148 ? 7.730   -13.481 -2.885  1.00 37.69 ? 148 ARG A CD    1 
ATOM   1152 N NE    . ARG A 1 148 ? 7.313   -12.904 -4.169  1.00 43.15 ? 148 ARG A NE    1 
ATOM   1153 C CZ    . ARG A 1 148 ? 6.046   -12.652 -4.519  1.00 39.66 ? 148 ARG A CZ    1 
ATOM   1154 N NH1   . ARG A 1 148 ? 5.057   -12.928 -3.672  1.00 40.19 ? 148 ARG A NH1   1 
ATOM   1155 N NH2   . ARG A 1 148 ? 5.767   -12.121 -5.715  1.00 28.17 ? 148 ARG A NH2   1 
ATOM   1156 N N     . GLU A 1 149 ? 9.086   -8.447  -0.700  1.00 29.20 ? 149 GLU A N     1 
ATOM   1157 C CA    . GLU A 1 149 ? 10.305  -7.701  -0.394  1.00 29.08 ? 149 GLU A CA    1 
ATOM   1158 C C     . GLU A 1 149 ? 10.325  -7.243  1.057   1.00 28.38 ? 149 GLU A C     1 
ATOM   1159 O O     . GLU A 1 149 ? 11.391  -7.188  1.666   1.00 27.57 ? 149 GLU A O     1 
ATOM   1160 C CB    . GLU A 1 149 ? 10.507  -6.517  -1.343  1.00 29.06 ? 149 GLU A CB    1 
ATOM   1161 C CG    . GLU A 1 149 ? 10.752  -6.940  -2.791  1.00 33.89 ? 149 GLU A CG    1 
ATOM   1162 C CD    . GLU A 1 149 ? 12.076  -7.685  -2.992  1.00 39.31 ? 149 GLU A CD    1 
ATOM   1163 O OE1   . GLU A 1 149 ? 12.039  -8.862  -3.425  1.00 40.01 ? 149 GLU A OE1   1 
ATOM   1164 O OE2   . GLU A 1 149 ? 13.148  -7.095  -2.711  1.00 38.68 ? 149 GLU A OE2   1 
ATOM   1165 N N     . CYS A 1 150 ? 9.154   -6.928  1.610   1.00 26.31 ? 150 CYS A N     1 
ATOM   1166 C CA    . CYS A 1 150 ? 9.047   -6.581  3.028   1.00 27.24 ? 150 CYS A CA    1 
ATOM   1167 C C     . CYS A 1 150 ? 9.499   -7.714  3.921   1.00 27.72 ? 150 CYS A C     1 
ATOM   1168 O O     . CYS A 1 150 ? 10.239  -7.497  4.879   1.00 30.58 ? 150 CYS A O     1 
ATOM   1169 C CB    . CYS A 1 150 ? 7.609   -6.222  3.415   1.00 26.11 ? 150 CYS A CB    1 
ATOM   1170 S SG    . CYS A 1 150 ? 7.076   -4.676  2.809   1.00 29.67 ? 150 CYS A SG    1 
ATOM   1171 N N     . ILE A 1 151 ? 9.025   -8.920  3.624   1.00 28.46 ? 151 ILE A N     1 
ATOM   1172 C CA    . ILE A 1 151 ? 9.199   -10.053 4.534   1.00 27.75 ? 151 ILE A CA    1 
ATOM   1173 C C     . ILE A 1 151 ? 10.599  -10.642 4.484   1.00 25.55 ? 151 ILE A C     1 
ATOM   1174 O O     . ILE A 1 151 ? 10.912  -11.558 5.240   1.00 25.77 ? 151 ILE A O     1 
ATOM   1175 C CB    . ILE A 1 151 ? 8.081   -11.145 4.367   1.00 29.41 ? 151 ILE A CB    1 
ATOM   1176 C CG1   . ILE A 1 151 ? 7.928   -11.581 2.905   1.00 28.01 ? 151 ILE A CG1   1 
ATOM   1177 C CG2   . ILE A 1 151 ? 6.756   -10.599 4.891   1.00 31.47 ? 151 ILE A CG2   1 
ATOM   1178 C CD1   . ILE A 1 151 ? 7.773   -13.068 2.680   1.00 25.91 ? 151 ILE A CD1   1 
ATOM   1179 N N     . ARG A 1 152 ? 11.442  -10.095 3.609   1.00 24.99 ? 152 ARG A N     1 
ATOM   1180 C CA    . ARG A 1 152 ? 12.892  -10.385 3.602   1.00 24.51 ? 152 ARG A CA    1 
ATOM   1181 C C     . ARG A 1 152 ? 13.541  -9.876  4.890   1.00 23.69 ? 152 ARG A C     1 
ATOM   1182 O O     . ARG A 1 152 ? 14.613  -10.343 5.291   1.00 21.39 ? 152 ARG A O     1 
ATOM   1183 C CB    . ARG A 1 152 ? 13.600  -9.678  2.440   1.00 23.75 ? 152 ARG A CB    1 
ATOM   1184 C CG    . ARG A 1 152 ? 13.108  -10.001 1.039   1.00 27.71 ? 152 ARG A CG    1 
ATOM   1185 C CD    . ARG A 1 152 ? 14.143  -9.571  -0.041  1.00 27.59 ? 152 ARG A CD    1 
ATOM   1186 N NE    . ARG A 1 152 ? 14.884  -8.355  0.317   1.00 37.00 ? 152 ARG A NE    1 
ATOM   1187 C CZ    . ARG A 1 152 ? 16.205  -8.293  0.516   1.00 36.33 ? 152 ARG A CZ    1 
ATOM   1188 N NH1   . ARG A 1 152 ? 16.963  -9.377  0.372   1.00 35.30 ? 152 ARG A NH1   1 
ATOM   1189 N NH2   . ARG A 1 152 ? 16.774  -7.137  0.850   1.00 32.18 ? 152 ARG A NH2   1 
ATOM   1190 N N     . HIS A 1 153 ? 12.903  -8.879  5.503   1.00 23.25 ? 153 HIS A N     1 
ATOM   1191 C CA    . HIS A 1 153 ? 13.417  -8.274  6.722   1.00 23.97 ? 153 HIS A CA    1 
ATOM   1192 C C     . HIS A 1 153 ? 12.685  -8.846  7.915   1.00 23.06 ? 153 HIS A C     1 
ATOM   1193 O O     . HIS A 1 153 ? 11.463  -8.805  7.978   1.00 22.39 ? 153 HIS A O     1 
ATOM   1194 C CB    . HIS A 1 153 ? 13.293  -6.758  6.660   1.00 23.80 ? 153 HIS A CB    1 
ATOM   1195 C CG    . HIS A 1 153 ? 14.062  -6.145  5.528   1.00 25.81 ? 153 HIS A CG    1 
ATOM   1196 N ND1   . HIS A 1 153 ? 13.540  -6.018  4.256   1.00 22.65 ? 153 HIS A ND1   1 
ATOM   1197 C CD2   . HIS A 1 153 ? 15.316  -5.634  5.475   1.00 22.94 ? 153 HIS A CD2   1 
ATOM   1198 C CE1   . HIS A 1 153 ? 14.437  -5.442  3.474   1.00 26.84 ? 153 HIS A CE1   1 
ATOM   1199 N NE2   . HIS A 1 153 ? 15.524  -5.203  4.187   1.00 24.02 ? 153 HIS A NE2   1 
ATOM   1200 N N     . GLU A 1 154 ? 13.454  -9.393  8.849   1.00 23.09 ? 154 GLU A N     1 
ATOM   1201 C CA    . GLU A 1 154 ? 12.914  -10.158 9.960   1.00 23.52 ? 154 GLU A CA    1 
ATOM   1202 C C     . GLU A 1 154 ? 11.842  -9.439  10.794  1.00 23.57 ? 154 GLU A C     1 
ATOM   1203 O O     . GLU A 1 154 ? 10.834  -10.060 11.126  1.00 22.31 ? 154 GLU A O     1 
ATOM   1204 C CB    . GLU A 1 154 ? 14.037  -10.669 10.853  1.00 25.12 ? 154 GLU A CB    1 
ATOM   1205 C CG    . GLU A 1 154 ? 13.709  -11.961 11.554  1.00 28.81 ? 154 GLU A CG    1 
ATOM   1206 C CD    . GLU A 1 154 ? 14.401  -12.070 12.884  1.00 36.89 ? 154 GLU A CD    1 
ATOM   1207 O OE1   . GLU A 1 154 ? 15.417  -12.796 12.980  1.00 35.32 ? 154 GLU A OE1   1 
ATOM   1208 O OE2   . GLU A 1 154 ? 13.932  -11.407 13.834  1.00 44.68 ? 154 GLU A OE2   1 
ATOM   1209 N N     . PRO A 1 155 ? 12.057  -8.142  11.151  1.00 24.13 ? 155 PRO A N     1 
ATOM   1210 C CA    . PRO A 1 155 ? 11.032  -7.448  11.933  1.00 24.02 ? 155 PRO A CA    1 
ATOM   1211 C C     . PRO A 1 155 ? 9.670   -7.400  11.246  1.00 24.46 ? 155 PRO A C     1 
ATOM   1212 O O     . PRO A 1 155 ? 8.647   -7.474  11.918  1.00 24.86 ? 155 PRO A O     1 
ATOM   1213 C CB    . PRO A 1 155 ? 11.611  -6.032  12.085  1.00 24.60 ? 155 PRO A CB    1 
ATOM   1214 C CG    . PRO A 1 155 ? 13.079  -6.224  12.002  1.00 22.14 ? 155 PRO A CG    1 
ATOM   1215 C CD    . PRO A 1 155 ? 13.231  -7.269  10.939  1.00 24.15 ? 155 PRO A CD    1 
ATOM   1216 N N     . LEU A 1 156 ? 9.668   -7.294  9.922   1.00 24.47 ? 156 LEU A N     1 
ATOM   1217 C CA    . LEU A 1 156 ? 8.433   -7.180  9.165   1.00 24.88 ? 156 LEU A CA    1 
ATOM   1218 C C     . LEU A 1 156 ? 7.764   -8.550  8.986   1.00 25.60 ? 156 LEU A C     1 
ATOM   1219 O O     . LEU A 1 156 ? 6.543   -8.673  9.102   1.00 26.84 ? 156 LEU A O     1 
ATOM   1220 C CB    . LEU A 1 156 ? 8.701   -6.472  7.833   1.00 25.10 ? 156 LEU A CB    1 
ATOM   1221 C CG    . LEU A 1 156 ? 9.336   -5.070  7.916   1.00 22.11 ? 156 LEU A CG    1 
ATOM   1222 C CD1   . LEU A 1 156 ? 9.523   -4.462  6.525   1.00 20.34 ? 156 LEU A CD1   1 
ATOM   1223 C CD2   . LEU A 1 156 ? 8.542   -4.111  8.825   1.00 22.63 ? 156 LEU A CD2   1 
ATOM   1224 N N     . ALA A 1 157 ? 8.576   -9.571  8.722   1.00 23.50 ? 157 ALA A N     1 
ATOM   1225 C CA    . ALA A 1 157 ? 8.167   -10.968 8.814   1.00 23.37 ? 157 ALA A CA    1 
ATOM   1226 C C     . ALA A 1 157 ? 7.468   -11.304 10.145  1.00 24.76 ? 157 ALA A C     1 
ATOM   1227 O O     . ALA A 1 157 ? 6.422   -11.960 10.146  1.00 24.77 ? 157 ALA A O     1 
ATOM   1228 C CB    . ALA A 1 157 ? 9.379   -11.868 8.610   1.00 22.29 ? 157 ALA A CB    1 
ATOM   1229 N N     . LYS A 1 158 ? 8.032   -10.840 11.266  1.00 24.60 ? 158 LYS A N     1 
ATOM   1230 C CA    . LYS A 1 158 ? 7.484   -11.130 12.598  1.00 26.12 ? 158 LYS A CA    1 
ATOM   1231 C C     . LYS A 1 158 ? 6.102   -10.525 12.811  1.00 26.24 ? 158 LYS A C     1 
ATOM   1232 O O     . LYS A 1 158 ? 5.209   -11.189 13.339  1.00 27.49 ? 158 LYS A O     1 
ATOM   1233 C CB    . LYS A 1 158 ? 8.439   -10.690 13.723  1.00 25.62 ? 158 LYS A CB    1 
ATOM   1234 C CG    . LYS A 1 158 ? 7.938   -11.016 15.143  1.00 24.50 ? 158 LYS A CG    1 
ATOM   1235 C CD    . LYS A 1 158 ? 8.955   -10.637 16.238  1.00 28.44 ? 158 LYS A CD    1 
ATOM   1236 C CE    . LYS A 1 158 ? 8.476   -11.049 17.654  1.00 31.48 ? 158 LYS A CE    1 
ATOM   1237 N NZ    . LYS A 1 158 ? 9.610   -11.311 18.613  1.00 31.04 ? 158 LYS A NZ    1 
ATOM   1238 N N     . ILE A 1 159 ? 5.937   -9.268  12.409  1.00 27.19 ? 159 ILE A N     1 
ATOM   1239 C CA    . ILE A 1 159 ? 4.637   -8.577  12.470  1.00 27.23 ? 159 ILE A CA    1 
ATOM   1240 C C     . ILE A 1 159 ? 3.515   -9.350  11.763  1.00 27.44 ? 159 ILE A C     1 
ATOM   1241 O O     . ILE A 1 159 ? 2.439   -9.559  12.326  1.00 28.75 ? 159 ILE A O     1 
ATOM   1242 C CB    . ILE A 1 159 ? 4.749   -7.133  11.914  1.00 28.00 ? 159 ILE A CB    1 
ATOM   1243 C CG1   . ILE A 1 159 ? 5.535   -6.256  12.903  1.00 24.63 ? 159 ILE A CG1   1 
ATOM   1244 C CG2   . ILE A 1 159 ? 3.371   -6.550  11.598  1.00 23.91 ? 159 ILE A CG2   1 
ATOM   1245 C CD1   . ILE A 1 159 ? 6.229   -5.056  12.253  1.00 23.56 ? 159 ILE A CD1   1 
ATOM   1246 N N     . ILE A 1 160 ? 3.774   -9.798  10.543  1.00 27.54 ? 160 ILE A N     1 
ATOM   1247 C CA    . ILE A 1 160 ? 2.799   -10.614 9.810   1.00 26.57 ? 160 ILE A CA    1 
ATOM   1248 C C     . ILE A 1 160 ? 2.545   -11.985 10.439  1.00 27.03 ? 160 ILE A C     1 
ATOM   1249 O O     . ILE A 1 160 ? 1.402   -12.406 10.569  1.00 28.63 ? 160 ILE A O     1 
ATOM   1250 C CB    . ILE A 1 160 ? 3.196   -10.758 8.335   1.00 26.19 ? 160 ILE A CB    1 
ATOM   1251 C CG1   . ILE A 1 160 ? 2.982   -9.425  7.623   1.00 27.70 ? 160 ILE A CG1   1 
ATOM   1252 C CG2   . ILE A 1 160 ? 2.393   -11.867 7.651   1.00 26.10 ? 160 ILE A CG2   1 
ATOM   1253 C CD1   . ILE A 1 160 ? 3.603   -9.372  6.268   1.00 35.96 ? 160 ILE A CD1   1 
ATOM   1254 N N     . LEU A 1 161 ? 3.605   -12.666 10.846  1.00 27.22 ? 161 LEU A N     1 
ATOM   1255 C CA    . LEU A 1 161 ? 3.495   -14.012 11.421  1.00 28.56 ? 161 LEU A CA    1 
ATOM   1256 C C     . LEU A 1 161 ? 2.696   -14.076 12.711  1.00 27.55 ? 161 LEU A C     1 
ATOM   1257 O O     . LEU A 1 161 ? 2.016   -15.073 12.966  1.00 26.75 ? 161 LEU A O     1 
ATOM   1258 C CB    . LEU A 1 161 ? 4.886   -14.589 11.671  1.00 27.97 ? 161 LEU A CB    1 
ATOM   1259 C CG    . LEU A 1 161 ? 5.397   -15.813 10.898  1.00 32.38 ? 161 LEU A CG    1 
ATOM   1260 C CD1   . LEU A 1 161 ? 4.519   -16.229 9.742   1.00 21.44 ? 161 LEU A CD1   1 
ATOM   1261 C CD2   . LEU A 1 161 ? 6.893   -15.649 10.493  1.00 25.21 ? 161 LEU A CD2   1 
ATOM   1262 N N     . TRP A 1 162 ? 2.797   -13.023 13.522  1.00 26.90 ? 162 TRP A N     1 
ATOM   1263 C CA    . TRP A 1 162 ? 2.123   -12.971 14.821  1.00 27.69 ? 162 TRP A CA    1 
ATOM   1264 C C     . TRP A 1 162 ? 0.729   -12.310 14.801  1.00 26.95 ? 162 TRP A C     1 
ATOM   1265 O O     . TRP A 1 162 ? 0.121   -12.107 15.852  1.00 27.36 ? 162 TRP A O     1 
ATOM   1266 C CB    . TRP A 1 162 ? 3.027   -12.303 15.862  1.00 26.76 ? 162 TRP A CB    1 
ATOM   1267 C CG    . TRP A 1 162 ? 3.762   -13.306 16.698  1.00 30.27 ? 162 TRP A CG    1 
ATOM   1268 C CD1   . TRP A 1 162 ? 3.426   -13.728 17.956  1.00 30.57 ? 162 TRP A CD1   1 
ATOM   1269 C CD2   . TRP A 1 162 ? 4.944   -14.034 16.333  1.00 29.16 ? 162 TRP A CD2   1 
ATOM   1270 N NE1   . TRP A 1 162 ? 4.328   -14.666 18.397  1.00 31.14 ? 162 TRP A NE1   1 
ATOM   1271 C CE2   . TRP A 1 162 ? 5.273   -14.870 17.427  1.00 30.02 ? 162 TRP A CE2   1 
ATOM   1272 C CE3   . TRP A 1 162 ? 5.768   -14.048 15.195  1.00 28.71 ? 162 TRP A CE3   1 
ATOM   1273 C CZ2   . TRP A 1 162 ? 6.386   -15.719 17.416  1.00 27.81 ? 162 TRP A CZ2   1 
ATOM   1274 C CZ3   . TRP A 1 162 ? 6.872   -14.898 15.182  1.00 29.16 ? 162 TRP A CZ3   1 
ATOM   1275 C CH2   . TRP A 1 162 ? 7.173   -15.719 16.287  1.00 28.67 ? 162 TRP A CH2   1 
ATOM   1276 N N     . SER A 1 163 ? 0.237   -11.996 13.606  1.00 26.20 ? 163 SER A N     1 
ATOM   1277 C CA    . SER A 1 163 ? -1.047  -11.321 13.427  1.00 25.80 ? 163 SER A CA    1 
ATOM   1278 C C     . SER A 1 163 ? -2.186  -12.311 13.174  1.00 26.61 ? 163 SER A C     1 
ATOM   1279 O O     . SER A 1 163 ? -1.944  -13.468 12.804  1.00 27.60 ? 163 SER A O     1 
ATOM   1280 C CB    . SER A 1 163 ? -0.950  -10.349 12.256  1.00 24.24 ? 163 SER A CB    1 
ATOM   1281 O OG    . SER A 1 163 ? -0.778  -11.044 11.029  1.00 26.22 ? 163 SER A OG    1 
ATOM   1282 N N     . GLU A 1 164 ? -3.418  -11.849 13.390  1.00 26.57 ? 164 GLU A N     1 
ATOM   1283 C CA    . GLU A 1 164 ? -4.633  -12.550 12.969  1.00 27.93 ? 164 GLU A CA    1 
ATOM   1284 C C     . GLU A 1 164 ? -4.684  -12.730 11.459  1.00 27.65 ? 164 GLU A C     1 
ATOM   1285 O O     . GLU A 1 164 ? -5.130  -13.759 10.968  1.00 28.62 ? 164 GLU A O     1 
ATOM   1286 C CB    . GLU A 1 164 ? -5.877  -11.757 13.381  1.00 28.16 ? 164 GLU A CB    1 
ATOM   1287 C CG    . GLU A 1 164 ? -6.447  -12.119 14.726  1.00 35.30 ? 164 GLU A CG    1 
ATOM   1288 C CD    . GLU A 1 164 ? -6.781  -13.603 14.846  1.00 41.55 ? 164 GLU A CD    1 
ATOM   1289 O OE1   . GLU A 1 164 ? -6.275  -14.217 15.808  1.00 41.06 ? 164 GLU A OE1   1 
ATOM   1290 O OE2   . GLU A 1 164 ? -7.525  -14.150 13.985  1.00 41.00 ? 164 GLU A OE2   1 
ATOM   1291 N N     . GLN A 1 165 ? -4.220  -11.714 10.738  1.00 27.61 ? 165 GLN A N     1 
ATOM   1292 C CA    . GLN A 1 165 ? -4.339  -11.648 9.291   1.00 27.65 ? 165 GLN A CA    1 
ATOM   1293 C C     . GLN A 1 165 ? -3.528  -12.723 8.540   1.00 29.18 ? 165 GLN A C     1 
ATOM   1294 O O     . GLN A 1 165 ? -3.893  -13.104 7.425   1.00 31.46 ? 165 GLN A O     1 
ATOM   1295 C CB    . GLN A 1 165 ? -4.012  -10.231 8.801   1.00 26.81 ? 165 GLN A CB    1 
ATOM   1296 C CG    . GLN A 1 165 ? -5.034  -9.153  9.232   1.00 25.97 ? 165 GLN A CG    1 
ATOM   1297 C CD    . GLN A 1 165 ? -4.691  -8.459  10.555  1.00 27.43 ? 165 GLN A CD    1 
ATOM   1298 O OE1   . GLN A 1 165 ? -4.050  -9.028  11.439  1.00 31.14 ? 165 GLN A OE1   1 
ATOM   1299 N NE2   . GLN A 1 165 ? -5.126  -7.219  10.689  1.00 25.50 ? 165 GLN A NE2   1 
ATOM   1300 N N     . PHE A 1 166 ? -2.440  -13.205 9.145   1.00 29.51 ? 166 PHE A N     1 
ATOM   1301 C CA    . PHE A 1 166 ? -1.641  -14.307 8.587   1.00 28.33 ? 166 PHE A CA    1 
ATOM   1302 C C     . PHE A 1 166 ? -2.504  -15.497 8.109   1.00 28.94 ? 166 PHE A C     1 
ATOM   1303 O O     . PHE A 1 166 ? -2.209  -16.089 7.079   1.00 29.76 ? 166 PHE A O     1 
ATOM   1304 C CB    . PHE A 1 166 ? -0.586  -14.792 9.604   1.00 27.06 ? 166 PHE A CB    1 
ATOM   1305 C CG    . PHE A 1 166 ? 0.156   -16.037 9.163   1.00 30.04 ? 166 PHE A CG    1 
ATOM   1306 C CD1   . PHE A 1 166 ? 1.179   -15.960 8.207   1.00 30.48 ? 166 PHE A CD1   1 
ATOM   1307 C CD2   . PHE A 1 166 ? -0.180  -17.286 9.674   1.00 25.05 ? 166 PHE A CD2   1 
ATOM   1308 C CE1   . PHE A 1 166 ? 1.856   -17.118 7.775   1.00 29.10 ? 166 PHE A CE1   1 
ATOM   1309 C CE2   . PHE A 1 166 ? 0.481   -18.448 9.236   1.00 27.45 ? 166 PHE A CE2   1 
ATOM   1310 C CZ    . PHE A 1 166 ? 1.500   -18.359 8.290   1.00 26.62 ? 166 PHE A CZ    1 
ATOM   1311 N N     . TYR A 1 167 ? -3.565  -15.835 8.849   1.00 28.31 ? 167 TYR A N     1 
ATOM   1312 C CA    . TYR A 1 167 ? -4.387  -17.010 8.541   1.00 27.15 ? 167 TYR A CA    1 
ATOM   1313 C C     . TYR A 1 167 ? -5.227  -16.858 7.278   1.00 27.88 ? 167 TYR A C     1 
ATOM   1314 O O     . TYR A 1 167 ? -5.743  -17.846 6.746   1.00 29.18 ? 167 TYR A O     1 
ATOM   1315 C CB    . TYR A 1 167 ? -5.219  -17.430 9.764   1.00 27.85 ? 167 TYR A CB    1 
ATOM   1316 C CG    . TYR A 1 167 ? -4.298  -17.744 10.920  1.00 29.22 ? 167 TYR A CG    1 
ATOM   1317 C CD1   . TYR A 1 167 ? -3.721  -19.015 11.056  1.00 26.14 ? 167 TYR A CD1   1 
ATOM   1318 C CD2   . TYR A 1 167 ? -3.932  -16.746 11.829  1.00 27.99 ? 167 TYR A CD2   1 
ATOM   1319 C CE1   . TYR A 1 167 ? -2.829  -19.286 12.081  1.00 30.91 ? 167 TYR A CE1   1 
ATOM   1320 C CE2   . TYR A 1 167 ? -3.039  -17.004 12.858  1.00 29.41 ? 167 TYR A CE2   1 
ATOM   1321 C CZ    . TYR A 1 167 ? -2.493  -18.272 12.978  1.00 31.12 ? 167 TYR A CZ    1 
ATOM   1322 O OH    . TYR A 1 167 ? -1.618  -18.518 13.998  1.00 33.00 ? 167 TYR A OH    1 
ATOM   1323 N N     . ASP A 1 168 ? -5.328  -15.626 6.781   1.00 26.93 ? 168 ASP A N     1 
ATOM   1324 C CA    . ASP A 1 168 ? -5.978  -15.339 5.495   1.00 27.04 ? 168 ASP A CA    1 
ATOM   1325 C C     . ASP A 1 168 ? -5.260  -15.994 4.317   1.00 26.13 ? 168 ASP A C     1 
ATOM   1326 O O     . ASP A 1 168 ? -5.866  -16.251 3.280   1.00 25.60 ? 168 ASP A O     1 
ATOM   1327 C CB    . ASP A 1 168 ? -6.095  -13.831 5.267   1.00 26.76 ? 168 ASP A CB    1 
ATOM   1328 C CG    . ASP A 1 168 ? -7.045  -13.158 6.251   1.00 28.33 ? 168 ASP A CG    1 
ATOM   1329 O OD1   . ASP A 1 168 ? -7.824  -13.885 6.919   1.00 29.78 ? 168 ASP A OD1   1 
ATOM   1330 O OD2   . ASP A 1 168 ? -7.031  -11.897 6.341   1.00 27.15 ? 168 ASP A OD2   1 
ATOM   1331 N N     . PHE A 1 169 ? -3.964  -16.256 4.495   1.00 27.23 ? 169 PHE A N     1 
ATOM   1332 C CA    . PHE A 1 169 ? -3.135  -16.941 3.517   1.00 25.45 ? 169 PHE A CA    1 
ATOM   1333 C C     . PHE A 1 169 ? -3.740  -18.306 3.148   1.00 26.58 ? 169 PHE A C     1 
ATOM   1334 O O     . PHE A 1 169 ? -3.671  -18.728 2.003   1.00 28.31 ? 169 PHE A O     1 
ATOM   1335 C CB    . PHE A 1 169 ? -1.725  -17.154 4.096   1.00 26.12 ? 169 PHE A CB    1 
ATOM   1336 C CG    . PHE A 1 169 ? -0.748  -16.035 3.808   1.00 27.62 ? 169 PHE A CG    1 
ATOM   1337 C CD1   . PHE A 1 169 ? -0.359  -15.738 2.496   1.00 26.76 ? 169 PHE A CD1   1 
ATOM   1338 C CD2   . PHE A 1 169 ? -0.176  -15.312 4.844   1.00 27.70 ? 169 PHE A CD2   1 
ATOM   1339 C CE1   . PHE A 1 169 ? 0.558   -14.717 2.223   1.00 24.03 ? 169 PHE A CE1   1 
ATOM   1340 C CE2   . PHE A 1 169 ? 0.755   -14.297 4.582   1.00 25.49 ? 169 PHE A CE2   1 
ATOM   1341 C CZ    . PHE A 1 169 ? 1.121   -14.006 3.267   1.00 28.37 ? 169 PHE A CZ    1 
ATOM   1342 N N     . PHE A 1 170 ? -4.317  -18.999 4.125   1.00 26.18 ? 170 PHE A N     1 
ATOM   1343 C CA    . PHE A 1 170 ? -4.910  -20.314 3.874   1.00 28.13 ? 170 PHE A CA    1 
ATOM   1344 C C     . PHE A 1 170 ? -6.074  -20.246 2.871   1.00 30.00 ? 170 PHE A C     1 
ATOM   1345 O O     . PHE A 1 170 ? -6.293  -21.197 2.129   1.00 30.98 ? 170 PHE A O     1 
ATOM   1346 C CB    . PHE A 1 170 ? -5.334  -20.996 5.186   1.00 26.22 ? 170 PHE A CB    1 
ATOM   1347 C CG    . PHE A 1 170 ? -4.180  -21.428 6.034   1.00 26.41 ? 170 PHE A CG    1 
ATOM   1348 C CD1   . PHE A 1 170 ? -3.569  -22.667 5.826   1.00 28.04 ? 170 PHE A CD1   1 
ATOM   1349 C CD2   . PHE A 1 170 ? -3.691  -20.596 7.037   1.00 24.63 ? 170 PHE A CD2   1 
ATOM   1350 C CE1   . PHE A 1 170 ? -2.477  -23.073 6.622   1.00 29.59 ? 170 PHE A CE1   1 
ATOM   1351 C CE2   . PHE A 1 170 ? -2.618  -20.974 7.830   1.00 25.37 ? 170 PHE A CE2   1 
ATOM   1352 C CZ    . PHE A 1 170 ? -1.994  -22.216 7.620   1.00 28.53 ? 170 PHE A CZ    1 
ATOM   1353 N N     . ARG A 1 171 ? -6.805  -19.126 2.869   1.00 30.26 ? 171 ARG A N     1 
ATOM   1354 C CA    . ARG A 1 171 ? -7.754  -18.801 1.810   1.00 32.12 ? 171 ARG A CA    1 
ATOM   1355 C C     . ARG A 1 171 ? -7.032  -18.438 0.490   1.00 31.69 ? 171 ARG A C     1 
ATOM   1356 O O     . ARG A 1 171 ? -7.337  -19.014 -0.565  1.00 31.19 ? 171 ARG A O     1 
ATOM   1357 C CB    . ARG A 1 171 ? -8.686  -17.662 2.257   1.00 30.40 ? 171 ARG A CB    1 
ATOM   1358 C CG    . ARG A 1 171 ? -9.916  -17.488 1.368   1.00 37.55 ? 171 ARG A CG    1 
ATOM   1359 C CD    . ARG A 1 171 ? -11.043 -16.644 2.014   1.00 37.19 ? 171 ARG A CD    1 
ATOM   1360 N NE    . ARG A 1 171 ? -10.713 -15.217 2.125   1.00 41.51 ? 171 ARG A NE    1 
ATOM   1361 C CZ    . ARG A 1 171 ? -10.363 -14.614 3.264   1.00 43.59 ? 171 ARG A CZ    1 
ATOM   1362 N NH1   . ARG A 1 171 ? -10.294 -15.307 4.400   1.00 41.83 ? 171 ARG A NH1   1 
ATOM   1363 N NH2   . ARG A 1 171 ? -10.076 -13.314 3.268   1.00 41.41 ? 171 ARG A NH2   1 
ATOM   1364 N N     . TYR A 1 172 ? -6.078  -17.504 0.558   1.00 29.51 ? 172 TYR A N     1 
ATOM   1365 C CA    . TYR A 1 172 ? -5.416  -16.959 -0.638  1.00 29.25 ? 172 TYR A CA    1 
ATOM   1366 C C     . TYR A 1 172 ? -4.718  -18.006 -1.503  1.00 29.83 ? 172 TYR A C     1 
ATOM   1367 O O     . TYR A 1 172 ? -4.751  -17.915 -2.735  1.00 30.53 ? 172 TYR A O     1 
ATOM   1368 C CB    . TYR A 1 172 ? -4.398  -15.841 -0.288  1.00 27.98 ? 172 TYR A CB    1 
ATOM   1369 C CG    . TYR A 1 172 ? -4.966  -14.650 0.459   1.00 25.35 ? 172 TYR A CG    1 
ATOM   1370 C CD1   . TYR A 1 172 ? -6.321  -14.295 0.342   1.00 27.18 ? 172 TYR A CD1   1 
ATOM   1371 C CD2   . TYR A 1 172 ? -4.155  -13.876 1.284   1.00 23.32 ? 172 TYR A CD2   1 
ATOM   1372 C CE1   . TYR A 1 172 ? -6.845  -13.197 1.037   1.00 26.97 ? 172 TYR A CE1   1 
ATOM   1373 C CE2   . TYR A 1 172 ? -4.673  -12.770 1.981   1.00 23.53 ? 172 TYR A CE2   1 
ATOM   1374 C CZ    . TYR A 1 172 ? -6.014  -12.433 1.852   1.00 26.02 ? 172 TYR A CZ    1 
ATOM   1375 O OH    . TYR A 1 172 ? -6.527  -11.340 2.538   1.00 22.77 ? 172 TYR A OH    1 
ATOM   1376 N N     . VAL A 1 173 ? -4.080  -18.987 -0.862  1.00 29.07 ? 173 VAL A N     1 
ATOM   1377 C CA    . VAL A 1 173 ? -3.326  -20.034 -1.582  1.00 28.03 ? 173 VAL A CA    1 
ATOM   1378 C C     . VAL A 1 173 ? -4.214  -21.032 -2.366  1.00 29.81 ? 173 VAL A C     1 
ATOM   1379 O O     . VAL A 1 173 ? -3.709  -21.847 -3.146  1.00 28.80 ? 173 VAL A O     1 
ATOM   1380 C CB    . VAL A 1 173 ? -2.346  -20.796 -0.649  1.00 28.91 ? 173 VAL A CB    1 
ATOM   1381 C CG1   . VAL A 1 173 ? -1.365  -19.815 0.071   1.00 21.72 ? 173 VAL A CG1   1 
ATOM   1382 C CG2   . VAL A 1 173 ? -3.109  -21.690 0.337   1.00 27.72 ? 173 VAL A CG2   1 
ATOM   1383 N N     . GLU A 1 174 ? -5.527  -20.950 -2.153  1.00 28.94 ? 174 GLU A N     1 
ATOM   1384 C CA    . GLU A 1 174 ? -6.500  -21.823 -2.791  1.00 30.56 ? 174 GLU A CA    1 
ATOM   1385 C C     . GLU A 1 174 ? -7.438  -21.051 -3.727  1.00 30.15 ? 174 GLU A C     1 
ATOM   1386 O O     . GLU A 1 174 ? -8.429  -21.585 -4.199  1.00 28.90 ? 174 GLU A O     1 
ATOM   1387 C CB    . GLU A 1 174 ? -7.336  -22.533 -1.721  1.00 31.66 ? 174 GLU A CB    1 
ATOM   1388 C CG    . GLU A 1 174 ? -6.545  -23.532 -0.903  1.00 34.41 ? 174 GLU A CG    1 
ATOM   1389 C CD    . GLU A 1 174 ? -7.263  -24.867 -0.773  1.00 42.14 ? 174 GLU A CD    1 
ATOM   1390 O OE1   . GLU A 1 174 ? -7.552  -25.481 -1.828  1.00 41.71 ? 174 GLU A OE1   1 
ATOM   1391 O OE2   . GLU A 1 174 ? -7.522  -25.311 0.375   1.00 44.08 ? 174 GLU A OE2   1 
ATOM   1392 N N     . MET A 1 175 ? -7.117  -19.786 -3.963  1.00 31.53 ? 175 MET A N     1 
ATOM   1393 C CA    . MET A 1 175 ? -7.852  -18.908 -4.861  1.00 33.40 ? 175 MET A CA    1 
ATOM   1394 C C     . MET A 1 175 ? -7.860  -19.540 -6.259  1.00 31.14 ? 175 MET A C     1 
ATOM   1395 O O     . MET A 1 175 ? -6.844  -20.125 -6.694  1.00 30.19 ? 175 MET A O     1 
ATOM   1396 C CB    . MET A 1 175 ? -7.085  -17.605 -4.913  1.00 32.02 ? 175 MET A CB    1 
ATOM   1397 C CG    . MET A 1 175 ? -7.878  -16.360 -5.026  1.00 38.20 ? 175 MET A CG    1 
ATOM   1398 S SD    . MET A 1 175 ? -6.712  -14.972 -5.089  1.00 42.87 ? 175 MET A SD    1 
ATOM   1399 C CE    . MET A 1 175 ? -6.275  -14.833 -3.362  1.00 34.77 ? 175 MET A CE    1 
ATOM   1400 N N     . SER A 1 176 ? -8.990  -19.441 -6.956  1.00 26.01 ? 176 SER A N     1 
ATOM   1401 C CA    . SER A 1 176 ? -9.126  -20.103 -8.248  1.00 23.99 ? 176 SER A CA    1 
ATOM   1402 C C     . SER A 1 176 ? -8.326  -19.469 -9.409  1.00 22.17 ? 176 SER A C     1 
ATOM   1403 O O     . SER A 1 176 ? -8.035  -20.156 -10.382 1.00 20.31 ? 176 SER A O     1 
ATOM   1404 C CB    . SER A 1 176 ? -10.596 -20.298 -8.614  1.00 23.08 ? 176 SER A CB    1 
ATOM   1405 O OG    . SER A 1 176 ? -11.177 -19.053 -8.921  1.00 32.04 ? 176 SER A OG    1 
ATOM   1406 N N     . THR A 1 177 ? -7.982  -18.180 -9.308  1.00 20.43 ? 177 THR A N     1 
ATOM   1407 C CA    . THR A 1 177 ? -7.007  -17.555 -10.213 1.00 20.79 ? 177 THR A CA    1 
ATOM   1408 C C     . THR A 1 177 ? -5.602  -17.995 -9.765  1.00 22.19 ? 177 THR A C     1 
ATOM   1409 O O     . THR A 1 177 ? -5.111  -17.581 -8.706  1.00 21.28 ? 177 THR A O     1 
ATOM   1410 C CB    . THR A 1 177 ? -7.101  -15.992 -10.249 1.00 20.47 ? 177 THR A CB    1 
ATOM   1411 O OG1   . THR A 1 177 ? -7.037  -15.469 -8.921  1.00 26.61 ? 177 THR A OG1   1 
ATOM   1412 C CG2   . THR A 1 177 ? -8.391  -15.508 -10.898 1.00 18.58 ? 177 THR A CG2   1 
ATOM   1413 N N     . PHE A 1 178 ? -4.980  -18.850 -10.571 1.00 22.33 ? 178 PHE A N     1 
ATOM   1414 C CA    . PHE A 1 178 ? -3.781  -19.586 -10.179 1.00 23.54 ? 178 PHE A CA    1 
ATOM   1415 C C     . PHE A 1 178 ? -2.532  -18.723 -10.081 1.00 24.95 ? 178 PHE A C     1 
ATOM   1416 O O     . PHE A 1 178 ? -1.649  -18.991 -9.258  1.00 26.55 ? 178 PHE A O     1 
ATOM   1417 C CB    . PHE A 1 178 ? -3.533  -20.758 -11.147 1.00 23.93 ? 178 PHE A CB    1 
ATOM   1418 C CG    . PHE A 1 178 ? -2.318  -21.562 -10.814 1.00 24.31 ? 178 PHE A CG    1 
ATOM   1419 C CD1   . PHE A 1 178 ? -2.233  -22.255 -9.603  1.00 27.30 ? 178 PHE A CD1   1 
ATOM   1420 C CD2   . PHE A 1 178 ? -1.244  -21.609 -11.690 1.00 24.54 ? 178 PHE A CD2   1 
ATOM   1421 C CE1   . PHE A 1 178 ? -1.096  -22.992 -9.274  1.00 24.55 ? 178 PHE A CE1   1 
ATOM   1422 C CE2   . PHE A 1 178 ? -0.088  -22.341 -11.374 1.00 23.09 ? 178 PHE A CE2   1 
ATOM   1423 C CZ    . PHE A 1 178 ? -0.016  -23.036 -10.168 1.00 26.75 ? 178 PHE A CZ    1 
ATOM   1424 N N     . ASP A 1 179 ? -2.449  -17.695 -10.917 1.00 25.01 ? 179 ASP A N     1 
ATOM   1425 C CA    . ASP A 1 179 ? -1.352  -16.731 -10.830 1.00 25.21 ? 179 ASP A CA    1 
ATOM   1426 C C     . ASP A 1 179 ? -1.295  -16.049 -9.443  1.00 26.30 ? 179 ASP A C     1 
ATOM   1427 O O     . ASP A 1 179 ? -0.214  -15.877 -8.877  1.00 27.44 ? 179 ASP A O     1 
ATOM   1428 C CB    . ASP A 1 179 ? -1.441  -15.691 -11.953 1.00 25.10 ? 179 ASP A CB    1 
ATOM   1429 C CG    . ASP A 1 179 ? -2.780  -14.925 -11.974 1.00 29.71 ? 179 ASP A CG    1 
ATOM   1430 O OD1   . ASP A 1 179 ? -3.831  -15.435 -11.513 1.00 29.64 ? 179 ASP A OD1   1 
ATOM   1431 O OD2   . ASP A 1 179 ? -2.780  -13.786 -12.483 1.00 39.23 ? 179 ASP A OD2   1 
ATOM   1432 N N     . ILE A 1 180 ? -2.448  -15.693 -8.878  1.00 26.53 ? 180 ILE A N     1 
ATOM   1433 C CA    . ILE A 1 180 ? -2.451  -15.050 -7.561  1.00 25.54 ? 180 ILE A CA    1 
ATOM   1434 C C     . ILE A 1 180 ? -2.242  -16.052 -6.419  1.00 25.93 ? 180 ILE A C     1 
ATOM   1435 O O     . ILE A 1 180 ? -1.456  -15.793 -5.509  1.00 24.74 ? 180 ILE A O     1 
ATOM   1436 C CB    . ILE A 1 180 ? -3.696  -14.162 -7.345  1.00 25.17 ? 180 ILE A CB    1 
ATOM   1437 C CG1   . ILE A 1 180 ? -3.717  -13.036 -8.374  1.00 24.96 ? 180 ILE A CG1   1 
ATOM   1438 C CG2   . ILE A 1 180 ? -3.683  -13.547 -5.953  1.00 24.39 ? 180 ILE A CG2   1 
ATOM   1439 C CD1   . ILE A 1 180 ? -5.104  -12.417 -8.569  1.00 33.82 ? 180 ILE A CD1   1 
ATOM   1440 N N     . ALA A 1 181 ? -2.932  -17.199 -6.483  1.00 25.24 ? 181 ALA A N     1 
ATOM   1441 C CA    . ALA A 1 181 ? -2.727  -18.295 -5.539  1.00 25.12 ? 181 ALA A CA    1 
ATOM   1442 C C     . ALA A 1 181 ? -1.249  -18.737 -5.436  1.00 26.19 ? 181 ALA A C     1 
ATOM   1443 O O     . ALA A 1 181 ? -0.728  -18.961 -4.341  1.00 27.45 ? 181 ALA A O     1 
ATOM   1444 C CB    . ALA A 1 181 ? -3.611  -19.463 -5.909  1.00 25.10 ? 181 ALA A CB    1 
ATOM   1445 N N     . SER A 1 182 ? -0.583  -18.850 -6.581  1.00 27.60 ? 182 SER A N     1 
ATOM   1446 C CA    . SER A 1 182 ? 0.853   -19.170 -6.664  1.00 27.40 ? 182 SER A CA    1 
ATOM   1447 C C     . SER A 1 182 ? 1.729   -18.124 -6.005  1.00 26.84 ? 182 SER A C     1 
ATOM   1448 O O     . SER A 1 182 ? 2.640   -18.461 -5.245  1.00 27.99 ? 182 SER A O     1 
ATOM   1449 C CB    . SER A 1 182 ? 1.275   -19.291 -8.130  1.00 26.44 ? 182 SER A CB    1 
ATOM   1450 O OG    . SER A 1 182 ? 0.761   -20.495 -8.660  1.00 31.83 ? 182 SER A OG    1 
ATOM   1451 N N     . ASP A 1 183 ? 1.470   -16.860 -6.342  1.00 26.45 ? 183 ASP A N     1 
ATOM   1452 C CA    . ASP A 1 183 ? 2.115   -15.702 -5.719  1.00 26.77 ? 183 ASP A CA    1 
ATOM   1453 C C     . ASP A 1 183 ? 1.983   -15.722 -4.186  1.00 25.90 ? 183 ASP A C     1 
ATOM   1454 O O     . ASP A 1 183 ? 2.972   -15.517 -3.475  1.00 27.66 ? 183 ASP A O     1 
ATOM   1455 C CB    . ASP A 1 183 ? 1.531   -14.410 -6.314  1.00 26.28 ? 183 ASP A CB    1 
ATOM   1456 C CG    . ASP A 1 183 ? 2.351   -13.176 -5.970  1.00 33.04 ? 183 ASP A CG    1 
ATOM   1457 O OD1   . ASP A 1 183 ? 3.136   -12.726 -6.833  1.00 38.77 ? 183 ASP A OD1   1 
ATOM   1458 O OD2   . ASP A 1 183 ? 2.217   -12.650 -4.841  1.00 37.83 ? 183 ASP A OD2   1 
ATOM   1459 N N     . ALA A 1 184 ? 0.777   -16.004 -3.686  1.00 24.80 ? 184 ALA A N     1 
ATOM   1460 C CA    . ALA A 1 184 ? 0.486   -16.020 -2.246  1.00 23.95 ? 184 ALA A CA    1 
ATOM   1461 C C     . ALA A 1 184 ? 1.156   -17.178 -1.525  1.00 25.59 ? 184 ALA A C     1 
ATOM   1462 O O     . ALA A 1 184 ? 1.624   -17.024 -0.386  1.00 25.07 ? 184 ALA A O     1 
ATOM   1463 C CB    . ALA A 1 184 ? -1.015  -16.075 -2.010  1.00 23.12 ? 184 ALA A CB    1 
ATOM   1464 N N     . PHE A 1 185 ? 1.164   -18.346 -2.169  1.00 24.89 ? 185 PHE A N     1 
ATOM   1465 C CA    . PHE A 1 185 ? 1.851   -19.492 -1.615  1.00 26.26 ? 185 PHE A CA    1 
ATOM   1466 C C     . PHE A 1 185 ? 3.357   -19.253 -1.572  1.00 28.30 ? 185 PHE A C     1 
ATOM   1467 O O     . PHE A 1 185 ? 4.015   -19.716 -0.642  1.00 30.95 ? 185 PHE A O     1 
ATOM   1468 C CB    . PHE A 1 185 ? 1.528   -20.787 -2.375  1.00 26.94 ? 185 PHE A CB    1 
ATOM   1469 C CG    . PHE A 1 185 ? 2.079   -22.022 -1.708  1.00 29.60 ? 185 PHE A CG    1 
ATOM   1470 C CD1   . PHE A 1 185 ? 3.350   -22.505 -2.037  1.00 27.84 ? 185 PHE A CD1   1 
ATOM   1471 C CD2   . PHE A 1 185 ? 1.346   -22.682 -0.732  1.00 28.33 ? 185 PHE A CD2   1 
ATOM   1472 C CE1   . PHE A 1 185 ? 3.852   -23.630 -1.423  1.00 28.43 ? 185 PHE A CE1   1 
ATOM   1473 C CE2   . PHE A 1 185 ? 1.853   -23.805 -0.107  1.00 29.16 ? 185 PHE A CE2   1 
ATOM   1474 C CZ    . PHE A 1 185 ? 3.113   -24.279 -0.449  1.00 28.08 ? 185 PHE A CZ    1 
ATOM   1475 N N     . ALA A 1 186 ? 3.896   -18.522 -2.553  1.00 27.75 ? 186 ALA A N     1 
ATOM   1476 C CA    . ALA A 1 186 ? 5.320   -18.145 -2.534  1.00 28.90 ? 186 ALA A CA    1 
ATOM   1477 C C     . ALA A 1 186 ? 5.692   -17.277 -1.310  1.00 28.42 ? 186 ALA A C     1 
ATOM   1478 O O     . ALA A 1 186 ? 6.744   -17.460 -0.706  1.00 28.77 ? 186 ALA A O     1 
ATOM   1479 C CB    . ALA A 1 186 ? 5.730   -17.442 -3.861  1.00 27.44 ? 186 ALA A CB    1 
ATOM   1480 N N     . THR A 1 187 ? 4.813   -16.350 -0.952  1.00 28.56 ? 187 THR A N     1 
ATOM   1481 C CA    . THR A 1 187 ? 5.024   -15.450 0.174   1.00 28.90 ? 187 THR A CA    1 
ATOM   1482 C C     . THR A 1 187 ? 4.880   -16.221 1.494   1.00 28.40 ? 187 THR A C     1 
ATOM   1483 O O     . THR A 1 187 ? 5.630   -16.000 2.440   1.00 28.92 ? 187 THR A O     1 
ATOM   1484 C CB    . THR A 1 187 ? 4.004   -14.266 0.138   1.00 28.80 ? 187 THR A CB    1 
ATOM   1485 O OG1   . THR A 1 187 ? 4.173   -13.512 -1.069  1.00 31.43 ? 187 THR A OG1   1 
ATOM   1486 C CG2   . THR A 1 187 ? 4.194   -13.318 1.348   1.00 29.62 ? 187 THR A CG2   1 
ATOM   1487 N N     . PHE A 1 188 ? 3.905   -17.122 1.521   1.00 27.01 ? 188 PHE A N     1 
ATOM   1488 C CA    . PHE A 1 188 ? 3.567   -17.970 2.658   1.00 27.10 ? 188 PHE A CA    1 
ATOM   1489 C C     . PHE A 1 188 ? 4.744   -18.900 2.984   1.00 27.64 ? 188 PHE A C     1 
ATOM   1490 O O     . PHE A 1 188 ? 5.142   -19.025 4.144   1.00 26.73 ? 188 PHE A O     1 
ATOM   1491 C CB    . PHE A 1 188 ? 2.286   -18.732 2.264   1.00 26.94 ? 188 PHE A CB    1 
ATOM   1492 C CG    . PHE A 1 188 ? 1.847   -19.783 3.226   1.00 28.09 ? 188 PHE A CG    1 
ATOM   1493 C CD1   . PHE A 1 188 ? 1.150   -19.447 4.382   1.00 21.05 ? 188 PHE A CD1   1 
ATOM   1494 C CD2   . PHE A 1 188 ? 2.072   -21.135 2.941   1.00 28.80 ? 188 PHE A CD2   1 
ATOM   1495 C CE1   . PHE A 1 188 ? 0.720   -20.435 5.263   1.00 18.52 ? 188 PHE A CE1   1 
ATOM   1496 C CE2   . PHE A 1 188 ? 1.638   -22.130 3.806   1.00 21.82 ? 188 PHE A CE2   1 
ATOM   1497 C CZ    . PHE A 1 188 ? 0.962   -21.783 4.978   1.00 24.51 ? 188 PHE A CZ    1 
ATOM   1498 N N     . LYS A 1 189 ? 5.318   -19.511 1.943   1.00 26.99 ? 189 LYS A N     1 
ATOM   1499 C CA    . LYS A 1 189 ? 6.446   -20.420 2.073   1.00 27.26 ? 189 LYS A CA    1 
ATOM   1500 C C     . LYS A 1 189 ? 7.705   -19.661 2.539   1.00 27.73 ? 189 LYS A C     1 
ATOM   1501 O O     . LYS A 1 189 ? 8.401   -20.096 3.455   1.00 26.92 ? 189 LYS A O     1 
ATOM   1502 C CB    . LYS A 1 189 ? 6.675   -21.184 0.750   1.00 27.03 ? 189 LYS A CB    1 
ATOM   1503 C CG    . LYS A 1 189 ? 7.959   -22.023 0.710   1.00 28.02 ? 189 LYS A CG    1 
ATOM   1504 C CD    . LYS A 1 189 ? 8.174   -22.741 -0.629  1.00 27.46 ? 189 LYS A CD    1 
ATOM   1505 C CE    . LYS A 1 189 ? 9.555   -23.422 -0.657  1.00 29.92 ? 189 LYS A CE    1 
ATOM   1506 N NZ    . LYS A 1 189 ? 10.026  -23.895 -2.026  1.00 28.60 ? 189 LYS A NZ    1 
ATOM   1507 N N     . ASP A 1 190 ? 7.973   -18.514 1.919   1.00 27.06 ? 190 ASP A N     1 
ATOM   1508 C CA    . ASP A 1 190 ? 9.052   -17.642 2.351   1.00 27.04 ? 190 ASP A CA    1 
ATOM   1509 C C     . ASP A 1 190 ? 8.969   -17.288 3.859   1.00 27.65 ? 190 ASP A C     1 
ATOM   1510 O O     . ASP A 1 190 ? 9.969   -17.405 4.578   1.00 28.62 ? 190 ASP A O     1 
ATOM   1511 C CB    . ASP A 1 190 ? 9.089   -16.380 1.483   1.00 27.62 ? 190 ASP A CB    1 
ATOM   1512 C CG    . ASP A 1 190 ? 10.367  -15.600 1.655   1.00 29.37 ? 190 ASP A CG    1 
ATOM   1513 O OD1   . ASP A 1 190 ? 10.584  -15.007 2.732   1.00 31.97 ? 190 ASP A OD1   1 
ATOM   1514 O OD2   . ASP A 1 190 ? 11.172  -15.582 0.713   1.00 37.63 ? 190 ASP A OD2   1 
ATOM   1515 N N     . LEU A 1 191 ? 7.789   -16.867 4.321   1.00 25.50 ? 191 LEU A N     1 
ATOM   1516 C CA    . LEU A 1 191 ? 7.541   -16.585 5.731   1.00 25.98 ? 191 LEU A CA    1 
ATOM   1517 C C     . LEU A 1 191 ? 7.909   -17.731 6.687   1.00 26.51 ? 191 LEU A C     1 
ATOM   1518 O O     . LEU A 1 191 ? 8.461   -17.511 7.775   1.00 26.80 ? 191 LEU A O     1 
ATOM   1519 C CB    . LEU A 1 191 ? 6.065   -16.222 5.931   1.00 25.91 ? 191 LEU A CB    1 
ATOM   1520 C CG    . LEU A 1 191 ? 5.662   -14.770 5.641   1.00 29.10 ? 191 LEU A CG    1 
ATOM   1521 C CD1   . LEU A 1 191 ? 4.149   -14.597 5.688   1.00 20.61 ? 191 LEU A CD1   1 
ATOM   1522 C CD2   . LEU A 1 191 ? 6.353   -13.789 6.621   1.00 24.86 ? 191 LEU A CD2   1 
ATOM   1523 N N     . LEU A 1 192 ? 7.586   -18.950 6.272   1.00 26.37 ? 192 LEU A N     1 
ATOM   1524 C CA    . LEU A 1 192 ? 7.781   -20.127 7.090   1.00 25.36 ? 192 LEU A CA    1 
ATOM   1525 C C     . LEU A 1 192 ? 9.184   -20.700 6.992   1.00 25.66 ? 192 LEU A C     1 
ATOM   1526 O O     . LEU A 1 192 ? 9.537   -21.549 7.807   1.00 23.84 ? 192 LEU A O     1 
ATOM   1527 C CB    . LEU A 1 192 ? 6.775   -21.204 6.694   1.00 24.47 ? 192 LEU A CB    1 
ATOM   1528 C CG    . LEU A 1 192 ? 5.314   -20.879 7.018   1.00 27.69 ? 192 LEU A CG    1 
ATOM   1529 C CD1   . LEU A 1 192 ? 4.404   -21.742 6.189   1.00 25.51 ? 192 LEU A CD1   1 
ATOM   1530 C CD2   . LEU A 1 192 ? 5.058   -21.060 8.507   1.00 27.20 ? 192 LEU A CD2   1 
ATOM   1531 N N     . THR A 1 193 ? 9.976   -20.246 6.010   1.00 25.51 ? 193 THR A N     1 
ATOM   1532 C CA    . THR A 1 193 ? 11.270  -20.883 5.725   1.00 27.42 ? 193 THR A CA    1 
ATOM   1533 C C     . THR A 1 193 ? 12.500  -19.968 5.721   1.00 27.34 ? 193 THR A C     1 
ATOM   1534 O O     . THR A 1 193 ? 13.618  -20.455 5.775   1.00 28.63 ? 193 THR A O     1 
ATOM   1535 C CB    . THR A 1 193 ? 11.254  -21.646 4.381   1.00 27.84 ? 193 THR A CB    1 
ATOM   1536 O OG1   . THR A 1 193 ? 10.932  -20.737 3.318   1.00 30.60 ? 193 THR A OG1   1 
ATOM   1537 C CG2   . THR A 1 193 ? 10.240  -22.815 4.391   1.00 25.89 ? 193 THR A CG2   1 
ATOM   1538 N N     . ARG A 1 194 ? 12.309  -18.658 5.631   1.00 27.93 ? 194 ARG A N     1 
ATOM   1539 C CA    . ARG A 1 194 ? 13.447  -17.745 5.484   1.00 27.79 ? 194 ARG A CA    1 
ATOM   1540 C C     . ARG A 1 194 ? 14.148  -17.470 6.820   1.00 28.20 ? 194 ARG A C     1 
ATOM   1541 O O     . ARG A 1 194 ? 15.353  -17.708 6.963   1.00 27.71 ? 194 ARG A O     1 
ATOM   1542 C CB    . ARG A 1 194 ? 13.010  -16.433 4.815   1.00 27.77 ? 194 ARG A CB    1 
ATOM   1543 C CG    . ARG A 1 194 ? 14.111  -15.376 4.677   1.00 26.84 ? 194 ARG A CG    1 
ATOM   1544 C CD    . ARG A 1 194 ? 13.569  -14.098 4.027   1.00 27.19 ? 194 ARG A CD    1 
ATOM   1545 N NE    . ARG A 1 194 ? 13.205  -14.306 2.622   1.00 25.75 ? 194 ARG A NE    1 
ATOM   1546 C CZ    . ARG A 1 194 ? 14.074  -14.306 1.604   1.00 28.42 ? 194 ARG A CZ    1 
ATOM   1547 N NH1   . ARG A 1 194 ? 15.375  -14.092 1.809   1.00 19.04 ? 194 ARG A NH1   1 
ATOM   1548 N NH2   . ARG A 1 194 ? 13.641  -14.528 0.368   1.00 22.63 ? 194 ARG A NH2   1 
ATOM   1549 N N     . HIS A 1 195 ? 13.392  -16.953 7.781   1.00 28.57 ? 195 HIS A N     1 
ATOM   1550 C CA    . HIS A 1 195 ? 13.923  -16.682 9.123   1.00 29.19 ? 195 HIS A CA    1 
ATOM   1551 C C     . HIS A 1 195 ? 13.518  -17.835 10.034  1.00 27.91 ? 195 HIS A C     1 
ATOM   1552 O O     . HIS A 1 195 ? 12.453  -17.839 10.670  1.00 28.87 ? 195 HIS A O     1 
ATOM   1553 C CB    . HIS A 1 195 ? 13.457  -15.313 9.637   1.00 28.12 ? 195 HIS A CB    1 
ATOM   1554 C CG    . HIS A 1 195 ? 13.905  -14.174 8.777   1.00 27.91 ? 195 HIS A CG    1 
ATOM   1555 N ND1   . HIS A 1 195 ? 13.035  -13.445 7.993   1.00 34.43 ? 195 HIS A ND1   1 
ATOM   1556 C CD2   . HIS A 1 195 ? 15.133  -13.654 8.556   1.00 32.12 ? 195 HIS A CD2   1 
ATOM   1557 C CE1   . HIS A 1 195 ? 13.707  -12.521 7.333   1.00 32.20 ? 195 HIS A CE1   1 
ATOM   1558 N NE2   . HIS A 1 195 ? 14.985  -12.632 7.651   1.00 35.47 ? 195 HIS A NE2   1 
ATOM   1559 N N     . LYS A 1 196 ? 14.392  -18.824 10.050  1.00 27.47 ? 196 LYS A N     1 
ATOM   1560 C CA    . LYS A 1 196 ? 14.109  -20.148 10.582  1.00 26.05 ? 196 LYS A CA    1 
ATOM   1561 C C     . LYS A 1 196 ? 13.910  -20.196 12.090  1.00 25.77 ? 196 LYS A C     1 
ATOM   1562 O O     . LYS A 1 196 ? 13.143  -21.015 12.591  1.00 27.00 ? 196 LYS A O     1 
ATOM   1563 C CB    . LYS A 1 196 ? 15.200  -21.126 10.133  1.00 25.12 ? 196 LYS A CB    1 
ATOM   1564 C CG    . LYS A 1 196 ? 15.075  -21.508 8.662   1.00 21.82 ? 196 LYS A CG    1 
ATOM   1565 C CD    . LYS A 1 196 ? 16.228  -22.382 8.201   1.00 26.17 ? 196 LYS A CD    1 
ATOM   1566 C CE    . LYS A 1 196 ? 16.146  -22.642 6.712   1.00 28.11 ? 196 LYS A CE    1 
ATOM   1567 N NZ    . LYS A 1 196 ? 14.822  -23.231 6.359   1.00 29.15 ? 196 LYS A NZ    1 
ATOM   1568 N N     . LEU A 1 197 ? 14.598  -19.326 12.812  1.00 26.08 ? 197 LEU A N     1 
ATOM   1569 C CA    . LEU A 1 197 ? 14.373  -19.214 14.242  1.00 27.16 ? 197 LEU A CA    1 
ATOM   1570 C C     . LEU A 1 197 ? 12.994  -18.618 14.518  1.00 27.81 ? 197 LEU A C     1 
ATOM   1571 O O     . LEU A 1 197 ? 12.231  -19.140 15.337  1.00 26.56 ? 197 LEU A O     1 
ATOM   1572 C CB    . LEU A 1 197 ? 15.467  -18.373 14.889  1.00 27.69 ? 197 LEU A CB    1 
ATOM   1573 C CG    . LEU A 1 197 ? 16.469  -19.149 15.727  1.00 32.38 ? 197 LEU A CG    1 
ATOM   1574 C CD1   . LEU A 1 197 ? 17.785  -18.367 15.823  1.00 37.37 ? 197 LEU A CD1   1 
ATOM   1575 C CD2   . LEU A 1 197 ? 15.882  -19.471 17.121  1.00 32.98 ? 197 LEU A CD2   1 
ATOM   1576 N N     . LEU A 1 198 ? 12.684  -17.533 13.807  1.00 28.45 ? 198 LEU A N     1 
ATOM   1577 C CA    . LEU A 1 198 ? 11.395  -16.855 13.903  1.00 28.68 ? 198 LEU A CA    1 
ATOM   1578 C C     . LEU A 1 198 ? 10.233  -17.789 13.557  1.00 28.95 ? 198 LEU A C     1 
ATOM   1579 O O     . LEU A 1 198 ? 9.191   -17.795 14.221  1.00 28.91 ? 198 LEU A O     1 
ATOM   1580 C CB    . LEU A 1 198 ? 11.386  -15.647 12.964  1.00 27.94 ? 198 LEU A CB    1 
ATOM   1581 C CG    . LEU A 1 198 ? 10.165  -14.741 13.006  1.00 24.70 ? 198 LEU A CG    1 
ATOM   1582 C CD1   . LEU A 1 198 ? 10.163  -13.960 14.319  1.00 27.63 ? 198 LEU A CD1   1 
ATOM   1583 C CD2   . LEU A 1 198 ? 10.174  -13.805 11.814  1.00 20.37 ? 198 LEU A CD2   1 
ATOM   1584 N N     . SER A 1 199 ? 10.434  -18.572 12.510  1.00 29.69 ? 199 SER A N     1 
ATOM   1585 C CA    . SER A 1 199 ? 9.445   -19.519 12.033  1.00 30.65 ? 199 SER A CA    1 
ATOM   1586 C C     . SER A 1 199 ? 9.242   -20.654 13.048  1.00 29.81 ? 199 SER A C     1 
ATOM   1587 O O     . SER A 1 199 ? 8.111   -21.075 13.297  1.00 30.51 ? 199 SER A O     1 
ATOM   1588 C CB    . SER A 1 199 ? 9.888   -20.067 10.671  1.00 30.72 ? 199 SER A CB    1 
ATOM   1589 O OG    . SER A 1 199 ? 9.089   -21.172 10.297  1.00 34.86 ? 199 SER A OG    1 
ATOM   1590 N N     . ALA A 1 200 ? 10.338  -21.135 13.634  1.00 28.24 ? 200 ALA A N     1 
ATOM   1591 C CA    . ALA A 1 200 ? 10.277  -22.192 14.637  1.00 27.50 ? 200 ALA A CA    1 
ATOM   1592 C C     . ALA A 1 200 ? 9.486   -21.722 15.856  1.00 27.52 ? 200 ALA A C     1 
ATOM   1593 O O     . ALA A 1 200 ? 8.671   -22.474 16.385  1.00 27.74 ? 200 ALA A O     1 
ATOM   1594 C CB    . ALA A 1 200 ? 11.689  -22.658 15.042  1.00 25.96 ? 200 ALA A CB    1 
ATOM   1595 N N     . GLU A 1 201 ? 9.733   -20.484 16.293  1.00 27.16 ? 201 GLU A N     1 
ATOM   1596 C CA    . GLU A 1 201 ? 9.015   -19.883 17.421  1.00 27.16 ? 201 GLU A CA    1 
ATOM   1597 C C     . GLU A 1 201 ? 7.526   -19.726 17.109  1.00 25.86 ? 201 GLU A C     1 
ATOM   1598 O O     . GLU A 1 201 ? 6.684   -20.093 17.927  1.00 25.15 ? 201 GLU A O     1 
ATOM   1599 C CB    . GLU A 1 201 ? 9.622   -18.532 17.807  1.00 26.09 ? 201 GLU A CB    1 
ATOM   1600 C CG    . GLU A 1 201 ? 10.984  -18.625 18.458  1.00 30.03 ? 201 GLU A CG    1 
ATOM   1601 C CD    . GLU A 1 201 ? 11.659  -17.267 18.656  1.00 30.67 ? 201 GLU A CD    1 
ATOM   1602 O OE1   . GLU A 1 201 ? 12.409  -17.123 19.647  1.00 29.64 ? 201 GLU A OE1   1 
ATOM   1603 O OE2   . GLU A 1 201 ? 11.455  -16.350 17.823  1.00 35.47 ? 201 GLU A OE2   1 
ATOM   1604 N N     . PHE A 1 202 ? 7.218   -19.178 15.931  1.00 26.43 ? 202 PHE A N     1 
ATOM   1605 C CA    . PHE A 1 202 ? 5.835   -19.058 15.447  1.00 26.90 ? 202 PHE A CA    1 
ATOM   1606 C C     . PHE A 1 202 ? 5.093   -20.394 15.498  1.00 27.05 ? 202 PHE A C     1 
ATOM   1607 O O     . PHE A 1 202 ? 3.975   -20.464 16.012  1.00 30.20 ? 202 PHE A O     1 
ATOM   1608 C CB    . PHE A 1 202 ? 5.780   -18.478 14.016  1.00 27.13 ? 202 PHE A CB    1 
ATOM   1609 C CG    . PHE A 1 202 ? 4.465   -18.735 13.313  1.00 27.09 ? 202 PHE A CG    1 
ATOM   1610 C CD1   . PHE A 1 202 ? 3.356   -17.926 13.563  1.00 20.65 ? 202 PHE A CD1   1 
ATOM   1611 C CD2   . PHE A 1 202 ? 4.328   -19.817 12.432  1.00 25.41 ? 202 PHE A CD2   1 
ATOM   1612 C CE1   . PHE A 1 202 ? 2.135   -18.191 12.945  1.00 24.20 ? 202 PHE A CE1   1 
ATOM   1613 C CE2   . PHE A 1 202 ? 3.119   -20.087 11.815  1.00 21.82 ? 202 PHE A CE2   1 
ATOM   1614 C CZ    . PHE A 1 202 ? 2.016   -19.268 12.071  1.00 23.71 ? 202 PHE A CZ    1 
ATOM   1615 N N     . LEU A 1 203 ? 5.718   -21.448 14.979  1.00 26.62 ? 203 LEU A N     1 
ATOM   1616 C CA    . LEU A 1 203 ? 5.092   -22.769 14.941  1.00 26.98 ? 203 LEU A CA    1 
ATOM   1617 C C     . LEU A 1 203 ? 4.867   -23.392 16.319  1.00 27.24 ? 203 LEU A C     1 
ATOM   1618 O O     . LEU A 1 203 ? 3.830   -24.017 16.540  1.00 27.18 ? 203 LEU A O     1 
ATOM   1619 C CB    . LEU A 1 203 ? 5.883   -23.739 14.065  1.00 25.81 ? 203 LEU A CB    1 
ATOM   1620 C CG    . LEU A 1 203 ? 6.050   -23.472 12.567  1.00 28.85 ? 203 LEU A CG    1 
ATOM   1621 C CD1   . LEU A 1 203 ? 7.107   -24.439 11.956  1.00 26.70 ? 203 LEU A CD1   1 
ATOM   1622 C CD2   . LEU A 1 203 ? 4.728   -23.558 11.816  1.00 22.81 ? 203 LEU A CD2   1 
ATOM   1623 N N     . GLU A 1 204 ? 5.835   -23.249 17.228  1.00 28.18 ? 204 GLU A N     1 
ATOM   1624 C CA    . GLU A 1 204 ? 5.659   -23.704 18.599  1.00 29.32 ? 204 GLU A CA    1 
ATOM   1625 C C     . GLU A 1 204 ? 4.516   -22.972 19.286  1.00 29.70 ? 204 GLU A C     1 
ATOM   1626 O O     . GLU A 1 204 ? 3.687   -23.600 19.942  1.00 28.98 ? 204 GLU A O     1 
ATOM   1627 C CB    . GLU A 1 204 ? 6.941   -23.575 19.420  1.00 30.83 ? 204 GLU A CB    1 
ATOM   1628 C CG    . GLU A 1 204 ? 7.573   -24.921 19.849  1.00 35.88 ? 204 GLU A CG    1 
ATOM   1629 C CD    . GLU A 1 204 ? 6.815   -25.656 20.978  1.00 44.28 ? 204 GLU A CD    1 
ATOM   1630 O OE1   . GLU A 1 204 ? 7.421   -25.895 22.056  1.00 45.72 ? 204 GLU A OE1   1 
ATOM   1631 O OE2   . GLU A 1 204 ? 5.625   -26.014 20.791  1.00 47.33 ? 204 GLU A OE2   1 
ATOM   1632 N N     . GLN A 1 205 ? 4.454   -21.654 19.098  1.00 30.15 ? 205 GLN A N     1 
ATOM   1633 C CA    . GLN A 1 205 ? 3.467   -20.820 19.791  1.00 30.66 ? 205 GLN A CA    1 
ATOM   1634 C C     . GLN A 1 205 ? 2.055   -20.875 19.210  1.00 30.78 ? 205 GLN A C     1 
ATOM   1635 O O     . GLN A 1 205 ? 1.087   -20.618 19.923  1.00 31.16 ? 205 GLN A O     1 
ATOM   1636 C CB    . GLN A 1 205 ? 3.938   -19.370 19.839  1.00 30.87 ? 205 GLN A CB    1 
ATOM   1637 C CG    . GLN A 1 205 ? 5.091   -19.132 20.791  1.00 32.71 ? 205 GLN A CG    1 
ATOM   1638 C CD    . GLN A 1 205 ? 5.599   -17.710 20.734  1.00 35.17 ? 205 GLN A CD    1 
ATOM   1639 O OE1   . GLN A 1 205 ? 4.813   -16.756 20.687  1.00 36.80 ? 205 GLN A OE1   1 
ATOM   1640 N NE2   . GLN A 1 205 ? 6.920   -17.556 20.746  1.00 32.27 ? 205 GLN A NE2   1 
ATOM   1641 N N     . HIS A 1 206 ? 1.938   -21.192 17.924  1.00 30.20 ? 206 HIS A N     1 
ATOM   1642 C CA    . HIS A 1 206 ? 0.636   -21.197 17.253  1.00 29.30 ? 206 HIS A CA    1 
ATOM   1643 C C     . HIS A 1 206 ? 0.351   -22.577 16.681  1.00 28.97 ? 206 HIS A C     1 
ATOM   1644 O O     . HIS A 1 206 ? -0.456  -22.712 15.762  1.00 29.18 ? 206 HIS A O     1 
ATOM   1645 C CB    . HIS A 1 206 ? 0.596   -20.164 16.115  1.00 28.85 ? 206 HIS A CB    1 
ATOM   1646 C CG    . HIS A 1 206 ? 1.028   -18.785 16.518  1.00 29.78 ? 206 HIS A CG    1 
ATOM   1647 N ND1   . HIS A 1 206 ? 2.352   -18.436 16.687  1.00 31.15 ? 206 HIS A ND1   1 
ATOM   1648 C CD2   . HIS A 1 206 ? 0.311   -17.661 16.762  1.00 28.45 ? 206 HIS A CD2   1 
ATOM   1649 C CE1   . HIS A 1 206 ? 2.430   -17.161 17.030  1.00 31.98 ? 206 HIS A CE1   1 
ATOM   1650 N NE2   . HIS A 1 206 ? 1.206   -16.669 17.089  1.00 29.37 ? 206 HIS A NE2   1 
ATOM   1651 N N     . TYR A 1 207 ? 1.020   -23.594 17.226  1.00 27.73 ? 207 TYR A N     1 
ATOM   1652 C CA    . TYR A 1 207 ? 0.933   -24.962 16.712  1.00 27.11 ? 207 TYR A CA    1 
ATOM   1653 C C     . TYR A 1 207 ? -0.464  -25.388 16.293  1.00 28.04 ? 207 TYR A C     1 
ATOM   1654 O O     . TYR A 1 207 ? -0.677  -25.790 15.147  1.00 28.94 ? 207 TYR A O     1 
ATOM   1655 C CB    . TYR A 1 207 ? 1.487   -25.978 17.727  1.00 25.21 ? 207 TYR A CB    1 
ATOM   1656 C CG    . TYR A 1 207 ? 1.544   -27.374 17.152  1.00 23.99 ? 207 TYR A CG    1 
ATOM   1657 C CD1   . TYR A 1 207 ? 0.420   -28.214 17.171  1.00 23.78 ? 207 TYR A CD1   1 
ATOM   1658 C CD2   . TYR A 1 207 ? 2.709   -27.853 16.562  1.00 23.32 ? 207 TYR A CD2   1 
ATOM   1659 C CE1   . TYR A 1 207 ? 0.468   -29.509 16.622  1.00 20.94 ? 207 TYR A CE1   1 
ATOM   1660 C CE2   . TYR A 1 207 ? 2.767   -29.142 16.014  1.00 24.47 ? 207 TYR A CE2   1 
ATOM   1661 C CZ    . TYR A 1 207 ? 1.646   -29.956 16.044  1.00 22.09 ? 207 TYR A CZ    1 
ATOM   1662 O OH    . TYR A 1 207 ? 1.714   -31.204 15.488  1.00 23.39 ? 207 TYR A OH    1 
ATOM   1663 N N     . ASP A 1 208 ? -1.400  -25.312 17.238  1.00 29.76 ? 208 ASP A N     1 
ATOM   1664 C CA    . ASP A 1 208 ? -2.733  -25.888 17.087  1.00 30.65 ? 208 ASP A CA    1 
ATOM   1665 C C     . ASP A 1 208 ? -3.541  -25.210 15.985  1.00 30.38 ? 208 ASP A C     1 
ATOM   1666 O O     . ASP A 1 208 ? -4.112  -25.891 15.133  1.00 30.18 ? 208 ASP A O     1 
ATOM   1667 C CB    . ASP A 1 208 ? -3.502  -25.842 18.409  1.00 30.70 ? 208 ASP A CB    1 
ATOM   1668 C CG    . ASP A 1 208 ? -2.733  -26.482 19.578  1.00 37.21 ? 208 ASP A CG    1 
ATOM   1669 O OD1   . ASP A 1 208 ? -2.548  -27.727 19.607  1.00 38.04 ? 208 ASP A OD1   1 
ATOM   1670 O OD2   . ASP A 1 208 ? -2.336  -25.728 20.494  1.00 41.39 ? 208 ASP A OD2   1 
ATOM   1671 N N     . ARG A 1 209 ? -3.585  -23.880 15.988  1.00 29.75 ? 209 ARG A N     1 
ATOM   1672 C CA    . ARG A 1 209 ? -4.310  -23.164 14.939  1.00 29.20 ? 209 ARG A CA    1 
ATOM   1673 C C     . ARG A 1 209 ? -3.681  -23.375 13.551  1.00 29.07 ? 209 ARG A C     1 
ATOM   1674 O O     . ARG A 1 209 ? -4.391  -23.633 12.569  1.00 29.97 ? 209 ARG A O     1 
ATOM   1675 C CB    . ARG A 1 209 ? -4.434  -21.677 15.270  1.00 29.96 ? 209 ARG A CB    1 
ATOM   1676 C CG    . ARG A 1 209 ? -5.237  -20.899 14.236  1.00 30.05 ? 209 ARG A CG    1 
ATOM   1677 C CD    . ARG A 1 209 ? -5.674  -19.558 14.771  1.00 28.14 ? 209 ARG A CD    1 
ATOM   1678 N NE    . ARG A 1 209 ? -6.544  -18.865 13.824  1.00 27.20 ? 209 ARG A NE    1 
ATOM   1679 C CZ    . ARG A 1 209 ? -6.854  -17.577 13.916  1.00 28.05 ? 209 ARG A CZ    1 
ATOM   1680 N NH1   . ARG A 1 209 ? -6.359  -16.848 14.913  1.00 25.86 ? 209 ARG A NH1   1 
ATOM   1681 N NH2   . ARG A 1 209 ? -7.647  -17.015 13.010  1.00 27.90 ? 209 ARG A NH2   1 
ATOM   1682 N N     . PHE A 1 210 ? -2.355  -23.284 13.482  1.00 27.55 ? 210 PHE A N     1 
ATOM   1683 C CA    . PHE A 1 210 ? -1.633  -23.437 12.227  1.00 26.29 ? 210 PHE A CA    1 
ATOM   1684 C C     . PHE A 1 210 ? -1.869  -24.804 11.596  1.00 26.13 ? 210 PHE A C     1 
ATOM   1685 O O     . PHE A 1 210 ? -2.211  -24.888 10.407  1.00 25.58 ? 210 PHE A O     1 
ATOM   1686 C CB    . PHE A 1 210 ? -0.126  -23.188 12.412  1.00 25.24 ? 210 PHE A CB    1 
ATOM   1687 C CG    . PHE A 1 210 ? 0.672   -23.322 11.135  1.00 27.30 ? 210 PHE A CG    1 
ATOM   1688 C CD1   . PHE A 1 210 ? 0.751   -22.262 10.235  1.00 26.68 ? 210 PHE A CD1   1 
ATOM   1689 C CD2   . PHE A 1 210 ? 1.330   -24.517 10.821  1.00 28.22 ? 210 PHE A CD2   1 
ATOM   1690 C CE1   . PHE A 1 210 ? 1.492   -22.375 9.050   1.00 26.37 ? 210 PHE A CE1   1 
ATOM   1691 C CE2   . PHE A 1 210 ? 2.066   -24.644 9.621   1.00 22.31 ? 210 PHE A CE2   1 
ATOM   1692 C CZ    . PHE A 1 210 ? 2.135   -23.575 8.741   1.00 23.11 ? 210 PHE A CZ    1 
ATOM   1693 N N     . PHE A 1 211 ? -1.699  -25.869 12.385  1.00 26.30 ? 211 PHE A N     1 
ATOM   1694 C CA    . PHE A 1 211 ? -1.807  -27.230 11.840  1.00 25.65 ? 211 PHE A CA    1 
ATOM   1695 C C     . PHE A 1 211 ? -3.231  -27.652 11.614  1.00 25.92 ? 211 PHE A C     1 
ATOM   1696 O O     . PHE A 1 211 ? -3.484  -28.545 10.814  1.00 28.48 ? 211 PHE A O     1 
ATOM   1697 C CB    . PHE A 1 211 ? -0.997  -28.250 12.647  1.00 26.36 ? 211 PHE A CB    1 
ATOM   1698 C CG    . PHE A 1 211 ? 0.478   -28.173 12.361  1.00 27.59 ? 211 PHE A CG    1 
ATOM   1699 C CD1   . PHE A 1 211 ? 0.996   -28.676 11.161  1.00 29.40 ? 211 PHE A CD1   1 
ATOM   1700 C CD2   . PHE A 1 211 ? 1.338   -27.510 13.235  1.00 28.65 ? 211 PHE A CD2   1 
ATOM   1701 C CE1   . PHE A 1 211 ? 2.366   -28.557 10.857  1.00 28.96 ? 211 PHE A CE1   1 
ATOM   1702 C CE2   . PHE A 1 211 ? 2.706   -27.402 12.955  1.00 26.54 ? 211 PHE A CE2   1 
ATOM   1703 C CZ    . PHE A 1 211 ? 3.222   -27.927 11.761  1.00 27.95 ? 211 PHE A CZ    1 
ATOM   1704 N N     . SER A 1 212 ? -4.163  -27.003 12.303  1.00 25.87 ? 212 SER A N     1 
ATOM   1705 C CA    . SER A 1 212 ? -5.589  -27.187 12.030  1.00 26.30 ? 212 SER A CA    1 
ATOM   1706 C C     . SER A 1 212 ? -5.947  -26.619 10.635  1.00 26.47 ? 212 SER A C     1 
ATOM   1707 O O     . SER A 1 212 ? -6.640  -27.265 9.848   1.00 25.51 ? 212 SER A O     1 
ATOM   1708 C CB    . SER A 1 212 ? -6.410  -26.523 13.129  1.00 24.85 ? 212 SER A CB    1 
ATOM   1709 O OG    . SER A 1 212 ? -7.745  -26.355 12.723  1.00 31.62 ? 212 SER A OG    1 
ATOM   1710 N N     . GLU A 1 213 ? -5.438  -25.417 10.337  1.00 26.88 ? 213 GLU A N     1 
ATOM   1711 C CA    . GLU A 1 213 ? -5.563  -24.811 9.018   1.00 24.96 ? 213 GLU A CA    1 
ATOM   1712 C C     . GLU A 1 213 ? -4.767  -25.588 7.966   1.00 26.57 ? 213 GLU A C     1 
ATOM   1713 O O     . GLU A 1 213 ? -5.250  -25.778 6.845   1.00 24.71 ? 213 GLU A O     1 
ATOM   1714 C CB    . GLU A 1 213 ? -5.080  -23.363 9.052   1.00 24.82 ? 213 GLU A CB    1 
ATOM   1715 C CG    . GLU A 1 213 ? -5.918  -22.403 9.872   1.00 24.64 ? 213 GLU A CG    1 
ATOM   1716 C CD    . GLU A 1 213 ? -7.128  -21.865 9.124   1.00 30.88 ? 213 GLU A CD    1 
ATOM   1717 O OE1   . GLU A 1 213 ? -7.530  -22.461 8.095   1.00 30.13 ? 213 GLU A OE1   1 
ATOM   1718 O OE2   . GLU A 1 213 ? -7.687  -20.835 9.577   1.00 39.82 ? 213 GLU A OE2   1 
ATOM   1719 N N     . TYR A 1 214 ? -3.546  -26.021 8.323   1.00 27.97 ? 214 TYR A N     1 
ATOM   1720 C CA    . TYR A 1 214 ? -2.675  -26.747 7.394   1.00 27.97 ? 214 TYR A CA    1 
ATOM   1721 C C     . TYR A 1 214 ? -3.275  -28.089 6.982   1.00 29.56 ? 214 TYR A C     1 
ATOM   1722 O O     . TYR A 1 214 ? -3.134  -28.517 5.831   1.00 31.09 ? 214 TYR A O     1 
ATOM   1723 C CB    . TYR A 1 214 ? -1.249  -26.934 7.950   1.00 27.88 ? 214 TYR A CB    1 
ATOM   1724 C CG    . TYR A 1 214 ? -0.195  -26.991 6.855   1.00 25.89 ? 214 TYR A CG    1 
ATOM   1725 C CD1   . TYR A 1 214 ? 0.036   -28.162 6.125   1.00 22.18 ? 214 TYR A CD1   1 
ATOM   1726 C CD2   . TYR A 1 214 ? 0.540   -25.861 6.521   1.00 19.83 ? 214 TYR A CD2   1 
ATOM   1727 C CE1   . TYR A 1 214 ? 0.998   -28.196 5.088   1.00 21.48 ? 214 TYR A CE1   1 
ATOM   1728 C CE2   . TYR A 1 214 ? 1.474   -25.885 5.495   1.00 24.99 ? 214 TYR A CE2   1 
ATOM   1729 C CZ    . TYR A 1 214 ? 1.706   -27.058 4.792   1.00 25.21 ? 214 TYR A CZ    1 
ATOM   1730 O OH    . TYR A 1 214 ? 2.650   -27.053 3.790   1.00 29.48 ? 214 TYR A OH    1 
ATOM   1731 N N     . GLU A 1 215 ? -3.944  -28.744 7.922   1.00 30.34 ? 215 GLU A N     1 
ATOM   1732 C CA    . GLU A 1 215 ? -4.644  -29.997 7.664   1.00 32.36 ? 215 GLU A CA    1 
ATOM   1733 C C     . GLU A 1 215 ? -5.649  -29.865 6.524   1.00 31.84 ? 215 GLU A C     1 
ATOM   1734 O O     . GLU A 1 215 ? -5.818  -30.796 5.740   1.00 33.72 ? 215 GLU A O     1 
ATOM   1735 C CB    . GLU A 1 215 ? -5.347  -30.491 8.936   1.00 32.25 ? 215 GLU A CB    1 
ATOM   1736 C CG    . GLU A 1 215 ? -5.823  -31.949 8.871   1.00 34.67 ? 215 GLU A CG    1 
ATOM   1737 C CD    . GLU A 1 215 ? -6.425  -32.466 10.181  1.00 36.33 ? 215 GLU A CD    1 
ATOM   1738 O OE1   . GLU A 1 215 ? -6.629  -31.674 11.137  1.00 40.33 ? 215 GLU A OE1   1 
ATOM   1739 O OE2   . GLU A 1 215 ? -6.708  -33.685 10.251  1.00 42.41 ? 215 GLU A OE2   1 
ATOM   1740 N N     . LYS A 1 216 ? -6.316  -28.713 6.442   1.00 31.30 ? 216 LYS A N     1 
ATOM   1741 C CA    . LYS A 1 216 ? -7.290  -28.439 5.379   1.00 30.26 ? 216 LYS A CA    1 
ATOM   1742 C C     . LYS A 1 216 ? -6.679  -28.372 3.979   1.00 30.49 ? 216 LYS A C     1 
ATOM   1743 O O     . LYS A 1 216 ? -7.337  -28.726 2.997   1.00 30.86 ? 216 LYS A O     1 
ATOM   1744 C CB    . LYS A 1 216 ? -8.065  -27.156 5.682   1.00 31.26 ? 216 LYS A CB    1 
ATOM   1745 C CG    . LYS A 1 216 ? -9.145  -27.321 6.758   1.00 30.74 ? 216 LYS A CG    1 
ATOM   1746 C CD    . LYS A 1 216 ? -9.798  -25.995 7.128   1.00 29.25 ? 216 LYS A CD    1 
ATOM   1747 C CE    . LYS A 1 216 ? -10.496 -26.112 8.472   1.00 30.89 ? 216 LYS A CE    1 
ATOM   1748 N NZ    . LYS A 1 216 ? -11.039 -24.812 8.956   1.00 33.97 ? 216 LYS A NZ    1 
ATOM   1749 N N     . LEU A 1 217 ? -5.429  -27.907 3.899   1.00 30.84 ? 217 LEU A N     1 
ATOM   1750 C CA    . LEU A 1 217 ? -4.677  -27.793 2.644   1.00 29.80 ? 217 LEU A CA    1 
ATOM   1751 C C     . LEU A 1 217 ? -4.315  -29.174 2.110   1.00 29.77 ? 217 LEU A C     1 
ATOM   1752 O O     . LEU A 1 217 ? -4.289  -29.407 0.902   1.00 30.77 ? 217 LEU A O     1 
ATOM   1753 C CB    . LEU A 1 217 ? -3.384  -26.987 2.867   1.00 30.57 ? 217 LEU A CB    1 
ATOM   1754 C CG    . LEU A 1 217 ? -3.471  -25.504 3.266   1.00 31.08 ? 217 LEU A CG    1 
ATOM   1755 C CD1   . LEU A 1 217 ? -2.063  -24.924 3.426   1.00 28.47 ? 217 LEU A CD1   1 
ATOM   1756 C CD2   . LEU A 1 217 ? -4.284  -24.667 2.261   1.00 21.96 ? 217 LEU A CD2   1 
ATOM   1757 N N     . LEU A 1 218 ? -4.017  -30.081 3.031   1.00 29.22 ? 218 LEU A N     1 
ATOM   1758 C CA    . LEU A 1 218 ? -3.703  -31.458 2.711   1.00 27.71 ? 218 LEU A CA    1 
ATOM   1759 C C     . LEU A 1 218 ? -4.952  -32.241 2.256   1.00 26.77 ? 218 LEU A C     1 
ATOM   1760 O O     . LEU A 1 218 ? -4.843  -33.318 1.700   1.00 27.55 ? 218 LEU A O     1 
ATOM   1761 C CB    . LEU A 1 218 ? -3.029  -32.119 3.919   1.00 28.93 ? 218 LEU A CB    1 
ATOM   1762 C CG    . LEU A 1 218 ? -1.726  -31.442 4.405   1.00 27.19 ? 218 LEU A CG    1 
ATOM   1763 C CD1   . LEU A 1 218 ? -1.200  -32.160 5.632   1.00 23.31 ? 218 LEU A CD1   1 
ATOM   1764 C CD2   . LEU A 1 218 ? -0.654  -31.358 3.337   1.00 18.33 ? 218 LEU A CD2   1 
ATOM   1765 N N     . HIS A 1 219 ? -6.129  -31.671 2.459   1.00 25.08 ? 219 HIS A N     1 
ATOM   1766 C CA    . HIS A 1 219 ? -7.366  -32.286 1.970   1.00 25.37 ? 219 HIS A CA    1 
ATOM   1767 C C     . HIS A 1 219 ? -7.909  -31.570 0.731   1.00 23.99 ? 219 HIS A C     1 
ATOM   1768 O O     . HIS A 1 219 ? -8.963  -31.929 0.225   1.00 23.11 ? 219 HIS A O     1 
ATOM   1769 C CB    . HIS A 1 219 ? -8.426  -32.313 3.072   1.00 22.45 ? 219 HIS A CB    1 
ATOM   1770 C CG    . HIS A 1 219 ? -8.229  -33.402 4.084   1.00 27.69 ? 219 HIS A CG    1 
ATOM   1771 N ND1   . HIS A 1 219 ? -8.636  -34.704 3.869   1.00 33.39 ? 219 HIS A ND1   1 
ATOM   1772 C CD2   . HIS A 1 219 ? -7.695  -33.379 5.328   1.00 32.57 ? 219 HIS A CD2   1 
ATOM   1773 C CE1   . HIS A 1 219 ? -8.360  -35.435 4.935   1.00 31.28 ? 219 HIS A CE1   1 
ATOM   1774 N NE2   . HIS A 1 219 ? -7.790  -34.654 5.835   1.00 35.16 ? 219 HIS A NE2   1 
ATOM   1775 N N     . SER A 1 220 ? -7.175  -30.572 0.243   1.00 24.18 ? 220 SER A N     1 
ATOM   1776 C CA    . SER A 1 220 ? -7.642  -29.715 -0.857  1.00 25.46 ? 220 SER A CA    1 
ATOM   1777 C C     . SER A 1 220 ? -8.087  -30.470 -2.107  1.00 27.60 ? 220 SER A C     1 
ATOM   1778 O O     . SER A 1 220 ? -7.489  -31.477 -2.490  1.00 29.28 ? 220 SER A O     1 
ATOM   1779 C CB    . SER A 1 220 ? -6.576  -28.676 -1.229  1.00 24.83 ? 220 SER A CB    1 
ATOM   1780 O OG    . SER A 1 220 ? -7.054  -27.809 -2.248  1.00 20.65 ? 220 SER A OG    1 
ATOM   1781 N N     . GLU A 1 221 ? -9.154  -29.976 -2.732  1.00 29.79 ? 221 GLU A N     1 
ATOM   1782 C CA    . GLU A 1 221 ? -9.616  -30.498 -4.010  1.00 30.07 ? 221 GLU A CA    1 
ATOM   1783 C C     . GLU A 1 221 ? -8.745  -29.937 -5.145  1.00 28.77 ? 221 GLU A C     1 
ATOM   1784 O O     . GLU A 1 221 ? -8.876  -30.374 -6.283  1.00 29.14 ? 221 GLU A O     1 
ATOM   1785 C CB    . GLU A 1 221 ? -11.096 -30.149 -4.241  1.00 30.30 ? 221 GLU A CB    1 
ATOM   1786 C CG    . GLU A 1 221 ? -12.103 -31.209 -3.779  1.00 33.17 ? 221 GLU A CG    1 
ATOM   1787 C CD    . GLU A 1 221 ? -13.495 -31.042 -4.426  1.00 35.90 ? 221 GLU A CD    1 
ATOM   1788 O OE1   . GLU A 1 221 ? -14.135 -29.972 -4.246  1.00 40.97 ? 221 GLU A OE1   1 
ATOM   1789 O OE2   . GLU A 1 221 ? -13.955 -31.990 -5.112  1.00 40.89 ? 221 GLU A OE2   1 
ATOM   1790 N N     . ASN A 1 222 ? -7.867  -28.977 -4.829  1.00 27.42 ? 222 ASN A N     1 
ATOM   1791 C CA    . ASN A 1 222 ? -6.919  -28.402 -5.792  1.00 26.34 ? 222 ASN A CA    1 
ATOM   1792 C C     . ASN A 1 222 ? -5.605  -29.202 -5.814  1.00 26.23 ? 222 ASN A C     1 
ATOM   1793 O O     . ASN A 1 222 ? -4.915  -29.307 -4.791  1.00 27.98 ? 222 ASN A O     1 
ATOM   1794 C CB    . ASN A 1 222 ? -6.664  -26.922 -5.463  1.00 25.11 ? 222 ASN A CB    1 
ATOM   1795 C CG    . ASN A 1 222 ? -5.801  -26.202 -6.525  1.00 27.01 ? 222 ASN A CG    1 
ATOM   1796 O OD1   . ASN A 1 222 ? -4.745  -26.691 -6.940  1.00 29.48 ? 222 ASN A OD1   1 
ATOM   1797 N ND2   . ASN A 1 222 ? -6.252  -25.028 -6.946  1.00 26.33 ? 222 ASN A ND2   1 
ATOM   1798 N N     . TYR A 1 223 ? -5.255  -29.753 -6.975  1.00 25.57 ? 223 TYR A N     1 
ATOM   1799 C CA    . TYR A 1 223 ? -4.104  -30.659 -7.099  1.00 24.81 ? 223 TYR A CA    1 
ATOM   1800 C C     . TYR A 1 223 ? -2.774  -30.007 -6.708  1.00 25.90 ? 223 TYR A C     1 
ATOM   1801 O O     . TYR A 1 223 ? -1.937  -30.639 -6.069  1.00 26.00 ? 223 TYR A O     1 
ATOM   1802 C CB    . TYR A 1 223 ? -4.014  -31.251 -8.515  1.00 23.13 ? 223 TYR A CB    1 
ATOM   1803 C CG    . TYR A 1 223 ? -2.671  -31.891 -8.871  1.00 24.11 ? 223 TYR A CG    1 
ATOM   1804 C CD1   . TYR A 1 223 ? -2.404  -33.225 -8.553  1.00 21.92 ? 223 TYR A CD1   1 
ATOM   1805 C CD2   . TYR A 1 223 ? -1.676  -31.162 -9.533  1.00 21.79 ? 223 TYR A CD2   1 
ATOM   1806 C CE1   . TYR A 1 223 ? -1.189  -33.819 -8.882  1.00 25.58 ? 223 TYR A CE1   1 
ATOM   1807 C CE2   . TYR A 1 223 ? -0.453  -31.744 -9.859  1.00 22.49 ? 223 TYR A CE2   1 
ATOM   1808 C CZ    . TYR A 1 223 ? -0.215  -33.076 -9.539  1.00 26.01 ? 223 TYR A CZ    1 
ATOM   1809 O OH    . TYR A 1 223 ? 0.998   -33.665 -9.856  1.00 24.46 ? 223 TYR A OH    1 
ATOM   1810 N N     . VAL A 1 224 ? -2.574  -28.756 -7.109  1.00 26.31 ? 224 VAL A N     1 
ATOM   1811 C CA    . VAL A 1 224 ? -1.313  -28.073 -6.835  1.00 25.79 ? 224 VAL A CA    1 
ATOM   1812 C C     . VAL A 1 224 ? -1.207  -27.686 -5.356  1.00 27.63 ? 224 VAL A C     1 
ATOM   1813 O O     . VAL A 1 224 ? -0.156  -27.873 -4.749  1.00 27.50 ? 224 VAL A O     1 
ATOM   1814 C CB    . VAL A 1 224 ? -1.131  -26.838 -7.746  1.00 25.62 ? 224 VAL A CB    1 
ATOM   1815 C CG1   . VAL A 1 224 ? 0.180   -26.124 -7.442  1.00 26.39 ? 224 VAL A CG1   1 
ATOM   1816 C CG2   . VAL A 1 224 ? -1.167  -27.249 -9.186  1.00 20.09 ? 224 VAL A CG2   1 
ATOM   1817 N N     . THR A 1 225 ? -2.300  -27.164 -4.785  1.00 28.91 ? 225 THR A N     1 
ATOM   1818 C CA    . THR A 1 225 ? -2.377  -26.869 -3.352  1.00 29.79 ? 225 THR A CA    1 
ATOM   1819 C C     . THR A 1 225 ? -1.906  -28.070 -2.536  1.00 30.88 ? 225 THR A C     1 
ATOM   1820 O O     . THR A 1 225 ? -1.023  -27.948 -1.683  1.00 33.77 ? 225 THR A O     1 
ATOM   1821 C CB    . THR A 1 225 ? -3.815  -26.466 -2.919  1.00 31.03 ? 225 THR A CB    1 
ATOM   1822 O OG1   . THR A 1 225 ? -4.225  -25.306 -3.654  1.00 31.51 ? 225 THR A OG1   1 
ATOM   1823 C CG2   . THR A 1 225 ? -3.868  -26.123 -1.423  1.00 31.75 ? 225 THR A CG2   1 
ATOM   1824 N N     . LYS A 1 226 ? -2.473  -29.234 -2.828  1.00 29.63 ? 226 LYS A N     1 
ATOM   1825 C CA    . LYS A 1 226 ? -2.144  -30.455 -2.122  1.00 28.30 ? 226 LYS A CA    1 
ATOM   1826 C C     . LYS A 1 226 ? -0.688  -30.877 -2.353  1.00 29.16 ? 226 LYS A C     1 
ATOM   1827 O O     . LYS A 1 226 ? 0.029   -31.180 -1.398  1.00 29.35 ? 226 LYS A O     1 
ATOM   1828 C CB    . LYS A 1 226 ? -3.115  -31.572 -2.527  1.00 28.33 ? 226 LYS A CB    1 
ATOM   1829 C CG    . LYS A 1 226 ? -2.945  -32.865 -1.744  1.00 28.32 ? 226 LYS A CG    1 
ATOM   1830 C CD    . LYS A 1 226 ? -3.734  -34.017 -2.353  1.00 28.01 ? 226 LYS A CD    1 
ATOM   1831 C CE    . LYS A 1 226 ? -5.153  -34.072 -1.813  1.00 30.56 ? 226 LYS A CE    1 
ATOM   1832 N NZ    . LYS A 1 226 ? -5.736  -35.425 -2.002  1.00 31.38 ? 226 LYS A NZ    1 
ATOM   1833 N N     . ARG A 1 227 ? -0.258  -30.895 -3.613  1.00 27.33 ? 227 ARG A N     1 
ATOM   1834 C CA    . ARG A 1 227 ? 1.118   -31.245 -3.958  1.00 26.66 ? 227 ARG A CA    1 
ATOM   1835 C C     . ARG A 1 227 ? 2.153   -30.314 -3.283  1.00 26.94 ? 227 ARG A C     1 
ATOM   1836 O O     . ARG A 1 227 ? 3.070   -30.788 -2.623  1.00 26.35 ? 227 ARG A O     1 
ATOM   1837 C CB    . ARG A 1 227 ? 1.290   -31.297 -5.493  1.00 25.61 ? 227 ARG A CB    1 
ATOM   1838 C CG    . ARG A 1 227 ? 2.691   -31.581 -5.965  1.00 20.62 ? 227 ARG A CG    1 
ATOM   1839 C CD    . ARG A 1 227 ? 2.733   -31.830 -7.465  1.00 24.93 ? 227 ARG A CD    1 
ATOM   1840 N NE    . ARG A 1 227 ? 4.110   -31.854 -7.952  1.00 23.37 ? 227 ARG A NE    1 
ATOM   1841 C CZ    . ARG A 1 227 ? 4.474   -31.968 -9.226  1.00 24.14 ? 227 ARG A CZ    1 
ATOM   1842 N NH1   . ARG A 1 227 ? 3.568   -32.079 -10.193 1.00 25.25 ? 227 ARG A NH1   1 
ATOM   1843 N NH2   . ARG A 1 227 ? 5.759   -31.959 -9.532  1.00 20.25 ? 227 ARG A NH2   1 
ATOM   1844 N N     . GLN A 1 228 ? 1.984   -29.004 -3.445  1.00 26.91 ? 228 GLN A N     1 
ATOM   1845 C CA    . GLN A 1 228 ? 2.893   -28.009 -2.865  1.00 29.24 ? 228 GLN A CA    1 
ATOM   1846 C C     . GLN A 1 228 ? 2.908   -28.064 -1.342  1.00 29.29 ? 228 GLN A C     1 
ATOM   1847 O O     . GLN A 1 228 ? 3.969   -28.007 -0.723  1.00 31.87 ? 228 GLN A O     1 
ATOM   1848 C CB    . GLN A 1 228 ? 2.435   -26.600 -3.221  1.00 29.64 ? 228 GLN A CB    1 
ATOM   1849 C CG    . GLN A 1 228 ? 2.695   -26.100 -4.599  1.00 30.43 ? 228 GLN A CG    1 
ATOM   1850 C CD    . GLN A 1 228 ? 2.082   -24.716 -4.757  1.00 42.35 ? 228 GLN A CD    1 
ATOM   1851 O OE1   . GLN A 1 228 ? 0.988   -24.424 -4.191  1.00 36.30 ? 228 GLN A OE1   1 
ATOM   1852 N NE2   . GLN A 1 228 ? 2.776   -23.839 -5.510  1.00 37.77 ? 228 GLN A NE2   1 
ATOM   1853 N N     . SER A 1 229 ? 1.719   -28.133 -0.747  1.00 28.87 ? 229 SER A N     1 
ATOM   1854 C CA    . SER A 1 229 ? 1.575   -28.071 0.698   1.00 28.41 ? 229 SER A CA    1 
ATOM   1855 C C     . SER A 1 229 ? 2.192   -29.282 1.353   1.00 28.82 ? 229 SER A C     1 
ATOM   1856 O O     . SER A 1 229 ? 2.777   -29.178 2.424   1.00 31.08 ? 229 SER A O     1 
ATOM   1857 C CB    . SER A 1 229 ? 0.105   -27.976 1.084   1.00 29.42 ? 229 SER A CB    1 
ATOM   1858 O OG    . SER A 1 229 ? -0.472  -26.814 0.513   1.00 29.44 ? 229 SER A OG    1 
ATOM   1859 N N     . LEU A 1 230 ? 2.066   -30.430 0.701   1.00 28.20 ? 230 LEU A N     1 
ATOM   1860 C CA    . LEU A 1 230 ? 2.592   -31.666 1.226   1.00 28.37 ? 230 LEU A CA    1 
ATOM   1861 C C     . LEU A 1 230 ? 4.110   -31.637 1.189   1.00 28.49 ? 230 LEU A C     1 
ATOM   1862 O O     . LEU A 1 230 ? 4.765   -32.125 2.105   1.00 29.99 ? 230 LEU A O     1 
ATOM   1863 C CB    . LEU A 1 230 ? 2.029   -32.852 0.445   1.00 28.04 ? 230 LEU A CB    1 
ATOM   1864 C CG    . LEU A 1 230 ? 2.201   -34.260 1.000   1.00 28.93 ? 230 LEU A CG    1 
ATOM   1865 C CD1   . LEU A 1 230 ? 1.609   -34.394 2.392   1.00 27.60 ? 230 LEU A CD1   1 
ATOM   1866 C CD2   . LEU A 1 230 ? 1.585   -35.267 0.037   1.00 26.65 ? 230 LEU A CD2   1 
ATOM   1867 N N     . LYS A 1 231 ? 4.650   -31.028 0.137   1.00 28.98 ? 231 LYS A N     1 
ATOM   1868 C CA    . LYS A 1 231 ? 6.088   -30.844 -0.040  1.00 27.27 ? 231 LYS A CA    1 
ATOM   1869 C C     . LYS A 1 231 ? 6.682   -29.896 1.009   1.00 26.53 ? 231 LYS A C     1 
ATOM   1870 O O     . LYS A 1 231 ? 7.728   -30.176 1.601   1.00 26.29 ? 231 LYS A O     1 
ATOM   1871 C CB    . LYS A 1 231 ? 6.357   -30.311 -1.452  1.00 27.29 ? 231 LYS A CB    1 
ATOM   1872 C CG    . LYS A 1 231 ? 7.832   -30.218 -1.827  1.00 25.41 ? 231 LYS A CG    1 
ATOM   1873 C CD    . LYS A 1 231 ? 7.986   -29.855 -3.302  1.00 27.68 ? 231 LYS A CD    1 
ATOM   1874 C CE    . LYS A 1 231 ? 9.330   -29.165 -3.597  1.00 32.31 ? 231 LYS A CE    1 
ATOM   1875 N NZ    . LYS A 1 231 ? 10.485  -29.866 -2.994  1.00 34.78 ? 231 LYS A NZ    1 
ATOM   1876 N N     . LEU A 1 232 ? 6.014   -28.767 1.228   1.00 26.79 ? 232 LEU A N     1 
ATOM   1877 C CA    . LEU A 1 232 ? 6.467   -27.799 2.211   1.00 25.77 ? 232 LEU A CA    1 
ATOM   1878 C C     . LEU A 1 232 ? 6.454   -28.428 3.610   1.00 26.26 ? 232 LEU A C     1 
ATOM   1879 O O     . LEU A 1 232 ? 7.369   -28.194 4.402   1.00 27.75 ? 232 LEU A O     1 
ATOM   1880 C CB    . LEU A 1 232 ? 5.598   -26.524 2.154   1.00 27.50 ? 232 LEU A CB    1 
ATOM   1881 C CG    . LEU A 1 232 ? 5.855   -25.380 3.153   1.00 25.01 ? 232 LEU A CG    1 
ATOM   1882 C CD1   . LEU A 1 232 ? 7.320   -24.884 3.058   1.00 28.64 ? 232 LEU A CD1   1 
ATOM   1883 C CD2   . LEU A 1 232 ? 4.854   -24.234 2.954   1.00 22.95 ? 232 LEU A CD2   1 
ATOM   1884 N N     . LEU A 1 233 ? 5.421   -29.218 3.900   1.00 23.41 ? 233 LEU A N     1 
ATOM   1885 C CA    . LEU A 1 233 ? 5.314   -29.952 5.162   1.00 25.89 ? 233 LEU A CA    1 
ATOM   1886 C C     . LEU A 1 233 ? 6.529   -30.827 5.445   1.00 25.10 ? 233 LEU A C     1 
ATOM   1887 O O     . LEU A 1 233 ? 7.078   -30.782 6.539   1.00 27.07 ? 233 LEU A O     1 
ATOM   1888 C CB    . LEU A 1 233 ? 4.033   -30.819 5.217   1.00 25.17 ? 233 LEU A CB    1 
ATOM   1889 C CG    . LEU A 1 233 ? 3.712   -31.461 6.577   1.00 26.94 ? 233 LEU A CG    1 
ATOM   1890 C CD1   . LEU A 1 233 ? 3.565   -30.366 7.652   1.00 25.46 ? 233 LEU A CD1   1 
ATOM   1891 C CD2   . LEU A 1 233 ? 2.480   -32.425 6.564   1.00 24.45 ? 233 LEU A CD2   1 
ATOM   1892 N N     . GLY A 1 234 ? 6.934   -31.631 4.466   1.00 26.80 ? 234 GLY A N     1 
ATOM   1893 C CA    . GLY A 1 234 ? 8.141   -32.451 4.593   1.00 27.42 ? 234 GLY A CA    1 
ATOM   1894 C C     . GLY A 1 234 ? 9.397   -31.630 4.832   1.00 29.63 ? 234 GLY A C     1 
ATOM   1895 O O     . GLY A 1 234 ? 10.247  -32.008 5.644   1.00 31.15 ? 234 GLY A O     1 
ATOM   1896 N N     . GLU A 1 235 ? 9.524   -30.507 4.127   1.00 30.81 ? 235 GLU A N     1 
ATOM   1897 C CA    . GLU A 1 235 ? 10.691  -29.631 4.274   1.00 31.70 ? 235 GLU A CA    1 
ATOM   1898 C C     . GLU A 1 235 ? 10.729  -28.944 5.637   1.00 31.71 ? 235 GLU A C     1 
ATOM   1899 O O     . GLU A 1 235 ? 11.808  -28.685 6.177   1.00 32.88 ? 235 GLU A O     1 
ATOM   1900 C CB    . GLU A 1 235 ? 10.741  -28.602 3.147   1.00 33.03 ? 235 GLU A CB    1 
ATOM   1901 C CG    . GLU A 1 235 ? 11.147  -29.216 1.788   1.00 35.12 ? 235 GLU A CG    1 
ATOM   1902 C CD    . GLU A 1 235 ? 10.672  -28.407 0.583   1.00 38.95 ? 235 GLU A CD    1 
ATOM   1903 O OE1   . GLU A 1 235 ? 9.928   -27.405 0.756   1.00 36.05 ? 235 GLU A OE1   1 
ATOM   1904 O OE2   . GLU A 1 235 ? 11.051  -28.784 -0.552  1.00 40.05 ? 235 GLU A OE2   1 
ATOM   1905 N N     . LEU A 1 236 ? 9.549   -28.672 6.186   1.00 30.52 ? 236 LEU A N     1 
ATOM   1906 C CA    . LEU A 1 236 ? 9.405   -28.067 7.510   1.00 29.93 ? 236 LEU A CA    1 
ATOM   1907 C C     . LEU A 1 236 ? 9.757   -29.028 8.661   1.00 29.26 ? 236 LEU A C     1 
ATOM   1908 O O     . LEU A 1 236 ? 10.455  -28.641 9.600   1.00 28.35 ? 236 LEU A O     1 
ATOM   1909 C CB    . LEU A 1 236 ? 7.979   -27.520 7.694   1.00 29.68 ? 236 LEU A CB    1 
ATOM   1910 C CG    . LEU A 1 236 ? 7.523   -26.245 6.971   1.00 30.54 ? 236 LEU A CG    1 
ATOM   1911 C CD1   . LEU A 1 236 ? 6.079   -25.948 7.306   1.00 28.37 ? 236 LEU A CD1   1 
ATOM   1912 C CD2   . LEU A 1 236 ? 8.395   -25.027 7.303   1.00 31.74 ? 236 LEU A CD2   1 
ATOM   1913 N N     . LEU A 1 237 ? 9.270   -30.270 8.578   1.00 28.34 ? 237 LEU A N     1 
ATOM   1914 C CA    . LEU A 1 237 ? 9.506   -31.289 9.605   1.00 26.10 ? 237 LEU A CA    1 
ATOM   1915 C C     . LEU A 1 237 ? 10.943  -31.820 9.641   1.00 26.07 ? 237 LEU A C     1 
ATOM   1916 O O     . LEU A 1 237 ? 11.435  -32.214 10.716  1.00 24.04 ? 237 LEU A O     1 
ATOM   1917 C CB    . LEU A 1 237 ? 8.518   -32.454 9.461   1.00 26.89 ? 237 LEU A CB    1 
ATOM   1918 C CG    . LEU A 1 237 ? 6.997   -32.186 9.440   1.00 28.69 ? 237 LEU A CG    1 
ATOM   1919 C CD1   . LEU A 1 237 ? 6.257   -33.485 9.142   1.00 29.33 ? 237 LEU A CD1   1 
ATOM   1920 C CD2   . LEU A 1 237 ? 6.466   -31.535 10.726  1.00 26.21 ? 237 LEU A CD2   1 
ATOM   1921 N N     . LEU A 1 238 ? 11.619  -31.837 8.487   1.00 25.13 ? 238 LEU A N     1 
ATOM   1922 C CA    . LEU A 1 238 ? 13.018  -32.293 8.454   1.00 24.69 ? 238 LEU A CA    1 
ATOM   1923 C C     . LEU A 1 238 ? 14.024  -31.206 8.809   1.00 25.15 ? 238 LEU A C     1 
ATOM   1924 O O     . LEU A 1 238 ? 15.223  -31.479 8.900   1.00 25.61 ? 238 LEU A O     1 
ATOM   1925 C CB    . LEU A 1 238 ? 13.389  -32.971 7.122   1.00 25.41 ? 238 LEU A CB    1 
ATOM   1926 C CG    . LEU A 1 238 ? 13.007  -34.454 6.882   1.00 28.11 ? 238 LEU A CG    1 
ATOM   1927 C CD1   . LEU A 1 238 ? 13.545  -35.388 7.939   1.00 32.00 ? 238 LEU A CD1   1 
ATOM   1928 C CD2   . LEU A 1 238 ? 11.492  -34.628 6.795   1.00 40.41 ? 238 LEU A CD2   1 
ATOM   1929 N N     . ASP A 1 239 ? 13.546  -29.979 9.019   1.00 26.05 ? 239 ASP A N     1 
ATOM   1930 C CA    . ASP A 1 239 ? 14.431  -28.889 9.438   1.00 26.72 ? 239 ASP A CA    1 
ATOM   1931 C C     . ASP A 1 239 ? 14.751  -28.934 10.935  1.00 26.98 ? 239 ASP A C     1 
ATOM   1932 O O     . ASP A 1 239 ? 13.839  -29.023 11.771  1.00 26.36 ? 239 ASP A O     1 
ATOM   1933 C CB    . ASP A 1 239 ? 13.850  -27.531 9.077   1.00 26.38 ? 239 ASP A CB    1 
ATOM   1934 C CG    . ASP A 1 239 ? 14.898  -26.454 9.087   1.00 28.93 ? 239 ASP A CG    1 
ATOM   1935 O OD1   . ASP A 1 239 ? 15.323  -26.029 7.990   1.00 35.62 ? 239 ASP A OD1   1 
ATOM   1936 O OD2   . ASP A 1 239 ? 15.334  -26.061 10.188  1.00 26.86 ? 239 ASP A OD2   1 
ATOM   1937 N N     . ARG A 1 240 ? 16.043  -28.854 11.258  1.00 24.69 ? 240 ARG A N     1 
ATOM   1938 C CA    . ARG A 1 240 ? 16.524  -28.974 12.637  1.00 26.08 ? 240 ARG A CA    1 
ATOM   1939 C C     . ARG A 1 240 ? 15.935  -27.934 13.597  1.00 24.87 ? 240 ARG A C     1 
ATOM   1940 O O     . ARG A 1 240 ? 15.692  -28.238 14.766  1.00 24.89 ? 240 ARG A O     1 
ATOM   1941 C CB    . ARG A 1 240 ? 18.072  -29.004 12.702  1.00 27.36 ? 240 ARG A CB    1 
ATOM   1942 C CG    . ARG A 1 240 ? 18.784  -27.946 11.837  1.00 35.07 ? 240 ARG A CG    1 
ATOM   1943 C CD    . ARG A 1 240 ? 18.800  -28.265 10.313  1.00 41.61 ? 240 ARG A CD    1 
ATOM   1944 N NE    . ARG A 1 240 ? 18.504  -27.077 9.500   1.00 45.73 ? 240 ARG A NE    1 
ATOM   1945 C CZ    . ARG A 1 240 ? 19.385  -26.126 9.185   1.00 48.25 ? 240 ARG A CZ    1 
ATOM   1946 N NH1   . ARG A 1 240 ? 20.650  -26.211 9.612   1.00 48.00 ? 240 ARG A NH1   1 
ATOM   1947 N NH2   . ARG A 1 240 ? 18.999  -25.084 8.440   1.00 42.25 ? 240 ARG A NH2   1 
ATOM   1948 N N     . HIS A 1 241 ? 15.693  -26.723 13.093  1.00 23.20 ? 241 HIS A N     1 
ATOM   1949 C CA    . HIS A 1 241 ? 15.022  -25.662 13.852  1.00 22.77 ? 241 HIS A CA    1 
ATOM   1950 C C     . HIS A 1 241 ? 13.614  -26.057 14.325  1.00 23.90 ? 241 HIS A C     1 
ATOM   1951 O O     . HIS A 1 241 ? 13.132  -25.515 15.314  1.00 23.70 ? 241 HIS A O     1 
ATOM   1952 C CB    . HIS A 1 241 ? 14.906  -24.381 13.022  1.00 22.05 ? 241 HIS A CB    1 
ATOM   1953 C CG    . HIS A 1 241 ? 16.217  -23.736 12.695  1.00 20.49 ? 241 HIS A CG    1 
ATOM   1954 N ND1   . HIS A 1 241 ? 16.928  -24.033 11.551  1.00 18.09 ? 241 HIS A ND1   1 
ATOM   1955 C CD2   . HIS A 1 241 ? 16.930  -22.785 13.343  1.00 19.92 ? 241 HIS A CD2   1 
ATOM   1956 C CE1   . HIS A 1 241 ? 18.032  -23.309 11.521  1.00 20.60 ? 241 HIS A CE1   1 
ATOM   1957 N NE2   . HIS A 1 241 ? 18.060  -22.544 12.598  1.00 19.46 ? 241 HIS A NE2   1 
ATOM   1958 N N     . ASN A 1 242 ? 12.964  -26.992 13.624  1.00 23.89 ? 242 ASN A N     1 
ATOM   1959 C CA    . ASN A 1 242 ? 11.572  -27.379 13.931  1.00 24.35 ? 242 ASN A CA    1 
ATOM   1960 C C     . ASN A 1 242 ? 11.433  -28.729 14.645  1.00 24.38 ? 242 ASN A C     1 
ATOM   1961 O O     . ASN A 1 242 ? 10.349  -29.303 14.681  1.00 25.57 ? 242 ASN A O     1 
ATOM   1962 C CB    . ASN A 1 242 ? 10.714  -27.385 12.659  1.00 23.01 ? 242 ASN A CB    1 
ATOM   1963 C CG    . ASN A 1 242 ? 10.673  -26.036 11.961  1.00 25.64 ? 242 ASN A CG    1 
ATOM   1964 O OD1   . ASN A 1 242 ? 11.007  -25.004 12.535  1.00 24.63 ? 242 ASN A OD1   1 
ATOM   1965 N ND2   . ASN A 1 242 ? 10.252  -26.044 10.709  1.00 31.12 ? 242 ASN A ND2   1 
ATOM   1966 N N     . PHE A 1 243 ? 12.527  -29.218 15.223  1.00 24.37 ? 243 PHE A N     1 
ATOM   1967 C CA    . PHE A 1 243 ? 12.569  -30.536 15.860  1.00 25.20 ? 243 PHE A CA    1 
ATOM   1968 C C     . PHE A 1 243 ? 11.443  -30.774 16.862  1.00 25.48 ? 243 PHE A C     1 
ATOM   1969 O O     . PHE A 1 243 ? 10.847  -31.847 16.906  1.00 25.14 ? 243 PHE A O     1 
ATOM   1970 C CB    . PHE A 1 243 ? 13.932  -30.767 16.541  1.00 25.13 ? 243 PHE A CB    1 
ATOM   1971 C CG    . PHE A 1 243 ? 14.063  -32.129 17.191  1.00 24.83 ? 243 PHE A CG    1 
ATOM   1972 C CD1   . PHE A 1 243 ? 14.320  -33.263 16.416  1.00 21.23 ? 243 PHE A CD1   1 
ATOM   1973 C CD2   . PHE A 1 243 ? 13.910  -32.278 18.567  1.00 24.97 ? 243 PHE A CD2   1 
ATOM   1974 C CE1   . PHE A 1 243 ? 14.424  -34.517 16.992  1.00 20.80 ? 243 PHE A CE1   1 
ATOM   1975 C CE2   . PHE A 1 243 ? 14.021  -33.541 19.168  1.00 26.76 ? 243 PHE A CE2   1 
ATOM   1976 C CZ    . PHE A 1 243 ? 14.281  -34.662 18.380  1.00 23.95 ? 243 PHE A CZ    1 
ATOM   1977 N N     . THR A 1 244 ? 11.177  -29.763 17.677  1.00 28.43 ? 244 THR A N     1 
ATOM   1978 C CA    . THR A 1 244 ? 10.164  -29.836 18.728  1.00 29.98 ? 244 THR A CA    1 
ATOM   1979 C C     . THR A 1 244 ? 8.758   -29.954 18.138  1.00 29.94 ? 244 THR A C     1 
ATOM   1980 O O     . THR A 1 244 ? 7.952   -30.774 18.584  1.00 30.48 ? 244 THR A O     1 
ATOM   1981 C CB    . THR A 1 244 ? 10.301  -28.623 19.673  1.00 29.94 ? 244 THR A CB    1 
ATOM   1982 O OG1   . THR A 1 244 ? 11.379  -28.879 20.577  1.00 30.16 ? 244 THR A OG1   1 
ATOM   1983 C CG2   . THR A 1 244 ? 9.030   -28.377 20.477  1.00 31.66 ? 244 THR A CG2   1 
ATOM   1984 N N     . ILE A 1 245 ? 8.494   -29.135 17.126  1.00 29.84 ? 245 ILE A N     1 
ATOM   1985 C CA    . ILE A 1 245 ? 7.247   -29.151 16.375  1.00 30.00 ? 245 ILE A CA    1 
ATOM   1986 C C     . ILE A 1 245 ? 7.058   -30.503 15.678  1.00 29.94 ? 245 ILE A C     1 
ATOM   1987 O O     . ILE A 1 245 ? 5.971   -31.089 15.741  1.00 28.49 ? 245 ILE A O     1 
ATOM   1988 C CB    . ILE A 1 245 ? 7.227   -27.978 15.355  1.00 29.50 ? 245 ILE A CB    1 
ATOM   1989 C CG1   . ILE A 1 245 ? 7.093   -26.648 16.092  1.00 31.52 ? 245 ILE A CG1   1 
ATOM   1990 C CG2   . ILE A 1 245 ? 6.104   -28.121 14.336  1.00 31.00 ? 245 ILE A CG2   1 
ATOM   1991 C CD1   . ILE A 1 245 ? 8.415   -25.981 16.419  1.00 32.34 ? 245 ILE A CD1   1 
ATOM   1992 N N     . MET A 1 246 ? 8.121   -30.988 15.028  1.00 29.79 ? 246 MET A N     1 
ATOM   1993 C CA    . MET A 1 246 ? 8.092   -32.277 14.347  1.00 32.37 ? 246 MET A CA    1 
ATOM   1994 C C     . MET A 1 246 ? 7.744   -33.437 15.291  1.00 31.42 ? 246 MET A C     1 
ATOM   1995 O O     . MET A 1 246 ? 6.988   -34.323 14.907  1.00 31.35 ? 246 MET A O     1 
ATOM   1996 C CB    . MET A 1 246 ? 9.424   -32.582 13.662  1.00 31.15 ? 246 MET A CB    1 
ATOM   1997 C CG    . MET A 1 246 ? 9.473   -34.021 13.138  1.00 33.09 ? 246 MET A CG    1 
ATOM   1998 S SD    . MET A 1 246 ? 10.964  -34.989 13.476  1.00 40.62 ? 246 MET A SD    1 
ATOM   1999 C CE    . MET A 1 246 ? 11.212  -34.796 15.217  1.00 37.88 ? 246 MET A CE    1 
ATOM   2000 N N     . THR A 1 247 ? 8.313   -33.443 16.502  1.00 31.00 ? 247 THR A N     1 
ATOM   2001 C CA    . THR A 1 247 ? 8.069   -34.533 17.458  1.00 30.83 ? 247 THR A CA    1 
ATOM   2002 C C     . THR A 1 247 ? 6.630   -34.514 17.982  1.00 29.20 ? 247 THR A C     1 
ATOM   2003 O O     . THR A 1 247 ? 6.048   -35.557 18.264  1.00 29.39 ? 247 THR A O     1 
ATOM   2004 C CB    . THR A 1 247 ? 9.091   -34.570 18.642  1.00 31.00 ? 247 THR A CB    1 
ATOM   2005 O OG1   . THR A 1 247 ? 9.273   -33.263 19.179  1.00 32.80 ? 247 THR A OG1   1 
ATOM   2006 C CG2   . THR A 1 247 ? 10.425  -35.075 18.191  1.00 31.01 ? 247 THR A CG2   1 
ATOM   2007 N N     . LYS A 1 248 ? 6.057   -33.324 18.099  1.00 28.04 ? 248 LYS A N     1 
ATOM   2008 C CA    . LYS A 1 248 ? 4.628   -33.202 18.385  1.00 26.81 ? 248 LYS A CA    1 
ATOM   2009 C C     . LYS A 1 248 ? 3.796   -33.812 17.231  1.00 26.21 ? 248 LYS A C     1 
ATOM   2010 O O     . LYS A 1 248 ? 2.913   -34.656 17.464  1.00 26.73 ? 248 LYS A O     1 
ATOM   2011 C CB    . LYS A 1 248 ? 4.266   -31.734 18.620  1.00 25.39 ? 248 LYS A CB    1 
ATOM   2012 C CG    . LYS A 1 248 ? 3.189   -31.470 19.657  1.00 26.69 ? 248 LYS A CG    1 
ATOM   2013 C CD    . LYS A 1 248 ? 3.070   -29.956 19.910  1.00 25.96 ? 248 LYS A CD    1 
ATOM   2014 C CE    . LYS A 1 248 ? 2.307   -29.626 21.184  1.00 26.42 ? 248 LYS A CE    1 
ATOM   2015 N NZ    . LYS A 1 248 ? 2.130   -28.150 21.356  1.00 25.98 ? 248 LYS A NZ    1 
ATOM   2016 N N     . TYR A 1 249 ? 4.113   -33.403 16.000  1.00 23.54 ? 249 TYR A N     1 
ATOM   2017 C CA    . TYR A 1 249 ? 3.343   -33.769 14.812  1.00 24.14 ? 249 TYR A CA    1 
ATOM   2018 C C     . TYR A 1 249 ? 3.255   -35.276 14.562  1.00 24.00 ? 249 TYR A C     1 
ATOM   2019 O O     . TYR A 1 249 ? 2.180   -35.806 14.263  1.00 24.95 ? 249 TYR A O     1 
ATOM   2020 C CB    . TYR A 1 249 ? 3.884   -33.040 13.558  1.00 25.28 ? 249 TYR A CB    1 
ATOM   2021 C CG    . TYR A 1 249 ? 3.029   -33.263 12.318  1.00 27.65 ? 249 TYR A CG    1 
ATOM   2022 C CD1   . TYR A 1 249 ? 3.297   -34.320 11.437  1.00 29.88 ? 249 TYR A CD1   1 
ATOM   2023 C CD2   . TYR A 1 249 ? 1.939   -32.435 12.041  1.00 25.98 ? 249 TYR A CD2   1 
ATOM   2024 C CE1   . TYR A 1 249 ? 2.500   -34.543 10.326  1.00 27.38 ? 249 TYR A CE1   1 
ATOM   2025 C CE2   . TYR A 1 249 ? 1.146   -32.641 10.924  1.00 21.73 ? 249 TYR A CE2   1 
ATOM   2026 C CZ    . TYR A 1 249 ? 1.424   -33.704 10.080  1.00 27.58 ? 249 TYR A CZ    1 
ATOM   2027 O OH    . TYR A 1 249 ? 0.630   -33.927 8.977   1.00 31.17 ? 249 TYR A OH    1 
ATOM   2028 N N     . ILE A 1 250 ? 4.392   -35.950 14.694  1.00 23.73 ? 250 ILE A N     1 
ATOM   2029 C CA    . ILE A 1 250 ? 4.526   -37.365 14.383  1.00 23.51 ? 250 ILE A CA    1 
ATOM   2030 C C     . ILE A 1 250 ? 4.091   -38.270 15.532  1.00 24.44 ? 250 ILE A C     1 
ATOM   2031 O O     . ILE A 1 250 ? 4.268   -39.485 15.465  1.00 26.90 ? 250 ILE A O     1 
ATOM   2032 C CB    . ILE A 1 250 ? 5.990   -37.711 13.953  1.00 24.12 ? 250 ILE A CB    1 
ATOM   2033 C CG1   . ILE A 1 250 ? 6.955   -37.533 15.133  1.00 22.87 ? 250 ILE A CG1   1 
ATOM   2034 C CG2   . ILE A 1 250 ? 6.411   -36.879 12.741  1.00 19.65 ? 250 ILE A CG2   1 
ATOM   2035 C CD1   . ILE A 1 250 ? 8.244   -38.281 15.006  1.00 22.85 ? 250 ILE A CD1   1 
ATOM   2036 N N     . SER A 1 251 ? 3.525   -37.679 16.582  1.00 24.42 ? 251 SER A N     1 
ATOM   2037 C CA    . SER A 1 251 ? 2.989   -38.433 17.720  1.00 24.37 ? 251 SER A CA    1 
ATOM   2038 C C     . SER A 1 251 ? 1.474   -38.601 17.647  1.00 24.40 ? 251 SER A C     1 
ATOM   2039 O O     . SER A 1 251 ? 0.904   -39.346 18.441  1.00 23.99 ? 251 SER A O     1 
ATOM   2040 C CB    . SER A 1 251 ? 3.345   -37.746 19.045  1.00 24.00 ? 251 SER A CB    1 
ATOM   2041 O OG    . SER A 1 251 ? 2.582   -36.560 19.218  1.00 27.15 ? 251 SER A OG    1 
ATOM   2042 N N     . LYS A 1 252 ? 0.831   -37.908 16.706  1.00 24.21 ? 252 LYS A N     1 
ATOM   2043 C CA    . LYS A 1 252 ? -0.631  -37.904 16.614  1.00 24.32 ? 252 LYS A CA    1 
ATOM   2044 C C     . LYS A 1 252 ? -1.107  -38.958 15.624  1.00 23.98 ? 252 LYS A C     1 
ATOM   2045 O O     . LYS A 1 252 ? -0.681  -38.952 14.483  1.00 23.15 ? 252 LYS A O     1 
ATOM   2046 C CB    . LYS A 1 252 ? -1.169  -36.509 16.217  1.00 26.15 ? 252 LYS A CB    1 
ATOM   2047 C CG    . LYS A 1 252 ? -0.751  -35.333 17.135  1.00 23.91 ? 252 LYS A CG    1 
ATOM   2048 C CD    . LYS A 1 252 ? -0.978  -35.640 18.625  1.00 30.10 ? 252 LYS A CD    1 
ATOM   2049 C CE    . LYS A 1 252 ? -0.395  -34.538 19.518  1.00 31.92 ? 252 LYS A CE    1 
ATOM   2050 N NZ    . LYS A 1 252 ? -0.910  -34.606 20.923  1.00 32.63 ? 252 LYS A NZ    1 
ATOM   2051 N N     . PRO A 1 253 ? -1.968  -39.895 16.073  1.00 25.17 ? 253 PRO A N     1 
ATOM   2052 C CA    . PRO A 1 253 ? -2.529  -40.946 15.195  1.00 25.54 ? 253 PRO A CA    1 
ATOM   2053 C C     . PRO A 1 253 ? -3.154  -40.446 13.885  1.00 26.02 ? 253 PRO A C     1 
ATOM   2054 O O     . PRO A 1 253 ? -2.900  -41.021 12.823  1.00 25.75 ? 253 PRO A O     1 
ATOM   2055 C CB    . PRO A 1 253 ? -3.587  -41.640 16.081  1.00 25.83 ? 253 PRO A CB    1 
ATOM   2056 C CG    . PRO A 1 253 ? -3.690  -40.818 17.341  1.00 24.88 ? 253 PRO A CG    1 
ATOM   2057 C CD    . PRO A 1 253 ? -2.409  -40.057 17.472  1.00 24.73 ? 253 PRO A CD    1 
ATOM   2058 N N     . GLU A 1 254 ? -3.949  -39.384 13.965  1.00 27.47 ? 254 GLU A N     1 
ATOM   2059 C CA    . GLU A 1 254 ? -4.665  -38.836 12.810  1.00 29.04 ? 254 GLU A CA    1 
ATOM   2060 C C     . GLU A 1 254 ? -3.774  -38.277 11.701  1.00 28.99 ? 254 GLU A C     1 
ATOM   2061 O O     . GLU A 1 254 ? -4.201  -38.221 10.546  1.00 29.62 ? 254 GLU A O     1 
ATOM   2062 C CB    . GLU A 1 254 ? -5.705  -37.792 13.250  1.00 31.31 ? 254 GLU A CB    1 
ATOM   2063 C CG    . GLU A 1 254 ? -5.142  -36.578 13.984  1.00 36.46 ? 254 GLU A CG    1 
ATOM   2064 C CD    . GLU A 1 254 ? -4.862  -36.820 15.461  1.00 41.73 ? 254 GLU A CD    1 
ATOM   2065 O OE1   . GLU A 1 254 ? -5.004  -37.966 15.950  1.00 41.37 ? 254 GLU A OE1   1 
ATOM   2066 O OE2   . GLU A 1 254 ? -4.492  -35.840 16.140  1.00 47.69 ? 254 GLU A OE2   1 
ATOM   2067 N N     . ASN A 1 255 ? -2.551  -37.868 12.048  1.00 27.69 ? 255 ASN A N     1 
ATOM   2068 C CA    . ASN A 1 255 ? -1.579  -37.396 11.061  1.00 26.65 ? 255 ASN A CA    1 
ATOM   2069 C C     . ASN A 1 255 ? -0.933  -38.549 10.291  1.00 27.77 ? 255 ASN A C     1 
ATOM   2070 O O     . ASN A 1 255 ? -0.677  -38.423 9.079   1.00 28.59 ? 255 ASN A O     1 
ATOM   2071 C CB    . ASN A 1 255 ? -0.484  -36.556 11.717  1.00 27.03 ? 255 ASN A CB    1 
ATOM   2072 C CG    . ASN A 1 255 ? -1.008  -35.271 12.358  1.00 24.82 ? 255 ASN A CG    1 
ATOM   2073 O OD1   . ASN A 1 255 ? -2.001  -34.680 11.920  1.00 27.80 ? 255 ASN A OD1   1 
ATOM   2074 N ND2   . ASN A 1 255 ? -0.318  -34.826 13.399  1.00 25.39 ? 255 ASN A ND2   1 
ATOM   2075 N N     . LEU A 1 256 ? -0.635  -39.645 11.005  1.00 26.34 ? 256 LEU A N     1 
ATOM   2076 C CA    . LEU A 1 256 ? -0.158  -40.895 10.401  1.00 25.28 ? 256 LEU A CA    1 
ATOM   2077 C C     . LEU A 1 256 ? -1.213  -41.482 9.463   1.00 26.65 ? 256 LEU A C     1 
ATOM   2078 O O     . LEU A 1 256 ? -0.881  -41.913 8.356   1.00 27.78 ? 256 LEU A O     1 
ATOM   2079 C CB    . LEU A 1 256 ? 0.219   -41.930 11.471  1.00 24.59 ? 256 LEU A CB    1 
ATOM   2080 C CG    . LEU A 1 256 ? 0.863   -43.271 11.033  1.00 25.53 ? 256 LEU A CG    1 
ATOM   2081 C CD1   . LEU A 1 256 ? 2.127   -43.081 10.191  1.00 18.44 ? 256 LEU A CD1   1 
ATOM   2082 C CD2   . LEU A 1 256 ? 1.166   -44.172 12.235  1.00 23.02 ? 256 LEU A CD2   1 
ATOM   2083 N N     . LYS A 1 257 ? -2.473  -41.496 9.915   1.00 26.43 ? 257 LYS A N     1 
ATOM   2084 C CA    . LYS A 1 257 ? -3.600  -41.944 9.106   1.00 26.06 ? 257 LYS A CA    1 
ATOM   2085 C C     . LYS A 1 257 ? -3.584  -41.235 7.748   1.00 26.21 ? 257 LYS A C     1 
ATOM   2086 O O     . LYS A 1 257 ? -3.529  -41.885 6.704   1.00 26.94 ? 257 LYS A O     1 
ATOM   2087 C CB    . LYS A 1 257 ? -4.927  -41.690 9.839   1.00 26.66 ? 257 LYS A CB    1 
ATOM   2088 C CG    . LYS A 1 257 ? -6.156  -42.274 9.113   1.00 27.79 ? 257 LYS A CG    1 
ATOM   2089 C CD    . LYS A 1 257 ? -7.485  -41.720 9.618   1.00 28.80 ? 257 LYS A CD    1 
ATOM   2090 C CE    . LYS A 1 257 ? -8.666  -42.254 8.797   1.00 32.66 ? 257 LYS A CE    1 
ATOM   2091 N NZ    . LYS A 1 257 ? -9.991  -41.822 9.344   1.00 31.14 ? 257 LYS A NZ    1 
ATOM   2092 N N     . LEU A 1 258 ? -3.595  -39.905 7.781   1.00 25.74 ? 258 LEU A N     1 
ATOM   2093 C CA    . LEU A 1 258 ? -3.576  -39.065 6.584   1.00 27.13 ? 258 LEU A CA    1 
ATOM   2094 C C     . LEU A 1 258 ? -2.387  -39.338 5.636   1.00 27.09 ? 258 LEU A C     1 
ATOM   2095 O O     . LEU A 1 258 ? -2.585  -39.470 4.431   1.00 28.82 ? 258 LEU A O     1 
ATOM   2096 C CB    . LEU A 1 258 ? -3.647  -37.581 6.979   1.00 26.49 ? 258 LEU A CB    1 
ATOM   2097 C CG    . LEU A 1 258 ? -3.598  -36.542 5.848   1.00 31.43 ? 258 LEU A CG    1 
ATOM   2098 C CD1   . LEU A 1 258 ? -4.976  -36.257 5.262   1.00 24.16 ? 258 LEU A CD1   1 
ATOM   2099 C CD2   . LEU A 1 258 ? -2.941  -35.255 6.331   1.00 31.37 ? 258 LEU A CD2   1 
ATOM   2100 N N     . MET A 1 259 ? -1.167  -39.408 6.178   1.00 26.93 ? 259 MET A N     1 
ATOM   2101 C CA    . MET A 1 259 ? 0.036   -39.697 5.387   1.00 24.93 ? 259 MET A CA    1 
ATOM   2102 C C     . MET A 1 259 ? -0.033  -41.079 4.735   1.00 25.51 ? 259 MET A C     1 
ATOM   2103 O O     . MET A 1 259 ? 0.330   -41.234 3.566   1.00 25.97 ? 259 MET A O     1 
ATOM   2104 C CB    . MET A 1 259 ? 1.302   -39.578 6.244   1.00 24.83 ? 259 MET A CB    1 
ATOM   2105 C CG    . MET A 1 259 ? 1.607   -38.163 6.706   1.00 29.60 ? 259 MET A CG    1 
ATOM   2106 S SD    . MET A 1 259 ? 1.622   -36.989 5.321   1.00 32.43 ? 259 MET A SD    1 
ATOM   2107 C CE    . MET A 1 259 ? 0.621   -35.658 5.949   1.00 27.59 ? 259 MET A CE    1 
ATOM   2108 N N     . MET A 1 260 ? -0.502  -42.072 5.495   1.00 25.30 ? 260 MET A N     1 
ATOM   2109 C CA    . MET A 1 260 ? -0.691  -43.425 4.995   1.00 25.88 ? 260 MET A CA    1 
ATOM   2110 C C     . MET A 1 260 ? -1.677  -43.460 3.824   1.00 27.20 ? 260 MET A C     1 
ATOM   2111 O O     . MET A 1 260 ? -1.418  -44.121 2.819   1.00 27.40 ? 260 MET A O     1 
ATOM   2112 C CB    . MET A 1 260 ? -1.118  -44.365 6.126   1.00 25.13 ? 260 MET A CB    1 
ATOM   2113 C CG    . MET A 1 260 ? 0.072   -44.895 6.931   1.00 25.90 ? 260 MET A CG    1 
ATOM   2114 S SD    . MET A 1 260 ? -0.288  -45.891 8.389   1.00 27.30 ? 260 MET A SD    1 
ATOM   2115 C CE    . MET A 1 260 ? -0.821  -47.420 7.633   1.00 24.68 ? 260 MET A CE    1 
ATOM   2116 N N     . ASN A 1 261 ? -2.784  -42.729 3.960   1.00 27.64 ? 261 ASN A N     1 
ATOM   2117 C CA    . ASN A 1 261 ? -3.765  -42.563 2.895   1.00 28.76 ? 261 ASN A CA    1 
ATOM   2118 C C     . ASN A 1 261 ? -3.211  -41.840 1.663   1.00 28.17 ? 261 ASN A C     1 
ATOM   2119 O O     . ASN A 1 261 ? -3.446  -42.263 0.530   1.00 29.83 ? 261 ASN A O     1 
ATOM   2120 C CB    . ASN A 1 261 ? -5.004  -41.822 3.413   1.00 29.15 ? 261 ASN A CB    1 
ATOM   2121 C CG    . ASN A 1 261 ? -5.919  -42.709 4.236   1.00 28.35 ? 261 ASN A CG    1 
ATOM   2122 O OD1   . ASN A 1 261 ? -5.932  -43.927 4.084   1.00 30.85 ? 261 ASN A OD1   1 
ATOM   2123 N ND2   . ASN A 1 261 ? -6.708  -42.091 5.105   1.00 32.40 ? 261 ASN A ND2   1 
ATOM   2124 N N     . LEU A 1 262 ? -2.482  -40.755 1.883   1.00 26.82 ? 262 LEU A N     1 
ATOM   2125 C CA    . LEU A 1 262 ? -1.846  -40.029 0.782   1.00 25.48 ? 262 LEU A CA    1 
ATOM   2126 C C     . LEU A 1 262 ? -0.795  -40.880 0.048   1.00 25.63 ? 262 LEU A C     1 
ATOM   2127 O O     . LEU A 1 262 ? -0.471  -40.607 -1.096  1.00 26.47 ? 262 LEU A O     1 
ATOM   2128 C CB    . LEU A 1 262 ? -1.268  -38.700 1.277   1.00 25.33 ? 262 LEU A CB    1 
ATOM   2129 C CG    . LEU A 1 262 ? -2.270  -37.601 1.674   1.00 22.93 ? 262 LEU A CG    1 
ATOM   2130 C CD1   . LEU A 1 262 ? -1.598  -36.459 2.439   1.00 20.65 ? 262 LEU A CD1   1 
ATOM   2131 C CD2   . LEU A 1 262 ? -3.037  -37.052 0.468   1.00 21.84 ? 262 LEU A CD2   1 
ATOM   2132 N N     . LEU A 1 263 ? -0.289  -41.930 0.693   1.00 26.87 ? 263 LEU A N     1 
ATOM   2133 C CA    . LEU A 1 263 ? 0.573   -42.916 0.017   1.00 27.56 ? 263 LEU A CA    1 
ATOM   2134 C C     . LEU A 1 263 ? -0.169  -43.737 -1.039  1.00 26.93 ? 263 LEU A C     1 
ATOM   2135 O O     . LEU A 1 263 ? 0.457   -44.353 -1.899  1.00 26.75 ? 263 LEU A O     1 
ATOM   2136 C CB    . LEU A 1 263 ? 1.180   -43.885 1.022   1.00 27.78 ? 263 LEU A CB    1 
ATOM   2137 C CG    . LEU A 1 263 ? 2.338   -43.497 1.918   1.00 28.78 ? 263 LEU A CG    1 
ATOM   2138 C CD1   . LEU A 1 263 ? 2.463   -44.610 2.970   1.00 31.57 ? 263 LEU A CD1   1 
ATOM   2139 C CD2   . LEU A 1 263 ? 3.630   -43.343 1.123   1.00 27.21 ? 263 LEU A CD2   1 
ATOM   2140 N N     . ARG A 1 264 ? -1.497  -43.750 -0.959  1.00 27.80 ? 264 ARG A N     1 
ATOM   2141 C CA    . ARG A 1 264 ? -2.342  -44.487 -1.909  1.00 28.79 ? 264 ARG A CA    1 
ATOM   2142 C C     . ARG A 1 264 ? -3.123  -43.567 -2.867  1.00 27.91 ? 264 ARG A C     1 
ATOM   2143 O O     . ARG A 1 264 ? -4.019  -44.015 -3.575  1.00 28.63 ? 264 ARG A O     1 
ATOM   2144 C CB    . ARG A 1 264 ? -3.306  -45.424 -1.164  1.00 28.98 ? 264 ARG A CB    1 
ATOM   2145 C CG    . ARG A 1 264 ? -2.657  -46.632 -0.486  1.00 31.23 ? 264 ARG A CG    1 
ATOM   2146 C CD    . ARG A 1 264 ? -3.722  -47.706 -0.250  1.00 37.75 ? 264 ARG A CD    1 
ATOM   2147 N NE    . ARG A 1 264 ? -3.282  -48.754 0.664   1.00 40.74 ? 264 ARG A NE    1 
ATOM   2148 C CZ    . ARG A 1 264 ? -2.744  -49.911 0.288   1.00 41.48 ? 264 ARG A CZ    1 
ATOM   2149 N NH1   . ARG A 1 264 ? -2.570  -50.182 -1.001  1.00 40.66 ? 264 ARG A NH1   1 
ATOM   2150 N NH2   . ARG A 1 264 ? -2.382  -50.799 1.210   1.00 38.72 ? 264 ARG A NH2   1 
ATOM   2151 N N     . ASP A 1 265 ? -2.770  -42.288 -2.880  1.00 28.47 ? 265 ASP A N     1 
ATOM   2152 C CA    . ASP A 1 265 ? -3.331  -41.305 -3.810  1.00 28.10 ? 265 ASP A CA    1 
ATOM   2153 C C     . ASP A 1 265 ? -3.096  -41.717 -5.257  1.00 27.96 ? 265 ASP A C     1 
ATOM   2154 O O     . ASP A 1 265 ? -2.168  -42.471 -5.527  1.00 28.08 ? 265 ASP A O     1 
ATOM   2155 C CB    . ASP A 1 265 ? -2.656  -39.965 -3.570  1.00 27.14 ? 265 ASP A CB    1 
ATOM   2156 C CG    . ASP A 1 265 ? -3.430  -38.811 -4.157  1.00 30.34 ? 265 ASP A CG    1 
ATOM   2157 O OD1   . ASP A 1 265 ? -4.370  -38.346 -3.486  1.00 29.99 ? 265 ASP A OD1   1 
ATOM   2158 O OD2   . ASP A 1 265 ? -3.084  -38.359 -5.273  1.00 31.37 ? 265 ASP A OD2   1 
ATOM   2159 N N     . LYS A 1 266 ? -3.914  -41.226 -6.192  1.00 28.69 ? 266 LYS A N     1 
ATOM   2160 C CA    . LYS A 1 266 ? -3.671  -41.529 -7.611  1.00 29.76 ? 266 LYS A CA    1 
ATOM   2161 C C     . LYS A 1 266 ? -2.422  -40.834 -8.178  1.00 29.36 ? 266 LYS A C     1 
ATOM   2162 O O     . LYS A 1 266 ? -1.778  -41.346 -9.090  1.00 30.89 ? 266 LYS A O     1 
ATOM   2163 C CB    . LYS A 1 266 ? -4.909  -41.296 -8.501  1.00 30.04 ? 266 LYS A CB    1 
ATOM   2164 C CG    . LYS A 1 266 ? -5.629  -39.951 -8.323  1.00 33.32 ? 266 LYS A CG    1 
ATOM   2165 C CD    . LYS A 1 266 ? -6.435  -39.563 -9.575  1.00 31.52 ? 266 LYS A CD    1 
ATOM   2166 C CE    . LYS A 1 266 ? -7.777  -38.886 -9.233  1.00 36.57 ? 266 LYS A CE    1 
ATOM   2167 N NZ    . LYS A 1 266 ? -7.696  -37.707 -8.307  1.00 32.59 ? 266 LYS A NZ    1 
ATOM   2168 N N     . SER A 1 267 ? -2.072  -39.676 -7.636  1.00 28.50 ? 267 SER A N     1 
ATOM   2169 C CA    . SER A 1 267 ? -0.891  -38.972 -8.103  1.00 28.33 ? 267 SER A CA    1 
ATOM   2170 C C     . SER A 1 267 ? 0.419   -39.587 -7.600  1.00 28.43 ? 267 SER A C     1 
ATOM   2171 O O     . SER A 1 267 ? 0.649   -39.676 -6.391  1.00 28.79 ? 267 SER A O     1 
ATOM   2172 C CB    . SER A 1 267 ? -0.950  -37.510 -7.708  1.00 27.70 ? 267 SER A CB    1 
ATOM   2173 O OG    . SER A 1 267 ? 0.323   -36.915 -7.883  1.00 27.31 ? 267 SER A OG    1 
ATOM   2174 N N     . ARG A 1 268 ? 1.271   -39.993 -8.541  1.00 27.22 ? 268 ARG A N     1 
ATOM   2175 C CA    . ARG A 1 268 ? 2.619   -40.493 -8.242  1.00 27.18 ? 268 ARG A CA    1 
ATOM   2176 C C     . ARG A 1 268 ? 3.441   -39.443 -7.447  1.00 26.27 ? 268 ARG A C     1 
ATOM   2177 O O     . ARG A 1 268 ? 4.090   -39.772 -6.455  1.00 24.11 ? 268 ARG A O     1 
ATOM   2178 C CB    . ARG A 1 268 ? 3.303   -40.911 -9.554  1.00 26.82 ? 268 ARG A CB    1 
ATOM   2179 C CG    . ARG A 1 268 ? 4.756   -41.335 -9.464  1.00 29.87 ? 268 ARG A CG    1 
ATOM   2180 C CD    . ARG A 1 268 ? 5.351   -41.591 -10.863 1.00 28.60 ? 268 ARG A CD    1 
ATOM   2181 N NE    . ARG A 1 268 ? 6.804   -41.765 -10.818 1.00 31.76 ? 268 ARG A NE    1 
ATOM   2182 C CZ    . ARG A 1 268 ? 7.428   -42.923 -10.573 1.00 36.85 ? 268 ARG A CZ    1 
ATOM   2183 N NH1   . ARG A 1 268 ? 6.738   -44.046 -10.351 1.00 32.27 ? 268 ARG A NH1   1 
ATOM   2184 N NH2   . ARG A 1 268 ? 8.756   -42.961 -10.553 1.00 38.34 ? 268 ARG A NH2   1 
ATOM   2185 N N     . ASN A 1 269 ? 3.373   -38.182 -7.874  1.00 25.90 ? 269 ASN A N     1 
ATOM   2186 C CA    . ASN A 1 269 ? 4.008   -37.073 -7.162  1.00 25.72 ? 269 ASN A CA    1 
ATOM   2187 C C     . ASN A 1 269 ? 3.553   -36.933 -5.710  1.00 25.07 ? 269 ASN A C     1 
ATOM   2188 O O     . ASN A 1 269 ? 4.385   -36.874 -4.797  1.00 22.47 ? 269 ASN A O     1 
ATOM   2189 C CB    . ASN A 1 269 ? 3.801   -35.757 -7.928  1.00 26.15 ? 269 ASN A CB    1 
ATOM   2190 C CG    . ASN A 1 269 ? 4.424   -35.786 -9.314  1.00 30.32 ? 269 ASN A CG    1 
ATOM   2191 O OD1   . ASN A 1 269 ? 5.475   -36.397 -9.530  1.00 36.93 ? 269 ASN A OD1   1 
ATOM   2192 N ND2   . ASN A 1 269 ? 3.779   -35.126 -10.264 1.00 36.15 ? 269 ASN A ND2   1 
ATOM   2193 N N     . ILE A 1 270 ? 2.234   -36.884 -5.504  1.00 26.27 ? 270 ILE A N     1 
ATOM   2194 C CA    . ILE A 1 270 ? 1.626   -36.841 -4.163  1.00 26.19 ? 270 ILE A CA    1 
ATOM   2195 C C     . ILE A 1 270 ? 2.073   -37.992 -3.248  1.00 27.06 ? 270 ILE A C     1 
ATOM   2196 O O     . ILE A 1 270 ? 2.479   -37.753 -2.104  1.00 28.68 ? 270 ILE A O     1 
ATOM   2197 C CB    . ILE A 1 270 ? 0.064   -36.803 -4.240  1.00 28.37 ? 270 ILE A CB    1 
ATOM   2198 C CG1   . ILE A 1 270 ? -0.422  -35.509 -4.902  1.00 25.69 ? 270 ILE A CG1   1 
ATOM   2199 C CG2   . ILE A 1 270 ? -0.586  -36.994 -2.850  1.00 27.72 ? 270 ILE A CG2   1 
ATOM   2200 C CD1   . ILE A 1 270 ? -0.009  -34.300 -4.190  1.00 32.58 ? 270 ILE A CD1   1 
ATOM   2201 N N     . GLN A 1 271 ? 2.008   -39.232 -3.733  1.00 25.97 ? 271 GLN A N     1 
ATOM   2202 C CA    . GLN A 1 271 ? 2.415   -40.372 -2.898  1.00 26.56 ? 271 GLN A CA    1 
ATOM   2203 C C     . GLN A 1 271 ? 3.903   -40.362 -2.517  1.00 26.30 ? 271 GLN A C     1 
ATOM   2204 O O     . GLN A 1 271 ? 4.265   -40.821 -1.430  1.00 26.07 ? 271 GLN A O     1 
ATOM   2205 C CB    . GLN A 1 271 ? 1.971   -41.719 -3.482  1.00 25.96 ? 271 GLN A CB    1 
ATOM   2206 C CG    . GLN A 1 271 ? 2.354   -41.943 -4.902  1.00 29.56 ? 271 GLN A CG    1 
ATOM   2207 C CD    . GLN A 1 271 ? 1.606   -43.088 -5.554  1.00 32.36 ? 271 GLN A CD    1 
ATOM   2208 O OE1   . GLN A 1 271 ? 2.215   -43.946 -6.187  1.00 31.66 ? 271 GLN A OE1   1 
ATOM   2209 N NE2   . GLN A 1 271 ? 0.283   -43.098 -5.425  1.00 31.54 ? 271 GLN A NE2   1 
ATOM   2210 N N     . PHE A 1 272 ? 4.741   -39.791 -3.385  1.00 26.32 ? 272 PHE A N     1 
ATOM   2211 C CA    . PHE A 1 272 ? 6.179   -39.622 -3.120  1.00 24.77 ? 272 PHE A CA    1 
ATOM   2212 C C     . PHE A 1 272 ? 6.453   -38.550 -2.053  1.00 25.59 ? 272 PHE A C     1 
ATOM   2213 O O     . PHE A 1 272 ? 7.316   -38.722 -1.197  1.00 26.93 ? 272 PHE A O     1 
ATOM   2214 C CB    . PHE A 1 272 ? 6.930   -39.278 -4.421  1.00 25.17 ? 272 PHE A CB    1 
ATOM   2215 C CG    . PHE A 1 272 ? 8.454   -39.243 -4.278  1.00 23.50 ? 272 PHE A CG    1 
ATOM   2216 C CD1   . PHE A 1 272 ? 9.154   -40.365 -3.831  1.00 22.77 ? 272 PHE A CD1   1 
ATOM   2217 C CD2   . PHE A 1 272 ? 9.176   -38.090 -4.625  1.00 23.42 ? 272 PHE A CD2   1 
ATOM   2218 C CE1   . PHE A 1 272 ? 10.564  -40.345 -3.707  1.00 28.08 ? 272 PHE A CE1   1 
ATOM   2219 C CE2   . PHE A 1 272 ? 10.580  -38.048 -4.510  1.00 26.29 ? 272 PHE A CE2   1 
ATOM   2220 C CZ    . PHE A 1 272 ? 11.279  -39.184 -4.047  1.00 25.98 ? 272 PHE A CZ    1 
ATOM   2221 N N     . GLU A 1 273 ? 5.727   -37.442 -2.111  1.00 25.08 ? 273 GLU A N     1 
ATOM   2222 C CA    . GLU A 1 273 ? 5.828   -36.405 -1.081  1.00 25.65 ? 273 GLU A CA    1 
ATOM   2223 C C     . GLU A 1 273 ? 5.206   -36.807 0.258   1.00 25.58 ? 273 GLU A C     1 
ATOM   2224 O O     . GLU A 1 273 ? 5.631   -36.307 1.305   1.00 23.76 ? 273 GLU A O     1 
ATOM   2225 C CB    . GLU A 1 273 ? 5.199   -35.108 -1.571  1.00 26.73 ? 273 GLU A CB    1 
ATOM   2226 C CG    . GLU A 1 273 ? 5.983   -34.389 -2.653  1.00 29.17 ? 273 GLU A CG    1 
ATOM   2227 C CD    . GLU A 1 273 ? 5.142   -33.307 -3.277  1.00 43.49 ? 273 GLU A CD    1 
ATOM   2228 O OE1   . GLU A 1 273 ? 5.608   -32.638 -4.229  1.00 49.89 ? 273 GLU A OE1   1 
ATOM   2229 O OE2   . GLU A 1 273 ? 3.994   -33.125 -2.802  1.00 49.24 ? 273 GLU A OE2   1 
ATOM   2230 N N     . ALA A 1 274 ? 4.190   -37.684 0.209   1.00 24.95 ? 274 ALA A N     1 
ATOM   2231 C CA    . ALA A 1 274 ? 3.658   -38.363 1.397   1.00 24.44 ? 274 ALA A CA    1 
ATOM   2232 C C     . ALA A 1 274 ? 4.722   -39.260 2.052   1.00 26.05 ? 274 ALA A C     1 
ATOM   2233 O O     . ALA A 1 274 ? 4.846   -39.270 3.281   1.00 27.67 ? 274 ALA A O     1 
ATOM   2234 C CB    . ALA A 1 274 ? 2.429   -39.171 1.043   1.00 21.27 ? 274 ALA A CB    1 
ATOM   2235 N N     . PHE A 1 275 ? 5.476   -40.006 1.232   1.00 25.45 ? 275 PHE A N     1 
ATOM   2236 C CA    . PHE A 1 275 ? 6.587   -40.841 1.706   1.00 25.86 ? 275 PHE A CA    1 
ATOM   2237 C C     . PHE A 1 275 ? 7.580   -40.046 2.573   1.00 27.75 ? 275 PHE A C     1 
ATOM   2238 O O     . PHE A 1 275 ? 7.964   -40.517 3.652   1.00 28.45 ? 275 PHE A O     1 
ATOM   2239 C CB    . PHE A 1 275 ? 7.318   -41.536 0.537   1.00 24.17 ? 275 PHE A CB    1 
ATOM   2240 C CG    . PHE A 1 275 ? 8.474   -42.419 0.976   1.00 24.80 ? 275 PHE A CG    1 
ATOM   2241 C CD1   . PHE A 1 275 ? 8.259   -43.744 1.336   1.00 22.36 ? 275 PHE A CD1   1 
ATOM   2242 C CD2   . PHE A 1 275 ? 9.769   -41.918 1.040   1.00 21.65 ? 275 PHE A CD2   1 
ATOM   2243 C CE1   . PHE A 1 275 ? 9.310   -44.550 1.748   1.00 22.09 ? 275 PHE A CE1   1 
ATOM   2244 C CE2   . PHE A 1 275 ? 10.834  -42.726 1.453   1.00 26.95 ? 275 PHE A CE2   1 
ATOM   2245 C CZ    . PHE A 1 275 ? 10.605  -44.044 1.804   1.00 24.08 ? 275 PHE A CZ    1 
ATOM   2246 N N     . HIS A 1 276 ? 7.960   -38.853 2.096   1.00 27.34 ? 276 HIS A N     1 
ATOM   2247 C CA    . HIS A 1 276 ? 8.892   -37.924 2.772   1.00 28.33 ? 276 HIS A CA    1 
ATOM   2248 C C     . HIS A 1 276 ? 8.443   -37.591 4.196   1.00 27.53 ? 276 HIS A C     1 
ATOM   2249 O O     . HIS A 1 276 ? 9.274   -37.376 5.071   1.00 27.65 ? 276 HIS A O     1 
ATOM   2250 C CB    . HIS A 1 276 ? 9.057   -36.637 1.926   1.00 27.88 ? 276 HIS A CB    1 
ATOM   2251 C CG    . HIS A 1 276 ? 10.125  -35.684 2.406   1.00 34.71 ? 276 HIS A CG    1 
ATOM   2252 N ND1   . HIS A 1 276 ? 11.197  -35.305 1.619   1.00 33.53 ? 276 HIS A ND1   1 
ATOM   2253 C CD2   . HIS A 1 276 ? 10.260  -34.992 3.567   1.00 37.84 ? 276 HIS A CD2   1 
ATOM   2254 C CE1   . HIS A 1 276 ? 11.948  -34.436 2.275   1.00 30.82 ? 276 HIS A CE1   1 
ATOM   2255 N NE2   . HIS A 1 276 ? 11.409  -34.238 3.464   1.00 34.25 ? 276 HIS A NE2   1 
ATOM   2256 N N     . VAL A 1 277 ? 7.137   -37.550 4.433   1.00 28.88 ? 277 VAL A N     1 
ATOM   2257 C CA    . VAL A 1 277 ? 6.637   -37.273 5.784   1.00 29.58 ? 277 VAL A CA    1 
ATOM   2258 C C     . VAL A 1 277 ? 6.438   -38.569 6.575   1.00 30.71 ? 277 VAL A C     1 
ATOM   2259 O O     . VAL A 1 277 ? 6.815   -38.654 7.750   1.00 31.15 ? 277 VAL A O     1 
ATOM   2260 C CB    . VAL A 1 277 ? 5.345   -36.446 5.772   1.00 30.02 ? 277 VAL A CB    1 
ATOM   2261 C CG1   . VAL A 1 277 ? 4.853   -36.206 7.199   1.00 30.02 ? 277 VAL A CG1   1 
ATOM   2262 C CG2   . VAL A 1 277 ? 5.570   -35.106 5.056   1.00 29.23 ? 277 VAL A CG2   1 
ATOM   2263 N N     . PHE A 1 278 ? 5.851   -39.569 5.914   1.00 30.49 ? 278 PHE A N     1 
ATOM   2264 C CA    . PHE A 1 278 ? 5.619   -40.891 6.498   1.00 30.18 ? 278 PHE A CA    1 
ATOM   2265 C C     . PHE A 1 278 ? 6.892   -41.494 7.093   1.00 30.31 ? 278 PHE A C     1 
ATOM   2266 O O     . PHE A 1 278 ? 6.865   -42.021 8.206   1.00 31.37 ? 278 PHE A O     1 
ATOM   2267 C CB    . PHE A 1 278 ? 5.021   -41.836 5.443   1.00 30.06 ? 278 PHE A CB    1 
ATOM   2268 C CG    . PHE A 1 278 ? 4.927   -43.260 5.893   1.00 30.53 ? 278 PHE A CG    1 
ATOM   2269 C CD1   . PHE A 1 278 ? 3.854   -43.680 6.691   1.00 30.57 ? 278 PHE A CD1   1 
ATOM   2270 C CD2   . PHE A 1 278 ? 5.909   -44.188 5.525   1.00 30.16 ? 278 PHE A CD2   1 
ATOM   2271 C CE1   . PHE A 1 278 ? 3.756   -45.005 7.125   1.00 29.56 ? 278 PHE A CE1   1 
ATOM   2272 C CE2   . PHE A 1 278 ? 5.832   -45.519 5.953   1.00 32.88 ? 278 PHE A CE2   1 
ATOM   2273 C CZ    . PHE A 1 278 ? 4.747   -45.931 6.759   1.00 33.23 ? 278 PHE A CZ    1 
ATOM   2274 N N     . LYS A 1 279 ? 8.002   -41.406 6.352   1.00 28.51 ? 279 LYS A N     1 
ATOM   2275 C CA    . LYS A 1 279 ? 9.266   -41.981 6.781   1.00 26.52 ? 279 LYS A CA    1 
ATOM   2276 C C     . LYS A 1 279 ? 9.660   -41.512 8.175   1.00 26.83 ? 279 LYS A C     1 
ATOM   2277 O O     . LYS A 1 279 ? 10.349  -42.230 8.895   1.00 28.59 ? 279 LYS A O     1 
ATOM   2278 C CB    . LYS A 1 279 ? 10.394  -41.720 5.754   1.00 25.72 ? 279 LYS A CB    1 
ATOM   2279 C CG    . LYS A 1 279 ? 10.882  -40.258 5.616   1.00 25.74 ? 279 LYS A CG    1 
ATOM   2280 C CD    . LYS A 1 279 ? 11.996  -40.112 4.544   1.00 25.32 ? 279 LYS A CD    1 
ATOM   2281 C CE    . LYS A 1 279 ? 12.481  -38.679 4.431   1.00 25.59 ? 279 LYS A CE    1 
ATOM   2282 N NZ    . LYS A 1 279 ? 13.267  -38.322 3.173   1.00 26.46 ? 279 LYS A NZ    1 
ATOM   2283 N N     . VAL A 1 280 ? 9.230   -40.313 8.560   1.00 27.36 ? 280 VAL A N     1 
ATOM   2284 C CA    . VAL A 1 280 ? 9.668   -39.708 9.841   1.00 25.94 ? 280 VAL A CA    1 
ATOM   2285 C C     . VAL A 1 280 ? 8.920   -40.326 11.048  1.00 26.59 ? 280 VAL A C     1 
ATOM   2286 O O     . VAL A 1 280 ? 9.514   -40.561 12.112  1.00 26.75 ? 280 VAL A O     1 
ATOM   2287 C CB    . VAL A 1 280 ? 9.559   -38.160 9.800   1.00 25.62 ? 280 VAL A CB    1 
ATOM   2288 C CG1   . VAL A 1 280 ? 10.013  -37.542 11.099  1.00 24.00 ? 280 VAL A CG1   1 
ATOM   2289 C CG2   . VAL A 1 280 ? 10.384  -37.606 8.652   1.00 22.34 ? 280 VAL A CG2   1 
ATOM   2290 N N     . PHE A 1 281 ? 7.632   -40.613 10.854  1.00 25.37 ? 281 PHE A N     1 
ATOM   2291 C CA    . PHE A 1 281 ? 6.808   -41.301 11.843  1.00 25.68 ? 281 PHE A CA    1 
ATOM   2292 C C     . PHE A 1 281 ? 7.396   -42.651 12.245  1.00 26.23 ? 281 PHE A C     1 
ATOM   2293 O O     . PHE A 1 281 ? 7.289   -43.068 13.393  1.00 27.25 ? 281 PHE A O     1 
ATOM   2294 C CB    . PHE A 1 281 ? 5.407   -41.560 11.280  1.00 24.91 ? 281 PHE A CB    1 
ATOM   2295 C CG    . PHE A 1 281 ? 4.527   -40.339 11.184  1.00 23.71 ? 281 PHE A CG    1 
ATOM   2296 C CD1   . PHE A 1 281 ? 4.704   -39.404 10.167  1.00 22.18 ? 281 PHE A CD1   1 
ATOM   2297 C CD2   . PHE A 1 281 ? 3.477   -40.162 12.077  1.00 22.14 ? 281 PHE A CD2   1 
ATOM   2298 C CE1   . PHE A 1 281 ? 3.870   -38.306 10.069  1.00 22.91 ? 281 PHE A CE1   1 
ATOM   2299 C CE2   . PHE A 1 281 ? 2.634   -39.083 11.976  1.00 16.23 ? 281 PHE A CE2   1 
ATOM   2300 C CZ    . PHE A 1 281 ? 2.828   -38.148 10.975  1.00 23.08 ? 281 PHE A CZ    1 
ATOM   2301 N N     . VAL A 1 282 ? 8.005   -43.333 11.282  1.00 28.43 ? 282 VAL A N     1 
ATOM   2302 C CA    . VAL A 1 282 ? 8.511   -44.700 11.458  1.00 27.67 ? 282 VAL A CA    1 
ATOM   2303 C C     . VAL A 1 282 ? 9.970   -44.738 11.931  1.00 28.06 ? 282 VAL A C     1 
ATOM   2304 O O     . VAL A 1 282 ? 10.345  -45.613 12.716  1.00 28.87 ? 282 VAL A O     1 
ATOM   2305 C CB    . VAL A 1 282 ? 8.342   -45.509 10.157  1.00 28.08 ? 282 VAL A CB    1 
ATOM   2306 C CG1   . VAL A 1 282 ? 8.744   -46.962 10.355  1.00 27.05 ? 282 VAL A CG1   1 
ATOM   2307 C CG2   . VAL A 1 282 ? 6.899   -45.415 9.673   1.00 27.77 ? 282 VAL A CG2   1 
ATOM   2308 N N     . ALA A 1 283 ? 10.783  -43.790 11.458  1.00 28.25 ? 283 ALA A N     1 
ATOM   2309 C CA    . ALA A 1 283 ? 12.185  -43.659 11.886  1.00 26.74 ? 283 ALA A CA    1 
ATOM   2310 C C     . ALA A 1 283 ? 12.286  -43.283 13.351  1.00 27.31 ? 283 ALA A C     1 
ATOM   2311 O O     . ALA A 1 283 ? 13.314  -43.529 13.991  1.00 29.13 ? 283 ALA A O     1 
ATOM   2312 C CB    . ALA A 1 283 ? 12.910  -42.635 11.047  1.00 25.94 ? 283 ALA A CB    1 
ATOM   2313 N N     . ASN A 1 284 ? 11.215  -42.681 13.868  1.00 27.89 ? 284 ASN A N     1 
ATOM   2314 C CA    . ASN A 1 284 ? 11.117  -42.249 15.267  1.00 26.89 ? 284 ASN A CA    1 
ATOM   2315 C C     . ASN A 1 284 ? 11.284  -43.417 16.262  1.00 28.13 ? 284 ASN A C     1 
ATOM   2316 O O     . ASN A 1 284 ? 10.470  -44.352 16.253  1.00 27.35 ? 284 ASN A O     1 
ATOM   2317 C CB    . ASN A 1 284 ? 9.762   -41.559 15.457  1.00 26.39 ? 284 ASN A CB    1 
ATOM   2318 C CG    . ASN A 1 284 ? 9.534   -41.050 16.862  1.00 25.12 ? 284 ASN A CG    1 
ATOM   2319 O OD1   . ASN A 1 284 ? 10.467  -40.669 17.578  1.00 22.42 ? 284 ASN A OD1   1 
ATOM   2320 N ND2   . ASN A 1 284 ? 8.270   -41.022 17.263  1.00 24.67 ? 284 ASN A ND2   1 
ATOM   2321 N N     . PRO A 1 285 ? 12.334  -43.360 17.121  1.00 27.78 ? 285 PRO A N     1 
ATOM   2322 C CA    . PRO A 1 285 ? 12.570  -44.405 18.124  1.00 28.38 ? 285 PRO A CA    1 
ATOM   2323 C C     . PRO A 1 285 ? 11.629  -44.342 19.329  1.00 28.72 ? 285 PRO A C     1 
ATOM   2324 O O     . PRO A 1 285 ? 11.506  -45.326 20.057  1.00 28.58 ? 285 PRO A O     1 
ATOM   2325 C CB    . PRO A 1 285 ? 14.018  -44.154 18.591  1.00 28.13 ? 285 PRO A CB    1 
ATOM   2326 C CG    . PRO A 1 285 ? 14.506  -42.957 17.862  1.00 28.38 ? 285 PRO A CG    1 
ATOM   2327 C CD    . PRO A 1 285 ? 13.348  -42.293 17.195  1.00 28.12 ? 285 PRO A CD    1 
ATOM   2328 N N     . ASN A 1 286 ? 10.987  -43.196 19.541  1.00 29.32 ? 286 ASN A N     1 
ATOM   2329 C CA    . ASN A 1 286 ? 10.108  -43.000 20.696  1.00 29.42 ? 286 ASN A CA    1 
ATOM   2330 C C     . ASN A 1 286 ? 8.635   -42.893 20.302  1.00 29.59 ? 286 ASN A C     1 
ATOM   2331 O O     . ASN A 1 286 ? 7.954   -41.932 20.664  1.00 29.95 ? 286 ASN A O     1 
ATOM   2332 C CB    . ASN A 1 286 ? 10.539  -41.765 21.504  1.00 29.73 ? 286 ASN A CB    1 
ATOM   2333 C CG    . ASN A 1 286 ? 12.000  -41.823 21.944  1.00 31.53 ? 286 ASN A CG    1 
ATOM   2334 O OD1   . ASN A 1 286 ? 12.804  -40.960 21.576  1.00 31.36 ? 286 ASN A OD1   1 
ATOM   2335 N ND2   . ASN A 1 286 ? 12.349  -42.844 22.730  1.00 29.01 ? 286 ASN A ND2   1 
ATOM   2336 N N     . LYS A 1 287 ? 8.145   -43.894 19.575  1.00 29.57 ? 287 LYS A N     1 
ATOM   2337 C CA    . LYS A 1 287 ? 6.764   -43.905 19.095  1.00 29.78 ? 287 LYS A CA    1 
ATOM   2338 C C     . LYS A 1 287 ? 5.744   -44.110 20.218  1.00 29.86 ? 287 LYS A C     1 
ATOM   2339 O O     . LYS A 1 287 ? 5.881   -45.023 21.037  1.00 29.25 ? 287 LYS A O     1 
ATOM   2340 C CB    . LYS A 1 287 ? 6.582   -44.977 18.020  1.00 30.40 ? 287 LYS A CB    1 
ATOM   2341 C CG    . LYS A 1 287 ? 7.278   -44.668 16.696  1.00 32.22 ? 287 LYS A CG    1 
ATOM   2342 C CD    . LYS A 1 287 ? 7.112   -45.809 15.708  1.00 30.37 ? 287 LYS A CD    1 
ATOM   2343 C CE    . LYS A 1 287 ? 8.172   -46.862 15.902  1.00 33.53 ? 287 LYS A CE    1 
ATOM   2344 N NZ    . LYS A 1 287 ? 9.391   -46.548 15.120  1.00 35.04 ? 287 LYS A NZ    1 
ATOM   2345 N N     . THR A 1 288 ? 4.728   -43.248 20.245  1.00 29.60 ? 288 THR A N     1 
ATOM   2346 C CA    . THR A 1 288 ? 3.636   -43.340 21.216  1.00 29.44 ? 288 THR A CA    1 
ATOM   2347 C C     . THR A 1 288 ? 2.765   -44.560 20.935  1.00 29.74 ? 288 THR A C     1 
ATOM   2348 O O     . THR A 1 288 ? 2.821   -45.126 19.848  1.00 29.89 ? 288 THR A O     1 
ATOM   2349 C CB    . THR A 1 288 ? 2.756   -42.056 21.241  1.00 28.89 ? 288 THR A CB    1 
ATOM   2350 O OG1   . THR A 1 288 ? 2.106   -41.876 19.978  1.00 27.65 ? 288 THR A OG1   1 
ATOM   2351 C CG2   . THR A 1 288 ? 3.599   -40.831 21.541  1.00 30.76 ? 288 THR A CG2   1 
ATOM   2352 N N     . GLN A 1 289 ? 1.955   -44.954 21.917  1.00 30.26 ? 289 GLN A N     1 
ATOM   2353 C CA    . GLN A 1 289 ? 1.116   -46.143 21.788  1.00 29.97 ? 289 GLN A CA    1 
ATOM   2354 C C     . GLN A 1 289 ? 0.139   -46.107 20.603  1.00 30.04 ? 289 GLN A C     1 
ATOM   2355 O O     . GLN A 1 289 ? 0.107   -47.062 19.832  1.00 30.12 ? 289 GLN A O     1 
ATOM   2356 C CB    . GLN A 1 289 ? 0.400   -46.482 23.108  1.00 29.96 ? 289 GLN A CB    1 
ATOM   2357 C CG    . GLN A 1 289 ? 0.086   -47.969 23.265  1.00 29.21 ? 289 GLN A CG    1 
ATOM   2358 C CD    . GLN A 1 289 ? 1.283   -48.860 22.948  1.00 30.15 ? 289 GLN A CD    1 
ATOM   2359 O OE1   . GLN A 1 289 ? 2.340   -48.753 23.572  1.00 31.52 ? 289 GLN A OE1   1 
ATOM   2360 N NE2   . GLN A 1 289 ? 1.119   -49.738 21.964  1.00 30.69 ? 289 GLN A NE2   1 
ATOM   2361 N N     . PRO A 1 290 ? -0.638  -45.007 20.435  1.00 30.58 ? 290 PRO A N     1 
ATOM   2362 C CA    . PRO A 1 290 ? -1.560  -44.960 19.291  1.00 29.73 ? 290 PRO A CA    1 
ATOM   2363 C C     . PRO A 1 290 ? -0.860  -45.059 17.936  1.00 29.71 ? 290 PRO A C     1 
ATOM   2364 O O     . PRO A 1 290 ? -1.464  -45.541 16.976  1.00 30.47 ? 290 PRO A O     1 
ATOM   2365 C CB    . PRO A 1 290 ? -2.233  -43.593 19.437  1.00 29.51 ? 290 PRO A CB    1 
ATOM   2366 C CG    . PRO A 1 290 ? -2.092  -43.247 20.873  1.00 29.96 ? 290 PRO A CG    1 
ATOM   2367 C CD    . PRO A 1 290 ? -0.740  -43.777 21.245  1.00 30.76 ? 290 PRO A CD    1 
ATOM   2368 N N     . ILE A 1 291 ? 0.392   -44.601 17.869  1.00 28.25 ? 291 ILE A N     1 
ATOM   2369 C CA    . ILE A 1 291 ? 1.195   -44.664 16.657  1.00 27.59 ? 291 ILE A CA    1 
ATOM   2370 C C     . ILE A 1 291 ? 1.663   -46.098 16.440  1.00 27.29 ? 291 ILE A C     1 
ATOM   2371 O O     . ILE A 1 291 ? 1.531   -46.668 15.349  1.00 25.51 ? 291 ILE A O     1 
ATOM   2372 C CB    . ILE A 1 291 ? 2.419   -43.690 16.747  1.00 28.23 ? 291 ILE A CB    1 
ATOM   2373 C CG1   . ILE A 1 291 ? 1.981   -42.226 16.553  1.00 29.22 ? 291 ILE A CG1   1 
ATOM   2374 C CG2   . ILE A 1 291 ? 3.536   -44.071 15.761  1.00 27.97 ? 291 ILE A CG2   1 
ATOM   2375 C CD1   . ILE A 1 291 ? 1.417   -41.881 15.190  1.00 23.21 ? 291 ILE A CD1   1 
ATOM   2376 N N     . LEU A 1 292 ? 2.196   -46.672 17.513  1.00 27.96 ? 292 LEU A N     1 
ATOM   2377 C CA    . LEU A 1 292 ? 2.703   -48.026 17.519  1.00 28.68 ? 292 LEU A CA    1 
ATOM   2378 C C     . LEU A 1 292 ? 1.581   -49.017 17.158  1.00 28.61 ? 292 LEU A C     1 
ATOM   2379 O O     . LEU A 1 292 ? 1.803   -49.960 16.393  1.00 28.13 ? 292 LEU A O     1 
ATOM   2380 C CB    . LEU A 1 292 ? 3.314   -48.310 18.891  1.00 28.00 ? 292 LEU A CB    1 
ATOM   2381 C CG    . LEU A 1 292 ? 4.664   -49.024 19.001  1.00 32.18 ? 292 LEU A CG    1 
ATOM   2382 C CD1   . LEU A 1 292 ? 5.622   -48.654 17.877  1.00 30.21 ? 292 LEU A CD1   1 
ATOM   2383 C CD2   . LEU A 1 292 ? 5.306   -48.742 20.374  1.00 31.11 ? 292 LEU A CD2   1 
ATOM   2384 N N     . ASP A 1 293 ? 0.378   -48.763 17.685  1.00 28.56 ? 293 ASP A N     1 
ATOM   2385 C CA    . ASP A 1 293 ? -0.831  -49.535 17.364  1.00 27.84 ? 293 ASP A CA    1 
ATOM   2386 C C     . ASP A 1 293 ? -1.202  -49.562 15.870  1.00 26.80 ? 293 ASP A C     1 
ATOM   2387 O O     . ASP A 1 293 ? -1.592  -50.605 15.354  1.00 26.12 ? 293 ASP A O     1 
ATOM   2388 C CB    . ASP A 1 293 ? -2.015  -49.029 18.192  1.00 28.48 ? 293 ASP A CB    1 
ATOM   2389 C CG    . ASP A 1 293 ? -1.916  -49.419 19.674  1.00 32.83 ? 293 ASP A CG    1 
ATOM   2390 O OD1   . ASP A 1 293 ? -0.913  -50.062 20.075  1.00 34.20 ? 293 ASP A OD1   1 
ATOM   2391 O OD2   . ASP A 1 293 ? -2.847  -49.077 20.444  1.00 33.92 ? 293 ASP A OD2   1 
ATOM   2392 N N     . ILE A 1 294 ? -1.066  -48.423 15.185  1.00 25.84 ? 294 ILE A N     1 
ATOM   2393 C CA    . ILE A 1 294 ? -1.383  -48.321 13.754  1.00 24.64 ? 294 ILE A CA    1 
ATOM   2394 C C     . ILE A 1 294 ? -0.357  -49.069 12.883  1.00 27.30 ? 294 ILE A C     1 
ATOM   2395 O O     . ILE A 1 294 ? -0.706  -49.691 11.871  1.00 28.65 ? 294 ILE A O     1 
ATOM   2396 C CB    . ILE A 1 294 ? -1.528  -46.833 13.314  1.00 25.75 ? 294 ILE A CB    1 
ATOM   2397 C CG1   . ILE A 1 294 ? -2.811  -46.222 13.906  1.00 23.15 ? 294 ILE A CG1   1 
ATOM   2398 C CG2   . ILE A 1 294 ? -1.488  -46.682 11.779  1.00 21.77 ? 294 ILE A CG2   1 
ATOM   2399 C CD1   . ILE A 1 294 ? -2.938  -44.728 13.715  1.00 22.47 ? 294 ILE A CD1   1 
ATOM   2400 N N     . LEU A 1 295 ? 0.909   -49.019 13.281  1.00 27.46 ? 295 LEU A N     1 
ATOM   2401 C CA    . LEU A 1 295 ? 1.952   -49.698 12.527  1.00 26.96 ? 295 LEU A CA    1 
ATOM   2402 C C     . LEU A 1 295 ? 1.885   -51.217 12.685  1.00 27.48 ? 295 LEU A C     1 
ATOM   2403 O O     . LEU A 1 295 ? 2.022   -51.939 11.701  1.00 28.63 ? 295 LEU A O     1 
ATOM   2404 C CB    . LEU A 1 295 ? 3.339   -49.129 12.873  1.00 25.77 ? 295 LEU A CB    1 
ATOM   2405 C CG    . LEU A 1 295 ? 3.526   -47.643 12.533  1.00 25.96 ? 295 LEU A CG    1 
ATOM   2406 C CD1   . LEU A 1 295 ? 4.899   -47.127 12.965  1.00 24.76 ? 295 LEU A CD1   1 
ATOM   2407 C CD2   . LEU A 1 295 ? 3.296   -47.367 11.044  1.00 22.32 ? 295 LEU A CD2   1 
ATOM   2408 N N     . LEU A 1 296 ? 1.650   -51.698 13.904  1.00 28.04 ? 296 LEU A N     1 
ATOM   2409 C CA    . LEU A 1 296 ? 1.462   -53.139 14.144  1.00 28.89 ? 296 LEU A CA    1 
ATOM   2410 C C     . LEU A 1 296 ? 0.192   -53.705 13.485  1.00 29.15 ? 296 LEU A C     1 
ATOM   2411 O O     . LEU A 1 296 ? 0.187   -54.847 13.021  1.00 29.81 ? 296 LEU A O     1 
ATOM   2412 C CB    . LEU A 1 296 ? 1.492   -53.474 15.647  1.00 28.42 ? 296 LEU A CB    1 
ATOM   2413 C CG    . LEU A 1 296 ? 2.870   -53.495 16.331  1.00 29.91 ? 296 LEU A CG    1 
ATOM   2414 C CD1   . LEU A 1 296 ? 2.751   -53.293 17.843  1.00 29.42 ? 296 LEU A CD1   1 
ATOM   2415 C CD2   . LEU A 1 296 ? 3.664   -54.774 16.008  1.00 27.36 ? 296 LEU A CD2   1 
ATOM   2416 N N     . LYS A 1 297 ? -0.872  -52.902 13.443  1.00 28.83 ? 297 LYS A N     1 
ATOM   2417 C CA    . LYS A 1 297 ? -2.146  -53.289 12.811  1.00 28.08 ? 297 LYS A CA    1 
ATOM   2418 C C     . LYS A 1 297 ? -1.983  -53.565 11.303  1.00 27.69 ? 297 LYS A C     1 
ATOM   2419 O O     . LYS A 1 297 ? -2.595  -54.486 10.763  1.00 26.48 ? 297 LYS A O     1 
ATOM   2420 C CB    . LYS A 1 297 ? -3.175  -52.180 13.037  1.00 27.88 ? 297 LYS A CB    1 
ATOM   2421 C CG    . LYS A 1 297 ? -4.628  -52.553 12.771  1.00 30.96 ? 297 LYS A CG    1 
ATOM   2422 C CD    . LYS A 1 297 ? -5.375  -52.890 14.055  1.00 32.37 ? 297 LYS A CD    1 
ATOM   2423 C CE    . LYS A 1 297 ? -6.843  -52.485 13.951  1.00 33.45 ? 297 LYS A CE    1 
ATOM   2424 N NZ    . LYS A 1 297 ? -7.687  -53.219 14.929  1.00 31.19 ? 297 LYS A NZ    1 
ATOM   2425 N N     . ASN A 1 298 ? -1.140  -52.763 10.647  1.00 28.11 ? 298 ASN A N     1 
ATOM   2426 C CA    . ASN A 1 298 ? -0.880  -52.845 9.203   1.00 27.70 ? 298 ASN A CA    1 
ATOM   2427 C C     . ASN A 1 298 ? 0.524   -53.374 8.852   1.00 28.03 ? 298 ASN A C     1 
ATOM   2428 O O     . ASN A 1 298 ? 1.031   -53.132 7.747   1.00 27.21 ? 298 ASN A O     1 
ATOM   2429 C CB    . ASN A 1 298 ? -1.067  -51.463 8.574   1.00 28.44 ? 298 ASN A CB    1 
ATOM   2430 C CG    . ASN A 1 298 ? -2.497  -50.969 8.660   1.00 28.08 ? 298 ASN A CG    1 
ATOM   2431 O OD1   . ASN A 1 298 ? -3.288  -51.208 7.754   1.00 29.65 ? 298 ASN A OD1   1 
ATOM   2432 N ND2   . ASN A 1 298 ? -2.841  -50.296 9.759   1.00 24.31 ? 298 ASN A ND2   1 
ATOM   2433 N N     . GLN A 1 299 ? 1.131   -54.101 9.794   1.00 27.56 ? 299 GLN A N     1 
ATOM   2434 C CA    . GLN A 1 299 ? 2.520   -54.556 9.701   1.00 27.26 ? 299 GLN A CA    1 
ATOM   2435 C C     . GLN A 1 299 ? 2.808   -55.284 8.394   1.00 27.92 ? 299 GLN A C     1 
ATOM   2436 O O     . GLN A 1 299 ? 3.699   -54.881 7.653   1.00 28.29 ? 299 GLN A O     1 
ATOM   2437 C CB    . GLN A 1 299 ? 2.890   -55.440 10.906  1.00 27.22 ? 299 GLN A CB    1 
ATOM   2438 C CG    . GLN A 1 299 ? 4.378   -55.802 10.970  1.00 27.37 ? 299 GLN A CG    1 
ATOM   2439 C CD    . GLN A 1 299 ? 4.776   -56.563 12.222  1.00 27.43 ? 299 GLN A CD    1 
ATOM   2440 O OE1   . GLN A 1 299 ? 4.057   -57.444 12.696  1.00 25.21 ? 299 GLN A OE1   1 
ATOM   2441 N NE2   . GLN A 1 299 ? 5.944   -56.236 12.753  1.00 28.90 ? 299 GLN A NE2   1 
ATOM   2442 N N     . ALA A 1 300 ? 2.049   -56.346 8.121   1.00 29.19 ? 300 ALA A N     1 
ATOM   2443 C CA    . ALA A 1 300 ? 2.192   -57.127 6.888   1.00 28.90 ? 300 ALA A CA    1 
ATOM   2444 C C     . ALA A 1 300 ? 1.877   -56.317 5.622   1.00 29.08 ? 300 ALA A C     1 
ATOM   2445 O O     . ALA A 1 300 ? 2.566   -56.464 4.612   1.00 28.51 ? 300 ALA A O     1 
ATOM   2446 C CB    . ALA A 1 300 ? 1.328   -58.373 6.951   1.00 29.57 ? 300 ALA A CB    1 
ATOM   2447 N N     . LYS A 1 301 ? 0.852   -55.463 5.685   1.00 28.64 ? 301 LYS A N     1 
ATOM   2448 C CA    . LYS A 1 301 ? 0.453   -54.654 4.526   1.00 28.74 ? 301 LYS A CA    1 
ATOM   2449 C C     . LYS A 1 301 ? 1.516   -53.620 4.158   1.00 27.67 ? 301 LYS A C     1 
ATOM   2450 O O     . LYS A 1 301 ? 1.791   -53.400 2.983   1.00 26.80 ? 301 LYS A O     1 
ATOM   2451 C CB    . LYS A 1 301 ? -0.910  -53.968 4.736   1.00 29.29 ? 301 LYS A CB    1 
ATOM   2452 C CG    . LYS A 1 301 ? -1.964  -54.814 5.466   1.00 32.72 ? 301 LYS A CG    1 
ATOM   2453 C CD    . LYS A 1 301 ? -3.383  -54.403 5.079   1.00 33.50 ? 301 LYS A CD    1 
ATOM   2454 C CE    . LYS A 1 301 ? -4.290  -54.188 6.297   1.00 33.46 ? 301 LYS A CE    1 
ATOM   2455 N NZ    . LYS A 1 301 ? -4.591  -55.414 7.097   1.00 32.04 ? 301 LYS A NZ    1 
ATOM   2456 N N     . LEU A 1 302 ? 2.104   -52.990 5.171   1.00 28.22 ? 302 LEU A N     1 
ATOM   2457 C CA    . LEU A 1 302 ? 3.138   -51.968 4.967   1.00 28.58 ? 302 LEU A CA    1 
ATOM   2458 C C     . LEU A 1 302 ? 4.406   -52.560 4.363   1.00 28.39 ? 302 LEU A C     1 
ATOM   2459 O O     . LEU A 1 302 ? 4.953   -52.002 3.424   1.00 29.17 ? 302 LEU A O     1 
ATOM   2460 C CB    . LEU A 1 302 ? 3.458   -51.226 6.276   1.00 28.24 ? 302 LEU A CB    1 
ATOM   2461 C CG    . LEU A 1 302 ? 2.441   -50.190 6.782   1.00 27.12 ? 302 LEU A CG    1 
ATOM   2462 C CD1   . LEU A 1 302 ? 2.649   -49.919 8.257   1.00 24.76 ? 302 LEU A CD1   1 
ATOM   2463 C CD2   . LEU A 1 302 ? 2.460   -48.869 5.975   1.00 21.43 ? 302 LEU A CD2   1 
ATOM   2464 N N     . ILE A 1 303 ? 4.860   -53.690 4.899   1.00 27.84 ? 303 ILE A N     1 
ATOM   2465 C CA    . ILE A 1 303 ? 6.019   -54.398 4.354   1.00 28.29 ? 303 ILE A CA    1 
ATOM   2466 C C     . ILE A 1 303 ? 5.816   -54.726 2.862   1.00 29.92 ? 303 ILE A C     1 
ATOM   2467 O O     . ILE A 1 303 ? 6.717   -54.491 2.034   1.00 30.72 ? 303 ILE A O     1 
ATOM   2468 C CB    . ILE A 1 303 ? 6.351   -55.669 5.188   1.00 28.54 ? 303 ILE A CB    1 
ATOM   2469 C CG1   . ILE A 1 303 ? 6.682   -55.262 6.632   1.00 28.36 ? 303 ILE A CG1   1 
ATOM   2470 C CG2   . ILE A 1 303 ? 7.505   -56.488 4.550   1.00 24.92 ? 303 ILE A CG2   1 
ATOM   2471 C CD1   . ILE A 1 303 ? 6.644   -56.384 7.630   1.00 25.95 ? 303 ILE A CD1   1 
ATOM   2472 N N     . GLU A 1 304 ? 4.634   -55.241 2.524   1.00 28.52 ? 304 GLU A N     1 
ATOM   2473 C CA    . GLU A 1 304 ? 4.303   -55.560 1.136   1.00 29.73 ? 304 GLU A CA    1 
ATOM   2474 C C     . GLU A 1 304 ? 4.238   -54.308 0.252   1.00 29.02 ? 304 GLU A C     1 
ATOM   2475 O O     . GLU A 1 304 ? 4.817   -54.282 -0.835  1.00 28.64 ? 304 GLU A O     1 
ATOM   2476 C CB    . GLU A 1 304 ? 2.993   -56.359 1.060   1.00 30.53 ? 304 GLU A CB    1 
ATOM   2477 C CG    . GLU A 1 304 ? 2.636   -56.899 -0.331  1.00 34.97 ? 304 GLU A CG    1 
ATOM   2478 C CD    . GLU A 1 304 ? 3.573   -58.015 -0.817  1.00 45.52 ? 304 GLU A CD    1 
ATOM   2479 O OE1   . GLU A 1 304 ? 3.605   -58.264 -2.045  1.00 49.94 ? 304 GLU A OE1   1 
ATOM   2480 O OE2   . GLU A 1 304 ? 4.273   -58.649 0.012   1.00 46.84 ? 304 GLU A OE2   1 
ATOM   2481 N N     . PHE A 1 305 ? 3.537   -53.281 0.734   1.00 29.25 ? 305 PHE A N     1 
ATOM   2482 C CA    . PHE A 1 305 ? 3.392   -52.002 0.032   1.00 28.71 ? 305 PHE A CA    1 
ATOM   2483 C C     . PHE A 1 305 ? 4.738   -51.357 -0.282  1.00 28.47 ? 305 PHE A C     1 
ATOM   2484 O O     . PHE A 1 305 ? 4.971   -50.932 -1.405  1.00 28.72 ? 305 PHE A O     1 
ATOM   2485 C CB    . PHE A 1 305 ? 2.544   -51.039 0.869   1.00 29.17 ? 305 PHE A CB    1 
ATOM   2486 C CG    . PHE A 1 305 ? 2.325   -49.704 0.222   1.00 30.68 ? 305 PHE A CG    1 
ATOM   2487 C CD1   . PHE A 1 305 ? 3.162   -48.625 0.517   1.00 30.64 ? 305 PHE A CD1   1 
ATOM   2488 C CD2   . PHE A 1 305 ? 1.284   -49.521 -0.691  1.00 32.61 ? 305 PHE A CD2   1 
ATOM   2489 C CE1   . PHE A 1 305 ? 2.977   -47.389 -0.096  1.00 30.90 ? 305 PHE A CE1   1 
ATOM   2490 C CE2   . PHE A 1 305 ? 1.076   -48.280 -1.302  1.00 32.85 ? 305 PHE A CE2   1 
ATOM   2491 C CZ    . PHE A 1 305 ? 1.926   -47.212 -1.002  1.00 30.29 ? 305 PHE A CZ    1 
ATOM   2492 N N     . LEU A 1 306 ? 5.610   -51.291 0.723   1.00 29.63 ? 306 LEU A N     1 
ATOM   2493 C CA    . LEU A 1 306 ? 6.927   -50.661 0.611   1.00 29.98 ? 306 LEU A CA    1 
ATOM   2494 C C     . LEU A 1 306 ? 7.902   -51.392 -0.315  1.00 30.22 ? 306 LEU A C     1 
ATOM   2495 O O     . LEU A 1 306 ? 8.746   -50.754 -0.940  1.00 30.67 ? 306 LEU A O     1 
ATOM   2496 C CB    . LEU A 1 306 ? 7.548   -50.458 2.001   1.00 30.23 ? 306 LEU A CB    1 
ATOM   2497 C CG    . LEU A 1 306 ? 6.963   -49.345 2.897   1.00 32.97 ? 306 LEU A CG    1 
ATOM   2498 C CD1   . LEU A 1 306 ? 7.313   -49.572 4.366   1.00 32.85 ? 306 LEU A CD1   1 
ATOM   2499 C CD2   . LEU A 1 306 ? 7.394   -47.930 2.462   1.00 35.48 ? 306 LEU A CD2   1 
ATOM   2500 N N     . SER A 1 307 ? 7.779   -52.718 -0.408  1.00 29.72 ? 307 SER A N     1 
ATOM   2501 C CA    . SER A 1 307 ? 8.563   -53.519 -1.351  1.00 29.24 ? 307 SER A CA    1 
ATOM   2502 C C     . SER A 1 307 ? 8.266   -53.228 -2.820  1.00 29.64 ? 307 SER A C     1 
ATOM   2503 O O     . SER A 1 307 ? 9.123   -53.428 -3.683  1.00 29.55 ? 307 SER A O     1 
ATOM   2504 C CB    . SER A 1 307 ? 8.349   -55.009 -1.091  1.00 29.63 ? 307 SER A CB    1 
ATOM   2505 O OG    . SER A 1 307 ? 9.052   -55.405 0.073   1.00 32.44 ? 307 SER A OG    1 
ATOM   2506 N N     . LYS A 1 308 ? 7.051   -52.776 -3.107  1.00 29.14 ? 308 LYS A N     1 
ATOM   2507 C CA    . LYS A 1 308 ? 6.640   -52.540 -4.480  1.00 29.41 ? 308 LYS A CA    1 
ATOM   2508 C C     . LYS A 1 308 ? 6.356   -51.063 -4.735  1.00 29.08 ? 308 LYS A C     1 
ATOM   2509 O O     . LYS A 1 308 ? 5.681   -50.706 -5.709  1.00 29.30 ? 308 LYS A O     1 
ATOM   2510 C CB    . LYS A 1 308 ? 5.425   -53.410 -4.819  1.00 29.71 ? 308 LYS A CB    1 
ATOM   2511 C CG    . LYS A 1 308 ? 5.794   -54.868 -5.114  1.00 33.68 ? 308 LYS A CG    1 
ATOM   2512 C CD    . LYS A 1 308 ? 6.416   -55.028 -6.516  1.00 38.85 ? 308 LYS A CD    1 
ATOM   2513 C CE    . LYS A 1 308 ? 7.651   -55.930 -6.509  1.00 39.85 ? 308 LYS A CE    1 
ATOM   2514 N NZ    . LYS A 1 308 ? 7.391   -57.266 -5.914  1.00 40.63 ? 308 LYS A NZ    1 
ATOM   2515 N N     . PHE A 1 309 ? 6.890   -50.210 -3.866  1.00 27.00 ? 309 PHE A N     1 
ATOM   2516 C CA    . PHE A 1 309 ? 6.568   -48.789 -3.916  1.00 26.21 ? 309 PHE A CA    1 
ATOM   2517 C C     . PHE A 1 309 ? 7.528   -48.009 -4.832  1.00 26.01 ? 309 PHE A C     1 
ATOM   2518 O O     . PHE A 1 309 ? 8.709   -47.831 -4.514  1.00 25.68 ? 309 PHE A O     1 
ATOM   2519 C CB    . PHE A 1 309 ? 6.468   -48.193 -2.504  1.00 23.89 ? 309 PHE A CB    1 
ATOM   2520 C CG    . PHE A 1 309 ? 6.068   -46.744 -2.484  1.00 25.04 ? 309 PHE A CG    1 
ATOM   2521 C CD1   . PHE A 1 309 ? 4.881   -46.328 -3.069  1.00 20.61 ? 309 PHE A CD1   1 
ATOM   2522 C CD2   . PHE A 1 309 ? 6.886   -45.794 -1.882  1.00 25.40 ? 309 PHE A CD2   1 
ATOM   2523 C CE1   . PHE A 1 309 ? 4.518   -44.992 -3.068  1.00 25.68 ? 309 PHE A CE1   1 
ATOM   2524 C CE2   . PHE A 1 309 ? 6.531   -44.443 -1.884  1.00 27.79 ? 309 PHE A CE2   1 
ATOM   2525 C CZ    . PHE A 1 309 ? 5.350   -44.042 -2.466  1.00 22.59 ? 309 PHE A CZ    1 
ATOM   2526 N N     . GLN A 1 310 ? 6.987   -47.564 -5.972  1.00 24.55 ? 310 GLN A N     1 
ATOM   2527 C CA    . GLN A 1 310 ? 7.721   -46.842 -7.019  1.00 23.38 ? 310 GLN A CA    1 
ATOM   2528 C C     . GLN A 1 310 ? 9.088   -47.455 -7.297  1.00 23.44 ? 310 GLN A C     1 
ATOM   2529 O O     . GLN A 1 310 ? 10.103  -46.762 -7.228  1.00 22.66 ? 310 GLN A O     1 
ATOM   2530 C CB    . GLN A 1 310 ? 7.848   -45.345 -6.692  1.00 22.99 ? 310 GLN A CB    1 
ATOM   2531 C CG    . GLN A 1 310 ? 6.578   -44.727 -6.159  1.00 22.55 ? 310 GLN A CG    1 
ATOM   2532 C CD    . GLN A 1 310 ? 6.504   -43.212 -6.319  1.00 24.25 ? 310 GLN A CD    1 
ATOM   2533 O OE1   . GLN A 1 310 ? 7.493   -42.544 -6.623  1.00 25.31 ? 310 GLN A OE1   1 
ATOM   2534 N NE2   . GLN A 1 310 ? 5.317   -42.665 -6.094  1.00 19.87 ? 310 GLN A NE2   1 
ATOM   2535 N N     . ASN A 1 311 ? 9.090   -48.758 -7.596  1.00 24.47 ? 311 ASN A N     1 
ATOM   2536 C CA    . ASN A 1 311 ? 10.290  -49.518 -7.956  1.00 24.60 ? 311 ASN A CA    1 
ATOM   2537 C C     . ASN A 1 311 ? 10.974  -49.031 -9.228  1.00 24.93 ? 311 ASN A C     1 
ATOM   2538 O O     . ASN A 1 311 ? 12.157  -49.296 -9.434  1.00 24.03 ? 311 ASN A O     1 
ATOM   2539 C CB    . ASN A 1 311 ? 9.957   -51.007 -8.105  1.00 25.55 ? 311 ASN A CB    1 
ATOM   2540 C CG    . ASN A 1 311 ? 9.882   -51.725 -6.773  1.00 27.10 ? 311 ASN A CG    1 
ATOM   2541 O OD1   . ASN A 1 311 ? 10.171  -51.149 -5.728  1.00 32.07 ? 311 ASN A OD1   1 
ATOM   2542 N ND2   . ASN A 1 311 ? 9.500   -52.994 -6.806  1.00 30.25 ? 311 ASN A ND2   1 
ATOM   2543 N N     . ASP A 1 312 ? 10.220  -48.330 -10.074 1.00 26.12 ? 312 ASP A N     1 
ATOM   2544 C CA    . ASP A 1 312 ? 10.743  -47.737 -11.307 1.00 27.84 ? 312 ASP A CA    1 
ATOM   2545 C C     . ASP A 1 312 ? 11.537  -46.452 -11.042 1.00 28.52 ? 312 ASP A C     1 
ATOM   2546 O O     . ASP A 1 312 ? 12.187  -45.923 -11.945 1.00 29.09 ? 312 ASP A O     1 
ATOM   2547 C CB    . ASP A 1 312 ? 9.602   -47.457 -12.287 1.00 28.31 ? 312 ASP A CB    1 
ATOM   2548 C CG    . ASP A 1 312 ? 8.655   -46.371 -11.788 1.00 30.81 ? 312 ASP A CG    1 
ATOM   2549 O OD1   . ASP A 1 312 ? 8.206   -46.439 -10.621 1.00 30.15 ? 312 ASP A OD1   1 
ATOM   2550 O OD2   . ASP A 1 312 ? 8.366   -45.442 -12.569 1.00 35.69 ? 312 ASP A OD2   1 
ATOM   2551 N N     . ARG A 1 313 ? 11.468  -45.951 -9.811  1.00 29.96 ? 313 ARG A N     1 
ATOM   2552 C CA    . ARG A 1 313 ? 12.307  -44.836 -9.358  1.00 32.14 ? 313 ARG A CA    1 
ATOM   2553 C C     . ARG A 1 313 ? 13.705  -45.386 -9.039  1.00 33.72 ? 313 ARG A C     1 
ATOM   2554 O O     . ARG A 1 313 ? 13.994  -45.827 -7.920  1.00 35.86 ? 313 ARG A O     1 
ATOM   2555 C CB    . ARG A 1 313 ? 11.670  -44.156 -8.145  1.00 30.92 ? 313 ARG A CB    1 
ATOM   2556 C CG    . ARG A 1 313 ? 12.086  -42.722 -7.939  1.00 29.37 ? 313 ARG A CG    1 
ATOM   2557 C CD    . ARG A 1 313 ? 11.384  -42.135 -6.729  1.00 28.17 ? 313 ARG A CD    1 
ATOM   2558 N NE    . ARG A 1 313 ? 10.042  -41.651 -7.041  1.00 27.13 ? 313 ARG A NE    1 
ATOM   2559 C CZ    . ARG A 1 313 ? 9.773   -40.452 -7.561  1.00 28.97 ? 313 ARG A CZ    1 
ATOM   2560 N NH1   . ARG A 1 313 ? 10.755  -39.601 -7.833  1.00 27.40 ? 313 ARG A NH1   1 
ATOM   2561 N NH2   . ARG A 1 313 ? 8.513   -40.096 -7.808  1.00 27.87 ? 313 ARG A NH2   1 
ATOM   2562 N N     . THR A 1 314 ? 14.576  -45.334 -10.034 1.00 35.24 ? 314 THR A N     1 
ATOM   2563 C CA    . THR A 1 314 ? 15.668  -46.284 -10.106 1.00 37.14 ? 314 THR A CA    1 
ATOM   2564 C C     . THR A 1 314 ? 17.013  -45.827 -9.530  1.00 38.14 ? 314 THR A C     1 
ATOM   2565 O O     . THR A 1 314 ? 17.705  -46.630 -8.892  1.00 38.85 ? 314 THR A O     1 
ATOM   2566 C CB    . THR A 1 314 ? 15.797  -46.874 -11.551 1.00 37.04 ? 314 THR A CB    1 
ATOM   2567 O OG1   . THR A 1 314 ? 16.051  -48.280 -11.471 1.00 37.72 ? 314 THR A OG1   1 
ATOM   2568 C CG2   . THR A 1 314 ? 16.895  -46.193 -12.374 1.00 37.21 ? 314 THR A CG2   1 
ATOM   2569 N N     . GLU A 1 315 ? 17.401  -44.570 -9.753  1.00 38.11 ? 315 GLU A N     1 
ATOM   2570 C CA    . GLU A 1 315 ? 18.695  -44.118 -9.225  1.00 37.91 ? 315 GLU A CA    1 
ATOM   2571 C C     . GLU A 1 315 ? 18.628  -43.023 -8.154  1.00 36.29 ? 315 GLU A C     1 
ATOM   2572 O O     . GLU A 1 315 ? 19.566  -42.240 -7.993  1.00 36.61 ? 315 GLU A O     1 
ATOM   2573 C CB    . GLU A 1 315 ? 19.746  -43.842 -10.325 1.00 38.79 ? 315 GLU A CB    1 
ATOM   2574 C CG    . GLU A 1 315 ? 19.223  -43.387 -11.682 1.00 42.69 ? 315 GLU A CG    1 
ATOM   2575 C CD    . GLU A 1 315 ? 19.048  -41.885 -11.770 1.00 47.12 ? 315 GLU A CD    1 
ATOM   2576 O OE1   . GLU A 1 315 ? 18.153  -41.345 -11.075 1.00 49.64 ? 315 GLU A OE1   1 
ATOM   2577 O OE2   . GLU A 1 315 ? 19.802  -41.249 -12.542 1.00 45.60 ? 315 GLU A OE2   1 
ATOM   2578 N N     . ASP A 1 316 ? 17.522  -42.998 -7.415  1.00 33.47 ? 316 ASP A N     1 
ATOM   2579 C CA    . ASP A 1 316 ? 17.443  -42.251 -6.172  1.00 31.87 ? 316 ASP A CA    1 
ATOM   2580 C C     . ASP A 1 316 ? 17.905  -43.209 -5.060  1.00 31.11 ? 316 ASP A C     1 
ATOM   2581 O O     . ASP A 1 316 ? 17.120  -44.006 -4.536  1.00 31.75 ? 316 ASP A O     1 
ATOM   2582 C CB    . ASP A 1 316 ? 16.010  -41.747 -5.944  1.00 30.89 ? 316 ASP A CB    1 
ATOM   2583 C CG    . ASP A 1 316 ? 15.880  -40.814 -4.737  1.00 30.67 ? 316 ASP A CG    1 
ATOM   2584 O OD1   . ASP A 1 316 ? 16.753  -40.815 -3.848  1.00 26.13 ? 316 ASP A OD1   1 
ATOM   2585 O OD2   . ASP A 1 316 ? 14.871  -40.079 -4.661  1.00 35.47 ? 316 ASP A OD2   1 
ATOM   2586 N N     . GLU A 1 317 ? 19.184  -43.129 -4.712  1.00 29.96 ? 317 GLU A N     1 
ATOM   2587 C CA    . GLU A 1 317 ? 19.785  -44.035 -3.727  1.00 30.12 ? 317 GLU A CA    1 
ATOM   2588 C C     . GLU A 1 317 ? 19.309  -43.823 -2.281  1.00 29.41 ? 317 GLU A C     1 
ATOM   2589 O O     . GLU A 1 317 ? 19.290  -44.775 -1.495  1.00 29.16 ? 317 GLU A O     1 
ATOM   2590 C CB    . GLU A 1 317 ? 21.314  -44.015 -3.821  1.00 29.80 ? 317 GLU A CB    1 
ATOM   2591 C CG    . GLU A 1 317 ? 21.863  -45.091 -4.754  1.00 32.37 ? 317 GLU A CG    1 
ATOM   2592 C CD    . GLU A 1 317 ? 23.384  -45.095 -4.856  1.00 33.38 ? 317 GLU A CD    1 
ATOM   2593 O OE1   . GLU A 1 317 ? 23.975  -46.190 -5.003  1.00 38.59 ? 317 GLU A OE1   1 
ATOM   2594 O OE2   . GLU A 1 317 ? 23.993  -44.006 -4.798  1.00 40.82 ? 317 GLU A OE2   1 
ATOM   2595 N N     . GLN A 1 318 ? 18.930  -42.581 -1.952  1.00 27.62 ? 318 GLN A N     1 
ATOM   2596 C CA    . GLN A 1 318 ? 18.323  -42.226 -0.667  1.00 27.27 ? 318 GLN A CA    1 
ATOM   2597 C C     . GLN A 1 318 ? 16.953  -42.890 -0.467  1.00 28.04 ? 318 GLN A C     1 
ATOM   2598 O O     . GLN A 1 318 ? 16.735  -43.543 0.557   1.00 29.03 ? 318 GLN A O     1 
ATOM   2599 C CB    . GLN A 1 318 ? 18.196  -40.701 -0.519  1.00 26.13 ? 318 GLN A CB    1 
ATOM   2600 C CG    . GLN A 1 318 ? 17.612  -40.269 0.828   1.00 26.37 ? 318 GLN A CG    1 
ATOM   2601 C CD    . GLN A 1 318 ? 17.268  -38.792 0.881   1.00 28.42 ? 318 GLN A CD    1 
ATOM   2602 O OE1   . GLN A 1 318 ? 16.241  -38.359 0.350   1.00 32.79 ? 318 GLN A OE1   1 
ATOM   2603 N NE2   . GLN A 1 318 ? 18.112  -38.014 1.535   1.00 23.14 ? 318 GLN A NE2   1 
ATOM   2604 N N     . PHE A 1 319 ? 16.052  -42.703 -1.439  1.00 26.74 ? 319 PHE A N     1 
ATOM   2605 C CA    . PHE A 1 319 ? 14.728  -43.350 -1.498  1.00 26.89 ? 319 PHE A CA    1 
ATOM   2606 C C     . PHE A 1 319 ? 14.773  -44.879 -1.344  1.00 28.34 ? 319 PHE A C     1 
ATOM   2607 O O     . PHE A 1 319 ? 13.941  -45.458 -0.638  1.00 28.77 ? 319 PHE A O     1 
ATOM   2608 C CB    . PHE A 1 319 ? 14.058  -43.000 -2.834  1.00 25.70 ? 319 PHE A CB    1 
ATOM   2609 C CG    . PHE A 1 319 ? 12.712  -43.648 -3.051  1.00 25.00 ? 319 PHE A CG    1 
ATOM   2610 C CD1   . PHE A 1 319 ? 11.637  -43.374 -2.205  1.00 23.27 ? 319 PHE A CD1   1 
ATOM   2611 C CD2   . PHE A 1 319 ? 12.504  -44.498 -4.137  1.00 24.37 ? 319 PHE A CD2   1 
ATOM   2612 C CE1   . PHE A 1 319 ? 10.373  -43.959 -2.424  1.00 27.33 ? 319 PHE A CE1   1 
ATOM   2613 C CE2   . PHE A 1 319 ? 11.244  -45.078 -4.370  1.00 24.60 ? 319 PHE A CE2   1 
ATOM   2614 C CZ    . PHE A 1 319 ? 10.177  -44.808 -3.512  1.00 23.65 ? 319 PHE A CZ    1 
ATOM   2615 N N     . ASN A 1 320 ? 15.728  -45.519 -2.022  1.00 27.87 ? 320 ASN A N     1 
ATOM   2616 C CA    . ASN A 1 320 ? 15.883  -46.967 -1.986  1.00 27.74 ? 320 ASN A CA    1 
ATOM   2617 C C     . ASN A 1 320 ? 16.282  -47.449 -0.592  1.00 28.73 ? 320 ASN A C     1 
ATOM   2618 O O     . ASN A 1 320 ? 15.684  -48.392 -0.054  1.00 30.40 ? 320 ASN A O     1 
ATOM   2619 C CB    . ASN A 1 320 ? 16.946  -47.424 -2.995  1.00 27.86 ? 320 ASN A CB    1 
ATOM   2620 C CG    . ASN A 1 320 ? 16.498  -47.281 -4.450  1.00 29.30 ? 320 ASN A CG    1 
ATOM   2621 O OD1   . ASN A 1 320 ? 15.352  -46.960 -4.745  1.00 32.01 ? 320 ASN A OD1   1 
ATOM   2622 N ND2   . ASN A 1 320 ? 17.419  -47.539 -5.367  1.00 29.91 ? 320 ASN A ND2   1 
ATOM   2623 N N     . ASP A 1 321 ? 17.309  -46.810 -0.030  1.00 27.54 ? 321 ASP A N     1 
ATOM   2624 C CA    . ASP A 1 321 ? 17.816  -47.144 1.285   1.00 26.66 ? 321 ASP A CA    1 
ATOM   2625 C C     . ASP A 1 321 ? 16.784  -46.821 2.374   1.00 27.04 ? 321 ASP A C     1 
ATOM   2626 O O     . ASP A 1 321 ? 16.653  -47.568 3.352   1.00 26.87 ? 321 ASP A O     1 
ATOM   2627 C CB    . ASP A 1 321 ? 19.144  -46.426 1.556   1.00 25.46 ? 321 ASP A CB    1 
ATOM   2628 C CG    . ASP A 1 321 ? 20.300  -46.957 0.704   1.00 25.32 ? 321 ASP A CG    1 
ATOM   2629 O OD1   . ASP A 1 321 ? 20.147  -47.976 -0.005  1.00 23.16 ? 321 ASP A OD1   1 
ATOM   2630 O OD2   . ASP A 1 321 ? 21.392  -46.349 0.750   1.00 27.36 ? 321 ASP A OD2   1 
ATOM   2631 N N     . GLU A 1 322 ? 16.064  -45.713 2.204   1.00 27.15 ? 322 GLU A N     1 
ATOM   2632 C CA    . GLU A 1 322 ? 14.966  -45.351 3.118   1.00 28.15 ? 322 GLU A CA    1 
ATOM   2633 C C     . GLU A 1 322 ? 13.891  -46.407 3.151   1.00 27.89 ? 322 GLU A C     1 
ATOM   2634 O O     . GLU A 1 322 ? 13.481  -46.822 4.231   1.00 29.93 ? 322 GLU A O     1 
ATOM   2635 C CB    . GLU A 1 322 ? 14.362  -43.984 2.790   1.00 27.03 ? 322 GLU A CB    1 
ATOM   2636 C CG    . GLU A 1 322 ? 15.323  -42.825 3.073   1.00 26.86 ? 322 GLU A CG    1 
ATOM   2637 C CD    . GLU A 1 322 ? 14.722  -41.455 2.797   1.00 28.75 ? 322 GLU A CD    1 
ATOM   2638 O OE1   . GLU A 1 322 ? 13.761  -41.359 1.994   1.00 32.87 ? 322 GLU A OE1   1 
ATOM   2639 O OE2   . GLU A 1 322 ? 15.226  -40.468 3.387   1.00 25.72 ? 322 GLU A OE2   1 
ATOM   2640 N N     . LYS A 1 323 ? 13.454  -46.865 1.979   1.00 28.54 ? 323 LYS A N     1 
ATOM   2641 C CA    . LYS A 1 323 ? 12.453  -47.947 1.899   1.00 27.83 ? 323 LYS A CA    1 
ATOM   2642 C C     . LYS A 1 323 ? 12.919  -49.243 2.573   1.00 26.77 ? 323 LYS A C     1 
ATOM   2643 O O     . LYS A 1 323 ? 12.126  -49.907 3.237   1.00 25.57 ? 323 LYS A O     1 
ATOM   2644 C CB    . LYS A 1 323 ? 12.066  -48.243 0.451   1.00 27.24 ? 323 LYS A CB    1 
ATOM   2645 C CG    . LYS A 1 323 ? 11.049  -47.283 -0.155  1.00 28.83 ? 323 LYS A CG    1 
ATOM   2646 C CD    . LYS A 1 323 ? 10.544  -47.826 -1.489  1.00 22.87 ? 323 LYS A CD    1 
ATOM   2647 C CE    . LYS A 1 323 ? 11.660  -47.919 -2.529  1.00 23.20 ? 323 LYS A CE    1 
ATOM   2648 N NZ    . LYS A 1 323 ? 11.198  -48.524 -3.820  1.00 23.48 ? 323 LYS A NZ    1 
ATOM   2649 N N     . THR A 1 324 ? 14.194  -49.597 2.381   1.00 27.72 ? 324 THR A N     1 
ATOM   2650 C CA    . THR A 1 324 ? 14.817  -50.778 3.017   1.00 27.12 ? 324 THR A CA    1 
ATOM   2651 C C     . THR A 1 324 ? 14.745  -50.653 4.533   1.00 28.17 ? 324 THR A C     1 
ATOM   2652 O O     . THR A 1 324 ? 14.377  -51.617 5.226   1.00 27.78 ? 324 THR A O     1 
ATOM   2653 C CB    . THR A 1 324 ? 16.289  -50.906 2.614   1.00 27.00 ? 324 THR A CB    1 
ATOM   2654 O OG1   . THR A 1 324 ? 16.388  -50.954 1.189   1.00 31.23 ? 324 THR A OG1   1 
ATOM   2655 C CG2   . THR A 1 324 ? 16.934  -52.161 3.213   1.00 24.23 ? 324 THR A CG2   1 
ATOM   2656 N N     . TYR A 1 325 ? 15.086  -49.453 5.023   1.00 28.66 ? 325 TYR A N     1 
ATOM   2657 C CA    . TYR A 1 325 ? 15.123  -49.123 6.450   1.00 29.02 ? 325 TYR A CA    1 
ATOM   2658 C C     . TYR A 1 325 ? 13.754  -49.197 7.116   1.00 30.45 ? 325 TYR A C     1 
ATOM   2659 O O     . TYR A 1 325 ? 13.619  -49.781 8.196   1.00 31.11 ? 325 TYR A O     1 
ATOM   2660 C CB    . TYR A 1 325 ? 15.710  -47.733 6.620   1.00 29.96 ? 325 TYR A CB    1 
ATOM   2661 C CG    . TYR A 1 325 ? 15.761  -47.204 8.035   1.00 28.77 ? 325 TYR A CG    1 
ATOM   2662 C CD1   . TYR A 1 325 ? 16.646  -47.723 8.966   1.00 30.91 ? 325 TYR A CD1   1 
ATOM   2663 C CD2   . TYR A 1 325 ? 14.942  -46.158 8.426   1.00 28.85 ? 325 TYR A CD2   1 
ATOM   2664 C CE1   . TYR A 1 325 ? 16.698  -47.224 10.256  1.00 32.00 ? 325 TYR A CE1   1 
ATOM   2665 C CE2   . TYR A 1 325 ? 14.992  -45.650 9.704   1.00 31.33 ? 325 TYR A CE2   1 
ATOM   2666 C CZ    . TYR A 1 325 ? 15.873  -46.179 10.613  1.00 28.32 ? 325 TYR A CZ    1 
ATOM   2667 O OH    . TYR A 1 325 ? 15.914  -45.661 11.886  1.00 31.14 ? 325 TYR A OH    1 
ATOM   2668 N N     . LEU A 1 326 ? 12.750  -48.612 6.463   1.00 30.29 ? 326 LEU A N     1 
ATOM   2669 C CA    . LEU A 1 326 ? 11.370  -48.622 6.953   1.00 30.31 ? 326 LEU A CA    1 
ATOM   2670 C C     . LEU A 1 326 ? 10.827  -50.040 7.043   1.00 30.81 ? 326 LEU A C     1 
ATOM   2671 O O     . LEU A 1 326 ? 10.153  -50.378 8.011   1.00 32.40 ? 326 LEU A O     1 
ATOM   2672 C CB    . LEU A 1 326 ? 10.452  -47.752 6.076   1.00 29.68 ? 326 LEU A CB    1 
ATOM   2673 C CG    . LEU A 1 326 ? 10.683  -46.227 5.942   1.00 30.32 ? 326 LEU A CG    1 
ATOM   2674 C CD1   . LEU A 1 326 ? 9.556   -45.595 5.132   1.00 28.95 ? 326 LEU A CD1   1 
ATOM   2675 C CD2   . LEU A 1 326 ? 10.817  -45.503 7.294   1.00 26.89 ? 326 LEU A CD2   1 
ATOM   2676 N N     . VAL A 1 327 ? 11.131  -50.871 6.045   1.00 29.90 ? 327 VAL A N     1 
ATOM   2677 C CA    . VAL A 1 327 ? 10.682  -52.262 6.053   1.00 27.57 ? 327 VAL A CA    1 
ATOM   2678 C C     . VAL A 1 327 ? 11.300  -53.002 7.246   1.00 27.43 ? 327 VAL A C     1 
ATOM   2679 O O     . VAL A 1 327 ? 10.582  -53.671 7.981   1.00 28.55 ? 327 VAL A O     1 
ATOM   2680 C CB    . VAL A 1 327 ? 10.953  -53.008 4.703   1.00 26.98 ? 327 VAL A CB    1 
ATOM   2681 C CG1   . VAL A 1 327 ? 10.798  -54.522 4.863   1.00 25.11 ? 327 VAL A CG1   1 
ATOM   2682 C CG2   . VAL A 1 327 ? 10.012  -52.533 3.621   1.00 24.12 ? 327 VAL A CG2   1 
ATOM   2683 N N     . LYS A 1 328 ? 12.615  -52.870 7.440   1.00 26.38 ? 328 LYS A N     1 
ATOM   2684 C CA    . LYS A 1 328 ? 13.279  -53.447 8.607   1.00 25.80 ? 328 LYS A CA    1 
ATOM   2685 C C     . LYS A 1 328 ? 12.641  -52.964 9.905   1.00 25.01 ? 328 LYS A C     1 
ATOM   2686 O O     . LYS A 1 328 ? 12.310  -53.775 10.770  1.00 24.29 ? 328 LYS A O     1 
ATOM   2687 C CB    . LYS A 1 328 ? 14.783  -53.145 8.615   1.00 26.39 ? 328 LYS A CB    1 
ATOM   2688 C CG    . LYS A 1 328 ? 15.550  -53.891 9.716   1.00 27.08 ? 328 LYS A CG    1 
ATOM   2689 C CD    . LYS A 1 328 ? 17.035  -53.545 9.708   1.00 27.56 ? 328 LYS A CD    1 
ATOM   2690 C CE    . LYS A 1 328 ? 17.644  -53.591 11.117  1.00 28.91 ? 328 LYS A CE    1 
ATOM   2691 N NZ    . LYS A 1 328 ? 17.685  -54.962 11.721  1.00 34.41 ? 328 LYS A NZ    1 
ATOM   2692 N N     . GLN A 1 329 ? 12.460  -51.646 10.028  1.00 24.39 ? 329 GLN A N     1 
ATOM   2693 C CA    . GLN A 1 329 ? 11.901  -51.047 11.236  1.00 24.09 ? 329 GLN A CA    1 
ATOM   2694 C C     . GLN A 1 329 ? 10.547  -51.643 11.609  1.00 24.03 ? 329 GLN A C     1 
ATOM   2695 O O     . GLN A 1 329 ? 10.334  -52.016 12.763  1.00 24.08 ? 329 GLN A O     1 
ATOM   2696 C CB    . GLN A 1 329 ? 11.788  -49.524 11.095  1.00 25.52 ? 329 GLN A CB    1 
ATOM   2697 C CG    . GLN A 1 329 ? 13.124  -48.778 11.164  1.00 27.97 ? 329 GLN A CG    1 
ATOM   2698 C CD    . GLN A 1 329 ? 13.840  -48.988 12.483  1.00 33.76 ? 329 GLN A CD    1 
ATOM   2699 O OE1   . GLN A 1 329 ? 14.932  -49.561 12.526  1.00 36.49 ? 329 GLN A OE1   1 
ATOM   2700 N NE2   . GLN A 1 329 ? 13.221  -48.539 13.571  1.00 33.93 ? 329 GLN A NE2   1 
ATOM   2701 N N     . ILE A 1 330 ? 9.655   -51.733 10.619  1.00 24.01 ? 330 ILE A N     1 
ATOM   2702 C CA    . ILE A 1 330 ? 8.286   -52.199 10.797  1.00 23.26 ? 330 ILE A CA    1 
ATOM   2703 C C     . ILE A 1 330 ? 8.251   -53.706 11.075  1.00 23.79 ? 330 ILE A C     1 
ATOM   2704 O O     . ILE A 1 330 ? 7.400   -54.184 11.839  1.00 23.29 ? 330 ILE A O     1 
ATOM   2705 C CB    . ILE A 1 330 ? 7.410   -51.819 9.571   1.00 23.34 ? 330 ILE A CB    1 
ATOM   2706 C CG1   . ILE A 1 330 ? 7.051   -50.333 9.622   1.00 22.56 ? 330 ILE A CG1   1 
ATOM   2707 C CG2   . ILE A 1 330 ? 6.128   -52.657 9.513   1.00 22.54 ? 330 ILE A CG2   1 
ATOM   2708 C CD1   . ILE A 1 330 ? 6.958   -49.672 8.270   1.00 22.97 ? 330 ILE A CD1   1 
ATOM   2709 N N     . ARG A 1 331 ? 9.181   -54.436 10.456  1.00 23.14 ? 331 ARG A N     1 
ATOM   2710 C CA    . ARG A 1 331 ? 9.358   -55.873 10.672  1.00 23.20 ? 331 ARG A CA    1 
ATOM   2711 C C     . ARG A 1 331 ? 9.850   -56.129 12.100  1.00 23.28 ? 331 ARG A C     1 
ATOM   2712 O O     . ARG A 1 331 ? 9.430   -57.090 12.745  1.00 21.63 ? 331 ARG A O     1 
ATOM   2713 C CB    . ARG A 1 331 ? 10.367  -56.419 9.662   1.00 23.42 ? 331 ARG A CB    1 
ATOM   2714 C CG    . ARG A 1 331 ? 10.371  -57.924 9.474   1.00 26.17 ? 331 ARG A CG    1 
ATOM   2715 C CD    . ARG A 1 331 ? 11.746  -58.417 9.007   1.00 32.19 ? 331 ARG A CD    1 
ATOM   2716 N NE    . ARG A 1 331 ? 12.327  -57.543 7.988   1.00 40.79 ? 331 ARG A NE    1 
ATOM   2717 C CZ    . ARG A 1 331 ? 13.633  -57.325 7.814   1.00 41.87 ? 331 ARG A CZ    1 
ATOM   2718 N NH1   . ARG A 1 331 ? 14.537  -57.918 8.590   1.00 37.94 ? 331 ARG A NH1   1 
ATOM   2719 N NH2   . ARG A 1 331 ? 14.035  -56.498 6.855   1.00 38.94 ? 331 ARG A NH2   1 
ATOM   2720 N N     . ASP A 1 332 ? 10.719  -55.239 12.585  1.00 23.97 ? 332 ASP A N     1 
ATOM   2721 C CA    . ASP A 1 332 ? 11.282  -55.302 13.941  1.00 25.42 ? 332 ASP A CA    1 
ATOM   2722 C C     . ASP A 1 332 ? 10.285  -54.902 15.047  1.00 24.61 ? 332 ASP A C     1 
ATOM   2723 O O     . ASP A 1 332 ? 10.613  -54.938 16.230  1.00 24.66 ? 332 ASP A O     1 
ATOM   2724 C CB    . ASP A 1 332 ? 12.548  -54.424 14.041  1.00 25.60 ? 332 ASP A CB    1 
ATOM   2725 C CG    . ASP A 1 332 ? 13.777  -55.065 13.384  1.00 29.63 ? 332 ASP A CG    1 
ATOM   2726 O OD1   . ASP A 1 332 ? 13.740  -56.281 13.083  1.00 30.95 ? 332 ASP A OD1   1 
ATOM   2727 O OD2   . ASP A 1 332 ? 14.792  -54.350 13.176  1.00 30.95 ? 332 ASP A OD2   1 
ATOM   2728 N N     . LEU A 1 333 ? 9.077   -54.506 14.674  1.00 25.08 ? 333 LEU A N     1 
ATOM   2729 C CA    . LEU A 1 333 ? 8.080   -54.140 15.675  1.00 24.84 ? 333 LEU A CA    1 
ATOM   2730 C C     . LEU A 1 333 ? 7.559   -55.377 16.393  1.00 25.01 ? 333 LEU A C     1 
ATOM   2731 O O     . LEU A 1 333 ? 7.084   -56.325 15.761  1.00 24.10 ? 333 LEU A O     1 
ATOM   2732 C CB    . LEU A 1 333 ? 6.934   -53.330 15.055  1.00 24.27 ? 333 LEU A CB    1 
ATOM   2733 C CG    . LEU A 1 333 ? 7.203   -51.920 14.519  1.00 23.89 ? 333 LEU A CG    1 
ATOM   2734 C CD1   . LEU A 1 333 ? 5.892   -51.247 14.227  1.00 19.65 ? 333 LEU A CD1   1 
ATOM   2735 C CD2   . LEU A 1 333 ? 8.027   -51.063 15.486  1.00 26.95 ? 333 LEU A CD2   1 
ATOM   2736 N N     . LYS A 1 334 ? 7.686   -55.371 17.715  1.00 26.46 ? 334 LYS A N     1 
ATOM   2737 C CA    . LYS A 1 334 ? 7.213   -56.481 18.541  1.00 28.60 ? 334 LYS A CA    1 
ATOM   2738 C C     . LYS A 1 334 ? 5.997   -56.049 19.349  1.00 29.47 ? 334 LYS A C     1 
ATOM   2739 O O     . LYS A 1 334 ? 5.925   -54.909 19.819  1.00 29.09 ? 334 LYS A O     1 
ATOM   2740 C CB    . LYS A 1 334 ? 8.318   -56.997 19.482  1.00 28.73 ? 334 LYS A CB    1 
ATOM   2741 C CG    . LYS A 1 334 ? 9.380   -57.911 18.838  1.00 28.87 ? 334 LYS A CG    1 
ATOM   2742 C CD    . LYS A 1 334 ? 8.889   -59.348 18.618  1.00 31.81 ? 334 LYS A CD    1 
ATOM   2743 C CE    . LYS A 1 334 ? 8.605   -60.100 19.938  1.00 35.36 ? 334 LYS A CE    1 
ATOM   2744 N NZ    . LYS A 1 334 ? 9.812   -60.674 20.613  1.00 32.58 ? 334 LYS A NZ    1 
ATOM   2745 N N     . ARG A 1 335 ? 5.046   -56.965 19.503  1.00 30.69 ? 335 ARG A N     1 
ATOM   2746 C CA    . ARG A 1 335 ? 3.858   -56.707 20.299  1.00 32.17 ? 335 ARG A CA    1 
ATOM   2747 C C     . ARG A 1 335 ? 4.098   -57.185 21.740  1.00 32.34 ? 335 ARG A C     1 
ATOM   2748 O O     . ARG A 1 335 ? 4.409   -58.358 21.961  1.00 32.53 ? 335 ARG A O     1 
ATOM   2749 C CB    . ARG A 1 335 ? 2.647   -57.403 19.674  1.00 32.76 ? 335 ARG A CB    1 
ATOM   2750 C CG    . ARG A 1 335 ? 1.310   -56.740 19.989  1.00 36.34 ? 335 ARG A CG    1 
ATOM   2751 C CD    . ARG A 1 335 ? 0.142   -57.613 19.551  1.00 41.01 ? 335 ARG A CD    1 
ATOM   2752 N NE    . ARG A 1 335 ? -1.144  -56.927 19.689  1.00 45.12 ? 335 ARG A NE    1 
ATOM   2753 C CZ    . ARG A 1 335 ? -2.318  -57.539 19.848  1.00 46.36 ? 335 ARG A CZ    1 
ATOM   2754 N NH1   . ARG A 1 335 ? -2.386  -58.865 19.900  1.00 47.07 ? 335 ARG A NH1   1 
ATOM   2755 N NH2   . ARG A 1 335 ? -3.430  -56.822 19.964  1.00 46.60 ? 335 ARG A NH2   1 
ATOM   2756 N N     . PRO A 1 336 ? 3.973   -56.275 22.726  1.00 32.44 ? 336 PRO A N     1 
ATOM   2757 C CA    . PRO A 1 336 ? 4.280   -56.645 24.111  1.00 31.81 ? 336 PRO A CA    1 
ATOM   2758 C C     . PRO A 1 336 ? 3.111   -57.348 24.794  1.00 32.03 ? 336 PRO A C     1 
ATOM   2759 O O     . PRO A 1 336 ? 3.013   -58.575 24.741  1.00 31.60 ? 336 PRO A O     1 
ATOM   2760 C CB    . PRO A 1 336 ? 4.566   -55.295 24.789  1.00 31.88 ? 336 PRO A CB    1 
ATOM   2761 C CG    . PRO A 1 336 ? 4.325   -54.214 23.712  1.00 32.40 ? 336 PRO A CG    1 
ATOM   2762 C CD    . PRO A 1 336 ? 3.550   -54.867 22.618  1.00 31.96 ? 336 PRO A CD    1 
ATOM   2763 N N     . ALA B 2 2   ? -6.513  6.829   2.658   1.00 29.17 ? -15 ALA B N     1 
ATOM   2764 C CA    . ALA B 2 2   ? -7.959  7.163   2.889   1.00 30.59 ? -15 ALA B CA    1 
ATOM   2765 C C     . ALA B 2 2   ? -8.615  7.738   1.630   1.00 30.15 ? -15 ALA B C     1 
ATOM   2766 O O     . ALA B 2 2   ? -8.433  8.913   1.306   1.00 31.62 ? -15 ALA B O     1 
ATOM   2767 C CB    . ALA B 2 2   ? -8.112  8.136   4.066   1.00 31.00 ? -15 ALA B CB    1 
ATOM   2768 N N     . HIS B 2 3   ? -9.365  6.903   0.917   1.00 28.39 ? -14 HIS B N     1 
ATOM   2769 C CA    . HIS B 2 3   ? -9.983  7.324   -0.335  1.00 25.37 ? -14 HIS B CA    1 
ATOM   2770 C C     . HIS B 2 3   ? -11.499 7.133   -0.334  1.00 24.77 ? -14 HIS B C     1 
ATOM   2771 O O     . HIS B 2 3   ? -12.069 6.521   0.576   1.00 23.89 ? -14 HIS B O     1 
ATOM   2772 C CB    . HIS B 2 3   ? -9.337  6.615   -1.527  1.00 24.02 ? -14 HIS B CB    1 
ATOM   2773 C CG    . HIS B 2 3   ? -9.479  5.127   -1.491  1.00 23.78 ? -14 HIS B CG    1 
ATOM   2774 N ND1   . HIS B 2 3   ? -10.648 4.481   -1.838  1.00 21.25 ? -14 HIS B ND1   1 
ATOM   2775 C CD2   . HIS B 2 3   ? -8.600  4.157   -1.146  1.00 16.82 ? -14 HIS B CD2   1 
ATOM   2776 C CE1   . HIS B 2 3   ? -10.478 3.178   -1.713  1.00 14.27 ? -14 HIS B CE1   1 
ATOM   2777 N NE2   . HIS B 2 3   ? -9.247  2.957   -1.291  1.00 18.02 ? -14 HIS B NE2   1 
ATOM   2778 N N     . HIS B 2 4   ? -12.148 7.675   -1.359  1.00 24.15 ? -13 HIS B N     1 
ATOM   2779 C CA    . HIS B 2 4   ? -13.592 7.571   -1.482  1.00 23.80 ? -13 HIS B CA    1 
ATOM   2780 C C     . HIS B 2 4   ? -14.014 6.720   -2.693  1.00 23.54 ? -13 HIS B C     1 
ATOM   2781 O O     . HIS B 2 4   ? -15.052 6.954   -3.290  1.00 23.59 ? -13 HIS B O     1 
ATOM   2782 C CB    . HIS B 2 4   ? -14.215 8.972   -1.493  1.00 22.53 ? -13 HIS B CB    1 
ATOM   2783 C CG    . HIS B 2 4   ? -14.214 9.638   -0.148  1.00 24.94 ? -13 HIS B CG    1 
ATOM   2784 N ND1   . HIS B 2 4   ? -13.153 10.389  0.313   1.00 25.45 ? -13 HIS B ND1   1 
ATOM   2785 C CD2   . HIS B 2 4   ? -15.144 9.660   0.836   1.00 23.09 ? -13 HIS B CD2   1 
ATOM   2786 C CE1   . HIS B 2 4   ? -13.431 10.848  1.521   1.00 23.35 ? -13 HIS B CE1   1 
ATOM   2787 N NE2   . HIS B 2 4   ? -14.635 10.422  1.859   1.00 24.15 ? -13 HIS B NE2   1 
ATOM   2788 N N     . HIS B 2 5   ? -13.206 5.718   -3.031  1.00 25.58 ? -12 HIS B N     1 
ATOM   2789 C CA    . HIS B 2 5   ? -13.521 4.806   -4.134  1.00 26.38 ? -12 HIS B CA    1 
ATOM   2790 C C     . HIS B 2 5   ? -13.715 3.337   -3.722  1.00 25.87 ? -12 HIS B C     1 
ATOM   2791 O O     . HIS B 2 5   ? -13.219 2.444   -4.396  1.00 24.35 ? -12 HIS B O     1 
ATOM   2792 C CB    . HIS B 2 5   ? -12.472 4.926   -5.246  1.00 26.04 ? -12 HIS B CB    1 
ATOM   2793 C CG    . HIS B 2 5   ? -12.435 6.279   -5.888  1.00 28.19 ? -12 HIS B CG    1 
ATOM   2794 N ND1   . HIS B 2 5   ? -12.963 6.524   -7.136  1.00 28.68 ? -12 HIS B ND1   1 
ATOM   2795 C CD2   . HIS B 2 5   ? -11.953 7.465   -5.442  1.00 25.34 ? -12 HIS B CD2   1 
ATOM   2796 C CE1   . HIS B 2 5   ? -12.799 7.801   -7.437  1.00 30.81 ? -12 HIS B CE1   1 
ATOM   2797 N NE2   . HIS B 2 5   ? -12.190 8.393   -6.425  1.00 29.85 ? -12 HIS B NE2   1 
ATOM   2798 N N     . HIS B 2 6   ? -14.456 3.107   -2.635  1.00 26.15 ? -11 HIS B N     1 
ATOM   2799 C CA    . HIS B 2 6   ? -14.822 1.750   -2.175  1.00 26.70 ? -11 HIS B CA    1 
ATOM   2800 C C     . HIS B 2 6   ? -16.081 1.194   -2.872  1.00 27.21 ? -11 HIS B C     1 
ATOM   2801 O O     . HIS B 2 6   ? -16.450 0.029   -2.681  1.00 27.00 ? -11 HIS B O     1 
ATOM   2802 C CB    . HIS B 2 6   ? -15.018 1.723   -0.650  1.00 25.90 ? -11 HIS B CB    1 
ATOM   2803 C CG    . HIS B 2 6   ? -13.774 2.018   0.129   1.00 27.82 ? -11 HIS B CG    1 
ATOM   2804 N ND1   . HIS B 2 6   ? -13.438 3.290   0.544   1.00 30.92 ? -11 HIS B ND1   1 
ATOM   2805 C CD2   . HIS B 2 6   ? -12.784 1.205   0.568   1.00 27.48 ? -11 HIS B CD2   1 
ATOM   2806 C CE1   . HIS B 2 6   ? -12.294 3.248   1.205   1.00 29.33 ? -11 HIS B CE1   1 
ATOM   2807 N NE2   . HIS B 2 6   ? -11.878 1.993   1.235   1.00 31.04 ? -11 HIS B NE2   1 
ATOM   2808 N N     . HIS B 2 7   ? -16.742 2.047   -3.655  1.00 27.41 ? -10 HIS B N     1 
ATOM   2809 C CA    . HIS B 2 7   ? -17.815 1.657   -4.563  1.00 27.07 ? -10 HIS B CA    1 
ATOM   2810 C C     . HIS B 2 7   ? -17.240 1.074   -5.870  1.00 28.40 ? -10 HIS B C     1 
ATOM   2811 O O     . HIS B 2 7   ? -17.944 1.000   -6.890  1.00 29.62 ? -10 HIS B O     1 
ATOM   2812 C CB    . HIS B 2 7   ? -18.658 2.890   -4.899  1.00 26.26 ? -10 HIS B CB    1 
ATOM   2813 C CG    . HIS B 2 7   ? -17.947 3.883   -5.765  1.00 26.84 ? -10 HIS B CG    1 
ATOM   2814 N ND1   . HIS B 2 7   ? -16.790 4.522   -5.373  1.00 29.16 ? -10 HIS B ND1   1 
ATOM   2815 C CD2   . HIS B 2 7   ? -18.212 4.324   -7.017  1.00 28.90 ? -10 HIS B CD2   1 
ATOM   2816 C CE1   . HIS B 2 7   ? -16.378 5.324   -6.339  1.00 23.96 ? -10 HIS B CE1   1 
ATOM   2817 N NE2   . HIS B 2 7   ? -17.221 5.220   -7.350  1.00 29.51 ? -10 HIS B NE2   1 
ATOM   2818 N N     . HIS B 2 8   ? -15.973 0.662   -5.837  1.00 26.35 ? -9  HIS B N     1 
ATOM   2819 C CA    . HIS B 2 8   ? -15.250 0.240   -7.039  1.00 27.09 ? -9  HIS B CA    1 
ATOM   2820 C C     . HIS B 2 8   ? -15.795 -1.029  -7.697  1.00 26.56 ? -9  HIS B C     1 
ATOM   2821 O O     . HIS B 2 8   ? -15.869 -1.109  -8.922  1.00 25.90 ? -9  HIS B O     1 
ATOM   2822 C CB    . HIS B 2 8   ? -13.756 0.089   -6.741  1.00 27.04 ? -9  HIS B CB    1 
ATOM   2823 C CG    . HIS B 2 8   ? -12.946 -0.364  -7.916  1.00 29.81 ? -9  HIS B CG    1 
ATOM   2824 N ND1   . HIS B 2 8   ? -12.777 0.407   -9.047  1.00 33.25 ? -9  HIS B ND1   1 
ATOM   2825 C CD2   . HIS B 2 8   ? -12.257 -1.509  -8.134  1.00 30.14 ? -9  HIS B CD2   1 
ATOM   2826 C CE1   . HIS B 2 8   ? -12.018 -0.242  -9.911  1.00 31.19 ? -9  HIS B CE1   1 
ATOM   2827 N NE2   . HIS B 2 8   ? -11.691 -1.408  -9.382  1.00 33.11 ? -9  HIS B NE2   1 
ATOM   2828 N N     . MET B 2 9   ? -16.163 -2.017  -6.883  1.00 27.30 ? -8  MET B N     1 
ATOM   2829 C CA    . MET B 2 9   ? -16.769 -3.257  -7.377  1.00 28.32 ? -8  MET B CA    1 
ATOM   2830 C C     . MET B 2 9   ? -17.850 -2.919  -8.387  1.00 27.50 ? -8  MET B C     1 
ATOM   2831 O O     . MET B 2 9   ? -17.911 -3.493  -9.470  1.00 26.81 ? -8  MET B O     1 
ATOM   2832 C CB    . MET B 2 9   ? -17.362 -4.064  -6.211  1.00 29.87 ? -8  MET B CB    1 
ATOM   2833 C CG    . MET B 2 9   ? -18.026 -5.383  -6.600  1.00 33.05 ? -8  MET B CG    1 
ATOM   2834 S SD    . MET B 2 9   ? -19.701 -5.233  -7.290  1.00 40.93 ? -8  MET B SD    1 
ATOM   2835 C CE    . MET B 2 9   ? -19.801 -6.773  -8.212  1.00 36.71 ? -8  MET B CE    1 
ATOM   2836 N N     . GLU B 2 10  ? -18.686 -1.963  -8.000  1.00 27.74 ? -7  GLU B N     1 
ATOM   2837 C CA    . GLU B 2 10  ? -19.803 -1.477  -8.788  1.00 28.30 ? -7  GLU B CA    1 
ATOM   2838 C C     . GLU B 2 10  ? -19.353 -0.443  -9.821  1.00 29.15 ? -7  GLU B C     1 
ATOM   2839 O O     . GLU B 2 10  ? -19.948 -0.333  -10.894 1.00 28.26 ? -7  GLU B O     1 
ATOM   2840 C CB    . GLU B 2 10  ? -20.790 -0.840  -7.829  1.00 27.73 ? -7  GLU B CB    1 
ATOM   2841 C CG    . GLU B 2 10  ? -22.157 -0.614  -8.365  1.00 27.99 ? -7  GLU B CG    1 
ATOM   2842 C CD    . GLU B 2 10  ? -22.861 0.466   -7.588  1.00 31.18 ? -7  GLU B CD    1 
ATOM   2843 O OE1   . GLU B 2 10  ? -22.296 1.053   -6.669  1.00 28.83 ? -7  GLU B OE1   1 
ATOM   2844 O OE2   . GLU B 2 10  ? -24.102 0.743   -7.953  1.00 36.70 ? -7  GLU B OE2   1 
ATOM   2845 N N     . ASN B 2 11  ? -18.300 0.308   -9.475  1.00 31.26 ? -6  ASN B N     1 
ATOM   2846 C CA    . ASN B 2 11  ? -17.716 1.363   -10.325 1.00 32.24 ? -6  ASN B CA    1 
ATOM   2847 C C     . ASN B 2 11  ? -17.384 0.848   -11.711 1.00 31.76 ? -6  ASN B C     1 
ATOM   2848 O O     . ASN B 2 11  ? -17.493 1.584   -12.690 1.00 32.72 ? -6  ASN B O     1 
ATOM   2849 C CB    . ASN B 2 11  ? -16.451 1.943   -9.674  1.00 33.17 ? -6  ASN B CB    1 
ATOM   2850 C CG    . ASN B 2 11  ? -16.145 3.364   -10.118 1.00 35.21 ? -6  ASN B CG    1 
ATOM   2851 O OD1   . ASN B 2 11  ? -16.777 3.905   -11.032 1.00 36.80 ? -6  ASN B OD1   1 
ATOM   2852 N ND2   . ASN B 2 11  ? -15.164 3.984   -9.457  1.00 38.64 ? -6  ASN B ND2   1 
ATOM   2853 N N     . LEU B 2 12  ? -16.945 -0.408  -11.775 1.00 31.23 ? -5  LEU B N     1 
ATOM   2854 C CA    . LEU B 2 12  ? -16.916 -1.165  -13.023 1.00 30.91 ? -5  LEU B CA    1 
ATOM   2855 C C     . LEU B 2 12  ? -16.953 -2.661  -12.786 1.00 29.11 ? -5  LEU B C     1 
ATOM   2856 O O     . LEU B 2 12  ? -16.397 -3.178  -11.818 1.00 28.66 ? -5  LEU B O     1 
ATOM   2857 C CB    . LEU B 2 12  ? -15.753 -0.768  -13.966 1.00 32.10 ? -5  LEU B CB    1 
ATOM   2858 C CG    . LEU B 2 12  ? -14.349 -0.313  -13.534 1.00 34.08 ? -5  LEU B CG    1 
ATOM   2859 C CD1   . LEU B 2 12  ? -13.659 -1.321  -12.616 1.00 36.58 ? -5  LEU B CD1   1 
ATOM   2860 C CD2   . LEU B 2 12  ? -13.489 -0.034  -14.774 1.00 32.20 ? -5  LEU B CD2   1 
ATOM   2861 N N     . TYR B 2 13  ? -17.603 -3.324  -13.733 1.00 28.24 ? -4  TYR B N     1 
ATOM   2862 C CA    . TYR B 2 13  ? -18.001 -4.727  -13.714 1.00 26.54 ? -4  TYR B CA    1 
ATOM   2863 C C     . TYR B 2 13  ? -19.202 -4.682  -14.645 1.00 24.80 ? -4  TYR B C     1 
ATOM   2864 O O     . TYR B 2 13  ? -19.816 -5.701  -14.976 1.00 25.06 ? -4  TYR B O     1 
ATOM   2865 C CB    . TYR B 2 13  ? -18.386 -5.202  -12.313 1.00 27.83 ? -4  TYR B CB    1 
ATOM   2866 C CG    . TYR B 2 13  ? -19.815 -4.931  -11.916 1.00 28.25 ? -4  TYR B CG    1 
ATOM   2867 C CD1   . TYR B 2 13  ? -20.715 -5.981  -11.751 1.00 29.88 ? -4  TYR B CD1   1 
ATOM   2868 C CD2   . TYR B 2 13  ? -20.268 -3.633  -11.702 1.00 29.55 ? -4  TYR B CD2   1 
ATOM   2869 C CE1   . TYR B 2 13  ? -22.029 -5.751  -11.384 1.00 30.50 ? -4  TYR B CE1   1 
ATOM   2870 C CE2   . TYR B 2 13  ? -21.581 -3.389  -11.333 1.00 31.22 ? -4  TYR B CE2   1 
ATOM   2871 C CZ    . TYR B 2 13  ? -22.457 -4.453  -11.177 1.00 30.63 ? -4  TYR B CZ    1 
ATOM   2872 O OH    . TYR B 2 13  ? -23.762 -4.219  -10.807 1.00 30.25 ? -4  TYR B OH    1 
ATOM   2873 N N     . PHE B 2 14  ? -19.538 -3.447  -15.013 1.00 22.23 ? -3  PHE B N     1 
ATOM   2874 C CA    . PHE B 2 14  ? -20.325 -3.130  -16.188 1.00 20.84 ? -3  PHE B CA    1 
ATOM   2875 C C     . PHE B 2 14  ? -19.352 -2.911  -17.349 1.00 21.49 ? -3  PHE B C     1 
ATOM   2876 O O     . PHE B 2 14  ? -18.999 -1.773  -17.674 1.00 21.39 ? -3  PHE B O     1 
ATOM   2877 C CB    . PHE B 2 14  ? -21.137 -1.856  -15.947 1.00 18.31 ? -3  PHE B CB    1 
ATOM   2878 C CG    . PHE B 2 14  ? -22.458 -2.092  -15.285 1.00 14.67 ? -3  PHE B CG    1 
ATOM   2879 C CD1   . PHE B 2 14  ? -22.709 -1.592  -14.018 1.00 10.15 ? -3  PHE B CD1   1 
ATOM   2880 C CD2   . PHE B 2 14  ? -23.457 -2.806  -15.932 1.00 6.98  ? -3  PHE B CD2   1 
ATOM   2881 C CE1   . PHE B 2 14  ? -23.932 -1.811  -13.405 1.00 7.28  ? -3  PHE B CE1   1 
ATOM   2882 C CE2   . PHE B 2 14  ? -24.673 -3.022  -15.325 1.00 5.20  ? -3  PHE B CE2   1 
ATOM   2883 C CZ    . PHE B 2 14  ? -24.911 -2.523  -14.061 1.00 6.25  ? -3  PHE B CZ    1 
ATOM   2884 N N     . GLN B 2 15  ? -18.918 -4.009  -17.967 1.00 22.23 ? -2  GLN B N     1 
ATOM   2885 C CA    . GLN B 2 15  ? -17.829 -3.954  -18.944 1.00 22.55 ? -2  GLN B CA    1 
ATOM   2886 C C     . GLN B 2 15  ? -18.271 -4.400  -20.329 1.00 22.55 ? -2  GLN B C     1 
ATOM   2887 O O     . GLN B 2 15  ? -17.606 -4.097  -21.319 1.00 22.63 ? -2  GLN B O     1 
ATOM   2888 C CB    . GLN B 2 15  ? -16.631 -4.791  -18.471 1.00 23.07 ? -2  GLN B CB    1 
ATOM   2889 C CG    . GLN B 2 15  ? -16.190 -4.541  -17.019 1.00 22.25 ? -2  GLN B CG    1 
ATOM   2890 C CD    . GLN B 2 15  ? -15.517 -3.190  -16.798 1.00 24.46 ? -2  GLN B CD    1 
ATOM   2891 O OE1   . GLN B 2 15  ? -15.943 -2.168  -17.339 1.00 25.47 ? -2  GLN B OE1   1 
ATOM   2892 N NE2   . GLN B 2 15  ? -14.471 -3.180  -15.974 1.00 25.60 ? -2  GLN B NE2   1 
ATOM   2893 N N     . SER B 2 18  ? -12.478 -7.462  -20.032 1.00 45.95 ? 60  SER B N     1 
ATOM   2894 C CA    . SER B 2 18  ? -12.310 -7.925  -18.658 1.00 46.07 ? 60  SER B CA    1 
ATOM   2895 C C     . SER B 2 18  ? -11.701 -9.329  -18.568 1.00 45.36 ? 60  SER B C     1 
ATOM   2896 O O     . SER B 2 18  ? -11.195 -9.876  -19.560 1.00 46.43 ? 60  SER B O     1 
ATOM   2897 C CB    . SER B 2 18  ? -13.648 -7.889  -17.917 1.00 46.32 ? 60  SER B CB    1 
ATOM   2898 O OG    . SER B 2 18  ? -13.935 -6.585  -17.449 1.00 48.59 ? 60  SER B OG    1 
ATOM   2899 N N     . SER B 2 19  ? -11.754 -9.899  -17.364 1.00 43.41 ? 61  SER B N     1 
ATOM   2900 C CA    . SER B 2 19  ? -11.269 -11.253 -17.100 1.00 40.40 ? 61  SER B CA    1 
ATOM   2901 C C     . SER B 2 19  ? -12.205 -12.281 -17.716 1.00 38.14 ? 61  SER B C     1 
ATOM   2902 O O     . SER B 2 19  ? -13.380 -11.994 -17.973 1.00 39.24 ? 61  SER B O     1 
ATOM   2903 C CB    . SER B 2 19  ? -11.204 -11.512 -15.589 1.00 40.48 ? 61  SER B CB    1 
ATOM   2904 O OG    . SER B 2 19  ? -11.374 -10.322 -14.839 1.00 39.71 ? 61  SER B OG    1 
ATOM   2905 N N     . PHE B 2 20  ? -11.682 -13.477 -17.954 1.00 35.09 ? 62  PHE B N     1 
ATOM   2906 C CA    . PHE B 2 20  ? -12.532 -14.627 -18.201 1.00 33.09 ? 62  PHE B CA    1 
ATOM   2907 C C     . PHE B 2 20  ? -12.686 -15.375 -16.889 1.00 31.42 ? 62  PHE B C     1 
ATOM   2908 O O     . PHE B 2 20  ? -11.796 -15.341 -16.045 1.00 31.06 ? 62  PHE B O     1 
ATOM   2909 C CB    . PHE B 2 20  ? -11.949 -15.549 -19.273 1.00 32.77 ? 62  PHE B CB    1 
ATOM   2910 C CG    . PHE B 2 20  ? -12.020 -14.991 -20.674 1.00 33.46 ? 62  PHE B CG    1 
ATOM   2911 C CD1   . PHE B 2 20  ? -12.906 -13.970 -20.999 1.00 32.85 ? 62  PHE B CD1   1 
ATOM   2912 C CD2   . PHE B 2 20  ? -11.206 -15.508 -21.675 1.00 33.74 ? 62  PHE B CD2   1 
ATOM   2913 C CE1   . PHE B 2 20  ? -12.974 -13.456 -22.297 1.00 35.35 ? 62  PHE B CE1   1 
ATOM   2914 C CE2   . PHE B 2 20  ? -11.261 -14.996 -22.978 1.00 39.24 ? 62  PHE B CE2   1 
ATOM   2915 C CZ    . PHE B 2 20  ? -12.159 -13.969 -23.288 1.00 34.65 ? 62  PHE B CZ    1 
ATOM   2916 N N     . LEU B 2 21  ? -13.830 -16.029 -16.713 1.00 30.70 ? 63  LEU B N     1 
ATOM   2917 C CA    . LEU B 2 21  ? -14.076 -16.863 -15.540 1.00 27.88 ? 63  LEU B CA    1 
ATOM   2918 C C     . LEU B 2 21  ? -13.007 -17.964 -15.458 1.00 26.14 ? 63  LEU B C     1 
ATOM   2919 O O     . LEU B 2 21  ? -12.771 -18.680 -16.432 1.00 25.93 ? 63  LEU B O     1 
ATOM   2920 C CB    . LEU B 2 21  ? -15.498 -17.434 -15.578 1.00 24.84 ? 63  LEU B CB    1 
ATOM   2921 C CG    . LEU B 2 21  ? -16.587 -16.873 -14.653 1.00 27.98 ? 63  LEU B CG    1 
ATOM   2922 C CD1   . LEU B 2 21  ? -16.141 -15.685 -13.783 1.00 28.09 ? 63  LEU B CD1   1 
ATOM   2923 C CD2   . LEU B 2 21  ? -17.902 -16.556 -15.413 1.00 21.13 ? 63  LEU B CD2   1 
ATOM   2924 N N     . PRO B 2 22  ? -12.340 -18.083 -14.296 1.00 25.87 ? 64  PRO B N     1 
ATOM   2925 C CA    . PRO B 2 22  ? -11.210 -19.000 -14.181 1.00 26.06 ? 64  PRO B CA    1 
ATOM   2926 C C     . PRO B 2 22  ? -11.681 -20.388 -13.769 1.00 27.39 ? 64  PRO B C     1 
ATOM   2927 O O     . PRO B 2 22  ? -11.317 -20.873 -12.685 1.00 28.43 ? 64  PRO B O     1 
ATOM   2928 C CB    . PRO B 2 22  ? -10.354 -18.358 -13.084 1.00 25.56 ? 64  PRO B CB    1 
ATOM   2929 C CG    . PRO B 2 22  ? -11.344 -17.613 -12.218 1.00 25.17 ? 64  PRO B CG    1 
ATOM   2930 C CD    . PRO B 2 22  ? -12.605 -17.374 -13.030 1.00 23.89 ? 64  PRO B CD    1 
ATOM   2931 N N     . GLU B 2 23  ? -12.490 -21.004 -14.638 1.00 26.96 ? 65  GLU B N     1 
ATOM   2932 C CA    . GLU B 2 23  ? -13.166 -22.273 -14.361 1.00 27.97 ? 65  GLU B CA    1 
ATOM   2933 C C     . GLU B 2 23  ? -13.262 -23.102 -15.630 1.00 28.88 ? 65  GLU B C     1 
ATOM   2934 O O     . GLU B 2 23  ? -13.779 -22.631 -16.650 1.00 30.29 ? 65  GLU B O     1 
ATOM   2935 C CB    . GLU B 2 23  ? -14.580 -22.034 -13.849 1.00 26.82 ? 65  GLU B CB    1 
ATOM   2936 C CG    . GLU B 2 23  ? -14.663 -21.286 -12.543 1.00 30.22 ? 65  GLU B CG    1 
ATOM   2937 C CD    . GLU B 2 23  ? -16.049 -20.745 -12.274 1.00 32.79 ? 65  GLU B CD    1 
ATOM   2938 O OE1   . GLU B 2 23  ? -17.032 -21.353 -12.743 1.00 33.30 ? 65  GLU B OE1   1 
ATOM   2939 O OE2   . GLU B 2 23  ? -16.155 -19.707 -11.587 1.00 36.66 ? 65  GLU B OE2   1 
ATOM   2940 N N     . GLY B 2 24  ? -12.794 -24.346 -15.553 1.00 28.27 ? 66  GLY B N     1 
ATOM   2941 C CA    . GLY B 2 24  ? -12.775 -25.248 -16.701 1.00 27.52 ? 66  GLY B CA    1 
ATOM   2942 C C     . GLY B 2 24  ? -14.089 -25.340 -17.460 1.00 25.87 ? 66  GLY B C     1 
ATOM   2943 O O     . GLY B 2 24  ? -14.098 -25.255 -18.679 1.00 25.90 ? 66  GLY B O     1 
ATOM   2944 N N     . GLY B 2 25  ? -15.193 -25.483 -16.733 1.00 25.81 ? 67  GLY B N     1 
ATOM   2945 C CA    . GLY B 2 25  ? -16.536 -25.643 -17.322 1.00 24.59 ? 67  GLY B CA    1 
ATOM   2946 C C     . GLY B 2 25  ? -16.995 -24.555 -18.280 1.00 23.55 ? 67  GLY B C     1 
ATOM   2947 O O     . GLY B 2 25  ? -17.880 -24.787 -19.086 1.00 22.84 ? 67  GLY B O     1 
ATOM   2948 N N     . CYS B 2 26  ? -16.385 -23.373 -18.192 1.00 24.50 ? 68  CYS B N     1 
ATOM   2949 C CA    . CYS B 2 26  ? -16.726 -22.228 -19.044 1.00 24.42 ? 68  CYS B CA    1 
ATOM   2950 C C     . CYS B 2 26  ? -16.247 -22.382 -20.481 1.00 24.82 ? 68  CYS B C     1 
ATOM   2951 O O     . CYS B 2 26  ? -16.655 -21.617 -21.361 1.00 26.20 ? 68  CYS B O     1 
ATOM   2952 C CB    . CYS B 2 26  ? -16.135 -20.940 -18.460 1.00 24.97 ? 68  CYS B CB    1 
ATOM   2953 S SG    . CYS B 2 26  ? -17.004 -20.332 -17.010 1.00 26.46 ? 68  CYS B SG    1 
ATOM   2954 N N     . TYR B 2 27  ? -15.378 -23.361 -20.712 1.00 25.12 ? 69  TYR B N     1 
ATOM   2955 C CA    . TYR B 2 27  ? -14.747 -23.570 -22.015 1.00 24.49 ? 69  TYR B CA    1 
ATOM   2956 C C     . TYR B 2 27  ? -15.208 -24.892 -22.610 1.00 25.59 ? 69  TYR B C     1 
ATOM   2957 O O     . TYR B 2 27  ? -15.232 -25.925 -21.925 1.00 23.95 ? 69  TYR B O     1 
ATOM   2958 C CB    . TYR B 2 27  ? -13.212 -23.486 -21.886 1.00 24.54 ? 69  TYR B CB    1 
ATOM   2959 C CG    . TYR B 2 27  ? -12.801 -22.231 -21.131 1.00 24.51 ? 69  TYR B CG    1 
ATOM   2960 C CD1   . TYR B 2 27  ? -12.687 -22.234 -19.738 1.00 20.65 ? 69  TYR B CD1   1 
ATOM   2961 C CD2   . TYR B 2 27  ? -12.597 -21.028 -21.804 1.00 22.73 ? 69  TYR B CD2   1 
ATOM   2962 C CE1   . TYR B 2 27  ? -12.354 -21.084 -19.041 1.00 18.14 ? 69  TYR B CE1   1 
ATOM   2963 C CE2   . TYR B 2 27  ? -12.272 -19.872 -21.111 1.00 25.67 ? 69  TYR B CE2   1 
ATOM   2964 C CZ    . TYR B 2 27  ? -12.155 -19.906 -19.731 1.00 23.42 ? 69  TYR B CZ    1 
ATOM   2965 O OH    . TYR B 2 27  ? -11.857 -18.749 -19.044 1.00 23.54 ? 69  TYR B OH    1 
ATOM   2966 N N     . GLU B 2 28  ? -15.632 -24.826 -23.871 1.00 26.19 ? 70  GLU B N     1 
ATOM   2967 C CA    . GLU B 2 28  ? -15.875 -26.007 -24.686 1.00 28.91 ? 70  GLU B CA    1 
ATOM   2968 C C     . GLU B 2 28  ? -14.705 -26.156 -25.658 1.00 29.43 ? 70  GLU B C     1 
ATOM   2969 O O     . GLU B 2 28  ? -14.546 -25.347 -26.578 1.00 29.94 ? 70  GLU B O     1 
ATOM   2970 C CB    . GLU B 2 28  ? -17.205 -25.891 -25.451 1.00 27.82 ? 70  GLU B CB    1 
ATOM   2971 C CG    . GLU B 2 28  ? -17.665 -27.196 -26.081 1.00 28.63 ? 70  GLU B CG    1 
ATOM   2972 C CD    . GLU B 2 28  ? -18.600 -27.003 -27.279 1.00 31.36 ? 70  GLU B CD    1 
ATOM   2973 O OE1   . GLU B 2 28  ? -19.077 -25.866 -27.512 1.00 35.44 ? 70  GLU B OE1   1 
ATOM   2974 O OE2   . GLU B 2 28  ? -18.861 -28.002 -27.997 1.00 32.39 ? 70  GLU B OE2   1 
ATOM   2975 N N     . LEU B 2 29  ? -13.883 -27.179 -25.426 1.00 30.55 ? 71  LEU B N     1 
ATOM   2976 C CA    . LEU B 2 29  ? -12.719 -27.486 -26.265 1.00 30.80 ? 71  LEU B CA    1 
ATOM   2977 C C     . LEU B 2 29  ? -13.119 -27.961 -27.679 1.00 31.38 ? 71  LEU B C     1 
ATOM   2978 O O     . LEU B 2 29  ? -13.876 -28.931 -27.838 1.00 31.26 ? 71  LEU B O     1 
ATOM   2979 C CB    . LEU B 2 29  ? -11.846 -28.548 -25.575 1.00 30.09 ? 71  LEU B CB    1 
ATOM   2980 C CG    . LEU B 2 29  ? -10.797 -28.232 -24.493 1.00 32.12 ? 71  LEU B CG    1 
ATOM   2981 C CD1   . LEU B 2 29  ? -11.087 -26.998 -23.667 1.00 24.96 ? 71  LEU B CD1   1 
ATOM   2982 C CD2   . LEU B 2 29  ? -10.604 -29.437 -23.583 1.00 31.64 ? 71  LEU B CD2   1 
ATOM   2983 N N     . LEU B 2 30  ? -12.627 -27.260 -28.699 1.00 31.80 ? 72  LEU B N     1 
ATOM   2984 C CA    . LEU B 2 30  ? -12.731 -27.733 -30.086 1.00 32.17 ? 72  LEU B CA    1 
ATOM   2985 C C     . LEU B 2 30  ? -11.365 -28.289 -30.532 1.00 31.56 ? 72  LEU B C     1 
ATOM   2986 O O     . LEU B 2 30  ? -10.705 -29.006 -29.767 1.00 32.47 ? 72  LEU B O     1 
ATOM   2987 C CB    . LEU B 2 30  ? -13.229 -26.624 -31.035 1.00 31.76 ? 72  LEU B CB    1 
ATOM   2988 C CG    . LEU B 2 30  ? -14.595 -25.924 -30.893 1.00 33.38 ? 72  LEU B CG    1 
ATOM   2989 C CD1   . LEU B 2 30  ? -15.736 -26.884 -30.524 1.00 34.78 ? 72  LEU B CD1   1 
ATOM   2990 C CD2   . LEU B 2 30  ? -14.550 -24.756 -29.921 1.00 32.59 ? 72  LEU B CD2   1 
ATOM   2991 N N     . THR B 2 31  ? -10.931 -27.935 -31.739 1.00 30.12 ? 73  THR B N     1 
ATOM   2992 C CA    . THR B 2 31  ? -9.710  -28.497 -32.326 1.00 29.08 ? 73  THR B CA    1 
ATOM   2993 C C     . THR B 2 31  ? -8.436  -28.189 -31.559 1.00 27.78 ? 73  THR B C     1 
ATOM   2994 O O     . THR B 2 31  ? -8.323  -27.164 -30.882 1.00 27.79 ? 73  THR B O     1 
ATOM   2995 C CB    . THR B 2 31  ? -9.460  -27.987 -33.756 1.00 28.84 ? 73  THR B CB    1 
ATOM   2996 O OG1   . THR B 2 31  ? -10.656 -27.410 -34.285 1.00 31.94 ? 73  THR B OG1   1 
ATOM   2997 C CG2   . THR B 2 31  ? -8.971  -29.121 -34.655 1.00 27.55 ? 73  THR B CG2   1 
ATOM   2998 N N     . VAL B 2 32  ? -7.484  -29.106 -31.683 1.00 26.79 ? 74  VAL B N     1 
ATOM   2999 C CA    . VAL B 2 32  ? -6.098  -28.845 -31.371 1.00 26.50 ? 74  VAL B CA    1 
ATOM   3000 C C     . VAL B 2 32  ? -5.598  -27.899 -32.455 1.00 27.17 ? 74  VAL B C     1 
ATOM   3001 O O     . VAL B 2 32  ? -5.744  -28.178 -33.649 1.00 29.00 ? 74  VAL B O     1 
ATOM   3002 C CB    . VAL B 2 32  ? -5.289  -30.150 -31.379 1.00 26.59 ? 74  VAL B CB    1 
ATOM   3003 C CG1   . VAL B 2 32  ? -3.830  -29.893 -31.048 1.00 22.87 ? 74  VAL B CG1   1 
ATOM   3004 C CG2   . VAL B 2 32  ? -5.905  -31.156 -30.395 1.00 28.15 ? 74  VAL B CG2   1 
ATOM   3005 N N     . ILE B 2 33  ? -5.051  -26.761 -32.045 1.00 26.69 ? 75  ILE B N     1 
ATOM   3006 C CA    . ILE B 2 33  ? -4.482  -25.815 -33.013 1.00 26.29 ? 75  ILE B CA    1 
ATOM   3007 C C     . ILE B 2 33  ? -2.943  -25.807 -32.955 1.00 25.83 ? 75  ILE B C     1 
ATOM   3008 O O     . ILE B 2 33  ? -2.272  -25.247 -33.838 1.00 23.53 ? 75  ILE B O     1 
ATOM   3009 C CB    . ILE B 2 33  ? -5.077  -24.384 -32.858 1.00 25.46 ? 75  ILE B CB    1 
ATOM   3010 C CG1   . ILE B 2 33  ? -4.817  -23.823 -31.446 1.00 25.72 ? 75  ILE B CG1   1 
ATOM   3011 C CG2   . ILE B 2 33  ? -6.563  -24.404 -33.196 1.00 25.34 ? 75  ILE B CG2   1 
ATOM   3012 C CD1   . ILE B 2 33  ? -5.077  -22.327 -31.289 1.00 25.16 ? 75  ILE B CD1   1 
ATOM   3013 N N     . GLY B 2 34  ? -2.398  -26.452 -31.922 1.00 25.96 ? 76  GLY B N     1 
ATOM   3014 C CA    . GLY B 2 34  ? -0.954  -26.442 -31.693 1.00 26.58 ? 76  GLY B CA    1 
ATOM   3015 C C     . GLY B 2 34  ? -0.481  -27.359 -30.591 1.00 25.36 ? 76  GLY B C     1 
ATOM   3016 O O     . GLY B 2 34  ? -1.279  -27.967 -29.893 1.00 25.88 ? 76  GLY B O     1 
ATOM   3017 N N     . LYS B 2 35  ? 0.834   -27.432 -30.445 1.00 26.96 ? 77  LYS B N     1 
ATOM   3018 C CA    . LYS B 2 35  ? 1.511   -28.305 -29.481 1.00 28.62 ? 77  LYS B CA    1 
ATOM   3019 C C     . LYS B 2 35  ? 2.817   -27.625 -29.051 1.00 28.04 ? 77  LYS B C     1 
ATOM   3020 O O     . LYS B 2 35  ? 3.491   -26.991 -29.869 1.00 27.04 ? 77  LYS B O     1 
ATOM   3021 C CB    . LYS B 2 35  ? 1.839   -29.655 -30.134 1.00 28.07 ? 77  LYS B CB    1 
ATOM   3022 C CG    . LYS B 2 35  ? 1.700   -30.869 -29.231 1.00 31.77 ? 77  LYS B CG    1 
ATOM   3023 C CD    . LYS B 2 35  ? 0.342   -31.564 -29.410 1.00 38.50 ? 77  LYS B CD    1 
ATOM   3024 C CE    . LYS B 2 35  ? 0.265   -32.892 -28.628 1.00 41.20 ? 77  LYS B CE    1 
ATOM   3025 N NZ    . LYS B 2 35  ? 0.184   -32.668 -27.153 1.00 41.10 ? 77  LYS B NZ    1 
ATOM   3026 N N     . GLY B 2 36  ? 3.174   -27.760 -27.777 1.00 27.47 ? 78  GLY B N     1 
ATOM   3027 C CA    . GLY B 2 36  ? 4.486   -27.314 -27.319 1.00 26.74 ? 78  GLY B CA    1 
ATOM   3028 C C     . GLY B 2 36  ? 4.906   -27.831 -25.958 1.00 26.34 ? 78  GLY B C     1 
ATOM   3029 O O     . GLY B 2 36  ? 4.494   -28.920 -25.539 1.00 24.40 ? 78  GLY B O     1 
ATOM   3030 N N     . PHE B 2 37  ? 5.711   -27.014 -25.274 1.00 25.87 ? 79  PHE B N     1 
ATOM   3031 C CA    . PHE B 2 37  ? 6.409   -27.363 -24.026 1.00 26.55 ? 79  PHE B CA    1 
ATOM   3032 C C     . PHE B 2 37  ? 6.892   -28.811 -23.992 1.00 27.19 ? 79  PHE B C     1 
ATOM   3033 O O     . PHE B 2 37  ? 6.399   -29.632 -23.220 1.00 27.73 ? 79  PHE B O     1 
ATOM   3034 C CB    . PHE B 2 37  ? 5.585   -26.996 -22.776 1.00 23.73 ? 79  PHE B CB    1 
ATOM   3035 C CG    . PHE B 2 37  ? 6.389   -26.997 -21.491 1.00 24.04 ? 79  PHE B CG    1 
ATOM   3036 C CD1   . PHE B 2 37  ? 7.619   -26.322 -21.408 1.00 21.79 ? 79  PHE B CD1   1 
ATOM   3037 C CD2   . PHE B 2 37  ? 5.922   -27.668 -20.363 1.00 17.85 ? 79  PHE B CD2   1 
ATOM   3038 C CE1   . PHE B 2 37  ? 8.377   -26.326 -20.214 1.00 15.70 ? 79  PHE B CE1   1 
ATOM   3039 C CE2   . PHE B 2 37  ? 6.664   -27.670 -19.171 1.00 19.49 ? 79  PHE B CE2   1 
ATOM   3040 C CZ    . PHE B 2 37  ? 7.899   -26.999 -19.100 1.00 16.29 ? 79  PHE B CZ    1 
ATOM   3041 N N     . GLU B 2 38  ? 7.851   -29.117 -24.857 1.00 28.87 ? 80  GLU B N     1 
ATOM   3042 C CA    . GLU B 2 38  ? 8.447   -30.457 -24.915 1.00 31.63 ? 80  GLU B CA    1 
ATOM   3043 C C     . GLU B 2 38  ? 7.378   -31.553 -25.111 1.00 31.35 ? 80  GLU B C     1 
ATOM   3044 O O     . GLU B 2 38  ? 7.497   -32.663 -24.578 1.00 31.20 ? 80  GLU B O     1 
ATOM   3045 C CB    . GLU B 2 38  ? 9.295   -30.723 -23.652 1.00 32.98 ? 80  GLU B CB    1 
ATOM   3046 C CG    . GLU B 2 38  ? 10.354  -29.642 -23.332 1.00 36.34 ? 80  GLU B CG    1 
ATOM   3047 C CD    . GLU B 2 38  ? 11.662  -29.815 -24.110 1.00 41.15 ? 80  GLU B CD    1 
ATOM   3048 O OE1   . GLU B 2 38  ? 11.976  -30.950 -24.540 1.00 42.71 ? 80  GLU B OE1   1 
ATOM   3049 O OE2   . GLU B 2 38  ? 12.389  -28.810 -24.284 1.00 43.06 ? 80  GLU B OE2   1 
ATOM   3050 N N     . ASP B 2 39  ? 6.342   -31.216 -25.883 1.00 30.37 ? 81  ASP B N     1 
ATOM   3051 C CA    . ASP B 2 39  ? 5.205   -32.098 -26.171 1.00 31.00 ? 81  ASP B CA    1 
ATOM   3052 C C     . ASP B 2 39  ? 4.220   -32.320 -25.029 1.00 29.87 ? 81  ASP B C     1 
ATOM   3053 O O     . ASP B 2 39  ? 3.356   -33.191 -25.124 1.00 29.22 ? 81  ASP B O     1 
ATOM   3054 C CB    . ASP B 2 39  ? 5.664   -33.445 -26.741 1.00 32.50 ? 81  ASP B CB    1 
ATOM   3055 C CG    . ASP B 2 39  ? 5.645   -33.467 -28.248 1.00 36.77 ? 81  ASP B CG    1 
ATOM   3056 O OD1   . ASP B 2 39  ? 6.064   -34.495 -28.826 1.00 40.26 ? 81  ASP B OD1   1 
ATOM   3057 O OD2   . ASP B 2 39  ? 5.209   -32.451 -28.849 1.00 43.75 ? 81  ASP B OD2   1 
ATOM   3058 N N     . LEU B 2 40  ? 4.332   -31.519 -23.972 1.00 29.11 ? 82  LEU B N     1 
ATOM   3059 C CA    . LEU B 2 40  ? 3.488   -31.683 -22.800 1.00 28.89 ? 82  LEU B CA    1 
ATOM   3060 C C     . LEU B 2 40  ? 2.297   -30.736 -22.803 1.00 30.06 ? 82  LEU B C     1 
ATOM   3061 O O     . LEU B 2 40  ? 1.346   -30.926 -22.036 1.00 30.64 ? 82  LEU B O     1 
ATOM   3062 C CB    . LEU B 2 40  ? 4.304   -31.527 -21.510 1.00 27.56 ? 82  LEU B CB    1 
ATOM   3063 C CG    . LEU B 2 40  ? 5.404   -32.559 -21.270 1.00 24.66 ? 82  LEU B CG    1 
ATOM   3064 C CD1   . LEU B 2 40  ? 6.048   -32.293 -19.923 1.00 23.87 ? 82  LEU B CD1   1 
ATOM   3065 C CD2   . LEU B 2 40  ? 4.881   -34.002 -21.348 1.00 13.62 ? 82  LEU B CD2   1 
ATOM   3066 N N     . MET B 2 41  ? 2.355   -29.727 -23.670 1.00 29.17 ? 83  MET B N     1 
ATOM   3067 C CA    . MET B 2 41  ? 1.278   -28.765 -23.807 1.00 28.30 ? 83  MET B CA    1 
ATOM   3068 C C     . MET B 2 41  ? 0.477   -28.969 -25.082 1.00 28.82 ? 83  MET B C     1 
ATOM   3069 O O     . MET B 2 41  ? 1.027   -29.075 -26.175 1.00 29.26 ? 83  MET B O     1 
ATOM   3070 C CB    . MET B 2 41  ? 1.807   -27.334 -23.764 1.00 27.53 ? 83  MET B CB    1 
ATOM   3071 C CG    . MET B 2 41  ? 0.738   -26.287 -24.064 1.00 26.15 ? 83  MET B CG    1 
ATOM   3072 S SD    . MET B 2 41  ? 1.348   -24.604 -24.023 1.00 30.86 ? 83  MET B SD    1 
ATOM   3073 C CE    . MET B 2 41  ? 2.527   -24.591 -25.365 1.00 21.01 ? 83  MET B CE    1 
ATOM   3074 N N     . THR B 2 42  ? -0.838  -29.022 -24.908 1.00 29.48 ? 84  THR B N     1 
ATOM   3075 C CA    . THR B 2 42  ? -1.798  -29.025 -25.995 1.00 28.23 ? 84  THR B CA    1 
ATOM   3076 C C     . THR B 2 42  ? -2.405  -27.627 -26.070 1.00 28.31 ? 84  THR B C     1 
ATOM   3077 O O     . THR B 2 42  ? -2.856  -27.072 -25.060 1.00 26.21 ? 84  THR B O     1 
ATOM   3078 C CB    . THR B 2 42  ? -2.907  -30.082 -25.748 1.00 28.20 ? 84  THR B CB    1 
ATOM   3079 O OG1   . THR B 2 42  ? -2.305  -31.376 -25.585 1.00 30.23 ? 84  THR B OG1   1 
ATOM   3080 C CG2   . THR B 2 42  ? -3.892  -30.134 -26.907 1.00 26.89 ? 84  THR B CG2   1 
ATOM   3081 N N     . VAL B 2 43  ? -2.387  -27.056 -27.271 1.00 28.72 ? 85  VAL B N     1 
ATOM   3082 C CA    . VAL B 2 43  ? -3.025  -25.777 -27.511 1.00 27.64 ? 85  VAL B CA    1 
ATOM   3083 C C     . VAL B 2 43  ? -4.344  -26.008 -28.255 1.00 28.40 ? 85  VAL B C     1 
ATOM   3084 O O     . VAL B 2 43  ? -4.373  -26.489 -29.389 1.00 27.98 ? 85  VAL B O     1 
ATOM   3085 C CB    . VAL B 2 43  ? -2.099  -24.773 -28.240 1.00 27.58 ? 85  VAL B CB    1 
ATOM   3086 C CG1   . VAL B 2 43  ? -2.759  -23.392 -28.299 1.00 23.53 ? 85  VAL B CG1   1 
ATOM   3087 C CG2   . VAL B 2 43  ? -0.726  -24.689 -27.539 1.00 25.12 ? 85  VAL B CG2   1 
ATOM   3088 N N     . ASN B 2 44  ? -5.432  -25.663 -27.577 1.00 29.77 ? 86  ASN B N     1 
ATOM   3089 C CA    . ASN B 2 44  ? -6.776  -25.895 -28.069 1.00 29.44 ? 86  ASN B CA    1 
ATOM   3090 C C     . ASN B 2 44  ? -7.457  -24.606 -28.464 1.00 28.70 ? 86  ASN B C     1 
ATOM   3091 O O     . ASN B 2 44  ? -7.287  -23.592 -27.790 1.00 28.92 ? 86  ASN B O     1 
ATOM   3092 C CB    . ASN B 2 44  ? -7.610  -26.580 -26.980 1.00 29.98 ? 86  ASN B CB    1 
ATOM   3093 C CG    . ASN B 2 44  ? -7.351  -28.075 -26.896 1.00 30.59 ? 86  ASN B CG    1 
ATOM   3094 O OD1   . ASN B 2 44  ? -6.871  -28.570 -25.880 1.00 34.66 ? 86  ASN B OD1   1 
ATOM   3095 N ND2   . ASN B 2 44  ? -7.666  -28.799 -27.966 1.00 31.03 ? 86  ASN B ND2   1 
ATOM   3096 N N     . LEU B 2 45  ? -8.215  -24.649 -29.561 1.00 28.06 ? 87  LEU B N     1 
ATOM   3097 C CA    . LEU B 2 45  ? -9.237  -23.641 -29.832 1.00 27.35 ? 87  LEU B CA    1 
ATOM   3098 C C     . LEU B 2 45  ? -10.444 -23.973 -28.946 1.00 28.51 ? 87  LEU B C     1 
ATOM   3099 O O     . LEU B 2 45  ? -10.800 -25.155 -28.786 1.00 28.24 ? 87  LEU B O     1 
ATOM   3100 C CB    . LEU B 2 45  ? -9.643  -23.651 -31.315 1.00 27.05 ? 87  LEU B CB    1 
ATOM   3101 C CG    . LEU B 2 45  ? -10.919 -22.919 -31.771 1.00 24.60 ? 87  LEU B CG    1 
ATOM   3102 C CD1   . LEU B 2 45  ? -10.717 -21.424 -31.920 1.00 23.71 ? 87  LEU B CD1   1 
ATOM   3103 C CD2   . LEU B 2 45  ? -11.429 -23.498 -33.072 1.00 27.05 ? 87  LEU B CD2   1 
ATOM   3104 N N     . ALA B 2 46  ? -11.074 -22.936 -28.386 1.00 28.06 ? 88  ALA B N     1 
ATOM   3105 C CA    . ALA B 2 46  ? -12.192 -23.107 -27.460 1.00 27.04 ? 88  ALA B CA    1 
ATOM   3106 C C     . ALA B 2 46  ? -13.309 -22.069 -27.632 1.00 27.02 ? 88  ALA B C     1 
ATOM   3107 O O     . ALA B 2 46  ? -13.088 -20.964 -28.138 1.00 26.09 ? 88  ALA B O     1 
ATOM   3108 C CB    . ALA B 2 46  ? -11.687 -23.116 -26.015 1.00 26.13 ? 88  ALA B CB    1 
ATOM   3109 N N     . ARG B 2 47  ? -14.510 -22.453 -27.207 1.00 26.53 ? 89  ARG B N     1 
ATOM   3110 C CA    . ARG B 2 47  ? -15.646 -21.540 -27.115 1.00 27.31 ? 89  ARG B CA    1 
ATOM   3111 C C     . ARG B 2 47  ? -15.837 -21.144 -25.651 1.00 26.34 ? 89  ARG B C     1 
ATOM   3112 O O     . ARG B 2 47  ? -16.084 -22.009 -24.806 1.00 26.69 ? 89  ARG B O     1 
ATOM   3113 C CB    . ARG B 2 47  ? -16.917 -22.212 -27.663 1.00 26.91 ? 89  ARG B CB    1 
ATOM   3114 C CG    . ARG B 2 47  ? -18.143 -21.297 -27.791 1.00 28.03 ? 89  ARG B CG    1 
ATOM   3115 C CD    . ARG B 2 47  ? -19.396 -22.075 -28.237 1.00 29.08 ? 89  ARG B CD    1 
ATOM   3116 N NE    . ARG B 2 47  ? -19.886 -22.989 -27.195 1.00 34.29 ? 89  ARG B NE    1 
ATOM   3117 C CZ    . ARG B 2 47  ? -20.614 -22.598 -26.085 1.00 34.74 ? 89  ARG B CZ    1 
ATOM   3118 N NH1   . ARG B 2 47  ? -21.044 -21.297 -25.842 1.00 34.24 ? 89  ARG B NH1   1 
ATOM   3119 N NH2   . ARG B 2 47  ? -20.999 -23.522 -25.214 1.00 33.43 ? 89  ARG B NH2   1 
ATOM   3120 N N     . TYR B 2 48  ? -15.684 -19.851 -25.354 1.00 25.87 ? 90  TYR B N     1 
ATOM   3121 C CA    . TYR B 2 48  ? -16.013 -19.300 -24.034 1.00 25.52 ? 90  TYR B CA    1 
ATOM   3122 C C     . TYR B 2 48  ? -17.532 -19.276 -23.875 1.00 24.80 ? 90  TYR B C     1 
ATOM   3123 O O     . TYR B 2 48  ? -18.194 -18.407 -24.441 1.00 25.61 ? 90  TYR B O     1 
ATOM   3124 C CB    . TYR B 2 48  ? -15.435 -17.885 -23.862 1.00 25.01 ? 90  TYR B CB    1 
ATOM   3125 C CG    . TYR B 2 48  ? -15.574 -17.320 -22.456 1.00 24.96 ? 90  TYR B CG    1 
ATOM   3126 C CD1   . TYR B 2 48  ? -15.211 -18.079 -21.336 1.00 25.37 ? 90  TYR B CD1   1 
ATOM   3127 C CD2   . TYR B 2 48  ? -16.044 -16.026 -22.243 1.00 26.86 ? 90  TYR B CD2   1 
ATOM   3128 C CE1   . TYR B 2 48  ? -15.329 -17.570 -20.038 1.00 23.77 ? 90  TYR B CE1   1 
ATOM   3129 C CE2   . TYR B 2 48  ? -16.171 -15.501 -20.937 1.00 26.18 ? 90  TYR B CE2   1 
ATOM   3130 C CZ    . TYR B 2 48  ? -15.802 -16.286 -19.845 1.00 25.66 ? 90  TYR B CZ    1 
ATOM   3131 O OH    . TYR B 2 48  ? -15.910 -15.801 -18.557 1.00 25.41 ? 90  TYR B OH    1 
ATOM   3132 N N     . LYS B 2 49  ? -18.074 -20.226 -23.112 1.00 24.48 ? 91  LYS B N     1 
ATOM   3133 C CA    . LYS B 2 49  ? -19.534 -20.441 -23.039 1.00 25.88 ? 91  LYS B CA    1 
ATOM   3134 C C     . LYS B 2 49  ? -20.389 -19.197 -22.696 1.00 25.99 ? 91  LYS B C     1 
ATOM   3135 O O     . LYS B 2 49  ? -21.438 -18.987 -23.311 1.00 26.52 ? 91  LYS B O     1 
ATOM   3136 C CB    . LYS B 2 49  ? -19.886 -21.592 -22.086 1.00 25.65 ? 91  LYS B CB    1 
ATOM   3137 C CG    . LYS B 2 49  ? -19.297 -22.968 -22.436 1.00 26.03 ? 91  LYS B CG    1 
ATOM   3138 C CD    . LYS B 2 49  ? -20.070 -24.037 -21.616 1.00 27.34 ? 91  LYS B CD    1 
ATOM   3139 C CE    . LYS B 2 49  ? -19.826 -25.452 -22.127 1.00 30.96 ? 91  LYS B CE    1 
ATOM   3140 N NZ    . LYS B 2 49  ? -18.485 -25.962 -21.712 1.00 27.41 ? 91  LYS B NZ    1 
ATOM   3141 N N     . PRO B 2 50  ? -19.968 -18.381 -21.705 1.00 26.77 ? 92  PRO B N     1 
ATOM   3142 C CA    . PRO B 2 50  ? -20.760 -17.179 -21.389 1.00 26.94 ? 92  PRO B CA    1 
ATOM   3143 C C     . PRO B 2 50  ? -20.881 -16.105 -22.487 1.00 27.53 ? 92  PRO B C     1 
ATOM   3144 O O     . PRO B 2 50  ? -21.721 -15.217 -22.359 1.00 28.19 ? 92  PRO B O     1 
ATOM   3145 C CB    . PRO B 2 50  ? -20.050 -16.606 -20.158 1.00 26.76 ? 92  PRO B CB    1 
ATOM   3146 C CG    . PRO B 2 50  ? -19.288 -17.767 -19.586 1.00 26.47 ? 92  PRO B CG    1 
ATOM   3147 C CD    . PRO B 2 50  ? -18.828 -18.521 -20.780 1.00 26.19 ? 92  PRO B CD    1 
ATOM   3148 N N     . THR B 2 51  ? -20.066 -16.165 -23.541 1.00 28.31 ? 93  THR B N     1 
ATOM   3149 C CA    . THR B 2 51  ? -20.197 -15.200 -24.651 1.00 28.26 ? 93  THR B CA    1 
ATOM   3150 C C     . THR B 2 51  ? -20.199 -15.844 -26.033 1.00 28.73 ? 93  THR B C     1 
ATOM   3151 O O     . THR B 2 51  ? -20.405 -15.148 -27.046 1.00 29.46 ? 93  THR B O     1 
ATOM   3152 C CB    . THR B 2 51  ? -19.091 -14.110 -24.638 1.00 28.41 ? 93  THR B CB    1 
ATOM   3153 O OG1   . THR B 2 51  ? -17.795 -14.725 -24.696 1.00 25.53 ? 93  THR B OG1   1 
ATOM   3154 C CG2   . THR B 2 51  ? -19.196 -13.229 -23.398 1.00 29.55 ? 93  THR B CG2   1 
ATOM   3155 N N     . GLY B 2 52  ? -19.949 -17.162 -26.074 1.00 29.86 ? 94  GLY B N     1 
ATOM   3156 C CA    . GLY B 2 52  ? -19.785 -17.872 -27.343 1.00 30.57 ? 94  GLY B CA    1 
ATOM   3157 C C     . GLY B 2 52  ? -18.514 -17.526 -28.113 1.00 31.47 ? 94  GLY B C     1 
ATOM   3158 O O     . GLY B 2 52  ? -18.233 -18.141 -29.141 1.00 32.51 ? 94  GLY B O     1 
ATOM   3159 N N     . GLU B 2 53  ? -17.751 -16.549 -27.613 1.00 31.91 ? 95  GLU B N     1 
ATOM   3160 C CA    . GLU B 2 53  ? -16.533 -16.038 -28.262 1.00 32.61 ? 95  GLU B CA    1 
ATOM   3161 C C     . GLU B 2 53  ? -15.403 -17.090 -28.313 1.00 31.42 ? 95  GLU B C     1 
ATOM   3162 O O     . GLU B 2 53  ? -15.294 -17.929 -27.417 1.00 30.22 ? 95  GLU B O     1 
ATOM   3163 C CB    . GLU B 2 53  ? -16.081 -14.743 -27.550 1.00 33.02 ? 95  GLU B CB    1 
ATOM   3164 C CG    . GLU B 2 53  ? -14.671 -14.198 -27.898 1.00 35.84 ? 95  GLU B CG    1 
ATOM   3165 C CD    . GLU B 2 53  ? -14.089 -13.263 -26.819 1.00 34.90 ? 95  GLU B CD    1 
ATOM   3166 O OE1   . GLU B 2 53  ? -12.906 -12.867 -26.947 1.00 35.50 ? 95  GLU B OE1   1 
ATOM   3167 O OE2   . GLU B 2 53  ? -14.805 -12.924 -25.848 1.00 36.54 ? 95  GLU B OE2   1 
ATOM   3168 N N     . TYR B 2 54  ? -14.592 -17.043 -29.376 1.00 30.88 ? 96  TYR B N     1 
ATOM   3169 C CA    . TYR B 2 54  ? -13.450 -17.949 -29.551 1.00 30.58 ? 96  TYR B CA    1 
ATOM   3170 C C     . TYR B 2 54  ? -12.226 -17.505 -28.751 1.00 29.62 ? 96  TYR B C     1 
ATOM   3171 O O     . TYR B 2 54  ? -11.849 -16.325 -28.734 1.00 29.12 ? 96  TYR B O     1 
ATOM   3172 C CB    . TYR B 2 54  ? -13.046 -18.076 -31.031 1.00 32.20 ? 96  TYR B CB    1 
ATOM   3173 C CG    . TYR B 2 54  ? -13.874 -19.018 -31.895 1.00 33.74 ? 96  TYR B CG    1 
ATOM   3174 C CD1   . TYR B 2 54  ? -14.265 -18.635 -33.183 1.00 37.31 ? 96  TYR B CD1   1 
ATOM   3175 C CD2   . TYR B 2 54  ? -14.250 -20.291 -31.445 1.00 34.89 ? 96  TYR B CD2   1 
ATOM   3176 C CE1   . TYR B 2 54  ? -15.018 -19.485 -34.003 1.00 37.93 ? 96  TYR B CE1   1 
ATOM   3177 C CE2   . TYR B 2 54  ? -15.008 -21.153 -32.255 1.00 35.65 ? 96  TYR B CE2   1 
ATOM   3178 C CZ    . TYR B 2 54  ? -15.388 -20.741 -33.539 1.00 37.21 ? 96  TYR B CZ    1 
ATOM   3179 O OH    . TYR B 2 54  ? -16.134 -21.569 -34.365 1.00 34.37 ? 96  TYR B OH    1 
ATOM   3180 N N     . VAL B 2 55  ? -11.597 -18.472 -28.098 1.00 28.59 ? 97  VAL B N     1 
ATOM   3181 C CA    . VAL B 2 55  ? -10.399 -18.230 -27.311 1.00 26.78 ? 97  VAL B CA    1 
ATOM   3182 C C     . VAL B 2 55  ? -9.438  -19.399 -27.505 1.00 27.54 ? 97  VAL B C     1 
ATOM   3183 O O     . VAL B 2 55  ? -9.809  -20.406 -28.110 1.00 26.67 ? 97  VAL B O     1 
ATOM   3184 C CB    . VAL B 2 55  ? -10.715 -18.041 -25.785 1.00 26.48 ? 97  VAL B CB    1 
ATOM   3185 C CG1   . VAL B 2 55  ? -11.613 -16.822 -25.551 1.00 24.04 ? 97  VAL B CG1   1 
ATOM   3186 C CG2   . VAL B 2 55  ? -11.327 -19.294 -25.176 1.00 24.64 ? 97  VAL B CG2   1 
ATOM   3187 N N     . THR B 2 56  ? -8.212  -19.244 -26.996 1.00 26.48 ? 98  THR B N     1 
ATOM   3188 C CA    . THR B 2 56  ? -7.206  -20.287 -26.985 1.00 26.08 ? 98  THR B CA    1 
ATOM   3189 C C     . THR B 2 56  ? -7.029  -20.802 -25.560 1.00 27.11 ? 98  THR B C     1 
ATOM   3190 O O     . THR B 2 56  ? -6.822  -20.012 -24.637 1.00 27.83 ? 98  THR B O     1 
ATOM   3191 C CB    . THR B 2 56  ? -5.857  -19.736 -27.478 1.00 26.06 ? 98  THR B CB    1 
ATOM   3192 O OG1   . THR B 2 56  ? -5.954  -19.414 -28.863 1.00 28.71 ? 98  THR B OG1   1 
ATOM   3193 C CG2   . THR B 2 56  ? -4.747  -20.734 -27.292 1.00 22.89 ? 98  THR B CG2   1 
ATOM   3194 N N     . VAL B 2 57  ? -7.124  -22.117 -25.380 1.00 27.26 ? 99  VAL B N     1 
ATOM   3195 C CA    . VAL B 2 57  ? -6.792  -22.746 -24.101 1.00 27.91 ? 99  VAL B CA    1 
ATOM   3196 C C     . VAL B 2 57  ? -5.502  -23.567 -24.237 1.00 27.72 ? 99  VAL B C     1 
ATOM   3197 O O     . VAL B 2 57  ? -5.417  -24.474 -25.078 1.00 28.18 ? 99  VAL B O     1 
ATOM   3198 C CB    . VAL B 2 57  ? -7.946  -23.628 -23.566 1.00 27.80 ? 99  VAL B CB    1 
ATOM   3199 C CG1   . VAL B 2 57  ? -7.570  -24.239 -22.242 1.00 30.42 ? 99  VAL B CG1   1 
ATOM   3200 C CG2   . VAL B 2 57  ? -9.224  -22.823 -23.409 1.00 27.44 ? 99  VAL B CG2   1 
ATOM   3201 N N     . ARG B 2 58  ? -4.501  -23.209 -23.428 1.00 28.11 ? 100 ARG B N     1 
ATOM   3202 C CA    . ARG B 2 58  ? -3.204  -23.910 -23.354 1.00 28.20 ? 100 ARG B CA    1 
ATOM   3203 C C     . ARG B 2 58  ? -3.218  -24.869 -22.158 1.00 29.14 ? 100 ARG B C     1 
ATOM   3204 O O     . ARG B 2 58  ? -3.410  -24.432 -21.027 1.00 31.42 ? 100 ARG B O     1 
ATOM   3205 C CB    . ARG B 2 58  ? -2.046  -22.901 -23.212 1.00 27.94 ? 100 ARG B CB    1 
ATOM   3206 C CG    . ARG B 2 58  ? -2.030  -21.814 -24.285 1.00 25.10 ? 100 ARG B CG    1 
ATOM   3207 C CD    . ARG B 2 58  ? -1.279  -20.543 -23.857 1.00 28.22 ? 100 ARG B CD    1 
ATOM   3208 N NE    . ARG B 2 58  ? 0.161   -20.758 -23.710 1.00 26.64 ? 100 ARG B NE    1 
ATOM   3209 C CZ    . ARG B 2 58  ? 1.017   -20.941 -24.717 1.00 28.03 ? 100 ARG B CZ    1 
ATOM   3210 N NH1   . ARG B 2 58  ? 0.602   -20.927 -25.983 1.00 24.88 ? 100 ARG B NH1   1 
ATOM   3211 N NH2   . ARG B 2 58  ? 2.299   -21.162 -24.456 1.00 25.84 ? 100 ARG B NH2   1 
ATOM   3212 N N     . ARG B 2 59  ? -3.037  -26.168 -22.408 1.00 28.04 ? 101 ARG B N     1 
ATOM   3213 C CA    . ARG B 2 59  ? -3.169  -27.180 -21.359 1.00 27.17 ? 101 ARG B CA    1 
ATOM   3214 C C     . ARG B 2 59  ? -1.909  -28.020 -21.151 1.00 27.40 ? 101 ARG B C     1 
ATOM   3215 O O     . ARG B 2 59  ? -1.363  -28.589 -22.098 1.00 27.08 ? 101 ARG B O     1 
ATOM   3216 C CB    . ARG B 2 59  ? -4.343  -28.118 -21.649 1.00 25.50 ? 101 ARG B CB    1 
ATOM   3217 C CG    . ARG B 2 59  ? -5.689  -27.431 -21.799 1.00 27.23 ? 101 ARG B CG    1 
ATOM   3218 C CD    . ARG B 2 59  ? -6.802  -28.434 -22.033 1.00 24.76 ? 101 ARG B CD    1 
ATOM   3219 N NE    . ARG B 2 59  ? -6.560  -29.236 -23.225 1.00 27.24 ? 101 ARG B NE    1 
ATOM   3220 C CZ    . ARG B 2 59  ? -6.236  -30.527 -23.215 1.00 28.09 ? 101 ARG B CZ    1 
ATOM   3221 N NH1   . ARG B 2 59  ? -6.124  -31.182 -22.069 1.00 31.91 ? 101 ARG B NH1   1 
ATOM   3222 N NH2   . ARG B 2 59  ? -6.027  -31.166 -24.356 1.00 29.84 ? 101 ARG B NH2   1 
ATOM   3223 N N     . ILE B 2 60  ? -1.479  -28.110 -19.895 1.00 25.81 ? 102 ILE B N     1 
ATOM   3224 C CA    . ILE B 2 60  ? -0.309  -28.899 -19.515 1.00 24.37 ? 102 ILE B CA    1 
ATOM   3225 C C     . ILE B 2 60  ? -0.620  -29.784 -18.314 1.00 23.59 ? 102 ILE B C     1 
ATOM   3226 O O     . ILE B 2 60  ? -1.073  -29.284 -17.281 1.00 22.88 ? 102 ILE B O     1 
ATOM   3227 C CB    . ILE B 2 60  ? 0.882   -27.971 -19.175 1.00 23.20 ? 102 ILE B CB    1 
ATOM   3228 C CG1   . ILE B 2 60  ? 1.222   -27.110 -20.390 1.00 21.40 ? 102 ILE B CG1   1 
ATOM   3229 C CG2   . ILE B 2 60  ? 2.085   -28.778 -18.661 1.00 22.55 ? 102 ILE B CG2   1 
ATOM   3230 C CD1   . ILE B 2 60  ? 2.346   -26.113 -20.173 1.00 24.95 ? 102 ILE B CD1   1 
ATOM   3231 N N     . ASN B 2 61  ? -0.378  -31.088 -18.449 1.00 24.12 ? 103 ASN B N     1 
ATOM   3232 C CA    . ASN B 2 61  ? -0.492  -32.015 -17.311 1.00 24.49 ? 103 ASN B CA    1 
ATOM   3233 C C     . ASN B 2 61  ? 0.659   -31.825 -16.327 1.00 25.14 ? 103 ASN B C     1 
ATOM   3234 O O     . ASN B 2 61  ? 1.819   -32.129 -16.625 1.00 25.53 ? 103 ASN B O     1 
ATOM   3235 C CB    . ASN B 2 61  ? -0.565  -33.473 -17.768 1.00 23.79 ? 103 ASN B CB    1 
ATOM   3236 C CG    . ASN B 2 61  ? -0.991  -34.420 -16.649 1.00 27.91 ? 103 ASN B CG    1 
ATOM   3237 O OD1   . ASN B 2 61  ? -0.866  -34.107 -15.468 1.00 31.88 ? 103 ASN B OD1   1 
ATOM   3238 N ND2   . ASN B 2 61  ? -1.499  -35.583 -17.021 1.00 27.28 ? 103 ASN B ND2   1 
ATOM   3239 N N     . LEU B 2 62  ? 0.327   -31.309 -15.150 1.00 26.33 ? 104 LEU B N     1 
ATOM   3240 C CA    . LEU B 2 62  ? 1.325   -30.996 -14.127 1.00 25.24 ? 104 LEU B CA    1 
ATOM   3241 C C     . LEU B 2 62  ? 1.917   -32.253 -13.479 1.00 24.40 ? 104 LEU B C     1 
ATOM   3242 O O     . LEU B 2 62  ? 3.016   -32.203 -12.907 1.00 23.03 ? 104 LEU B O     1 
ATOM   3243 C CB    . LEU B 2 62  ? 0.712   -30.075 -13.072 1.00 26.02 ? 104 LEU B CB    1 
ATOM   3244 C CG    . LEU B 2 62  ? 0.849   -28.544 -13.122 1.00 27.13 ? 104 LEU B CG    1 
ATOM   3245 C CD1   . LEU B 2 62  ? 1.335   -27.981 -14.446 1.00 23.35 ? 104 LEU B CD1   1 
ATOM   3246 C CD2   . LEU B 2 62  ? -0.488  -27.948 -12.737 1.00 24.65 ? 104 LEU B CD2   1 
ATOM   3247 N N     . GLU B 2 63  ? 1.199   -33.375 -13.586 1.00 22.03 ? 105 GLU B N     1 
ATOM   3248 C CA    . GLU B 2 63  ? 1.719   -34.673 -13.143 1.00 21.65 ? 105 GLU B CA    1 
ATOM   3249 C C     . GLU B 2 63  ? 2.955   -35.121 -13.951 1.00 21.92 ? 105 GLU B C     1 
ATOM   3250 O O     . GLU B 2 63  ? 3.836   -35.806 -13.425 1.00 22.08 ? 105 GLU B O     1 
ATOM   3251 C CB    . GLU B 2 63  ? 0.617   -35.740 -13.176 1.00 20.54 ? 105 GLU B CB    1 
ATOM   3252 C CG    . GLU B 2 63  ? 0.993   -37.096 -12.552 1.00 24.22 ? 105 GLU B CG    1 
ATOM   3253 C CD    . GLU B 2 63  ? 1.285   -37.037 -11.050 1.00 24.28 ? 105 GLU B CD    1 
ATOM   3254 O OE1   . GLU B 2 63  ? 2.179   -37.784 -10.590 1.00 23.82 ? 105 GLU B OE1   1 
ATOM   3255 O OE2   . GLU B 2 63  ? 0.632   -36.247 -10.327 1.00 25.25 ? 105 GLU B OE2   1 
ATOM   3256 N N     . ALA B 2 64  ? 3.022   -34.727 -15.220 1.00 21.03 ? 106 ALA B N     1 
ATOM   3257 C CA    . ALA B 2 64  ? 4.178   -35.036 -16.055 1.00 21.16 ? 106 ALA B CA    1 
ATOM   3258 C C     . ALA B 2 64  ? 5.312   -34.013 -15.884 1.00 22.80 ? 106 ALA B C     1 
ATOM   3259 O O     . ALA B 2 64  ? 6.350   -34.116 -16.544 1.00 23.76 ? 106 ALA B O     1 
ATOM   3260 C CB    . ALA B 2 64  ? 3.765   -35.118 -17.506 1.00 20.89 ? 106 ALA B CB    1 
ATOM   3261 N N     . CYS B 2 65  ? 5.106   -33.024 -15.011 1.00 22.77 ? 107 CYS B N     1 
ATOM   3262 C CA    . CYS B 2 65  ? 6.101   -31.988 -14.732 1.00 22.01 ? 107 CYS B CA    1 
ATOM   3263 C C     . CYS B 2 65  ? 6.893   -32.222 -13.451 1.00 22.39 ? 107 CYS B C     1 
ATOM   3264 O O     . CYS B 2 65  ? 6.318   -32.531 -12.411 1.00 21.71 ? 107 CYS B O     1 
ATOM   3265 C CB    . CYS B 2 65  ? 5.425   -30.628 -14.626 1.00 20.71 ? 107 CYS B CB    1 
ATOM   3266 S SG    . CYS B 2 65  ? 4.756   -30.079 -16.156 1.00 23.12 ? 107 CYS B SG    1 
ATOM   3267 N N     . SER B 2 66  ? 8.211   -32.035 -13.523 1.00 23.66 ? 108 SER B N     1 
ATOM   3268 C CA    . SER B 2 66  ? 9.033   -31.963 -12.311 1.00 25.39 ? 108 SER B CA    1 
ATOM   3269 C C     . SER B 2 66  ? 8.712   -30.691 -11.496 1.00 26.72 ? 108 SER B C     1 
ATOM   3270 O O     . SER B 2 66  ? 7.923   -29.830 -11.934 1.00 26.47 ? 108 SER B O     1 
ATOM   3271 C CB    . SER B 2 66  ? 10.530  -32.042 -12.649 1.00 24.68 ? 108 SER B CB    1 
ATOM   3272 O OG    . SER B 2 66  ? 10.955  -30.931 -13.414 1.00 27.02 ? 108 SER B OG    1 
ATOM   3273 N N     . ASN B 2 67  ? 9.308   -30.585 -10.309 1.00 27.69 ? 109 ASN B N     1 
ATOM   3274 C CA    . ASN B 2 67  ? 9.128   -29.405 -9.460  1.00 28.90 ? 109 ASN B CA    1 
ATOM   3275 C C     . ASN B 2 67  ? 9.655   -28.157 -10.175 1.00 29.32 ? 109 ASN B C     1 
ATOM   3276 O O     . ASN B 2 67  ? 8.986   -27.125 -10.221 1.00 30.11 ? 109 ASN B O     1 
ATOM   3277 C CB    . ASN B 2 67  ? 9.833   -29.584 -8.100  1.00 28.91 ? 109 ASN B CB    1 
ATOM   3278 C CG    . ASN B 2 67  ? 9.222   -30.694 -7.240  1.00 29.14 ? 109 ASN B CG    1 
ATOM   3279 O OD1   . ASN B 2 67  ? 8.046   -31.047 -7.373  1.00 27.82 ? 109 ASN B OD1   1 
ATOM   3280 N ND2   . ASN B 2 67  ? 10.031  -31.233 -6.326  1.00 29.48 ? 109 ASN B ND2   1 
ATOM   3281 N N     . GLU B 2 68  ? 10.859  -28.281 -10.734 1.00 30.25 ? 110 GLU B N     1 
ATOM   3282 C CA    . GLU B 2 68  ? 11.488  -27.243 -11.538 1.00 31.88 ? 110 GLU B CA    1 
ATOM   3283 C C     . GLU B 2 68  ? 10.630  -26.788 -12.742 1.00 31.04 ? 110 GLU B C     1 
ATOM   3284 O O     . GLU B 2 68  ? 10.587  -25.594 -13.061 1.00 30.58 ? 110 GLU B O     1 
ATOM   3285 C CB    . GLU B 2 68  ? 12.851  -27.737 -12.010 1.00 31.47 ? 110 GLU B CB    1 
ATOM   3286 C CG    . GLU B 2 68  ? 13.689  -26.719 -12.772 1.00 35.00 ? 110 GLU B CG    1 
ATOM   3287 C CD    . GLU B 2 68  ? 15.096  -27.239 -13.046 1.00 34.94 ? 110 GLU B CD    1 
ATOM   3288 O OE1   . GLU B 2 68  ? 15.677  -27.872 -12.135 1.00 39.38 ? 110 GLU B OE1   1 
ATOM   3289 O OE2   . GLU B 2 68  ? 15.619  -27.020 -14.161 1.00 36.45 ? 110 GLU B OE2   1 
ATOM   3290 N N     . MET B 2 69  ? 9.968   -27.737 -13.405 1.00 29.11 ? 111 MET B N     1 
ATOM   3291 C CA    . MET B 2 69  ? 9.115   -27.418 -14.538 1.00 28.10 ? 111 MET B CA    1 
ATOM   3292 C C     . MET B 2 69  ? 7.875   -26.647 -14.103 1.00 28.51 ? 111 MET B C     1 
ATOM   3293 O O     . MET B 2 69  ? 7.392   -25.797 -14.836 1.00 29.23 ? 111 MET B O     1 
ATOM   3294 C CB    . MET B 2 69  ? 8.707   -28.678 -15.281 1.00 27.59 ? 111 MET B CB    1 
ATOM   3295 C CG    . MET B 2 69  ? 9.826   -29.306 -16.078 1.00 27.35 ? 111 MET B CG    1 
ATOM   3296 S SD    . MET B 2 69  ? 9.439   -30.963 -16.679 1.00 28.25 ? 111 MET B SD    1 
ATOM   3297 C CE    . MET B 2 69  ? 8.203   -30.571 -17.898 1.00 24.72 ? 111 MET B CE    1 
ATOM   3298 N N     . VAL B 2 70  ? 7.364   -26.944 -12.911 1.00 28.77 ? 112 VAL B N     1 
ATOM   3299 C CA    . VAL B 2 70  ? 6.215   -26.218 -12.363 1.00 27.93 ? 112 VAL B CA    1 
ATOM   3300 C C     . VAL B 2 70  ? 6.599   -24.768 -12.012 1.00 28.16 ? 112 VAL B C     1 
ATOM   3301 O O     . VAL B 2 70  ? 5.817   -23.847 -12.268 1.00 27.29 ? 112 VAL B O     1 
ATOM   3302 C CB    . VAL B 2 70  ? 5.596   -26.960 -11.144 1.00 28.16 ? 112 VAL B CB    1 
ATOM   3303 C CG1   . VAL B 2 70  ? 4.475   -26.137 -10.494 1.00 25.11 ? 112 VAL B CG1   1 
ATOM   3304 C CG2   . VAL B 2 70  ? 5.062   -28.335 -11.567 1.00 26.04 ? 112 VAL B CG2   1 
ATOM   3305 N N     . THR B 2 71  ? 7.797   -24.593 -11.441 1.00 27.39 ? 113 THR B N     1 
ATOM   3306 C CA    . THR B 2 71  ? 8.376   -23.289 -11.083 1.00 27.35 ? 113 THR B CA    1 
ATOM   3307 C C     . THR B 2 71  ? 8.579   -22.419 -12.330 1.00 28.35 ? 113 THR B C     1 
ATOM   3308 O O     . THR B 2 71  ? 8.237   -21.227 -12.354 1.00 29.20 ? 113 THR B O     1 
ATOM   3309 C CB    . THR B 2 71  ? 9.748   -23.485 -10.369 1.00 29.43 ? 113 THR B CB    1 
ATOM   3310 O OG1   . THR B 2 71  ? 9.558   -24.131 -9.104  1.00 27.35 ? 113 THR B OG1   1 
ATOM   3311 C CG2   . THR B 2 71  ? 10.494  -22.146 -10.152 1.00 26.64 ? 113 THR B CG2   1 
ATOM   3312 N N     . PHE B 2 72  ? 9.132   -23.044 -13.365 1.00 28.43 ? 114 PHE B N     1 
ATOM   3313 C CA    . PHE B 2 72  ? 9.392   -22.423 -14.662 1.00 27.20 ? 114 PHE B CA    1 
ATOM   3314 C C     . PHE B 2 72  ? 8.086   -21.917 -15.266 1.00 27.64 ? 114 PHE B C     1 
ATOM   3315 O O     . PHE B 2 72  ? 8.022   -20.803 -15.777 1.00 28.82 ? 114 PHE B O     1 
ATOM   3316 C CB    . PHE B 2 72  ? 10.058  -23.463 -15.574 1.00 25.49 ? 114 PHE B CB    1 
ATOM   3317 C CG    . PHE B 2 72  ? 10.539  -22.924 -16.899 1.00 25.42 ? 114 PHE B CG    1 
ATOM   3318 C CD1   . PHE B 2 72  ? 11.555  -21.956 -16.959 1.00 23.40 ? 114 PHE B CD1   1 
ATOM   3319 C CD2   . PHE B 2 72  ? 10.013  -23.422 -18.100 1.00 19.62 ? 114 PHE B CD2   1 
ATOM   3320 C CE1   . PHE B 2 72  ? 12.018  -21.474 -18.190 1.00 22.14 ? 114 PHE B CE1   1 
ATOM   3321 C CE2   . PHE B 2 72  ? 10.477  -22.940 -19.343 1.00 20.23 ? 114 PHE B CE2   1 
ATOM   3322 C CZ    . PHE B 2 72  ? 11.471  -21.964 -19.384 1.00 20.83 ? 114 PHE B CZ    1 
ATOM   3323 N N     . LEU B 2 73  ? 7.046   -22.737 -15.176 1.00 27.44 ? 115 LEU B N     1 
ATOM   3324 C CA    . LEU B 2 73  ? 5.703   -22.397 -15.666 1.00 27.89 ? 115 LEU B CA    1 
ATOM   3325 C C     . LEU B 2 73  ? 4.985   -21.283 -14.892 1.00 27.09 ? 115 LEU B C     1 
ATOM   3326 O O     . LEU B 2 73  ? 4.256   -20.487 -15.490 1.00 31.90 ? 115 LEU B O     1 
ATOM   3327 C CB    . LEU B 2 73  ? 4.824   -23.664 -15.707 1.00 26.72 ? 115 LEU B CB    1 
ATOM   3328 C CG    . LEU B 2 73  ? 5.181   -24.772 -16.722 1.00 27.72 ? 115 LEU B CG    1 
ATOM   3329 C CD1   . LEU B 2 73  ? 4.373   -26.061 -16.458 1.00 25.61 ? 115 LEU B CD1   1 
ATOM   3330 C CD2   . LEU B 2 73  ? 5.005   -24.312 -18.178 1.00 21.13 ? 115 LEU B CD2   1 
ATOM   3331 N N     . GLN B 2 74  ? 5.136   -21.254 -13.570 1.00 27.43 ? 116 GLN B N     1 
ATOM   3332 C CA    . GLN B 2 74  ? 4.538   -20.200 -12.725 1.00 25.64 ? 116 GLN B CA    1 
ATOM   3333 C C     . GLN B 2 74  ? 5.195   -18.848 -12.962 1.00 25.45 ? 116 GLN B C     1 
ATOM   3334 O O     . GLN B 2 74  ? 4.538   -17.807 -12.809 1.00 25.78 ? 116 GLN B O     1 
ATOM   3335 C CB    . GLN B 2 74  ? 4.633   -20.552 -11.238 1.00 26.27 ? 116 GLN B CB    1 
ATOM   3336 C CG    . GLN B 2 74  ? 3.563   -21.530 -10.755 1.00 25.60 ? 116 GLN B CG    1 
ATOM   3337 C CD    . GLN B 2 74  ? 3.974   -22.311 -9.517  1.00 27.92 ? 116 GLN B CD    1 
ATOM   3338 O OE1   . GLN B 2 74  ? 5.163   -22.521 -9.254  1.00 26.62 ? 116 GLN B OE1   1 
ATOM   3339 N NE2   . GLN B 2 74  ? 2.987   -22.756 -8.753  1.00 25.88 ? 116 GLN B NE2   1 
ATOM   3340 N N     . GLY B 2 75  ? 6.491   -18.872 -13.309 1.00 24.02 ? 117 GLY B N     1 
ATOM   3341 C CA    . GLY B 2 75  ? 7.234   -17.684 -13.730 1.00 22.71 ? 117 GLY B CA    1 
ATOM   3342 C C     . GLY B 2 75  ? 6.636   -17.002 -14.957 1.00 24.99 ? 117 GLY B C     1 
ATOM   3343 O O     . GLY B 2 75  ? 6.527   -15.766 -14.987 1.00 23.01 ? 117 GLY B O     1 
ATOM   3344 N N     . GLU B 2 76  ? 6.219   -17.804 -15.949 1.00 24.66 ? 118 GLU B N     1 
ATOM   3345 C CA    . GLU B 2 76  ? 5.541   -17.296 -17.153 1.00 27.22 ? 118 GLU B CA    1 
ATOM   3346 C C     . GLU B 2 76  ? 4.280   -16.512 -16.819 1.00 26.95 ? 118 GLU B C     1 
ATOM   3347 O O     . GLU B 2 76  ? 3.982   -15.507 -17.456 1.00 26.98 ? 118 GLU B O     1 
ATOM   3348 C CB    . GLU B 2 76  ? 5.176   -18.419 -18.137 1.00 27.14 ? 118 GLU B CB    1 
ATOM   3349 C CG    . GLU B 2 76  ? 4.484   -17.901 -19.434 1.00 26.58 ? 118 GLU B CG    1 
ATOM   3350 C CD    . GLU B 2 76  ? 3.878   -19.007 -20.317 1.00 29.39 ? 118 GLU B CD    1 
ATOM   3351 O OE1   . GLU B 2 76  ? 4.059   -20.209 -20.029 1.00 27.61 ? 118 GLU B OE1   1 
ATOM   3352 O OE2   . GLU B 2 76  ? 3.190   -18.667 -21.306 1.00 34.42 ? 118 GLU B OE2   1 
ATOM   3353 N N     . LEU B 2 77  ? 3.545   -16.991 -15.824 1.00 27.31 ? 119 LEU B N     1 
ATOM   3354 C CA    . LEU B 2 77  ? 2.271   -16.387 -15.445 1.00 28.13 ? 119 LEU B CA    1 
ATOM   3355 C C     . LEU B 2 77  ? 2.504   -15.060 -14.748 1.00 27.90 ? 119 LEU B C     1 
ATOM   3356 O O     . LEU B 2 77  ? 1.717   -14.125 -14.906 1.00 29.44 ? 119 LEU B O     1 
ATOM   3357 C CB    . LEU B 2 77  ? 1.481   -17.316 -14.517 1.00 26.83 ? 119 LEU B CB    1 
ATOM   3358 C CG    . LEU B 2 77  ? 1.279   -18.782 -14.914 1.00 30.40 ? 119 LEU B CG    1 
ATOM   3359 C CD1   . LEU B 2 77  ? 0.565   -19.525 -13.794 1.00 30.21 ? 119 LEU B CD1   1 
ATOM   3360 C CD2   . LEU B 2 77  ? 0.528   -18.936 -16.247 1.00 26.24 ? 119 LEU B CD2   1 
ATOM   3361 N N     . HIS B 2 78  ? 3.580   -15.000 -13.970 1.00 26.10 ? 120 HIS B N     1 
ATOM   3362 C CA    . HIS B 2 78  ? 3.989   -13.789 -13.288 1.00 27.44 ? 120 HIS B CA    1 
ATOM   3363 C C     . HIS B 2 78  ? 4.372   -12.717 -14.310 1.00 28.13 ? 120 HIS B C     1 
ATOM   3364 O O     . HIS B 2 78  ? 3.863   -11.598 -14.254 1.00 28.22 ? 120 HIS B O     1 
ATOM   3365 C CB    . HIS B 2 78  ? 5.155   -14.095 -12.327 1.00 27.85 ? 120 HIS B CB    1 
ATOM   3366 C CG    . HIS B 2 78  ? 5.726   -12.890 -11.644 1.00 28.24 ? 120 HIS B CG    1 
ATOM   3367 N ND1   . HIS B 2 78  ? 5.112   -12.281 -10.568 1.00 31.48 ? 120 HIS B ND1   1 
ATOM   3368 C CD2   . HIS B 2 78  ? 6.863   -12.191 -11.873 1.00 28.90 ? 120 HIS B CD2   1 
ATOM   3369 C CE1   . HIS B 2 78  ? 5.842   -11.254 -10.171 1.00 30.70 ? 120 HIS B CE1   1 
ATOM   3370 N NE2   . HIS B 2 78  ? 6.910   -11.178 -10.945 1.00 32.10 ? 120 HIS B NE2   1 
ATOM   3371 N N     . VAL B 2 79  ? 5.242   -13.076 -15.255 1.00 29.07 ? 121 VAL B N     1 
ATOM   3372 C CA    . VAL B 2 79  ? 5.778   -12.121 -16.233 1.00 30.19 ? 121 VAL B CA    1 
ATOM   3373 C C     . VAL B 2 79  ? 4.707   -11.589 -17.187 1.00 30.94 ? 121 VAL B C     1 
ATOM   3374 O O     . VAL B 2 79  ? 4.750   -10.423 -17.592 1.00 30.21 ? 121 VAL B O     1 
ATOM   3375 C CB    . VAL B 2 79  ? 6.979   -12.720 -17.033 1.00 30.36 ? 121 VAL B CB    1 
ATOM   3376 C CG1   . VAL B 2 79  ? 7.524   -11.717 -18.022 1.00 30.83 ? 121 VAL B CG1   1 
ATOM   3377 C CG2   . VAL B 2 79  ? 8.086   -13.127 -16.093 1.00 30.91 ? 121 VAL B CG2   1 
ATOM   3378 N N     . SER B 2 80  ? 3.745   -12.443 -17.531 1.00 31.91 ? 122 SER B N     1 
ATOM   3379 C CA    . SER B 2 80  ? 2.703   -12.102 -18.509 1.00 32.41 ? 122 SER B CA    1 
ATOM   3380 C C     . SER B 2 80  ? 1.666   -11.146 -17.941 1.00 31.61 ? 122 SER B C     1 
ATOM   3381 O O     . SER B 2 80  ? 1.026   -10.406 -18.682 1.00 33.27 ? 122 SER B O     1 
ATOM   3382 C CB    . SER B 2 80  ? 2.014   -13.370 -19.015 1.00 32.98 ? 122 SER B CB    1 
ATOM   3383 O OG    . SER B 2 80  ? 1.280   -13.979 -17.967 1.00 35.22 ? 122 SER B OG    1 
ATOM   3384 N N     . LYS B 2 81  ? 1.486   -11.175 -16.627 1.00 31.68 ? 123 LYS B N     1 
ATOM   3385 C CA    . LYS B 2 81  ? 0.600   -10.225 -15.955 1.00 30.16 ? 123 LYS B CA    1 
ATOM   3386 C C     . LYS B 2 81  ? 1.276   -8.853  -15.723 1.00 28.60 ? 123 LYS B C     1 
ATOM   3387 O O     . LYS B 2 81  ? 0.591   -7.852  -15.533 1.00 26.92 ? 123 LYS B O     1 
ATOM   3388 C CB    . LYS B 2 81  ? 0.045   -10.836 -14.663 1.00 30.81 ? 123 LYS B CB    1 
ATOM   3389 C CG    . LYS B 2 81  ? -1.115  -11.831 -14.910 1.00 36.13 ? 123 LYS B CG    1 
ATOM   3390 C CD    . LYS B 2 81  ? -2.489  -11.110 -14.984 1.00 38.74 ? 123 LYS B CD    1 
ATOM   3391 C CE    . LYS B 2 81  ? -3.416  -11.704 -16.056 1.00 41.57 ? 123 LYS B CE    1 
ATOM   3392 N NZ    . LYS B 2 81  ? -4.165  -12.945 -15.639 1.00 43.59 ? 123 LYS B NZ    1 
ATOM   3393 N N     . LEU B 2 82  ? 2.611   -8.816  -15.770 1.00 26.29 ? 124 LEU B N     1 
ATOM   3394 C CA    . LEU B 2 82  ? 3.375   -7.559  -15.712 1.00 25.54 ? 124 LEU B CA    1 
ATOM   3395 C C     . LEU B 2 82  ? 3.372   -6.781  -17.030 1.00 24.88 ? 124 LEU B C     1 
ATOM   3396 O O     . LEU B 2 82  ? 3.594   -5.569  -17.033 1.00 24.82 ? 124 LEU B O     1 
ATOM   3397 C CB    . LEU B 2 82  ? 4.837   -7.819  -15.295 1.00 25.90 ? 124 LEU B CB    1 
ATOM   3398 C CG    . LEU B 2 82  ? 5.182   -8.126  -13.833 1.00 26.06 ? 124 LEU B CG    1 
ATOM   3399 C CD1   . LEU B 2 82  ? 6.601   -8.648  -13.714 1.00 27.46 ? 124 LEU B CD1   1 
ATOM   3400 C CD2   . LEU B 2 82  ? 5.005   -6.889  -12.958 1.00 27.05 ? 124 LEU B CD2   1 
ATOM   3401 N N     . PHE B 2 83  ? 3.142   -7.480  -18.145 1.00 24.13 ? 125 PHE B N     1 
ATOM   3402 C CA    . PHE B 2 83  ? 3.212   -6.873  -19.476 1.00 24.31 ? 125 PHE B CA    1 
ATOM   3403 C C     . PHE B 2 83  ? 1.837   -6.462  -20.003 1.00 25.22 ? 125 PHE B C     1 
ATOM   3404 O O     . PHE B 2 83  ? 0.864   -7.223  -19.932 1.00 26.34 ? 125 PHE B O     1 
ATOM   3405 C CB    . PHE B 2 83  ? 3.876   -7.810  -20.490 1.00 23.67 ? 125 PHE B CB    1 
ATOM   3406 C CG    . PHE B 2 83  ? 5.336   -8.068  -20.242 1.00 22.06 ? 125 PHE B CG    1 
ATOM   3407 C CD1   . PHE B 2 83  ? 5.978   -9.104  -20.909 1.00 24.38 ? 125 PHE B CD1   1 
ATOM   3408 C CD2   . PHE B 2 83  ? 6.071   -7.291  -19.355 1.00 25.69 ? 125 PHE B CD2   1 
ATOM   3409 C CE1   . PHE B 2 83  ? 7.336   -9.364  -20.704 1.00 28.43 ? 125 PHE B CE1   1 
ATOM   3410 C CE2   . PHE B 2 83  ? 7.440   -7.543  -19.138 1.00 27.57 ? 125 PHE B CE2   1 
ATOM   3411 C CZ    . PHE B 2 83  ? 8.069   -8.580  -19.809 1.00 25.81 ? 125 PHE B CZ    1 
ATOM   3412 N N     . ASN B 2 84  ? 1.762   -5.249  -20.527 1.00 25.13 ? 126 ASN B N     1 
ATOM   3413 C CA    . ASN B 2 84  ? 0.568   -4.795  -21.216 1.00 26.10 ? 126 ASN B CA    1 
ATOM   3414 C C     . ASN B 2 84  ? 1.004   -3.956  -22.404 1.00 25.54 ? 126 ASN B C     1 
ATOM   3415 O O     . ASN B 2 84  ? 1.461   -2.824  -22.231 1.00 26.84 ? 126 ASN B O     1 
ATOM   3416 C CB    . ASN B 2 84  ? -0.337  -3.995  -20.271 1.00 26.18 ? 126 ASN B CB    1 
ATOM   3417 C CG    . ASN B 2 84  ? -1.623  -3.537  -20.936 1.00 27.71 ? 126 ASN B CG    1 
ATOM   3418 O OD1   . ASN B 2 84  ? -2.024  -2.386  -20.802 1.00 27.79 ? 126 ASN B OD1   1 
ATOM   3419 N ND2   . ASN B 2 84  ? -2.273  -4.441  -21.658 1.00 33.69 ? 126 ASN B ND2   1 
ATOM   3420 N N     . HIS B 2 85  ? 0.878   -4.515  -23.603 1.00 24.30 ? 127 HIS B N     1 
ATOM   3421 C CA    . HIS B 2 85  ? 1.374   -3.856  -24.821 1.00 24.80 ? 127 HIS B CA    1 
ATOM   3422 C C     . HIS B 2 85  ? 0.585   -4.318  -26.059 1.00 23.84 ? 127 HIS B C     1 
ATOM   3423 O O     . HIS B 2 85  ? 0.212   -5.486  -26.152 1.00 25.07 ? 127 HIS B O     1 
ATOM   3424 C CB    . HIS B 2 85  ? 2.881   -4.138  -24.991 1.00 24.94 ? 127 HIS B CB    1 
ATOM   3425 C CG    . HIS B 2 85  ? 3.531   -3.333  -26.072 1.00 26.51 ? 127 HIS B CG    1 
ATOM   3426 N ND1   . HIS B 2 85  ? 3.554   -3.737  -27.391 1.00 28.49 ? 127 HIS B ND1   1 
ATOM   3427 C CD2   . HIS B 2 85  ? 4.162   -2.135  -26.036 1.00 26.38 ? 127 HIS B CD2   1 
ATOM   3428 C CE1   . HIS B 2 85  ? 4.174   -2.827  -28.119 1.00 26.20 ? 127 HIS B CE1   1 
ATOM   3429 N NE2   . HIS B 2 85  ? 4.558   -1.848  -27.321 1.00 27.75 ? 127 HIS B NE2   1 
ATOM   3430 N N     . PRO B 2 86  ? 0.310   -3.398  -27.009 1.00 24.21 ? 128 PRO B N     1 
ATOM   3431 C CA    . PRO B 2 86  ? -0.477  -3.742  -28.203 1.00 23.36 ? 128 PRO B CA    1 
ATOM   3432 C C     . PRO B 2 86  ? 0.051   -4.922  -29.037 1.00 23.15 ? 128 PRO B C     1 
ATOM   3433 O O     . PRO B 2 86  ? -0.740  -5.579  -29.714 1.00 22.27 ? 128 PRO B O     1 
ATOM   3434 C CB    . PRO B 2 86  ? -0.450  -2.446  -29.020 1.00 22.39 ? 128 PRO B CB    1 
ATOM   3435 C CG    . PRO B 2 86  ? -0.277  -1.395  -28.016 1.00 23.29 ? 128 PRO B CG    1 
ATOM   3436 C CD    . PRO B 2 86  ? 0.667   -1.965  -27.004 1.00 22.99 ? 128 PRO B CD    1 
ATOM   3437 N N     . ASN B 2 87  ? 1.361   -5.172  -28.964 1.00 23.79 ? 129 ASN B N     1 
ATOM   3438 C CA    . ASN B 2 87  ? 2.038   -6.279  -29.666 1.00 23.55 ? 129 ASN B CA    1 
ATOM   3439 C C     . ASN B 2 87  ? 2.493   -7.444  -28.781 1.00 23.14 ? 129 ASN B C     1 
ATOM   3440 O O     . ASN B 2 87  ? 3.294   -8.281  -29.205 1.00 22.38 ? 129 ASN B O     1 
ATOM   3441 C CB    . ASN B 2 87  ? 3.254   -5.754  -30.427 1.00 23.42 ? 129 ASN B CB    1 
ATOM   3442 C CG    . ASN B 2 87  ? 2.893   -4.725  -31.473 1.00 25.67 ? 129 ASN B CG    1 
ATOM   3443 O OD1   . ASN B 2 87  ? 3.165   -3.536  -31.302 1.00 27.66 ? 129 ASN B OD1   1 
ATOM   3444 N ND2   . ASN B 2 87  ? 2.277   -5.176  -32.567 1.00 20.36 ? 129 ASN B ND2   1 
ATOM   3445 N N     . ILE B 2 88  ? 2.010   -7.501  -27.549 1.00 23.03 ? 130 ILE B N     1 
ATOM   3446 C CA    . ILE B 2 88  ? 2.283   -8.670  -26.725 1.00 24.69 ? 130 ILE B CA    1 
ATOM   3447 C C     . ILE B 2 88  ? 0.953   -9.338  -26.454 1.00 25.92 ? 130 ILE B C     1 
ATOM   3448 O O     . ILE B 2 88  ? 0.003   -8.664  -26.069 1.00 26.86 ? 130 ILE B O     1 
ATOM   3449 C CB    . ILE B 2 88  ? 3.028   -8.318  -25.411 1.00 24.72 ? 130 ILE B CB    1 
ATOM   3450 C CG1   . ILE B 2 88  ? 4.416   -7.741  -25.728 1.00 23.78 ? 130 ILE B CG1   1 
ATOM   3451 C CG2   . ILE B 2 88  ? 3.152   -9.564  -24.517 1.00 20.69 ? 130 ILE B CG2   1 
ATOM   3452 C CD1   . ILE B 2 88  ? 5.067   -6.978  -24.600 1.00 21.32 ? 130 ILE B CD1   1 
ATOM   3453 N N     . VAL B 2 89  ? 0.893   -10.650 -26.682 1.00 26.73 ? 131 VAL B N     1 
ATOM   3454 C CA    . VAL B 2 89  ? -0.335  -11.440 -26.514 1.00 28.33 ? 131 VAL B CA    1 
ATOM   3455 C C     . VAL B 2 89  ? -0.896  -11.365 -25.085 1.00 29.52 ? 131 VAL B C     1 
ATOM   3456 O O     . VAL B 2 89  ? -0.205  -11.685 -24.125 1.00 29.81 ? 131 VAL B O     1 
ATOM   3457 C CB    . VAL B 2 89  ? -0.140  -12.935 -26.971 1.00 27.38 ? 131 VAL B CB    1 
ATOM   3458 C CG1   . VAL B 2 89  ? 0.894   -13.656 -26.108 1.00 27.33 ? 131 VAL B CG1   1 
ATOM   3459 C CG2   . VAL B 2 89  ? -1.457  -13.688 -26.961 1.00 27.56 ? 131 VAL B CG2   1 
ATOM   3460 N N     . PRO B 2 90  ? -2.160  -10.941 -24.945 1.00 31.17 ? 132 PRO B N     1 
ATOM   3461 C CA    . PRO B 2 90  ? -2.768  -10.872 -23.618 1.00 31.74 ? 132 PRO B CA    1 
ATOM   3462 C C     . PRO B 2 90  ? -3.155  -12.245 -23.051 1.00 32.11 ? 132 PRO B C     1 
ATOM   3463 O O     . PRO B 2 90  ? -3.616  -13.123 -23.783 1.00 33.21 ? 132 PRO B O     1 
ATOM   3464 C CB    . PRO B 2 90  ? -4.029  -10.025 -23.854 1.00 31.98 ? 132 PRO B CB    1 
ATOM   3465 C CG    . PRO B 2 90  ? -3.917  -9.495  -25.278 1.00 32.94 ? 132 PRO B CG    1 
ATOM   3466 C CD    . PRO B 2 90  ? -3.092  -10.499 -25.994 1.00 31.59 ? 132 PRO B CD    1 
ATOM   3467 N N     . TYR B 2 91  ? -2.962  -12.419 -21.750 1.00 32.99 ? 133 TYR B N     1 
ATOM   3468 C CA    . TYR B 2 91  ? -3.437  -13.596 -21.044 1.00 32.90 ? 133 TYR B CA    1 
ATOM   3469 C C     . TYR B 2 91  ? -4.737  -13.228 -20.326 1.00 32.84 ? 133 TYR B C     1 
ATOM   3470 O O     . TYR B 2 91  ? -4.861  -12.137 -19.758 1.00 33.32 ? 133 TYR B O     1 
ATOM   3471 C CB    . TYR B 2 91  ? -2.386  -14.065 -20.051 1.00 34.71 ? 133 TYR B CB    1 
ATOM   3472 C CG    . TYR B 2 91  ? -1.185  -14.741 -20.676 1.00 37.68 ? 133 TYR B CG    1 
ATOM   3473 C CD1   . TYR B 2 91  ? -0.472  -14.142 -21.722 1.00 39.43 ? 133 TYR B CD1   1 
ATOM   3474 C CD2   . TYR B 2 91  ? -0.734  -15.963 -20.192 1.00 37.74 ? 133 TYR B CD2   1 
ATOM   3475 C CE1   . TYR B 2 91  ? 0.644   -14.762 -22.282 1.00 41.20 ? 133 TYR B CE1   1 
ATOM   3476 C CE2   . TYR B 2 91  ? 0.383   -16.586 -20.740 1.00 40.73 ? 133 TYR B CE2   1 
ATOM   3477 C CZ    . TYR B 2 91  ? 1.061   -15.985 -21.782 1.00 39.84 ? 133 TYR B CZ    1 
ATOM   3478 O OH    . TYR B 2 91  ? 2.157   -16.609 -22.318 1.00 39.73 ? 133 TYR B OH    1 
ATOM   3479 N N     . ARG B 2 92  ? -5.704  -14.136 -20.353 1.00 30.81 ? 134 ARG B N     1 
ATOM   3480 C CA    . ARG B 2 92  ? -7.055  -13.814 -19.911 1.00 29.22 ? 134 ARG B CA    1 
ATOM   3481 C C     . ARG B 2 92  ? -7.520  -14.519 -18.649 1.00 27.66 ? 134 ARG B C     1 
ATOM   3482 O O     . ARG B 2 92  ? -8.418  -14.036 -17.953 1.00 29.04 ? 134 ARG B O     1 
ATOM   3483 C CB    . ARG B 2 92  ? -8.023  -14.123 -21.039 1.00 30.06 ? 134 ARG B CB    1 
ATOM   3484 C CG    . ARG B 2 92  ? -8.578  -12.904 -21.699 1.00 34.76 ? 134 ARG B CG    1 
ATOM   3485 C CD    . ARG B 2 92  ? -7.648  -12.293 -22.713 1.00 35.90 ? 134 ARG B CD    1 
ATOM   3486 N NE    . ARG B 2 92  ? -8.397  -11.731 -23.836 1.00 44.45 ? 134 ARG B NE    1 
ATOM   3487 C CZ    . ARG B 2 92  ? -9.662  -11.304 -23.793 1.00 41.66 ? 134 ARG B CZ    1 
ATOM   3488 N NH1   . ARG B 2 92  ? -10.364 -11.319 -22.662 1.00 37.65 ? 134 ARG B NH1   1 
ATOM   3489 N NH2   . ARG B 2 92  ? -10.218 -10.840 -24.899 1.00 43.95 ? 134 ARG B NH2   1 
ATOM   3490 N N     . ALA B 2 93  ? -6.926  -15.674 -18.384 1.00 25.64 ? 135 ALA B N     1 
ATOM   3491 C CA    . ALA B 2 93  ? -7.284  -16.528 -17.262 1.00 25.55 ? 135 ALA B CA    1 
ATOM   3492 C C     . ALA B 2 93  ? -6.217  -17.588 -17.080 1.00 26.34 ? 135 ALA B C     1 
ATOM   3493 O O     . ALA B 2 93  ? -5.571  -18.036 -18.036 1.00 27.16 ? 135 ALA B O     1 
ATOM   3494 C CB    . ALA B 2 93  ? -8.628  -17.185 -17.485 1.00 24.90 ? 135 ALA B CB    1 
ATOM   3495 N N     . THR B 2 94  ? -6.019  -17.976 -15.834 1.00 26.78 ? 136 THR B N     1 
ATOM   3496 C CA    . THR B 2 94  ? -5.123  -19.056 -15.522 1.00 27.75 ? 136 THR B CA    1 
ATOM   3497 C C     . THR B 2 94  ? -5.677  -19.770 -14.297 1.00 28.91 ? 136 THR B C     1 
ATOM   3498 O O     . THR B 2 94  ? -5.979  -19.136 -13.275 1.00 27.75 ? 136 THR B O     1 
ATOM   3499 C CB    . THR B 2 94  ? -3.665  -18.563 -15.320 1.00 28.24 ? 136 THR B CB    1 
ATOM   3500 O OG1   . THR B 2 94  ? -2.823  -19.688 -15.031 1.00 35.78 ? 136 THR B OG1   1 
ATOM   3501 C CG2   . THR B 2 94  ? -3.565  -17.555 -14.191 1.00 22.86 ? 136 THR B CG2   1 
ATOM   3502 N N     . PHE B 2 95  ? -5.837  -21.086 -14.421 1.00 28.97 ? 137 PHE B N     1 
ATOM   3503 C CA    . PHE B 2 95  ? -6.443  -21.890 -13.369 1.00 26.76 ? 137 PHE B CA    1 
ATOM   3504 C C     . PHE B 2 95  ? -6.071  -23.362 -13.499 1.00 27.98 ? 137 PHE B C     1 
ATOM   3505 O O     . PHE B 2 95  ? -5.649  -23.815 -14.567 1.00 27.43 ? 137 PHE B O     1 
ATOM   3506 C CB    . PHE B 2 95  ? -7.968  -21.718 -13.367 1.00 26.34 ? 137 PHE B CB    1 
ATOM   3507 C CG    . PHE B 2 95  ? -8.634  -22.054 -14.675 1.00 24.40 ? 137 PHE B CG    1 
ATOM   3508 C CD1   . PHE B 2 95  ? -8.829  -21.071 -15.651 1.00 25.88 ? 137 PHE B CD1   1 
ATOM   3509 C CD2   . PHE B 2 95  ? -9.105  -23.342 -14.919 1.00 25.41 ? 137 PHE B CD2   1 
ATOM   3510 C CE1   . PHE B 2 95  ? -9.474  -21.367 -16.864 1.00 20.46 ? 137 PHE B CE1   1 
ATOM   3511 C CE2   . PHE B 2 95  ? -9.741  -23.664 -16.128 1.00 20.58 ? 137 PHE B CE2   1 
ATOM   3512 C CZ    . PHE B 2 95  ? -9.933  -22.672 -17.101 1.00 24.29 ? 137 PHE B CZ    1 
ATOM   3513 N N     . ILE B 2 96  ? -6.245  -24.096 -12.401 1.00 28.15 ? 138 ILE B N     1 
ATOM   3514 C CA    . ILE B 2 96  ? -6.078  -25.544 -12.378 1.00 28.38 ? 138 ILE B CA    1 
ATOM   3515 C C     . ILE B 2 96  ? -7.424  -26.242 -12.702 1.00 28.96 ? 138 ILE B C     1 
ATOM   3516 O O     . ILE B 2 96  ? -8.443  -25.956 -12.073 1.00 29.81 ? 138 ILE B O     1 
ATOM   3517 C CB    . ILE B 2 96  ? -5.449  -26.005 -11.016 1.00 28.13 ? 138 ILE B CB    1 
ATOM   3518 C CG1   . ILE B 2 96  ? -4.212  -25.160 -10.659 1.00 25.64 ? 138 ILE B CG1   1 
ATOM   3519 C CG2   . ILE B 2 96  ? -5.079  -27.508 -11.013 1.00 28.43 ? 138 ILE B CG2   1 
ATOM   3520 C CD1   . ILE B 2 96  ? -3.056  -25.173 -11.700 1.00 21.58 ? 138 ILE B CD1   1 
ATOM   3521 N N     . ALA B 2 97  ? -7.426  -27.099 -13.724 1.00 28.38 ? 139 ALA B N     1 
ATOM   3522 C CA    . ALA B 2 97  ? -8.571  -27.970 -14.049 1.00 30.17 ? 139 ALA B CA    1 
ATOM   3523 C C     . ALA B 2 97  ? -8.037  -29.371 -13.797 1.00 31.26 ? 139 ALA B C     1 
ATOM   3524 O O     . ALA B 2 97  ? -7.184  -29.878 -14.544 1.00 30.13 ? 139 ALA B O     1 
ATOM   3525 C CB    . ALA B 2 97  ? -9.010  -27.790 -15.493 1.00 28.91 ? 139 ALA B CB    1 
ATOM   3526 N N     . ASP B 2 98  ? -8.508  -29.983 -12.718 1.00 32.71 ? 140 ASP B N     1 
ATOM   3527 C CA    . ASP B 2 98  ? -7.530  -30.648 -11.858 1.00 34.05 ? 140 ASP B CA    1 
ATOM   3528 C C     . ASP B 2 98  ? -6.529  -31.600 -12.457 1.00 32.91 ? 140 ASP B C     1 
ATOM   3529 O O     . ASP B 2 98  ? -6.848  -32.413 -13.335 1.00 34.20 ? 140 ASP B O     1 
ATOM   3530 C CB    . ASP B 2 98  ? -8.056  -31.053 -10.484 1.00 36.59 ? 140 ASP B CB    1 
ATOM   3531 C CG    . ASP B 2 98  ? -7.588  -30.089 -9.411  1.00 39.86 ? 140 ASP B CG    1 
ATOM   3532 O OD1   . ASP B 2 98  ? -6.373  -29.837 -9.346  1.00 44.55 ? 140 ASP B OD1   1 
ATOM   3533 O OD2   . ASP B 2 98  ? -8.420  -29.540 -8.672  1.00 51.39 ? 140 ASP B OD2   1 
ATOM   3534 N N     . ASN B 2 99  ? -5.296  -31.413 -11.991 1.00 29.84 ? 141 ASN B N     1 
ATOM   3535 C CA    . ASN B 2 99  ? -4.100  -32.080 -12.516 1.00 28.15 ? 141 ASN B CA    1 
ATOM   3536 C C     . ASN B 2 99  ? -3.464  -31.347 -13.729 1.00 27.29 ? 141 ASN B C     1 
ATOM   3537 O O     . ASN B 2 99  ? -2.265  -31.489 -13.985 1.00 28.14 ? 141 ASN B O     1 
ATOM   3538 C CB    . ASN B 2 99  ? -4.325  -33.614 -12.597 1.00 27.32 ? 141 ASN B CB    1 
ATOM   3539 C CG    . ASN B 2 99  ? -3.807  -34.261 -13.860 1.00 29.05 ? 141 ASN B CG    1 
ATOM   3540 O OD1   . ASN B 2 99  ? -3.007  -35.197 -13.782 1.00 33.23 ? 141 ASN B OD1   1 
ATOM   3541 N ND2   . ASN B 2 99  ? -4.316  -33.842 -15.021 1.00 23.32 ? 141 ASN B ND2   1 
ATOM   3542 N N     . GLU B 2 100 ? -4.250  -30.502 -14.403 1.00 25.56 ? 142 GLU B N     1 
ATOM   3543 C CA    . GLU B 2 100 ? -3.759  -29.657 -15.497 1.00 25.43 ? 142 GLU B CA    1 
ATOM   3544 C C     . GLU B 2 100 ? -3.746  -28.151 -15.187 1.00 25.58 ? 142 GLU B C     1 
ATOM   3545 O O     . GLU B 2 100 ? -4.688  -27.603 -14.605 1.00 24.92 ? 142 GLU B O     1 
ATOM   3546 C CB    . GLU B 2 100 ? -4.592  -29.870 -16.765 1.00 25.54 ? 142 GLU B CB    1 
ATOM   3547 C CG    . GLU B 2 100 ? -4.488  -31.270 -17.369 1.00 28.20 ? 142 GLU B CG    1 
ATOM   3548 C CD    . GLU B 2 100 ? -5.117  -31.367 -18.749 1.00 28.08 ? 142 GLU B CD    1 
ATOM   3549 O OE1   . GLU B 2 100 ? -6.053  -30.607 -19.046 1.00 35.36 ? 142 GLU B OE1   1 
ATOM   3550 O OE2   . GLU B 2 100 ? -4.683  -32.219 -19.543 1.00 38.38 ? 142 GLU B OE2   1 
ATOM   3551 N N     . LEU B 2 101 ? -2.667  -27.487 -15.597 1.00 25.08 ? 143 LEU B N     1 
ATOM   3552 C CA    . LEU B 2 101 ? -2.638  -26.032 -15.683 1.00 23.60 ? 143 LEU B CA    1 
ATOM   3553 C C     . LEU B 2 101 ? -3.338  -25.587 -16.962 1.00 23.05 ? 143 LEU B C     1 
ATOM   3554 O O     . LEU B 2 101 ? -2.969  -26.011 -18.057 1.00 21.66 ? 143 LEU B O     1 
ATOM   3555 C CB    . LEU B 2 101 ? -1.187  -25.513 -15.647 1.00 23.87 ? 143 LEU B CB    1 
ATOM   3556 C CG    . LEU B 2 101 ? -0.962  -23.998 -15.831 1.00 24.77 ? 143 LEU B CG    1 
ATOM   3557 C CD1   . LEU B 2 101 ? -1.704  -23.144 -14.797 1.00 22.99 ? 143 LEU B CD1   1 
ATOM   3558 C CD2   . LEU B 2 101 ? 0.497   -23.687 -15.814 1.00 21.05 ? 143 LEU B CD2   1 
ATOM   3559 N N     . TRP B 2 102 ? -4.368  -24.751 -16.824 1.00 25.24 ? 144 TRP B N     1 
ATOM   3560 C CA    . TRP B 2 102 ? -5.039  -24.158 -17.993 1.00 23.74 ? 144 TRP B CA    1 
ATOM   3561 C C     . TRP B 2 102 ? -4.717  -22.696 -18.071 1.00 23.86 ? 144 TRP B C     1 
ATOM   3562 O O     . TRP B 2 102 ? -4.834  -21.972 -17.086 1.00 22.12 ? 144 TRP B O     1 
ATOM   3563 C CB    . TRP B 2 102 ? -6.552  -24.325 -17.938 1.00 24.24 ? 144 TRP B CB    1 
ATOM   3564 C CG    . TRP B 2 102 ? -7.033  -25.694 -18.307 1.00 26.42 ? 144 TRP B CG    1 
ATOM   3565 C CD1   . TRP B 2 102 ? -6.366  -26.873 -18.138 1.00 23.53 ? 144 TRP B CD1   1 
ATOM   3566 C CD2   . TRP B 2 102 ? -8.313  -26.034 -18.870 1.00 25.28 ? 144 TRP B CD2   1 
ATOM   3567 N NE1   . TRP B 2 102 ? -7.141  -27.922 -18.575 1.00 23.52 ? 144 TRP B NE1   1 
ATOM   3568 C CE2   . TRP B 2 102 ? -8.343  -27.441 -19.020 1.00 22.23 ? 144 TRP B CE2   1 
ATOM   3569 C CE3   . TRP B 2 102 ? -9.418  -25.284 -19.291 1.00 25.43 ? 144 TRP B CE3   1 
ATOM   3570 C CZ2   . TRP B 2 102 ? -9.441  -28.122 -19.567 1.00 21.21 ? 144 TRP B CZ2   1 
ATOM   3571 C CZ3   . TRP B 2 102 ? -10.525 -25.969 -19.829 1.00 26.64 ? 144 TRP B CZ3   1 
ATOM   3572 C CH2   . TRP B 2 102 ? -10.519 -27.374 -19.961 1.00 23.55 ? 144 TRP B CH2   1 
ATOM   3573 N N     . VAL B 2 103 ? -4.283  -22.273 -19.254 1.00 26.51 ? 145 VAL B N     1 
ATOM   3574 C CA    . VAL B 2 103 ? -3.951  -20.880 -19.505 1.00 26.01 ? 145 VAL B CA    1 
ATOM   3575 C C     . VAL B 2 103 ? -4.704  -20.471 -20.739 1.00 26.00 ? 145 VAL B C     1 
ATOM   3576 O O     . VAL B 2 103 ? -4.587  -21.092 -21.796 1.00 25.14 ? 145 VAL B O     1 
ATOM   3577 C CB    . VAL B 2 103 ? -2.432  -20.651 -19.673 1.00 27.38 ? 145 VAL B CB    1 
ATOM   3578 C CG1   . VAL B 2 103 ? -2.148  -19.194 -20.016 1.00 27.26 ? 145 VAL B CG1   1 
ATOM   3579 C CG2   . VAL B 2 103 ? -1.697  -21.042 -18.409 1.00 25.92 ? 145 VAL B CG2   1 
ATOM   3580 N N     . VAL B 2 104 ? -5.514  -19.431 -20.574 1.00 26.87 ? 146 VAL B N     1 
ATOM   3581 C CA    . VAL B 2 104 ? -6.405  -18.969 -21.617 1.00 24.16 ? 146 VAL B CA    1 
ATOM   3582 C C     . VAL B 2 104 ? -5.869  -17.648 -22.142 1.00 25.20 ? 146 VAL B C     1 
ATOM   3583 O O     . VAL B 2 104 ? -5.598  -16.723 -21.363 1.00 22.56 ? 146 VAL B O     1 
ATOM   3584 C CB    . VAL B 2 104 ? -7.819  -18.768 -21.067 1.00 24.31 ? 146 VAL B CB    1 
ATOM   3585 C CG1   . VAL B 2 104 ? -8.759  -18.282 -22.160 1.00 22.44 ? 146 VAL B CG1   1 
ATOM   3586 C CG2   . VAL B 2 104 ? -8.328  -20.062 -20.438 1.00 24.79 ? 146 VAL B CG2   1 
ATOM   3587 N N     . THR B 2 105 ? -5.710  -17.577 -23.461 1.00 25.38 ? 147 THR B N     1 
ATOM   3588 C CA    . THR B 2 105 ? -5.326  -16.342 -24.141 1.00 28.55 ? 147 THR B CA    1 
ATOM   3589 C C     . THR B 2 105 ? -6.327  -16.075 -25.271 1.00 30.24 ? 147 THR B C     1 
ATOM   3590 O O     . THR B 2 105 ? -7.120  -16.951 -25.620 1.00 32.50 ? 147 THR B O     1 
ATOM   3591 C CB    . THR B 2 105 ? -3.888  -16.413 -24.715 1.00 28.57 ? 147 THR B CB    1 
ATOM   3592 O OG1   . THR B 2 105 ? -3.810  -17.472 -25.673 1.00 34.11 ? 147 THR B OG1   1 
ATOM   3593 C CG2   . THR B 2 105 ? -2.867  -16.683 -23.613 1.00 28.17 ? 147 THR B CG2   1 
ATOM   3594 N N     . SER B 2 106 ? -6.319  -14.858 -25.817 1.00 31.35 ? 148 SER B N     1 
ATOM   3595 C CA    . SER B 2 106 ? -7.140  -14.556 -26.988 1.00 31.40 ? 148 SER B CA    1 
ATOM   3596 C C     . SER B 2 106 ? -6.676  -15.361 -28.219 1.00 29.97 ? 148 SER B C     1 
ATOM   3597 O O     . SER B 2 106 ? -5.491  -15.669 -28.367 1.00 28.95 ? 148 SER B O     1 
ATOM   3598 C CB    . SER B 2 106 ? -7.160  -13.057 -27.273 1.00 32.01 ? 148 SER B CB    1 
ATOM   3599 O OG    . SER B 2 106 ? -8.367  -12.726 -27.943 1.00 36.63 ? 148 SER B OG    1 
ATOM   3600 N N     . PHE B 2 107 ? -7.629  -15.727 -29.069 1.00 28.20 ? 149 PHE B N     1 
ATOM   3601 C CA    . PHE B 2 107 ? -7.367  -16.566 -30.233 1.00 27.36 ? 149 PHE B CA    1 
ATOM   3602 C C     . PHE B 2 107 ? -6.967  -15.713 -31.429 1.00 27.40 ? 149 PHE B C     1 
ATOM   3603 O O     . PHE B 2 107 ? -7.689  -14.783 -31.800 1.00 26.58 ? 149 PHE B O     1 
ATOM   3604 C CB    . PHE B 2 107 ? -8.606  -17.414 -30.554 1.00 28.03 ? 149 PHE B CB    1 
ATOM   3605 C CG    . PHE B 2 107 ? -8.529  -18.158 -31.866 1.00 27.48 ? 149 PHE B CG    1 
ATOM   3606 C CD1   . PHE B 2 107 ? -7.597  -19.179 -32.055 1.00 24.63 ? 149 PHE B CD1   1 
ATOM   3607 C CD2   . PHE B 2 107 ? -9.413  -17.850 -32.905 1.00 26.32 ? 149 PHE B CD2   1 
ATOM   3608 C CE1   . PHE B 2 107 ? -7.519  -19.875 -33.274 1.00 24.26 ? 149 PHE B CE1   1 
ATOM   3609 C CE2   . PHE B 2 107 ? -9.358  -18.540 -34.131 1.00 28.17 ? 149 PHE B CE2   1 
ATOM   3610 C CZ    . PHE B 2 107 ? -8.408  -19.557 -34.317 1.00 27.70 ? 149 PHE B CZ    1 
ATOM   3611 N N     . MET B 2 108 ? -5.809  -16.023 -32.015 1.00 26.89 ? 150 MET B N     1 
ATOM   3612 C CA    . MET B 2 108 ? -5.307  -15.292 -33.187 1.00 25.64 ? 150 MET B CA    1 
ATOM   3613 C C     . MET B 2 108 ? -5.578  -16.120 -34.436 1.00 23.44 ? 150 MET B C     1 
ATOM   3614 O O     . MET B 2 108 ? -4.904  -17.116 -34.684 1.00 24.01 ? 150 MET B O     1 
ATOM   3615 C CB    . MET B 2 108 ? -3.815  -14.960 -33.044 1.00 25.58 ? 150 MET B CB    1 
ATOM   3616 C CG    . MET B 2 108 ? -3.423  -14.429 -31.658 1.00 27.99 ? 150 MET B CG    1 
ATOM   3617 S SD    . MET B 2 108 ? -4.269  -12.899 -31.256 1.00 36.71 ? 150 MET B SD    1 
ATOM   3618 C CE    . MET B 2 108 ? -3.890  -12.725 -29.515 1.00 32.90 ? 150 MET B CE    1 
ATOM   3619 N N     . ALA B 2 109 ? -6.553  -15.663 -35.215 1.00 22.33 ? 151 ALA B N     1 
ATOM   3620 C CA    . ALA B 2 109 ? -7.195  -16.436 -36.295 1.00 23.07 ? 151 ALA B CA    1 
ATOM   3621 C C     . ALA B 2 109 ? -6.327  -16.782 -37.522 1.00 23.65 ? 151 ALA B C     1 
ATOM   3622 O O     . ALA B 2 109 ? -6.670  -17.684 -38.290 1.00 24.39 ? 151 ALA B O     1 
ATOM   3623 C CB    . ALA B 2 109 ? -8.541  -15.764 -36.727 1.00 19.48 ? 151 ALA B CB    1 
ATOM   3624 N N     . TYR B 2 110 ? -5.214  -16.078 -37.709 1.00 25.28 ? 152 TYR B N     1 
ATOM   3625 C CA    . TYR B 2 110 ? -4.254  -16.468 -38.738 1.00 26.05 ? 152 TYR B CA    1 
ATOM   3626 C C     . TYR B 2 110 ? -3.132  -17.318 -38.181 1.00 28.13 ? 152 TYR B C     1 
ATOM   3627 O O     . TYR B 2 110 ? -2.165  -17.604 -38.897 1.00 28.97 ? 152 TYR B O     1 
ATOM   3628 C CB    . TYR B 2 110 ? -3.641  -15.251 -39.423 1.00 26.60 ? 152 TYR B CB    1 
ATOM   3629 C CG    . TYR B 2 110 ? -4.504  -14.611 -40.482 1.00 25.16 ? 152 TYR B CG    1 
ATOM   3630 C CD1   . TYR B 2 110 ? -5.221  -13.450 -40.206 1.00 21.74 ? 152 TYR B CD1   1 
ATOM   3631 C CD2   . TYR B 2 110 ? -4.576  -15.145 -41.768 1.00 23.55 ? 152 TYR B CD2   1 
ATOM   3632 C CE1   . TYR B 2 110 ? -5.998  -12.838 -41.176 1.00 25.09 ? 152 TYR B CE1   1 
ATOM   3633 C CE2   . TYR B 2 110 ? -5.357  -14.530 -42.758 1.00 25.20 ? 152 TYR B CE2   1 
ATOM   3634 C CZ    . TYR B 2 110 ? -6.063  -13.379 -42.449 1.00 24.75 ? 152 TYR B CZ    1 
ATOM   3635 O OH    . TYR B 2 110 ? -6.846  -12.767 -43.400 1.00 27.87 ? 152 TYR B OH    1 
ATOM   3636 N N     . GLY B 2 111 ? -3.244  -17.707 -36.907 1.00 28.50 ? 153 GLY B N     1 
ATOM   3637 C CA    . GLY B 2 111 ? -2.211  -18.514 -36.261 1.00 26.62 ? 153 GLY B CA    1 
ATOM   3638 C C     . GLY B 2 111 ? -0.881  -17.798 -36.215 1.00 26.95 ? 153 GLY B C     1 
ATOM   3639 O O     . GLY B 2 111 ? -0.838  -16.553 -36.212 1.00 27.40 ? 153 GLY B O     1 
ATOM   3640 N N     . SER B 2 112 ? 0.203   -18.577 -36.181 1.00 26.28 ? 154 SER B N     1 
ATOM   3641 C CA    . SER B 2 112 ? 1.562   -18.025 -36.168 1.00 27.11 ? 154 SER B CA    1 
ATOM   3642 C C     . SER B 2 112 ? 2.148   -17.833 -37.586 1.00 26.83 ? 154 SER B C     1 
ATOM   3643 O O     . SER B 2 112 ? 1.663   -18.426 -38.548 1.00 27.28 ? 154 SER B O     1 
ATOM   3644 C CB    . SER B 2 112 ? 2.492   -18.884 -35.295 1.00 25.03 ? 154 SER B CB    1 
ATOM   3645 O OG    . SER B 2 112 ? 3.071   -19.941 -36.042 1.00 32.31 ? 154 SER B OG    1 
ATOM   3646 N N     . ALA B 2 113 ? 3.184   -17.000 -37.695 1.00 25.87 ? 155 ALA B N     1 
ATOM   3647 C CA    . ALA B 2 113 ? 3.954   -16.834 -38.934 1.00 26.48 ? 155 ALA B CA    1 
ATOM   3648 C C     . ALA B 2 113 ? 4.483   -18.163 -39.502 1.00 26.65 ? 155 ALA B C     1 
ATOM   3649 O O     . ALA B 2 113 ? 4.561   -18.330 -40.717 1.00 26.22 ? 155 ALA B O     1 
ATOM   3650 C CB    . ALA B 2 113 ? 5.106   -15.842 -38.723 1.00 25.60 ? 155 ALA B CB    1 
ATOM   3651 N N     . LYS B 2 114 ? 4.831   -19.101 -38.620 1.00 27.26 ? 156 LYS B N     1 
ATOM   3652 C CA    . LYS B 2 114 ? 5.242   -20.447 -39.018 1.00 27.09 ? 156 LYS B CA    1 
ATOM   3653 C C     . LYS B 2 114 ? 4.057   -21.247 -39.592 1.00 26.56 ? 156 LYS B C     1 
ATOM   3654 O O     . LYS B 2 114 ? 4.191   -21.880 -40.631 1.00 25.93 ? 156 LYS B O     1 
ATOM   3655 C CB    . LYS B 2 114 ? 5.898   -21.172 -37.834 1.00 28.57 ? 156 LYS B CB    1 
ATOM   3656 C CG    . LYS B 2 114 ? 6.599   -22.484 -38.162 1.00 29.54 ? 156 LYS B CG    1 
ATOM   3657 C CD    . LYS B 2 114 ? 7.772   -22.262 -39.120 1.00 39.16 ? 156 LYS B CD    1 
ATOM   3658 C CE    . LYS B 2 114 ? 8.849   -23.347 -38.971 1.00 41.04 ? 156 LYS B CE    1 
ATOM   3659 N NZ    . LYS B 2 114 ? 10.147  -22.960 -39.609 1.00 38.12 ? 156 LYS B NZ    1 
ATOM   3660 N N     . ASP B 2 115 ? 2.897   -21.189 -38.933 1.00 26.89 ? 157 ASP B N     1 
ATOM   3661 C CA    . ASP B 2 115 ? 1.657   -21.781 -39.465 1.00 25.51 ? 157 ASP B CA    1 
ATOM   3662 C C     . ASP B 2 115 ? 1.384   -21.333 -40.892 1.00 26.30 ? 157 ASP B C     1 
ATOM   3663 O O     . ASP B 2 115 ? 1.068   -22.158 -41.770 1.00 24.99 ? 157 ASP B O     1 
ATOM   3664 C CB    . ASP B 2 115 ? 0.455   -21.413 -38.591 1.00 25.63 ? 157 ASP B CB    1 
ATOM   3665 C CG    . ASP B 2 115 ? 0.558   -21.982 -37.177 1.00 31.80 ? 157 ASP B CG    1 
ATOM   3666 O OD1   . ASP B 2 115 ? 1.115   -23.091 -37.018 1.00 32.37 ? 157 ASP B OD1   1 
ATOM   3667 O OD2   . ASP B 2 115 ? 0.080   -21.322 -36.223 1.00 37.31 ? 157 ASP B OD2   1 
ATOM   3668 N N     . LEU B 2 116 ? 1.520   -20.020 -41.110 1.00 26.23 ? 158 LEU B N     1 
ATOM   3669 C CA    . LEU B 2 116 ? 1.275   -19.391 -42.411 1.00 25.46 ? 158 LEU B CA    1 
ATOM   3670 C C     . LEU B 2 116 ? 2.248   -19.893 -43.469 1.00 24.80 ? 158 LEU B C     1 
ATOM   3671 O O     . LEU B 2 116 ? 1.854   -20.213 -44.583 1.00 24.55 ? 158 LEU B O     1 
ATOM   3672 C CB    . LEU B 2 116 ? 1.352   -17.863 -42.279 1.00 24.94 ? 158 LEU B CB    1 
ATOM   3673 C CG    . LEU B 2 116 ? 0.127   -17.247 -41.598 1.00 25.29 ? 158 LEU B CG    1 
ATOM   3674 C CD1   . LEU B 2 116 ? 0.432   -15.869 -41.017 1.00 23.76 ? 158 LEU B CD1   1 
ATOM   3675 C CD2   . LEU B 2 116 ? -1.046  -17.195 -42.559 1.00 26.18 ? 158 LEU B CD2   1 
ATOM   3676 N N     . ILE B 2 117 ? 3.519   -19.963 -43.098 1.00 24.96 ? 159 ILE B N     1 
ATOM   3677 C CA    . ILE B 2 117 ? 4.552   -20.549 -43.939 1.00 25.10 ? 159 ILE B CA    1 
ATOM   3678 C C     . ILE B 2 117 ? 4.181   -21.986 -44.350 1.00 26.04 ? 159 ILE B C     1 
ATOM   3679 O O     . ILE B 2 117 ? 4.219   -22.330 -45.527 1.00 26.80 ? 159 ILE B O     1 
ATOM   3680 C CB    . ILE B 2 117 ? 5.941   -20.499 -43.220 1.00 24.75 ? 159 ILE B CB    1 
ATOM   3681 C CG1   . ILE B 2 117 ? 6.497   -19.065 -43.244 1.00 22.89 ? 159 ILE B CG1   1 
ATOM   3682 C CG2   . ILE B 2 117 ? 6.909   -21.491 -43.841 1.00 24.31 ? 159 ILE B CG2   1 
ATOM   3683 C CD1   . ILE B 2 117 ? 7.751   -18.838 -42.391 1.00 22.19 ? 159 ILE B CD1   1 
ATOM   3684 N N     . CYS B 2 118 ? 3.793   -22.801 -43.377 1.00 26.48 ? 160 CYS B N     1 
ATOM   3685 C CA    . CYS B 2 118 ? 3.464   -24.201 -43.620 1.00 28.77 ? 160 CYS B CA    1 
ATOM   3686 C C     . CYS B 2 118 ? 2.185   -24.425 -44.438 1.00 28.91 ? 160 CYS B C     1 
ATOM   3687 O O     . CYS B 2 118 ? 2.083   -25.405 -45.165 1.00 29.27 ? 160 CYS B O     1 
ATOM   3688 C CB    . CYS B 2 118 ? 3.362   -24.949 -42.288 1.00 29.20 ? 160 CYS B CB    1 
ATOM   3689 S SG    . CYS B 2 118 ? 4.944   -25.070 -41.447 1.00 33.97 ? 160 CYS B SG    1 
ATOM   3690 N N     . THR B 2 119 ? 1.203   -23.541 -44.306 1.00 28.99 ? 161 THR B N     1 
ATOM   3691 C CA    . THR B 2 119 ? -0.064  -23.763 -44.992 1.00 28.82 ? 161 THR B CA    1 
ATOM   3692 C C     . THR B 2 119 ? -0.042  -23.269 -46.436 1.00 27.93 ? 161 THR B C     1 
ATOM   3693 O O     . THR B 2 119 ? -0.826  -23.733 -47.254 1.00 26.78 ? 161 THR B O     1 
ATOM   3694 C CB    . THR B 2 119 ? -1.283  -23.161 -44.233 1.00 29.60 ? 161 THR B CB    1 
ATOM   3695 O OG1   . THR B 2 119 ? -2.504  -23.732 -44.754 1.00 30.08 ? 161 THR B OG1   1 
ATOM   3696 C CG2   . THR B 2 119 ? -1.317  -21.616 -44.357 1.00 26.09 ? 161 THR B CG2   1 
ATOM   3697 N N     . HIS B 2 120 ? 0.862   -22.338 -46.735 1.00 27.31 ? 162 HIS B N     1 
ATOM   3698 C CA    . HIS B 2 120 ? 0.879   -21.675 -48.020 1.00 26.18 ? 162 HIS B CA    1 
ATOM   3699 C C     . HIS B 2 120 ? 2.235   -21.083 -48.427 1.00 27.02 ? 162 HIS B C     1 
ATOM   3700 O O     . HIS B 2 120 ? 2.749   -21.378 -49.507 1.00 28.27 ? 162 HIS B O     1 
ATOM   3701 C CB    . HIS B 2 120 ? -0.194  -20.584 -48.060 1.00 26.57 ? 162 HIS B CB    1 
ATOM   3702 C CG    . HIS B 2 120 ? -0.434  -20.048 -49.432 1.00 27.57 ? 162 HIS B CG    1 
ATOM   3703 N ND1   . HIS B 2 120 ? 0.305   -19.014 -49.963 1.00 28.96 ? 162 HIS B ND1   1 
ATOM   3704 C CD2   . HIS B 2 120 ? -1.295  -20.436 -50.401 1.00 29.75 ? 162 HIS B CD2   1 
ATOM   3705 C CE1   . HIS B 2 120 ? -0.102  -18.773 -51.197 1.00 31.83 ? 162 HIS B CE1   1 
ATOM   3706 N NE2   . HIS B 2 120 ? -1.076  -19.619 -51.485 1.00 34.25 ? 162 HIS B NE2   1 
ATOM   3707 N N     . PHE B 2 121 ? 2.798   -20.233 -47.579 1.00 26.51 ? 163 PHE B N     1 
ATOM   3708 C CA    . PHE B 2 121 ? 4.010   -19.483 -47.911 1.00 27.04 ? 163 PHE B CA    1 
ATOM   3709 C C     . PHE B 2 121 ? 5.261   -20.306 -47.626 1.00 26.74 ? 163 PHE B C     1 
ATOM   3710 O O     . PHE B 2 121 ? 6.206   -19.813 -46.998 1.00 26.03 ? 163 PHE B O     1 
ATOM   3711 C CB    . PHE B 2 121 ? 4.045   -18.145 -47.138 1.00 26.09 ? 163 PHE B CB    1 
ATOM   3712 C CG    . PHE B 2 121 ? 2.916   -17.197 -47.499 1.00 29.27 ? 163 PHE B CG    1 
ATOM   3713 C CD1   . PHE B 2 121 ? 1.764   -17.118 -46.703 1.00 30.71 ? 163 PHE B CD1   1 
ATOM   3714 C CD2   . PHE B 2 121 ? 2.997   -16.386 -48.645 1.00 30.55 ? 163 PHE B CD2   1 
ATOM   3715 C CE1   . PHE B 2 121 ? 0.712   -16.241 -47.040 1.00 28.53 ? 163 PHE B CE1   1 
ATOM   3716 C CE2   . PHE B 2 121 ? 1.947   -15.512 -48.992 1.00 27.82 ? 163 PHE B CE2   1 
ATOM   3717 C CZ    . PHE B 2 121 ? 0.808   -15.440 -48.188 1.00 27.29 ? 163 PHE B CZ    1 
ATOM   3718 N N     . MET B 2 122 ? 5.253   -21.557 -48.102 1.00 27.11 ? 164 MET B N     1 
ATOM   3719 C CA    . MET B 2 122 ? 6.305   -22.559 -47.826 1.00 26.69 ? 164 MET B CA    1 
ATOM   3720 C C     . MET B 2 122 ? 7.695   -22.126 -48.287 1.00 26.12 ? 164 MET B C     1 
ATOM   3721 O O     . MET B 2 122 ? 8.714   -22.534 -47.717 1.00 26.18 ? 164 MET B O     1 
ATOM   3722 C CB    . MET B 2 122 ? 5.932   -23.909 -48.460 1.00 27.01 ? 164 MET B CB    1 
ATOM   3723 C CG    . MET B 2 122 ? 4.891   -24.682 -47.667 1.00 28.70 ? 164 MET B CG    1 
ATOM   3724 S SD    . MET B 2 122 ? 4.220   -26.193 -48.406 1.00 27.92 ? 164 MET B SD    1 
ATOM   3725 C CE    . MET B 2 122 ? 3.945   -27.135 -46.897 1.00 33.10 ? 164 MET B CE    1 
ATOM   3726 N N     . ASP B 2 123 ? 7.707   -21.283 -49.310 1.00 25.30 ? 165 ASP B N     1 
ATOM   3727 C CA    . ASP B 2 123 ? 8.910   -20.759 -49.918 1.00 26.31 ? 165 ASP B CA    1 
ATOM   3728 C C     . ASP B 2 123 ? 9.303   -19.418 -49.295 1.00 26.46 ? 165 ASP B C     1 
ATOM   3729 O O     . ASP B 2 123 ? 10.228  -18.763 -49.773 1.00 26.50 ? 165 ASP B O     1 
ATOM   3730 C CB    . ASP B 2 123 ? 8.665   -20.581 -51.425 1.00 27.07 ? 165 ASP B CB    1 
ATOM   3731 C CG    . ASP B 2 123 ? 9.942   -20.638 -52.237 1.00 33.09 ? 165 ASP B CG    1 
ATOM   3732 O OD1   . ASP B 2 123 ? 11.039  -20.642 -51.638 1.00 38.34 ? 165 ASP B OD1   1 
ATOM   3733 O OD2   . ASP B 2 123 ? 9.855   -20.682 -53.485 1.00 41.12 ? 165 ASP B OD2   1 
ATOM   3734 N N     . GLY B 2 124 ? 8.605   -19.012 -48.232 1.00 26.32 ? 166 GLY B N     1 
ATOM   3735 C CA    . GLY B 2 124 ? 8.847   -17.720 -47.593 1.00 27.05 ? 166 GLY B CA    1 
ATOM   3736 C C     . GLY B 2 124 ? 7.819   -16.656 -47.942 1.00 28.05 ? 166 GLY B C     1 
ATOM   3737 O O     . GLY B 2 124 ? 7.115   -16.757 -48.939 1.00 28.55 ? 166 GLY B O     1 
ATOM   3738 N N     . MET B 2 125 ? 7.728   -15.627 -47.110 1.00 30.91 ? 167 MET B N     1 
ATOM   3739 C CA    . MET B 2 125 ? 6.723   -14.579 -47.285 1.00 31.58 ? 167 MET B CA    1 
ATOM   3740 C C     . MET B 2 125 ? 7.254   -13.425 -48.117 1.00 31.22 ? 167 MET B C     1 
ATOM   3741 O O     . MET B 2 125 ? 8.470   -13.252 -48.236 1.00 31.60 ? 167 MET B O     1 
ATOM   3742 C CB    . MET B 2 125 ? 6.250   -14.075 -45.929 1.00 31.76 ? 167 MET B CB    1 
ATOM   3743 C CG    . MET B 2 125 ? 5.474   -15.092 -45.140 1.00 31.02 ? 167 MET B CG    1 
ATOM   3744 S SD    . MET B 2 125 ? 5.014   -14.409 -43.551 1.00 35.34 ? 167 MET B SD    1 
ATOM   3745 C CE    . MET B 2 125 ? 4.468   -15.874 -42.710 1.00 37.87 ? 167 MET B CE    1 
ATOM   3746 N N     . ASN B 2 126 ? 6.341   -12.653 -48.708 1.00 31.33 ? 168 ASN B N     1 
ATOM   3747 C CA    . ASN B 2 126 ? 6.719   -11.422 -49.409 1.00 33.00 ? 168 ASN B CA    1 
ATOM   3748 C C     . ASN B 2 126 ? 7.354   -10.408 -48.450 1.00 32.22 ? 168 ASN B C     1 
ATOM   3749 O O     . ASN B 2 126 ? 7.099   -10.438 -47.245 1.00 32.47 ? 168 ASN B O     1 
ATOM   3750 C CB    . ASN B 2 126 ? 5.550   -10.809 -50.223 1.00 34.14 ? 168 ASN B CB    1 
ATOM   3751 C CG    . ASN B 2 126 ? 4.162   -11.150 -49.654 1.00 35.80 ? 168 ASN B CG    1 
ATOM   3752 O OD1   . ASN B 2 126 ? 3.952   -11.157 -48.442 1.00 39.86 ? 168 ASN B OD1   1 
ATOM   3753 N ND2   . ASN B 2 126 ? 3.209   -11.425 -50.545 1.00 35.67 ? 168 ASN B ND2   1 
ATOM   3754 N N     . GLU B 2 127 ? 8.195   -9.532  -48.984 1.00 32.01 ? 169 GLU B N     1 
ATOM   3755 C CA    . GLU B 2 127 ? 9.013   -8.659  -48.150 1.00 32.30 ? 169 GLU B CA    1 
ATOM   3756 C C     . GLU B 2 127 ? 8.220   -7.606  -47.356 1.00 31.98 ? 169 GLU B C     1 
ATOM   3757 O O     . GLU B 2 127 ? 8.563   -7.321  -46.201 1.00 32.24 ? 169 GLU B O     1 
ATOM   3758 C CB    . GLU B 2 127 ? 10.108  -7.998  -48.984 1.00 32.80 ? 169 GLU B CB    1 
ATOM   3759 C CG    . GLU B 2 127 ? 11.211  -7.371  -48.146 1.00 35.01 ? 169 GLU B CG    1 
ATOM   3760 C CD    . GLU B 2 127 ? 12.136  -6.502  -48.964 1.00 33.86 ? 169 GLU B CD    1 
ATOM   3761 O OE1   . GLU B 2 127 ? 12.317  -5.325  -48.589 1.00 34.08 ? 169 GLU B OE1   1 
ATOM   3762 O OE2   . GLU B 2 127 ? 12.675  -6.994  -49.978 1.00 34.40 ? 169 GLU B OE2   1 
ATOM   3763 N N     . LEU B 2 128 ? 7.171   -7.047  -47.968 1.00 30.71 ? 170 LEU B N     1 
ATOM   3764 C CA    . LEU B 2 128 ? 6.319   -6.052  -47.311 1.00 30.00 ? 170 LEU B CA    1 
ATOM   3765 C C     . LEU B 2 128 ? 5.685   -6.652  -46.059 1.00 29.44 ? 170 LEU B C     1 
ATOM   3766 O O     . LEU B 2 128 ? 5.639   -6.000  -45.011 1.00 30.67 ? 170 LEU B O     1 
ATOM   3767 C CB    . LEU B 2 128 ? 5.224   -5.527  -48.257 1.00 29.71 ? 170 LEU B CB    1 
ATOM   3768 C CG    . LEU B 2 128 ? 4.868   -4.027  -48.289 1.00 30.35 ? 170 LEU B CG    1 
ATOM   3769 C CD1   . LEU B 2 128 ? 3.540   -3.766  -49.017 1.00 30.05 ? 170 LEU B CD1   1 
ATOM   3770 C CD2   . LEU B 2 128 ? 4.840   -3.382  -46.914 1.00 29.69 ? 170 LEU B CD2   1 
ATOM   3771 N N     . ALA B 2 129 ? 5.208   -7.891  -46.180 1.00 27.48 ? 171 ALA B N     1 
ATOM   3772 C CA    . ALA B 2 129 ? 4.633   -8.641  -45.060 1.00 26.88 ? 171 ALA B CA    1 
ATOM   3773 C C     . ALA B 2 129 ? 5.609   -8.764  -43.896 1.00 25.54 ? 171 ALA B C     1 
ATOM   3774 O O     . ALA B 2 129 ? 5.234   -8.548  -42.744 1.00 25.06 ? 171 ALA B O     1 
ATOM   3775 C CB    . ALA B 2 129 ? 4.175   -10.029 -45.522 1.00 26.70 ? 171 ALA B CB    1 
ATOM   3776 N N     . ILE B 2 130 ? 6.859   -9.102  -44.218 1.00 24.94 ? 172 ILE B N     1 
ATOM   3777 C CA    . ILE B 2 130 ? 7.939   -9.259  -43.231 1.00 24.00 ? 172 ILE B CA    1 
ATOM   3778 C C     . ILE B 2 130 ? 8.228   -7.953  -42.475 1.00 24.35 ? 172 ILE B C     1 
ATOM   3779 O O     . ILE B 2 130 ? 8.492   -7.970  -41.278 1.00 25.41 ? 172 ILE B O     1 
ATOM   3780 C CB    . ILE B 2 130 ? 9.230   -9.823  -43.907 1.00 24.18 ? 172 ILE B CB    1 
ATOM   3781 C CG1   . ILE B 2 130 ? 8.959   -11.234 -44.460 1.00 23.22 ? 172 ILE B CG1   1 
ATOM   3782 C CG2   . ILE B 2 130 ? 10.408  -9.827  -42.937 1.00 20.12 ? 172 ILE B CG2   1 
ATOM   3783 C CD1   . ILE B 2 130 ? 10.055  -11.810 -45.315 1.00 23.14 ? 172 ILE B CD1   1 
ATOM   3784 N N     . ALA B 2 131 ? 8.160   -6.829  -43.179 1.00 24.54 ? 173 ALA B N     1 
ATOM   3785 C CA    . ALA B 2 131 ? 8.335   -5.526  -42.565 1.00 25.06 ? 173 ALA B CA    1 
ATOM   3786 C C     . ALA B 2 131 ? 7.226   -5.220  -41.543 1.00 26.34 ? 173 ALA B C     1 
ATOM   3787 O O     . ALA B 2 131 ? 7.519   -4.782  -40.423 1.00 26.49 ? 173 ALA B O     1 
ATOM   3788 C CB    . ALA B 2 131 ? 8.423   -4.441  -43.638 1.00 23.95 ? 173 ALA B CB    1 
ATOM   3789 N N     . TYR B 2 132 ? 5.966   -5.459  -41.915 1.00 26.86 ? 174 TYR B N     1 
ATOM   3790 C CA    . TYR B 2 132 ? 4.846   -5.293  -40.978 1.00 28.24 ? 174 TYR B CA    1 
ATOM   3791 C C     . TYR B 2 132 ? 4.972   -6.213  -39.770 1.00 29.22 ? 174 TYR B C     1 
ATOM   3792 O O     . TYR B 2 132 ? 4.761   -5.794  -38.630 1.00 30.39 ? 174 TYR B O     1 
ATOM   3793 C CB    . TYR B 2 132 ? 3.498   -5.534  -41.666 1.00 28.45 ? 174 TYR B CB    1 
ATOM   3794 C CG    . TYR B 2 132 ? 2.976   -4.336  -42.423 1.00 29.60 ? 174 TYR B CG    1 
ATOM   3795 C CD1   . TYR B 2 132 ? 2.464   -3.223  -41.744 1.00 31.21 ? 174 TYR B CD1   1 
ATOM   3796 C CD2   . TYR B 2 132 ? 2.996   -4.307  -43.817 1.00 27.83 ? 174 TYR B CD2   1 
ATOM   3797 C CE1   . TYR B 2 132 ? 1.985   -2.115  -42.440 1.00 31.42 ? 174 TYR B CE1   1 
ATOM   3798 C CE2   . TYR B 2 132 ? 2.518   -3.208  -44.520 1.00 28.99 ? 174 TYR B CE2   1 
ATOM   3799 C CZ    . TYR B 2 132 ? 2.018   -2.111  -43.829 1.00 30.99 ? 174 TYR B CZ    1 
ATOM   3800 O OH    . TYR B 2 132 ? 1.548   -1.019  -44.531 1.00 29.25 ? 174 TYR B OH    1 
ATOM   3801 N N     . ILE B 2 133 ? 5.321   -7.470  -40.030 1.00 29.94 ? 175 ILE B N     1 
ATOM   3802 C CA    . ILE B 2 133 ? 5.448   -8.471  -38.978 1.00 29.89 ? 175 ILE B CA    1 
ATOM   3803 C C     . ILE B 2 133 ? 6.595   -8.128  -38.021 1.00 30.24 ? 175 ILE B C     1 
ATOM   3804 O O     . ILE B 2 133 ? 6.383   -8.115  -36.810 1.00 30.51 ? 175 ILE B O     1 
ATOM   3805 C CB    . ILE B 2 133 ? 5.574   -9.912  -39.565 1.00 30.33 ? 175 ILE B CB    1 
ATOM   3806 C CG1   . ILE B 2 133 ? 4.224   -10.379 -40.125 1.00 28.56 ? 175 ILE B CG1   1 
ATOM   3807 C CG2   . ILE B 2 133 ? 6.085   -10.895 -38.518 1.00 28.23 ? 175 ILE B CG2   1 
ATOM   3808 C CD1   . ILE B 2 133 ? 4.286   -11.666 -40.954 1.00 28.60 ? 175 ILE B CD1   1 
ATOM   3809 N N     . LEU B 2 134 ? 7.778   -7.816  -38.560 1.00 29.45 ? 176 LEU B N     1 
ATOM   3810 C CA    . LEU B 2 134 ? 8.967   -7.563  -37.725 1.00 29.53 ? 176 LEU B CA    1 
ATOM   3811 C C     . LEU B 2 134 ? 8.951   -6.210  -36.999 1.00 30.54 ? 176 LEU B C     1 
ATOM   3812 O O     . LEU B 2 134 ? 9.646   -6.041  -35.992 1.00 32.45 ? 176 LEU B O     1 
ATOM   3813 C CB    . LEU B 2 134 ? 10.275  -7.730  -38.525 1.00 30.11 ? 176 LEU B CB    1 
ATOM   3814 C CG    . LEU B 2 134 ? 10.795  -9.108  -38.984 1.00 29.34 ? 176 LEU B CG    1 
ATOM   3815 C CD1   . LEU B 2 134 ? 12.101  -8.933  -39.741 1.00 28.75 ? 176 LEU B CD1   1 
ATOM   3816 C CD2   . LEU B 2 134 ? 10.997  -10.094 -37.837 1.00 26.48 ? 176 LEU B CD2   1 
ATOM   3817 N N     . GLN B 2 135 ? 8.177   -5.252  -37.509 1.00 28.87 ? 177 GLN B N     1 
ATOM   3818 C CA    . GLN B 2 135 ? 7.937   -3.987  -36.814 1.00 27.48 ? 177 GLN B CA    1 
ATOM   3819 C C     . GLN B 2 135 ? 7.174   -4.208  -35.495 1.00 27.92 ? 177 GLN B C     1 
ATOM   3820 O O     . GLN B 2 135 ? 7.540   -3.637  -34.460 1.00 28.63 ? 177 GLN B O     1 
ATOM   3821 C CB    . GLN B 2 135 ? 7.158   -3.020  -37.718 1.00 27.92 ? 177 GLN B CB    1 
ATOM   3822 C CG    . GLN B 2 135 ? 7.051   -1.579  -37.195 1.00 26.26 ? 177 GLN B CG    1 
ATOM   3823 C CD    . GLN B 2 135 ? 6.103   -0.727  -38.021 1.00 26.36 ? 177 GLN B CD    1 
ATOM   3824 O OE1   . GLN B 2 135 ? 4.981   -1.141  -38.315 1.00 25.11 ? 177 GLN B OE1   1 
ATOM   3825 N NE2   . GLN B 2 135 ? 6.548   0.468   -38.398 1.00 21.06 ? 177 GLN B NE2   1 
ATOM   3826 N N     . GLY B 2 136 ? 6.120   -5.028  -35.543 1.00 27.03 ? 178 GLY B N     1 
ATOM   3827 C CA    . GLY B 2 136 ? 5.340   -5.394  -34.355 1.00 26.80 ? 178 GLY B CA    1 
ATOM   3828 C C     . GLY B 2 136 ? 6.157   -6.123  -33.304 1.00 27.14 ? 178 GLY B C     1 
ATOM   3829 O O     . GLY B 2 136 ? 6.051   -5.842  -32.110 1.00 27.36 ? 178 GLY B O     1 
ATOM   3830 N N     . VAL B 2 137 ? 6.985   -7.059  -33.758 1.00 28.61 ? 179 VAL B N     1 
ATOM   3831 C CA    . VAL B 2 137 ? 7.911   -7.798  -32.897 1.00 28.85 ? 179 VAL B CA    1 
ATOM   3832 C C     . VAL B 2 137 ? 8.887   -6.835  -32.237 1.00 29.60 ? 179 VAL B C     1 
ATOM   3833 O O     . VAL B 2 137 ? 9.196   -6.967  -31.057 1.00 31.02 ? 179 VAL B O     1 
ATOM   3834 C CB    . VAL B 2 137 ? 8.665   -8.884  -33.710 1.00 29.04 ? 179 VAL B CB    1 
ATOM   3835 C CG1   . VAL B 2 137 ? 9.871   -9.449  -32.944 1.00 27.41 ? 179 VAL B CG1   1 
ATOM   3836 C CG2   . VAL B 2 137 ? 7.698   -9.996  -34.101 1.00 29.86 ? 179 VAL B CG2   1 
ATOM   3837 N N     . LEU B 2 138 ? 9.346   -5.846  -32.996 1.00 29.62 ? 180 LEU B N     1 
ATOM   3838 C CA    . LEU B 2 138 ? 10.312  -4.886  -32.476 1.00 29.76 ? 180 LEU B CA    1 
ATOM   3839 C C     . LEU B 2 138 ? 9.721   -3.919  -31.445 1.00 29.73 ? 180 LEU B C     1 
ATOM   3840 O O     . LEU B 2 138 ? 10.377  -3.614  -30.445 1.00 31.03 ? 180 LEU B O     1 
ATOM   3841 C CB    . LEU B 2 138 ? 11.021  -4.149  -33.616 1.00 28.64 ? 180 LEU B CB    1 
ATOM   3842 C CG    . LEU B 2 138 ? 12.523  -4.370  -33.848 1.00 27.30 ? 180 LEU B CG    1 
ATOM   3843 C CD1   . LEU B 2 138 ? 13.071  -5.676  -33.300 1.00 23.63 ? 180 LEU B CD1   1 
ATOM   3844 C CD2   . LEU B 2 138 ? 12.828  -4.234  -35.328 1.00 28.67 ? 180 LEU B CD2   1 
ATOM   3845 N N     . LYS B 2 139 ? 8.499   -3.442  -31.684 1.00 29.11 ? 181 LYS B N     1 
ATOM   3846 C CA    . LYS B 2 139 ? 7.791   -2.609  -30.703 1.00 28.14 ? 181 LYS B CA    1 
ATOM   3847 C C     . LYS B 2 139 ? 7.648   -3.362  -29.361 1.00 27.41 ? 181 LYS B C     1 
ATOM   3848 O O     . LYS B 2 139 ? 7.875   -2.788  -28.300 1.00 26.13 ? 181 LYS B O     1 
ATOM   3849 C CB    . LYS B 2 139 ? 6.417   -2.173  -31.240 1.00 27.37 ? 181 LYS B CB    1 
ATOM   3850 C CG    . LYS B 2 139 ? 6.465   -1.044  -32.273 1.00 29.62 ? 181 LYS B CG    1 
ATOM   3851 C CD    . LYS B 2 139 ? 5.073   -0.704  -32.855 1.00 28.95 ? 181 LYS B CD    1 
ATOM   3852 C CE    . LYS B 2 139 ? 5.162   0.417   -33.902 1.00 31.30 ? 181 LYS B CE    1 
ATOM   3853 N NZ    . LYS B 2 139 ? 3.846   0.819   -34.511 1.00 30.08 ? 181 LYS B NZ    1 
ATOM   3854 N N     . ALA B 2 140 ? 7.295   -4.648  -29.440 1.00 27.31 ? 182 ALA B N     1 
ATOM   3855 C CA    . ALA B 2 140 ? 7.137   -5.530  -28.286 1.00 27.98 ? 182 ALA B CA    1 
ATOM   3856 C C     . ALA B 2 140 ? 8.445   -5.717  -27.535 1.00 28.76 ? 182 ALA B C     1 
ATOM   3857 O O     . ALA B 2 140 ? 8.479   -5.599  -26.311 1.00 31.01 ? 182 ALA B O     1 
ATOM   3858 C CB    . ALA B 2 140 ? 6.579   -6.897  -28.734 1.00 27.67 ? 182 ALA B CB    1 
ATOM   3859 N N     . LEU B 2 141 ? 9.515   -6.008  -28.277 1.00 29.52 ? 183 LEU B N     1 
ATOM   3860 C CA    . LEU B 2 141 ? 10.863  -6.179  -27.726 1.00 28.85 ? 183 LEU B CA    1 
ATOM   3861 C C     . LEU B 2 141 ? 11.418  -4.914  -27.050 1.00 29.41 ? 183 LEU B C     1 
ATOM   3862 O O     . LEU B 2 141 ? 12.156  -4.996  -26.062 1.00 29.41 ? 183 LEU B O     1 
ATOM   3863 C CB    . LEU B 2 141 ? 11.829  -6.656  -28.823 1.00 28.15 ? 183 LEU B CB    1 
ATOM   3864 C CG    . LEU B 2 141 ? 11.788  -8.130  -29.244 1.00 28.61 ? 183 LEU B CG    1 
ATOM   3865 C CD1   . LEU B 2 141 ? 12.791  -8.384  -30.328 1.00 24.48 ? 183 LEU B CD1   1 
ATOM   3866 C CD2   . LEU B 2 141 ? 12.029  -9.094  -28.074 1.00 26.21 ? 183 LEU B CD2   1 
ATOM   3867 N N     . ASP B 2 142 ? 11.079  -3.753  -27.606 1.00 28.82 ? 184 ASP B N     1 
ATOM   3868 C CA    . ASP B 2 142 ? 11.470  -2.464  -27.051 1.00 27.62 ? 184 ASP B CA    1 
ATOM   3869 C C     . ASP B 2 142 ? 10.880  -2.351  -25.642 1.00 27.39 ? 184 ASP B C     1 
ATOM   3870 O O     . ASP B 2 142 ? 11.591  -2.040  -24.682 1.00 27.77 ? 184 ASP B O     1 
ATOM   3871 C CB    . ASP B 2 142 ? 10.941  -1.347  -27.965 1.00 28.29 ? 184 ASP B CB    1 
ATOM   3872 C CG    . ASP B 2 142 ? 11.560  0.023   -27.679 1.00 30.93 ? 184 ASP B CG    1 
ATOM   3873 O OD1   . ASP B 2 142 ? 12.695  0.099   -27.156 1.00 32.46 ? 184 ASP B OD1   1 
ATOM   3874 O OD2   . ASP B 2 142 ? 10.903  1.038   -28.003 1.00 31.27 ? 184 ASP B OD2   1 
ATOM   3875 N N     . TYR B 2 143 ? 9.579   -2.624  -25.532 1.00 26.56 ? 185 TYR B N     1 
ATOM   3876 C CA    . TYR B 2 143 ? 8.851   -2.611  -24.251 1.00 26.39 ? 185 TYR B CA    1 
ATOM   3877 C C     . TYR B 2 143 ? 9.429   -3.650  -23.266 1.00 25.45 ? 185 TYR B C     1 
ATOM   3878 O O     . TYR B 2 143 ? 9.812   -3.323  -22.160 1.00 24.07 ? 185 TYR B O     1 
ATOM   3879 C CB    . TYR B 2 143 ? 7.351   -2.836  -24.509 1.00 25.20 ? 185 TYR B CB    1 
ATOM   3880 C CG    . TYR B 2 143 ? 6.480   -2.959  -23.275 1.00 24.66 ? 185 TYR B CG    1 
ATOM   3881 C CD1   . TYR B 2 143 ? 5.776   -1.859  -22.782 1.00 26.72 ? 185 TYR B CD1   1 
ATOM   3882 C CD2   . TYR B 2 143 ? 6.341   -4.184  -22.614 1.00 18.15 ? 185 TYR B CD2   1 
ATOM   3883 C CE1   . TYR B 2 143 ? 4.966   -1.975  -21.647 1.00 25.04 ? 185 TYR B CE1   1 
ATOM   3884 C CE2   . TYR B 2 143 ? 5.547   -4.307  -21.477 1.00 21.56 ? 185 TYR B CE2   1 
ATOM   3885 C CZ    . TYR B 2 143 ? 4.856   -3.209  -21.005 1.00 21.59 ? 185 TYR B CZ    1 
ATOM   3886 O OH    . TYR B 2 143 ? 4.067   -3.344  -19.892 1.00 23.36 ? 185 TYR B OH    1 
ATOM   3887 N N     . ILE B 2 144 ? 9.506   -4.900  -23.697 1.00 26.48 ? 186 ILE B N     1 
ATOM   3888 C CA    . ILE B 2 144 ? 10.148  -5.951  -22.904 1.00 26.52 ? 186 ILE B CA    1 
ATOM   3889 C C     . ILE B 2 144 ? 11.579  -5.586  -22.426 1.00 26.91 ? 186 ILE B C     1 
ATOM   3890 O O     . ILE B 2 144 ? 11.927  -5.840  -21.264 1.00 26.17 ? 186 ILE B O     1 
ATOM   3891 C CB    . ILE B 2 144 ? 10.120  -7.283  -23.677 1.00 25.04 ? 186 ILE B CB    1 
ATOM   3892 C CG1   . ILE B 2 144 ? 8.666   -7.761  -23.806 1.00 23.68 ? 186 ILE B CG1   1 
ATOM   3893 C CG2   . ILE B 2 144 ? 11.051  -8.319  -23.032 1.00 25.33 ? 186 ILE B CG2   1 
ATOM   3894 C CD1   . ILE B 2 144 ? 8.434   -8.825  -24.875 1.00 19.97 ? 186 ILE B CD1   1 
ATOM   3895 N N     . HIS B 2 145 ? 12.387  -4.982  -23.304 1.00 26.50 ? 187 HIS B N     1 
ATOM   3896 C CA    . HIS B 2 145 ? 13.748  -4.562  -22.927 1.00 26.32 ? 187 HIS B CA    1 
ATOM   3897 C C     . HIS B 2 145 ? 13.781  -3.379  -21.958 1.00 27.56 ? 187 HIS B C     1 
ATOM   3898 O O     . HIS B 2 145 ? 14.623  -3.350  -21.056 1.00 29.06 ? 187 HIS B O     1 
ATOM   3899 C CB    . HIS B 2 145 ? 14.637  -4.291  -24.149 1.00 25.71 ? 187 HIS B CB    1 
ATOM   3900 C CG    . HIS B 2 145 ? 14.867  -5.494  -25.022 1.00 23.03 ? 187 HIS B CG    1 
ATOM   3901 N ND1   . HIS B 2 145 ? 15.241  -5.390  -26.346 1.00 23.06 ? 187 HIS B ND1   1 
ATOM   3902 C CD2   . HIS B 2 145 ? 14.763  -6.821  -24.767 1.00 17.88 ? 187 HIS B CD2   1 
ATOM   3903 C CE1   . HIS B 2 145 ? 15.367  -6.598  -26.867 1.00 21.63 ? 187 HIS B CE1   1 
ATOM   3904 N NE2   . HIS B 2 145 ? 15.086  -7.486  -25.927 1.00 17.27 ? 187 HIS B NE2   1 
ATOM   3905 N N     . HIS B 2 146 ? 12.876  -2.412  -22.129 1.00 27.71 ? 188 HIS B N     1 
ATOM   3906 C CA    . HIS B 2 146 ? 12.769  -1.286  -21.190 1.00 27.56 ? 188 HIS B CA    1 
ATOM   3907 C C     . HIS B 2 146 ? 12.361  -1.750  -19.788 1.00 28.14 ? 188 HIS B C     1 
ATOM   3908 O O     . HIS B 2 146 ? 12.724  -1.117  -18.803 1.00 28.51 ? 188 HIS B O     1 
ATOM   3909 C CB    . HIS B 2 146 ? 11.797  -0.219  -21.702 1.00 27.62 ? 188 HIS B CB    1 
ATOM   3910 C CG    . HIS B 2 146 ? 12.440  0.810   -22.579 1.00 31.65 ? 188 HIS B CG    1 
ATOM   3911 N ND1   . HIS B 2 146 ? 12.669  0.610   -23.925 1.00 33.60 ? 188 HIS B ND1   1 
ATOM   3912 C CD2   . HIS B 2 146 ? 12.916  2.048   -22.299 1.00 33.54 ? 188 HIS B CD2   1 
ATOM   3913 C CE1   . HIS B 2 146 ? 13.251  1.681   -24.436 1.00 30.17 ? 188 HIS B CE1   1 
ATOM   3914 N NE2   . HIS B 2 146 ? 13.412  2.566   -23.470 1.00 33.93 ? 188 HIS B NE2   1 
ATOM   3915 N N     . MET B 2 147 ? 11.626  -2.863  -19.720 1.00 28.07 ? 189 MET B N     1 
ATOM   3916 C CA    . MET B 2 147 ? 11.189  -3.487  -18.462 1.00 29.23 ? 189 MET B CA    1 
ATOM   3917 C C     . MET B 2 147 ? 12.278  -4.301  -17.786 1.00 28.26 ? 189 MET B C     1 
ATOM   3918 O O     . MET B 2 147 ? 12.040  -4.905  -16.747 1.00 28.90 ? 189 MET B O     1 
ATOM   3919 C CB    . MET B 2 147 ? 10.013  -4.437  -18.725 1.00 31.59 ? 189 MET B CB    1 
ATOM   3920 C CG    . MET B 2 147 ? 8.743   -3.765  -19.172 1.00 34.09 ? 189 MET B CG    1 
ATOM   3921 S SD    . MET B 2 147 ? 8.073   -2.887  -17.782 1.00 42.35 ? 189 MET B SD    1 
ATOM   3922 C CE    . MET B 2 147 ? 7.597   -1.328  -18.557 1.00 36.28 ? 189 MET B CE    1 
ATOM   3923 N N     . GLY B 2 148 ? 13.452  -4.362  -18.401 1.00 27.95 ? 190 GLY B N     1 
ATOM   3924 C CA    . GLY B 2 148 ? 14.583  -5.083  -17.839 1.00 27.84 ? 190 GLY B CA    1 
ATOM   3925 C C     . GLY B 2 148 ? 14.503  -6.579  -18.052 1.00 27.70 ? 190 GLY B C     1 
ATOM   3926 O O     . GLY B 2 148 ? 14.975  -7.349  -17.221 1.00 29.08 ? 190 GLY B O     1 
ATOM   3927 N N     . TYR B 2 149 ? 13.900  -6.987  -19.163 1.00 27.73 ? 191 TYR B N     1 
ATOM   3928 C CA    . TYR B 2 149 ? 13.819  -8.406  -19.534 1.00 28.38 ? 191 TYR B CA    1 
ATOM   3929 C C     . TYR B 2 149 ? 14.474  -8.717  -20.878 1.00 27.47 ? 191 TYR B C     1 
ATOM   3930 O O     . TYR B 2 149 ? 14.620  -7.847  -21.738 1.00 25.72 ? 191 TYR B O     1 
ATOM   3931 C CB    . TYR B 2 149 ? 12.367  -8.876  -19.591 1.00 28.34 ? 191 TYR B CB    1 
ATOM   3932 C CG    . TYR B 2 149 ? 11.686  -9.042  -18.256 1.00 31.02 ? 191 TYR B CG    1 
ATOM   3933 C CD1   . TYR B 2 149 ? 11.560  -10.303 -17.660 1.00 33.22 ? 191 TYR B CD1   1 
ATOM   3934 C CD2   . TYR B 2 149 ? 11.129  -7.943  -17.600 1.00 33.08 ? 191 TYR B CD2   1 
ATOM   3935 C CE1   . TYR B 2 149 ? 10.909  -10.449 -16.431 1.00 33.36 ? 191 TYR B CE1   1 
ATOM   3936 C CE2   . TYR B 2 149 ? 10.482  -8.080  -16.380 1.00 32.53 ? 191 TYR B CE2   1 
ATOM   3937 C CZ    . TYR B 2 149 ? 10.376  -9.325  -15.802 1.00 31.63 ? 191 TYR B CZ    1 
ATOM   3938 O OH    . TYR B 2 149 ? 9.728   -9.431  -14.597 1.00 32.67 ? 191 TYR B OH    1 
ATOM   3939 N N     . VAL B 2 150 ? 14.866  -9.978  -21.033 1.00 28.32 ? 192 VAL B N     1 
ATOM   3940 C CA    . VAL B 2 150 ? 15.239  -10.544 -22.322 1.00 29.45 ? 192 VAL B CA    1 
ATOM   3941 C C     . VAL B 2 150 ? 14.165  -11.585 -22.681 1.00 29.29 ? 192 VAL B C     1 
ATOM   3942 O O     . VAL B 2 150 ? 13.695  -12.312 -21.800 1.00 29.47 ? 192 VAL B O     1 
ATOM   3943 C CB    . VAL B 2 150 ? 16.626  -11.219 -22.257 1.00 30.18 ? 192 VAL B CB    1 
ATOM   3944 C CG1   . VAL B 2 150 ? 17.116  -11.595 -23.660 1.00 29.46 ? 192 VAL B CG1   1 
ATOM   3945 C CG2   . VAL B 2 150 ? 17.621  -10.298 -21.624 1.00 31.15 ? 192 VAL B CG2   1 
ATOM   3946 N N     . HIS B 2 151 ? 13.773  -11.636 -23.958 1.00 27.98 ? 193 HIS B N     1 
ATOM   3947 C CA    . HIS B 2 151 ? 12.759  -12.571 -24.421 1.00 27.26 ? 193 HIS B CA    1 
ATOM   3948 C C     . HIS B 2 151 ? 13.309  -14.000 -24.440 1.00 28.55 ? 193 HIS B C     1 
ATOM   3949 O O     . HIS B 2 151 ? 12.818  -14.890 -23.720 1.00 28.86 ? 193 HIS B O     1 
ATOM   3950 C CB    . HIS B 2 151 ? 12.244  -12.181 -25.817 1.00 26.80 ? 193 HIS B CB    1 
ATOM   3951 C CG    . HIS B 2 151 ? 11.016  -12.930 -26.228 1.00 26.50 ? 193 HIS B CG    1 
ATOM   3952 N ND1   . HIS B 2 151 ? 11.059  -14.226 -26.701 1.00 28.26 ? 193 HIS B ND1   1 
ATOM   3953 C CD2   . HIS B 2 151 ? 9.706   -12.584 -26.198 1.00 21.44 ? 193 HIS B CD2   1 
ATOM   3954 C CE1   . HIS B 2 151 ? 9.828   -14.642 -26.949 1.00 27.16 ? 193 HIS B CE1   1 
ATOM   3955 N NE2   . HIS B 2 151 ? 8.990   -13.667 -26.645 1.00 22.80 ? 193 HIS B NE2   1 
ATOM   3956 N N     . ARG B 2 152 ? 14.321  -14.202 -25.285 1.00 27.31 ? 194 ARG B N     1 
ATOM   3957 C CA    . ARG B 2 152 ? 15.059  -15.467 -25.405 1.00 26.77 ? 194 ARG B CA    1 
ATOM   3958 C C     . ARG B 2 152 ? 14.410  -16.534 -26.309 1.00 26.53 ? 194 ARG B C     1 
ATOM   3959 O O     . ARG B 2 152 ? 14.928  -17.650 -26.398 1.00 26.04 ? 194 ARG B O     1 
ATOM   3960 C CB    . ARG B 2 152 ? 15.429  -16.057 -24.024 1.00 26.18 ? 194 ARG B CB    1 
ATOM   3961 C CG    . ARG B 2 152 ? 16.175  -15.101 -23.094 1.00 25.16 ? 194 ARG B CG    1 
ATOM   3962 C CD    . ARG B 2 152 ? 16.897  -15.837 -21.970 1.00 25.94 ? 194 ARG B CD    1 
ATOM   3963 N NE    . ARG B 2 152 ? 16.001  -16.731 -21.248 1.00 28.78 ? 194 ARG B NE    1 
ATOM   3964 C CZ    . ARG B 2 152 ? 16.378  -17.609 -20.317 1.00 30.15 ? 194 ARG B CZ    1 
ATOM   3965 N NH1   . ARG B 2 152 ? 17.657  -17.729 -19.977 1.00 22.16 ? 194 ARG B NH1   1 
ATOM   3966 N NH2   . ARG B 2 152 ? 15.460  -18.372 -19.723 1.00 25.50 ? 194 ARG B NH2   1 
ATOM   3967 N N     . SER B 2 153 ? 13.295  -16.215 -26.972 1.00 26.73 ? 195 SER B N     1 
ATOM   3968 C CA    . SER B 2 153 ? 12.702  -17.173 -27.938 1.00 27.81 ? 195 SER B CA    1 
ATOM   3969 C C     . SER B 2 153 ? 11.937  -16.560 -29.117 1.00 27.56 ? 195 SER B C     1 
ATOM   3970 O O     . SER B 2 153 ? 10.906  -17.093 -29.554 1.00 30.14 ? 195 SER B O     1 
ATOM   3971 C CB    . SER B 2 153 ? 11.876  -18.275 -27.237 1.00 27.58 ? 195 SER B CB    1 
ATOM   3972 O OG    . SER B 2 153 ? 10.686  -17.763 -26.659 1.00 30.21 ? 195 SER B OG    1 
ATOM   3973 N N     . VAL B 2 154 ? 12.448  -15.448 -29.632 1.00 27.22 ? 196 VAL B N     1 
ATOM   3974 C CA    . VAL B 2 154 ? 11.917  -14.836 -30.843 1.00 26.71 ? 196 VAL B CA    1 
ATOM   3975 C C     . VAL B 2 154 ? 12.163  -15.754 -32.052 1.00 27.87 ? 196 VAL B C     1 
ATOM   3976 O O     . VAL B 2 154 ? 13.311  -16.033 -32.418 1.00 26.57 ? 196 VAL B O     1 
ATOM   3977 C CB    . VAL B 2 154 ? 12.531  -13.456 -31.119 1.00 27.21 ? 196 VAL B CB    1 
ATOM   3978 C CG1   . VAL B 2 154 ? 11.844  -12.806 -32.316 1.00 28.42 ? 196 VAL B CG1   1 
ATOM   3979 C CG2   . VAL B 2 154 ? 12.434  -12.554 -29.888 1.00 26.10 ? 196 VAL B CG2   1 
ATOM   3980 N N     . LYS B 2 155 ? 11.056  -16.216 -32.641 1.00 28.09 ? 197 LYS B N     1 
ATOM   3981 C CA    . LYS B 2 155 ? 11.022  -17.107 -33.801 1.00 27.29 ? 197 LYS B CA    1 
ATOM   3982 C C     . LYS B 2 155 ? 9.623   -16.980 -34.418 1.00 26.81 ? 197 LYS B C     1 
ATOM   3983 O O     . LYS B 2 155 ? 8.720   -16.407 -33.791 1.00 26.19 ? 197 LYS B O     1 
ATOM   3984 C CB    . LYS B 2 155 ? 11.310  -18.562 -33.389 1.00 26.99 ? 197 LYS B CB    1 
ATOM   3985 C CG    . LYS B 2 155 ? 10.468  -19.083 -32.200 1.00 26.40 ? 197 LYS B CG    1 
ATOM   3986 C CD    . LYS B 2 155 ? 10.930  -20.457 -31.708 1.00 26.86 ? 197 LYS B CD    1 
ATOM   3987 C CE    . LYS B 2 155 ? 10.793  -21.521 -32.801 1.00 30.34 ? 197 LYS B CE    1 
ATOM   3988 N NZ    . LYS B 2 155 ? 10.803  -22.915 -32.272 1.00 36.75 ? 197 LYS B NZ    1 
ATOM   3989 N N     . ALA B 2 156 ? 9.453   -17.504 -35.633 1.00 25.07 ? 198 ALA B N     1 
ATOM   3990 C CA    . ALA B 2 156 ? 8.206   -17.354 -36.388 1.00 25.60 ? 198 ALA B CA    1 
ATOM   3991 C C     . ALA B 2 156 ? 6.994   -17.954 -35.683 1.00 25.59 ? 198 ALA B C     1 
ATOM   3992 O O     . ALA B 2 156 ? 5.891   -17.428 -35.812 1.00 24.90 ? 198 ALA B O     1 
ATOM   3993 C CB    . ALA B 2 156 ? 8.348   -17.954 -37.802 1.00 25.89 ? 198 ALA B CB    1 
ATOM   3994 N N     . SER B 2 157 ? 7.203   -19.062 -34.960 1.00 25.67 ? 199 SER B N     1 
ATOM   3995 C CA    . SER B 2 157 ? 6.122   -19.733 -34.236 1.00 25.44 ? 199 SER B CA    1 
ATOM   3996 C C     . SER B 2 157 ? 5.719   -18.999 -32.958 1.00 25.62 ? 199 SER B C     1 
ATOM   3997 O O     . SER B 2 157 ? 4.706   -19.334 -32.333 1.00 26.47 ? 199 SER B O     1 
ATOM   3998 C CB    . SER B 2 157 ? 6.467   -21.200 -33.953 1.00 25.28 ? 199 SER B CB    1 
ATOM   3999 O OG    . SER B 2 157 ? 7.470   -21.326 -32.957 1.00 25.71 ? 199 SER B OG    1 
ATOM   4000 N N     . HIS B 2 158 ? 6.500   -17.983 -32.592 1.00 25.87 ? 200 HIS B N     1 
ATOM   4001 C CA    . HIS B 2 158 ? 6.174   -17.104 -31.470 1.00 25.38 ? 200 HIS B CA    1 
ATOM   4002 C C     . HIS B 2 158 ? 5.711   -15.722 -31.924 1.00 26.53 ? 200 HIS B C     1 
ATOM   4003 O O     . HIS B 2 158 ? 5.864   -14.738 -31.192 1.00 26.24 ? 200 HIS B O     1 
ATOM   4004 C CB    . HIS B 2 158 ? 7.354   -16.981 -30.490 1.00 23.83 ? 200 HIS B CB    1 
ATOM   4005 C CG    . HIS B 2 158 ? 7.532   -18.180 -29.613 1.00 23.51 ? 200 HIS B CG    1 
ATOM   4006 N ND1   . HIS B 2 158 ? 8.717   -18.459 -28.967 1.00 26.37 ? 200 HIS B ND1   1 
ATOM   4007 C CD2   . HIS B 2 158 ? 6.696   -19.208 -29.329 1.00 23.37 ? 200 HIS B CD2   1 
ATOM   4008 C CE1   . HIS B 2 158 ? 8.592   -19.590 -28.294 1.00 26.34 ? 200 HIS B CE1   1 
ATOM   4009 N NE2   . HIS B 2 158 ? 7.378   -20.066 -28.500 1.00 26.26 ? 200 HIS B NE2   1 
ATOM   4010 N N     . ILE B 2 159 ? 5.166   -15.662 -33.140 1.00 27.43 ? 201 ILE B N     1 
ATOM   4011 C CA    . ILE B 2 159 ? 4.569   -14.449 -33.690 1.00 28.07 ? 201 ILE B CA    1 
ATOM   4012 C C     . ILE B 2 159 ? 3.176   -14.813 -34.194 1.00 28.99 ? 201 ILE B C     1 
ATOM   4013 O O     . ILE B 2 159 ? 3.044   -15.635 -35.089 1.00 29.78 ? 201 ILE B O     1 
ATOM   4014 C CB    . ILE B 2 159 ? 5.371   -13.870 -34.880 1.00 28.77 ? 201 ILE B CB    1 
ATOM   4015 C CG1   . ILE B 2 159 ? 6.843   -13.602 -34.503 1.00 28.40 ? 201 ILE B CG1   1 
ATOM   4016 C CG2   . ILE B 2 159 ? 4.680   -12.611 -35.414 1.00 27.67 ? 201 ILE B CG2   1 
ATOM   4017 C CD1   . ILE B 2 159 ? 7.762   -13.392 -35.708 1.00 27.59 ? 201 ILE B CD1   1 
ATOM   4018 N N     . LEU B 2 160 ? 2.149   -14.182 -33.628 1.00 28.73 ? 202 LEU B N     1 
ATOM   4019 C CA    . LEU B 2 160 ? 0.759   -14.528 -33.913 1.00 27.65 ? 202 LEU B CA    1 
ATOM   4020 C C     . LEU B 2 160 ? 0.050   -13.367 -34.599 1.00 27.56 ? 202 LEU B C     1 
ATOM   4021 O O     . LEU B 2 160 ? 0.325   -12.204 -34.315 1.00 28.42 ? 202 LEU B O     1 
ATOM   4022 C CB    . LEU B 2 160 ? 0.029   -14.919 -32.622 1.00 26.44 ? 202 LEU B CB    1 
ATOM   4023 C CG    . LEU B 2 160 ? 0.663   -16.034 -31.776 1.00 25.13 ? 202 LEU B CG    1 
ATOM   4024 C CD1   . LEU B 2 160 ? -0.014  -16.096 -30.405 1.00 24.55 ? 202 LEU B CD1   1 
ATOM   4025 C CD2   . LEU B 2 160 ? 0.580   -17.383 -32.478 1.00 19.14 ? 202 LEU B CD2   1 
ATOM   4026 N N     . ILE B 2 161 ? -0.853  -13.690 -35.516 1.00 27.32 ? 203 ILE B N     1 
ATOM   4027 C CA    . ILE B 2 161 ? -1.540  -12.674 -36.302 1.00 26.70 ? 203 ILE B CA    1 
ATOM   4028 C C     . ILE B 2 161 ? -3.051  -12.868 -36.189 1.00 25.89 ? 203 ILE B C     1 
ATOM   4029 O O     . ILE B 2 161 ? -3.570  -13.945 -36.471 1.00 25.11 ? 203 ILE B O     1 
ATOM   4030 C CB    . ILE B 2 161 ? -1.043  -12.672 -37.781 1.00 26.77 ? 203 ILE B CB    1 
ATOM   4031 C CG1   . ILE B 2 161 ? 0.424   -12.232 -37.832 1.00 26.92 ? 203 ILE B CG1   1 
ATOM   4032 C CG2   . ILE B 2 161 ? -1.906  -11.759 -38.666 1.00 26.97 ? 203 ILE B CG2   1 
ATOM   4033 C CD1   . ILE B 2 161 ? 1.247   -12.931 -38.894 1.00 28.48 ? 203 ILE B CD1   1 
ATOM   4034 N N     . SER B 2 162 ? -3.736  -11.812 -35.763 1.00 25.09 ? 204 SER B N     1 
ATOM   4035 C CA    . SER B 2 162 ? -5.165  -11.857 -35.472 1.00 26.17 ? 204 SER B CA    1 
ATOM   4036 C C     . SER B 2 162 ? -6.034  -11.654 -36.720 1.00 26.05 ? 204 SER B C     1 
ATOM   4037 O O     . SER B 2 162 ? -5.519  -11.301 -37.779 1.00 24.55 ? 204 SER B O     1 
ATOM   4038 C CB    . SER B 2 162 ? -5.495  -10.787 -34.432 1.00 25.96 ? 204 SER B CB    1 
ATOM   4039 O OG    . SER B 2 162 ? -5.148  -9.507  -34.922 1.00 27.85 ? 204 SER B OG    1 
ATOM   4040 N N     . VAL B 2 163 ? -7.348  -11.852 -36.567 1.00 27.48 ? 205 VAL B N     1 
ATOM   4041 C CA    . VAL B 2 163 ? -8.334  -11.710 -37.664 1.00 29.15 ? 205 VAL B CA    1 
ATOM   4042 C C     . VAL B 2 163 ? -8.221  -10.398 -38.443 1.00 29.29 ? 205 VAL B C     1 
ATOM   4043 O O     . VAL B 2 163 ? -8.503  -10.358 -39.649 1.00 29.62 ? 205 VAL B O     1 
ATOM   4044 C CB    . VAL B 2 163 ? -9.821  -11.784 -37.176 1.00 29.52 ? 205 VAL B CB    1 
ATOM   4045 C CG1   . VAL B 2 163 ? -10.687 -12.477 -38.229 1.00 29.60 ? 205 VAL B CG1   1 
ATOM   4046 C CG2   . VAL B 2 163 ? -9.958  -12.477 -35.817 1.00 32.35 ? 205 VAL B CG2   1 
ATOM   4047 N N     . ASP B 2 164 ? -7.844  -9.328  -37.744 1.00 28.52 ? 206 ASP B N     1 
ATOM   4048 C CA    . ASP B 2 164 ? -7.741  -8.004  -38.348 1.00 28.54 ? 206 ASP B CA    1 
ATOM   4049 C C     . ASP B 2 164 ? -6.293  -7.547  -38.570 1.00 28.23 ? 206 ASP B C     1 
ATOM   4050 O O     . ASP B 2 164 ? -6.036  -6.357  -38.716 1.00 27.68 ? 206 ASP B O     1 
ATOM   4051 C CB    . ASP B 2 164 ? -8.514  -6.978  -37.516 1.00 28.83 ? 206 ASP B CB    1 
ATOM   4052 C CG    . ASP B 2 164 ? -7.921  -6.776  -36.129 1.00 31.94 ? 206 ASP B CG    1 
ATOM   4053 O OD1   . ASP B 2 164 ? -7.191  -7.669  -35.631 1.00 37.08 ? 206 ASP B OD1   1 
ATOM   4054 O OD2   . ASP B 2 164 ? -8.186  -5.711  -35.529 1.00 36.48 ? 206 ASP B OD2   1 
ATOM   4055 N N     . GLY B 2 165 ? -5.354  -8.491  -38.589 1.00 27.56 ? 207 GLY B N     1 
ATOM   4056 C CA    . GLY B 2 165 ? -3.983  -8.199  -39.004 1.00 27.99 ? 207 GLY B CA    1 
ATOM   4057 C C     . GLY B 2 165 ? -3.055  -7.572  -37.976 1.00 28.64 ? 207 GLY B C     1 
ATOM   4058 O O     . GLY B 2 165 ? -2.036  -6.975  -38.336 1.00 28.53 ? 207 GLY B O     1 
ATOM   4059 N N     . LYS B 2 166 ? -3.394  -7.713  -36.697 1.00 28.73 ? 208 LYS B N     1 
ATOM   4060 C CA    . LYS B 2 166 ? -2.534  -7.227  -35.620 1.00 28.63 ? 208 LYS B CA    1 
ATOM   4061 C C     . LYS B 2 166 ? -1.481  -8.289  -35.334 1.00 27.57 ? 208 LYS B C     1 
ATOM   4062 O O     . LYS B 2 166 ? -1.782  -9.485  -35.367 1.00 27.13 ? 208 LYS B O     1 
ATOM   4063 C CB    . LYS B 2 166 ? -3.354  -6.913  -34.363 1.00 29.09 ? 208 LYS B CB    1 
ATOM   4064 C CG    . LYS B 2 166 ? -4.463  -5.869  -34.572 1.00 29.55 ? 208 LYS B CG    1 
ATOM   4065 C CD    . LYS B 2 166 ? -5.047  -5.377  -33.246 1.00 30.02 ? 208 LYS B CD    1 
ATOM   4066 C CE    . LYS B 2 166 ? -6.045  -4.240  -33.463 1.00 31.50 ? 208 LYS B CE    1 
ATOM   4067 N NZ    . LYS B 2 166 ? -6.761  -3.847  -32.210 1.00 30.13 ? 208 LYS B NZ    1 
ATOM   4068 N N     . VAL B 2 167 ? -0.245  -7.859  -35.094 1.00 26.38 ? 209 VAL B N     1 
ATOM   4069 C CA    . VAL B 2 167 ? 0.819   -8.801  -34.746 1.00 26.20 ? 209 VAL B CA    1 
ATOM   4070 C C     . VAL B 2 167 ? 1.182   -8.773  -33.258 1.00 27.12 ? 209 VAL B C     1 
ATOM   4071 O O     . VAL B 2 167 ? 1.292   -7.701  -32.645 1.00 27.87 ? 209 VAL B O     1 
ATOM   4072 C CB    . VAL B 2 167 ? 2.053   -8.790  -35.744 1.00 26.12 ? 209 VAL B CB    1 
ATOM   4073 C CG1   . VAL B 2 167 ? 1.967   -7.663  -36.772 1.00 26.91 ? 209 VAL B CG1   1 
ATOM   4074 C CG2   . VAL B 2 167 ? 3.417   -8.846  -35.021 1.00 25.44 ? 209 VAL B CG2   1 
ATOM   4075 N N     . TYR B 2 168 ? 1.311   -9.976  -32.695 1.00 27.36 ? 210 TYR B N     1 
ATOM   4076 C CA    . TYR B 2 168 ? 1.631   -10.200 -31.293 1.00 27.15 ? 210 TYR B CA    1 
ATOM   4077 C C     . TYR B 2 168 ? 2.855   -11.090 -31.151 1.00 28.40 ? 210 TYR B C     1 
ATOM   4078 O O     . TYR B 2 168 ? 2.961   -12.133 -31.805 1.00 28.28 ? 210 TYR B O     1 
ATOM   4079 C CB    . TYR B 2 168 ? 0.449   -10.879 -30.588 1.00 27.52 ? 210 TYR B CB    1 
ATOM   4080 C CG    . TYR B 2 168 ? -0.816  -10.066 -30.619 1.00 25.78 ? 210 TYR B CG    1 
ATOM   4081 C CD1   . TYR B 2 168 ? -1.153  -9.233  -29.557 1.00 23.31 ? 210 TYR B CD1   1 
ATOM   4082 C CD2   . TYR B 2 168 ? -1.664  -10.107 -31.728 1.00 23.56 ? 210 TYR B CD2   1 
ATOM   4083 C CE1   . TYR B 2 168 ? -2.314  -8.462  -29.590 1.00 23.54 ? 210 TYR B CE1   1 
ATOM   4084 C CE2   . TYR B 2 168 ? -2.819  -9.351  -31.774 1.00 25.70 ? 210 TYR B CE2   1 
ATOM   4085 C CZ    . TYR B 2 168 ? -3.138  -8.529  -30.702 1.00 26.69 ? 210 TYR B CZ    1 
ATOM   4086 O OH    . TYR B 2 168 ? -4.280  -7.779  -30.754 1.00 27.91 ? 210 TYR B OH    1 
ATOM   4087 N N     . LEU B 2 169 ? 3.780   -10.679 -30.289 1.00 30.45 ? 211 LEU B N     1 
ATOM   4088 C CA    . LEU B 2 169 ? 4.843   -11.569 -29.819 1.00 29.97 ? 211 LEU B CA    1 
ATOM   4089 C C     . LEU B 2 169 ? 4.292   -12.476 -28.705 1.00 29.01 ? 211 LEU B C     1 
ATOM   4090 O O     . LEU B 2 169 ? 3.682   -11.992 -27.743 1.00 28.34 ? 211 LEU B O     1 
ATOM   4091 C CB    . LEU B 2 169 ? 6.008   -10.751 -29.267 1.00 29.44 ? 211 LEU B CB    1 
ATOM   4092 C CG    . LEU B 2 169 ? 7.464   -11.020 -29.675 1.00 30.90 ? 211 LEU B CG    1 
ATOM   4093 C CD1   . LEU B 2 169 ? 8.381   -10.533 -28.564 1.00 28.52 ? 211 LEU B CD1   1 
ATOM   4094 C CD2   . LEU B 2 169 ? 7.771   -12.469 -30.060 1.00 23.90 ? 211 LEU B CD2   1 
ATOM   4095 N N     . SER B 2 170 ? 4.505   -13.784 -28.842 1.00 28.84 ? 212 SER B N     1 
ATOM   4096 C CA    . SER B 2 170 ? 4.180   -14.737 -27.782 1.00 28.80 ? 212 SER B CA    1 
ATOM   4097 C C     . SER B 2 170 ? 5.469   -15.283 -27.166 1.00 29.00 ? 212 SER B C     1 
ATOM   4098 O O     . SER B 2 170 ? 6.509   -14.622 -27.212 1.00 28.38 ? 212 SER B O     1 
ATOM   4099 C CB    . SER B 2 170 ? 3.277   -15.864 -28.315 1.00 30.75 ? 212 SER B CB    1 
ATOM   4100 O OG    . SER B 2 170 ? 3.900   -16.553 -29.393 1.00 29.85 ? 212 SER B OG    1 
ATOM   4101 N N     . GLY B 2 171 ? 5.408   -16.474 -26.575 1.00 29.38 ? 213 GLY B N     1 
ATOM   4102 C CA    . GLY B 2 171 ? 6.629   -17.153 -26.112 1.00 30.64 ? 213 GLY B CA    1 
ATOM   4103 C C     . GLY B 2 171 ? 7.256   -16.591 -24.846 1.00 30.17 ? 213 GLY B C     1 
ATOM   4104 O O     . GLY B 2 171 ? 8.479   -16.690 -24.644 1.00 30.75 ? 213 GLY B O     1 
ATOM   4105 N N     . LEU B 2 172 ? 6.409   -16.028 -23.989 1.00 28.50 ? 214 LEU B N     1 
ATOM   4106 C CA    . LEU B 2 172 ? 6.826   -15.388 -22.745 1.00 29.25 ? 214 LEU B CA    1 
ATOM   4107 C C     . LEU B 2 172 ? 7.407   -16.331 -21.690 1.00 28.34 ? 214 LEU B C     1 
ATOM   4108 O O     . LEU B 2 172 ? 8.049   -15.876 -20.757 1.00 29.01 ? 214 LEU B O     1 
ATOM   4109 C CB    . LEU B 2 172 ? 5.661   -14.581 -22.143 1.00 29.37 ? 214 LEU B CB    1 
ATOM   4110 C CG    . LEU B 2 172 ? 5.076   -13.435 -22.973 1.00 27.92 ? 214 LEU B CG    1 
ATOM   4111 C CD1   . LEU B 2 172 ? 4.126   -12.620 -22.122 1.00 28.97 ? 214 LEU B CD1   1 
ATOM   4112 C CD2   . LEU B 2 172 ? 6.167   -12.524 -23.547 1.00 34.72 ? 214 LEU B CD2   1 
ATOM   4113 N N     . ARG B 2 173 ? 7.190   -17.634 -21.849 1.00 27.76 ? 215 ARG B N     1 
ATOM   4114 C CA    . ARG B 2 173 ? 7.747   -18.664 -20.955 1.00 27.71 ? 215 ARG B CA    1 
ATOM   4115 C C     . ARG B 2 173 ? 9.275   -18.610 -20.798 1.00 28.50 ? 215 ARG B C     1 
ATOM   4116 O O     . ARG B 2 173 ? 9.806   -18.910 -19.722 1.00 29.00 ? 215 ARG B O     1 
ATOM   4117 C CB    . ARG B 2 173 ? 7.346   -20.054 -21.454 1.00 26.88 ? 215 ARG B CB    1 
ATOM   4118 C CG    . ARG B 2 173 ? 7.532   -21.150 -20.436 1.00 25.16 ? 215 ARG B CG    1 
ATOM   4119 C CD    . ARG B 2 173 ? 7.664   -22.495 -21.112 1.00 26.27 ? 215 ARG B CD    1 
ATOM   4120 N NE    . ARG B 2 173 ? 6.454   -22.847 -21.822 1.00 27.49 ? 215 ARG B NE    1 
ATOM   4121 C CZ    . ARG B 2 173 ? 6.412   -23.247 -23.086 1.00 26.42 ? 215 ARG B CZ    1 
ATOM   4122 N NH1   . ARG B 2 173 ? 7.525   -23.388 -23.797 1.00 21.64 ? 215 ARG B NH1   1 
ATOM   4123 N NH2   . ARG B 2 173 ? 5.239   -23.529 -23.628 1.00 29.40 ? 215 ARG B NH2   1 
ATOM   4124 N N     . SER B 2 174 ? 9.965   -18.243 -21.877 1.00 28.68 ? 216 SER B N     1 
ATOM   4125 C CA    . SER B 2 174 ? 11.426  -18.133 -21.904 1.00 29.57 ? 216 SER B CA    1 
ATOM   4126 C C     . SER B 2 174 ? 11.993  -16.792 -21.408 1.00 29.90 ? 216 SER B C     1 
ATOM   4127 O O     . SER B 2 174 ? 13.219  -16.635 -21.333 1.00 30.81 ? 216 SER B O     1 
ATOM   4128 C CB    . SER B 2 174 ? 11.925  -18.379 -23.331 1.00 31.18 ? 216 SER B CB    1 
ATOM   4129 O OG    . SER B 2 174 ? 11.663  -17.253 -24.160 1.00 33.07 ? 216 SER B OG    1 
ATOM   4130 N N     . ASN B 2 175 ? 11.123  -15.833 -21.082 1.00 30.74 ? 217 ASN B N     1 
ATOM   4131 C CA    . ASN B 2 175 ? 11.561  -14.490 -20.649 1.00 31.25 ? 217 ASN B CA    1 
ATOM   4132 C C     . ASN B 2 175 ? 12.339  -14.496 -19.342 1.00 30.72 ? 217 ASN B C     1 
ATOM   4133 O O     . ASN B 2 175 ? 11.965  -15.185 -18.390 1.00 29.31 ? 217 ASN B O     1 
ATOM   4134 C CB    . ASN B 2 175 ? 10.396  -13.485 -20.593 1.00 31.62 ? 217 ASN B CB    1 
ATOM   4135 C CG    . ASN B 2 175 ? 9.932   -13.045 -21.985 1.00 35.39 ? 217 ASN B CG    1 
ATOM   4136 O OD1   . ASN B 2 175 ? 10.029  -13.799 -22.958 1.00 40.54 ? 217 ASN B OD1   1 
ATOM   4137 N ND2   . ASN B 2 175 ? 9.427   -11.827 -22.080 1.00 37.77 ? 217 ASN B ND2   1 
ATOM   4138 N N     . LEU B 2 176 ? 13.425  -13.723 -19.320 1.00 30.64 ? 218 LEU B N     1 
ATOM   4139 C CA    . LEU B 2 176 ? 14.387  -13.744 -18.215 1.00 29.50 ? 218 LEU B CA    1 
ATOM   4140 C C     . LEU B 2 176 ? 14.729  -12.330 -17.759 1.00 28.26 ? 218 LEU B C     1 
ATOM   4141 O O     . LEU B 2 176 ? 15.105  -11.485 -18.559 1.00 27.28 ? 218 LEU B O     1 
ATOM   4142 C CB    . LEU B 2 176 ? 15.654  -14.512 -18.639 1.00 29.32 ? 218 LEU B CB    1 
ATOM   4143 C CG    . LEU B 2 176 ? 16.725  -15.067 -17.680 1.00 29.81 ? 218 LEU B CG    1 
ATOM   4144 C CD1   . LEU B 2 176 ? 17.822  -14.050 -17.474 1.00 28.84 ? 218 LEU B CD1   1 
ATOM   4145 C CD2   . LEU B 2 176 ? 16.175  -15.573 -16.324 1.00 24.72 ? 218 LEU B CD2   1 
ATOM   4146 N N     . SER B 2 177 ? 14.572  -12.084 -16.464 1.00 28.00 ? 219 SER B N     1 
ATOM   4147 C CA    . SER B 2 177 ? 14.904  -10.800 -15.863 1.00 26.84 ? 219 SER B CA    1 
ATOM   4148 C C     . SER B 2 177 ? 16.418  -10.663 -15.656 1.00 27.94 ? 219 SER B C     1 
ATOM   4149 O O     . SER B 2 177 ? 17.088  -11.611 -15.209 1.00 27.84 ? 219 SER B O     1 
ATOM   4150 C CB    . SER B 2 177 ? 14.177  -10.669 -14.520 1.00 27.15 ? 219 SER B CB    1 
ATOM   4151 O OG    . SER B 2 177 ? 14.512  -9.468  -13.860 1.00 22.47 ? 219 SER B OG    1 
ATOM   4152 N N     . MET B 2 178 ? 16.956  -9.488  -15.977 1.00 26.79 ? 220 MET B N     1 
ATOM   4153 C CA    . MET B 2 178 ? 18.338  -9.177  -15.609 1.00 28.74 ? 220 MET B CA    1 
ATOM   4154 C C     . MET B 2 178 ? 18.450  -8.360  -14.323 1.00 27.58 ? 220 MET B C     1 
ATOM   4155 O O     . MET B 2 178 ? 19.535  -7.902  -13.967 1.00 27.09 ? 220 MET B O     1 
ATOM   4156 C CB    . MET B 2 178 ? 19.109  -8.509  -16.749 1.00 28.00 ? 220 MET B CB    1 
ATOM   4157 C CG    . MET B 2 178 ? 18.277  -8.009  -17.896 1.00 29.81 ? 220 MET B CG    1 
ATOM   4158 S SD    . MET B 2 178 ? 19.329  -7.792  -19.344 1.00 32.32 ? 220 MET B SD    1 
ATOM   4159 C CE    . MET B 2 178 ? 20.324  -9.289  -19.296 1.00 33.74 ? 220 MET B CE    1 
ATOM   4160 N N     . ILE B 2 179 ? 17.321  -8.200  -13.633 1.00 27.62 ? 221 ILE B N     1 
ATOM   4161 C CA    . ILE B 2 179 ? 17.255  -7.434  -12.389 1.00 27.29 ? 221 ILE B CA    1 
ATOM   4162 C C     . ILE B 2 179 ? 17.593  -8.312  -11.174 1.00 27.08 ? 221 ILE B C     1 
ATOM   4163 O O     . ILE B 2 179 ? 16.743  -9.048  -10.668 1.00 27.33 ? 221 ILE B O     1 
ATOM   4164 C CB    . ILE B 2 179 ? 15.878  -6.714  -12.223 1.00 26.47 ? 221 ILE B CB    1 
ATOM   4165 C CG1   . ILE B 2 179 ? 15.727  -5.616  -13.281 1.00 25.30 ? 221 ILE B CG1   1 
ATOM   4166 C CG2   . ILE B 2 179 ? 15.722  -6.131  -10.816 1.00 24.86 ? 221 ILE B CG2   1 
ATOM   4167 C CD1   . ILE B 2 179 ? 14.458  -4.777  -13.141 1.00 28.07 ? 221 ILE B CD1   1 
ATOM   4168 N N     . SER B 2 180 ? 18.848  -8.230  -10.735 1.00 26.71 ? 222 SER B N     1 
ATOM   4169 C CA    . SER B 2 180 ? 19.334  -8.951  -9.559  1.00 27.01 ? 222 SER B CA    1 
ATOM   4170 C C     . SER B 2 180 ? 19.563  -7.988  -8.389  1.00 27.26 ? 222 SER B C     1 
ATOM   4171 O O     . SER B 2 180 ? 20.147  -6.916  -8.569  1.00 27.39 ? 222 SER B O     1 
ATOM   4172 C CB    . SER B 2 180 ? 20.628  -9.704  -9.895  1.00 26.74 ? 222 SER B CB    1 
ATOM   4173 O OG    . SER B 2 180 ? 21.168  -10.361 -8.759  1.00 26.24 ? 222 SER B OG    1 
ATOM   4174 N N     . HIS B 2 181 ? 19.091  -8.379  -7.202  1.00 27.82 ? 223 HIS B N     1 
ATOM   4175 C CA    . HIS B 2 181 ? 19.283  -7.625  -5.946  1.00 28.52 ? 223 HIS B CA    1 
ATOM   4176 C C     . HIS B 2 181 ? 18.728  -6.185  -6.003  1.00 28.00 ? 223 HIS B C     1 
ATOM   4177 O O     . HIS B 2 181 ? 19.264  -5.266  -5.368  1.00 27.52 ? 223 HIS B O     1 
ATOM   4178 C CB    . HIS B 2 181 ? 20.765  -7.652  -5.523  1.00 28.98 ? 223 HIS B CB    1 
ATOM   4179 C CG    . HIS B 2 181 ? 20.977  -7.735  -4.041  1.00 31.78 ? 223 HIS B CG    1 
ATOM   4180 N ND1   . HIS B 2 181 ? 20.837  -8.911  -3.334  1.00 34.86 ? 223 HIS B ND1   1 
ATOM   4181 C CD2   . HIS B 2 181 ? 21.344  -6.795  -3.136  1.00 34.26 ? 223 HIS B CD2   1 
ATOM   4182 C CE1   . HIS B 2 181 ? 21.096  -8.689  -2.056  1.00 35.09 ? 223 HIS B CE1   1 
ATOM   4183 N NE2   . HIS B 2 181 ? 21.406  -7.413  -1.909  1.00 33.98 ? 223 HIS B NE2   1 
ATOM   4184 N N     . GLY B 2 182 ? 17.646  -6.011  -6.763  1.00 27.75 ? 224 GLY B N     1 
ATOM   4185 C CA    . GLY B 2 182 ? 17.010  -4.706  -6.966  1.00 28.10 ? 224 GLY B CA    1 
ATOM   4186 C C     . GLY B 2 182 ? 17.604  -3.828  -8.061  1.00 27.84 ? 224 GLY B C     1 
ATOM   4187 O O     . GLY B 2 182 ? 17.141  -2.711  -8.277  1.00 27.50 ? 224 GLY B O     1 
ATOM   4188 N N     . GLN B 2 183 ? 18.627  -4.332  -8.752  1.00 28.28 ? 225 GLN B N     1 
ATOM   4189 C CA    . GLN B 2 183 ? 19.375  -3.554  -9.744  1.00 28.84 ? 225 GLN B CA    1 
ATOM   4190 C C     . GLN B 2 183 ? 19.528  -4.309  -11.063 1.00 28.78 ? 225 GLN B C     1 
ATOM   4191 O O     . GLN B 2 183 ? 19.604  -5.538  -11.074 1.00 28.52 ? 225 GLN B O     1 
ATOM   4192 C CB    . GLN B 2 183 ? 20.770  -3.207  -9.210  1.00 28.80 ? 225 GLN B CB    1 
ATOM   4193 C CG    . GLN B 2 183 ? 20.802  -2.308  -7.980  1.00 28.76 ? 225 GLN B CG    1 
ATOM   4194 C CD    . GLN B 2 183 ? 22.208  -2.144  -7.425  1.00 29.46 ? 225 GLN B CD    1 
ATOM   4195 O OE1   . GLN B 2 183 ? 23.178  -2.067  -8.181  1.00 32.13 ? 225 GLN B OE1   1 
ATOM   4196 N NE2   . GLN B 2 183 ? 22.325  -2.091  -6.100  1.00 26.06 ? 225 GLN B NE2   1 
ATOM   4197 N N     . ARG B 2 184 ? 19.587  -3.566  -12.166 1.00 28.97 ? 226 ARG B N     1 
ATOM   4198 C CA    . ARG B 2 184 ? 19.814  -4.150  -13.486 1.00 29.69 ? 226 ARG B CA    1 
ATOM   4199 C C     . ARG B 2 184 ? 21.231  -4.689  -13.584 1.00 29.11 ? 226 ARG B C     1 
ATOM   4200 O O     . ARG B 2 184 ? 22.172  -4.048  -13.119 1.00 29.32 ? 226 ARG B O     1 
ATOM   4201 C CB    . ARG B 2 184 ? 19.594  -3.105  -14.581 1.00 29.87 ? 226 ARG B CB    1 
ATOM   4202 C CG    . ARG B 2 184 ? 18.138  -2.911  -15.003 1.00 32.32 ? 226 ARG B CG    1 
ATOM   4203 C CD    . ARG B 2 184 ? 17.975  -1.687  -15.926 1.00 32.53 ? 226 ARG B CD    1 
ATOM   4204 N NE    . ARG B 2 184 ? 18.139  -0.414  -15.206 1.00 35.07 ? 226 ARG B NE    1 
ATOM   4205 C CZ    . ARG B 2 184 ? 18.087  0.798   -15.764 1.00 32.85 ? 226 ARG B CZ    1 
ATOM   4206 N NH1   . ARG B 2 184 ? 17.877  0.939   -17.070 1.00 31.64 ? 226 ARG B NH1   1 
ATOM   4207 N NH2   . ARG B 2 184 ? 18.248  1.877   -15.009 1.00 30.24 ? 226 ARG B NH2   1 
ATOM   4208 N N     . GLN B 2 185 ? 21.382  -5.870  -14.176 1.00 28.97 ? 227 GLN B N     1 
ATOM   4209 C CA    . GLN B 2 185 ? 22.716  -6.430  -14.434 1.00 29.08 ? 227 GLN B CA    1 
ATOM   4210 C C     . GLN B 2 185 ? 23.088  -6.304  -15.914 1.00 28.39 ? 227 GLN B C     1 
ATOM   4211 O O     . GLN B 2 185 ? 22.295  -6.646  -16.797 1.00 28.16 ? 227 GLN B O     1 
ATOM   4212 C CB    . GLN B 2 185 ? 22.819  -7.889  -13.967 1.00 29.37 ? 227 GLN B CB    1 
ATOM   4213 C CG    . GLN B 2 185 ? 22.604  -8.103  -12.464 1.00 30.76 ? 227 GLN B CG    1 
ATOM   4214 C CD    . GLN B 2 185 ? 23.547  -7.281  -11.589 1.00 34.21 ? 227 GLN B CD    1 
ATOM   4215 O OE1   . GLN B 2 185 ? 24.772  -7.350  -11.729 1.00 34.49 ? 227 GLN B OE1   1 
ATOM   4216 N NE2   . GLN B 2 185 ? 22.974  -6.506  -10.672 1.00 34.47 ? 227 GLN B NE2   1 
ATOM   4217 N N     . ARG B 2 186 ? 24.300  -5.812  -16.168 1.00 27.38 ? 228 ARG B N     1 
ATOM   4218 C CA    . ARG B 2 186 ? 24.778  -5.554  -17.527 1.00 26.58 ? 228 ARG B CA    1 
ATOM   4219 C C     . ARG B 2 186 ? 24.710  -6.801  -18.409 1.00 25.27 ? 228 ARG B C     1 
ATOM   4220 O O     . ARG B 2 186 ? 24.282  -6.721  -19.562 1.00 24.31 ? 228 ARG B O     1 
ATOM   4221 C CB    . ARG B 2 186 ? 26.204  -4.991  -17.500 1.00 27.04 ? 228 ARG B CB    1 
ATOM   4222 C CG    . ARG B 2 186 ? 26.551  -4.117  -18.697 1.00 27.88 ? 228 ARG B CG    1 
ATOM   4223 C CD    . ARG B 2 186 ? 28.054  -4.096  -18.970 1.00 31.60 ? 228 ARG B CD    1 
ATOM   4224 N NE    . ARG B 2 186 ? 28.508  -5.317  -19.643 1.00 33.97 ? 228 ARG B NE    1 
ATOM   4225 C CZ    . ARG B 2 186 ? 28.496  -5.512  -20.963 1.00 34.21 ? 228 ARG B CZ    1 
ATOM   4226 N NH1   . ARG B 2 186 ? 28.051  -4.567  -21.785 1.00 33.57 ? 228 ARG B NH1   1 
ATOM   4227 N NH2   . ARG B 2 186 ? 28.929  -6.660  -21.468 1.00 33.48 ? 228 ARG B NH2   1 
ATOM   4228 N N     . VAL B 2 187 ? 25.150  -7.934  -17.858 1.00 24.71 ? 229 VAL B N     1 
ATOM   4229 C CA    . VAL B 2 187 ? 24.999  -9.254  -18.494 1.00 24.54 ? 229 VAL B CA    1 
ATOM   4230 C C     . VAL B 2 187 ? 24.381  -10.284 -17.538 1.00 25.39 ? 229 VAL B C     1 
ATOM   4231 O O     . VAL B 2 187 ? 24.470  -10.155 -16.313 1.00 25.38 ? 229 VAL B O     1 
ATOM   4232 C CB    . VAL B 2 187 ? 26.338  -9.841  -19.061 1.00 23.78 ? 229 VAL B CB    1 
ATOM   4233 C CG1   . VAL B 2 187 ? 26.800  -9.085  -20.302 1.00 22.72 ? 229 VAL B CG1   1 
ATOM   4234 C CG2   . VAL B 2 187 ? 27.421  -9.902  -17.987 1.00 21.35 ? 229 VAL B CG2   1 
ATOM   4235 N N     . VAL B 2 188 ? 23.760  -11.305 -18.123 1.00 26.27 ? 230 VAL B N     1 
ATOM   4236 C CA    . VAL B 2 188 ? 23.190  -12.419 -17.384 1.00 26.33 ? 230 VAL B CA    1 
ATOM   4237 C C     . VAL B 2 188 ? 23.787  -13.734 -17.943 1.00 27.45 ? 230 VAL B C     1 
ATOM   4238 O O     . VAL B 2 188 ? 24.359  -13.743 -19.041 1.00 26.72 ? 230 VAL B O     1 
ATOM   4239 C CB    . VAL B 2 188 ? 21.633  -12.354 -17.428 1.00 26.88 ? 230 VAL B CB    1 
ATOM   4240 C CG1   . VAL B 2 188 ? 21.089  -12.892 -18.748 1.00 25.82 ? 230 VAL B CG1   1 
ATOM   4241 C CG2   . VAL B 2 188 ? 21.003  -13.055 -16.213 1.00 27.12 ? 230 VAL B CG2   1 
ATOM   4242 N N     . HIS B 2 189 ? 23.673  -14.830 -17.188 1.00 28.82 ? 231 HIS B N     1 
ATOM   4243 C CA    . HIS B 2 189 ? 24.390  -16.079 -17.517 1.00 29.29 ? 231 HIS B CA    1 
ATOM   4244 C C     . HIS B 2 189 ? 23.529  -17.352 -17.642 1.00 30.04 ? 231 HIS B C     1 
ATOM   4245 O O     . HIS B 2 189 ? 24.050  -18.422 -17.978 1.00 29.72 ? 231 HIS B O     1 
ATOM   4246 C CB    . HIS B 2 189 ? 25.539  -16.313 -16.521 1.00 28.58 ? 231 HIS B CB    1 
ATOM   4247 C CG    . HIS B 2 189 ? 26.640  -15.300 -16.622 1.00 28.25 ? 231 HIS B CG    1 
ATOM   4248 N ND1   . HIS B 2 189 ? 27.680  -15.415 -17.523 1.00 25.03 ? 231 HIS B ND1   1 
ATOM   4249 C CD2   . HIS B 2 189 ? 26.859  -14.148 -15.940 1.00 24.92 ? 231 HIS B CD2   1 
ATOM   4250 C CE1   . HIS B 2 189 ? 28.491  -14.381 -17.389 1.00 24.01 ? 231 HIS B CE1   1 
ATOM   4251 N NE2   . HIS B 2 189 ? 28.016  -13.597 -16.437 1.00 24.76 ? 231 HIS B NE2   1 
ATOM   4252 N N     . ASP B 2 190 ? 22.225  -17.230 -17.393 1.00 30.46 ? 232 ASP B N     1 
ATOM   4253 C CA    . ASP B 2 190 ? 21.322  -18.384 -17.375 1.00 31.32 ? 232 ASP B CA    1 
ATOM   4254 C C     . ASP B 2 190 ? 21.131  -19.027 -18.754 1.00 32.07 ? 232 ASP B C     1 
ATOM   4255 O O     . ASP B 2 190 ? 20.703  -18.360 -19.704 1.00 32.25 ? 232 ASP B O     1 
ATOM   4256 C CB    . ASP B 2 190 ? 19.957  -17.978 -16.801 1.00 30.76 ? 232 ASP B CB    1 
ATOM   4257 C CG    . ASP B 2 190 ? 18.953  -19.124 -16.806 1.00 32.33 ? 232 ASP B CG    1 
ATOM   4258 O OD1   . ASP B 2 190 ? 18.152  -19.207 -17.760 1.00 32.90 ? 232 ASP B OD1   1 
ATOM   4259 O OD2   . ASP B 2 190 ? 18.969  -19.953 -15.867 1.00 32.38 ? 232 ASP B OD2   1 
ATOM   4260 N N     . PHE B 2 191 ? 21.433  -20.323 -18.859 1.00 32.31 ? 233 PHE B N     1 
ATOM   4261 C CA    . PHE B 2 191 ? 21.082  -21.069 -20.068 1.00 32.69 ? 233 PHE B CA    1 
ATOM   4262 C C     . PHE B 2 191 ? 19.578  -21.374 -20.087 1.00 32.55 ? 233 PHE B C     1 
ATOM   4263 O O     . PHE B 2 191 ? 19.062  -22.040 -19.172 1.00 32.32 ? 233 PHE B O     1 
ATOM   4264 C CB    . PHE B 2 191 ? 21.907  -22.351 -20.236 1.00 33.44 ? 233 PHE B CB    1 
ATOM   4265 C CG    . PHE B 2 191 ? 21.756  -22.991 -21.602 1.00 35.74 ? 233 PHE B CG    1 
ATOM   4266 C CD1   . PHE B 2 191 ? 21.039  -24.177 -21.757 1.00 36.13 ? 233 PHE B CD1   1 
ATOM   4267 C CD2   . PHE B 2 191 ? 22.311  -22.389 -22.738 1.00 37.67 ? 233 PHE B CD2   1 
ATOM   4268 C CE1   . PHE B 2 191 ? 20.882  -24.761 -23.017 1.00 37.80 ? 233 PHE B CE1   1 
ATOM   4269 C CE2   . PHE B 2 191 ? 22.161  -22.964 -24.006 1.00 38.08 ? 233 PHE B CE2   1 
ATOM   4270 C CZ    . PHE B 2 191 ? 21.448  -24.152 -24.146 1.00 37.89 ? 233 PHE B CZ    1 
ATOM   4271 N N     . PRO B 2 192 ? 18.874  -20.892 -21.135 1.00 31.86 ? 234 PRO B N     1 
ATOM   4272 C CA    . PRO B 2 192 ? 17.417  -21.055 -21.257 1.00 31.56 ? 234 PRO B CA    1 
ATOM   4273 C C     . PRO B 2 192 ? 16.986  -22.518 -21.085 1.00 31.06 ? 234 PRO B C     1 
ATOM   4274 O O     . PRO B 2 192 ? 17.317  -23.372 -21.918 1.00 30.38 ? 234 PRO B O     1 
ATOM   4275 C CB    . PRO B 2 192 ? 17.120  -20.557 -22.686 1.00 31.24 ? 234 PRO B CB    1 
ATOM   4276 C CG    . PRO B 2 192 ? 18.459  -20.492 -23.376 1.00 30.54 ? 234 PRO B CG    1 
ATOM   4277 C CD    . PRO B 2 192 ? 19.436  -20.180 -22.297 1.00 31.21 ? 234 PRO B CD    1 
ATOM   4278 N N     . LYS B 2 193 ? 16.268  -22.807 -20.004 1.00 30.69 ? 235 LYS B N     1 
ATOM   4279 C CA    . LYS B 2 193 ? 15.839  -24.178 -19.758 1.00 30.94 ? 235 LYS B CA    1 
ATOM   4280 C C     . LYS B 2 193 ? 14.697  -24.593 -20.692 1.00 29.65 ? 235 LYS B C     1 
ATOM   4281 O O     . LYS B 2 193 ? 13.862  -23.768 -21.083 1.00 28.50 ? 235 LYS B O     1 
ATOM   4282 C CB    . LYS B 2 193 ? 15.519  -24.407 -18.279 1.00 30.61 ? 235 LYS B CB    1 
ATOM   4283 C CG    . LYS B 2 193 ? 16.787  -24.467 -17.417 1.00 33.38 ? 235 LYS B CG    1 
ATOM   4284 C CD    . LYS B 2 193 ? 16.542  -24.988 -16.004 1.00 33.61 ? 235 LYS B CD    1 
ATOM   4285 C CE    . LYS B 2 193 ? 16.313  -23.865 -14.991 1.00 36.71 ? 235 LYS B CE    1 
ATOM   4286 N NZ    . LYS B 2 193 ? 14.940  -23.288 -15.089 1.00 37.10 ? 235 LYS B NZ    1 
ATOM   4287 N N     . TYR B 2 194 ? 14.711  -25.869 -21.078 1.00 28.48 ? 236 TYR B N     1 
ATOM   4288 C CA    . TYR B 2 194 ? 13.698  -26.466 -21.958 1.00 27.72 ? 236 TYR B CA    1 
ATOM   4289 C C     . TYR B 2 194 ? 13.581  -25.730 -23.298 1.00 27.75 ? 236 TYR B C     1 
ATOM   4290 O O     . TYR B 2 194 ? 12.477  -25.506 -23.802 1.00 28.20 ? 236 TYR B O     1 
ATOM   4291 C CB    . TYR B 2 194 ? 12.331  -26.586 -21.237 1.00 26.88 ? 236 TYR B CB    1 
ATOM   4292 C CG    . TYR B 2 194 ? 12.468  -26.924 -19.765 1.00 25.76 ? 236 TYR B CG    1 
ATOM   4293 C CD1   . TYR B 2 194 ? 12.351  -25.933 -18.790 1.00 23.86 ? 236 TYR B CD1   1 
ATOM   4294 C CD2   . TYR B 2 194 ? 12.757  -28.223 -19.349 1.00 25.24 ? 236 TYR B CD2   1 
ATOM   4295 C CE1   . TYR B 2 194 ? 12.495  -26.225 -17.438 1.00 23.24 ? 236 TYR B CE1   1 
ATOM   4296 C CE2   . TYR B 2 194 ? 12.906  -28.523 -17.995 1.00 26.36 ? 236 TYR B CE2   1 
ATOM   4297 C CZ    . TYR B 2 194 ? 12.774  -27.516 -17.050 1.00 24.94 ? 236 TYR B CZ    1 
ATOM   4298 O OH    . TYR B 2 194 ? 12.920  -27.801 -15.717 1.00 25.11 ? 236 TYR B OH    1 
ATOM   4299 N N     . SER B 2 195 ? 14.729  -25.357 -23.865 1.00 27.60 ? 237 SER B N     1 
ATOM   4300 C CA    . SER B 2 195 ? 14.769  -24.636 -25.142 1.00 27.64 ? 237 SER B CA    1 
ATOM   4301 C C     . SER B 2 195 ? 15.518  -25.396 -26.256 1.00 27.43 ? 237 SER B C     1 
ATOM   4302 O O     . SER B 2 195 ? 16.051  -24.783 -27.191 1.00 26.41 ? 237 SER B O     1 
ATOM   4303 C CB    . SER B 2 195 ? 15.333  -23.215 -24.953 1.00 27.69 ? 237 SER B CB    1 
ATOM   4304 O OG    . SER B 2 195 ? 16.744  -23.214 -24.811 1.00 28.12 ? 237 SER B OG    1 
ATOM   4305 N N     . VAL B 2 196 ? 15.544  -26.726 -26.148 1.00 27.67 ? 238 VAL B N     1 
ATOM   4306 C CA    . VAL B 2 196 ? 16.133  -27.577 -27.180 1.00 28.04 ? 238 VAL B CA    1 
ATOM   4307 C C     . VAL B 2 196 ? 15.166  -27.575 -28.361 1.00 28.10 ? 238 VAL B C     1 
ATOM   4308 O O     . VAL B 2 196 ? 14.079  -28.155 -28.285 1.00 29.63 ? 238 VAL B O     1 
ATOM   4309 C CB    . VAL B 2 196 ? 16.387  -29.032 -26.698 1.00 27.76 ? 238 VAL B CB    1 
ATOM   4310 C CG1   . VAL B 2 196 ? 17.385  -29.720 -27.620 1.00 28.55 ? 238 VAL B CG1   1 
ATOM   4311 C CG2   . VAL B 2 196 ? 16.904  -29.058 -25.263 1.00 29.74 ? 238 VAL B CG2   1 
ATOM   4312 N N     . LYS B 2 197 ? 15.573  -26.900 -29.434 1.00 27.04 ? 239 LYS B N     1 
ATOM   4313 C CA    . LYS B 2 197 ? 14.739  -26.603 -30.613 1.00 26.14 ? 239 LYS B CA    1 
ATOM   4314 C C     . LYS B 2 197 ? 14.800  -25.119 -30.943 1.00 25.46 ? 239 LYS B C     1 
ATOM   4315 O O     . LYS B 2 197 ? 14.740  -24.746 -32.116 1.00 25.02 ? 239 LYS B O     1 
ATOM   4316 C CB    . LYS B 2 197 ? 13.277  -27.064 -30.469 1.00 25.94 ? 239 LYS B CB    1 
ATOM   4317 C CG    . LYS B 2 197 ? 12.986  -28.393 -31.166 1.00 26.26 ? 239 LYS B CG    1 
ATOM   4318 C CD    . LYS B 2 197 ? 11.612  -28.941 -30.807 1.00 26.03 ? 239 LYS B CD    1 
ATOM   4319 C CE    . LYS B 2 197 ? 11.418  -30.338 -31.392 1.00 25.66 ? 239 LYS B CE    1 
ATOM   4320 N NZ    . LYS B 2 197 ? 10.020  -30.832 -31.259 1.00 24.24 ? 239 LYS B NZ    1 
ATOM   4321 N N     . VAL B 2 198 ? 14.929  -24.285 -29.908 1.00 24.33 ? 240 VAL B N     1 
ATOM   4322 C CA    . VAL B 2 198 ? 15.077  -22.836 -30.082 1.00 24.22 ? 240 VAL B CA    1 
ATOM   4323 C C     . VAL B 2 198 ? 16.533  -22.479 -30.389 1.00 24.94 ? 240 VAL B C     1 
ATOM   4324 O O     . VAL B 2 198 ? 16.836  -21.332 -30.731 1.00 24.35 ? 240 VAL B O     1 
ATOM   4325 C CB    . VAL B 2 198 ? 14.586  -22.024 -28.838 1.00 23.68 ? 240 VAL B CB    1 
ATOM   4326 C CG1   . VAL B 2 198 ? 14.442  -20.541 -29.177 1.00 21.39 ? 240 VAL B CG1   1 
ATOM   4327 C CG2   . VAL B 2 198 ? 13.262  -22.564 -28.317 1.00 23.86 ? 240 VAL B CG2   1 
ATOM   4328 N N     . LEU B 2 199 ? 17.423  -23.468 -30.279 1.00 26.18 ? 241 LEU B N     1 
ATOM   4329 C CA    . LEU B 2 199 ? 18.863  -23.257 -30.467 1.00 27.70 ? 241 LEU B CA    1 
ATOM   4330 C C     . LEU B 2 199 ? 19.237  -22.464 -31.741 1.00 26.94 ? 241 LEU B C     1 
ATOM   4331 O O     . LEU B 2 199 ? 20.011  -21.507 -31.652 1.00 28.34 ? 241 LEU B O     1 
ATOM   4332 C CB    . LEU B 2 199 ? 19.648  -24.587 -30.371 1.00 26.62 ? 241 LEU B CB    1 
ATOM   4333 C CG    . LEU B 2 199 ? 20.280  -25.024 -29.037 1.00 30.06 ? 241 LEU B CG    1 
ATOM   4334 C CD1   . LEU B 2 199 ? 19.297  -25.091 -27.867 1.00 29.94 ? 241 LEU B CD1   1 
ATOM   4335 C CD2   . LEU B 2 199 ? 20.996  -26.366 -29.194 1.00 29.01 ? 241 LEU B CD2   1 
ATOM   4336 N N     . PRO B 2 200 ? 18.713  -22.859 -32.923 1.00 26.19 ? 242 PRO B N     1 
ATOM   4337 C CA    . PRO B 2 200 ? 19.102  -22.105 -34.136 1.00 26.08 ? 242 PRO B CA    1 
ATOM   4338 C C     . PRO B 2 200 ? 18.834  -20.588 -34.137 1.00 25.00 ? 242 PRO B C     1 
ATOM   4339 O O     . PRO B 2 200 ? 19.522  -19.865 -34.849 1.00 24.58 ? 242 PRO B O     1 
ATOM   4340 C CB    . PRO B 2 200 ? 18.330  -22.812 -35.264 1.00 26.43 ? 242 PRO B CB    1 
ATOM   4341 C CG    . PRO B 2 200 ? 18.072  -24.206 -34.721 1.00 26.75 ? 242 PRO B CG    1 
ATOM   4342 C CD    . PRO B 2 200 ? 17.836  -24.004 -33.250 1.00 25.89 ? 242 PRO B CD    1 
ATOM   4343 N N     . TRP B 2 201 ? 17.862  -20.111 -33.360 1.00 25.22 ? 243 TRP B N     1 
ATOM   4344 C CA    . TRP B 2 201 ? 17.601  -18.656 -33.246 1.00 25.29 ? 243 TRP B CA    1 
ATOM   4345 C C     . TRP B 2 201 ? 18.475  -17.966 -32.171 1.00 24.97 ? 243 TRP B C     1 
ATOM   4346 O O     . TRP B 2 201 ? 18.427  -16.739 -32.004 1.00 24.64 ? 243 TRP B O     1 
ATOM   4347 C CB    . TRP B 2 201 ? 16.111  -18.375 -32.951 1.00 24.82 ? 243 TRP B CB    1 
ATOM   4348 C CG    . TRP B 2 201 ? 15.168  -18.821 -34.013 1.00 24.89 ? 243 TRP B CG    1 
ATOM   4349 C CD1   . TRP B 2 201 ? 14.567  -18.039 -34.959 1.00 25.35 ? 243 TRP B CD1   1 
ATOM   4350 C CD2   . TRP B 2 201 ? 14.715  -20.161 -34.251 1.00 23.82 ? 243 TRP B CD2   1 
ATOM   4351 N NE1   . TRP B 2 201 ? 13.774  -18.812 -35.781 1.00 23.57 ? 243 TRP B NE1   1 
ATOM   4352 C CE2   . TRP B 2 201 ? 13.847  -20.118 -35.364 1.00 23.62 ? 243 TRP B CE2   1 
ATOM   4353 C CE3   . TRP B 2 201 ? 14.959  -21.393 -33.631 1.00 24.20 ? 243 TRP B CE3   1 
ATOM   4354 C CZ2   . TRP B 2 201 ? 13.215  -21.261 -35.866 1.00 24.88 ? 243 TRP B CZ2   1 
ATOM   4355 C CZ3   . TRP B 2 201 ? 14.335  -22.525 -34.132 1.00 24.48 ? 243 TRP B CZ3   1 
ATOM   4356 C CH2   . TRP B 2 201 ? 13.476  -22.452 -35.240 1.00 23.76 ? 243 TRP B CH2   1 
ATOM   4357 N N     . LEU B 2 202 ? 19.259  -18.752 -31.440 1.00 24.33 ? 244 LEU B N     1 
ATOM   4358 C CA    . LEU B 2 202 ? 20.045  -18.209 -30.329 1.00 25.88 ? 244 LEU B CA    1 
ATOM   4359 C C     . LEU B 2 202 ? 21.392  -17.616 -30.763 1.00 26.66 ? 244 LEU B C     1 
ATOM   4360 O O     . LEU B 2 202 ? 22.117  -18.190 -31.589 1.00 25.20 ? 244 LEU B O     1 
ATOM   4361 C CB    . LEU B 2 202 ? 20.219  -19.250 -29.204 1.00 24.66 ? 244 LEU B CB    1 
ATOM   4362 C CG    . LEU B 2 202 ? 18.940  -19.570 -28.418 1.00 26.29 ? 244 LEU B CG    1 
ATOM   4363 C CD1   . LEU B 2 202 ? 19.100  -20.783 -27.513 1.00 21.48 ? 244 LEU B CD1   1 
ATOM   4364 C CD2   . LEU B 2 202 ? 18.427  -18.350 -27.623 1.00 28.75 ? 244 LEU B CD2   1 
ATOM   4365 N N     . SER B 2 203 ? 21.711  -16.452 -30.197 1.00 27.49 ? 245 SER B N     1 
ATOM   4366 C CA    . SER B 2 203 ? 22.971  -15.785 -30.484 1.00 26.94 ? 245 SER B CA    1 
ATOM   4367 C C     . SER B 2 203 ? 24.149  -16.587 -29.912 1.00 27.86 ? 245 SER B C     1 
ATOM   4368 O O     . SER B 2 203 ? 23.967  -17.378 -28.967 1.00 28.15 ? 245 SER B O     1 
ATOM   4369 C CB    . SER B 2 203 ? 22.952  -14.344 -29.967 1.00 26.17 ? 245 SER B CB    1 
ATOM   4370 O OG    . SER B 2 203 ? 23.064  -14.284 -28.559 1.00 25.17 ? 245 SER B OG    1 
ATOM   4371 N N     . PRO B 2 204 ? 25.351  -16.416 -30.504 1.00 27.75 ? 246 PRO B N     1 
ATOM   4372 C CA    . PRO B 2 204 ? 26.543  -17.123 -30.040 1.00 27.87 ? 246 PRO B CA    1 
ATOM   4373 C C     . PRO B 2 204 ? 26.825  -16.940 -28.547 1.00 28.21 ? 246 PRO B C     1 
ATOM   4374 O O     . PRO B 2 204 ? 27.202  -17.909 -27.883 1.00 28.46 ? 246 PRO B O     1 
ATOM   4375 C CB    . PRO B 2 204 ? 27.665  -16.500 -30.874 1.00 28.16 ? 246 PRO B CB    1 
ATOM   4376 C CG    . PRO B 2 204 ? 26.998  -16.034 -32.108 1.00 26.92 ? 246 PRO B CG    1 
ATOM   4377 C CD    . PRO B 2 204 ? 25.653  -15.555 -31.664 1.00 27.70 ? 246 PRO B CD    1 
ATOM   4378 N N     . GLU B 2 205 ? 26.626  -15.726 -28.028 1.00 27.78 ? 247 GLU B N     1 
ATOM   4379 C CA    . GLU B 2 205 ? 26.878  -15.438 -26.605 1.00 28.30 ? 247 GLU B CA    1 
ATOM   4380 C C     . GLU B 2 205 ? 25.858  -16.029 -25.620 1.00 28.38 ? 247 GLU B C     1 
ATOM   4381 O O     . GLU B 2 205 ? 26.162  -16.168 -24.435 1.00 28.87 ? 247 GLU B O     1 
ATOM   4382 C CB    . GLU B 2 205 ? 27.081  -13.929 -26.351 1.00 28.33 ? 247 GLU B CB    1 
ATOM   4383 C CG    . GLU B 2 205 ? 25.829  -13.051 -26.500 1.00 29.53 ? 247 GLU B CG    1 
ATOM   4384 C CD    . GLU B 2 205 ? 25.560  -12.591 -27.934 1.00 30.24 ? 247 GLU B CD    1 
ATOM   4385 O OE1   . GLU B 2 205 ? 24.540  -11.890 -28.136 1.00 29.91 ? 247 GLU B OE1   1 
ATOM   4386 O OE2   . GLU B 2 205 ? 26.351  -12.926 -28.851 1.00 26.05 ? 247 GLU B OE2   1 
ATOM   4387 N N     . VAL B 2 206 ? 24.657  -16.368 -26.094 1.00 28.44 ? 248 VAL B N     1 
ATOM   4388 C CA    . VAL B 2 206 ? 23.726  -17.140 -25.267 1.00 29.03 ? 248 VAL B CA    1 
ATOM   4389 C C     . VAL B 2 206 ? 24.129  -18.624 -25.277 1.00 30.01 ? 248 VAL B C     1 
ATOM   4390 O O     . VAL B 2 206 ? 24.075  -19.305 -24.243 1.00 28.35 ? 248 VAL B O     1 
ATOM   4391 C CB    . VAL B 2 206 ? 22.235  -16.972 -25.695 1.00 29.22 ? 248 VAL B CB    1 
ATOM   4392 C CG1   . VAL B 2 206 ? 21.307  -17.730 -24.744 1.00 26.84 ? 248 VAL B CG1   1 
ATOM   4393 C CG2   . VAL B 2 206 ? 21.844  -15.512 -25.732 1.00 27.13 ? 248 VAL B CG2   1 
ATOM   4394 N N     . LEU B 2 207 ? 24.546  -19.103 -26.451 1.00 30.91 ? 249 LEU B N     1 
ATOM   4395 C CA    . LEU B 2 207 ? 24.933  -20.501 -26.633 1.00 31.71 ? 249 LEU B CA    1 
ATOM   4396 C C     . LEU B 2 207 ? 26.222  -20.880 -25.902 1.00 31.65 ? 249 LEU B C     1 
ATOM   4397 O O     . LEU B 2 207 ? 26.250  -21.887 -25.187 1.00 31.10 ? 249 LEU B O     1 
ATOM   4398 C CB    . LEU B 2 207 ? 25.030  -20.859 -28.120 1.00 31.74 ? 249 LEU B CB    1 
ATOM   4399 C CG    . LEU B 2 207 ? 23.722  -20.977 -28.916 1.00 33.82 ? 249 LEU B CG    1 
ATOM   4400 C CD1   . LEU B 2 207 ? 24.023  -20.984 -30.415 1.00 30.04 ? 249 LEU B CD1   1 
ATOM   4401 C CD2   . LEU B 2 207 ? 22.891  -22.212 -28.512 1.00 32.60 ? 249 LEU B CD2   1 
ATOM   4402 N N     . GLN B 2 208 ? 27.282  -20.090 -26.072 1.00 32.12 ? 250 GLN B N     1 
ATOM   4403 C CA    . GLN B 2 208 ? 28.552  -20.404 -25.403 1.00 33.54 ? 250 GLN B CA    1 
ATOM   4404 C C     . GLN B 2 208 ? 28.477  -20.106 -23.903 1.00 33.01 ? 250 GLN B C     1 
ATOM   4405 O O     . GLN B 2 208 ? 28.901  -19.044 -23.419 1.00 32.86 ? 250 GLN B O     1 
ATOM   4406 C CB    . GLN B 2 208 ? 29.777  -19.775 -26.096 1.00 33.19 ? 250 GLN B CB    1 
ATOM   4407 C CG    . GLN B 2 208 ? 29.723  -18.268 -26.310 1.00 36.73 ? 250 GLN B CG    1 
ATOM   4408 C CD    . GLN B 2 208 ? 30.670  -17.791 -27.400 1.00 35.77 ? 250 GLN B CD    1 
ATOM   4409 O OE1   . GLN B 2 208 ? 31.808  -18.254 -27.501 1.00 38.75 ? 250 GLN B OE1   1 
ATOM   4410 N NE2   . GLN B 2 208 ? 30.204  -16.849 -28.216 1.00 36.47 ? 250 GLN B NE2   1 
ATOM   4411 N N     . GLN B 2 209 ? 27.899  -21.072 -23.191 1.00 32.75 ? 251 GLN B N     1 
ATOM   4412 C CA    . GLN B 2 209 ? 27.757  -21.023 -21.745 1.00 32.10 ? 251 GLN B CA    1 
ATOM   4413 C C     . GLN B 2 209 ? 29.111  -21.027 -21.078 1.00 31.02 ? 251 GLN B C     1 
ATOM   4414 O O     . GLN B 2 209 ? 30.076  -21.578 -21.622 1.00 30.45 ? 251 GLN B O     1 
ATOM   4415 C CB    . GLN B 2 209 ? 26.916  -22.196 -21.231 1.00 31.94 ? 251 GLN B CB    1 
ATOM   4416 C CG    . GLN B 2 209 ? 25.423  -21.904 -21.154 1.00 33.79 ? 251 GLN B CG    1 
ATOM   4417 C CD    . GLN B 2 209 ? 25.094  -20.567 -20.479 1.00 34.80 ? 251 GLN B CD    1 
ATOM   4418 O OE1   . GLN B 2 209 ? 24.444  -19.700 -21.076 1.00 37.43 ? 251 GLN B OE1   1 
ATOM   4419 N NE2   . GLN B 2 209 ? 25.542  -20.398 -19.239 1.00 30.87 ? 251 GLN B NE2   1 
ATOM   4420 N N     . ASN B 2 210 ? 29.161  -20.403 -19.900 1.00 30.32 ? 252 ASN B N     1 
ATOM   4421 C CA    . ASN B 2 210 ? 30.382  -20.252 -19.100 1.00 29.76 ? 252 ASN B CA    1 
ATOM   4422 C C     . ASN B 2 210 ? 31.333  -19.173 -19.628 1.00 28.96 ? 252 ASN B C     1 
ATOM   4423 O O     . ASN B 2 210 ? 32.367  -18.900 -19.017 1.00 29.89 ? 252 ASN B O     1 
ATOM   4424 C CB    . ASN B 2 210 ? 31.105  -21.603 -18.920 1.00 30.04 ? 252 ASN B CB    1 
ATOM   4425 C CG    . ASN B 2 210 ? 30.141  -22.733 -18.522 1.00 30.67 ? 252 ASN B CG    1 
ATOM   4426 O OD1   . ASN B 2 210 ? 29.146  -22.520 -17.734 1.00 30.42 ? 252 ASN B OD1   1 
ATOM   4427 N ND2   . ASN B 2 210 ? 30.428  -23.938 -19.075 1.00 29.92 ? 252 ASN B ND2   1 
ATOM   4428 N N     . LEU B 2 211 ? 30.975  -18.559 -20.755 1.00 29.05 ? 253 LEU B N     1 
ATOM   4429 C CA    . LEU B 2 211 ? 31.698  -17.389 -21.259 1.00 28.49 ? 253 LEU B CA    1 
ATOM   4430 C C     . LEU B 2 211 ? 31.032  -16.064 -20.846 1.00 28.49 ? 253 LEU B C     1 
ATOM   4431 O O     . LEU B 2 211 ? 30.461  -15.969 -19.755 1.00 28.97 ? 253 LEU B O     1 
ATOM   4432 C CB    . LEU B 2 211 ? 31.947  -17.465 -22.774 1.00 28.17 ? 253 LEU B CB    1 
ATOM   4433 C CG    . LEU B 2 211 ? 33.012  -18.433 -23.315 1.00 28.19 ? 253 LEU B CG    1 
ATOM   4434 C CD1   . LEU B 2 211 ? 33.457  -17.994 -24.705 1.00 28.65 ? 253 LEU B CD1   1 
ATOM   4435 C CD2   . LEU B 2 211 ? 34.225  -18.562 -22.406 1.00 27.22 ? 253 LEU B CD2   1 
ATOM   4436 N N     . GLN B 2 212 ? 31.110  -15.057 -21.714 1.00 27.83 ? 254 GLN B N     1 
ATOM   4437 C CA    . GLN B 2 212 ? 30.844  -13.657 -21.341 1.00 28.08 ? 254 GLN B CA    1 
ATOM   4438 C C     . GLN B 2 212 ? 29.412  -13.312 -20.883 1.00 27.23 ? 254 GLN B C     1 
ATOM   4439 O O     . GLN B 2 212 ? 29.215  -12.349 -20.135 1.00 26.87 ? 254 GLN B O     1 
ATOM   4440 C CB    . GLN B 2 212 ? 31.294  -12.719 -22.465 1.00 27.43 ? 254 GLN B CB    1 
ATOM   4441 C CG    . GLN B 2 212 ? 30.869  -13.178 -23.857 1.00 29.33 ? 254 GLN B CG    1 
ATOM   4442 C CD    . GLN B 2 212 ? 31.336  -12.241 -24.947 1.00 30.23 ? 254 GLN B CD    1 
ATOM   4443 O OE1   . GLN B 2 212 ? 32.460  -11.721 -24.899 1.00 34.64 ? 254 GLN B OE1   1 
ATOM   4444 N NE2   . GLN B 2 212 ? 30.480  -12.018 -25.944 1.00 27.63 ? 254 GLN B NE2   1 
ATOM   4445 N N     . GLY B 2 213 ? 28.429  -14.098 -21.317 1.00 26.16 ? 255 GLY B N     1 
ATOM   4446 C CA    . GLY B 2 213 ? 27.028  -13.836 -20.981 1.00 26.43 ? 255 GLY B CA    1 
ATOM   4447 C C     . GLY B 2 213 ? 26.349  -12.958 -22.016 1.00 26.14 ? 255 GLY B C     1 
ATOM   4448 O O     . GLY B 2 213 ? 26.923  -12.682 -23.067 1.00 26.70 ? 255 GLY B O     1 
ATOM   4449 N N     . TYR B 2 214 ? 25.133  -12.504 -21.717 1.00 26.36 ? 256 TYR B N     1 
ATOM   4450 C CA    . TYR B 2 214 ? 24.305  -11.806 -22.720 1.00 26.95 ? 256 TYR B CA    1 
ATOM   4451 C C     . TYR B 2 214 ? 23.377  -10.708 -22.158 1.00 28.03 ? 256 TYR B C     1 
ATOM   4452 O O     . TYR B 2 214 ? 23.219  -10.559 -20.941 1.00 28.22 ? 256 TYR B O     1 
ATOM   4453 C CB    . TYR B 2 214 ? 23.507  -12.822 -23.568 1.00 24.79 ? 256 TYR B CB    1 
ATOM   4454 C CG    . TYR B 2 214 ? 22.587  -13.713 -22.763 1.00 23.98 ? 256 TYR B CG    1 
ATOM   4455 C CD1   . TYR B 2 214 ? 21.223  -13.428 -22.657 1.00 20.56 ? 256 TYR B CD1   1 
ATOM   4456 C CD2   . TYR B 2 214 ? 23.081  -14.843 -22.095 1.00 24.09 ? 256 TYR B CD2   1 
ATOM   4457 C CE1   . TYR B 2 214 ? 20.375  -14.243 -21.915 1.00 18.16 ? 256 TYR B CE1   1 
ATOM   4458 C CE2   . TYR B 2 214 ? 22.245  -15.658 -21.344 1.00 21.44 ? 256 TYR B CE2   1 
ATOM   4459 C CZ    . TYR B 2 214 ? 20.892  -15.358 -21.261 1.00 22.21 ? 256 TYR B CZ    1 
ATOM   4460 O OH    . TYR B 2 214 ? 20.066  -16.170 -20.513 1.00 20.10 ? 256 TYR B OH    1 
ATOM   4461 N N     . ASP B 2 215 ? 22.796  -9.933  -23.075 1.00 28.73 ? 257 ASP B N     1 
ATOM   4462 C CA    . ASP B 2 215 ? 21.817  -8.888  -22.760 1.00 29.03 ? 257 ASP B CA    1 
ATOM   4463 C C     . ASP B 2 215 ? 20.729  -8.860  -23.851 1.00 28.17 ? 257 ASP B C     1 
ATOM   4464 O O     . ASP B 2 215 ? 20.609  -9.801  -24.644 1.00 27.88 ? 257 ASP B O     1 
ATOM   4465 C CB    . ASP B 2 215 ? 22.498  -7.517  -22.610 1.00 28.76 ? 257 ASP B CB    1 
ATOM   4466 C CG    . ASP B 2 215 ? 23.401  -7.168  -23.802 1.00 34.20 ? 257 ASP B CG    1 
ATOM   4467 O OD1   . ASP B 2 215 ? 22.996  -7.398  -24.972 1.00 35.15 ? 257 ASP B OD1   1 
ATOM   4468 O OD2   . ASP B 2 215 ? 24.526  -6.658  -23.568 1.00 38.30 ? 257 ASP B OD2   1 
ATOM   4469 N N     . ALA B 2 216 ? 19.954  -7.778  -23.891 1.00 26.91 ? 258 ALA B N     1 
ATOM   4470 C CA    . ALA B 2 216 ? 18.820  -7.640  -24.801 1.00 25.82 ? 258 ALA B CA    1 
ATOM   4471 C C     . ALA B 2 216 ? 19.219  -7.742  -26.273 1.00 26.68 ? 258 ALA B C     1 
ATOM   4472 O O     . ALA B 2 216 ? 18.413  -8.117  -27.122 1.00 25.34 ? 258 ALA B O     1 
ATOM   4473 C CB    . ALA B 2 216 ? 18.114  -6.329  -24.540 1.00 25.42 ? 258 ALA B CB    1 
ATOM   4474 N N     . LYS B 2 217 ? 20.468  -7.403  -26.581 1.00 28.06 ? 259 LYS B N     1 
ATOM   4475 C CA    . LYS B 2 217 ? 20.927  -7.407  -27.969 1.00 28.19 ? 259 LYS B CA    1 
ATOM   4476 C C     . LYS B 2 217 ? 21.059  -8.832  -28.536 1.00 29.19 ? 259 LYS B C     1 
ATOM   4477 O O     . LYS B 2 217 ? 21.261  -9.021  -29.746 1.00 29.27 ? 259 LYS B O     1 
ATOM   4478 C CB    . LYS B 2 217 ? 22.208  -6.580  -28.104 1.00 29.18 ? 259 LYS B CB    1 
ATOM   4479 C CG    . LYS B 2 217 ? 21.937  -5.067  -28.135 1.00 27.87 ? 259 LYS B CG    1 
ATOM   4480 C CD    . LYS B 2 217 ? 23.056  -4.308  -27.470 1.00 34.01 ? 259 LYS B CD    1 
ATOM   4481 C CE    . LYS B 2 217 ? 23.246  -2.925  -28.082 1.00 35.45 ? 259 LYS B CE    1 
ATOM   4482 N NZ    . LYS B 2 217 ? 24.662  -2.456  -27.956 1.00 33.55 ? 259 LYS B NZ    1 
ATOM   4483 N N     . SER B 2 218 ? 20.906  -9.827  -27.659 1.00 28.16 ? 260 SER B N     1 
ATOM   4484 C CA    . SER B 2 218 ? 20.831  -11.220 -28.076 1.00 28.32 ? 260 SER B CA    1 
ATOM   4485 C C     . SER B 2 218 ? 19.493  -11.489 -28.777 1.00 29.18 ? 260 SER B C     1 
ATOM   4486 O O     . SER B 2 218 ? 19.445  -12.268 -29.731 1.00 29.14 ? 260 SER B O     1 
ATOM   4487 C CB    . SER B 2 218 ? 21.027  -12.165 -26.883 1.00 27.88 ? 260 SER B CB    1 
ATOM   4488 O OG    . SER B 2 218 ? 19.931  -12.111 -25.984 1.00 29.54 ? 260 SER B OG    1 
ATOM   4489 N N     . ASP B 2 219 ? 18.424  -10.839 -28.296 1.00 28.73 ? 261 ASP B N     1 
ATOM   4490 C CA    . ASP B 2 219 ? 17.102  -10.895 -28.923 1.00 29.09 ? 261 ASP B CA    1 
ATOM   4491 C C     . ASP B 2 219 ? 17.116  -10.283 -30.312 1.00 29.18 ? 261 ASP B C     1 
ATOM   4492 O O     . ASP B 2 219 ? 16.288  -10.633 -31.166 1.00 28.03 ? 261 ASP B O     1 
ATOM   4493 C CB    . ASP B 2 219 ? 16.074  -10.112 -28.097 1.00 30.20 ? 261 ASP B CB    1 
ATOM   4494 C CG    . ASP B 2 219 ? 15.623  -10.840 -26.846 1.00 29.72 ? 261 ASP B CG    1 
ATOM   4495 O OD1   . ASP B 2 219 ? 15.620  -12.094 -26.805 1.00 24.77 ? 261 ASP B OD1   1 
ATOM   4496 O OD2   . ASP B 2 219 ? 15.238  -10.129 -25.900 1.00 33.35 ? 261 ASP B OD2   1 
ATOM   4497 N N     . ILE B 2 220 ? 18.043  -9.351  -30.520 1.00 27.66 ? 262 ILE B N     1 
ATOM   4498 C CA    . ILE B 2 220 ? 18.120  -8.606  -31.768 1.00 27.65 ? 262 ILE B CA    1 
ATOM   4499 C C     . ILE B 2 220 ? 18.669  -9.515  -32.858 1.00 28.05 ? 262 ILE B C     1 
ATOM   4500 O O     . ILE B 2 220 ? 18.210  -9.470  -34.003 1.00 29.60 ? 262 ILE B O     1 
ATOM   4501 C CB    . ILE B 2 220 ? 18.928  -7.285  -31.596 1.00 27.18 ? 262 ILE B CB    1 
ATOM   4502 C CG1   . ILE B 2 220 ? 18.183  -6.344  -30.640 1.00 25.96 ? 262 ILE B CG1   1 
ATOM   4503 C CG2   . ILE B 2 220 ? 19.232  -6.602  -32.959 1.00 25.06 ? 262 ILE B CG2   1 
ATOM   4504 C CD1   . ILE B 2 220 ? 16.715  -6.114  -31.000 1.00 21.01 ? 262 ILE B CD1   1 
ATOM   4505 N N     . TYR B 2 221 ? 19.627  -10.356 -32.473 1.00 27.16 ? 263 TYR B N     1 
ATOM   4506 C CA    . TYR B 2 221 ? 20.177  -11.403 -33.328 1.00 26.44 ? 263 TYR B CA    1 
ATOM   4507 C C     . TYR B 2 221 ? 19.090  -12.417 -33.727 1.00 26.58 ? 263 TYR B C     1 
ATOM   4508 O O     . TYR B 2 221 ? 19.062  -12.896 -34.860 1.00 27.36 ? 263 TYR B O     1 
ATOM   4509 C CB    . TYR B 2 221 ? 21.322  -12.092 -32.588 1.00 26.54 ? 263 TYR B CB    1 
ATOM   4510 C CG    . TYR B 2 221 ? 21.988  -13.211 -33.341 1.00 26.63 ? 263 TYR B CG    1 
ATOM   4511 C CD1   . TYR B 2 221 ? 23.202  -13.009 -33.998 1.00 25.33 ? 263 TYR B CD1   1 
ATOM   4512 C CD2   . TYR B 2 221 ? 21.416  -14.481 -33.382 1.00 28.26 ? 263 TYR B CD2   1 
ATOM   4513 C CE1   . TYR B 2 221 ? 23.822  -14.044 -34.689 1.00 28.87 ? 263 TYR B CE1   1 
ATOM   4514 C CE2   . TYR B 2 221 ? 22.026  -15.523 -34.074 1.00 29.89 ? 263 TYR B CE2   1 
ATOM   4515 C CZ    . TYR B 2 221 ? 23.225  -15.300 -34.724 1.00 27.89 ? 263 TYR B CZ    1 
ATOM   4516 O OH    . TYR B 2 221 ? 23.824  -16.342 -35.399 1.00 27.90 ? 263 TYR B OH    1 
ATOM   4517 N N     . SER B 2 222 ? 18.194  -12.725 -32.794 1.00 25.74 ? 264 SER B N     1 
ATOM   4518 C CA    . SER B 2 222 ? 17.093  -13.650 -33.048 1.00 26.35 ? 264 SER B CA    1 
ATOM   4519 C C     . SER B 2 222 ? 16.099  -13.053 -34.034 1.00 27.38 ? 264 SER B C     1 
ATOM   4520 O O     . SER B 2 222 ? 15.466  -13.782 -34.800 1.00 28.02 ? 264 SER B O     1 
ATOM   4521 C CB    . SER B 2 222 ? 16.379  -14.012 -31.749 1.00 25.30 ? 264 SER B CB    1 
ATOM   4522 O OG    . SER B 2 222 ? 17.292  -14.549 -30.813 1.00 23.52 ? 264 SER B OG    1 
ATOM   4523 N N     . VAL B 2 223 ? 15.965  -11.726 -34.009 1.00 28.53 ? 265 VAL B N     1 
ATOM   4524 C CA    . VAL B 2 223 ? 15.127  -11.004 -34.978 1.00 27.95 ? 265 VAL B CA    1 
ATOM   4525 C C     . VAL B 2 223 ? 15.645  -11.262 -36.398 1.00 27.46 ? 265 VAL B C     1 
ATOM   4526 O O     . VAL B 2 223 ? 14.865  -11.591 -37.291 1.00 26.36 ? 265 VAL B O     1 
ATOM   4527 C CB    . VAL B 2 223 ? 15.087  -9.471  -34.672 1.00 27.75 ? 265 VAL B CB    1 
ATOM   4528 C CG1   . VAL B 2 223 ? 14.371  -8.703  -35.774 1.00 27.71 ? 265 VAL B CG1   1 
ATOM   4529 C CG2   . VAL B 2 223 ? 14.418  -9.219  -33.343 1.00 26.75 ? 265 VAL B CG2   1 
ATOM   4530 N N     . GLY B 2 224 ? 16.963  -11.132 -36.580 1.00 25.80 ? 266 GLY B N     1 
ATOM   4531 C CA    . GLY B 2 224 ? 17.614  -11.419 -37.850 1.00 27.55 ? 266 GLY B CA    1 
ATOM   4532 C C     . GLY B 2 224 ? 17.435  -12.849 -38.330 1.00 29.05 ? 266 GLY B C     1 
ATOM   4533 O O     . GLY B 2 224 ? 17.160  -13.076 -39.516 1.00 27.66 ? 266 GLY B O     1 
ATOM   4534 N N     . ILE B 2 225 ? 17.599  -13.817 -37.420 1.00 28.89 ? 267 ILE B N     1 
ATOM   4535 C CA    . ILE B 2 225 ? 17.414  -15.226 -37.768 1.00 29.30 ? 267 ILE B CA    1 
ATOM   4536 C C     . ILE B 2 225 ? 15.973  -15.441 -38.236 1.00 29.28 ? 267 ILE B C     1 
ATOM   4537 O O     . ILE B 2 225 ? 15.720  -16.096 -39.255 1.00 29.00 ? 267 ILE B O     1 
ATOM   4538 C CB    . ILE B 2 225 ? 17.754  -16.181 -36.593 1.00 29.24 ? 267 ILE B CB    1 
ATOM   4539 C CG1   . ILE B 2 225 ? 19.223  -16.060 -36.174 1.00 30.08 ? 267 ILE B CG1   1 
ATOM   4540 C CG2   . ILE B 2 225 ? 17.454  -17.622 -36.973 1.00 32.31 ? 267 ILE B CG2   1 
ATOM   4541 C CD1   . ILE B 2 225 ? 20.252  -16.659 -37.170 1.00 27.78 ? 267 ILE B CD1   1 
ATOM   4542 N N     . THR B 2 226 ? 15.043  -14.854 -37.489 1.00 28.65 ? 268 THR B N     1 
ATOM   4543 C CA    . THR B 2 226 ? 13.626  -14.851 -37.832 1.00 28.27 ? 268 THR B CA    1 
ATOM   4544 C C     . THR B 2 226 ? 13.346  -14.209 -39.206 1.00 27.63 ? 268 THR B C     1 
ATOM   4545 O O     . THR B 2 226 ? 12.484  -14.698 -39.953 1.00 28.46 ? 268 THR B O     1 
ATOM   4546 C CB    . THR B 2 226 ? 12.806  -14.195 -36.705 1.00 27.66 ? 268 THR B CB    1 
ATOM   4547 O OG1   . THR B 2 226 ? 13.168  -14.817 -35.470 1.00 29.13 ? 268 THR B OG1   1 
ATOM   4548 C CG2   . THR B 2 226 ? 11.320  -14.390 -36.916 1.00 29.88 ? 268 THR B CG2   1 
ATOM   4549 N N     . ALA B 2 227 ? 14.084  -13.145 -39.536 1.00 25.91 ? 269 ALA B N     1 
ATOM   4550 C CA    . ALA B 2 227 ? 13.987  -12.486 -40.849 1.00 25.59 ? 269 ALA B CA    1 
ATOM   4551 C C     . ALA B 2 227 ? 14.373  -13.442 -41.983 1.00 26.17 ? 269 ALA B C     1 
ATOM   4552 O O     . ALA B 2 227 ? 13.743  -13.452 -43.046 1.00 25.45 ? 269 ALA B O     1 
ATOM   4553 C CB    . ALA B 2 227 ? 14.856  -11.250 -40.893 1.00 23.30 ? 269 ALA B CB    1 
ATOM   4554 N N     . CYS B 2 228 ? 15.412  -14.236 -41.736 1.00 26.42 ? 270 CYS B N     1 
ATOM   4555 C CA    . CYS B 2 228 ? 15.860  -15.269 -42.660 1.00 27.47 ? 270 CYS B CA    1 
ATOM   4556 C C     . CYS B 2 228 ? 14.857  -16.424 -42.739 1.00 26.52 ? 270 CYS B C     1 
ATOM   4557 O O     . CYS B 2 228 ? 14.568  -16.934 -43.822 1.00 27.22 ? 270 CYS B O     1 
ATOM   4558 C CB    . CYS B 2 228 ? 17.236  -15.772 -42.243 1.00 26.32 ? 270 CYS B CB    1 
ATOM   4559 S SG    . CYS B 2 228 ? 18.561  -14.628 -42.668 1.00 32.89 ? 270 CYS B SG    1 
ATOM   4560 N N     . GLU B 2 229 ? 14.335  -16.824 -41.586 1.00 25.89 ? 271 GLU B N     1 
ATOM   4561 C CA    . GLU B 2 229 ? 13.274  -17.816 -41.510 1.00 26.13 ? 271 GLU B CA    1 
ATOM   4562 C C     . GLU B 2 229 ? 12.029  -17.341 -42.285 1.00 26.00 ? 271 GLU B C     1 
ATOM   4563 O O     . GLU B 2 229 ? 11.415  -18.128 -43.009 1.00 26.48 ? 271 GLU B O     1 
ATOM   4564 C CB    . GLU B 2 229 ? 12.940  -18.146 -40.035 1.00 25.15 ? 271 GLU B CB    1 
ATOM   4565 C CG    . GLU B 2 229 ? 11.874  -19.245 -39.846 1.00 26.56 ? 271 GLU B CG    1 
ATOM   4566 C CD    . GLU B 2 229 ? 11.320  -19.351 -38.418 1.00 28.44 ? 271 GLU B CD    1 
ATOM   4567 O OE1   . GLU B 2 229 ? 10.774  -20.426 -38.068 1.00 29.53 ? 271 GLU B OE1   1 
ATOM   4568 O OE2   . GLU B 2 229 ? 11.399  -18.366 -37.646 1.00 31.60 ? 271 GLU B OE2   1 
ATOM   4569 N N     . LEU B 2 230 ? 11.673  -16.063 -42.154 1.00 25.77 ? 272 LEU B N     1 
ATOM   4570 C CA    . LEU B 2 230 ? 10.455  -15.542 -42.817 1.00 26.70 ? 272 LEU B CA    1 
ATOM   4571 C C     . LEU B 2 230 ? 10.629  -15.368 -44.321 1.00 27.57 ? 272 LEU B C     1 
ATOM   4572 O O     . LEU B 2 230 ? 9.665   -15.524 -45.079 1.00 28.08 ? 272 LEU B O     1 
ATOM   4573 C CB    . LEU B 2 230 ? 9.985   -14.219 -42.196 1.00 25.37 ? 272 LEU B CB    1 
ATOM   4574 C CG    . LEU B 2 230 ? 9.433   -14.243 -40.764 1.00 25.99 ? 272 LEU B CG    1 
ATOM   4575 C CD1   . LEU B 2 230 ? 9.258   -12.824 -40.227 1.00 24.58 ? 272 LEU B CD1   1 
ATOM   4576 C CD2   . LEU B 2 230 ? 8.127   -15.016 -40.682 1.00 26.32 ? 272 LEU B CD2   1 
ATOM   4577 N N     . ALA B 2 231 ? 11.855  -15.047 -44.740 1.00 26.47 ? 273 ALA B N     1 
ATOM   4578 C CA    . ALA B 2 231 ? 12.175  -14.872 -46.148 1.00 26.91 ? 273 ALA B CA    1 
ATOM   4579 C C     . ALA B 2 231 ? 12.257  -16.209 -46.879 1.00 27.45 ? 273 ALA B C     1 
ATOM   4580 O O     . ALA B 2 231 ? 11.742  -16.350 -47.988 1.00 25.64 ? 273 ALA B O     1 
ATOM   4581 C CB    . ALA B 2 231 ? 13.489  -14.113 -46.300 1.00 27.11 ? 273 ALA B CB    1 
ATOM   4582 N N     . ASN B 2 232 ? 12.914  -17.182 -46.251 1.00 27.83 ? 274 ASN B N     1 
ATOM   4583 C CA    . ASN B 2 232 ? 13.212  -18.451 -46.898 1.00 28.40 ? 274 ASN B CA    1 
ATOM   4584 C C     . ASN B 2 232 ? 12.221  -19.568 -46.625 1.00 28.43 ? 274 ASN B C     1 
ATOM   4585 O O     . ASN B 2 232 ? 12.152  -20.531 -47.389 1.00 28.04 ? 274 ASN B O     1 
ATOM   4586 C CB    . ASN B 2 232 ? 14.610  -18.916 -46.500 1.00 30.22 ? 274 ASN B CB    1 
ATOM   4587 C CG    . ASN B 2 232 ? 15.693  -17.985 -46.997 1.00 31.25 ? 274 ASN B CG    1 
ATOM   4588 O OD1   . ASN B 2 232 ? 15.646  -17.514 -48.133 1.00 33.62 ? 274 ASN B OD1   1 
ATOM   4589 N ND2   . ASN B 2 232 ? 16.683  -17.721 -46.151 1.00 33.20 ? 274 ASN B ND2   1 
ATOM   4590 N N     . GLY B 2 233 ? 11.480  -19.452 -45.525 1.00 29.07 ? 275 GLY B N     1 
ATOM   4591 C CA    . GLY B 2 233 ? 10.549  -20.493 -45.114 1.00 29.36 ? 275 GLY B CA    1 
ATOM   4592 C C     . GLY B 2 233 ? 11.211  -21.608 -44.322 1.00 29.78 ? 275 GLY B C     1 
ATOM   4593 O O     . GLY B 2 233 ? 10.540  -22.537 -43.883 1.00 31.59 ? 275 GLY B O     1 
ATOM   4594 N N     . HIS B 2 234 ? 12.528  -21.534 -44.161 1.00 30.12 ? 276 HIS B N     1 
ATOM   4595 C CA    . HIS B 2 234 ? 13.263  -22.427 -43.257 1.00 28.64 ? 276 HIS B CA    1 
ATOM   4596 C C     . HIS B 2 234 ? 14.254  -21.615 -42.422 1.00 27.49 ? 276 HIS B C     1 
ATOM   4597 O O     . HIS B 2 234 ? 14.762  -20.590 -42.874 1.00 26.18 ? 276 HIS B O     1 
ATOM   4598 C CB    . HIS B 2 234 ? 13.965  -23.558 -44.031 1.00 28.71 ? 276 HIS B CB    1 
ATOM   4599 C CG    . HIS B 2 234 ? 15.095  -23.097 -44.902 1.00 29.69 ? 276 HIS B CG    1 
ATOM   4600 N ND1   . HIS B 2 234 ? 14.914  -22.683 -46.205 1.00 31.44 ? 276 HIS B ND1   1 
ATOM   4601 C CD2   . HIS B 2 234 ? 16.424  -22.997 -44.660 1.00 32.07 ? 276 HIS B CD2   1 
ATOM   4602 C CE1   . HIS B 2 234 ? 16.080  -22.341 -46.727 1.00 31.03 ? 276 HIS B CE1   1 
ATOM   4603 N NE2   . HIS B 2 234 ? 17.013  -22.522 -45.809 1.00 33.91 ? 276 HIS B NE2   1 
ATOM   4604 N N     . VAL B 2 235 ? 14.503  -22.062 -41.196 1.00 28.16 ? 277 VAL B N     1 
ATOM   4605 C CA    . VAL B 2 235 ? 15.465  -21.396 -40.308 1.00 30.02 ? 277 VAL B CA    1 
ATOM   4606 C C     . VAL B 2 235 ? 16.894  -21.797 -40.716 1.00 30.74 ? 277 VAL B C     1 
ATOM   4607 O O     . VAL B 2 235 ? 17.107  -22.948 -41.114 1.00 30.96 ? 277 VAL B O     1 
ATOM   4608 C CB    . VAL B 2 235 ? 15.180  -21.725 -38.798 1.00 29.96 ? 277 VAL B CB    1 
ATOM   4609 C CG1   . VAL B 2 235 ? 15.266  -23.238 -38.522 1.00 31.43 ? 277 VAL B CG1   1 
ATOM   4610 C CG2   . VAL B 2 235 ? 16.107  -20.941 -37.858 1.00 28.11 ? 277 VAL B CG2   1 
ATOM   4611 N N     . PRO B 2 236 ? 17.870  -20.856 -40.645 1.00 31.61 ? 278 PRO B N     1 
ATOM   4612 C CA    . PRO B 2 236 ? 19.269  -21.259 -40.912 1.00 32.61 ? 278 PRO B CA    1 
ATOM   4613 C C     . PRO B 2 236 ? 19.745  -22.272 -39.874 1.00 32.84 ? 278 PRO B C     1 
ATOM   4614 O O     . PRO B 2 236 ? 19.279  -22.225 -38.725 1.00 35.43 ? 278 PRO B O     1 
ATOM   4615 C CB    . PRO B 2 236 ? 20.057  -19.948 -40.755 1.00 32.35 ? 278 PRO B CB    1 
ATOM   4616 C CG    . PRO B 2 236 ? 19.049  -18.862 -40.879 1.00 30.96 ? 278 PRO B CG    1 
ATOM   4617 C CD    . PRO B 2 236 ? 17.771  -19.418 -40.333 1.00 31.33 ? 278 PRO B CD    1 
ATOM   4618 N N     . PHE B 2 237 ? 20.653  -23.166 -40.275 1.00 32.06 ? 279 PHE B N     1 
ATOM   4619 C CA    . PHE B 2 237 ? 21.249  -24.195 -39.393 1.00 31.03 ? 279 PHE B CA    1 
ATOM   4620 C C     . PHE B 2 237 ? 20.272  -25.284 -38.924 1.00 30.60 ? 279 PHE B C     1 
ATOM   4621 O O     . PHE B 2 237 ? 20.466  -25.883 -37.862 1.00 30.44 ? 279 PHE B O     1 
ATOM   4622 C CB    . PHE B 2 237 ? 21.949  -23.574 -38.169 1.00 31.12 ? 279 PHE B CB    1 
ATOM   4623 C CG    . PHE B 2 237 ? 22.781  -22.357 -38.476 1.00 31.08 ? 279 PHE B CG    1 
ATOM   4624 C CD1   . PHE B 2 237 ? 22.404  -21.108 -37.985 1.00 30.54 ? 279 PHE B CD1   1 
ATOM   4625 C CD2   . PHE B 2 237 ? 23.945  -22.460 -39.236 1.00 30.53 ? 279 PHE B CD2   1 
ATOM   4626 C CE1   . PHE B 2 237 ? 23.165  -19.977 -38.252 1.00 30.24 ? 279 PHE B CE1   1 
ATOM   4627 C CE2   . PHE B 2 237 ? 24.717  -21.335 -39.514 1.00 31.40 ? 279 PHE B CE2   1 
ATOM   4628 C CZ    . PHE B 2 237 ? 24.327  -20.092 -39.019 1.00 32.20 ? 279 PHE B CZ    1 
ATOM   4629 N N     . LYS B 2 238 ? 19.231  -25.539 -39.714 1.00 30.17 ? 280 LYS B N     1 
ATOM   4630 C CA    . LYS B 2 238 ? 18.248  -26.583 -39.399 1.00 29.92 ? 280 LYS B CA    1 
ATOM   4631 C C     . LYS B 2 238 ? 18.859  -27.979 -39.626 1.00 30.06 ? 280 LYS B C     1 
ATOM   4632 O O     . LYS B 2 238 ? 19.609  -28.189 -40.587 1.00 30.12 ? 280 LYS B O     1 
ATOM   4633 C CB    . LYS B 2 238 ? 16.956  -26.354 -40.209 1.00 29.24 ? 280 LYS B CB    1 
ATOM   4634 C CG    . LYS B 2 238 ? 15.986  -27.535 -40.342 1.00 28.86 ? 280 LYS B CG    1 
ATOM   4635 C CD    . LYS B 2 238 ? 15.130  -27.776 -39.101 1.00 27.26 ? 280 LYS B CD    1 
ATOM   4636 C CE    . LYS B 2 238 ? 14.215  -28.989 -39.308 1.00 26.94 ? 280 LYS B CE    1 
ATOM   4637 N NZ    . LYS B 2 238 ? 13.762  -29.613 -38.030 1.00 20.88 ? 280 LYS B NZ    1 
ATOM   4638 N N     . ASP B 2 239 ? 18.556  -28.909 -38.717 1.00 29.60 ? 281 ASP B N     1 
ATOM   4639 C CA    . ASP B 2 239 ? 19.090  -30.283 -38.741 1.00 29.60 ? 281 ASP B CA    1 
ATOM   4640 C C     . ASP B 2 239 ? 20.591  -30.350 -38.450 1.00 28.96 ? 281 ASP B C     1 
ATOM   4641 O O     . ASP B 2 239 ? 21.173  -31.437 -38.399 1.00 29.12 ? 281 ASP B O     1 
ATOM   4642 C CB    . ASP B 2 239 ? 18.780  -30.994 -40.068 1.00 30.01 ? 281 ASP B CB    1 
ATOM   4643 C CG    . ASP B 2 239 ? 17.299  -31.005 -40.397 1.00 31.83 ? 281 ASP B CG    1 
ATOM   4644 O OD1   . ASP B 2 239 ? 16.926  -30.433 -41.445 1.00 32.75 ? 281 ASP B OD1   1 
ATOM   4645 O OD2   . ASP B 2 239 ? 16.510  -31.578 -39.612 1.00 32.29 ? 281 ASP B OD2   1 
ATOM   4646 N N     . MET B 2 240 ? 21.209  -29.189 -38.256 1.00 27.80 ? 282 MET B N     1 
ATOM   4647 C CA    . MET B 2 240 ? 22.628  -29.110 -37.950 1.00 26.88 ? 282 MET B CA    1 
ATOM   4648 C C     . MET B 2 240 ? 22.903  -29.502 -36.491 1.00 27.63 ? 282 MET B C     1 
ATOM   4649 O O     . MET B 2 240 ? 22.233  -29.000 -35.588 1.00 27.55 ? 282 MET B O     1 
ATOM   4650 C CB    . MET B 2 240 ? 23.146  -27.698 -38.241 1.00 27.27 ? 282 MET B CB    1 
ATOM   4651 C CG    . MET B 2 240 ? 24.629  -27.523 -38.005 1.00 25.32 ? 282 MET B CG    1 
ATOM   4652 S SD    . MET B 2 240 ? 25.299  -26.070 -38.805 1.00 23.65 ? 282 MET B SD    1 
ATOM   4653 C CE    . MET B 2 240 ? 27.040  -26.313 -38.452 1.00 27.19 ? 282 MET B CE    1 
ATOM   4654 N N     . PRO B 2 241 ? 23.887  -30.405 -36.261 1.00 27.87 ? 283 PRO B N     1 
ATOM   4655 C CA    . PRO B 2 241 ? 24.292  -30.833 -34.909 1.00 28.26 ? 283 PRO B CA    1 
ATOM   4656 C C     . PRO B 2 241 ? 24.552  -29.686 -33.927 1.00 28.47 ? 283 PRO B C     1 
ATOM   4657 O O     . PRO B 2 241 ? 24.883  -28.575 -34.345 1.00 27.99 ? 283 PRO B O     1 
ATOM   4658 C CB    . PRO B 2 241 ? 25.587  -31.609 -35.163 1.00 28.01 ? 283 PRO B CB    1 
ATOM   4659 C CG    . PRO B 2 241 ? 25.424  -32.151 -36.533 1.00 28.04 ? 283 PRO B CG    1 
ATOM   4660 C CD    . PRO B 2 241 ? 24.667  -31.104 -37.303 1.00 27.78 ? 283 PRO B CD    1 
ATOM   4661 N N     . ALA B 2 242 ? 24.410  -29.980 -32.634 1.00 29.41 ? 284 ALA B N     1 
ATOM   4662 C CA    . ALA B 2 242 ? 24.576  -29.004 -31.544 1.00 29.96 ? 284 ALA B CA    1 
ATOM   4663 C C     . ALA B 2 242 ? 25.718  -28.000 -31.751 1.00 30.25 ? 284 ALA B C     1 
ATOM   4664 O O     . ALA B 2 242 ? 25.546  -26.811 -31.478 1.00 30.36 ? 284 ALA B O     1 
ATOM   4665 C CB    . ALA B 2 242 ? 24.732  -29.728 -30.199 1.00 30.27 ? 284 ALA B CB    1 
ATOM   4666 N N     . THR B 2 243 ? 26.867  -28.475 -32.242 1.00 30.33 ? 285 THR B N     1 
ATOM   4667 C CA    . THR B 2 243 ? 28.007  -27.599 -32.560 1.00 30.13 ? 285 THR B CA    1 
ATOM   4668 C C     . THR B 2 243 ? 27.809  -26.840 -33.897 1.00 30.28 ? 285 THR B C     1 
ATOM   4669 O O     . THR B 2 243 ? 28.706  -26.768 -34.749 1.00 30.31 ? 285 THR B O     1 
ATOM   4670 C CB    . THR B 2 243 ? 29.361  -28.358 -32.519 1.00 30.36 ? 285 THR B CB    1 
ATOM   4671 O OG1   . THR B 2 243 ? 29.284  -29.449 -31.589 1.00 28.83 ? 285 THR B OG1   1 
ATOM   4672 C CG2   . THR B 2 243 ? 30.486  -27.417 -32.095 1.00 30.92 ? 285 THR B CG2   1 
ATOM   4673 N N     . GLN B 2 244 ? 26.601  -26.296 -34.055 1.00 29.93 ? 286 GLN B N     1 
ATOM   4674 C CA    . GLN B 2 244 ? 26.256  -25.298 -35.065 1.00 28.75 ? 286 GLN B CA    1 
ATOM   4675 C C     . GLN B 2 244 ? 26.862  -23.956 -34.647 1.00 28.58 ? 286 GLN B C     1 
ATOM   4676 O O     . GLN B 2 244 ? 26.974  -23.019 -35.445 1.00 28.25 ? 286 GLN B O     1 
ATOM   4677 C CB    . GLN B 2 244 ? 24.726  -25.232 -35.192 1.00 28.52 ? 286 GLN B CB    1 
ATOM   4678 C CG    . GLN B 2 244 ? 24.078  -23.866 -35.029 1.00 26.75 ? 286 GLN B CG    1 
ATOM   4679 C CD    . GLN B 2 244 ? 22.874  -23.910 -34.102 1.00 26.21 ? 286 GLN B CD    1 
ATOM   4680 O OE1   . GLN B 2 244 ? 22.181  -24.927 -34.000 1.00 26.03 ? 286 GLN B OE1   1 
ATOM   4681 N NE2   . GLN B 2 244 ? 22.622  -22.804 -33.414 1.00 26.87 ? 286 GLN B NE2   1 
ATOM   4682 N N     . MET B 2 245 ? 27.235  -23.904 -33.369 1.00 28.03 ? 287 MET B N     1 
ATOM   4683 C CA    . MET B 2 245 ? 28.051  -22.861 -32.760 1.00 28.19 ? 287 MET B CA    1 
ATOM   4684 C C     . MET B 2 245 ? 29.135  -22.297 -33.682 1.00 27.44 ? 287 MET B C     1 
ATOM   4685 O O     . MET B 2 245 ? 29.195  -21.085 -33.915 1.00 26.77 ? 287 MET B O     1 
ATOM   4686 C CB    . MET B 2 245 ? 28.702  -23.439 -31.492 1.00 28.71 ? 287 MET B CB    1 
ATOM   4687 C CG    . MET B 2 245 ? 29.759  -22.563 -30.831 1.00 31.28 ? 287 MET B CG    1 
ATOM   4688 S SD    . MET B 2 245 ? 29.067  -21.363 -29.678 1.00 38.59 ? 287 MET B SD    1 
ATOM   4689 C CE    . MET B 2 245 ? 28.380  -20.126 -30.784 1.00 34.14 ? 287 MET B CE    1 
ATOM   4690 N N     . LEU B 2 246 ? 29.984  -23.192 -34.191 1.00 26.97 ? 288 LEU B N     1 
ATOM   4691 C CA    . LEU B 2 246 ? 31.136  -22.835 -35.016 1.00 26.36 ? 288 LEU B CA    1 
ATOM   4692 C C     . LEU B 2 246 ? 30.777  -21.946 -36.204 1.00 26.26 ? 288 LEU B C     1 
ATOM   4693 O O     . LEU B 2 246 ? 31.439  -20.932 -36.437 1.00 25.35 ? 288 LEU B O     1 
ATOM   4694 C CB    . LEU B 2 246 ? 31.863  -24.096 -35.498 1.00 26.70 ? 288 LEU B CB    1 
ATOM   4695 C CG    . LEU B 2 246 ? 32.661  -24.904 -34.471 1.00 26.29 ? 288 LEU B CG    1 
ATOM   4696 C CD1   . LEU B 2 246 ? 32.868  -26.334 -34.960 1.00 25.74 ? 288 LEU B CD1   1 
ATOM   4697 C CD2   . LEU B 2 246 ? 33.996  -24.234 -34.153 1.00 26.42 ? 288 LEU B CD2   1 
ATOM   4698 N N     . LEU B 2 247 ? 29.730  -22.325 -36.942 1.00 26.63 ? 289 LEU B N     1 
ATOM   4699 C CA    . LEU B 2 247 ? 29.274  -21.539 -38.095 1.00 27.15 ? 289 LEU B CA    1 
ATOM   4700 C C     . LEU B 2 247 ? 28.646  -20.193 -37.710 1.00 27.37 ? 289 LEU B C     1 
ATOM   4701 O O     . LEU B 2 247 ? 28.788  -19.213 -38.444 1.00 26.55 ? 289 LEU B O     1 
ATOM   4702 C CB    . LEU B 2 247 ? 28.355  -22.357 -39.021 1.00 27.52 ? 289 LEU B CB    1 
ATOM   4703 C CG    . LEU B 2 247 ? 29.040  -23.239 -40.088 1.00 27.94 ? 289 LEU B CG    1 
ATOM   4704 C CD1   . LEU B 2 247 ? 28.021  -24.079 -40.828 1.00 29.35 ? 289 LEU B CD1   1 
ATOM   4705 C CD2   . LEU B 2 247 ? 29.867  -22.429 -41.096 1.00 26.07 ? 289 LEU B CD2   1 
ATOM   4706 N N     . GLU B 2 248 ? 27.980  -20.143 -36.555 1.00 28.39 ? 290 GLU B N     1 
ATOM   4707 C CA    . GLU B 2 248 ? 27.448  -18.881 -36.025 1.00 29.56 ? 290 GLU B CA    1 
ATOM   4708 C C     . GLU B 2 248 ? 28.590  -17.924 -35.678 1.00 29.88 ? 290 GLU B C     1 
ATOM   4709 O O     . GLU B 2 248 ? 28.456  -16.704 -35.808 1.00 29.64 ? 290 GLU B O     1 
ATOM   4710 C CB    . GLU B 2 248 ? 26.521  -19.122 -34.829 1.00 28.89 ? 290 GLU B CB    1 
ATOM   4711 C CG    . GLU B 2 248 ? 25.048  -19.300 -35.221 1.00 30.57 ? 290 GLU B CG    1 
ATOM   4712 C CD    . GLU B 2 248 ? 24.203  -19.983 -34.146 1.00 32.24 ? 290 GLU B CD    1 
ATOM   4713 O OE1   . GLU B 2 248 ? 23.023  -19.592 -33.951 1.00 32.28 ? 290 GLU B OE1   1 
ATOM   4714 O OE2   . GLU B 2 248 ? 24.718  -20.923 -33.500 1.00 38.31 ? 290 GLU B OE2   1 
ATOM   4715 N N     . LYS B 2 249 ? 29.714  -18.494 -35.246 1.00 30.64 ? 291 LYS B N     1 
ATOM   4716 C CA    . LYS B 2 249 ? 30.973  -17.764 -35.163 1.00 31.24 ? 291 LYS B CA    1 
ATOM   4717 C C     . LYS B 2 249 ? 31.587  -17.649 -36.562 1.00 31.16 ? 291 LYS B C     1 
ATOM   4718 O O     . LYS B 2 249 ? 32.784  -17.404 -36.725 1.00 30.91 ? 291 LYS B O     1 
ATOM   4719 C CB    . LYS B 2 249 ? 31.940  -18.469 -34.218 1.00 31.62 ? 291 LYS B CB    1 
ATOM   4720 C CG    . LYS B 2 249 ? 31.708  -18.202 -32.750 1.00 32.87 ? 291 LYS B CG    1 
ATOM   4721 C CD    . LYS B 2 249 ? 32.996  -18.476 -32.000 1.00 38.72 ? 291 LYS B CD    1 
ATOM   4722 C CE    . LYS B 2 249 ? 32.827  -18.324 -30.506 1.00 42.49 ? 291 LYS B CE    1 
ATOM   4723 N NZ    . LYS B 2 249 ? 32.076  -19.475 -29.925 1.00 45.41 ? 291 LYS B NZ    1 
ATOM   4724 N N     . PHE B 2 306 ? 15.141  -9.548  -52.876 1.00 27.01 ? 348 PHE B N     1 
ATOM   4725 C CA    . PHE B 2 306 ? 14.800  -8.689  -51.737 1.00 28.84 ? 348 PHE B CA    1 
ATOM   4726 C C     . PHE B 2 306 ? 15.512  -7.343  -51.839 1.00 28.93 ? 348 PHE B C     1 
ATOM   4727 O O     . PHE B 2 306 ? 16.628  -7.274  -52.369 1.00 29.17 ? 348 PHE B O     1 
ATOM   4728 C CB    . PHE B 2 306 ? 15.151  -9.356  -50.395 1.00 28.10 ? 348 PHE B CB    1 
ATOM   4729 C CG    . PHE B 2 306 ? 14.540  -10.723 -50.209 1.00 29.52 ? 348 PHE B CG    1 
ATOM   4730 C CD1   . PHE B 2 306 ? 15.297  -11.874 -50.433 1.00 30.03 ? 348 PHE B CD1   1 
ATOM   4731 C CD2   . PHE B 2 306 ? 13.212  -10.862 -49.811 1.00 28.92 ? 348 PHE B CD2   1 
ATOM   4732 C CE1   . PHE B 2 306 ? 14.742  -13.146 -50.266 1.00 30.50 ? 348 PHE B CE1   1 
ATOM   4733 C CE2   . PHE B 2 306 ? 12.646  -12.127 -49.641 1.00 29.93 ? 348 PHE B CE2   1 
ATOM   4734 C CZ    . PHE B 2 306 ? 13.414  -13.273 -49.871 1.00 29.71 ? 348 PHE B CZ    1 
ATOM   4735 N N     . SER B 2 307 ? 14.870  -6.288  -51.325 1.00 28.42 ? 349 SER B N     1 
ATOM   4736 C CA    . SER B 2 307 ? 15.419  -4.925  -51.378 1.00 28.30 ? 349 SER B CA    1 
ATOM   4737 C C     . SER B 2 307 ? 16.727  -4.823  -50.584 1.00 28.92 ? 349 SER B C     1 
ATOM   4738 O O     . SER B 2 307 ? 16.907  -5.553  -49.610 1.00 29.29 ? 349 SER B O     1 
ATOM   4739 C CB    . SER B 2 307 ? 14.388  -3.891  -50.895 1.00 28.14 ? 349 SER B CB    1 
ATOM   4740 O OG    . SER B 2 307 ? 14.287  -3.846  -49.480 1.00 25.04 ? 349 SER B OG    1 
ATOM   4741 N N     . PRO B 2 308 ? 17.654  -3.939  -51.014 1.00 29.60 ? 350 PRO B N     1 
ATOM   4742 C CA    . PRO B 2 308 ? 18.933  -3.779  -50.309 1.00 29.89 ? 350 PRO B CA    1 
ATOM   4743 C C     . PRO B 2 308 ? 18.786  -3.374  -48.837 1.00 30.19 ? 350 PRO B C     1 
ATOM   4744 O O     . PRO B 2 308 ? 19.615  -3.765  -48.012 1.00 30.67 ? 350 PRO B O     1 
ATOM   4745 C CB    . PRO B 2 308 ? 19.641  -2.674  -51.106 1.00 30.03 ? 350 PRO B CB    1 
ATOM   4746 C CG    . PRO B 2 308 ? 18.563  -1.987  -51.865 1.00 29.68 ? 350 PRO B CG    1 
ATOM   4747 C CD    . PRO B 2 308 ? 17.574  -3.050  -52.186 1.00 28.97 ? 350 PRO B CD    1 
ATOM   4748 N N     . HIS B 2 309 ? 17.742  -2.606  -48.519 1.00 30.09 ? 351 HIS B N     1 
ATOM   4749 C CA    . HIS B 2 309 ? 17.452  -2.205  -47.139 1.00 29.93 ? 351 HIS B CA    1 
ATOM   4750 C C     . HIS B 2 309 ? 17.227  -3.410  -46.229 1.00 29.83 ? 351 HIS B C     1 
ATOM   4751 O O     . HIS B 2 309 ? 17.703  -3.436  -45.090 1.00 29.31 ? 351 HIS B O     1 
ATOM   4752 C CB    . HIS B 2 309 ? 16.241  -1.272  -47.085 1.00 29.85 ? 351 HIS B CB    1 
ATOM   4753 C CG    . HIS B 2 309 ? 16.510  0.107   -47.607 1.00 29.92 ? 351 HIS B CG    1 
ATOM   4754 N ND1   . HIS B 2 309 ? 17.716  0.752   -47.428 1.00 28.25 ? 351 HIS B ND1   1 
ATOM   4755 C CD2   . HIS B 2 309 ? 15.714  0.977   -48.274 1.00 28.43 ? 351 HIS B CD2   1 
ATOM   4756 C CE1   . HIS B 2 309 ? 17.656  1.952   -47.977 1.00 28.58 ? 351 HIS B CE1   1 
ATOM   4757 N NE2   . HIS B 2 309 ? 16.451  2.114   -48.494 1.00 28.22 ? 351 HIS B NE2   1 
ATOM   4758 N N     . PHE B 2 310 ? 16.505  -4.401  -46.753 1.00 29.85 ? 352 PHE B N     1 
ATOM   4759 C CA    . PHE B 2 310 ? 16.285  -5.673  -46.073 1.00 30.32 ? 352 PHE B CA    1 
ATOM   4760 C C     . PHE B 2 310 ? 17.601  -6.366  -45.741 1.00 30.75 ? 352 PHE B C     1 
ATOM   4761 O O     . PHE B 2 310 ? 17.787  -6.838  -44.620 1.00 31.14 ? 352 PHE B O     1 
ATOM   4762 C CB    . PHE B 2 310 ? 15.396  -6.596  -46.920 1.00 29.52 ? 352 PHE B CB    1 
ATOM   4763 C CG    . PHE B 2 310 ? 14.972  -7.864  -46.211 1.00 31.17 ? 352 PHE B CG    1 
ATOM   4764 C CD1   . PHE B 2 310 ? 14.758  -7.884  -44.825 1.00 29.80 ? 352 PHE B CD1   1 
ATOM   4765 C CD2   . PHE B 2 310 ? 14.755  -9.035  -46.933 1.00 29.63 ? 352 PHE B CD2   1 
ATOM   4766 C CE1   . PHE B 2 310 ? 14.354  -9.049  -44.179 1.00 26.45 ? 352 PHE B CE1   1 
ATOM   4767 C CE2   . PHE B 2 310 ? 14.350  -10.210 -46.291 1.00 27.99 ? 352 PHE B CE2   1 
ATOM   4768 C CZ    . PHE B 2 310 ? 14.152  -10.216 -44.915 1.00 27.58 ? 352 PHE B CZ    1 
ATOM   4769 N N     . HIS B 2 311 ? 18.503  -6.421  -46.719 1.00 31.22 ? 353 HIS B N     1 
ATOM   4770 C CA    . HIS B 2 311 ? 19.813  -7.035  -46.534 1.00 31.21 ? 353 HIS B CA    1 
ATOM   4771 C C     . HIS B 2 311 ? 20.588  -6.343  -45.412 1.00 30.84 ? 353 HIS B C     1 
ATOM   4772 O O     . HIS B 2 311 ? 21.132  -7.011  -44.533 1.00 31.35 ? 353 HIS B O     1 
ATOM   4773 C CB    . HIS B 2 311 ? 20.615  -7.024  -47.840 1.00 31.48 ? 353 HIS B CB    1 
ATOM   4774 C CG    . HIS B 2 311 ? 20.148  -8.029  -48.850 1.00 33.68 ? 353 HIS B CG    1 
ATOM   4775 N ND1   . HIS B 2 311 ? 19.253  -7.719  -49.854 1.00 35.46 ? 353 HIS B ND1   1 
ATOM   4776 C CD2   . HIS B 2 311 ? 20.463  -9.336  -49.021 1.00 34.95 ? 353 HIS B CD2   1 
ATOM   4777 C CE1   . HIS B 2 311 ? 19.035  -8.791  -50.596 1.00 33.37 ? 353 HIS B CE1   1 
ATOM   4778 N NE2   . HIS B 2 311 ? 19.757  -9.785  -50.112 1.00 32.23 ? 353 HIS B NE2   1 
ATOM   4779 N N     . HIS B 2 312 ? 20.610  -5.012  -45.428 1.00 29.85 ? 354 HIS B N     1 
ATOM   4780 C CA    . HIS B 2 312 ? 21.340  -4.239  -44.418 1.00 29.21 ? 354 HIS B CA    1 
ATOM   4781 C C     . HIS B 2 312 ? 20.707  -4.351  -43.032 1.00 27.90 ? 354 HIS B C     1 
ATOM   4782 O O     . HIS B 2 312 ? 21.407  -4.326  -42.016 1.00 27.06 ? 354 HIS B O     1 
ATOM   4783 C CB    . HIS B 2 312 ? 21.492  -2.779  -44.852 1.00 29.29 ? 354 HIS B CB    1 
ATOM   4784 C CG    . HIS B 2 312 ? 22.240  -2.611  -46.140 1.00 31.82 ? 354 HIS B CG    1 
ATOM   4785 N ND1   . HIS B 2 312 ? 21.879  -1.687  -47.098 1.00 33.63 ? 354 HIS B ND1   1 
ATOM   4786 C CD2   . HIS B 2 312 ? 23.320  -3.262  -46.636 1.00 33.92 ? 354 HIS B CD2   1 
ATOM   4787 C CE1   . HIS B 2 312 ? 22.713  -1.767  -48.121 1.00 34.08 ? 354 HIS B CE1   1 
ATOM   4788 N NE2   . HIS B 2 312 ? 23.595  -2.717  -47.867 1.00 33.68 ? 354 HIS B NE2   1 
ATOM   4789 N N     . PHE B 2 313 ? 19.384  -4.491  -43.010 1.00 27.72 ? 355 PHE B N     1 
ATOM   4790 C CA    . PHE B 2 313 ? 18.644  -4.819  -41.794 1.00 27.49 ? 355 PHE B CA    1 
ATOM   4791 C C     . PHE B 2 313 ? 19.126  -6.124  -41.174 1.00 27.33 ? 355 PHE B C     1 
ATOM   4792 O O     . PHE B 2 313 ? 19.453  -6.175  -39.992 1.00 27.31 ? 355 PHE B O     1 
ATOM   4793 C CB    . PHE B 2 313 ? 17.142  -4.929  -42.083 1.00 27.10 ? 355 PHE B CB    1 
ATOM   4794 C CG    . PHE B 2 313 ? 16.330  -5.334  -40.890 1.00 25.82 ? 355 PHE B CG    1 
ATOM   4795 C CD1   . PHE B 2 313 ? 15.949  -4.392  -39.941 1.00 24.50 ? 355 PHE B CD1   1 
ATOM   4796 C CD2   . PHE B 2 313 ? 15.957  -6.664  -40.703 1.00 28.11 ? 355 PHE B CD2   1 
ATOM   4797 C CE1   . PHE B 2 313 ? 15.196  -4.766  -38.828 1.00 24.07 ? 355 PHE B CE1   1 
ATOM   4798 C CE2   . PHE B 2 313 ? 15.209  -7.051  -39.587 1.00 25.99 ? 355 PHE B CE2   1 
ATOM   4799 C CZ    . PHE B 2 313 ? 14.828  -6.098  -38.649 1.00 25.16 ? 355 PHE B CZ    1 
ATOM   4800 N N     . VAL B 2 314 ? 19.147  -7.178  -41.985 1.00 27.58 ? 356 VAL B N     1 
ATOM   4801 C CA    . VAL B 2 314 ? 19.504  -8.525  -41.530 1.00 27.41 ? 356 VAL B CA    1 
ATOM   4802 C C     . VAL B 2 314 ? 20.968  -8.599  -41.079 1.00 27.54 ? 356 VAL B C     1 
ATOM   4803 O O     . VAL B 2 314 ? 21.276  -9.199  -40.054 1.00 26.74 ? 356 VAL B O     1 
ATOM   4804 C CB    . VAL B 2 314 ? 19.190  -9.572  -42.631 1.00 27.19 ? 356 VAL B CB    1 
ATOM   4805 C CG1   . VAL B 2 314 ? 19.799  -10.935 -42.308 1.00 29.05 ? 356 VAL B CG1   1 
ATOM   4806 C CG2   . VAL B 2 314 ? 17.687  -9.694  -42.821 1.00 25.16 ? 356 VAL B CG2   1 
ATOM   4807 N N     . GLU B 2 315 ? 21.850  -7.965  -41.851 1.00 27.99 ? 357 GLU B N     1 
ATOM   4808 C CA    . GLU B 2 315 ? 23.285  -7.939  -41.581 1.00 28.18 ? 357 GLU B CA    1 
ATOM   4809 C C     . GLU B 2 315 ? 23.619  -7.169  -40.304 1.00 27.63 ? 357 GLU B C     1 
ATOM   4810 O O     . GLU B 2 315 ? 24.642  -7.429  -39.667 1.00 27.14 ? 357 GLU B O     1 
ATOM   4811 C CB    . GLU B 2 315 ? 24.045  -7.349  -42.779 1.00 27.62 ? 357 GLU B CB    1 
ATOM   4812 C CG    . GLU B 2 315 ? 24.151  -8.285  -43.980 1.00 28.95 ? 357 GLU B CG    1 
ATOM   4813 C CD    . GLU B 2 315 ? 24.543  -7.573  -45.276 1.00 30.02 ? 357 GLU B CD    1 
ATOM   4814 O OE1   . GLU B 2 315 ? 24.272  -8.135  -46.362 1.00 30.07 ? 357 GLU B OE1   1 
ATOM   4815 O OE2   . GLU B 2 315 ? 25.122  -6.462  -45.214 1.00 32.07 ? 357 GLU B OE2   1 
ATOM   4816 N N     . GLN B 2 316 ? 22.759  -6.221  -39.938 1.00 27.87 ? 358 GLN B N     1 
ATOM   4817 C CA    . GLN B 2 316 ? 22.927  -5.481  -38.687 1.00 28.37 ? 358 GLN B CA    1 
ATOM   4818 C C     . GLN B 2 316 ? 22.561  -6.301  -37.456 1.00 26.59 ? 358 GLN B C     1 
ATOM   4819 O O     . GLN B 2 316 ? 23.316  -6.333  -36.485 1.00 26.34 ? 358 GLN B O     1 
ATOM   4820 C CB    . GLN B 2 316 ? 22.149  -4.167  -38.710 1.00 29.48 ? 358 GLN B CB    1 
ATOM   4821 C CG    . GLN B 2 316 ? 23.006  -2.991  -39.154 1.00 36.32 ? 358 GLN B CG    1 
ATOM   4822 C CD    . GLN B 2 316 ? 22.407  -1.662  -38.751 1.00 44.50 ? 358 GLN B CD    1 
ATOM   4823 O OE1   . GLN B 2 316 ? 21.446  -1.197  -39.364 1.00 50.91 ? 358 GLN B OE1   1 
ATOM   4824 N NE2   . GLN B 2 316 ? 22.969  -1.041  -37.714 1.00 43.70 ? 358 GLN B NE2   1 
ATOM   4825 N N     . CYS B 2 317 ? 21.410  -6.967  -37.513 1.00 24.75 ? 359 CYS B N     1 
ATOM   4826 C CA    . CYS B 2 317 ? 20.958  -7.869  -36.456 1.00 24.10 ? 359 CYS B CA    1 
ATOM   4827 C C     . CYS B 2 317 ? 21.976  -8.964  -36.169 1.00 23.12 ? 359 CYS B C     1 
ATOM   4828 O O     . CYS B 2 317 ? 22.174  -9.349  -35.017 1.00 20.56 ? 359 CYS B O     1 
ATOM   4829 C CB    . CYS B 2 317 ? 19.631  -8.522  -36.856 1.00 23.86 ? 359 CYS B CB    1 
ATOM   4830 S SG    . CYS B 2 317 ? 18.227  -7.383  -36.934 1.00 27.27 ? 359 CYS B SG    1 
ATOM   4831 N N     . LEU B 2 318 ? 22.626  -9.443  -37.228 1.00 22.78 ? 360 LEU B N     1 
ATOM   4832 C CA    . LEU B 2 318 ? 23.424  -10.666 -37.166 1.00 24.77 ? 360 LEU B CA    1 
ATOM   4833 C C     . LEU B 2 318 ? 24.905  -10.477 -36.850 1.00 26.05 ? 360 LEU B C     1 
ATOM   4834 O O     . LEU B 2 318 ? 25.682  -11.430 -36.955 1.00 26.47 ? 360 LEU B O     1 
ATOM   4835 C CB    . LEU B 2 318 ? 23.260  -11.492 -38.454 1.00 23.91 ? 360 LEU B CB    1 
ATOM   4836 C CG    . LEU B 2 318 ? 21.915  -12.178 -38.706 1.00 22.45 ? 360 LEU B CG    1 
ATOM   4837 C CD1   . LEU B 2 318 ? 21.976  -13.003 -39.979 1.00 23.79 ? 360 LEU B CD1   1 
ATOM   4838 C CD2   . LEU B 2 318 ? 21.489  -13.041 -37.521 1.00 24.26 ? 360 LEU B CD2   1 
ATOM   4839 N N     . GLN B 2 319 ? 25.290  -9.268  -36.450 1.00 27.37 ? 361 GLN B N     1 
ATOM   4840 C CA    . GLN B 2 319 ? 26.679  -8.977  -36.098 1.00 29.16 ? 361 GLN B CA    1 
ATOM   4841 C C     . GLN B 2 319 ? 27.158  -9.831  -34.926 1.00 30.28 ? 361 GLN B C     1 
ATOM   4842 O O     . GLN B 2 319 ? 26.441  -9.998  -33.931 1.00 29.59 ? 361 GLN B O     1 
ATOM   4843 C CB    . GLN B 2 319 ? 26.846  -7.501  -35.763 1.00 28.99 ? 361 GLN B CB    1 
ATOM   4844 C CG    . GLN B 2 319 ? 26.617  -6.588  -36.939 1.00 32.02 ? 361 GLN B CG    1 
ATOM   4845 C CD    . GLN B 2 319 ? 26.490  -5.143  -36.521 1.00 35.40 ? 361 GLN B CD    1 
ATOM   4846 O OE1   . GLN B 2 319 ? 27.474  -4.396  -36.522 1.00 35.36 ? 361 GLN B OE1   1 
ATOM   4847 N NE2   . GLN B 2 319 ? 25.279  -4.739  -36.148 1.00 34.06 ? 361 GLN B NE2   1 
ATOM   4848 N N     . ARG B 2 320 ? 28.372  -10.367 -35.070 1.00 31.80 ? 362 ARG B N     1 
ATOM   4849 C CA    . ARG B 2 320 ? 29.027  -11.201 -34.058 1.00 33.12 ? 362 ARG B CA    1 
ATOM   4850 C C     . ARG B 2 320 ? 29.105  -10.455 -32.726 1.00 32.95 ? 362 ARG B C     1 
ATOM   4851 O O     . ARG B 2 320 ? 28.714  -10.988 -31.682 1.00 34.52 ? 362 ARG B O     1 
ATOM   4852 C CB    . ARG B 2 320 ? 30.443  -11.568 -34.521 1.00 34.75 ? 362 ARG B CB    1 
ATOM   4853 C CG    . ARG B 2 320 ? 30.793  -13.054 -34.439 1.00 37.40 ? 362 ARG B CG    1 
ATOM   4854 C CD    . ARG B 2 320 ? 30.764  -13.702 -35.826 1.00 40.05 ? 362 ARG B CD    1 
ATOM   4855 N NE    . ARG B 2 320 ? 31.830  -13.202 -36.696 1.00 40.30 ? 362 ARG B NE    1 
ATOM   4856 C CZ    . ARG B 2 320 ? 31.920  -13.445 -38.004 1.00 42.73 ? 362 ARG B CZ    1 
ATOM   4857 N NH1   . ARG B 2 320 ? 31.005  -14.190 -38.617 1.00 44.22 ? 362 ARG B NH1   1 
ATOM   4858 N NH2   . ARG B 2 320 ? 32.927  -12.940 -38.707 1.00 40.86 ? 362 ARG B NH2   1 
ATOM   4859 N N     . ASN B 2 321 ? 29.611  -9.222  -32.778 1.00 32.04 ? 363 ASN B N     1 
ATOM   4860 C CA    . ASN B 2 321 ? 29.658  -8.334  -31.623 1.00 31.11 ? 363 ASN B CA    1 
ATOM   4861 C C     . ASN B 2 321 ? 28.260  -7.803  -31.275 1.00 30.64 ? 363 ASN B C     1 
ATOM   4862 O O     . ASN B 2 321 ? 27.680  -7.052  -32.064 1.00 31.60 ? 363 ASN B O     1 
ATOM   4863 C CB    . ASN B 2 321 ? 30.625  -7.172  -31.903 1.00 30.43 ? 363 ASN B CB    1 
ATOM   4864 C CG    . ASN B 2 321 ? 30.806  -6.240  -30.707 1.00 29.50 ? 363 ASN B CG    1 
ATOM   4865 O OD1   . ASN B 2 321 ? 30.311  -6.515  -29.595 1.00 24.06 ? 363 ASN B OD1   1 
ATOM   4866 N ND2   . ASN B 2 321 ? 31.530  -5.127  -30.935 1.00 26.85 ? 363 ASN B ND2   1 
ATOM   4867 N N     . PRO B 2 322 ? 27.714  -8.196  -30.101 1.00 29.45 ? 364 PRO B N     1 
ATOM   4868 C CA    . PRO B 2 322 ? 26.407  -7.676  -29.660 1.00 28.68 ? 364 PRO B CA    1 
ATOM   4869 C C     . PRO B 2 322 ? 26.411  -6.171  -29.344 1.00 28.39 ? 364 PRO B C     1 
ATOM   4870 O O     . PRO B 2 322 ? 25.395  -5.512  -29.545 1.00 27.25 ? 364 PRO B O     1 
ATOM   4871 C CB    . PRO B 2 322 ? 26.093  -8.500  -28.403 1.00 27.93 ? 364 PRO B CB    1 
ATOM   4872 C CG    . PRO B 2 322 ? 27.401  -9.003  -27.920 1.00 28.61 ? 364 PRO B CG    1 
ATOM   4873 C CD    . PRO B 2 322 ? 28.282  -9.156  -29.131 1.00 29.74 ? 364 PRO B CD    1 
ATOM   4874 N N     . ASP B 2 323 ? 27.544  -5.645  -28.867 1.00 29.41 ? 365 ASP B N     1 
ATOM   4875 C CA    . ASP B 2 323 ? 27.721  -4.205  -28.621 1.00 30.03 ? 365 ASP B CA    1 
ATOM   4876 C C     . ASP B 2 323 ? 27.548  -3.395  -29.901 1.00 29.74 ? 365 ASP B C     1 
ATOM   4877 O O     . ASP B 2 323 ? 27.094  -2.249  -29.863 1.00 29.81 ? 365 ASP B O     1 
ATOM   4878 C CB    . ASP B 2 323 ? 29.105  -3.912  -28.029 1.00 30.96 ? 365 ASP B CB    1 
ATOM   4879 C CG    . ASP B 2 323 ? 29.282  -4.464  -26.615 1.00 33.48 ? 365 ASP B CG    1 
ATOM   4880 O OD1   . ASP B 2 323 ? 30.130  -3.921  -25.872 1.00 38.67 ? 365 ASP B OD1   1 
ATOM   4881 O OD2   . ASP B 2 323 ? 28.593  -5.433  -26.240 1.00 34.70 ? 365 ASP B OD2   1 
ATOM   4882 N N     . ALA B 2 324 ? 27.924  -4.006  -31.024 1.00 29.10 ? 366 ALA B N     1 
ATOM   4883 C CA    . ALA B 2 324 ? 27.749  -3.420  -32.348 1.00 28.75 ? 366 ALA B CA    1 
ATOM   4884 C C     . ALA B 2 324 ? 26.293  -3.420  -32.837 1.00 28.16 ? 366 ALA B C     1 
ATOM   4885 O O     . ALA B 2 324 ? 25.912  -2.560  -33.635 1.00 27.78 ? 366 ALA B O     1 
ATOM   4886 C CB    . ALA B 2 324 ? 28.641  -4.130  -33.349 1.00 29.65 ? 366 ALA B CB    1 
ATOM   4887 N N     . ARG B 2 325 ? 25.495  -4.380  -32.360 1.00 27.69 ? 367 ARG B N     1 
ATOM   4888 C CA    . ARG B 2 325 ? 24.074  -4.520  -32.740 1.00 27.31 ? 367 ARG B CA    1 
ATOM   4889 C C     . ARG B 2 325 ? 23.222  -3.354  -32.240 1.00 26.97 ? 367 ARG B C     1 
ATOM   4890 O O     . ARG B 2 325 ? 23.385  -2.930  -31.096 1.00 27.02 ? 367 ARG B O     1 
ATOM   4891 C CB    . ARG B 2 325 ? 23.480  -5.813  -32.175 1.00 27.42 ? 367 ARG B CB    1 
ATOM   4892 C CG    . ARG B 2 325 ? 23.934  -7.096  -32.833 1.00 27.36 ? 367 ARG B CG    1 
ATOM   4893 C CD    . ARG B 2 325 ? 23.411  -8.284  -32.040 1.00 27.84 ? 367 ARG B CD    1 
ATOM   4894 N NE    . ARG B 2 325 ? 24.288  -9.450  -32.156 1.00 28.34 ? 367 ARG B NE    1 
ATOM   4895 C CZ    . ARG B 2 325 ? 24.395  -10.404 -31.235 1.00 27.46 ? 367 ARG B CZ    1 
ATOM   4896 N NH1   . ARG B 2 325 ? 23.681  -10.340 -30.115 1.00 27.49 ? 367 ARG B NH1   1 
ATOM   4897 N NH2   . ARG B 2 325 ? 25.225  -11.418 -31.428 1.00 25.76 ? 367 ARG B NH2   1 
ATOM   4898 N N     . PRO B 2 326 ? 22.313  -2.828  -33.092 1.00 26.56 ? 368 PRO B N     1 
ATOM   4899 C CA    . PRO B 2 326 ? 21.436  -1.751  -32.622 1.00 26.72 ? 368 PRO B CA    1 
ATOM   4900 C C     . PRO B 2 326 ? 20.347  -2.261  -31.677 1.00 26.82 ? 368 PRO B C     1 
ATOM   4901 O O     . PRO B 2 326 ? 19.991  -3.438  -31.729 1.00 26.33 ? 368 PRO B O     1 
ATOM   4902 C CB    . PRO B 2 326 ? 20.816  -1.203  -33.914 1.00 25.67 ? 368 PRO B CB    1 
ATOM   4903 C CG    . PRO B 2 326 ? 20.885  -2.311  -34.872 1.00 25.71 ? 368 PRO B CG    1 
ATOM   4904 C CD    . PRO B 2 326 ? 22.070  -3.161  -34.508 1.00 26.11 ? 368 PRO B CD    1 
ATOM   4905 N N     . SER B 2 327 ? 19.850  -1.378  -30.811 1.00 26.76 ? 369 SER B N     1 
ATOM   4906 C CA    . SER B 2 327 ? 18.706  -1.681  -29.958 1.00 26.90 ? 369 SER B CA    1 
ATOM   4907 C C     . SER B 2 327 ? 17.428  -1.745  -30.802 1.00 27.81 ? 369 SER B C     1 
ATOM   4908 O O     . SER B 2 327 ? 17.403  -1.279  -31.942 1.00 27.52 ? 369 SER B O     1 
ATOM   4909 C CB    . SER B 2 327 ? 18.557  -0.619  -28.869 1.00 26.00 ? 369 SER B CB    1 
ATOM   4910 O OG    . SER B 2 327 ? 18.084  0.592   -29.425 1.00 23.39 ? 369 SER B OG    1 
ATOM   4911 N N     . ALA B 2 328 ? 16.366  -2.312  -30.232 1.00 29.07 ? 370 ALA B N     1 
ATOM   4912 C CA    . ALA B 2 328 ? 15.082  -2.423  -30.930 1.00 29.12 ? 370 ALA B CA    1 
ATOM   4913 C C     . ALA B 2 328 ? 14.488  -1.058  -31.291 1.00 29.55 ? 370 ALA B C     1 
ATOM   4914 O O     . ALA B 2 328 ? 13.834  -0.925  -32.326 1.00 30.29 ? 370 ALA B O     1 
ATOM   4915 C CB    . ALA B 2 328 ? 14.090  -3.254  -30.117 1.00 28.53 ? 370 ALA B CB    1 
ATOM   4916 N N     . SER B 2 329 ? 14.733  -0.044  -30.463 1.00 29.38 ? 371 SER B N     1 
ATOM   4917 C CA    . SER B 2 329 ? 14.167  1.277   -30.723 1.00 30.06 ? 371 SER B CA    1 
ATOM   4918 C C     . SER B 2 329 ? 14.798  1.956   -31.940 1.00 30.10 ? 371 SER B C     1 
ATOM   4919 O O     . SER B 2 329 ? 14.093  2.580   -32.737 1.00 30.11 ? 371 SER B O     1 
ATOM   4920 C CB    . SER B 2 329 ? 14.225  2.184   -29.481 1.00 30.02 ? 371 SER B CB    1 
ATOM   4921 O OG    . SER B 2 329 ? 15.501  2.771   -29.311 1.00 29.54 ? 371 SER B OG    1 
ATOM   4922 N N     . THR B 2 330 ? 16.117  1.835   -32.079 1.00 30.51 ? 372 THR B N     1 
ATOM   4923 C CA    . THR B 2 330 ? 16.824  2.466   -33.202 1.00 30.73 ? 372 THR B CA    1 
ATOM   4924 C C     . THR B 2 330 ? 16.693  1.628   -34.462 1.00 29.22 ? 372 THR B C     1 
ATOM   4925 O O     . THR B 2 330 ? 16.781  2.147   -35.565 1.00 29.97 ? 372 THR B O     1 
ATOM   4926 C CB    . THR B 2 330 ? 18.317  2.794   -32.889 1.00 31.21 ? 372 THR B CB    1 
ATOM   4927 O OG1   . THR B 2 330 ? 18.911  1.740   -32.119 1.00 34.30 ? 372 THR B OG1   1 
ATOM   4928 C CG2   . THR B 2 330 ? 18.425  4.100   -32.100 1.00 32.87 ? 372 THR B CG2   1 
ATOM   4929 N N     . LEU B 2 331 ? 16.459  0.331   -34.277 1.00 28.71 ? 373 LEU B N     1 
ATOM   4930 C CA    . LEU B 2 331 ? 16.197  -0.607  -35.372 1.00 27.16 ? 373 LEU B CA    1 
ATOM   4931 C C     . LEU B 2 331 ? 14.849  -0.328  -36.023 1.00 26.35 ? 373 LEU B C     1 
ATOM   4932 O O     . LEU B 2 331 ? 14.647  -0.624  -37.203 1.00 25.54 ? 373 LEU B O     1 
ATOM   4933 C CB    . LEU B 2 331 ? 16.191  -2.047  -34.855 1.00 26.51 ? 373 LEU B CB    1 
ATOM   4934 C CG    . LEU B 2 331 ? 17.098  -3.083  -35.527 1.00 26.33 ? 373 LEU B CG    1 
ATOM   4935 C CD1   . LEU B 2 331 ? 16.516  -4.466  -35.337 1.00 23.91 ? 373 LEU B CD1   1 
ATOM   4936 C CD2   . LEU B 2 331 ? 17.347  -2.794  -37.010 1.00 27.88 ? 373 LEU B CD2   1 
ATOM   4937 N N     . LEU B 2 332 ? 13.931  0.225   -35.233 1.00 26.00 ? 374 LEU B N     1 
ATOM   4938 C CA    . LEU B 2 332 ? 12.622  0.642   -35.712 1.00 26.43 ? 374 LEU B CA    1 
ATOM   4939 C C     . LEU B 2 332 ? 12.729  1.863   -36.619 1.00 27.11 ? 374 LEU B C     1 
ATOM   4940 O O     . LEU B 2 332 ? 11.830  2.116   -37.421 1.00 27.73 ? 374 LEU B O     1 
ATOM   4941 C CB    . LEU B 2 332 ? 11.688  0.939   -34.536 1.00 26.33 ? 374 LEU B CB    1 
ATOM   4942 C CG    . LEU B 2 332 ? 10.956  -0.231  -33.861 1.00 25.81 ? 374 LEU B CG    1 
ATOM   4943 C CD1   . LEU B 2 332 ? 10.398  0.221   -32.522 1.00 23.81 ? 374 LEU B CD1   1 
ATOM   4944 C CD2   . LEU B 2 332 ? 9.850   -0.801  -34.744 1.00 21.06 ? 374 LEU B CD2   1 
ATOM   4945 N N     . ASN B 2 333 ? 13.825  2.612   -36.478 1.00 27.10 ? 375 ASN B N     1 
ATOM   4946 C CA    . ASN B 2 333 ? 14.142  3.741   -37.362 1.00 27.98 ? 375 ASN B CA    1 
ATOM   4947 C C     . ASN B 2 333 ? 14.958  3.343   -38.600 1.00 27.42 ? 375 ASN B C     1 
ATOM   4948 O O     . ASN B 2 333 ? 15.360  4.210   -39.373 1.00 26.27 ? 375 ASN B O     1 
ATOM   4949 C CB    . ASN B 2 333 ? 14.881  4.852   -36.597 1.00 28.32 ? 375 ASN B CB    1 
ATOM   4950 C CG    . ASN B 2 333 ? 14.033  5.485   -35.501 1.00 30.56 ? 375 ASN B CG    1 
ATOM   4951 O OD1   . ASN B 2 333 ? 12.802  5.379   -35.497 1.00 31.93 ? 375 ASN B OD1   1 
ATOM   4952 N ND2   . ASN B 2 333 ? 14.696  6.156   -34.564 1.00 32.87 ? 375 ASN B ND2   1 
ATOM   4953 N N     . HIS B 2 334 ? 15.202  2.040   -38.772 1.00 27.40 ? 376 HIS B N     1 
ATOM   4954 C CA    . HIS B 2 334 ? 15.957  1.511   -39.915 1.00 27.49 ? 376 HIS B CA    1 
ATOM   4955 C C     . HIS B 2 334 ? 15.189  1.676   -41.216 1.00 27.75 ? 376 HIS B C     1 
ATOM   4956 O O     . HIS B 2 334 ? 13.964  1.533   -41.247 1.00 27.85 ? 376 HIS B O     1 
ATOM   4957 C CB    . HIS B 2 334 ? 16.302  0.029   -39.721 1.00 27.71 ? 376 HIS B CB    1 
ATOM   4958 C CG    . HIS B 2 334 ? 17.297  -0.500  -40.712 1.00 25.60 ? 376 HIS B CG    1 
ATOM   4959 N ND1   . HIS B 2 334 ? 16.930  -1.016  -41.936 1.00 25.44 ? 376 HIS B ND1   1 
ATOM   4960 C CD2   . HIS B 2 334 ? 18.646  -0.600  -40.653 1.00 22.18 ? 376 HIS B CD2   1 
ATOM   4961 C CE1   . HIS B 2 334 ? 18.009  -1.410  -42.589 1.00 22.60 ? 376 HIS B CE1   1 
ATOM   4962 N NE2   . HIS B 2 334 ? 19.064  -1.166  -41.832 1.00 20.98 ? 376 HIS B NE2   1 
ATOM   4963 N N     . SER B 2 335 ? 15.939  1.964   -42.278 1.00 27.46 ? 377 SER B N     1 
ATOM   4964 C CA    . SER B 2 335 ? 15.416  2.159   -43.628 1.00 27.75 ? 377 SER B CA    1 
ATOM   4965 C C     . SER B 2 335 ? 14.407  1.094   -44.050 1.00 27.05 ? 377 SER B C     1 
ATOM   4966 O O     . SER B 2 335 ? 13.444  1.397   -44.759 1.00 27.83 ? 377 SER B O     1 
ATOM   4967 C CB    . SER B 2 335 ? 16.569  2.175   -44.642 1.00 28.62 ? 377 SER B CB    1 
ATOM   4968 O OG    . SER B 2 335 ? 17.651  2.986   -44.213 1.00 29.29 ? 377 SER B OG    1 
ATOM   4969 N N     . PHE B 2 336 ? 14.639  -0.143  -43.611 1.00 25.26 ? 378 PHE B N     1 
ATOM   4970 C CA    . PHE B 2 336 ? 13.809  -1.296  -43.975 1.00 23.76 ? 378 PHE B CA    1 
ATOM   4971 C C     . PHE B 2 336 ? 12.307  -1.076  -43.784 1.00 23.00 ? 378 PHE B C     1 
ATOM   4972 O O     . PHE B 2 336 ? 11.498  -1.551  -44.583 1.00 22.65 ? 378 PHE B O     1 
ATOM   4973 C CB    . PHE B 2 336 ? 14.268  -2.546  -43.210 1.00 23.74 ? 378 PHE B CB    1 
ATOM   4974 C CG    . PHE B 2 336 ? 13.444  -3.782  -43.496 1.00 24.04 ? 378 PHE B CG    1 
ATOM   4975 C CD1   . PHE B 2 336 ? 13.321  -4.278  -44.801 1.00 22.59 ? 378 PHE B CD1   1 
ATOM   4976 C CD2   . PHE B 2 336 ? 12.802  -4.457  -42.458 1.00 21.27 ? 378 PHE B CD2   1 
ATOM   4977 C CE1   . PHE B 2 336 ? 12.557  -5.420  -45.070 1.00 23.03 ? 378 PHE B CE1   1 
ATOM   4978 C CE2   . PHE B 2 336 ? 12.042  -5.596  -42.712 1.00 22.14 ? 378 PHE B CE2   1 
ATOM   4979 C CZ    . PHE B 2 336 ? 11.916  -6.080  -44.023 1.00 22.78 ? 378 PHE B CZ    1 
ATOM   4980 N N     . PHE B 2 337 ? 11.937  -0.353  -42.735 1.00 22.28 ? 379 PHE B N     1 
ATOM   4981 C CA    . PHE B 2 337 ? 10.528  -0.150  -42.413 1.00 22.14 ? 379 PHE B CA    1 
ATOM   4982 C C     . PHE B 2 337 ? 9.887   1.070   -43.094 1.00 22.47 ? 379 PHE B C     1 
ATOM   4983 O O     . PHE B 2 337 ? 8.695   1.320   -42.921 1.00 22.34 ? 379 PHE B O     1 
ATOM   4984 C CB    . PHE B 2 337 ? 10.330  -0.121  -40.887 1.00 21.96 ? 379 PHE B CB    1 
ATOM   4985 C CG    . PHE B 2 337 ? 10.880  -1.336  -40.187 1.00 19.51 ? 379 PHE B CG    1 
ATOM   4986 C CD1   . PHE B 2 337 ? 12.012  -1.241  -39.384 1.00 19.50 ? 379 PHE B CD1   1 
ATOM   4987 C CD2   . PHE B 2 337 ? 10.276  -2.576  -40.347 1.00 18.90 ? 379 PHE B CD2   1 
ATOM   4988 C CE1   . PHE B 2 337 ? 12.528  -2.365  -38.738 1.00 13.29 ? 379 PHE B CE1   1 
ATOM   4989 C CE2   . PHE B 2 337 ? 10.786  -3.704  -39.710 1.00 18.88 ? 379 PHE B CE2   1 
ATOM   4990 C CZ    . PHE B 2 337 ? 11.918  -3.595  -38.905 1.00 16.35 ? 379 PHE B CZ    1 
ATOM   4991 N N     . LYS B 2 338 ? 10.668  1.812   -43.879 1.00 23.22 ? 380 LYS B N     1 
ATOM   4992 C CA    . LYS B 2 338 ? 10.139  2.957   -44.634 1.00 24.75 ? 380 LYS B CA    1 
ATOM   4993 C C     . LYS B 2 338 ? 9.033   2.582   -45.645 1.00 24.52 ? 380 LYS B C     1 
ATOM   4994 O O     . LYS B 2 338 ? 8.161   3.404   -45.949 1.00 23.73 ? 380 LYS B O     1 
ATOM   4995 C CB    . LYS B 2 338 ? 11.265  3.731   -45.331 1.00 24.82 ? 380 LYS B CB    1 
ATOM   4996 C CG    . LYS B 2 338 ? 12.142  4.566   -44.399 1.00 26.20 ? 380 LYS B CG    1 
ATOM   4997 C CD    . LYS B 2 338 ? 13.231  5.306   -45.180 1.00 25.96 ? 380 LYS B CD    1 
ATOM   4998 C CE    . LYS B 2 338 ? 14.202  6.027   -44.246 1.00 29.70 ? 380 LYS B CE    1 
ATOM   4999 N NZ    . LYS B 2 338 ? 15.091  6.977   -44.988 1.00 26.11 ? 380 LYS B NZ    1 
ATOM   5000 N N     . GLN B 2 339 ? 9.062   1.339   -46.132 1.00 24.27 ? 381 GLN B N     1 
ATOM   5001 C CA    . GLN B 2 339 ? 8.067   0.826   -47.085 1.00 24.44 ? 381 GLN B CA    1 
ATOM   5002 C C     . GLN B 2 339 ? 6.649   0.616   -46.503 1.00 25.52 ? 381 GLN B C     1 
ATOM   5003 O O     . GLN B 2 339 ? 5.719   0.260   -47.238 1.00 25.53 ? 381 GLN B O     1 
ATOM   5004 C CB    . GLN B 2 339 ? 8.579   -0.467  -47.732 1.00 24.02 ? 381 GLN B CB    1 
ATOM   5005 C CG    . GLN B 2 339 ? 8.657   -1.666  -46.780 1.00 23.17 ? 381 GLN B CG    1 
ATOM   5006 C CD    . GLN B 2 339 ? 9.540   -2.779  -47.308 1.00 23.66 ? 381 GLN B CD    1 
ATOM   5007 O OE1   . GLN B 2 339 ? 9.269   -3.356  -48.357 1.00 22.89 ? 381 GLN B OE1   1 
ATOM   5008 N NE2   . GLN B 2 339 ? 10.603  -3.090  -46.577 1.00 22.73 ? 381 GLN B NE2   1 
ATOM   5009 N N     . ILE B 2 340 ? 6.497   0.824   -45.193 1.00 26.61 ? 382 ILE B N     1 
ATOM   5010 C CA    . ILE B 2 340 ? 5.212   0.666   -44.495 1.00 27.32 ? 382 ILE B CA    1 
ATOM   5011 C C     . ILE B 2 340 ? 4.193   1.732   -44.935 1.00 27.42 ? 382 ILE B C     1 
ATOM   5012 O O     . ILE B 2 340 ? 4.296   2.904   -44.573 1.00 26.97 ? 382 ILE B O     1 
ATOM   5013 C CB    . ILE B 2 340 ? 5.394   0.690   -42.935 1.00 27.73 ? 382 ILE B CB    1 
ATOM   5014 C CG1   . ILE B 2 340 ? 6.324   -0.439  -42.454 1.00 27.55 ? 382 ILE B CG1   1 
ATOM   5015 C CG2   . ILE B 2 340 ? 4.037   0.708   -42.197 1.00 27.56 ? 382 ILE B CG2   1 
ATOM   5016 C CD1   . ILE B 2 340 ? 5.748   -1.837  -42.484 1.00 27.42 ? 382 ILE B CD1   1 
ATOM   5017 N N     . ALA B 2 344 ? -1.597  -1.426  -41.717 1.00 47.65 ? 386 ALA B N     1 
ATOM   5018 C CA    . ALA B 2 344 ? -0.973  -2.306  -40.736 1.00 47.90 ? 386 ALA B CA    1 
ATOM   5019 C C     . ALA B 2 344 ? -1.955  -3.369  -40.262 1.00 47.64 ? 386 ALA B C     1 
ATOM   5020 O O     . ALA B 2 344 ? -1.602  -4.542  -40.134 1.00 46.70 ? 386 ALA B O     1 
ATOM   5021 C CB    . ALA B 2 344 ? -0.438  -1.493  -39.554 1.00 48.83 ? 386 ALA B CB    1 
ATOM   5022 N N     . SER B 2 345 ? -3.186  -2.936  -39.996 1.00 47.55 ? 387 SER B N     1 
ATOM   5023 C CA    . SER B 2 345 ? -4.284  -3.830  -39.638 1.00 46.97 ? 387 SER B CA    1 
ATOM   5024 C C     . SER B 2 345 ? -5.302  -3.901  -40.790 1.00 46.28 ? 387 SER B C     1 
ATOM   5025 O O     . SER B 2 345 ? -6.438  -4.354  -40.614 1.00 46.22 ? 387 SER B O     1 
ATOM   5026 C CB    . SER B 2 345 ? -4.945  -3.392  -38.316 1.00 47.22 ? 387 SER B CB    1 
ATOM   5027 O OG    . SER B 2 345 ? -5.554  -2.114  -38.422 1.00 46.61 ? 387 SER B OG    1 
ATOM   5028 N N     . GLU B 2 346 ? -4.879  -3.440  -41.966 1.00 44.99 ? 388 GLU B N     1 
ATOM   5029 C CA    . GLU B 2 346 ? -5.672  -3.562  -43.189 1.00 44.17 ? 388 GLU B CA    1 
ATOM   5030 C C     . GLU B 2 346 ? -4.761  -3.863  -44.385 1.00 42.59 ? 388 GLU B C     1 
ATOM   5031 O O     . GLU B 2 346 ? -5.230  -4.280  -45.451 1.00 42.24 ? 388 GLU B O     1 
ATOM   5032 C CB    . GLU B 2 346 ? -6.509  -2.302  -43.426 1.00 44.74 ? 388 GLU B CB    1 
ATOM   5033 C CG    . GLU B 2 346 ? -7.753  -2.541  -44.288 1.00 46.10 ? 388 GLU B CG    1 
ATOM   5034 C CD    . GLU B 2 346 ? -8.492  -1.262  -44.649 1.00 45.56 ? 388 GLU B CD    1 
ATOM   5035 O OE1   . GLU B 2 346 ? -8.829  -0.476  -43.734 1.00 46.84 ? 388 GLU B OE1   1 
ATOM   5036 O OE2   . GLU B 2 346 ? -8.747  -1.050  -45.856 1.00 47.53 ? 388 GLU B OE2   1 
ATOM   5037 N N     . ALA B 2 347 ? -3.457  -3.669  -44.181 1.00 40.98 ? 389 ALA B N     1 
ATOM   5038 C CA    . ALA B 2 347 ? -2.430  -4.012  -45.168 1.00 38.72 ? 389 ALA B CA    1 
ATOM   5039 C C     . ALA B 2 347 ? -1.969  -5.469  -45.078 1.00 37.24 ? 389 ALA B C     1 
ATOM   5040 O O     . ALA B 2 347 ? -1.599  -6.060  -46.095 1.00 37.48 ? 389 ALA B O     1 
ATOM   5041 C CB    . ALA B 2 347 ? -1.235  -3.076  -45.040 1.00 38.65 ? 389 ALA B CB    1 
ATOM   5042 N N     . LEU B 2 348 ? -1.974  -6.038  -43.870 1.00 34.67 ? 390 LEU B N     1 
ATOM   5043 C CA    . LEU B 2 348 ? -1.502  -7.416  -43.666 1.00 32.26 ? 390 LEU B CA    1 
ATOM   5044 C C     . LEU B 2 348 ? -2.472  -8.527  -44.088 1.00 30.76 ? 390 LEU B C     1 
ATOM   5045 O O     . LEU B 2 348 ? -2.030  -9.504  -44.691 1.00 30.24 ? 390 LEU B O     1 
ATOM   5046 C CB    . LEU B 2 348 ? -1.002  -7.668  -42.232 1.00 31.77 ? 390 LEU B CB    1 
ATOM   5047 C CG    . LEU B 2 348 ? 0.484   -8.005  -42.023 1.00 30.44 ? 390 LEU B CG    1 
ATOM   5048 C CD1   . LEU B 2 348 ? 0.746   -8.453  -40.585 1.00 24.28 ? 390 LEU B CD1   1 
ATOM   5049 C CD2   . LEU B 2 348 ? 0.968   -9.070  -42.992 1.00 25.92 ? 390 LEU B CD2   1 
ATOM   5050 N N     . PRO B 2 349 ? -3.776  -8.410  -43.746 1.00 29.07 ? 391 PRO B N     1 
ATOM   5051 C CA    . PRO B 2 349 ? -4.694  -9.461  -44.185 1.00 28.37 ? 391 PRO B CA    1 
ATOM   5052 C C     . PRO B 2 349 ? -4.619  -9.710  -45.693 1.00 28.10 ? 391 PRO B C     1 
ATOM   5053 O O     . PRO B 2 349 ? -4.578  -10.866 -46.125 1.00 27.60 ? 391 PRO B O     1 
ATOM   5054 C CB    . PRO B 2 349 ? -6.068  -8.912  -43.784 1.00 28.47 ? 391 PRO B CB    1 
ATOM   5055 C CG    . PRO B 2 349 ? -5.777  -8.063  -42.599 1.00 27.96 ? 391 PRO B CG    1 
ATOM   5056 C CD    . PRO B 2 349 ? -4.476  -7.390  -42.940 1.00 28.69 ? 391 PRO B CD    1 
ATOM   5057 N N     . GLU B 2 350 ? -4.581  -8.629  -46.470 1.00 27.48 ? 392 GLU B N     1 
ATOM   5058 C CA    . GLU B 2 350 ? -4.438  -8.708  -47.922 1.00 27.25 ? 392 GLU B CA    1 
ATOM   5059 C C     . GLU B 2 350 ? -3.117  -9.344  -48.374 1.00 25.50 ? 392 GLU B C     1 
ATOM   5060 O O     . GLU B 2 350 ? -3.122  -10.168 -49.280 1.00 25.67 ? 392 GLU B O     1 
ATOM   5061 C CB    . GLU B 2 350 ? -4.644  -7.331  -48.560 1.00 27.17 ? 392 GLU B CB    1 
ATOM   5062 C CG    . GLU B 2 350 ? -6.074  -7.061  -49.076 1.00 33.76 ? 392 GLU B CG    1 
ATOM   5063 C CD    . GLU B 2 350 ? -7.168  -7.129  -48.000 1.00 39.15 ? 392 GLU B CD    1 
ATOM   5064 O OE1   . GLU B 2 350 ? -7.761  -6.070  -47.695 1.00 39.78 ? 392 GLU B OE1   1 
ATOM   5065 O OE2   . GLU B 2 350 ? -7.449  -8.235  -47.475 1.00 40.43 ? 392 GLU B OE2   1 
ATOM   5066 N N     . LEU B 2 351 ? -1.999  -8.978  -47.744 1.00 23.74 ? 393 LEU B N     1 
ATOM   5067 C CA    . LEU B 2 351 ? -0.697  -9.595  -48.064 1.00 22.98 ? 393 LEU B CA    1 
ATOM   5068 C C     . LEU B 2 351 ? -0.659  -11.103 -47.759 1.00 21.57 ? 393 LEU B C     1 
ATOM   5069 O O     . LEU B 2 351 ? 0.162   -11.825 -48.316 1.00 22.10 ? 393 LEU B O     1 
ATOM   5070 C CB    . LEU B 2 351 ? 0.476   -8.882  -47.361 1.00 22.51 ? 393 LEU B CB    1 
ATOM   5071 C CG    . LEU B 2 351 ? 0.970   -7.505  -47.844 1.00 24.22 ? 393 LEU B CG    1 
ATOM   5072 C CD1   . LEU B 2 351 ? 1.908   -6.880  -46.816 1.00 21.43 ? 393 LEU B CD1   1 
ATOM   5073 C CD2   . LEU B 2 351 ? 1.643   -7.541  -49.226 1.00 22.08 ? 393 LEU B CD2   1 
ATOM   5074 N N     . LEU B 2 352 ? -1.559  -11.565 -46.892 1.00 19.83 ? 394 LEU B N     1 
ATOM   5075 C CA    . LEU B 2 352 ? -1.663  -12.987 -46.548 1.00 19.01 ? 394 LEU B CA    1 
ATOM   5076 C C     . LEU B 2 352 ? -2.655  -13.778 -47.421 1.00 17.78 ? 394 LEU B C     1 
ATOM   5077 O O     . LEU B 2 352 ? -2.888  -14.959 -47.188 1.00 18.32 ? 394 LEU B O     1 
ATOM   5078 C CB    . LEU B 2 352 ? -1.979  -13.166 -45.053 1.00 16.98 ? 394 LEU B CB    1 
ATOM   5079 C CG    . LEU B 2 352 ? -0.963  -12.573 -44.080 1.00 17.45 ? 394 LEU B CG    1 
ATOM   5080 C CD1   . LEU B 2 352 ? -1.488  -12.636 -42.660 1.00 20.06 ? 394 LEU B CD1   1 
ATOM   5081 C CD2   . LEU B 2 352 ? 0.385   -13.262 -44.179 1.00 17.46 ? 394 LEU B CD2   1 
ATOM   5082 N N     . ARG B 2 353 ? -3.227  -13.137 -48.429 1.00 17.97 ? 395 ARG B N     1 
ATOM   5083 C CA    . ARG B 2 353 ? -4.068  -13.846 -49.390 1.00 19.03 ? 395 ARG B CA    1 
ATOM   5084 C C     . ARG B 2 353 ? -3.229  -14.920 -50.093 1.00 18.06 ? 395 ARG B C     1 
ATOM   5085 O O     . ARG B 2 353 ? -2.050  -14.684 -50.380 1.00 17.61 ? 395 ARG B O     1 
ATOM   5086 C CB    . ARG B 2 353 ? -4.617  -12.874 -50.428 1.00 19.83 ? 395 ARG B CB    1 
ATOM   5087 C CG    . ARG B 2 353 ? -5.726  -11.952 -49.956 1.00 24.25 ? 395 ARG B CG    1 
ATOM   5088 C CD    . ARG B 2 353 ? -5.771  -10.763 -50.902 1.00 31.97 ? 395 ARG B CD    1 
ATOM   5089 N NE    . ARG B 2 353 ? -7.044  -10.050 -50.908 1.00 38.18 ? 395 ARG B NE    1 
ATOM   5090 C CZ    . ARG B 2 353 ? -7.265  -8.923  -51.584 1.00 40.23 ? 395 ARG B CZ    1 
ATOM   5091 N NH1   . ARG B 2 353 ? -6.290  -8.368  -52.296 1.00 40.78 ? 395 ARG B NH1   1 
ATOM   5092 N NH2   . ARG B 2 353 ? -8.457  -8.340  -51.539 1.00 41.84 ? 395 ARG B NH2   1 
ATOM   5093 N N     . PRO B 2 354 ? -3.831  -16.086 -50.418 1.00 17.83 ? 396 PRO B N     1 
ATOM   5094 C CA    . PRO B 2 354 ? -5.241  -16.484 -50.340 1.00 18.24 ? 396 PRO B CA    1 
ATOM   5095 C C     . PRO B 2 354 ? -5.605  -17.287 -49.090 1.00 18.54 ? 396 PRO B C     1 
ATOM   5096 O O     . PRO B 2 354 ? -6.589  -18.046 -49.109 1.00 18.40 ? 396 PRO B O     1 
ATOM   5097 C CB    . PRO B 2 354 ? -5.398  -17.374 -51.583 1.00 18.48 ? 396 PRO B CB    1 
ATOM   5098 C CG    . PRO B 2 354 ? -4.024  -18.042 -51.717 1.00 17.56 ? 396 PRO B CG    1 
ATOM   5099 C CD    . PRO B 2 354 ? -3.010  -17.174 -50.981 1.00 16.94 ? 396 PRO B CD    1 
ATOM   5100 N N     . VAL B 2 355 ? -4.812  -17.130 -48.028 1.00 19.83 ? 397 VAL B N     1 
ATOM   5101 C CA    . VAL B 2 355 ? -5.070  -17.805 -46.757 1.00 20.50 ? 397 VAL B CA    1 
ATOM   5102 C C     . VAL B 2 355 ? -6.315  -17.197 -46.124 1.00 21.62 ? 397 VAL B C     1 
ATOM   5103 O O     . VAL B 2 355 ? -6.399  -15.981 -45.948 1.00 21.87 ? 397 VAL B O     1 
ATOM   5104 C CB    . VAL B 2 355 ? -3.874  -17.674 -45.782 1.00 19.53 ? 397 VAL B CB    1 
ATOM   5105 C CG1   . VAL B 2 355 ? -4.142  -18.431 -44.499 1.00 19.98 ? 397 VAL B CG1   1 
ATOM   5106 C CG2   . VAL B 2 355 ? -2.600  -18.183 -46.431 1.00 20.13 ? 397 VAL B CG2   1 
ATOM   5107 N N     . THR B 2 356 ? -7.289  -18.040 -45.805 1.00 22.73 ? 398 THR B N     1 
ATOM   5108 C CA    . THR B 2 356 ? -8.460  -17.564 -45.093 1.00 25.45 ? 398 THR B CA    1 
ATOM   5109 C C     . THR B 2 356 ? -8.472  -18.070 -43.644 1.00 26.76 ? 398 THR B C     1 
ATOM   5110 O O     . THR B 2 356 ? -8.236  -19.252 -43.391 1.00 27.10 ? 398 THR B O     1 
ATOM   5111 C CB    . THR B 2 356 ? -9.793  -17.852 -45.876 1.00 26.07 ? 398 THR B CB    1 
ATOM   5112 O OG1   . THR B 2 356 ? -10.895 -17.182 -45.251 1.00 27.73 ? 398 THR B OG1   1 
ATOM   5113 C CG2   . THR B 2 356 ? -10.094 -19.337 -45.977 1.00 27.28 ? 398 THR B CG2   1 
ATOM   5114 N N     . PRO B 2 357 ? -8.707  -17.164 -42.681 1.00 28.57 ? 399 PRO B N     1 
ATOM   5115 C CA    . PRO B 2 357 ? -8.922  -17.628 -41.314 1.00 29.90 ? 399 PRO B CA    1 
ATOM   5116 C C     . PRO B 2 357 ? -10.392 -18.015 -41.141 1.00 31.84 ? 399 PRO B C     1 
ATOM   5117 O O     . PRO B 2 357 ? -11.219 -17.700 -42.005 1.00 32.53 ? 399 PRO B O     1 
ATOM   5118 C CB    . PRO B 2 357 ? -8.574  -16.401 -40.467 1.00 29.16 ? 399 PRO B CB    1 
ATOM   5119 C CG    . PRO B 2 357 ? -8.876  -15.229 -41.350 1.00 30.34 ? 399 PRO B CG    1 
ATOM   5120 C CD    . PRO B 2 357 ? -8.801  -15.695 -42.794 1.00 28.60 ? 399 PRO B CD    1 
ATOM   5121 N N     . ILE B 2 358 ? -10.721 -18.700 -40.051 1.00 34.22 ? 400 ILE B N     1 
ATOM   5122 C CA    . ILE B 2 358 ? -12.124 -19.034 -39.775 1.00 35.82 ? 400 ILE B CA    1 
ATOM   5123 C C     . ILE B 2 358 ? -12.704 -18.098 -38.709 1.00 36.21 ? 400 ILE B C     1 
ATOM   5124 O O     . ILE B 2 358 ? -12.057 -17.802 -37.697 1.00 35.89 ? 400 ILE B O     1 
ATOM   5125 C CB    . ILE B 2 358 ? -12.326 -20.546 -39.417 1.00 36.28 ? 400 ILE B CB    1 
ATOM   5126 C CG1   . ILE B 2 358 ? -13.814 -20.872 -39.183 1.00 36.73 ? 400 ILE B CG1   1 
ATOM   5127 C CG2   . ILE B 2 358 ? -11.423 -20.970 -38.221 1.00 36.71 ? 400 ILE B CG2   1 
ATOM   5128 C CD1   . ILE B 2 358 ? -14.722 -20.687 -40.409 1.00 37.02 ? 400 ILE B CD1   1 
ATOM   5129 N N     . THR B 2 359 ? -13.920 -17.625 -38.955 1.00 36.71 ? 401 THR B N     1 
ATOM   5130 C CA    . THR B 2 359 ? -14.534 -16.631 -38.089 1.00 37.51 ? 401 THR B CA    1 
ATOM   5131 C C     . THR B 2 359 ? -15.783 -17.186 -37.389 1.00 37.75 ? 401 THR B C     1 
ATOM   5132 O O     . THR B 2 359 ? -16.917 -16.789 -37.673 1.00 37.88 ? 401 THR B O     1 
ATOM   5133 C CB    . THR B 2 359 ? -14.837 -15.314 -38.867 1.00 38.17 ? 401 THR B CB    1 
ATOM   5134 O OG1   . THR B 2 359 ? -15.751 -15.581 -39.938 1.00 38.10 ? 401 THR B OG1   1 
ATOM   5135 C CG2   . THR B 2 359 ? -13.552 -14.707 -39.439 1.00 37.82 ? 401 THR B CG2   1 
ATOM   5136 N N     . GLU B 2 383 ? -2.667  -51.898 -5.748  1.00 45.22 ? 425 GLU B N     1 
ATOM   5137 C CA    . GLU B 2 383 ? -2.432  -53.345 -5.754  1.00 46.60 ? 425 GLU B CA    1 
ATOM   5138 C C     . GLU B 2 383 ? -2.827  -54.016 -4.431  1.00 45.72 ? 425 GLU B C     1 
ATOM   5139 O O     . GLU B 2 383 ? -3.591  -54.986 -4.422  1.00 45.48 ? 425 GLU B O     1 
ATOM   5140 C CB    . GLU B 2 383 ? -0.967  -53.655 -6.090  1.00 46.92 ? 425 GLU B CB    1 
ATOM   5141 C CG    . GLU B 2 383 ? -0.597  -53.443 -7.552  1.00 49.89 ? 425 GLU B CG    1 
ATOM   5142 C CD    . GLU B 2 383 ? 0.901   -53.277 -7.760  1.00 53.09 ? 425 GLU B CD    1 
ATOM   5143 O OE1   . GLU B 2 383 ? 1.332   -52.145 -8.081  1.00 55.24 ? 425 GLU B OE1   1 
ATOM   5144 O OE2   . GLU B 2 383 ? 1.646   -54.269 -7.599  1.00 52.41 ? 425 GLU B OE2   1 
ATOM   5145 N N     . VAL B 2 384 ? -2.295  -53.485 -3.329  1.00 45.19 ? 426 VAL B N     1 
ATOM   5146 C CA    . VAL B 2 384 ? -2.553  -53.985 -1.971  1.00 44.18 ? 426 VAL B CA    1 
ATOM   5147 C C     . VAL B 2 384 ? -3.920  -53.491 -1.474  1.00 42.85 ? 426 VAL B C     1 
ATOM   5148 O O     . VAL B 2 384 ? -4.347  -52.379 -1.810  1.00 42.86 ? 426 VAL B O     1 
ATOM   5149 C CB    . VAL B 2 384 ? -1.415  -53.541 -0.977  1.00 44.53 ? 426 VAL B CB    1 
ATOM   5150 C CG1   . VAL B 2 384 ? -1.615  -54.130 0.421   1.00 43.69 ? 426 VAL B CG1   1 
ATOM   5151 C CG2   . VAL B 2 384 ? -0.030  -53.915 -1.519  1.00 43.69 ? 426 VAL B CG2   1 
ATOM   5152 N N     . ASP B 2 385 ? -4.603  -54.325 -0.689  1.00 40.90 ? 427 ASP B N     1 
ATOM   5153 C CA    . ASP B 2 385 ? -5.872  -53.947 -0.049  1.00 39.21 ? 427 ASP B CA    1 
ATOM   5154 C C     . ASP B 2 385 ? -5.674  -52.852 1.008   1.00 37.02 ? 427 ASP B C     1 
ATOM   5155 O O     . ASP B 2 385 ? -4.579  -52.703 1.559   1.00 37.39 ? 427 ASP B O     1 
ATOM   5156 C CB    . ASP B 2 385 ? -6.572  -55.172 0.551   1.00 39.78 ? 427 ASP B CB    1 
ATOM   5157 C CG    . ASP B 2 385 ? -5.606  -56.125 1.238   1.00 41.65 ? 427 ASP B CG    1 
ATOM   5158 O OD1   . ASP B 2 385 ? -5.992  -57.293 1.459   1.00 42.13 ? 427 ASP B OD1   1 
ATOM   5159 O OD2   . ASP B 2 385 ? -4.464  -55.714 1.552   1.00 44.10 ? 427 ASP B OD2   1 
ATOM   5160 N N     . ASP B 2 386 ? -6.742  -52.105 1.288   1.00 33.68 ? 428 ASP B N     1 
ATOM   5161 C CA    . ASP B 2 386 ? -6.648  -50.837 2.021   1.00 30.24 ? 428 ASP B CA    1 
ATOM   5162 C C     . ASP B 2 386 ? -6.213  -50.978 3.478   1.00 26.18 ? 428 ASP B C     1 
ATOM   5163 O O     . ASP B 2 386 ? -6.423  -52.022 4.090   1.00 25.37 ? 428 ASP B O     1 
ATOM   5164 C CB    . ASP B 2 386 ? -7.970  -50.060 1.928   1.00 31.19 ? 428 ASP B CB    1 
ATOM   5165 C CG    . ASP B 2 386 ? -7.781  -48.550 2.096   1.00 34.66 ? 428 ASP B CG    1 
ATOM   5166 O OD1   . ASP B 2 386 ? -8.703  -47.893 2.629   1.00 41.63 ? 428 ASP B OD1   1 
ATOM   5167 O OD2   . ASP B 2 386 ? -6.717  -48.017 1.702   1.00 35.32 ? 428 ASP B OD2   1 
ATOM   5168 N N     . TRP B 2 387 ? -5.594  -49.922 4.012   1.00 21.62 ? 429 TRP B N     1 
ATOM   5169 C CA    . TRP B 2 387 ? -5.168  -49.878 5.409   1.00 18.05 ? 429 TRP B CA    1 
ATOM   5170 C C     . TRP B 2 387 ? -6.368  -50.056 6.331   1.00 17.46 ? 429 TRP B C     1 
ATOM   5171 O O     . TRP B 2 387 ? -7.483  -49.660 5.995   1.00 16.88 ? 429 TRP B O     1 
ATOM   5172 C CB    . TRP B 2 387 ? -4.472  -48.546 5.758   1.00 16.00 ? 429 TRP B CB    1 
ATOM   5173 C CG    . TRP B 2 387 ? -3.382  -48.050 4.789   1.00 15.99 ? 429 TRP B CG    1 
ATOM   5174 C CD1   . TRP B 2 387 ? -3.353  -46.843 4.134   1.00 14.14 ? 429 TRP B CD1   1 
ATOM   5175 C CD2   . TRP B 2 387 ? -2.183  -48.737 4.400   1.00 12.23 ? 429 TRP B CD2   1 
ATOM   5176 N NE1   . TRP B 2 387 ? -2.218  -46.744 3.367   1.00 14.65 ? 429 TRP B NE1   1 
ATOM   5177 C CE2   . TRP B 2 387 ? -1.484  -47.891 3.513   1.00 15.80 ? 429 TRP B CE2   1 
ATOM   5178 C CE3   . TRP B 2 387 ? -1.628  -49.980 4.721   1.00 13.38 ? 429 TRP B CE3   1 
ATOM   5179 C CZ2   . TRP B 2 387 ? -0.262  -48.254 2.938   1.00 16.63 ? 429 TRP B CZ2   1 
ATOM   5180 C CZ3   . TRP B 2 387 ? -0.419  -50.343 4.141   1.00 12.91 ? 429 TRP B CZ3   1 
ATOM   5181 C CH2   . TRP B 2 387 ? 0.247   -49.487 3.262   1.00 14.81 ? 429 TRP B CH2   1 
ATOM   5182 N N     . GLU B 2 388 ? -6.141  -50.658 7.490   1.00 17.31 ? 430 GLU B N     1 
ATOM   5183 C CA    . GLU B 2 388 ? -7.165  -50.689 8.516   1.00 19.07 ? 430 GLU B CA    1 
ATOM   5184 C C     . GLU B 2 388 ? -6.701  -49.896 9.722   1.00 18.65 ? 430 GLU B C     1 
ATOM   5185 O O     . GLU B 2 388 ? -5.609  -50.113 10.250  1.00 18.96 ? 430 GLU B O     1 
ATOM   5186 C CB    . GLU B 2 388 ? -7.628  -52.121 8.869   1.00 17.54 ? 430 GLU B CB    1 
ATOM   5187 C CG    . GLU B 2 388 ? -6.560  -53.102 9.342   1.00 20.02 ? 430 GLU B CG    1 
ATOM   5188 C CD    . GLU B 2 388 ? -7.138  -54.276 10.154  1.00 23.28 ? 430 GLU B CD    1 
ATOM   5189 O OE1   . GLU B 2 388 ? -6.795  -55.442 9.847   1.00 26.91 ? 430 GLU B OE1   1 
ATOM   5190 O OE2   . GLU B 2 388 ? -7.934  -54.041 11.100  1.00 27.96 ? 430 GLU B OE2   1 
ATOM   5191 N N     . PHE B 2 389 ? -7.526  -48.936 10.120  1.00 19.45 ? 431 PHE B N     1 
ATOM   5192 C CA    . PHE B 2 389 ? -7.221  -48.090 11.264  1.00 20.10 ? 431 PHE B CA    1 
ATOM   5193 C C     . PHE B 2 389 ? -8.157  -48.407 12.430  1.00 20.65 ? 431 PHE B C     1 
ATOM   5194 O O     . PHE B 2 389 ? -8.907  -49.398 12.427  1.00 21.63 ? 431 PHE B O     1 
ATOM   5195 C CB    . PHE B 2 389 ? -7.314  -46.600 10.888  1.00 19.28 ? 431 PHE B CB    1 
ATOM   5196 C CG    . PHE B 2 389 ? -6.388  -46.186 9.781   1.00 18.06 ? 431 PHE B CG    1 
ATOM   5197 C CD1   . PHE B 2 389 ? -6.895  -45.783 8.552   1.00 16.15 ? 431 PHE B CD1   1 
ATOM   5198 C CD2   . PHE B 2 389 ? -5.006  -46.195 9.967   1.00 17.48 ? 431 PHE B CD2   1 
ATOM   5199 C CE1   . PHE B 2 389 ? -6.032  -45.391 7.519   1.00 16.34 ? 431 PHE B CE1   1 
ATOM   5200 C CE2   . PHE B 2 389 ? -4.143  -45.807 8.941   1.00 14.87 ? 431 PHE B CE2   1 
ATOM   5201 C CZ    . PHE B 2 389 ? -4.659  -45.405 7.717   1.00 14.94 ? 431 PHE B CZ    1 
ATOM   5202 O OXT   . PHE B 2 389 ? -8.180  -47.663 13.411  1.00 20.86 ? 431 PHE B OXT   1 
HETATM 5203 C C1    . CIT C 3 .   ? 18.431  -15.134 -1.447  1.00 48.87 ? 342 CIT A C1    1 
HETATM 5204 O O1    . CIT C 3 .   ? 18.886  -16.051 -2.164  1.00 50.88 ? 342 CIT A O1    1 
HETATM 5205 O O2    . CIT C 3 .   ? 19.095  -14.752 -0.455  1.00 46.78 ? 342 CIT A O2    1 
HETATM 5206 C C2    . CIT C 3 .   ? 17.093  -14.517 -1.791  1.00 48.51 ? 342 CIT A C2    1 
HETATM 5207 C C3    . CIT C 3 .   ? 17.180  -13.003 -1.997  1.00 48.01 ? 342 CIT A C3    1 
HETATM 5208 O O7    . CIT C 3 .   ? 18.163  -12.446 -1.073  1.00 46.17 ? 342 CIT A O7    1 
HETATM 5209 C C4    . CIT C 3 .   ? 17.572  -12.637 -3.438  1.00 46.04 ? 342 CIT A C4    1 
HETATM 5210 C C5    . CIT C 3 .   ? 17.665  -11.107 -3.546  1.00 43.62 ? 342 CIT A C5    1 
HETATM 5211 O O3    . CIT C 3 .   ? 18.635  -10.476 -3.015  1.00 42.03 ? 342 CIT A O3    1 
HETATM 5212 O O4    . CIT C 3 .   ? 16.763  -10.456 -4.152  1.00 39.65 ? 342 CIT A O4    1 
HETATM 5213 C C6    . CIT C 3 .   ? 15.806  -12.414 -1.668  1.00 48.54 ? 342 CIT A C6    1 
HETATM 5214 O O5    . CIT C 3 .   ? 14.813  -12.546 -2.438  1.00 50.18 ? 342 CIT A O5    1 
HETATM 5215 O O6    . CIT C 3 .   ? 15.671  -11.787 -0.592  1.00 46.45 ? 342 CIT A O6    1 
HETATM 5216 P PG    . ATP D 4 .   ? 7.687   -24.902 -28.744 1.00 49.45 ? 1   ATP B PG    1 
HETATM 5217 O O1G   . ATP D 4 .   ? 7.495   -25.719 -30.012 1.00 47.68 ? 1   ATP B O1G   1 
HETATM 5218 O O2G   . ATP D 4 .   ? 7.911   -25.768 -27.519 1.00 49.50 ? 1   ATP B O2G   1 
HETATM 5219 O O3G   . ATP D 4 .   ? 8.657   -23.736 -28.850 1.00 51.16 ? 1   ATP B O3G   1 
HETATM 5220 P PB    . ATP D 4 .   ? 5.681   -23.477 -27.262 1.00 24.78 ? 1   ATP B PB    1 
HETATM 5221 O O1B   . ATP D 4 .   ? 5.776   -24.461 -26.130 1.00 21.00 ? 1   ATP B O1B   1 
HETATM 5222 O O2B   . ATP D 4 .   ? 6.285   -22.106 -27.110 1.00 25.44 ? 1   ATP B O2B   1 
HETATM 5223 O O3B   . ATP D 4 .   ? 6.250   -24.172 -28.596 1.00 34.29 ? 1   ATP B O3B   1 
HETATM 5224 P PA    . ATP D 4 .   ? 3.457   -21.991 -28.339 1.00 26.22 ? 1   ATP B PA    1 
HETATM 5225 O O1A   . ATP D 4 .   ? 2.950   -21.047 -27.280 1.00 32.82 ? 1   ATP B O1A   1 
HETATM 5226 O O2A   . ATP D 4 .   ? 4.373   -21.440 -29.397 1.00 23.84 ? 1   ATP B O2A   1 
HETATM 5227 O O3A   . ATP D 4 .   ? 4.109   -23.284 -27.614 1.00 27.48 ? 1   ATP B O3A   1 
HETATM 5228 O "O5'" . ATP D 4 .   ? 2.202   -22.703 -29.019 1.00 27.19 ? 1   ATP B "O5'" 1 
HETATM 5229 C "C5'" . ATP D 4 .   ? 2.415   -23.663 -30.059 1.00 26.09 ? 1   ATP B "C5'" 1 
HETATM 5230 C "C4'" . ATP D 4 .   ? 1.632   -23.252 -31.288 1.00 20.96 ? 1   ATP B "C4'" 1 
HETATM 5231 O "O4'" . ATP D 4 .   ? 0.243   -23.190 -30.951 1.00 27.20 ? 1   ATP B "O4'" 1 
HETATM 5232 C "C3'" . ATP D 4 .   ? 1.943   -21.857 -31.808 1.00 20.97 ? 1   ATP B "C3'" 1 
HETATM 5233 O "O3'" . ATP D 4 .   ? 3.093   -21.801 -32.648 1.00 20.88 ? 1   ATP B "O3'" 1 
HETATM 5234 C "C2'" . ATP D 4 .   ? 0.677   -21.545 -32.575 1.00 25.84 ? 1   ATP B "C2'" 1 
HETATM 5235 O "O2'" . ATP D 4 .   ? 0.671   -22.208 -33.853 1.00 25.44 ? 1   ATP B "O2'" 1 
HETATM 5236 C "C1'" . ATP D 4 .   ? -0.402  -22.139 -31.681 1.00 25.44 ? 1   ATP B "C1'" 1 
HETATM 5237 N N9    . ATP D 4 .   ? -0.874  -21.039 -30.801 1.00 27.69 ? 1   ATP B N9    1 
HETATM 5238 C C8    . ATP D 4 .   ? -0.388  -20.701 -29.581 1.00 28.23 ? 1   ATP B C8    1 
HETATM 5239 N N7    . ATP D 4 .   ? -1.041  -19.618 -29.078 1.00 31.33 ? 1   ATP B N7    1 
HETATM 5240 C C5    . ATP D 4 .   ? -1.977  -19.234 -29.978 1.00 25.02 ? 1   ATP B C5    1 
HETATM 5241 C C6    . ATP D 4 .   ? -3.007  -18.169 -30.073 1.00 25.43 ? 1   ATP B C6    1 
HETATM 5242 N N6    . ATP D 4 .   ? -3.200  -17.251 -29.088 1.00 25.15 ? 1   ATP B N6    1 
HETATM 5243 N N1    . ATP D 4 .   ? -3.769  -18.138 -31.186 1.00 27.72 ? 1   ATP B N1    1 
HETATM 5244 C C2    . ATP D 4 .   ? -3.605  -19.021 -32.192 1.00 29.45 ? 1   ATP B C2    1 
HETATM 5245 N N3    . ATP D 4 .   ? -2.691  -20.009 -32.177 1.00 26.64 ? 1   ATP B N3    1 
HETATM 5246 C C4    . ATP D 4 .   ? -1.856  -20.167 -31.114 1.00 30.01 ? 1   ATP B C4    1 
HETATM 5247 O O     . HOH E 5 .   ? 1.297   -22.698 -19.919 1.00 31.74 ? 343 HOH A O     1 
HETATM 5248 O O     . HOH E 5 .   ? 27.060  -17.420 -20.263 1.00 39.91 ? 344 HOH A O     1 
HETATM 5249 O O     . HOH E 5 .   ? 6.112   7.689   3.588   1.00 19.41 ? 345 HOH A O     1 
HETATM 5250 O O     . HOH E 5 .   ? 3.069   -18.883 -30.225 1.00 20.54 ? 346 HOH A O     1 
HETATM 5251 O O     . HOH E 5 .   ? 9.524   -20.776 -35.697 1.00 28.81 ? 347 HOH A O     1 
HETATM 5252 O O     . HOH E 5 .   ? 4.006   5.837   -13.685 1.00 21.98 ? 348 HOH A O     1 
HETATM 5253 O O     . HOH E 5 .   ? 6.137   -26.478 -1.712  1.00 29.90 ? 349 HOH A O     1 
HETATM 5254 O O     . HOH E 5 .   ? 2.794   -21.204 -17.815 1.00 22.35 ? 350 HOH A O     1 
HETATM 5255 O O     . HOH E 5 .   ? -8.261  -6.151  -1.431  1.00 29.19 ? 351 HOH A O     1 
HETATM 5256 O O     . HOH E 5 .   ? -4.541  -7.882  6.003   1.00 20.64 ? 352 HOH A O     1 
HETATM 5257 O O     . HOH E 5 .   ? 6.623   -34.014 1.816   1.00 20.56 ? 353 HOH A O     1 
HETATM 5258 O O     . HOH E 5 .   ? 17.490  -40.001 4.592   1.00 24.99 ? 354 HOH A O     1 
HETATM 5259 O O     . HOH E 5 .   ? -6.495  -6.377  7.369   1.00 32.16 ? 355 HOH A O     1 
HETATM 5260 O O     . HOH E 5 .   ? -7.061  -22.718 -10.002 1.00 24.32 ? 356 HOH A O     1 
HETATM 5261 O O     . HOH E 5 .   ? -0.307  -7.250  -23.572 1.00 35.56 ? 357 HOH A O     1 
HETATM 5262 O O     . HOH E 5 .   ? -3.819  -1.285  -1.698  1.00 18.29 ? 358 HOH A O     1 
HETATM 5263 O O     . HOH E 5 .   ? 1.367   -8.846  14.559  1.00 21.17 ? 359 HOH A O     1 
HETATM 5264 O O     . HOH E 5 .   ? 3.841   -18.644 -26.250 1.00 22.44 ? 360 HOH A O     1 
HETATM 5265 O O     . HOH E 5 .   ? 9.398   -9.103  -4.568  1.00 32.55 ? 361 HOH A O     1 
HETATM 5266 O O     . HOH E 5 .   ? -5.580  -10.082 4.779   1.00 21.84 ? 362 HOH A O     1 
HETATM 5267 O O     . HOH E 5 .   ? 3.464   -22.220 -21.768 1.00 23.64 ? 363 HOH A O     1 
HETATM 5268 O O     . HOH E 5 .   ? -6.076  -0.125  -2.905  1.00 24.95 ? 364 HOH A O     1 
HETATM 5269 O O     . HOH E 5 .   ? 0.309   -24.996 -34.708 1.00 23.13 ? 365 HOH A O     1 
HETATM 5270 O O     . HOH E 5 .   ? 6.301   0.259   -15.352 1.00 39.02 ? 366 HOH A O     1 
HETATM 5271 O O     . HOH E 5 .   ? 3.993   -20.819 -5.459  1.00 27.76 ? 367 HOH A O     1 
HETATM 5272 O O     . HOH E 5 .   ? 6.115   -41.398 15.313  1.00 20.70 ? 368 HOH A O     1 
HETATM 5273 O O     . HOH E 5 .   ? 12.913  -31.279 12.737  1.00 20.14 ? 369 HOH A O     1 
HETATM 5274 O O     . HOH E 5 .   ? 3.418   -22.584 -35.269 1.00 22.51 ? 370 HOH A O     1 
HETATM 5275 O O     . HOH E 5 .   ? -0.058  -3.406  -12.688 1.00 25.36 ? 371 HOH A O     1 
HETATM 5276 O O     . HOH E 5 .   ? -6.910  -23.932 5.732   1.00 24.74 ? 372 HOH A O     1 
HETATM 5277 O O     . HOH E 5 .   ? -3.598  -9.024  14.317  1.00 31.08 ? 373 HOH A O     1 
HETATM 5278 O O     . HOH E 5 .   ? -0.445  -15.414 13.960  1.00 32.06 ? 374 HOH A O     1 
HETATM 5279 O O     . HOH E 5 .   ? 14.902  18.183  -2.337  1.00 41.05 ? 375 HOH A O     1 
HETATM 5280 O O     . HOH E 5 .   ? 6.184   -22.322 -30.863 1.00 20.51 ? 376 HOH A O     1 
HETATM 5281 O O     . HOH E 5 .   ? -0.548  2.635   -17.718 1.00 32.71 ? 377 HOH A O     1 
HETATM 5282 O O     . HOH E 5 .   ? -11.200 -25.379 -13.020 1.00 33.37 ? 378 HOH A O     1 
HETATM 5283 O O     . HOH E 5 .   ? 1.480   -17.362 -25.613 1.00 32.87 ? 379 HOH A O     1 
HETATM 5284 O O     . HOH E 5 .   ? 15.563  0.576   4.634   1.00 36.36 ? 380 HOH A O     1 
HETATM 5285 O O     . HOH E 5 .   ? 9.304   -47.535 19.111  1.00 26.21 ? 381 HOH A O     1 
HETATM 5286 O O     . HOH E 5 .   ? 4.757   -18.786 -23.586 1.00 25.90 ? 382 HOH A O     1 
HETATM 5287 O O     . HOH E 5 .   ? -4.958  6.974   -12.038 1.00 29.83 ? 383 HOH A O     1 
HETATM 5288 O O     . HOH E 5 .   ? 8.983   -19.768 -24.716 1.00 27.78 ? 384 HOH A O     1 
HETATM 5289 O O     . HOH E 5 .   ? 16.698  -3.203  -27.338 1.00 20.05 ? 385 HOH A O     1 
HETATM 5290 O O     . HOH E 5 .   ? -4.170  1.817   -16.666 1.00 38.39 ? 386 HOH A O     1 
HETATM 5291 O O     . HOH E 5 .   ? -6.832  -40.264 -5.052  1.00 42.01 ? 387 HOH A O     1 
HETATM 5292 O O     . HOH E 5 .   ? 2.494   5.568   -15.893 1.00 23.60 ? 388 HOH A O     1 
HETATM 5293 O O     . HOH E 5 .   ? 4.266   -47.967 -6.867  1.00 28.04 ? 389 HOH A O     1 
HETATM 5294 O O     . HOH E 5 .   ? 11.418  -25.235 2.276   1.00 25.68 ? 390 HOH A O     1 
HETATM 5295 O O     . HOH E 5 .   ? 7.813   17.478  -0.449  1.00 25.84 ? 391 HOH A O     1 
HETATM 5296 O O     . HOH E 5 .   ? -0.015  -14.027 17.952  1.00 31.60 ? 392 HOH A O     1 
HETATM 5297 O O     . HOH E 5 .   ? 16.411  -9.018  8.510   1.00 28.81 ? 393 HOH A O     1 
HETATM 5298 O O     . HOH E 5 .   ? 0.297   -40.504 -11.082 1.00 43.33 ? 394 HOH A O     1 
HETATM 5299 O O     . HOH E 5 .   ? -4.007  16.960  -10.204 1.00 19.95 ? 395 HOH A O     1 
HETATM 5300 O O     . HOH E 5 .   ? -8.463  -28.943 10.459  1.00 36.80 ? 396 HOH A O     1 
HETATM 5301 O O     . HOH E 5 .   ? -9.214  -5.435  -8.388  1.00 27.61 ? 397 HOH A O     1 
HETATM 5302 O O     . HOH E 5 .   ? 6.442   3.497   -16.188 1.00 39.75 ? 398 HOH A O     1 
HETATM 5303 O O     . HOH E 5 .   ? 12.138  -22.968 11.233  1.00 27.26 ? 399 HOH A O     1 
HETATM 5304 O O     . HOH E 5 .   ? 16.916  -19.438 -44.000 1.00 26.51 ? 400 HOH A O     1 
HETATM 5305 O O     . HOH E 5 .   ? 6.401   -20.381 -24.871 1.00 31.79 ? 401 HOH A O     1 
HETATM 5306 O O     . HOH E 5 .   ? -6.416  17.451  -11.359 1.00 24.27 ? 402 HOH A O     1 
HETATM 5307 O O     . HOH E 5 .   ? -7.630  -39.367 4.402   1.00 33.62 ? 403 HOH A O     1 
HETATM 5308 O O     . HOH E 5 .   ? -6.912  0.986   0.977   1.00 27.01 ? 404 HOH A O     1 
HETATM 5309 O O     . HOH E 5 .   ? -5.461  -22.112 -7.820  1.00 20.48 ? 405 HOH A O     1 
HETATM 5310 O O     . HOH E 5 .   ? -5.107  -3.102  0.095   1.00 27.81 ? 406 HOH A O     1 
HETATM 5311 O O     . HOH E 5 .   ? 14.063  -29.597 5.191   1.00 34.25 ? 407 HOH A O     1 
HETATM 5312 O O     . HOH E 5 .   ? 8.982   -19.025 -17.151 1.00 26.92 ? 408 HOH A O     1 
HETATM 5313 O O     . HOH E 5 .   ? -0.757  -24.414 -19.651 1.00 27.37 ? 409 HOH A O     1 
HETATM 5314 O O     . HOH E 5 .   ? 0.936   -20.396 -21.098 1.00 29.92 ? 410 HOH A O     1 
HETATM 5315 O O     . HOH E 5 .   ? 6.718   0.106   -28.156 1.00 35.04 ? 411 HOH A O     1 
HETATM 5316 O O     . HOH E 5 .   ? 4.728   -26.111 -37.366 1.00 31.06 ? 412 HOH A O     1 
HETATM 5317 O O     . HOH E 5 .   ? 19.270  -2.946  -25.864 1.00 33.30 ? 413 HOH A O     1 
HETATM 5318 O O     . HOH E 5 .   ? 10.615  -16.089 7.659   1.00 24.21 ? 414 HOH A O     1 
HETATM 5319 O O     . HOH E 5 .   ? 10.210  -14.138 5.356   1.00 27.35 ? 415 HOH A O     1 
HETATM 5320 O O     . HOH E 5 .   ? 11.398  -23.410 8.726   1.00 22.47 ? 416 HOH A O     1 
HETATM 5321 O O     . HOH E 5 .   ? 12.551  -25.247 6.841   1.00 40.43 ? 417 HOH A O     1 
HETATM 5322 O O     . HOH E 5 .   ? -7.416  -3.732  -0.602  1.00 30.54 ? 418 HOH A O     1 
HETATM 5323 O O     . HOH E 5 .   ? 15.048  -0.902  -27.079 1.00 31.28 ? 419 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   HIS 9   9   9   HIS HIS A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  MET 50  50  50  MET MET A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  TYR 55  55  55  TYR TYR A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 CYS 121 121 121 CYS CYS A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 MET 129 129 129 MET MET A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 PRO 137 137 137 PRO PRO A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 CYS 143 143 143 CYS CYS A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 MET 146 146 146 MET MET A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 CYS 150 150 150 CYS CYS A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 HIS 153 153 153 HIS HIS A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 TRP 162 162 162 TRP TRP A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 TYR 172 172 172 TYR TYR A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 THR 177 177 177 THR THR A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 HIS 195 195 195 HIS HIS A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 GLN 205 205 205 GLN GLN A . n 
A 1 206 HIS 206 206 206 HIS HIS A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 PHE 210 210 210 PHE PHE A . n 
A 1 211 PHE 211 211 211 PHE PHE A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 TYR 214 214 214 TYR TYR A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 HIS 219 219 219 HIS HIS A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 ARG 227 227 227 ARG ARG A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 HIS 241 241 241 HIS HIS A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 MET 246 246 246 MET MET A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 TYR 249 249 249 TYR TYR A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 LYS 252 252 252 LYS LYS A . n 
A 1 253 PRO 253 253 253 PRO PRO A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 MET 260 260 260 MET MET A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 ARG 264 264 264 ARG ARG A . n 
A 1 265 ASP 265 265 265 ASP ASP A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 ARG 268 268 268 ARG ARG A . n 
A 1 269 ASN 269 269 269 ASN ASN A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 PHE 272 272 272 PHE PHE A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ALA 283 283 283 ALA ALA A . n 
A 1 284 ASN 284 284 284 ASN ASN A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 ASN 286 286 286 ASN ASN A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 GLN 289 289 289 GLN GLN A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 ASP 293 293 293 ASP ASP A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 GLN 299 299 299 GLN GLN A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 LYS 301 301 301 LYS LYS A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 PHE 305 305 305 PHE PHE A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 LYS 308 308 308 LYS LYS A . n 
A 1 309 PHE 309 309 309 PHE PHE A . n 
A 1 310 GLN 310 310 310 GLN GLN A . n 
A 1 311 ASN 311 311 311 ASN ASN A . n 
A 1 312 ASP 312 312 312 ASP ASP A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 THR 314 314 314 THR THR A . n 
A 1 315 GLU 315 315 315 GLU GLU A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 GLU 317 317 317 GLU GLU A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 PHE 319 319 319 PHE PHE A . n 
A 1 320 ASN 320 320 320 ASN ASN A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 GLU 322 322 322 GLU GLU A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 THR 324 324 324 THR THR A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 LEU 326 326 326 LEU LEU A . n 
A 1 327 VAL 327 327 327 VAL VAL A . n 
A 1 328 LYS 328 328 328 LYS LYS A . n 
A 1 329 GLN 329 329 329 GLN GLN A . n 
A 1 330 ILE 330 330 330 ILE ILE A . n 
A 1 331 ARG 331 331 331 ARG ARG A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 LYS 334 334 334 LYS LYS A . n 
A 1 335 ARG 335 335 335 ARG ARG A . n 
A 1 336 PRO 336 336 336 PRO PRO A . n 
A 1 337 ALA 337 337 ?   ?   ?   A . n 
A 1 338 GLN 338 338 ?   ?   ?   A . n 
A 1 339 GLN 339 339 ?   ?   ?   A . n 
A 1 340 GLU 340 340 ?   ?   ?   A . n 
A 1 341 ALA 341 341 ?   ?   ?   A . n 
B 2 1   MET 1   -16 ?   ?   ?   B . n 
B 2 2   ALA 2   -15 -15 ALA ALA B . n 
B 2 3   HIS 3   -14 -14 HIS HIS B . n 
B 2 4   HIS 4   -13 -13 HIS HIS B . n 
B 2 5   HIS 5   -12 -12 HIS HIS B . n 
B 2 6   HIS 6   -11 -11 HIS HIS B . n 
B 2 7   HIS 7   -10 -10 HIS HIS B . n 
B 2 8   HIS 8   -9  -9  HIS HIS B . n 
B 2 9   MET 9   -8  -8  MET MET B . n 
B 2 10  GLU 10  -7  -7  GLU GLU B . n 
B 2 11  ASN 11  -6  -6  ASN ASN B . n 
B 2 12  LEU 12  -5  -5  LEU LEU B . n 
B 2 13  TYR 13  -4  -4  TYR TYR B . n 
B 2 14  PHE 14  -3  -3  PHE PHE B . n 
B 2 15  GLN 15  -2  -2  GLN GLN B . n 
B 2 16  GLY 16  -1  ?   ?   ?   B . n 
B 2 17  MET 17  59  ?   ?   ?   B . n 
B 2 18  SER 18  60  60  SER SER B . n 
B 2 19  SER 19  61  61  SER SER B . n 
B 2 20  PHE 20  62  62  PHE PHE B . n 
B 2 21  LEU 21  63  63  LEU LEU B . n 
B 2 22  PRO 22  64  64  PRO PRO B . n 
B 2 23  GLU 23  65  65  GLU GLU B . n 
B 2 24  GLY 24  66  66  GLY GLY B . n 
B 2 25  GLY 25  67  67  GLY GLY B . n 
B 2 26  CYS 26  68  68  CYS CYS B . n 
B 2 27  TYR 27  69  69  TYR TYR B . n 
B 2 28  GLU 28  70  70  GLU GLU B . n 
B 2 29  LEU 29  71  71  LEU LEU B . n 
B 2 30  LEU 30  72  72  LEU LEU B . n 
B 2 31  THR 31  73  73  THR THR B . n 
B 2 32  VAL 32  74  74  VAL VAL B . n 
B 2 33  ILE 33  75  75  ILE ILE B . n 
B 2 34  GLY 34  76  76  GLY GLY B . n 
B 2 35  LYS 35  77  77  LYS LYS B . n 
B 2 36  GLY 36  78  78  GLY GLY B . n 
B 2 37  PHE 37  79  79  PHE PHE B . n 
B 2 38  GLU 38  80  80  GLU GLU B . n 
B 2 39  ASP 39  81  81  ASP ASP B . n 
B 2 40  LEU 40  82  82  LEU LEU B . n 
B 2 41  MET 41  83  83  MET MET B . n 
B 2 42  THR 42  84  84  THR THR B . n 
B 2 43  VAL 43  85  85  VAL VAL B . n 
B 2 44  ASN 44  86  86  ASN ASN B . n 
B 2 45  LEU 45  87  87  LEU LEU B . n 
B 2 46  ALA 46  88  88  ALA ALA B . n 
B 2 47  ARG 47  89  89  ARG ARG B . n 
B 2 48  TYR 48  90  90  TYR TYR B . n 
B 2 49  LYS 49  91  91  LYS LYS B . n 
B 2 50  PRO 50  92  92  PRO PRO B . n 
B 2 51  THR 51  93  93  THR THR B . n 
B 2 52  GLY 52  94  94  GLY GLY B . n 
B 2 53  GLU 53  95  95  GLU GLU B . n 
B 2 54  TYR 54  96  96  TYR TYR B . n 
B 2 55  VAL 55  97  97  VAL VAL B . n 
B 2 56  THR 56  98  98  THR THR B . n 
B 2 57  VAL 57  99  99  VAL VAL B . n 
B 2 58  ARG 58  100 100 ARG ARG B . n 
B 2 59  ARG 59  101 101 ARG ARG B . n 
B 2 60  ILE 60  102 102 ILE ILE B . n 
B 2 61  ASN 61  103 103 ASN ASN B . n 
B 2 62  LEU 62  104 104 LEU LEU B . n 
B 2 63  GLU 63  105 105 GLU GLU B . n 
B 2 64  ALA 64  106 106 ALA ALA B . n 
B 2 65  CYS 65  107 107 CYS CYS B . n 
B 2 66  SER 66  108 108 SER SER B . n 
B 2 67  ASN 67  109 109 ASN ASN B . n 
B 2 68  GLU 68  110 110 GLU GLU B . n 
B 2 69  MET 69  111 111 MET MET B . n 
B 2 70  VAL 70  112 112 VAL VAL B . n 
B 2 71  THR 71  113 113 THR THR B . n 
B 2 72  PHE 72  114 114 PHE PHE B . n 
B 2 73  LEU 73  115 115 LEU LEU B . n 
B 2 74  GLN 74  116 116 GLN GLN B . n 
B 2 75  GLY 75  117 117 GLY GLY B . n 
B 2 76  GLU 76  118 118 GLU GLU B . n 
B 2 77  LEU 77  119 119 LEU LEU B . n 
B 2 78  HIS 78  120 120 HIS HIS B . n 
B 2 79  VAL 79  121 121 VAL VAL B . n 
B 2 80  SER 80  122 122 SER SER B . n 
B 2 81  LYS 81  123 123 LYS LYS B . n 
B 2 82  LEU 82  124 124 LEU LEU B . n 
B 2 83  PHE 83  125 125 PHE PHE B . n 
B 2 84  ASN 84  126 126 ASN ASN B . n 
B 2 85  HIS 85  127 127 HIS HIS B . n 
B 2 86  PRO 86  128 128 PRO PRO B . n 
B 2 87  ASN 87  129 129 ASN ASN B . n 
B 2 88  ILE 88  130 130 ILE ILE B . n 
B 2 89  VAL 89  131 131 VAL VAL B . n 
B 2 90  PRO 90  132 132 PRO PRO B . n 
B 2 91  TYR 91  133 133 TYR TYR B . n 
B 2 92  ARG 92  134 134 ARG ARG B . n 
B 2 93  ALA 93  135 135 ALA ALA B . n 
B 2 94  THR 94  136 136 THR THR B . n 
B 2 95  PHE 95  137 137 PHE PHE B . n 
B 2 96  ILE 96  138 138 ILE ILE B . n 
B 2 97  ALA 97  139 139 ALA ALA B . n 
B 2 98  ASP 98  140 140 ASP ASP B . n 
B 2 99  ASN 99  141 141 ASN ASN B . n 
B 2 100 GLU 100 142 142 GLU GLU B . n 
B 2 101 LEU 101 143 143 LEU LEU B . n 
B 2 102 TRP 102 144 144 TRP TRP B . n 
B 2 103 VAL 103 145 145 VAL VAL B . n 
B 2 104 VAL 104 146 146 VAL VAL B . n 
B 2 105 THR 105 147 147 THR THR B . n 
B 2 106 SER 106 148 148 SER SER B . n 
B 2 107 PHE 107 149 149 PHE PHE B . n 
B 2 108 MET 108 150 150 MET MET B . n 
B 2 109 ALA 109 151 151 ALA ALA B . n 
B 2 110 TYR 110 152 152 TYR TYR B . n 
B 2 111 GLY 111 153 153 GLY GLY B . n 
B 2 112 SER 112 154 154 SER SER B . n 
B 2 113 ALA 113 155 155 ALA ALA B . n 
B 2 114 LYS 114 156 156 LYS LYS B . n 
B 2 115 ASP 115 157 157 ASP ASP B . n 
B 2 116 LEU 116 158 158 LEU LEU B . n 
B 2 117 ILE 117 159 159 ILE ILE B . n 
B 2 118 CYS 118 160 160 CYS CYS B . n 
B 2 119 THR 119 161 161 THR THR B . n 
B 2 120 HIS 120 162 162 HIS HIS B . n 
B 2 121 PHE 121 163 163 PHE PHE B . n 
B 2 122 MET 122 164 164 MET MET B . n 
B 2 123 ASP 123 165 165 ASP ASP B . n 
B 2 124 GLY 124 166 166 GLY GLY B . n 
B 2 125 MET 125 167 167 MET MET B . n 
B 2 126 ASN 126 168 168 ASN ASN B . n 
B 2 127 GLU 127 169 169 GLU GLU B . n 
B 2 128 LEU 128 170 170 LEU LEU B . n 
B 2 129 ALA 129 171 171 ALA ALA B . n 
B 2 130 ILE 130 172 172 ILE ILE B . n 
B 2 131 ALA 131 173 173 ALA ALA B . n 
B 2 132 TYR 132 174 174 TYR TYR B . n 
B 2 133 ILE 133 175 175 ILE ILE B . n 
B 2 134 LEU 134 176 176 LEU LEU B . n 
B 2 135 GLN 135 177 177 GLN GLN B . n 
B 2 136 GLY 136 178 178 GLY GLY B . n 
B 2 137 VAL 137 179 179 VAL VAL B . n 
B 2 138 LEU 138 180 180 LEU LEU B . n 
B 2 139 LYS 139 181 181 LYS LYS B . n 
B 2 140 ALA 140 182 182 ALA ALA B . n 
B 2 141 LEU 141 183 183 LEU LEU B . n 
B 2 142 ASP 142 184 184 ASP ASP B . n 
B 2 143 TYR 143 185 185 TYR TYR B . n 
B 2 144 ILE 144 186 186 ILE ILE B . n 
B 2 145 HIS 145 187 187 HIS HIS B . n 
B 2 146 HIS 146 188 188 HIS HIS B . n 
B 2 147 MET 147 189 189 MET MET B . n 
B 2 148 GLY 148 190 190 GLY GLY B . n 
B 2 149 TYR 149 191 191 TYR TYR B . n 
B 2 150 VAL 150 192 192 VAL VAL B . n 
B 2 151 HIS 151 193 193 HIS HIS B . n 
B 2 152 ARG 152 194 194 ARG ARG B . n 
B 2 153 SER 153 195 195 SER SER B . n 
B 2 154 VAL 154 196 196 VAL VAL B . n 
B 2 155 LYS 155 197 197 LYS LYS B . n 
B 2 156 ALA 156 198 198 ALA ALA B . n 
B 2 157 SER 157 199 199 SER SER B . n 
B 2 158 HIS 158 200 200 HIS HIS B . n 
B 2 159 ILE 159 201 201 ILE ILE B . n 
B 2 160 LEU 160 202 202 LEU LEU B . n 
B 2 161 ILE 161 203 203 ILE ILE B . n 
B 2 162 SER 162 204 204 SER SER B . n 
B 2 163 VAL 163 205 205 VAL VAL B . n 
B 2 164 ASP 164 206 206 ASP ASP B . n 
B 2 165 GLY 165 207 207 GLY GLY B . n 
B 2 166 LYS 166 208 208 LYS LYS B . n 
B 2 167 VAL 167 209 209 VAL VAL B . n 
B 2 168 TYR 168 210 210 TYR TYR B . n 
B 2 169 LEU 169 211 211 LEU LEU B . n 
B 2 170 SER 170 212 212 SER SER B . n 
B 2 171 GLY 171 213 213 GLY GLY B . n 
B 2 172 LEU 172 214 214 LEU LEU B . n 
B 2 173 ARG 173 215 215 ARG ARG B . n 
B 2 174 SER 174 216 216 SER SER B . n 
B 2 175 ASN 175 217 217 ASN ASN B . n 
B 2 176 LEU 176 218 218 LEU LEU B . n 
B 2 177 SER 177 219 219 SER SER B . n 
B 2 178 MET 178 220 220 MET MET B . n 
B 2 179 ILE 179 221 221 ILE ILE B . n 
B 2 180 SER 180 222 222 SER SER B . n 
B 2 181 HIS 181 223 223 HIS HIS B . n 
B 2 182 GLY 182 224 224 GLY GLY B . n 
B 2 183 GLN 183 225 225 GLN GLN B . n 
B 2 184 ARG 184 226 226 ARG ARG B . n 
B 2 185 GLN 185 227 227 GLN GLN B . n 
B 2 186 ARG 186 228 228 ARG ARG B . n 
B 2 187 VAL 187 229 229 VAL VAL B . n 
B 2 188 VAL 188 230 230 VAL VAL B . n 
B 2 189 HIS 189 231 231 HIS HIS B . n 
B 2 190 ASP 190 232 232 ASP ASP B . n 
B 2 191 PHE 191 233 233 PHE PHE B . n 
B 2 192 PRO 192 234 234 PRO PRO B . n 
B 2 193 LYS 193 235 235 LYS LYS B . n 
B 2 194 TYR 194 236 236 TYR TYR B . n 
B 2 195 SER 195 237 237 SER SER B . n 
B 2 196 VAL 196 238 238 VAL VAL B . n 
B 2 197 LYS 197 239 239 LYS LYS B . n 
B 2 198 VAL 198 240 240 VAL VAL B . n 
B 2 199 LEU 199 241 241 LEU LEU B . n 
B 2 200 PRO 200 242 242 PRO PRO B . n 
B 2 201 TRP 201 243 243 TRP TRP B . n 
B 2 202 LEU 202 244 244 LEU LEU B . n 
B 2 203 SER 203 245 245 SER SER B . n 
B 2 204 PRO 204 246 246 PRO PRO B . n 
B 2 205 GLU 205 247 247 GLU GLU B . n 
B 2 206 VAL 206 248 248 VAL VAL B . n 
B 2 207 LEU 207 249 249 LEU LEU B . n 
B 2 208 GLN 208 250 250 GLN GLN B . n 
B 2 209 GLN 209 251 251 GLN GLN B . n 
B 2 210 ASN 210 252 252 ASN ASN B . n 
B 2 211 LEU 211 253 253 LEU LEU B . n 
B 2 212 GLN 212 254 254 GLN GLN B . n 
B 2 213 GLY 213 255 255 GLY GLY B . n 
B 2 214 TYR 214 256 256 TYR TYR B . n 
B 2 215 ASP 215 257 257 ASP ASP B . n 
B 2 216 ALA 216 258 258 ALA ALA B . n 
B 2 217 LYS 217 259 259 LYS LYS B . n 
B 2 218 SER 218 260 260 SER SER B . n 
B 2 219 ASP 219 261 261 ASP ASP B . n 
B 2 220 ILE 220 262 262 ILE ILE B . n 
B 2 221 TYR 221 263 263 TYR TYR B . n 
B 2 222 SER 222 264 264 SER SER B . n 
B 2 223 VAL 223 265 265 VAL VAL B . n 
B 2 224 GLY 224 266 266 GLY GLY B . n 
B 2 225 ILE 225 267 267 ILE ILE B . n 
B 2 226 THR 226 268 268 THR THR B . n 
B 2 227 ALA 227 269 269 ALA ALA B . n 
B 2 228 CYS 228 270 270 CYS CYS B . n 
B 2 229 GLU 229 271 271 GLU GLU B . n 
B 2 230 LEU 230 272 272 LEU LEU B . n 
B 2 231 ALA 231 273 273 ALA ALA B . n 
B 2 232 ASN 232 274 274 ASN ASN B . n 
B 2 233 GLY 233 275 275 GLY GLY B . n 
B 2 234 HIS 234 276 276 HIS HIS B . n 
B 2 235 VAL 235 277 277 VAL VAL B . n 
B 2 236 PRO 236 278 278 PRO PRO B . n 
B 2 237 PHE 237 279 279 PHE PHE B . n 
B 2 238 LYS 238 280 280 LYS LYS B . n 
B 2 239 ASP 239 281 281 ASP ASP B . n 
B 2 240 MET 240 282 282 MET MET B . n 
B 2 241 PRO 241 283 283 PRO PRO B . n 
B 2 242 ALA 242 284 284 ALA ALA B . n 
B 2 243 THR 243 285 285 THR THR B . n 
B 2 244 GLN 244 286 286 GLN GLN B . n 
B 2 245 MET 245 287 287 MET MET B . n 
B 2 246 LEU 246 288 288 LEU LEU B . n 
B 2 247 LEU 247 289 289 LEU LEU B . n 
B 2 248 GLU 248 290 290 GLU GLU B . n 
B 2 249 LYS 249 291 291 LYS LYS B . n 
B 2 250 LEU 250 292 ?   ?   ?   B . n 
B 2 251 ASN 251 293 ?   ?   ?   B . n 
B 2 252 GLY 252 294 ?   ?   ?   B . n 
B 2 253 THR 253 295 ?   ?   ?   B . n 
B 2 254 VAL 254 296 ?   ?   ?   B . n 
B 2 255 PRO 255 297 ?   ?   ?   B . n 
B 2 256 CYS 256 298 ?   ?   ?   B . n 
B 2 257 LEU 257 299 ?   ?   ?   B . n 
B 2 258 LEU 258 300 ?   ?   ?   B . n 
B 2 259 ASP 259 301 ?   ?   ?   B . n 
B 2 260 THR 260 302 ?   ?   ?   B . n 
B 2 261 SER 261 303 ?   ?   ?   B . n 
B 2 262 THR 262 304 ?   ?   ?   B . n 
B 2 263 ILE 263 305 ?   ?   ?   B . n 
B 2 264 PRO 264 306 ?   ?   ?   B . n 
B 2 265 ALA 265 307 ?   ?   ?   B . n 
B 2 266 GLU 266 308 ?   ?   ?   B . n 
B 2 267 GLU 267 309 ?   ?   ?   B . n 
B 2 268 LEU 268 310 ?   ?   ?   B . n 
B 2 269 THR 269 311 ?   ?   ?   B . n 
B 2 270 MET 270 312 ?   ?   ?   B . n 
B 2 271 SER 271 313 ?   ?   ?   B . n 
B 2 272 PRO 272 314 ?   ?   ?   B . n 
B 2 273 SER 273 315 ?   ?   ?   B . n 
B 2 274 ARG 274 316 ?   ?   ?   B . n 
B 2 275 SER 275 317 ?   ?   ?   B . n 
B 2 276 VAL 276 318 ?   ?   ?   B . n 
B 2 277 ALA 277 319 ?   ?   ?   B . n 
B 2 278 ASN 278 320 ?   ?   ?   B . n 
B 2 279 SER 279 321 ?   ?   ?   B . n 
B 2 280 GLY 280 322 ?   ?   ?   B . n 
B 2 281 LEU 281 323 ?   ?   ?   B . n 
B 2 282 SER 282 324 ?   ?   ?   B . n 
B 2 283 ASP 283 325 ?   ?   ?   B . n 
B 2 284 SER 284 326 ?   ?   ?   B . n 
B 2 285 LEU 285 327 ?   ?   ?   B . n 
B 2 286 THR 286 328 ?   ?   ?   B . n 
B 2 287 THR 287 329 ?   ?   ?   B . n 
B 2 288 SER 288 330 ?   ?   ?   B . n 
B 2 289 THR 289 331 ?   ?   ?   B . n 
B 2 290 PRO 290 332 ?   ?   ?   B . n 
B 2 291 ARG 291 333 ?   ?   ?   B . n 
B 2 292 PRO 292 334 ?   ?   ?   B . n 
B 2 293 SER 293 335 ?   ?   ?   B . n 
B 2 294 ASN 294 336 ?   ?   ?   B . n 
B 2 295 GLY 295 337 ?   ?   ?   B . n 
B 2 296 ASP 296 338 ?   ?   ?   B . n 
B 2 297 SER 297 339 ?   ?   ?   B . n 
B 2 298 PRO 298 340 ?   ?   ?   B . n 
B 2 299 SER 299 341 ?   ?   ?   B . n 
B 2 300 HIS 300 342 ?   ?   ?   B . n 
B 2 301 PRO 301 343 ?   ?   ?   B . n 
B 2 302 TYR 302 344 ?   ?   ?   B . n 
B 2 303 HIS 303 345 ?   ?   ?   B . n 
B 2 304 ARG 304 346 ?   ?   ?   B . n 
B 2 305 THR 305 347 ?   ?   ?   B . n 
B 2 306 PHE 306 348 348 PHE PHE B . n 
B 2 307 SER 307 349 349 SER SER B . n 
B 2 308 PRO 308 350 350 PRO PRO B . n 
B 2 309 HIS 309 351 351 HIS HIS B . n 
B 2 310 PHE 310 352 352 PHE PHE B . n 
B 2 311 HIS 311 353 353 HIS HIS B . n 
B 2 312 HIS 312 354 354 HIS HIS B . n 
B 2 313 PHE 313 355 355 PHE PHE B . n 
B 2 314 VAL 314 356 356 VAL VAL B . n 
B 2 315 GLU 315 357 357 GLU GLU B . n 
B 2 316 GLN 316 358 358 GLN GLN B . n 
B 2 317 CYS 317 359 359 CYS CYS B . n 
B 2 318 LEU 318 360 360 LEU LEU B . n 
B 2 319 GLN 319 361 361 GLN GLN B . n 
B 2 320 ARG 320 362 362 ARG ARG B . n 
B 2 321 ASN 321 363 363 ASN ASN B . n 
B 2 322 PRO 322 364 364 PRO PRO B . n 
B 2 323 ASP 323 365 365 ASP ASP B . n 
B 2 324 ALA 324 366 366 ALA ALA B . n 
B 2 325 ARG 325 367 367 ARG ARG B . n 
B 2 326 PRO 326 368 368 PRO PRO B . n 
B 2 327 SER 327 369 369 SER SER B . n 
B 2 328 ALA 328 370 370 ALA ALA B . n 
B 2 329 SER 329 371 371 SER SER B . n 
B 2 330 THR 330 372 372 THR THR B . n 
B 2 331 LEU 331 373 373 LEU LEU B . n 
B 2 332 LEU 332 374 374 LEU LEU B . n 
B 2 333 ASN 333 375 375 ASN ASN B . n 
B 2 334 HIS 334 376 376 HIS HIS B . n 
B 2 335 SER 335 377 377 SER SER B . n 
B 2 336 PHE 336 378 378 PHE PHE B . n 
B 2 337 PHE 337 379 379 PHE PHE B . n 
B 2 338 LYS 338 380 380 LYS LYS B . n 
B 2 339 GLN 339 381 381 GLN GLN B . n 
B 2 340 ILE 340 382 382 ILE ILE B . n 
B 2 341 LYS 341 383 ?   ?   ?   B . n 
B 2 342 ARG 342 384 ?   ?   ?   B . n 
B 2 343 ARG 343 385 ?   ?   ?   B . n 
B 2 344 ALA 344 386 386 ALA ALA B . n 
B 2 345 SER 345 387 387 SER SER B . n 
B 2 346 GLU 346 388 388 GLU GLU B . n 
B 2 347 ALA 347 389 389 ALA ALA B . n 
B 2 348 LEU 348 390 390 LEU LEU B . n 
B 2 349 PRO 349 391 391 PRO PRO B . n 
B 2 350 GLU 350 392 392 GLU GLU B . n 
B 2 351 LEU 351 393 393 LEU LEU B . n 
B 2 352 LEU 352 394 394 LEU LEU B . n 
B 2 353 ARG 353 395 395 ARG ARG B . n 
B 2 354 PRO 354 396 396 PRO PRO B . n 
B 2 355 VAL 355 397 397 VAL VAL B . n 
B 2 356 THR 356 398 398 THR THR B . n 
B 2 357 PRO 357 399 399 PRO PRO B . n 
B 2 358 ILE 358 400 400 ILE ILE B . n 
B 2 359 THR 359 401 401 THR THR B . n 
B 2 360 ASN 360 402 ?   ?   ?   B . n 
B 2 361 PHE 361 403 ?   ?   ?   B . n 
B 2 362 GLU 362 404 ?   ?   ?   B . n 
B 2 363 GLY 363 405 ?   ?   ?   B . n 
B 2 364 SER 364 406 ?   ?   ?   B . n 
B 2 365 GLN 365 407 ?   ?   ?   B . n 
B 2 366 SER 366 408 ?   ?   ?   B . n 
B 2 367 GLN 367 409 ?   ?   ?   B . n 
B 2 368 ASP 368 410 ?   ?   ?   B . n 
B 2 369 HIS 369 411 ?   ?   ?   B . n 
B 2 370 SER 370 412 ?   ?   ?   B . n 
B 2 371 GLY 371 413 ?   ?   ?   B . n 
B 2 372 ILE 372 414 ?   ?   ?   B . n 
B 2 373 PHE 373 415 ?   ?   ?   B . n 
B 2 374 GLY 374 416 ?   ?   ?   B . n 
B 2 375 LEU 375 417 ?   ?   ?   B . n 
B 2 376 VAL 376 418 ?   ?   ?   B . n 
B 2 377 THR 377 419 ?   ?   ?   B . n 
B 2 378 ASN 378 420 ?   ?   ?   B . n 
B 2 379 LEU 379 421 ?   ?   ?   B . n 
B 2 380 GLU 380 422 ?   ?   ?   B . n 
B 2 381 GLU 381 423 ?   ?   ?   B . n 
B 2 382 LEU 382 424 ?   ?   ?   B . n 
B 2 383 GLU 383 425 425 GLU GLU B . n 
B 2 384 VAL 384 426 426 VAL VAL B . n 
B 2 385 ASP 385 427 427 ASP ASP B . n 
B 2 386 ASP 386 428 428 ASP ASP B . n 
B 2 387 TRP 387 429 429 TRP TRP B . n 
B 2 388 GLU 388 430 430 GLU GLU B . n 
B 2 389 PHE 389 431 431 PHE PHE B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5120  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  30780 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-16 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 9.0983   17.9254  -17.5156 0.1893  0.2180  0.4465 0.0108  -0.0778 0.0254  9.4971  0.6788  
117.7653 -2.4993 33.3740 -8.8839 0.1957  -0.6873 0.4916  0.9983  -0.1654 -0.7869 0.3514  0.2148  2.8933  
'X-RAY DIFFRACTION' 2  ? refined 0.0855   11.9948  -9.8850  0.2073  -0.0349 0.0451 -0.1164 -0.0121 0.0116  13.1125 4.4585  4.9357 
-2.5829 0.9840  -2.8308 -0.1201 0.0370  0.0831  0.4179  0.3863  -0.0484 0.1968  -0.5530 0.1942  
'X-RAY DIFFRACTION' 3  ? refined 9.0704   5.2438   -5.0367  0.1344  0.1047  0.1320 -0.1208 0.0181  -0.0052 4.7337  4.6765  6.1673 
-0.6983 1.8483  -0.8076 -0.2305 -0.0134 0.2439  -0.0433 0.2051  -0.6901 0.0079  -0.3397 0.9287  
'X-RAY DIFFRACTION' 4  ? refined 6.3465   -4.4418  3.6649   0.0600  0.0182  0.0065 -0.0404 0.0010  0.0034  5.8232  5.1488  7.6274 
-0.3164 3.2830  -0.0865 -0.1959 0.0726  0.1233  -0.0699 0.1170  -0.4440 0.2311  -0.5188 0.5438  
'X-RAY DIFFRACTION' 5  ? refined -0.8213  -16.9612 2.2626   -0.0456 -0.0123 0.0227 -0.0071 0.0307  0.0629  3.0698  3.5577  9.3783 
0.4358  2.1311  1.8296  -0.1203 0.1157  0.0046  -0.1053 -0.0993 0.2471  -0.0058 -0.4311 -0.1683 
'X-RAY DIFFRACTION' 6  ? refined 9.8747   -19.4064 12.8491  0.1158  0.1070  0.0049 0.0746  -0.0724 -0.0082 17.4089 8.7880  4.6312 
5.9454  -5.4651 -5.0365 0.1894  -0.0685 -0.1209 -0.9648 -0.2380 -0.1920 0.9583  0.1131  0.5886  
'X-RAY DIFFRACTION' 7  ? refined -0.6457  -28.1826 4.4044   -0.0768 -0.0224 0.1224 -0.0325 0.0422  0.0647  2.9112  5.4230  10.0953 
-1.2118 0.8813  0.7706  -0.0393 -0.1200 0.1593  0.0605  -0.2224 0.4614  0.1358  0.1021  -0.1805 
'X-RAY DIFFRACTION' 8  ? refined 3.1013   -36.7343 7.4036   -0.0003 0.0498  0.1729 0.0706  0.0802  0.1127  1.6831  6.1642  4.0993 
-0.5708 1.4491  -0.6066 -0.0610 0.0758  -0.0148 -0.1179 -0.1601 0.2827  0.4256  0.3013  -0.0371 
'X-RAY DIFFRACTION' 9  ? refined 6.3084   -46.2143 5.6517   -0.0228 0.0038  0.2029 0.0625  -0.0117 0.0781  4.2123  7.5457  9.8658 
-0.1847 -0.4661 -2.7292 0.1497  0.1169  -0.2667 -0.0951 -0.3289 0.2328  0.0627  0.3774  0.2526  
'X-RAY DIFFRACTION' 10 ? refined 12.2026  -50.3174 7.5462   0.0863  0.0756  0.2892 0.0550  -0.0833 0.0535  10.2824 9.3105  15.1217 
1.4896  -6.7556 -7.7979 -0.1162 0.0220  0.0942  -0.6223 -0.5824 0.2003  0.0643  0.9878  0.3755  
'X-RAY DIFFRACTION' 11 ? refined -13.9458 3.5366   -3.4728  0.0909  0.1660  0.2904 0.1544  0.1932  0.0179  24.0853 24.3759 13.2112 
19.3876 12.0092 1.7078  0.4429  -0.0370 -0.4060 0.1579  -0.3497 -0.1623 0.2402  0.3890  -0.7376 
'X-RAY DIFFRACTION' 12 ? refined -8.6413  -23.2075 -24.3158 0.0465  0.1982  0.0790 -0.0139 -0.0576 -0.0691 8.0679  6.0916  11.1580 
-1.5235 -5.2293 3.4712  0.0943  -0.3744 0.2800  0.8474  -0.3772 0.5286  -0.4203 -0.0451 -1.5653 
'X-RAY DIFFRACTION' 13 ? refined 4.2435   -18.2881 -17.2990 -0.0082 0.0847  0.1860 -0.0025 -0.0209 -0.0080 0.3336  9.4970  7.9088 
1.6072  -1.4631 -5.4324 0.0338  -0.1354 0.1015  -0.2813 -0.0605 -0.0299 -0.3998 -0.1498 0.2116  
'X-RAY DIFFRACTION' 14 ? refined -2.2771  -20.6720 -30.0454 -0.0061 0.0674  0.0676 0.0864  -0.0900 -0.0571 2.2690  1.1369  19.5662 
1.2280  -4.7457 -1.1899 0.0408  0.0233  -0.0641 0.1542  -0.0148 0.1700  -0.3767 -0.1935 -0.4011 
'X-RAY DIFFRACTION' 15 ? refined 7.2589   -10.0117 -31.0593 0.2051  0.0562  0.0304 -0.0077 0.0397  -0.0546 3.8003  4.3157  6.0024 
0.7212  0.5302  0.2492  0.2179  -0.2428 0.0249  -0.1231 0.3061  0.1702  -0.3909 -0.8166 0.1451  
'X-RAY DIFFRACTION' 16 ? refined 19.3550  -14.7019 -17.7010 0.2619  0.7152  0.2105 -0.1345 -0.0160 0.0332  4.7235  19.3518 7.1870 
-2.0436 0.2482  5.2433  -0.1012 0.3207  -0.2195 -0.0585 0.0530  -0.4192 0.0972  -0.3176 0.5739  
'X-RAY DIFFRACTION' 17 ? refined 20.1664  -16.0078 -31.9448 0.1149  0.4086  0.1527 -0.0646 0.0230  0.0197  4.1976  6.1304  5.2262 
0.6756  1.7933  3.1666  0.3516  0.0234  -0.3750 0.0350  -0.2458 -0.6542 0.3522  0.1501  1.2053  
'X-RAY DIFFRACTION' 18 ? refined 22.0340  -16.4202 -40.6211 0.3431  0.5230  0.3297 -0.1703 0.0812  -0.0800 9.1112  14.4438 8.2520 
-7.3237 2.7880  0.9546  0.0928  0.7688  -0.8616 -0.0681 -1.0283 -0.2619 -0.3600 -0.2113 0.9245  
'X-RAY DIFFRACTION' 19 ? refined 7.4469   -14.1333 -32.1989 0.2009  0.0784  0.1287 0.0344  -0.0110 -0.1564 1.5069  2.4970  5.9131 
0.2015  -1.1342 -1.9974 0.2037  0.0248  -0.2285 0.2136  0.1615  0.1647  -0.4901 -0.7008 0.0436  
'X-RAY DIFFRACTION' 20 ? refined 6.5264   -19.1962 -21.6787 -0.0237 0.0432  0.0527 0.0240  -0.0553 0.1477  18.4068 11.0167 29.0001 
10.2138 17.3011 12.8957 0.4358  -0.0722 -0.3635 -0.1530 -0.9715 -0.8722 0.1821  0.9990  0.7446  
'X-RAY DIFFRACTION' 21 ? refined 3.5060   -14.3895 -8.4316  -0.0089 0.0617  0.0713 0.0105  0.0142  0.0231  0.6127  0.5274  0.7079 
-0.2711 0.1011  0.4859  -0.0466 0.0367  0.0099  -0.0889 -0.0384 0.0321  -0.0680 -0.1289 0.1204  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 2   A 14  ? . . . . ? 
'X-RAY DIFFRACTION' 2  2  A 15  A 57  ? . . . . ? 
'X-RAY DIFFRACTION' 3  3  A 58  A 107 ? . . . . ? 
'X-RAY DIFFRACTION' 4  4  A 108 A 159 ? . . . . ? 
'X-RAY DIFFRACTION' 5  5  A 160 A 192 ? . . . . ? 
'X-RAY DIFFRACTION' 6  6  A 193 A 205 ? . . . . ? 
'X-RAY DIFFRACTION' 7  7  A 206 A 237 ? . . . . ? 
'X-RAY DIFFRACTION' 8  8  A 238 A 271 ? . . . . ? 
'X-RAY DIFFRACTION' 9  9  A 272 A 316 ? . . . . ? 
'X-RAY DIFFRACTION' 10 10 A 317 A 336 ? . . . . ? 
'X-RAY DIFFRACTION' 11 11 B -15 B -2  ? . . . . ? 
'X-RAY DIFFRACTION' 12 12 B 60  B 102 ? . . . . ? 
'X-RAY DIFFRACTION' 13 13 B 103 B 132 ? . . . . ? 
'X-RAY DIFFRACTION' 14 14 B 133 B 166 ? . . . . ? 
'X-RAY DIFFRACTION' 15 15 B 167 B 219 ? . . . . ? 
'X-RAY DIFFRACTION' 16 16 B 220 B 240 ? . . . . ? 
'X-RAY DIFFRACTION' 17 17 B 241 B 278 ? . . . . ? 
'X-RAY DIFFRACTION' 18 18 B 279 B 356 ? . . . . ? 
'X-RAY DIFFRACTION' 19 19 B 357 B 431 ? . . . . ? 
'X-RAY DIFFRACTION' 20 20 A 342 A 342 ? . . . . ? 
'X-RAY DIFFRACTION' 21 20 B 1   B 1   ? . . . . ? 
'X-RAY DIFFRACTION' 22 21 A 343 A 419 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DNA    'data collection' .        ? 1 
MOLREP phasing           .        ? 2 
REFMAC refinement        5.2.0005 ? 3 
MOSFLM 'data reduction'  .        ? 4 
SCALA  'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLN 63 ? ? NE2 A GLN 63 ? ? 1.504 1.324 0.180 0.025 N 
2 1 CD B GLU -7 ? ? OE2 B GLU -7 ? ? 1.323 1.252 0.071 0.011 N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              89 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              89 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              89 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.53 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            4.23 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 286 ? ? -110.98 54.48   
2  1 TYR B -4  ? ? 153.57  -6.41   
3  1 LEU B 72  ? ? -103.46 -135.38 
4  1 PHE B 79  ? ? 36.49   66.86   
5  1 ASN B 141 ? ? 85.93   -20.47  
6  1 HIS B 162 ? ? -156.51 -55.22  
7  1 PHE B 163 ? ? -84.83  48.28   
8  1 ARG B 194 ? ? 83.33   4.11    
9  1 SER B 195 ? ? -149.97 37.73   
10 1 SER B 212 ? ? -109.39 -155.43 
11 1 LYS B 239 ? ? 128.90  -33.16  
12 1 ASN B 252 ? ? 76.55   -2.86   
13 1 LEU B 253 ? ? -96.21  -146.13 
14 1 ASP B 281 ? ? 68.43   -1.79   
15 1 PRO B 283 ? ? -49.32  155.06  
16 1 THR B 285 ? ? -77.54  45.36   
17 1 GLU B 388 ? ? -141.97 -14.15  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ALA 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    139 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    140 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -133.71 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 337 ? A ALA 337 
3  1 Y 1 A GLN 338 ? A GLN 338 
4  1 Y 1 A GLN 339 ? A GLN 339 
5  1 Y 1 A GLU 340 ? A GLU 340 
6  1 Y 1 A ALA 341 ? A ALA 341 
7  1 Y 1 B MET -16 ? B MET 1   
8  1 Y 1 B GLY -1  ? B GLY 16  
9  1 Y 1 B MET 59  ? B MET 17  
10 1 Y 1 B LEU 292 ? B LEU 250 
11 1 Y 1 B ASN 293 ? B ASN 251 
12 1 Y 1 B GLY 294 ? B GLY 252 
13 1 Y 1 B THR 295 ? B THR 253 
14 1 Y 1 B VAL 296 ? B VAL 254 
15 1 Y 1 B PRO 297 ? B PRO 255 
16 1 Y 1 B CYS 298 ? B CYS 256 
17 1 Y 1 B LEU 299 ? B LEU 257 
18 1 Y 1 B LEU 300 ? B LEU 258 
19 1 Y 1 B ASP 301 ? B ASP 259 
20 1 Y 1 B THR 302 ? B THR 260 
21 1 Y 1 B SER 303 ? B SER 261 
22 1 Y 1 B THR 304 ? B THR 262 
23 1 Y 1 B ILE 305 ? B ILE 263 
24 1 Y 1 B PRO 306 ? B PRO 264 
25 1 Y 1 B ALA 307 ? B ALA 265 
26 1 Y 1 B GLU 308 ? B GLU 266 
27 1 Y 1 B GLU 309 ? B GLU 267 
28 1 Y 1 B LEU 310 ? B LEU 268 
29 1 Y 1 B THR 311 ? B THR 269 
30 1 Y 1 B MET 312 ? B MET 270 
31 1 Y 1 B SER 313 ? B SER 271 
32 1 Y 1 B PRO 314 ? B PRO 272 
33 1 Y 1 B SER 315 ? B SER 273 
34 1 Y 1 B ARG 316 ? B ARG 274 
35 1 Y 1 B SER 317 ? B SER 275 
36 1 Y 1 B VAL 318 ? B VAL 276 
37 1 Y 1 B ALA 319 ? B ALA 277 
38 1 Y 1 B ASN 320 ? B ASN 278 
39 1 Y 1 B SER 321 ? B SER 279 
40 1 Y 1 B GLY 322 ? B GLY 280 
41 1 Y 1 B LEU 323 ? B LEU 281 
42 1 Y 1 B SER 324 ? B SER 282 
43 1 Y 1 B ASP 325 ? B ASP 283 
44 1 Y 1 B SER 326 ? B SER 284 
45 1 Y 1 B LEU 327 ? B LEU 285 
46 1 Y 1 B THR 328 ? B THR 286 
47 1 Y 1 B THR 329 ? B THR 287 
48 1 Y 1 B SER 330 ? B SER 288 
49 1 Y 1 B THR 331 ? B THR 289 
50 1 Y 1 B PRO 332 ? B PRO 290 
51 1 Y 1 B ARG 333 ? B ARG 291 
52 1 Y 1 B PRO 334 ? B PRO 292 
53 1 Y 1 B SER 335 ? B SER 293 
54 1 Y 1 B ASN 336 ? B ASN 294 
55 1 Y 1 B GLY 337 ? B GLY 295 
56 1 Y 1 B ASP 338 ? B ASP 296 
57 1 Y 1 B SER 339 ? B SER 297 
58 1 Y 1 B PRO 340 ? B PRO 298 
59 1 Y 1 B SER 341 ? B SER 299 
60 1 Y 1 B HIS 342 ? B HIS 300 
61 1 Y 1 B PRO 343 ? B PRO 301 
62 1 Y 1 B TYR 344 ? B TYR 302 
63 1 Y 1 B HIS 345 ? B HIS 303 
64 1 Y 1 B ARG 346 ? B ARG 304 
65 1 Y 1 B THR 347 ? B THR 305 
66 1 Y 1 B LYS 383 ? B LYS 341 
67 1 Y 1 B ARG 384 ? B ARG 342 
68 1 Y 1 B ARG 385 ? B ARG 343 
69 1 Y 1 B ASN 402 ? B ASN 360 
70 1 Y 1 B PHE 403 ? B PHE 361 
71 1 Y 1 B GLU 404 ? B GLU 362 
72 1 Y 1 B GLY 405 ? B GLY 363 
73 1 Y 1 B SER 406 ? B SER 364 
74 1 Y 1 B GLN 407 ? B GLN 365 
75 1 Y 1 B SER 408 ? B SER 366 
76 1 Y 1 B GLN 409 ? B GLN 367 
77 1 Y 1 B ASP 410 ? B ASP 368 
78 1 Y 1 B HIS 411 ? B HIS 369 
79 1 Y 1 B SER 412 ? B SER 370 
80 1 Y 1 B GLY 413 ? B GLY 371 
81 1 Y 1 B ILE 414 ? B ILE 372 
82 1 Y 1 B PHE 415 ? B PHE 373 
83 1 Y 1 B GLY 416 ? B GLY 374 
84 1 Y 1 B LEU 417 ? B LEU 375 
85 1 Y 1 B VAL 418 ? B VAL 376 
86 1 Y 1 B THR 419 ? B THR 377 
87 1 Y 1 B ASN 420 ? B ASN 378 
88 1 Y 1 B LEU 421 ? B LEU 379 
89 1 Y 1 B GLU 422 ? B GLU 380 
90 1 Y 1 B GLU 423 ? B GLU 381 
91 1 Y 1 B LEU 424 ? B LEU 382 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CITRIC ACID'               CIT 
4 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
5 water                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CIT 1  342 2  CIT CIT A . 
D 4 ATP 1  1   1  ATP ATP B . 
E 5 HOH 1  343 1  HOH HOH A . 
E 5 HOH 2  344 2  HOH HOH A . 
E 5 HOH 3  345 3  HOH HOH A . 
E 5 HOH 4  346 4  HOH HOH A . 
E 5 HOH 5  347 5  HOH HOH A . 
E 5 HOH 6  348 6  HOH HOH A . 
E 5 HOH 7  349 7  HOH HOH A . 
E 5 HOH 8  350 8  HOH HOH A . 
E 5 HOH 9  351 9  HOH HOH A . 
E 5 HOH 10 352 10 HOH HOH A . 
E 5 HOH 11 353 11 HOH HOH A . 
E 5 HOH 12 354 12 HOH HOH A . 
E 5 HOH 13 355 13 HOH HOH A . 
E 5 HOH 14 356 14 HOH HOH A . 
E 5 HOH 15 357 15 HOH HOH A . 
E 5 HOH 16 358 16 HOH HOH A . 
E 5 HOH 17 359 17 HOH HOH A . 
E 5 HOH 18 360 18 HOH HOH A . 
E 5 HOH 19 361 19 HOH HOH A . 
E 5 HOH 20 362 20 HOH HOH A . 
E 5 HOH 21 363 21 HOH HOH A . 
E 5 HOH 22 364 22 HOH HOH A . 
E 5 HOH 23 365 23 HOH HOH A . 
E 5 HOH 24 366 24 HOH HOH A . 
E 5 HOH 25 367 25 HOH HOH A . 
E 5 HOH 26 368 26 HOH HOH A . 
E 5 HOH 27 369 27 HOH HOH A . 
E 5 HOH 28 370 28 HOH HOH A . 
E 5 HOH 29 371 29 HOH HOH A . 
E 5 HOH 30 372 30 HOH HOH A . 
E 5 HOH 31 373 31 HOH HOH A . 
E 5 HOH 32 374 32 HOH HOH A . 
E 5 HOH 33 375 33 HOH HOH A . 
E 5 HOH 34 376 34 HOH HOH A . 
E 5 HOH 35 377 35 HOH HOH A . 
E 5 HOH 36 378 36 HOH HOH A . 
E 5 HOH 37 379 37 HOH HOH A . 
E 5 HOH 38 380 38 HOH HOH A . 
E 5 HOH 39 381 39 HOH HOH A . 
E 5 HOH 40 382 40 HOH HOH A . 
E 5 HOH 41 383 41 HOH HOH A . 
E 5 HOH 42 384 42 HOH HOH A . 
E 5 HOH 43 385 43 HOH HOH A . 
E 5 HOH 44 386 44 HOH HOH A . 
E 5 HOH 45 387 46 HOH HOH A . 
E 5 HOH 46 388 47 HOH HOH A . 
E 5 HOH 47 389 48 HOH HOH A . 
E 5 HOH 48 390 49 HOH HOH A . 
E 5 HOH 49 391 50 HOH HOH A . 
E 5 HOH 50 392 51 HOH HOH A . 
E 5 HOH 51 393 52 HOH HOH A . 
E 5 HOH 52 394 53 HOH HOH A . 
E 5 HOH 53 395 54 HOH HOH A . 
E 5 HOH 54 396 55 HOH HOH A . 
E 5 HOH 55 397 56 HOH HOH A . 
E 5 HOH 56 398 57 HOH HOH A . 
E 5 HOH 57 399 58 HOH HOH A . 
E 5 HOH 58 400 59 HOH HOH A . 
E 5 HOH 59 401 60 HOH HOH A . 
E 5 HOH 60 402 62 HOH HOH A . 
E 5 HOH 61 403 63 HOH HOH A . 
E 5 HOH 62 404 64 HOH HOH A . 
E 5 HOH 63 405 65 HOH HOH A . 
E 5 HOH 64 406 66 HOH HOH A . 
E 5 HOH 65 407 67 HOH HOH A . 
E 5 HOH 66 408 68 HOH HOH A . 
E 5 HOH 67 409 69 HOH HOH A . 
E 5 HOH 68 410 70 HOH HOH A . 
E 5 HOH 69 411 71 HOH HOH A . 
E 5 HOH 70 412 72 HOH HOH A . 
E 5 HOH 71 413 73 HOH HOH A . 
E 5 HOH 72 414 74 HOH HOH A . 
E 5 HOH 73 415 75 HOH HOH A . 
E 5 HOH 74 416 76 HOH HOH A . 
E 5 HOH 75 417 77 HOH HOH A . 
E 5 HOH 76 418 78 HOH HOH A . 
E 5 HOH 77 419 79 HOH HOH A . 
#