data_3GYQ
# 
_entry.id   3GYQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GYQ         
RCSB  RCSB052473   
WWPDB D_1000052473 
# 
_pdbx_database_status.entry_id                        3GYQ 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-04 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dunstan, M.S.' 1 
'Conn, G.L.'    2 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the thiostrepton-resistance methyltransferase-S-adenosyl-L-methionine complex and its interaction with ribosomal RNA' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                17013 
_citation.page_last                 17020 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19369248 
_citation.pdbx_database_id_DOI      10.1074/jbc.M901618200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dunstan, M.S.'    1 
primary 'Hang, P.C.'       2 
primary 'Zelinskaya, N.V.' 3 
primary 'Honek, J.F.'      4 
primary 'Conn, G.L.'       5 
# 
_cell.length_a           40.960 
_cell.length_b           55.770 
_cell.length_c           215.580 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3GYQ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3GYQ 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;rRNA (adenosine-2'-O-)-methyltransferase
;
29215.307 2  2.1.1.66 ? ? ? 
2 non-polymer syn S-ADENOSYLMETHIONINE                       398.437   2  ?        ? ? ? 
3 water       nat water                                      18.015    72 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Thiostrepton Resistance methyltransferase, 23S rRNA [AM1067] 2'-O-methyltransferase, 23S rRNA methylase, Thiostrepton-resistance methylase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGSDSSPFPSELLDLCGRQNIPVR
LIDSSIVNQLFKGERKAKTFGIARVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIAD
RRLQRASRGYVFSLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVS
IPMMSQTESLNVSVSLGIALHERIDRNLAANR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGSDSSPFPSELLDLCGRQNIPVR
LIDSSIVNQLFKGERKAKTFGIARVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIAD
RRLQRASRGYVFSLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVS
IPMMSQTESLNVSVSLGIALHERIDRNLAANR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   THR n 
1 6   GLU n 
1 7   LEU n 
1 8   ASP n 
1 9   THR n 
1 10  ILE n 
1 11  ALA n 
1 12  ASN n 
1 13  PRO n 
1 14  SER n 
1 15  ASP n 
1 16  PRO n 
1 17  ALA n 
1 18  VAL n 
1 19  GLN n 
1 20  ARG n 
1 21  ILE n 
1 22  ILE n 
1 23  ASP n 
1 24  VAL n 
1 25  THR n 
1 26  LYS n 
1 27  PRO n 
1 28  SER n 
1 29  ARG n 
1 30  SER n 
1 31  ASN n 
1 32  ILE n 
1 33  LYS n 
1 34  THR n 
1 35  THR n 
1 36  LEU n 
1 37  ILE n 
1 38  GLU n 
1 39  ASP n 
1 40  VAL n 
1 41  GLU n 
1 42  PRO n 
1 43  LEU n 
1 44  MET n 
1 45  HIS n 
1 46  SER n 
1 47  ILE n 
1 48  ALA n 
1 49  ALA n 
1 50  GLY n 
1 51  VAL n 
1 52  GLU n 
1 53  PHE n 
1 54  ILE n 
1 55  GLU n 
1 56  VAL n 
1 57  TYR n 
1 58  GLY n 
1 59  SER n 
1 60  ASP n 
1 61  SER n 
1 62  SER n 
1 63  PRO n 
1 64  PHE n 
1 65  PRO n 
1 66  SER n 
1 67  GLU n 
1 68  LEU n 
1 69  LEU n 
1 70  ASP n 
1 71  LEU n 
1 72  CYS n 
1 73  GLY n 
1 74  ARG n 
1 75  GLN n 
1 76  ASN n 
1 77  ILE n 
1 78  PRO n 
1 79  VAL n 
1 80  ARG n 
1 81  LEU n 
1 82  ILE n 
1 83  ASP n 
1 84  SER n 
1 85  SER n 
1 86  ILE n 
1 87  VAL n 
1 88  ASN n 
1 89  GLN n 
1 90  LEU n 
1 91  PHE n 
1 92  LYS n 
1 93  GLY n 
1 94  GLU n 
1 95  ARG n 
1 96  LYS n 
1 97  ALA n 
1 98  LYS n 
1 99  THR n 
1 100 PHE n 
1 101 GLY n 
1 102 ILE n 
1 103 ALA n 
1 104 ARG n 
1 105 VAL n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 ARG n 
1 111 PHE n 
1 112 GLY n 
1 113 ASP n 
1 114 ILE n 
1 115 ALA n 
1 116 SER n 
1 117 ARG n 
1 118 ARG n 
1 119 GLY n 
1 120 ASP n 
1 121 VAL n 
1 122 VAL n 
1 123 VAL n 
1 124 LEU n 
1 125 ASP n 
1 126 GLY n 
1 127 VAL n 
1 128 LYS n 
1 129 ILE n 
1 130 VAL n 
1 131 GLY n 
1 132 ASN n 
1 133 ILE n 
1 134 GLY n 
1 135 ALA n 
1 136 ILE n 
1 137 VAL n 
1 138 ARG n 
1 139 THR n 
1 140 SER n 
1 141 LEU n 
1 142 ALA n 
1 143 LEU n 
1 144 GLY n 
1 145 ALA n 
1 146 SER n 
1 147 GLY n 
1 148 ILE n 
1 149 ILE n 
1 150 LEU n 
1 151 VAL n 
1 152 ASP n 
1 153 SER n 
1 154 ASP n 
1 155 ILE n 
1 156 THR n 
1 157 SER n 
1 158 ILE n 
1 159 ALA n 
1 160 ASP n 
1 161 ARG n 
1 162 ARG n 
1 163 LEU n 
1 164 GLN n 
1 165 ARG n 
1 166 ALA n 
1 167 SER n 
1 168 ARG n 
1 169 GLY n 
1 170 TYR n 
1 171 VAL n 
1 172 PHE n 
1 173 SER n 
1 174 LEU n 
1 175 PRO n 
1 176 VAL n 
1 177 VAL n 
1 178 LEU n 
1 179 SER n 
1 180 GLY n 
1 181 ARG n 
1 182 GLU n 
1 183 GLU n 
1 184 ALA n 
1 185 ILE n 
1 186 ALA n 
1 187 PHE n 
1 188 ILE n 
1 189 ARG n 
1 190 ASP n 
1 191 SER n 
1 192 GLY n 
1 193 MET n 
1 194 GLN n 
1 195 LEU n 
1 196 MET n 
1 197 THR n 
1 198 LEU n 
1 199 LYS n 
1 200 ALA n 
1 201 ASP n 
1 202 GLY n 
1 203 ASP n 
1 204 ILE n 
1 205 SER n 
1 206 VAL n 
1 207 LYS n 
1 208 GLU n 
1 209 LEU n 
1 210 GLY n 
1 211 ASP n 
1 212 ASN n 
1 213 PRO n 
1 214 ASP n 
1 215 ARG n 
1 216 LEU n 
1 217 ALA n 
1 218 LEU n 
1 219 LEU n 
1 220 PHE n 
1 221 GLY n 
1 222 SER n 
1 223 GLU n 
1 224 LYS n 
1 225 GLY n 
1 226 GLY n 
1 227 PRO n 
1 228 SER n 
1 229 ASP n 
1 230 LEU n 
1 231 PHE n 
1 232 GLU n 
1 233 GLU n 
1 234 ALA n 
1 235 SER n 
1 236 SER n 
1 237 ALA n 
1 238 SER n 
1 239 VAL n 
1 240 SER n 
1 241 ILE n 
1 242 PRO n 
1 243 MET n 
1 244 MET n 
1 245 SER n 
1 246 GLN n 
1 247 THR n 
1 248 GLU n 
1 249 SER n 
1 250 LEU n 
1 251 ASN n 
1 252 VAL n 
1 253 SER n 
1 254 VAL n 
1 255 SER n 
1 256 LEU n 
1 257 GLY n 
1 258 ILE n 
1 259 ALA n 
1 260 LEU n 
1 261 HIS n 
1 262 GLU n 
1 263 ARG n 
1 264 ILE n 
1 265 ASP n 
1 266 ARG n 
1 267 ASN n 
1 268 LEU n 
1 269 ALA n 
1 270 ALA n 
1 271 ASN n 
1 272 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Streptomyces curacoi' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces cyaneus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1904 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 PLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TSNR_STRCN 
_struct_ref.pdbx_db_accession          P18644 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGSDSSPFPSELLDLCGRQNIPVRLID
SSIVNQLFKGERKAKTFGIARVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRL
QRASRGYVFSLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVSIPM
MSQTESLNVSVSLGIALHERIDRNLAANR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GYQ A 4 ? 272 ? P18644 1 ? 269 ? 1 269 
2 1 3GYQ B 4 ? 272 ? P18644 1 ? 269 ? 1 269 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3GYQ GLY A 1 ? UNP P18644 ? ? 'EXPRESSION TAG' -2 1 
1 3GYQ SER A 2 ? UNP P18644 ? ? 'EXPRESSION TAG' -1 2 
1 3GYQ HIS A 3 ? UNP P18644 ? ? 'EXPRESSION TAG' 0  3 
2 3GYQ GLY B 1 ? UNP P18644 ? ? 'EXPRESSION TAG' -2 4 
2 3GYQ SER B 2 ? UNP P18644 ? ? 'EXPRESSION TAG' -1 5 
2 3GYQ HIS B 3 ? UNP P18644 ? ? 'EXPRESSION TAG' 0  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3GYQ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   41.62 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    '27% PEG 4000, 0.2M sodium acetate, 0.1M Tris buffer pH 8.0, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           180 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-08-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_wavelength_list        0.9763 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
# 
_reflns.entry_id                     3GYQ 
_reflns.observed_criterion_sigma_F   2.45 
_reflns.observed_criterion_sigma_I   2.85 
_reflns.d_resolution_high            2.45 
_reflns.d_resolution_low             19.6 
_reflns.number_all                   ? 
_reflns.number_obs                   18976 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.107 
_reflns.pdbx_netI_over_sigmaI        10.2 
_reflns.B_iso_Wilson_estimate        60.5 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.51 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   90.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    2.85 
_reflns_shell.pdbx_Rsym_value        0.365 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3GYQ 
_refine.ls_d_res_high                            2.450 
_refine.ls_d_res_low                             19.388 
_refine.pdbx_ls_sigma_F                          1.38 
_refine.ls_percent_reflns_obs                    99.670 
_refine.ls_number_reflns_obs                     18914 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_R_work                       0.215 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_percent_reflns_R_free                 5.230 
_refine.ls_number_reflns_R_free                  989 
_refine.B_iso_mean                               79.618 
_refine.solvent_model_param_bsol                 51.213 
_refine.solvent_model_param_ksol                 0.327 
_refine.aniso_B[1][1]                            -0.235 
_refine.aniso_B[2][2]                            0.262 
_refine.aniso_B[3][3]                            -1.427 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.overall_SU_ML                            0.170 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.overall_FOM_work_R_set                   0.814 
_refine.B_iso_max                                256.17 
_refine.B_iso_min                                19.77 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     18974 
_refine.ls_R_factor_all                          0.2179 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ipa' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3922 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             72 
_refine_hist.number_atoms_total               4048 
_refine_hist.d_res_high                       2.450 
_refine_hist.d_res_low                        19.388 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           4032 0.002  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          5460 0.630  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     648  0.042  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      714  0.003  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 1532 15.736 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.450 2.579  7 100.000 2537 . 0.237 0.307 . 129 . 2666 . . 'X-RAY DIFFRACTION' 
2.579 2.740  7 100.000 2524 . 0.235 0.298 . 130 . 2654 . . 'X-RAY DIFFRACTION' 
2.740 2.951  7 100.000 2507 . 0.236 0.278 . 145 . 2652 . . 'X-RAY DIFFRACTION' 
2.951 3.247  7 100.000 2538 . 0.221 0.319 . 133 . 2671 . . 'X-RAY DIFFRACTION' 
3.247 3.714  7 100.000 2570 . 0.214 0.240 . 147 . 2717 . . 'X-RAY DIFFRACTION' 
3.714 4.668  7 100.000 2568 . 0.189 0.237 . 152 . 2720 . . 'X-RAY DIFFRACTION' 
4.668 19.388 7 99.000  2681 . 0.200 0.264 . 153 . 2834 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3GYQ 
_struct.title                     'Structure of the Thiostrepton-Resistance Methyltransferase S-adenosyl-L-methionine Complex' 
_struct.pdbx_descriptor           
;rRNA (adenosine-2'-O-)-methyltransferase (E.C.2.1.1.66)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GYQ 
_struct_keywords.text            
;rRNA Methyltransferase, SPOUT MTases, SAM, Trefoil knot, Antibiotic resistance, Methyltransferase, S-adenosyl-L-methionine, Transferase
;
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 18  ? ARG A 20  ? VAL A 15  ARG A 17  5 ? 3  
HELX_P HELX_P2  2  ILE A 21  ? LYS A 26  ? ILE A 18  LYS A 23  1 ? 6  
HELX_P HELX_P3  3  ASP A 39  ? ALA A 48  ? ASP A 36  ALA A 45  1 ? 10 
HELX_P HELX_P4  4  LEU A 69  ? ARG A 74  ? LEU A 66  ARG A 71  1 ? 6  
HELX_P HELX_P5  5  ASP A 83  ? ASN A 88  ? ASP A 80  ASN A 85  1 ? 6  
HELX_P HELX_P6  6  ARG A 110 ? ARG A 117 ? ARG A 107 ARG A 114 1 ? 8  
HELX_P HELX_P7  7  ILE A 129 ? LEU A 143 ? ILE A 126 LEU A 140 1 ? 15 
HELX_P HELX_P8  8  ASP A 160 ? SER A 167 ? ASP A 157 SER A 164 1 ? 8  
HELX_P HELX_P9  9  ARG A 168 ? SER A 173 ? ARG A 165 SER A 170 5 ? 6  
HELX_P HELX_P10 10 GLY A 180 ? ASP A 190 ? GLY A 177 ASP A 187 1 ? 11 
HELX_P HELX_P11 11 LYS A 207 ? ASN A 212 ? LYS A 204 ASN A 209 5 ? 6  
HELX_P HELX_P12 12 SER A 228 ? GLU A 232 ? SER A 225 GLU A 229 5 ? 5  
HELX_P HELX_P13 13 ASN A 251 ? GLU A 262 ? ASN A 248 GLU A 259 1 ? 12 
HELX_P HELX_P14 14 ARG A 263 ? LEU A 268 ? ARG A 260 LEU A 265 1 ? 6  
HELX_P HELX_P15 15 VAL B 18  ? ARG B 20  ? VAL B 15  ARG B 17  5 ? 3  
HELX_P HELX_P16 16 ILE B 21  ? LYS B 26  ? ILE B 18  LYS B 23  1 ? 6  
HELX_P HELX_P17 17 ASP B 39  ? ALA B 49  ? ASP B 36  ALA B 46  1 ? 11 
HELX_P HELX_P18 18 GLU B 67  ? GLN B 75  ? GLU B 64  GLN B 72  1 ? 9  
HELX_P HELX_P19 19 ASP B 83  ? LEU B 90  ? ASP B 80  LEU B 87  1 ? 8  
HELX_P HELX_P20 20 ARG B 110 ? SER B 116 ? ARG B 107 SER B 113 1 ? 7  
HELX_P HELX_P21 21 ILE B 129 ? LEU B 143 ? ILE B 126 LEU B 140 1 ? 15 
HELX_P HELX_P22 22 ASP B 160 ? SER B 167 ? ASP B 157 SER B 164 1 ? 8  
HELX_P HELX_P23 23 GLY B 180 ? SER B 191 ? GLY B 177 SER B 188 1 ? 12 
HELX_P HELX_P24 24 LYS B 207 ? ASN B 212 ? LYS B 204 ASN B 209 5 ? 6  
HELX_P HELX_P25 25 SER B 228 ? ALA B 234 ? SER B 225 ALA B 231 5 ? 7  
HELX_P HELX_P26 26 ASN B 251 ? ARG B 263 ? ASN B 248 ARG B 260 1 ? 13 
HELX_P HELX_P27 27 ARG B 263 ? ALA B 270 ? ARG B 260 ALA B 267 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 15  A . ? ASP 12  A PRO 16  A ? PRO 13  A 1 -2.58 
2 GLY 93  A . ? GLY 90  A GLU 94  A ? GLU 91  A 1 1.81  
3 GLU 94  A . ? GLU 91  A ARG 95  A ? ARG 92  A 1 5.48  
4 GLY 226 A . ? GLY 223 A PRO 227 A ? PRO 224 A 1 -2.03 
5 ASP 15  B . ? ASP 12  B PRO 16  B ? PRO 13  B 1 -8.68 
6 LYS 92  B . ? LYS 89  B GLY 93  B ? GLY 90  B 1 6.16  
7 GLY 226 B . ? GLY 223 B PRO 227 B ? PRO 224 B 1 -0.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 7 ? 
C ? 4 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 34  ? ILE A 37  ? THR A 31  ILE A 34  
A 2 THR A 99  ? ARG A 104 ? THR A 96  ARG A 101 
A 3 GLU A 52  ? SER A 59  ? GLU A 49  SER A 56  
A 4 VAL A 79  ? ILE A 82  ? VAL A 76  ILE A 79  
B 1 VAL A 176 ? SER A 179 ? VAL A 173 SER A 176 
B 2 GLY A 147 ? VAL A 151 ? GLY A 144 VAL A 148 
B 3 VAL A 121 ? ASP A 125 ? VAL A 118 ASP A 122 
B 4 LEU A 216 ? GLY A 221 ? LEU A 213 GLY A 218 
B 5 GLN A 194 ? LEU A 198 ? GLN A 191 LEU A 195 
B 6 ALA A 237 ? SER A 240 ? ALA A 234 SER A 237 
B 7 ILE A 204 ? SER A 205 ? ILE A 201 SER A 202 
C 1 THR B 34  ? GLU B 38  ? THR B 31  GLU B 35  
C 2 THR B 99  ? ARG B 104 ? THR B 96  ARG B 101 
C 3 PHE B 53  ? SER B 59  ? PHE B 50  SER B 56  
C 4 VAL B 79  ? ILE B 82  ? VAL B 76  ILE B 79  
D 1 VAL B 176 ? SER B 179 ? VAL B 173 SER B 176 
D 2 GLY B 147 ? VAL B 151 ? GLY B 144 VAL B 148 
D 3 VAL B 121 ? ASP B 125 ? VAL B 118 ASP B 122 
D 4 LEU B 216 ? PHE B 220 ? LEU B 213 PHE B 217 
D 5 GLN B 194 ? LEU B 198 ? GLN B 191 LEU B 195 
D 6 ALA B 237 ? SER B 240 ? ALA B 234 SER B 237 
D 7 ILE B 204 ? SER B 205 ? ILE B 201 SER B 202 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 35  ? N THR A 32  O ALA A 103 ? O ALA A 100 
A 2 3 O ARG A 104 ? O ARG A 101 N GLU A 52  ? N GLU A 49  
A 3 4 N GLY A 58  ? N GLY A 55  O ILE A 82  ? O ILE A 79  
B 1 2 O VAL A 177 ? O VAL A 174 N ILE A 148 ? N ILE A 145 
B 2 3 O ILE A 149 ? O ILE A 146 N VAL A 122 ? N VAL A 119 
B 3 4 N VAL A 123 ? N VAL A 120 O LEU A 218 ? O LEU A 215 
B 4 5 O LEU A 219 ? O LEU A 216 N MET A 196 ? N MET A 193 
B 5 6 N THR A 197 ? N THR A 194 O ALA A 237 ? O ALA A 234 
B 6 7 O SER A 240 ? O SER A 237 N ILE A 204 ? N ILE A 201 
C 1 2 N THR B 35  ? N THR B 32  O ALA B 103 ? O ALA B 100 
C 2 3 O PHE B 100 ? O PHE B 97  N TYR B 57  ? N TYR B 54  
C 3 4 N GLY B 58  ? N GLY B 55  O ILE B 82  ? O ILE B 79  
D 1 2 O VAL B 177 ? O VAL B 174 N LEU B 150 ? N LEU B 147 
D 2 3 O ILE B 149 ? O ILE B 146 N VAL B 122 ? N VAL B 119 
D 3 4 N VAL B 123 ? N VAL B 120 O LEU B 218 ? O LEU B 215 
D 4 5 O LEU B 219 ? O LEU B 216 N MET B 196 ? N MET B 193 
D 5 6 N THR B 197 ? N THR B 194 O ALA B 237 ? O ALA B 234 
D 6 7 O SER B 240 ? O SER B 237 N ILE B 204 ? N ILE B 201 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE SAM A 270' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE SAM B 270' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 LEU A 198 ? LEU A 195 . ? 1_555 ? 
2  AC1 17 LYS A 199 ? LYS A 196 . ? 1_555 ? 
3  AC1 17 ALA A 200 ? ALA A 197 . ? 1_555 ? 
4  AC1 17 PHE A 220 ? PHE A 217 . ? 1_555 ? 
5  AC1 17 GLY A 221 ? GLY A 218 . ? 1_555 ? 
6  AC1 17 SER A 222 ? SER A 219 . ? 1_555 ? 
7  AC1 17 GLU A 223 ? GLU A 220 . ? 1_555 ? 
8  AC1 17 LYS A 224 ? LYS A 221 . ? 1_555 ? 
9  AC1 17 VAL A 239 ? VAL A 236 . ? 1_555 ? 
10 AC1 17 SER A 240 ? SER A 237 . ? 1_555 ? 
11 AC1 17 ILE A 241 ? ILE A 238 . ? 1_555 ? 
12 AC1 17 MET A 243 ? MET A 240 . ? 1_555 ? 
13 AC1 17 SER A 249 ? SER A 246 . ? 1_555 ? 
14 AC1 17 LEU A 250 ? LEU A 247 . ? 1_555 ? 
15 AC1 17 SER A 255 ? SER A 252 . ? 1_555 ? 
16 AC1 17 ARG B 138 ? ARG B 135 . ? 1_555 ? 
17 AC1 17 ARG B 168 ? ARG B 165 . ? 1_555 ? 
18 AC2 17 ARG A 138 ? ARG A 135 . ? 1_555 ? 
19 AC2 17 LEU B 198 ? LEU B 195 . ? 1_555 ? 
20 AC2 17 LYS B 199 ? LYS B 196 . ? 1_555 ? 
21 AC2 17 ALA B 200 ? ALA B 197 . ? 1_555 ? 
22 AC2 17 GLY B 221 ? GLY B 218 . ? 1_555 ? 
23 AC2 17 SER B 222 ? SER B 219 . ? 1_555 ? 
24 AC2 17 GLU B 223 ? GLU B 220 . ? 1_555 ? 
25 AC2 17 LYS B 224 ? LYS B 221 . ? 1_555 ? 
26 AC2 17 GLY B 226 ? GLY B 223 . ? 1_555 ? 
27 AC2 17 VAL B 239 ? VAL B 236 . ? 1_555 ? 
28 AC2 17 SER B 240 ? SER B 237 . ? 1_555 ? 
29 AC2 17 ILE B 241 ? ILE B 238 . ? 1_555 ? 
30 AC2 17 MET B 243 ? MET B 240 . ? 1_555 ? 
31 AC2 17 SER B 249 ? SER B 246 . ? 1_555 ? 
32 AC2 17 LEU B 250 ? LEU B 247 . ? 1_555 ? 
33 AC2 17 VAL B 252 ? VAL B 249 . ? 1_555 ? 
34 AC2 17 SER B 255 ? SER B 252 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3GYQ 
_atom_sites.fract_transf_matrix[1][1]   0.024414 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017931 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004639 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ALA A 1 11  ? 32.945 -11.726 63.339  1.00 123.22 ? 8   ALA A N     1 
ATOM   2    C CA    . ALA A 1 11  ? 34.203 -11.536 64.053  1.00 129.74 ? 8   ALA A CA    1 
ATOM   3    C C     . ALA A 1 11  ? 35.355 -11.300 63.082  1.00 138.18 ? 8   ALA A C     1 
ATOM   4    O O     . ALA A 1 11  ? 35.682 -12.168 62.272  1.00 136.88 ? 8   ALA A O     1 
ATOM   5    C CB    . ALA A 1 11  ? 34.492 -12.733 64.943  1.00 130.55 ? 8   ALA A CB    1 
ATOM   6    N N     . ASN A 1 12  ? 35.969 -10.124 63.169  1.00 148.49 ? 9   ASN A N     1 
ATOM   7    C CA    . ASN A 1 12  ? 37.058 -9.766  62.265  1.00 159.22 ? 9   ASN A CA    1 
ATOM   8    C C     . ASN A 1 12  ? 38.167 -8.943  62.920  1.00 162.30 ? 9   ASN A C     1 
ATOM   9    O O     . ASN A 1 12  ? 37.989 -7.758  63.199  1.00 158.73 ? 9   ASN A O     1 
ATOM   10   C CB    . ASN A 1 12  ? 36.514 -9.029  61.036  1.00 162.49 ? 9   ASN A CB    1 
ATOM   11   C CG    . ASN A 1 12  ? 35.789 -7.743  61.396  1.00 161.12 ? 9   ASN A CG    1 
ATOM   12   O OD1   . ASN A 1 12  ? 35.430 -7.520  62.552  1.00 163.46 ? 9   ASN A OD1   1 
ATOM   13   N ND2   . ASN A 1 12  ? 35.571 -6.891  60.402  1.00 156.50 ? 9   ASN A ND2   1 
ATOM   14   N N     . PRO A 1 13  ? 39.318 -9.583  63.179  1.00 168.26 ? 10  PRO A N     1 
ATOM   15   C CA    . PRO A 1 13  ? 40.527 -8.912  63.664  1.00 168.18 ? 10  PRO A CA    1 
ATOM   16   C C     . PRO A 1 13  ? 41.461 -8.557  62.510  1.00 167.26 ? 10  PRO A C     1 
ATOM   17   O O     . PRO A 1 13  ? 42.669 -8.450  62.714  1.00 169.12 ? 10  PRO A O     1 
ATOM   18   C CB    . PRO A 1 13  ? 41.193 -9.983  64.544  1.00 169.41 ? 10  PRO A CB    1 
ATOM   19   C CG    . PRO A 1 13  ? 40.260 -11.190 64.521  1.00 171.02 ? 10  PRO A CG    1 
ATOM   20   C CD    . PRO A 1 13  ? 39.442 -11.043 63.286  1.00 171.27 ? 10  PRO A CD    1 
ATOM   21   N N     . SER A 1 14  ? 40.906 -8.379  61.315  1.00 163.18 ? 11  SER A N     1 
ATOM   22   C CA    . SER A 1 14  ? 41.716 -8.150  60.122  1.00 160.22 ? 11  SER A CA    1 
ATOM   23   C C     . SER A 1 14  ? 41.704 -6.693  59.665  1.00 163.14 ? 11  SER A C     1 
ATOM   24   O O     . SER A 1 14  ? 40.728 -5.973  59.874  1.00 159.45 ? 11  SER A O     1 
ATOM   25   C CB    . SER A 1 14  ? 41.249 -9.058  58.981  1.00 153.86 ? 11  SER A CB    1 
ATOM   26   O OG    . SER A 1 14  ? 42.033 -8.859  57.816  1.00 148.66 ? 11  SER A OG    1 
ATOM   27   N N     . ASP A 1 15  ? 42.799 -6.270  59.039  1.00 167.85 ? 12  ASP A N     1 
ATOM   28   C CA    . ASP A 1 15  ? 42.917 -4.923  58.489  1.00 167.88 ? 12  ASP A CA    1 
ATOM   29   C C     . ASP A 1 15  ? 43.399 -4.976  57.042  1.00 177.25 ? 12  ASP A C     1 
ATOM   30   O O     . ASP A 1 15  ? 44.278 -5.770  56.706  1.00 179.01 ? 12  ASP A O     1 
ATOM   31   C CB    . ASP A 1 15  ? 43.887 -4.081  59.323  1.00 161.14 ? 12  ASP A CB    1 
ATOM   32   C CG    . ASP A 1 15  ? 43.350 -3.763  60.706  1.00 155.21 ? 12  ASP A CG    1 
ATOM   33   O OD1   . ASP A 1 15  ? 42.194 -4.131  61.000  1.00 157.06 ? 12  ASP A OD1   1 
ATOM   34   O OD2   . ASP A 1 15  ? 44.086 -3.140  61.500  1.00 148.92 ? 12  ASP A OD2   1 
ATOM   35   N N     . PRO A 1 16  ? 42.823 -4.128  56.176  1.00 184.30 ? 13  PRO A N     1 
ATOM   36   C CA    . PRO A 1 16  ? 41.736 -3.206  56.522  1.00 184.45 ? 13  PRO A CA    1 
ATOM   37   C C     . PRO A 1 16  ? 40.399 -3.932  56.627  1.00 183.27 ? 13  PRO A C     1 
ATOM   38   O O     . PRO A 1 16  ? 39.443 -3.380  57.169  1.00 183.45 ? 13  PRO A O     1 
ATOM   39   C CB    . PRO A 1 16  ? 41.704 -2.232  55.334  1.00 182.97 ? 13  PRO A CB    1 
ATOM   40   C CG    . PRO A 1 16  ? 42.981 -2.469  54.578  1.00 184.36 ? 13  PRO A CG    1 
ATOM   41   C CD    . PRO A 1 16  ? 43.313 -3.903  54.807  1.00 186.53 ? 13  PRO A CD    1 
ATOM   42   N N     . ALA A 1 17  ? 40.343 -5.155  56.105  1.00 180.45 ? 14  ALA A N     1 
ATOM   43   C CA    . ALA A 1 17  ? 39.126 -5.964  56.124  1.00 174.54 ? 14  ALA A CA    1 
ATOM   44   C C     . ALA A 1 17  ? 37.926 -5.226  55.532  1.00 166.27 ? 14  ALA A C     1 
ATOM   45   O O     . ALA A 1 17  ? 36.791 -5.693  55.626  1.00 167.78 ? 14  ALA A O     1 
ATOM   46   C CB    . ALA A 1 17  ? 38.820 -6.441  57.537  1.00 174.78 ? 14  ALA A CB    1 
ATOM   47   N N     . VAL A 1 18  ? 38.192 -4.074  54.924  1.00 156.43 ? 15  VAL A N     1 
ATOM   48   C CA    . VAL A 1 18  ? 37.163 -3.268  54.271  1.00 148.28 ? 15  VAL A CA    1 
ATOM   49   C C     . VAL A 1 18  ? 36.171 -2.638  55.250  1.00 148.60 ? 15  VAL A C     1 
ATOM   50   O O     . VAL A 1 18  ? 35.507 -1.655  54.920  1.00 147.79 ? 15  VAL A O     1 
ATOM   51   C CB    . VAL A 1 18  ? 36.395 -4.073  53.204  1.00 143.37 ? 15  VAL A CB    1 
ATOM   52   C CG1   . VAL A 1 18  ? 35.479 -3.154  52.417  1.00 140.02 ? 15  VAL A CG1   1 
ATOM   53   C CG2   . VAL A 1 18  ? 37.367 -4.784  52.273  1.00 143.39 ? 15  VAL A CG2   1 
ATOM   54   N N     . GLN A 1 19  ? 36.072 -3.196  56.454  1.00 150.55 ? 16  GLN A N     1 
ATOM   55   C CA    . GLN A 1 19  ? 35.182 -2.637  57.466  1.00 151.24 ? 16  GLN A CA    1 
ATOM   56   C C     . GLN A 1 19  ? 35.709 -1.273  57.899  1.00 149.31 ? 16  GLN A C     1 
ATOM   57   O O     . GLN A 1 19  ? 35.081 -0.569  58.691  1.00 142.04 ? 16  GLN A O     1 
ATOM   58   C CB    . GLN A 1 19  ? 35.057 -3.576  58.671  1.00 155.38 ? 16  GLN A CB    1 
ATOM   59   C CG    . GLN A 1 19  ? 35.766 -3.099  59.934  1.00 155.05 ? 16  GLN A CG    1 
ATOM   60   C CD    . GLN A 1 19  ? 37.270 -3.015  59.776  1.00 154.13 ? 16  GLN A CD    1 
ATOM   61   O OE1   . GLN A 1 19  ? 37.904 -2.070  60.246  1.00 150.24 ? 16  GLN A OE1   1 
ATOM   62   N NE2   . GLN A 1 19  ? 37.849 -4.004  59.111  1.00 157.29 ? 16  GLN A NE2   1 
ATOM   63   N N     . ARG A 1 20  ? 36.867 -0.908  57.357  1.00 155.96 ? 17  ARG A N     1 
ATOM   64   C CA    . ARG A 1 20  ? 37.528 0.354   57.673  1.00 157.84 ? 17  ARG A CA    1 
ATOM   65   C C     . ARG A 1 20  ? 36.708 1.584   57.288  1.00 151.66 ? 17  ARG A C     1 
ATOM   66   O O     . ARG A 1 20  ? 37.220 2.704   57.293  1.00 149.09 ? 17  ARG A O     1 
ATOM   67   C CB    . ARG A 1 20  ? 38.903 0.411   57.004  1.00 162.64 ? 17  ARG A CB    1 
ATOM   68   C CG    . ARG A 1 20  ? 40.050 -0.033  57.895  1.00 165.21 ? 17  ARG A CG    1 
ATOM   69   C CD    . ARG A 1 20  ? 40.385 1.050   58.904  1.00 165.23 ? 17  ARG A CD    1 
ATOM   70   N NE    . ARG A 1 20  ? 40.302 2.377   58.301  1.00 167.06 ? 17  ARG A NE    1 
ATOM   71   C CZ    . ARG A 1 20  ? 41.252 2.916   57.544  1.00 165.98 ? 17  ARG A CZ    1 
ATOM   72   N NH1   . ARG A 1 20  ? 42.365 2.241   57.293  1.00 167.11 ? 17  ARG A NH1   1 
ATOM   73   N NH2   . ARG A 1 20  ? 41.089 4.129   57.034  1.00 162.05 ? 17  ARG A NH2   1 
ATOM   74   N N     . ILE A 1 21  ? 35.440 1.375   56.951  1.00 147.79 ? 18  ILE A N     1 
ATOM   75   C CA    . ILE A 1 21  ? 34.534 2.483   56.688  1.00 142.10 ? 18  ILE A CA    1 
ATOM   76   C C     . ILE A 1 21  ? 34.351 3.265   57.980  1.00 140.70 ? 18  ILE A C     1 
ATOM   77   O O     . ILE A 1 21  ? 34.356 4.496   57.985  1.00 142.46 ? 18  ILE A O     1 
ATOM   78   C CB    . ILE A 1 21  ? 33.155 1.987   56.222  1.00 140.22 ? 18  ILE A CB    1 
ATOM   79   C CG1   . ILE A 1 21  ? 33.265 0.595   55.595  1.00 141.43 ? 18  ILE A CG1   1 
ATOM   80   C CG2   . ILE A 1 21  ? 32.526 2.987   55.261  1.00 134.85 ? 18  ILE A CG2   1 
ATOM   81   C CD1   . ILE A 1 21  ? 31.927 -0.077  55.368  1.00 138.85 ? 18  ILE A CD1   1 
ATOM   82   N N     . ILE A 1 22  ? 34.198 2.530   59.076  1.00 137.32 ? 19  ILE A N     1 
ATOM   83   C CA    . ILE A 1 22  ? 34.012 3.120   60.395  1.00 130.06 ? 19  ILE A CA    1 
ATOM   84   C C     . ILE A 1 22  ? 35.166 4.041   60.778  1.00 137.03 ? 19  ILE A C     1 
ATOM   85   O O     . ILE A 1 22  ? 34.978 5.010   61.511  1.00 140.97 ? 19  ILE A O     1 
ATOM   86   C CB    . ILE A 1 22  ? 33.870 2.031   61.474  1.00 118.73 ? 19  ILE A CB    1 
ATOM   87   C CG1   . ILE A 1 22  ? 35.095 1.114   61.468  1.00 116.21 ? 19  ILE A CG1   1 
ATOM   88   C CG2   . ILE A 1 22  ? 32.604 1.224   61.250  1.00 114.72 ? 19  ILE A CG2   1 
ATOM   89   C CD1   . ILE A 1 22  ? 34.982 -0.065  62.408  1.00 117.63 ? 19  ILE A CD1   1 
ATOM   90   N N     . ASP A 1 23  ? 36.358 3.735   60.277  1.00 139.27 ? 20  ASP A N     1 
ATOM   91   C CA    . ASP A 1 23  ? 37.545 4.512   60.612  1.00 140.73 ? 20  ASP A CA    1 
ATOM   92   C C     . ASP A 1 23  ? 37.780 5.634   59.603  1.00 133.18 ? 20  ASP A C     1 
ATOM   93   O O     . ASP A 1 23  ? 38.881 6.173   59.503  1.00 129.31 ? 20  ASP A O     1 
ATOM   94   C CB    . ASP A 1 23  ? 38.773 3.604   60.694  1.00 149.35 ? 20  ASP A CB    1 
ATOM   95   C CG    . ASP A 1 23  ? 39.899 4.217   61.501  1.00 157.60 ? 20  ASP A CG    1 
ATOM   96   O OD1   . ASP A 1 23  ? 41.067 4.107   61.074  1.00 159.64 ? 20  ASP A OD1   1 
ATOM   97   O OD2   . ASP A 1 23  ? 39.615 4.813   62.562  1.00 160.15 ? 20  ASP A OD2   1 
ATOM   98   N N     . VAL A 1 24  ? 36.735 5.974   58.856  1.00 132.48 ? 21  VAL A N     1 
ATOM   99   C CA    . VAL A 1 24  ? 36.791 7.074   57.899  1.00 135.67 ? 21  VAL A CA    1 
ATOM   100  C C     . VAL A 1 24  ? 35.501 7.887   57.972  1.00 139.71 ? 21  VAL A C     1 
ATOM   101  O O     . VAL A 1 24  ? 35.388 8.956   57.372  1.00 141.01 ? 21  VAL A O     1 
ATOM   102  C CB    . VAL A 1 24  ? 37.009 6.567   56.457  1.00 135.51 ? 21  VAL A CB    1 
ATOM   103  C CG1   . VAL A 1 24  ? 37.178 7.736   55.497  1.00 130.35 ? 21  VAL A CG1   1 
ATOM   104  C CG2   . VAL A 1 24  ? 38.221 5.653   56.393  1.00 140.62 ? 21  VAL A CG2   1 
ATOM   105  N N     . THR A 1 25  ? 34.528 7.371   58.715  1.00 141.91 ? 22  THR A N     1 
ATOM   106  C CA    . THR A 1 25  ? 33.269 8.075   58.920  1.00 143.36 ? 22  THR A CA    1 
ATOM   107  C C     . THR A 1 25  ? 33.185 8.604   60.346  1.00 147.99 ? 22  THR A C     1 
ATOM   108  O O     . THR A 1 25  ? 32.796 9.750   60.572  1.00 146.67 ? 22  THR A O     1 
ATOM   109  C CB    . THR A 1 25  ? 32.054 7.170   58.641  1.00 143.23 ? 22  THR A CB    1 
ATOM   110  O OG1   . THR A 1 25  ? 32.008 6.114   59.609  1.00 144.99 ? 22  THR A OG1   1 
ATOM   111  C CG2   . THR A 1 25  ? 32.142 6.573   57.244  1.00 143.15 ? 22  THR A CG2   1 
ATOM   112  N N     . LYS A 1 26  ? 33.553 7.761   61.306  1.00 155.28 ? 23  LYS A N     1 
ATOM   113  C CA    . LYS A 1 26  ? 33.568 8.162   62.708  1.00 160.76 ? 23  LYS A CA    1 
ATOM   114  C C     . LYS A 1 26  ? 34.583 9.280   62.939  1.00 172.24 ? 23  LYS A C     1 
ATOM   115  O O     . LYS A 1 26  ? 34.265 10.285  63.577  1.00 176.94 ? 23  LYS A O     1 
ATOM   116  C CB    . LYS A 1 26  ? 33.872 6.964   63.615  1.00 154.75 ? 23  LYS A CB    1 
ATOM   117  C CG    . LYS A 1 26  ? 33.187 7.022   64.971  1.00 149.19 ? 23  LYS A CG    1 
ATOM   118  C CD    . LYS A 1 26  ? 33.587 8.255   65.762  1.00 144.47 ? 23  LYS A CD    1 
ATOM   119  C CE    . LYS A 1 26  ? 32.464 8.692   66.688  1.00 137.98 ? 23  LYS A CE    1 
ATOM   120  N NZ    . LYS A 1 26  ? 31.254 9.097   65.916  1.00 134.61 ? 23  LYS A NZ    1 
ATOM   121  N N     . PRO A 1 27  ? 35.812 9.111   62.423  1.00 173.99 ? 24  PRO A N     1 
ATOM   122  C CA    . PRO A 1 27  ? 36.810 10.175  62.563  1.00 171.03 ? 24  PRO A CA    1 
ATOM   123  C C     . PRO A 1 27  ? 36.410 11.424  61.785  1.00 162.55 ? 24  PRO A C     1 
ATOM   124  O O     . PRO A 1 27  ? 35.639 11.334  60.830  1.00 159.78 ? 24  PRO A O     1 
ATOM   125  C CB    . PRO A 1 27  ? 38.073 9.556   61.950  1.00 173.25 ? 24  PRO A CB    1 
ATOM   126  C CG    . PRO A 1 27  ? 37.841 8.083   61.983  1.00 174.78 ? 24  PRO A CG    1 
ATOM   127  C CD    . PRO A 1 27  ? 36.374 7.916   61.770  1.00 174.60 ? 24  PRO A CD    1 
ATOM   128  N N     . SER A 1 28  ? 36.927 12.577  62.199  1.00 158.67 ? 25  SER A N     1 
ATOM   129  C CA    . SER A 1 28  ? 36.656 13.831  61.507  1.00 153.34 ? 25  SER A CA    1 
ATOM   130  C C     . SER A 1 28  ? 37.454 13.896  60.212  1.00 148.68 ? 25  SER A C     1 
ATOM   131  O O     . SER A 1 28  ? 38.651 14.181  60.224  1.00 143.89 ? 25  SER A O     1 
ATOM   132  C CB    . SER A 1 28  ? 37.003 15.023  62.401  1.00 151.70 ? 25  SER A CB    1 
ATOM   133  O OG    . SER A 1 28  ? 38.366 14.991  62.790  1.00 150.74 ? 25  SER A OG    1 
ATOM   134  N N     . ARG A 1 29  ? 36.786 13.633  59.093  1.00 151.14 ? 26  ARG A N     1 
ATOM   135  C CA    . ARG A 1 29  ? 37.470 13.560  57.807  1.00 155.29 ? 26  ARG A CA    1 
ATOM   136  C C     . ARG A 1 29  ? 37.054 14.680  56.855  1.00 155.83 ? 26  ARG A C     1 
ATOM   137  O O     . ARG A 1 29  ? 37.148 15.860  57.193  1.00 154.49 ? 26  ARG A O     1 
ATOM   138  C CB    . ARG A 1 29  ? 37.241 12.193  57.158  1.00 156.34 ? 26  ARG A CB    1 
ATOM   139  C CG    . ARG A 1 29  ? 37.282 11.036  58.143  1.00 156.76 ? 26  ARG A CG    1 
ATOM   140  C CD    . ARG A 1 29  ? 38.601 10.971  58.900  1.00 156.45 ? 26  ARG A CD    1 
ATOM   141  N NE    . ARG A 1 29  ? 39.614 10.191  58.195  1.00 156.90 ? 26  ARG A NE    1 
ATOM   142  C CZ    . ARG A 1 29  ? 40.652 10.716  57.551  1.00 155.76 ? 26  ARG A CZ    1 
ATOM   143  N NH1   . ARG A 1 29  ? 40.821 12.031  57.520  1.00 154.10 ? 26  ARG A NH1   1 
ATOM   144  N NH2   . ARG A 1 29  ? 41.523 9.925   56.940  1.00 156.14 ? 26  ARG A NH2   1 
ATOM   145  N N     . SER A 1 30  ? 36.592 14.303  55.666  1.00 158.86 ? 27  SER A N     1 
ATOM   146  C CA    . SER A 1 30  ? 36.332 15.272  54.605  1.00 162.23 ? 27  SER A CA    1 
ATOM   147  C C     . SER A 1 30  ? 34.850 15.579  54.377  1.00 163.77 ? 27  SER A C     1 
ATOM   148  O O     . SER A 1 30  ? 34.421 16.723  54.523  1.00 159.19 ? 27  SER A O     1 
ATOM   149  C CB    . SER A 1 30  ? 36.985 14.815  53.297  1.00 164.55 ? 27  SER A CB    1 
ATOM   150  O OG    . SER A 1 30  ? 36.700 13.453  53.031  1.00 167.55 ? 27  SER A OG    1 
ATOM   151  N N     . ASN A 1 31  ? 34.074 14.564  54.011  1.00 169.60 ? 28  ASN A N     1 
ATOM   152  C CA    . ASN A 1 31  ? 32.667 14.773  53.673  1.00 170.51 ? 28  ASN A CA    1 
ATOM   153  C C     . ASN A 1 31  ? 31.702 14.587  54.846  1.00 168.09 ? 28  ASN A C     1 
ATOM   154  O O     . ASN A 1 31  ? 32.011 13.901  55.820  1.00 171.17 ? 28  ASN A O     1 
ATOM   155  C CB    . ASN A 1 31  ? 32.251 13.903  52.481  1.00 171.14 ? 28  ASN A CB    1 
ATOM   156  C CG    . ASN A 1 31  ? 32.536 12.430  52.700  1.00 171.93 ? 28  ASN A CG    1 
ATOM   157  O OD1   . ASN A 1 31  ? 33.413 12.061  53.481  1.00 173.13 ? 28  ASN A OD1   1 
ATOM   158  N ND2   . ASN A 1 31  ? 31.796 11.577  52.001  1.00 170.54 ? 28  ASN A ND2   1 
ATOM   159  N N     . ILE A 1 32  ? 30.529 15.203  54.733  1.00 158.30 ? 29  ILE A N     1 
ATOM   160  C CA    . ILE A 1 32  ? 29.559 15.243  55.823  1.00 146.07 ? 29  ILE A CA    1 
ATOM   161  C C     . ILE A 1 32  ? 28.406 14.256  55.627  1.00 132.99 ? 29  ILE A C     1 
ATOM   162  O O     . ILE A 1 32  ? 27.471 14.217  56.427  1.00 128.28 ? 29  ILE A O     1 
ATOM   163  C CB    . ILE A 1 32  ? 28.980 16.666  55.987  1.00 145.17 ? 29  ILE A CB    1 
ATOM   164  C CG1   . ILE A 1 32  ? 28.197 16.790  57.297  1.00 143.67 ? 29  ILE A CG1   1 
ATOM   165  C CG2   . ILE A 1 32  ? 28.114 17.032  54.788  1.00 144.37 ? 29  ILE A CG2   1 
ATOM   166  C CD1   . ILE A 1 32  ? 27.459 18.102  57.445  1.00 139.10 ? 29  ILE A CD1   1 
ATOM   167  N N     . LYS A 1 33  ? 28.476 13.457  54.567  1.00 125.06 ? 30  LYS A N     1 
ATOM   168  C CA    . LYS A 1 33  ? 27.403 12.516  54.250  1.00 115.10 ? 30  LYS A CA    1 
ATOM   169  C C     . LYS A 1 33  ? 27.102 11.536  55.384  1.00 110.13 ? 30  LYS A C     1 
ATOM   170  O O     . LYS A 1 33  ? 26.347 11.854  56.302  1.00 116.55 ? 30  LYS A O     1 
ATOM   171  C CB    . LYS A 1 33  ? 27.705 11.762  52.952  1.00 113.38 ? 30  LYS A CB    1 
ATOM   172  C CG    . LYS A 1 33  ? 27.212 12.471  51.701  1.00 111.10 ? 30  LYS A CG    1 
ATOM   173  C CD    . LYS A 1 33  ? 27.571 11.698  50.443  1.00 113.80 ? 30  LYS A CD    1 
ATOM   174  C CE    . LYS A 1 33  ? 26.701 12.121  49.269  1.00 113.29 ? 30  LYS A CE    1 
ATOM   175  N NZ    . LYS A 1 33  ? 26.589 13.602  49.162  1.00 109.40 ? 30  LYS A NZ    1 
ATOM   176  N N     . THR A 1 34  ? 27.690 10.346  55.317  1.00 102.84 ? 31  THR A N     1 
ATOM   177  C CA    . THR A 1 34  ? 27.436 9.312   56.318  1.00 104.02 ? 31  THR A CA    1 
ATOM   178  C C     . THR A 1 34  ? 27.921 9.716   57.709  1.00 104.96 ? 31  THR A C     1 
ATOM   179  O O     . THR A 1 34  ? 28.522 10.775  57.885  1.00 107.83 ? 31  THR A O     1 
ATOM   180  C CB    . THR A 1 34  ? 28.079 7.966   55.923  1.00 102.71 ? 31  THR A CB    1 
ATOM   181  O OG1   . THR A 1 34  ? 29.467 8.164   55.629  1.00 100.69 ? 31  THR A OG1   1 
ATOM   182  C CG2   . THR A 1 34  ? 27.385 7.380   54.703  1.00 97.46  ? 31  THR A CG2   1 
ATOM   183  N N     . THR A 1 35  ? 27.654 8.862   58.693  1.00 103.08 ? 32  THR A N     1 
ATOM   184  C CA    . THR A 1 35  ? 28.042 9.124   60.075  1.00 98.16  ? 32  THR A CA    1 
ATOM   185  C C     . THR A 1 35  ? 27.951 7.850   60.911  1.00 97.01  ? 32  THR A C     1 
ATOM   186  O O     . THR A 1 35  ? 27.398 6.846   60.466  1.00 98.19  ? 32  THR A O     1 
ATOM   187  C CB    . THR A 1 35  ? 27.146 10.198  60.717  1.00 89.55  ? 32  THR A CB    1 
ATOM   188  O OG1   . THR A 1 35  ? 27.677 10.566  61.996  1.00 92.99  ? 32  THR A OG1   1 
ATOM   189  C CG2   . THR A 1 35  ? 25.729 9.671   60.892  1.00 80.54  ? 32  THR A CG2   1 
ATOM   190  N N     . LEU A 1 36  ? 28.492 7.895   62.125  1.00 90.65  ? 33  LEU A N     1 
ATOM   191  C CA    . LEU A 1 36  ? 28.431 6.748   63.023  1.00 87.59  ? 33  LEU A CA    1 
ATOM   192  C C     . LEU A 1 36  ? 27.553 7.048   64.232  1.00 83.24  ? 33  LEU A C     1 
ATOM   193  O O     . LEU A 1 36  ? 27.717 8.074   64.891  1.00 81.59  ? 33  LEU A O     1 
ATOM   194  C CB    . LEU A 1 36  ? 29.831 6.344   63.489  1.00 84.22  ? 33  LEU A CB    1 
ATOM   195  C CG    . LEU A 1 36  ? 29.987 4.868   63.861  1.00 90.79  ? 33  LEU A CG    1 
ATOM   196  C CD1   . LEU A 1 36  ? 30.558 4.091   62.686  1.00 93.66  ? 33  LEU A CD1   1 
ATOM   197  C CD2   . LEU A 1 36  ? 30.868 4.698   65.086  1.00 91.54  ? 33  LEU A CD2   1 
ATOM   198  N N     . ILE A 1 37  ? 26.621 6.145   64.519  1.00 82.85  ? 34  ILE A N     1 
ATOM   199  C CA    . ILE A 1 37  ? 25.728 6.294   65.662  1.00 90.10  ? 34  ILE A CA    1 
ATOM   200  C C     . ILE A 1 37  ? 26.034 5.252   66.731  1.00 102.44 ? 34  ILE A C     1 
ATOM   201  O O     . ILE A 1 37  ? 26.062 4.055   66.453  1.00 102.20 ? 34  ILE A O     1 
ATOM   202  C CB    . ILE A 1 37  ? 24.250 6.175   65.239  1.00 88.01  ? 34  ILE A CB    1 
ATOM   203  C CG1   . ILE A 1 37  ? 23.830 7.403   64.429  1.00 79.77  ? 34  ILE A CG1   1 
ATOM   204  C CG2   . ILE A 1 37  ? 23.356 6.011   66.457  1.00 92.68  ? 34  ILE A CG2   1 
ATOM   205  C CD1   . ILE A 1 37  ? 22.367 7.412   64.047  1.00 79.24  ? 34  ILE A CD1   1 
ATOM   206  N N     . GLU A 1 38  ? 26.265 5.714   67.956  1.00 109.55 ? 35  GLU A N     1 
ATOM   207  C CA    . GLU A 1 38  ? 26.604 4.820   69.058  1.00 120.39 ? 35  GLU A CA    1 
ATOM   208  C C     . GLU A 1 38  ? 25.387 4.446   69.899  1.00 125.28 ? 35  GLU A C     1 
ATOM   209  O O     . GLU A 1 38  ? 24.306 5.011   69.736  1.00 125.81 ? 35  GLU A O     1 
ATOM   210  C CB    . GLU A 1 38  ? 27.675 5.446   69.955  1.00 128.21 ? 35  GLU A CB    1 
ATOM   211  C CG    . GLU A 1 38  ? 29.029 5.614   69.291  1.00 134.98 ? 35  GLU A CG    1 
ATOM   212  C CD    . GLU A 1 38  ? 30.083 6.138   70.248  1.00 138.66 ? 35  GLU A CD    1 
ATOM   213  O OE1   . GLU A 1 38  ? 30.086 5.712   71.422  1.00 141.15 ? 35  GLU A OE1   1 
ATOM   214  O OE2   . GLU A 1 38  ? 30.910 6.973   69.824  1.00 137.99 ? 35  GLU A OE2   1 
ATOM   215  N N     . ASP A 1 39  ? 25.583 3.482   70.794  1.00 129.94 ? 36  ASP A N     1 
ATOM   216  C CA    . ASP A 1 39  ? 24.551 3.052   71.734  1.00 130.47 ? 36  ASP A CA    1 
ATOM   217  C C     . ASP A 1 39  ? 23.412 2.287   71.062  1.00 128.06 ? 36  ASP A C     1 
ATOM   218  O O     . ASP A 1 39  ? 23.072 2.539   69.906  1.00 124.09 ? 36  ASP A O     1 
ATOM   219  C CB    . ASP A 1 39  ? 24.018 4.243   72.534  1.00 127.96 ? 36  ASP A CB    1 
ATOM   220  C CG    . ASP A 1 39  ? 25.074 4.858   73.430  1.00 130.15 ? 36  ASP A CG    1 
ATOM   221  O OD1   . ASP A 1 39  ? 26.174 4.274   73.537  1.00 127.90 ? 36  ASP A OD1   1 
ATOM   222  O OD2   . ASP A 1 39  ? 24.808 5.922   74.028  1.00 134.31 ? 36  ASP A OD2   1 
ATOM   223  N N     . VAL A 1 40  ? 22.831 1.350   71.803  1.00 129.55 ? 37  VAL A N     1 
ATOM   224  C CA    . VAL A 1 40  ? 21.797 0.467   71.274  1.00 126.80 ? 37  VAL A CA    1 
ATOM   225  C C     . VAL A 1 40  ? 20.491 1.197   70.962  1.00 124.72 ? 37  VAL A C     1 
ATOM   226  O O     . VAL A 1 40  ? 19.874 0.962   69.923  1.00 120.77 ? 37  VAL A O     1 
ATOM   227  C CB    . VAL A 1 40  ? 21.513 -0.702  72.242  1.00 125.42 ? 37  VAL A CB    1 
ATOM   228  C CG1   . VAL A 1 40  ? 21.538 -0.218  73.685  1.00 125.92 ? 37  VAL A CG1   1 
ATOM   229  C CG2   . VAL A 1 40  ? 20.183 -1.363  71.909  1.00 125.53 ? 37  VAL A CG2   1 
ATOM   230  N N     . GLU A 1 41  ? 20.077 2.083   71.862  1.00 126.97 ? 38  GLU A N     1 
ATOM   231  C CA    . GLU A 1 41  ? 18.808 2.791   71.711  1.00 124.08 ? 38  GLU A CA    1 
ATOM   232  C C     . GLU A 1 41  ? 18.744 3.718   70.495  1.00 109.29 ? 38  GLU A C     1 
ATOM   233  O O     . GLU A 1 41  ? 17.810 3.627   69.699  1.00 104.74 ? 38  GLU A O     1 
ATOM   234  C CB    . GLU A 1 41  ? 18.453 3.555   72.991  1.00 130.27 ? 38  GLU A CB    1 
ATOM   235  C CG    . GLU A 1 41  ? 17.711 2.727   74.028  1.00 137.77 ? 38  GLU A CG    1 
ATOM   236  C CD    . GLU A 1 41  ? 16.278 2.427   73.623  1.00 138.58 ? 38  GLU A CD    1 
ATOM   237  O OE1   . GLU A 1 41  ? 15.382 2.543   74.484  1.00 138.68 ? 38  GLU A OE1   1 
ATOM   238  O OE2   . GLU A 1 41  ? 16.045 2.081   72.445  1.00 136.47 ? 38  GLU A OE2   1 
ATOM   239  N N     . PRO A 1 42  ? 19.733 4.617   70.349  1.00 101.33 ? 39  PRO A N     1 
ATOM   240  C CA    . PRO A 1 42  ? 19.719 5.551   69.217  1.00 99.62  ? 39  PRO A CA    1 
ATOM   241  C C     . PRO A 1 42  ? 19.527 4.839   67.881  1.00 110.27 ? 39  PRO A C     1 
ATOM   242  O O     . PRO A 1 42  ? 18.913 5.396   66.972  1.00 112.26 ? 39  PRO A O     1 
ATOM   243  C CB    . PRO A 1 42  ? 21.109 6.188   69.277  1.00 90.06  ? 39  PRO A CB    1 
ATOM   244  C CG    . PRO A 1 42  ? 21.491 6.107   70.707  1.00 86.88  ? 39  PRO A CG    1 
ATOM   245  C CD    . PRO A 1 42  ? 20.905 4.823   71.217  1.00 95.75  ? 39  PRO A CD    1 
ATOM   246  N N     . LEU A 1 43  ? 20.044 3.620   67.770  1.00 115.20 ? 40  LEU A N     1 
ATOM   247  C CA    . LEU A 1 43  ? 19.923 2.850   66.537  1.00 119.25 ? 40  LEU A CA    1 
ATOM   248  C C     . LEU A 1 43  ? 18.467 2.504   66.240  1.00 121.45 ? 40  LEU A C     1 
ATOM   249  O O     . LEU A 1 43  ? 17.982 2.723   65.129  1.00 121.56 ? 40  LEU A O     1 
ATOM   250  C CB    . LEU A 1 43  ? 20.765 1.575   66.615  1.00 117.63 ? 40  LEU A CB    1 
ATOM   251  C CG    . LEU A 1 43  ? 22.277 1.759   66.765  1.00 116.08 ? 40  LEU A CG    1 
ATOM   252  C CD1   . LEU A 1 43  ? 22.957 0.418   66.978  1.00 116.19 ? 40  LEU A CD1   1 
ATOM   253  C CD2   . LEU A 1 43  ? 22.862 2.470   65.554  1.00 115.28 ? 40  LEU A CD2   1 
ATOM   254  N N     . MET A 1 44  ? 17.775 1.968   67.240  1.00 122.14 ? 41  MET A N     1 
ATOM   255  C CA    . MET A 1 44  ? 16.381 1.565   67.089  1.00 119.26 ? 41  MET A CA    1 
ATOM   256  C C     . MET A 1 44  ? 15.510 2.684   66.524  1.00 106.22 ? 41  MET A C     1 
ATOM   257  O O     . MET A 1 44  ? 14.861 2.512   65.493  1.00 88.69  ? 41  MET A O     1 
ATOM   258  C CB    . MET A 1 44  ? 15.819 1.082   68.427  1.00 126.60 ? 41  MET A CB    1 
ATOM   259  C CG    . MET A 1 44  ? 16.406 -0.238  68.900  1.00 130.20 ? 41  MET A CG    1 
ATOM   260  S SD    . MET A 1 44  ? 15.790 -1.641  67.951  1.00 256.17 ? 41  MET A SD    1 
ATOM   261  C CE    . MET A 1 44  ? 14.077 -1.663  68.473  1.00 151.45 ? 41  MET A CE    1 
ATOM   262  N N     . HIS A 1 45  ? 15.501 3.829   67.198  1.00 113.90 ? 42  HIS A N     1 
ATOM   263  C CA    . HIS A 1 45  ? 14.666 4.949   66.773  1.00 122.43 ? 42  HIS A CA    1 
ATOM   264  C C     . HIS A 1 45  ? 15.134 5.568   65.460  1.00 128.04 ? 42  HIS A C     1 
ATOM   265  O O     . HIS A 1 45  ? 14.339 6.158   64.729  1.00 131.11 ? 42  HIS A O     1 
ATOM   266  C CB    . HIS A 1 45  ? 14.585 6.014   67.868  1.00 124.25 ? 42  HIS A CB    1 
ATOM   267  C CG    . HIS A 1 45  ? 13.779 5.593   69.055  1.00 130.27 ? 42  HIS A CG    1 
ATOM   268  N ND1   . HIS A 1 45  ? 14.316 5.482   70.319  1.00 133.74 ? 42  HIS A ND1   1 
ATOM   269  C CD2   . HIS A 1 45  ? 12.475 5.243   69.168  1.00 133.70 ? 42  HIS A CD2   1 
ATOM   270  C CE1   . HIS A 1 45  ? 13.377 5.088   71.161  1.00 138.48 ? 42  HIS A CE1   1 
ATOM   271  N NE2   . HIS A 1 45  ? 12.251 4.936   70.487  1.00 138.87 ? 42  HIS A NE2   1 
ATOM   272  N N     . SER A 1 46  ? 16.422 5.436   65.164  1.00 128.84 ? 43  SER A N     1 
ATOM   273  C CA    . SER A 1 46  ? 16.955 5.933   63.901  1.00 124.47 ? 43  SER A CA    1 
ATOM   274  C C     . SER A 1 46  ? 16.361 5.151   62.734  1.00 123.86 ? 43  SER A C     1 
ATOM   275  O O     . SER A 1 46  ? 15.889 5.734   61.758  1.00 127.75 ? 43  SER A O     1 
ATOM   276  C CB    . SER A 1 46  ? 18.482 5.851   63.885  1.00 117.56 ? 43  SER A CB    1 
ATOM   277  O OG    . SER A 1 46  ? 19.050 6.807   64.763  1.00 109.36 ? 43  SER A OG    1 
ATOM   278  N N     . ILE A 1 47  ? 16.379 3.827   62.848  1.00 116.25 ? 44  ILE A N     1 
ATOM   279  C CA    . ILE A 1 47  ? 15.793 2.960   61.833  1.00 115.52 ? 44  ILE A CA    1 
ATOM   280  C C     . ILE A 1 47  ? 14.271 3.041   61.883  1.00 113.61 ? 44  ILE A C     1 
ATOM   281  O O     . ILE A 1 47  ? 13.593 2.842   60.874  1.00 105.42 ? 44  ILE A O     1 
ATOM   282  C CB    . ILE A 1 47  ? 16.224 1.496   62.034  1.00 116.82 ? 44  ILE A CB    1 
ATOM   283  C CG1   . ILE A 1 47  ? 17.732 1.414   62.276  1.00 119.11 ? 44  ILE A CG1   1 
ATOM   284  C CG2   . ILE A 1 47  ? 15.819 0.649   60.837  1.00 116.36 ? 44  ILE A CG2   1 
ATOM   285  C CD1   . ILE A 1 47  ? 18.235 0.014   62.545  1.00 123.48 ? 44  ILE A CD1   1 
ATOM   286  N N     . ALA A 1 48  ? 13.743 3.339   63.066  1.00 113.86 ? 45  ALA A N     1 
ATOM   287  C CA    . ALA A 1 48  ? 12.303 3.439   63.265  1.00 118.93 ? 45  ALA A CA    1 
ATOM   288  C C     . ALA A 1 48  ? 11.765 4.779   62.776  1.00 129.10 ? 45  ALA A C     1 
ATOM   289  O O     . ALA A 1 48  ? 10.660 5.183   63.136  1.00 133.83 ? 45  ALA A O     1 
ATOM   290  C CB    . ALA A 1 48  ? 11.955 3.231   64.731  1.00 116.67 ? 45  ALA A CB    1 
ATOM   291  N N     . ALA A 1 49  ? 12.556 5.466   61.958  1.00 129.69 ? 46  ALA A N     1 
ATOM   292  C CA    . ALA A 1 49  ? 12.148 6.750   61.399  1.00 124.51 ? 46  ALA A CA    1 
ATOM   293  C C     . ALA A 1 49  ? 12.246 6.741   59.877  1.00 126.70 ? 46  ALA A C     1 
ATOM   294  O O     . ALA A 1 49  ? 11.295 7.100   59.183  1.00 128.30 ? 46  ALA A O     1 
ATOM   295  C CB    . ALA A 1 49  ? 12.991 7.874   61.981  1.00 119.61 ? 46  ALA A CB    1 
ATOM   296  N N     . GLY A 1 50  ? 13.400 6.326   59.365  1.00 127.89 ? 47  GLY A N     1 
ATOM   297  C CA    . GLY A 1 50  ? 13.620 6.267   57.931  1.00 129.54 ? 47  GLY A CA    1 
ATOM   298  C C     . GLY A 1 50  ? 15.086 6.362   57.553  1.00 125.34 ? 47  GLY A C     1 
ATOM   299  O O     . GLY A 1 50  ? 15.425 6.528   56.382  1.00 114.46 ? 47  GLY A O     1 
ATOM   300  N N     . VAL A 1 51  ? 15.958 6.255   58.550  1.00 127.18 ? 48  VAL A N     1 
ATOM   301  C CA    . VAL A 1 51  ? 17.397 6.319   58.322  1.00 122.27 ? 48  VAL A CA    1 
ATOM   302  C C     . VAL A 1 51  ? 17.908 5.018   57.710  1.00 125.56 ? 48  VAL A C     1 
ATOM   303  O O     . VAL A 1 51  ? 17.348 3.948   57.949  1.00 122.65 ? 48  VAL A O     1 
ATOM   304  C CB    . VAL A 1 51  ? 18.162 6.608   59.631  1.00 113.89 ? 48  VAL A CB    1 
ATOM   305  C CG1   . VAL A 1 51  ? 19.655 6.727   59.364  1.00 106.29 ? 48  VAL A CG1   1 
ATOM   306  C CG2   . VAL A 1 51  ? 17.633 7.875   60.283  1.00 115.86 ? 48  VAL A CG2   1 
ATOM   307  N N     . GLU A 1 52  ? 18.970 5.117   56.918  1.00 124.75 ? 49  GLU A N     1 
ATOM   308  C CA    . GLU A 1 52  ? 19.549 3.952   56.259  1.00 123.69 ? 49  GLU A CA    1 
ATOM   309  C C     . GLU A 1 52  ? 20.939 3.648   56.809  1.00 114.71 ? 49  GLU A C     1 
ATOM   310  O O     . GLU A 1 52  ? 21.824 4.501   56.785  1.00 112.69 ? 49  GLU A O     1 
ATOM   311  C CB    . GLU A 1 52  ? 19.617 4.178   54.748  1.00 130.95 ? 49  GLU A CB    1 
ATOM   312  C CG    . GLU A 1 52  ? 18.330 4.724   54.149  1.00 136.88 ? 49  GLU A CG    1 
ATOM   313  C CD    . GLU A 1 52  ? 18.371 4.796   52.636  1.00 140.38 ? 49  GLU A CD    1 
ATOM   314  O OE1   . GLU A 1 52  ? 19.159 4.045   52.024  1.00 139.34 ? 49  GLU A OE1   1 
ATOM   315  O OE2   . GLU A 1 52  ? 17.609 5.600   52.057  1.00 140.96 ? 49  GLU A OE2   1 
ATOM   316  N N     . PHE A 1 53  ? 21.125 2.428   57.303  1.00 105.32 ? 50  PHE A N     1 
ATOM   317  C CA    . PHE A 1 53  ? 22.401 2.029   57.888  1.00 98.82  ? 50  PHE A CA    1 
ATOM   318  C C     . PHE A 1 53  ? 23.211 1.134   56.956  1.00 100.81 ? 50  PHE A C     1 
ATOM   319  O O     . PHE A 1 53  ? 22.739 0.083   56.521  1.00 99.56  ? 50  PHE A O     1 
ATOM   320  C CB    . PHE A 1 53  ? 22.181 1.329   59.232  1.00 96.16  ? 50  PHE A CB    1 
ATOM   321  C CG    . PHE A 1 53  ? 21.817 2.265   60.350  1.00 98.28  ? 50  PHE A CG    1 
ATOM   322  C CD1   . PHE A 1 53  ? 20.526 2.749   60.474  1.00 97.51  ? 50  PHE A CD1   1 
ATOM   323  C CD2   . PHE A 1 53  ? 22.767 2.659   61.279  1.00 92.66  ? 50  PHE A CD2   1 
ATOM   324  C CE1   . PHE A 1 53  ? 20.189 3.611   61.502  1.00 95.55  ? 50  PHE A CE1   1 
ATOM   325  C CE2   . PHE A 1 53  ? 22.436 3.520   62.308  1.00 89.43  ? 50  PHE A CE2   1 
ATOM   326  C CZ    . PHE A 1 53  ? 21.146 3.996   62.420  1.00 91.06  ? 50  PHE A CZ    1 
ATOM   327  N N     . ILE A 1 54  ? 24.433 1.560   56.652  1.00 96.33  ? 51  ILE A N     1 
ATOM   328  C CA    . ILE A 1 54  ? 25.335 0.768   55.826  1.00 87.57  ? 51  ILE A CA    1 
ATOM   329  C C     . ILE A 1 54  ? 25.586 -0.585  56.480  1.00 91.66  ? 51  ILE A C     1 
ATOM   330  O O     . ILE A 1 54  ? 25.510 -1.625  55.827  1.00 93.78  ? 51  ILE A O     1 
ATOM   331  C CB    . ILE A 1 54  ? 26.680 1.486   55.605  1.00 86.56  ? 51  ILE A CB    1 
ATOM   332  C CG1   . ILE A 1 54  ? 26.461 2.815   54.879  1.00 88.42  ? 51  ILE A CG1   1 
ATOM   333  C CG2   . ILE A 1 54  ? 27.636 0.600   54.821  1.00 86.76  ? 51  ILE A CG2   1 
ATOM   334  C CD1   . ILE A 1 54  ? 27.737 3.586   54.614  1.00 92.46  ? 51  ILE A CD1   1 
ATOM   335  N N     . GLU A 1 55  ? 25.876 -0.562  57.778  1.00 103.15 ? 52  GLU A N     1 
ATOM   336  C CA    . GLU A 1 55  ? 26.104 -1.788  58.534  1.00 104.38 ? 52  GLU A CA    1 
ATOM   337  C C     . GLU A 1 55  ? 26.215 -1.517  60.031  1.00 108.07 ? 52  GLU A C     1 
ATOM   338  O O     . GLU A 1 55  ? 26.758 -0.495  60.451  1.00 108.57 ? 52  GLU A O     1 
ATOM   339  C CB    . GLU A 1 55  ? 27.363 -2.500  58.037  1.00 98.59  ? 52  GLU A CB    1 
ATOM   340  C CG    . GLU A 1 55  ? 27.575 -3.873  58.650  1.00 102.74 ? 52  GLU A CG    1 
ATOM   341  C CD    . GLU A 1 55  ? 28.678 -4.649  57.962  1.00 116.22 ? 52  GLU A CD    1 
ATOM   342  O OE1   . GLU A 1 55  ? 29.818 -4.143  57.903  1.00 120.35 ? 52  GLU A OE1   1 
ATOM   343  O OE2   . GLU A 1 55  ? 28.403 -5.767  57.481  1.00 123.28 ? 52  GLU A OE2   1 
ATOM   344  N N     . VAL A 1 56  ? 25.695 -2.443  60.829  1.00 108.29 ? 53  VAL A N     1 
ATOM   345  C CA    . VAL A 1 56  ? 25.750 -2.336  62.281  1.00 105.96 ? 53  VAL A CA    1 
ATOM   346  C C     . VAL A 1 56  ? 26.730 -3.353  62.856  1.00 111.45 ? 53  VAL A C     1 
ATOM   347  O O     . VAL A 1 56  ? 26.757 -4.507  62.433  1.00 108.63 ? 53  VAL A O     1 
ATOM   348  C CB    . VAL A 1 56  ? 24.358 -2.554  62.909  1.00 104.07 ? 53  VAL A CB    1 
ATOM   349  C CG1   . VAL A 1 56  ? 24.474 -2.772  64.410  1.00 102.49 ? 53  VAL A CG1   1 
ATOM   350  C CG2   . VAL A 1 56  ? 23.446 -1.376  62.599  1.00 86.98  ? 53  VAL A CG2   1 
ATOM   351  N N     . TYR A 1 57  ? 27.540 -2.917  63.815  1.00 117.66 ? 54  TYR A N     1 
ATOM   352  C CA    . TYR A 1 57  ? 28.520 -3.794  64.444  1.00 122.37 ? 54  TYR A CA    1 
ATOM   353  C C     . TYR A 1 57  ? 28.181 -4.022  65.915  1.00 127.45 ? 54  TYR A C     1 
ATOM   354  O O     . TYR A 1 57  ? 27.172 -3.520  66.409  1.00 128.51 ? 54  TYR A O     1 
ATOM   355  C CB    . TYR A 1 57  ? 29.926 -3.209  64.306  1.00 120.99 ? 54  TYR A CB    1 
ATOM   356  C CG    . TYR A 1 57  ? 30.337 -2.938  62.876  1.00 123.24 ? 54  TYR A CG    1 
ATOM   357  C CD1   . TYR A 1 57  ? 30.184 -1.677  62.315  1.00 120.08 ? 54  TYR A CD1   1 
ATOM   358  C CD2   . TYR A 1 57  ? 30.875 -3.944  62.085  1.00 126.19 ? 54  TYR A CD2   1 
ATOM   359  C CE1   . TYR A 1 57  ? 30.557 -1.426  61.009  1.00 120.64 ? 54  TYR A CE1   1 
ATOM   360  C CE2   . TYR A 1 57  ? 31.252 -3.703  60.778  1.00 125.06 ? 54  TYR A CE2   1 
ATOM   361  C CZ    . TYR A 1 57  ? 31.091 -2.442  60.245  1.00 123.24 ? 54  TYR A CZ    1 
ATOM   362  O OH    . TYR A 1 57  ? 31.465 -2.198  58.943  1.00 121.14 ? 54  TYR A OH    1 
ATOM   363  N N     . GLY A 1 58  ? 29.022 -4.782  66.610  1.00 131.96 ? 55  GLY A N     1 
ATOM   364  C CA    . GLY A 1 58  ? 28.793 -5.070  68.015  1.00 138.92 ? 55  GLY A CA    1 
ATOM   365  C C     . GLY A 1 58  ? 29.984 -5.710  68.703  1.00 148.18 ? 55  GLY A C     1 
ATOM   366  O O     . GLY A 1 58  ? 30.752 -6.440  68.080  1.00 147.97 ? 55  GLY A O     1 
ATOM   367  N N     . SER A 1 59  ? 30.133 -5.437  69.996  1.00 157.00 ? 56  SER A N     1 
ATOM   368  C CA    . SER A 1 59  ? 31.236 -5.985  70.780  1.00 161.55 ? 56  SER A CA    1 
ATOM   369  C C     . SER A 1 59  ? 31.050 -7.480  71.036  1.00 167.01 ? 56  SER A C     1 
ATOM   370  O O     . SER A 1 59  ? 29.959 -7.927  71.391  1.00 163.42 ? 56  SER A O     1 
ATOM   371  C CB    . SER A 1 59  ? 31.374 -5.231  72.105  1.00 158.23 ? 56  SER A CB    1 
ATOM   372  O OG    . SER A 1 59  ? 32.563 -5.599  72.784  1.00 159.09 ? 56  SER A OG    1 
ATOM   373  N N     . ASP A 1 60  ? 32.123 -8.246  70.859  1.00 177.60 ? 57  ASP A N     1 
ATOM   374  C CA    . ASP A 1 60  ? 32.062 -9.703  70.972  1.00 188.06 ? 57  ASP A CA    1 
ATOM   375  C C     . ASP A 1 60  ? 31.776 -10.193 72.392  1.00 191.33 ? 57  ASP A C     1 
ATOM   376  O O     . ASP A 1 60  ? 30.700 -10.727 72.660  1.00 193.44 ? 57  ASP A O     1 
ATOM   377  C CB    . ASP A 1 60  ? 33.346 -10.347 70.435  1.00 192.86 ? 57  ASP A CB    1 
ATOM   378  C CG    . ASP A 1 60  ? 34.591 -9.862  71.152  1.00 196.38 ? 57  ASP A CG    1 
ATOM   379  O OD1   . ASP A 1 60  ? 34.512 -8.841  71.866  1.00 198.28 ? 57  ASP A OD1   1 
ATOM   380  O OD2   . ASP A 1 60  ? 35.653 -10.502 70.998  1.00 197.11 ? 57  ASP A OD2   1 
ATOM   381  N N     . SER A 1 61  ? 32.740 -10.019 73.292  1.00 190.70 ? 58  SER A N     1 
ATOM   382  C CA    . SER A 1 61  ? 32.584 -10.452 74.677  1.00 190.32 ? 58  SER A CA    1 
ATOM   383  C C     . SER A 1 61  ? 31.568 -9.577  75.402  1.00 186.26 ? 58  SER A C     1 
ATOM   384  O O     . SER A 1 61  ? 31.877 -8.941  76.410  1.00 186.95 ? 58  SER A O     1 
ATOM   385  C CB    . SER A 1 61  ? 33.929 -10.437 75.409  1.00 190.85 ? 58  SER A CB    1 
ATOM   386  O OG    . SER A 1 61  ? 34.503 -9.142  75.406  1.00 188.07 ? 58  SER A OG    1 
ATOM   387  N N     . SER A 1 62  ? 30.353 -9.559  74.868  1.00 181.15 ? 59  SER A N     1 
ATOM   388  C CA    . SER A 1 62  ? 29.260 -8.767  75.407  1.00 175.25 ? 59  SER A CA    1 
ATOM   389  C C     . SER A 1 62  ? 28.002 -9.075  74.607  1.00 175.70 ? 59  SER A C     1 
ATOM   390  O O     . SER A 1 62  ? 27.880 -8.661  73.453  1.00 172.38 ? 59  SER A O     1 
ATOM   391  C CB    . SER A 1 62  ? 29.584 -7.275  75.326  1.00 166.06 ? 59  SER A CB    1 
ATOM   392  O OG    . SER A 1 62  ? 28.507 -6.496  75.816  1.00 162.17 ? 59  SER A OG    1 
ATOM   393  N N     . PRO A 1 63  ? 27.064 -9.811  75.221  1.00 178.45 ? 60  PRO A N     1 
ATOM   394  C CA    . PRO A 1 63  ? 25.839 -10.293 74.577  1.00 177.24 ? 60  PRO A CA    1 
ATOM   395  C C     . PRO A 1 63  ? 25.242 -9.282  73.606  1.00 168.89 ? 60  PRO A C     1 
ATOM   396  O O     . PRO A 1 63  ? 25.220 -8.083  73.888  1.00 167.36 ? 60  PRO A O     1 
ATOM   397  C CB    . PRO A 1 63  ? 24.898 -10.513 75.760  1.00 180.00 ? 60  PRO A CB    1 
ATOM   398  C CG    . PRO A 1 63  ? 25.809 -10.900 76.872  1.00 181.12 ? 60  PRO A CG    1 
ATOM   399  C CD    . PRO A 1 63  ? 27.097 -10.144 76.657  1.00 180.08 ? 60  PRO A CD    1 
ATOM   400  N N     . PHE A 1 64  ? 24.766 -9.773  72.467  1.00 161.21 ? 61  PHE A N     1 
ATOM   401  C CA    . PHE A 1 64  ? 24.191 -8.912  71.444  1.00 155.23 ? 61  PHE A CA    1 
ATOM   402  C C     . PHE A 1 64  ? 22.693 -8.734  71.669  1.00 151.32 ? 61  PHE A C     1 
ATOM   403  O O     . PHE A 1 64  ? 21.993 -9.691  72.005  1.00 154.71 ? 61  PHE A O     1 
ATOM   404  C CB    . PHE A 1 64  ? 24.455 -9.491  70.053  1.00 153.05 ? 61  PHE A CB    1 
ATOM   405  C CG    . PHE A 1 64  ? 24.434 -8.467  68.958  1.00 147.42 ? 61  PHE A CG    1 
ATOM   406  C CD1   . PHE A 1 64  ? 23.280 -8.234  68.230  1.00 143.67 ? 61  PHE A CD1   1 
ATOM   407  C CD2   . PHE A 1 64  ? 25.569 -7.733  68.659  1.00 143.07 ? 61  PHE A CD2   1 
ATOM   408  C CE1   . PHE A 1 64  ? 23.260 -7.290  67.223  1.00 139.35 ? 61  PHE A CE1   1 
ATOM   409  C CE2   . PHE A 1 64  ? 25.556 -6.788  67.653  1.00 138.24 ? 61  PHE A CE2   1 
ATOM   410  C CZ    . PHE A 1 64  ? 24.399 -6.565  66.936  1.00 137.78 ? 61  PHE A CZ    1 
ATOM   411  N N     . PRO A 1 65  ? 22.198 -7.502  71.486  1.00 142.40 ? 62  PRO A N     1 
ATOM   412  C CA    . PRO A 1 65  ? 20.784 -7.178  71.710  1.00 139.47 ? 62  PRO A CA    1 
ATOM   413  C C     . PRO A 1 65  ? 19.873 -7.739  70.621  1.00 143.55 ? 62  PRO A C     1 
ATOM   414  O O     . PRO A 1 65  ? 19.696 -7.106  69.580  1.00 144.45 ? 62  PRO A O     1 
ATOM   415  C CB    . PRO A 1 65  ? 20.765 -5.649  71.679  1.00 131.22 ? 62  PRO A CB    1 
ATOM   416  C CG    . PRO A 1 65  ? 21.956 -5.259  70.883  1.00 129.75 ? 62  PRO A CG    1 
ATOM   417  C CD    . PRO A 1 65  ? 22.983 -6.335  71.045  1.00 134.23 ? 62  PRO A CD    1 
ATOM   418  N N     . SER A 1 66  ? 19.303 -8.915  70.865  1.00 146.19 ? 63  SER A N     1 
ATOM   419  C CA    . SER A 1 66  ? 18.354 -9.507  69.930  1.00 144.82 ? 63  SER A CA    1 
ATOM   420  C C     . SER A 1 66  ? 17.112 -8.630  69.836  1.00 147.92 ? 63  SER A C     1 
ATOM   421  O O     . SER A 1 66  ? 16.545 -8.239  70.856  1.00 146.18 ? 63  SER A O     1 
ATOM   422  C CB    . SER A 1 66  ? 17.973 -10.923 70.364  1.00 137.13 ? 63  SER A CB    1 
ATOM   423  O OG    . SER A 1 66  ? 17.275 -10.909 71.596  1.00 132.76 ? 63  SER A OG    1 
ATOM   424  N N     . GLU A 1 67  ? 16.704 -8.345  68.601  1.00 149.65 ? 64  GLU A N     1 
ATOM   425  C CA    . GLU A 1 67  ? 15.634 -7.402  68.274  1.00 146.97 ? 64  GLU A CA    1 
ATOM   426  C C     . GLU A 1 67  ? 16.203 -6.403  67.283  1.00 147.67 ? 64  GLU A C     1 
ATOM   427  O O     . GLU A 1 67  ? 15.582 -6.089  66.268  1.00 149.43 ? 64  GLU A O     1 
ATOM   428  C CB    . GLU A 1 67  ? 15.111 -6.666  69.507  1.00 140.77 ? 64  GLU A CB    1 
ATOM   429  C CG    . GLU A 1 67  ? 14.036 -5.637  69.204  1.00 136.92 ? 64  GLU A CG    1 
ATOM   430  C CD    . GLU A 1 67  ? 13.680 -4.799  70.414  1.00 138.17 ? 64  GLU A CD    1 
ATOM   431  O OE1   . GLU A 1 67  ? 14.392 -4.896  71.436  1.00 139.26 ? 64  GLU A OE1   1 
ATOM   432  O OE2   . GLU A 1 67  ? 12.689 -4.042  70.344  1.00 138.23 ? 64  GLU A OE2   1 
ATOM   433  N N     . LEU A 1 68  ? 17.396 -5.907  67.593  1.00 144.87 ? 65  LEU A N     1 
ATOM   434  C CA    . LEU A 1 68  ? 18.150 -5.082  66.666  1.00 144.49 ? 65  LEU A CA    1 
ATOM   435  C C     . LEU A 1 68  ? 18.304 -5.874  65.377  1.00 152.86 ? 65  LEU A C     1 
ATOM   436  O O     . LEU A 1 68  ? 18.346 -5.311  64.284  1.00 154.08 ? 65  LEU A O     1 
ATOM   437  C CB    . LEU A 1 68  ? 19.528 -4.767  67.246  1.00 142.55 ? 65  LEU A CB    1 
ATOM   438  C CG    . LEU A 1 68  ? 20.192 -3.435  66.890  1.00 140.32 ? 65  LEU A CG    1 
ATOM   439  C CD1   . LEU A 1 68  ? 21.700 -3.586  66.961  1.00 139.28 ? 65  LEU A CD1   1 
ATOM   440  C CD2   . LEU A 1 68  ? 19.776 -2.951  65.514  1.00 140.14 ? 65  LEU A CD2   1 
ATOM   441  N N     . LEU A 1 69  ? 18.382 -7.193  65.521  1.00 156.76 ? 66  LEU A N     1 
ATOM   442  C CA    . LEU A 1 69  ? 18.513 -8.096  64.386  1.00 158.86 ? 66  LEU A CA    1 
ATOM   443  C C     . LEU A 1 69  ? 17.223 -8.146  63.577  1.00 161.59 ? 66  LEU A C     1 
ATOM   444  O O     . LEU A 1 69  ? 17.249 -8.113  62.348  1.00 164.45 ? 66  LEU A O     1 
ATOM   445  C CB    . LEU A 1 69  ? 18.875 -9.500  64.873  1.00 160.08 ? 66  LEU A CB    1 
ATOM   446  C CG    . LEU A 1 69  ? 20.147 -9.611  65.716  1.00 158.89 ? 66  LEU A CG    1 
ATOM   447  C CD1   . LEU A 1 69  ? 20.140 -10.887 66.543  1.00 160.95 ? 66  LEU A CD1   1 
ATOM   448  C CD2   . LEU A 1 69  ? 21.385 -9.538  64.836  1.00 158.44 ? 66  LEU A CD2   1 
ATOM   449  N N     . ASP A 1 70  ? 16.095 -8.228  64.276  1.00 160.15 ? 67  ASP A N     1 
ATOM   450  C CA    . ASP A 1 70  ? 14.791 -8.284  63.626  1.00 161.14 ? 67  ASP A CA    1 
ATOM   451  C C     . ASP A 1 70  ? 14.529 -7.017  62.821  1.00 160.33 ? 67  ASP A C     1 
ATOM   452  O O     . ASP A 1 70  ? 14.075 -7.079  61.678  1.00 160.48 ? 67  ASP A O     1 
ATOM   453  C CB    . ASP A 1 70  ? 13.678 -8.487  64.658  1.00 162.02 ? 67  ASP A CB    1 
ATOM   454  C CG    . ASP A 1 70  ? 13.882 -9.733  65.498  1.00 167.73 ? 67  ASP A CG    1 
ATOM   455  O OD1   . ASP A 1 70  ? 14.974 -9.886  66.086  1.00 169.76 ? 67  ASP A OD1   1 
ATOM   456  O OD2   . ASP A 1 70  ? 12.945 -10.555 65.580  1.00 169.67 ? 67  ASP A OD2   1 
ATOM   457  N N     . LEU A 1 71  ? 14.819 -5.868  63.423  1.00 160.38 ? 68  LEU A N     1 
ATOM   458  C CA    . LEU A 1 71  ? 14.623 -4.586  62.755  1.00 158.59 ? 68  LEU A CA    1 
ATOM   459  C C     . LEU A 1 71  ? 15.783 -4.258  61.819  1.00 153.79 ? 68  LEU A C     1 
ATOM   460  O O     . LEU A 1 71  ? 15.839 -3.172  61.244  1.00 151.91 ? 68  LEU A O     1 
ATOM   461  C CB    . LEU A 1 71  ? 14.428 -3.463  63.777  1.00 162.57 ? 68  LEU A CB    1 
ATOM   462  C CG    . LEU A 1 71  ? 13.089 -3.437  64.519  1.00 164.43 ? 68  LEU A CG    1 
ATOM   463  C CD1   . LEU A 1 71  ? 13.016 -4.552  65.550  1.00 164.47 ? 68  LEU A CD1   1 
ATOM   464  C CD2   . LEU A 1 71  ? 12.871 -2.086  65.179  1.00 162.60 ? 68  LEU A CD2   1 
ATOM   465  N N     . CYS A 1 72  ? 16.707 -5.203  61.677  1.00 153.02 ? 69  CYS A N     1 
ATOM   466  C CA    . CYS A 1 72  ? 17.809 -5.065  60.731  1.00 150.14 ? 69  CYS A CA    1 
ATOM   467  C C     . CYS A 1 72  ? 17.736 -6.156  59.671  1.00 151.53 ? 69  CYS A C     1 
ATOM   468  O O     . CYS A 1 72  ? 18.497 -6.151  58.706  1.00 148.38 ? 69  CYS A O     1 
ATOM   469  C CB    . CYS A 1 72  ? 19.159 -5.114  61.448  1.00 151.50 ? 69  CYS A CB    1 
ATOM   470  S SG    . CYS A 1 72  ? 19.675 -3.541  62.174  1.00 179.86 ? 69  CYS A SG    1 
ATOM   471  N N     . GLY A 1 73  ? 16.815 -7.094  59.860  1.00 156.83 ? 70  GLY A N     1 
ATOM   472  C CA    . GLY A 1 73  ? 16.604 -8.156  58.895  1.00 158.67 ? 70  GLY A CA    1 
ATOM   473  C C     . GLY A 1 73  ? 15.443 -7.822  57.981  1.00 158.32 ? 70  GLY A C     1 
ATOM   474  O O     . GLY A 1 73  ? 15.426 -8.205  56.812  1.00 155.40 ? 70  GLY A O     1 
ATOM   475  N N     . ARG A 1 74  ? 14.471 -7.097  58.522  1.00 158.73 ? 71  ARG A N     1 
ATOM   476  C CA    . ARG A 1 74  ? 13.293 -6.698  57.763  1.00 156.65 ? 71  ARG A CA    1 
ATOM   477  C C     . ARG A 1 74  ? 13.550 -5.410  56.989  1.00 151.14 ? 71  ARG A C     1 
ATOM   478  O O     . ARG A 1 74  ? 12.721 -4.979  56.186  1.00 145.91 ? 71  ARG A O     1 
ATOM   479  C CB    . ARG A 1 74  ? 12.091 -6.534  58.696  1.00 156.57 ? 71  ARG A CB    1 
ATOM   480  C CG    . ARG A 1 74  ? 11.715 -7.809  59.433  1.00 160.61 ? 71  ARG A CG    1 
ATOM   481  C CD    . ARG A 1 74  ? 10.599 -7.574  60.437  1.00 161.53 ? 71  ARG A CD    1 
ATOM   482  N NE    . ARG A 1 74  ? 10.997 -6.653  61.497  1.00 160.54 ? 71  ARG A NE    1 
ATOM   483  C CZ    . ARG A 1 74  ? 10.334 -6.500  62.638  1.00 161.15 ? 71  ARG A CZ    1 
ATOM   484  N NH1   . ARG A 1 74  ? 9.240  -7.211  62.872  1.00 160.46 ? 71  ARG A NH1   1 
ATOM   485  N NH2   . ARG A 1 74  ? 10.766 -5.639  63.549  1.00 162.50 ? 71  ARG A NH2   1 
ATOM   486  N N     . GLN A 1 75  ? 14.705 -4.799  57.236  1.00 152.63 ? 72  GLN A N     1 
ATOM   487  C CA    . GLN A 1 75  ? 15.104 -3.591  56.526  1.00 153.52 ? 72  GLN A CA    1 
ATOM   488  C C     . GLN A 1 75  ? 16.412 -3.842  55.785  1.00 148.81 ? 72  GLN A C     1 
ATOM   489  O O     . GLN A 1 75  ? 17.064 -2.907  55.319  1.00 141.38 ? 72  GLN A O     1 
ATOM   490  C CB    . GLN A 1 75  ? 15.282 -2.427  57.503  1.00 158.10 ? 72  GLN A CB    1 
ATOM   491  C CG    . GLN A 1 75  ? 14.401 -2.506  58.741  1.00 163.98 ? 72  GLN A CG    1 
ATOM   492  C CD    . GLN A 1 75  ? 12.921 -2.448  58.420  1.00 168.50 ? 72  GLN A CD    1 
ATOM   493  O OE1   . GLN A 1 75  ? 12.099 -3.023  59.132  1.00 171.66 ? 72  GLN A OE1   1 
ATOM   494  N NE2   . GLN A 1 75  ? 12.574 -1.752  57.343  1.00 167.25 ? 72  GLN A NE2   1 
ATOM   495  N N     . ASN A 1 76  ? 16.787 -5.113  55.683  1.00 151.82 ? 73  ASN A N     1 
ATOM   496  C CA    . ASN A 1 76  ? 18.056 -5.507  55.075  1.00 150.20 ? 73  ASN A CA    1 
ATOM   497  C C     . ASN A 1 76  ? 19.246 -4.679  55.551  1.00 149.91 ? 73  ASN A C     1 
ATOM   498  O O     . ASN A 1 76  ? 19.907 -4.003  54.762  1.00 154.26 ? 73  ASN A O     1 
ATOM   499  C CB    . ASN A 1 76  ? 17.967 -5.496  53.547  1.00 145.48 ? 73  ASN A CB    1 
ATOM   500  C CG    . ASN A 1 76  ? 17.447 -6.805  52.987  1.00 150.15 ? 73  ASN A CG    1 
ATOM   501  O OD1   . ASN A 1 76  ? 16.317 -7.209  53.264  1.00 154.16 ? 73  ASN A OD1   1 
ATOM   502  N ND2   . ASN A 1 76  ? 18.273 -7.478  52.193  1.00 147.53 ? 73  ASN A ND2   1 
ATOM   503  N N     . ILE A 1 77  ? 19.507 -4.739  56.852  1.00 140.39 ? 74  ILE A N     1 
ATOM   504  C CA    . ILE A 1 77  ? 20.664 -4.084  57.446  1.00 131.38 ? 74  ILE A CA    1 
ATOM   505  C C     . ILE A 1 77  ? 21.570 -5.133  58.083  1.00 127.92 ? 74  ILE A C     1 
ATOM   506  O O     . ILE A 1 77  ? 21.170 -5.813  59.029  1.00 127.49 ? 74  ILE A O     1 
ATOM   507  C CB    . ILE A 1 77  ? 20.246 -3.057  58.512  1.00 123.16 ? 74  ILE A CB    1 
ATOM   508  C CG1   . ILE A 1 77  ? 19.324 -2.000  57.899  1.00 118.14 ? 74  ILE A CG1   1 
ATOM   509  C CG2   . ILE A 1 77  ? 21.472 -2.406  59.134  1.00 117.07 ? 74  ILE A CG2   1 
ATOM   510  C CD1   . ILE A 1 77  ? 18.879 -0.937  58.878  1.00 112.89 ? 74  ILE A CD1   1 
ATOM   511  N N     . PRO A 1 78  ? 22.798 -5.267  57.562  1.00 123.33 ? 75  PRO A N     1 
ATOM   512  C CA    . PRO A 1 78  ? 23.734 -6.306  58.006  1.00 117.57 ? 75  PRO A CA    1 
ATOM   513  C C     . PRO A 1 78  ? 24.332 -6.012  59.378  1.00 113.88 ? 75  PRO A C     1 
ATOM   514  O O     . PRO A 1 78  ? 24.450 -4.851  59.770  1.00 100.86 ? 75  PRO A O     1 
ATOM   515  C CB    . PRO A 1 78  ? 24.826 -6.273  56.937  1.00 120.61 ? 75  PRO A CB    1 
ATOM   516  C CG    . PRO A 1 78  ? 24.781 -4.897  56.380  1.00 126.60 ? 75  PRO A CG    1 
ATOM   517  C CD    . PRO A 1 78  ? 23.383 -4.375  56.545  1.00 125.50 ? 75  PRO A CD    1 
ATOM   518  N N     . VAL A 1 79  ? 24.704 -7.068  60.093  1.00 117.32 ? 76  VAL A N     1 
ATOM   519  C CA    . VAL A 1 79  ? 25.299 -6.936  61.417  1.00 115.55 ? 76  VAL A CA    1 
ATOM   520  C C     . VAL A 1 79  ? 26.470 -7.898  61.589  1.00 120.82 ? 76  VAL A C     1 
ATOM   521  O O     . VAL A 1 79  ? 26.373 -9.076  61.245  1.00 119.01 ? 76  VAL A O     1 
ATOM   522  C CB    . VAL A 1 79  ? 24.264 -7.193  62.526  1.00 112.52 ? 76  VAL A CB    1 
ATOM   523  C CG1   . VAL A 1 79  ? 23.388 -8.383  62.168  1.00 115.22 ? 76  VAL A CG1   1 
ATOM   524  C CG2   . VAL A 1 79  ? 24.961 -7.415  63.858  1.00 108.16 ? 76  VAL A CG2   1 
ATOM   525  N N     . ARG A 1 80  ? 27.577 -7.388  62.121  1.00 125.27 ? 77  ARG A N     1 
ATOM   526  C CA    . ARG A 1 80  ? 28.775 -8.195  62.323  1.00 132.66 ? 77  ARG A CA    1 
ATOM   527  C C     . ARG A 1 80  ? 29.414 -7.909  63.678  1.00 137.40 ? 77  ARG A C     1 
ATOM   528  O O     . ARG A 1 80  ? 29.428 -6.769  64.140  1.00 139.90 ? 77  ARG A O     1 
ATOM   529  C CB    . ARG A 1 80  ? 29.785 -7.937  61.204  1.00 133.25 ? 77  ARG A CB    1 
ATOM   530  C CG    . ARG A 1 80  ? 29.281 -8.299  59.818  1.00 129.75 ? 77  ARG A CG    1 
ATOM   531  C CD    . ARG A 1 80  ? 30.182 -7.718  58.743  1.00 124.09 ? 77  ARG A CD    1 
ATOM   532  N NE    . ARG A 1 80  ? 31.523 -8.293  58.771  1.00 123.91 ? 77  ARG A NE    1 
ATOM   533  C CZ    . ARG A 1 80  ? 32.552 -7.812  58.081  1.00 122.49 ? 77  ARG A CZ    1 
ATOM   534  N NH1   . ARG A 1 80  ? 32.395 -6.743  57.313  1.00 119.79 ? 77  ARG A NH1   1 
ATOM   535  N NH2   . ARG A 1 80  ? 33.739 -8.396  58.163  1.00 122.56 ? 77  ARG A NH2   1 
ATOM   536  N N     . LEU A 1 81  ? 29.946 -8.951  64.308  1.00 139.40 ? 78  LEU A N     1 
ATOM   537  C CA    . LEU A 1 81  ? 30.568 -8.813  65.620  1.00 141.72 ? 78  LEU A CA    1 
ATOM   538  C C     . LEU A 1 81  ? 32.029 -8.386  65.522  1.00 147.38 ? 78  LEU A C     1 
ATOM   539  O O     . LEU A 1 81  ? 32.795 -8.929  64.727  1.00 149.81 ? 78  LEU A O     1 
ATOM   540  C CB    . LEU A 1 81  ? 30.462 -10.122 66.407  1.00 142.36 ? 78  LEU A CB    1 
ATOM   541  C CG    . LEU A 1 81  ? 29.061 -10.537 66.858  1.00 141.08 ? 78  LEU A CG    1 
ATOM   542  C CD1   . LEU A 1 81  ? 29.114 -11.843 67.635  1.00 141.87 ? 78  LEU A CD1   1 
ATOM   543  C CD2   . LEU A 1 81  ? 28.425 -9.438  67.694  1.00 137.81 ? 78  LEU A CD2   1 
ATOM   544  N N     . ILE A 1 82  ? 32.403 -7.405  66.335  1.00 154.12 ? 79  ILE A N     1 
ATOM   545  C CA    . ILE A 1 82  ? 33.789 -6.976  66.440  1.00 164.98 ? 79  ILE A CA    1 
ATOM   546  C C     . ILE A 1 82  ? 34.363 -7.513  67.746  1.00 177.22 ? 79  ILE A C     1 
ATOM   547  O O     . ILE A 1 82  ? 33.616 -7.856  68.660  1.00 181.64 ? 79  ILE A O     1 
ATOM   548  C CB    . ILE A 1 82  ? 33.905 -5.441  66.434  1.00 165.85 ? 79  ILE A CB    1 
ATOM   549  C CG1   . ILE A 1 82  ? 32.962 -4.833  65.394  1.00 168.31 ? 79  ILE A CG1   1 
ATOM   550  C CG2   . ILE A 1 82  ? 35.340 -5.014  66.167  1.00 164.41 ? 79  ILE A CG2   1 
ATOM   551  C CD1   . ILE A 1 82  ? 33.390 -5.080  63.967  1.00 171.26 ? 79  ILE A CD1   1 
ATOM   552  N N     . ASP A 1 83  ? 35.686 -7.591  67.833  1.00 184.59 ? 80  ASP A N     1 
ATOM   553  C CA    . ASP A 1 83  ? 36.340 -8.047  69.055  1.00 191.32 ? 80  ASP A CA    1 
ATOM   554  C C     . ASP A 1 83  ? 36.568 -6.894  70.033  1.00 198.59 ? 80  ASP A C     1 
ATOM   555  O O     . ASP A 1 83  ? 36.841 -5.768  69.622  1.00 199.01 ? 80  ASP A O     1 
ATOM   556  C CB    . ASP A 1 83  ? 37.657 -8.767  68.741  1.00 188.54 ? 80  ASP A CB    1 
ATOM   557  C CG    . ASP A 1 83  ? 38.502 -8.032  67.714  1.00 184.02 ? 80  ASP A CG    1 
ATOM   558  O OD1   . ASP A 1 83  ? 37.984 -7.110  67.050  1.00 180.33 ? 80  ASP A OD1   1 
ATOM   559  O OD2   . ASP A 1 83  ? 39.690 -8.386  67.567  1.00 183.84 ? 80  ASP A OD2   1 
ATOM   560  N N     . SER A 1 84  ? 36.449 -7.184  71.327  1.00 203.39 ? 81  SER A N     1 
ATOM   561  C CA    . SER A 1 84  ? 36.570 -6.162  72.365  1.00 202.38 ? 81  SER A CA    1 
ATOM   562  C C     . SER A 1 84  ? 37.945 -5.502  72.368  1.00 205.13 ? 81  SER A C     1 
ATOM   563  O O     . SER A 1 84  ? 38.143 -4.465  73.003  1.00 205.77 ? 81  SER A O     1 
ATOM   564  C CB    . SER A 1 84  ? 36.264 -6.751  73.746  1.00 198.57 ? 81  SER A CB    1 
ATOM   565  O OG    . SER A 1 84  ? 34.879 -7.014  73.895  1.00 194.99 ? 81  SER A OG    1 
ATOM   566  N N     . SER A 1 85  ? 38.892 -6.108  71.661  1.00 205.58 ? 82  SER A N     1 
ATOM   567  C CA    . SER A 1 85  ? 40.225 -5.537  71.529  1.00 202.02 ? 82  SER A CA    1 
ATOM   568  C C     . SER A 1 85  ? 40.230 -4.456  70.454  1.00 195.57 ? 82  SER A C     1 
ATOM   569  O O     . SER A 1 85  ? 41.044 -3.534  70.489  1.00 199.23 ? 82  SER A O     1 
ATOM   570  C CB    . SER A 1 85  ? 41.247 -6.625  71.197  1.00 204.69 ? 82  SER A CB    1 
ATOM   571  O OG    . SER A 1 85  ? 40.880 -7.328  70.023  1.00 206.05 ? 82  SER A OG    1 
ATOM   572  N N     . ILE A 1 86  ? 39.312 -4.576  69.500  1.00 183.03 ? 83  ILE A N     1 
ATOM   573  C CA    . ILE A 1 86  ? 39.174 -3.590  68.434  1.00 167.66 ? 83  ILE A CA    1 
ATOM   574  C C     . ILE A 1 86  ? 37.995 -2.655  68.700  1.00 168.18 ? 83  ILE A C     1 
ATOM   575  O O     . ILE A 1 86  ? 38.025 -1.481  68.329  1.00 166.40 ? 83  ILE A O     1 
ATOM   576  C CB    . ILE A 1 86  ? 39.024 -4.257  67.049  1.00 152.06 ? 83  ILE A CB    1 
ATOM   577  C CG1   . ILE A 1 86  ? 40.394 -4.659  66.497  1.00 145.43 ? 83  ILE A CG1   1 
ATOM   578  C CG2   . ILE A 1 86  ? 38.347 -3.314  66.070  1.00 147.63 ? 83  ILE A CG2   1 
ATOM   579  C CD1   . ILE A 1 86  ? 41.149 -5.647  67.357  1.00 144.85 ? 83  ILE A CD1   1 
ATOM   580  N N     . VAL A 1 87  ? 36.962 -3.181  69.351  1.00 169.02 ? 84  VAL A N     1 
ATOM   581  C CA    . VAL A 1 87  ? 35.820 -2.370  69.756  1.00 165.00 ? 84  VAL A CA    1 
ATOM   582  C C     . VAL A 1 87  ? 36.295 -1.208  70.620  1.00 166.12 ? 84  VAL A C     1 
ATOM   583  O O     . VAL A 1 87  ? 35.752 -0.105  70.553  1.00 167.96 ? 84  VAL A O     1 
ATOM   584  C CB    . VAL A 1 87  ? 34.787 -3.199  70.545  1.00 159.80 ? 84  VAL A CB    1 
ATOM   585  C CG1   . VAL A 1 87  ? 33.741 -2.291  71.177  1.00 154.38 ? 84  VAL A CG1   1 
ATOM   586  C CG2   . VAL A 1 87  ? 34.129 -4.227  69.641  1.00 159.35 ? 84  VAL A CG2   1 
ATOM   587  N N     . ASN A 1 88  ? 37.318 -1.466  71.428  1.00 162.92 ? 85  ASN A N     1 
ATOM   588  C CA    . ASN A 1 88  ? 37.900 -0.441  72.284  1.00 154.85 ? 85  ASN A CA    1 
ATOM   589  C C     . ASN A 1 88  ? 39.162 0.153   71.668  1.00 155.69 ? 85  ASN A C     1 
ATOM   590  O O     . ASN A 1 88  ? 39.729 1.114   72.187  1.00 157.83 ? 85  ASN A O     1 
ATOM   591  C CB    . ASN A 1 88  ? 38.193 -1.009  73.672  1.00 149.78 ? 85  ASN A CB    1 
ATOM   592  C CG    . ASN A 1 88  ? 36.946 -1.528  74.360  1.00 145.97 ? 85  ASN A CG    1 
ATOM   593  O OD1   . ASN A 1 88  ? 37.025 -2.302  75.314  1.00 144.87 ? 85  ASN A OD1   1 
ATOM   594  N ND2   . ASN A 1 88  ? 35.784 -1.107  73.874  1.00 143.28 ? 85  ASN A ND2   1 
ATOM   595  N N     . GLN A 1 89  ? 39.594 -0.431  70.555  1.00 155.04 ? 86  GLN A N     1 
ATOM   596  C CA    . GLN A 1 89  ? 40.704 0.107   69.780  1.00 156.92 ? 86  GLN A CA    1 
ATOM   597  C C     . GLN A 1 89  ? 40.287 1.436   69.159  1.00 160.82 ? 86  GLN A C     1 
ATOM   598  O O     . GLN A 1 89  ? 41.118 2.184   68.643  1.00 162.94 ? 86  GLN A O     1 
ATOM   599  C CB    . GLN A 1 89  ? 41.108 -0.887  68.687  1.00 155.31 ? 86  GLN A CB    1 
ATOM   600  C CG    . GLN A 1 89  ? 42.132 -0.375  67.685  1.00 149.18 ? 86  GLN A CG    1 
ATOM   601  C CD    . GLN A 1 89  ? 43.560 -0.530  68.167  1.00 145.31 ? 86  GLN A CD    1 
ATOM   602  O OE1   . GLN A 1 89  ? 43.862 -0.304  69.338  1.00 144.69 ? 86  GLN A OE1   1 
ATOM   603  N NE2   . GLN A 1 89  ? 44.450 -0.917  67.260  1.00 141.80 ? 86  GLN A NE2   1 
ATOM   604  N N     . LEU A 1 90  ? 38.990 1.726   69.220  1.00 160.75 ? 87  LEU A N     1 
ATOM   605  C CA    . LEU A 1 90  ? 38.439 2.935   68.616  1.00 156.75 ? 87  LEU A CA    1 
ATOM   606  C C     . LEU A 1 90  ? 37.569 3.726   69.592  1.00 160.48 ? 87  LEU A C     1 
ATOM   607  O O     . LEU A 1 90  ? 36.884 4.667   69.193  1.00 157.58 ? 87  LEU A O     1 
ATOM   608  C CB    . LEU A 1 90  ? 37.606 2.581   67.378  1.00 149.82 ? 87  LEU A CB    1 
ATOM   609  C CG    . LEU A 1 90  ? 38.304 2.146   66.084  1.00 144.43 ? 87  LEU A CG    1 
ATOM   610  C CD1   . LEU A 1 90  ? 39.275 3.215   65.601  1.00 142.72 ? 87  LEU A CD1   1 
ATOM   611  C CD2   . LEU A 1 90  ? 39.008 0.807   66.249  1.00 142.93 ? 87  LEU A CD2   1 
ATOM   612  N N     . PHE A 1 91  ? 37.595 3.348   70.867  1.00 168.84 ? 88  PHE A N     1 
ATOM   613  C CA    . PHE A 1 91  ? 36.685 3.940   71.848  1.00 175.69 ? 88  PHE A CA    1 
ATOM   614  C C     . PHE A 1 91  ? 37.356 4.419   73.134  1.00 180.21 ? 88  PHE A C     1 
ATOM   615  O O     . PHE A 1 91  ? 38.565 4.269   73.318  1.00 176.75 ? 88  PHE A O     1 
ATOM   616  C CB    . PHE A 1 91  ? 35.568 2.952   72.196  1.00 178.33 ? 88  PHE A CB    1 
ATOM   617  C CG    . PHE A 1 91  ? 34.411 2.982   71.239  1.00 178.33 ? 88  PHE A CG    1 
ATOM   618  C CD1   . PHE A 1 91  ? 33.158 3.392   71.663  1.00 176.81 ? 88  PHE A CD1   1 
ATOM   619  C CD2   . PHE A 1 91  ? 34.576 2.605   69.918  1.00 177.75 ? 88  PHE A CD2   1 
ATOM   620  C CE1   . PHE A 1 91  ? 32.092 3.421   70.787  1.00 174.54 ? 88  PHE A CE1   1 
ATOM   621  C CE2   . PHE A 1 91  ? 33.513 2.633   69.037  1.00 175.63 ? 88  PHE A CE2   1 
ATOM   622  C CZ    . PHE A 1 91  ? 32.269 3.041   69.472  1.00 173.90 ? 88  PHE A CZ    1 
ATOM   623  N N     . LYS A 1 92  ? 36.545 4.997   74.016  1.00 189.17 ? 89  LYS A N     1 
ATOM   624  C CA    . LYS A 1 92  ? 36.994 5.457   75.325  1.00 198.16 ? 89  LYS A CA    1 
ATOM   625  C C     . LYS A 1 92  ? 35.790 5.889   76.171  1.00 205.70 ? 89  LYS A C     1 
ATOM   626  O O     . LYS A 1 92  ? 35.046 6.793   75.795  1.00 205.64 ? 89  LYS A O     1 
ATOM   627  C CB    . LYS A 1 92  ? 38.015 6.596   75.187  1.00 197.38 ? 89  LYS A CB    1 
ATOM   628  C CG    . LYS A 1 92  ? 37.416 7.988   75.012  1.00 196.68 ? 89  LYS A CG    1 
ATOM   629  C CD    . LYS A 1 92  ? 36.513 8.077   73.790  1.00 197.06 ? 89  LYS A CD    1 
ATOM   630  C CE    . LYS A 1 92  ? 35.423 9.120   73.998  1.00 195.73 ? 89  LYS A CE    1 
ATOM   631  N NZ    . LYS A 1 92  ? 34.474 9.188   72.852  1.00 195.30 ? 89  LYS A NZ    1 
ATOM   632  N N     . GLY A 1 93  ? 35.584 5.227   77.305  1.00 212.30 ? 90  GLY A N     1 
ATOM   633  C CA    . GLY A 1 93  ? 34.455 5.550   78.161  1.00 215.25 ? 90  GLY A CA    1 
ATOM   634  C C     . GLY A 1 93  ? 34.271 4.596   79.326  1.00 218.72 ? 90  GLY A C     1 
ATOM   635  O O     . GLY A 1 93  ? 35.071 4.630   80.260  1.00 218.09 ? 90  GLY A O     1 
ATOM   636  N N     . GLU A 1 94  ? 33.243 3.743   79.304  1.00 222.94 ? 91  GLU A N     1 
ATOM   637  C CA    . GLU A 1 94  ? 32.255 3.597   78.219  1.00 225.87 ? 91  GLU A CA    1 
ATOM   638  C C     . GLU A 1 94  ? 32.691 4.024   76.809  1.00 226.40 ? 91  GLU A C     1 
ATOM   639  O O     . GLU A 1 94  ? 32.299 5.097   76.351  1.00 225.67 ? 91  GLU A O     1 
ATOM   640  C CB    . GLU A 1 94  ? 30.929 4.269   78.609  1.00 225.52 ? 91  GLU A CB    1 
ATOM   641  C CG    . GLU A 1 94  ? 31.054 5.716   79.067  1.00 225.12 ? 91  GLU A CG    1 
ATOM   642  C CD    . GLU A 1 94  ? 30.698 6.707   77.976  1.00 224.18 ? 91  GLU A CD    1 
ATOM   643  O OE1   . GLU A 1 94  ? 29.675 6.493   77.292  1.00 224.32 ? 91  GLU A OE1   1 
ATOM   644  O OE2   . GLU A 1 94  ? 31.434 7.701   77.808  1.00 223.12 ? 91  GLU A OE2   1 
ATOM   645  N N     . ARG A 1 95  ? 33.473 3.204   76.100  1.00 225.95 ? 92  ARG A N     1 
ATOM   646  C CA    . ARG A 1 95  ? 33.894 1.844   76.479  1.00 224.97 ? 92  ARG A CA    1 
ATOM   647  C C     . ARG A 1 95  ? 32.813 0.782   76.276  1.00 220.79 ? 92  ARG A C     1 
ATOM   648  O O     . ARG A 1 95  ? 33.061 -0.240  75.637  1.00 222.18 ? 92  ARG A O     1 
ATOM   649  C CB    . ARG A 1 95  ? 34.498 1.765   77.888  1.00 225.29 ? 92  ARG A CB    1 
ATOM   650  C CG    . ARG A 1 95  ? 35.043 0.397   78.260  1.00 224.73 ? 92  ARG A CG    1 
ATOM   651  C CD    . ARG A 1 95  ? 36.383 0.142   77.592  1.00 223.45 ? 92  ARG A CD    1 
ATOM   652  N NE    . ARG A 1 95  ? 37.315 1.243   77.817  1.00 221.29 ? 92  ARG A NE    1 
ATOM   653  C CZ    . ARG A 1 95  ? 37.585 2.188   76.922  1.00 219.13 ? 92  ARG A CZ    1 
ATOM   654  N NH1   . ARG A 1 95  ? 37.000 2.164   75.733  1.00 219.65 ? 92  ARG A NH1   1 
ATOM   655  N NH2   . ARG A 1 95  ? 38.445 3.155   77.215  1.00 216.43 ? 92  ARG A NH2   1 
ATOM   656  N N     . LYS A 1 96  ? 31.620 1.015   76.813  1.00 213.65 ? 93  LYS A N     1 
ATOM   657  C CA    . LYS A 1 96  ? 30.530 0.070   76.609  1.00 205.04 ? 93  LYS A CA    1 
ATOM   658  C C     . LYS A 1 96  ? 29.379 0.648   75.787  1.00 197.92 ? 93  LYS A C     1 
ATOM   659  O O     . LYS A 1 96  ? 28.220 0.278   75.979  1.00 200.97 ? 93  LYS A O     1 
ATOM   660  C CB    . LYS A 1 96  ? 30.023 -0.510  77.934  1.00 199.75 ? 93  LYS A CB    1 
ATOM   661  C CG    . LYS A 1 96  ? 29.090 0.389   78.720  1.00 190.88 ? 93  LYS A CG    1 
ATOM   662  C CD    . LYS A 1 96  ? 27.968 -0.435  79.331  1.00 184.81 ? 93  LYS A CD    1 
ATOM   663  C CE    . LYS A 1 96  ? 28.481 -1.786  79.807  1.00 182.01 ? 93  LYS A CE    1 
ATOM   664  N NZ    . LYS A 1 96  ? 27.371 -2.737  80.093  1.00 179.57 ? 93  LYS A NZ    1 
ATOM   665  N N     . ALA A 1 97  ? 29.706 1.554   74.869  1.00 185.02 ? 94  ALA A N     1 
ATOM   666  C CA    . ALA A 1 97  ? 28.731 2.011   73.891  1.00 172.42 ? 94  ALA A CA    1 
ATOM   667  C C     . ALA A 1 97  ? 28.145 0.757   73.264  1.00 168.85 ? 94  ALA A C     1 
ATOM   668  O O     . ALA A 1 97  ? 26.966 0.718   72.903  1.00 167.00 ? 94  ALA A O     1 
ATOM   669  C CB    . ALA A 1 97  ? 29.396 2.881   72.836  1.00 167.27 ? 94  ALA A CB    1 
ATOM   670  N N     . LYS A 1 98  ? 28.991 -0.266  73.149  1.00 168.81 ? 95  LYS A N     1 
ATOM   671  C CA    . LYS A 1 98  ? 28.579 -1.599  72.717  1.00 168.56 ? 95  LYS A CA    1 
ATOM   672  C C     . LYS A 1 98  ? 28.015 -1.659  71.297  1.00 164.29 ? 95  LYS A C     1 
ATOM   673  O O     . LYS A 1 98  ? 28.646 -2.198  70.386  1.00 161.35 ? 95  LYS A O     1 
ATOM   674  C CB    . LYS A 1 98  ? 27.566 -2.192  73.701  1.00 171.17 ? 95  LYS A CB    1 
ATOM   675  C CG    . LYS A 1 98  ? 28.123 -3.267  74.627  1.00 176.91 ? 95  LYS A CG    1 
ATOM   676  C CD    . LYS A 1 98  ? 29.371 -2.809  75.372  1.00 180.54 ? 95  LYS A CD    1 
ATOM   677  C CE    . LYS A 1 98  ? 29.792 -3.829  76.412  1.00 185.62 ? 95  LYS A CE    1 
ATOM   678  N NZ    . LYS A 1 98  ? 31.047 -3.428  77.091  1.00 187.32 ? 95  LYS A NZ    1 
ATOM   679  N N     . THR A 1 99  ? 26.817 -1.118  71.119  1.00 164.14 ? 96  THR A N     1 
ATOM   680  C CA    . THR A 1 99  ? 26.094 -1.264  69.861  1.00 163.60 ? 96  THR A CA    1 
ATOM   681  C C     . THR A 1 99  ? 26.103 0.015   69.030  1.00 158.64 ? 96  THR A C     1 
ATOM   682  O O     . THR A 1 99  ? 25.560 1.040   69.440  1.00 160.00 ? 96  THR A O     1 
ATOM   683  C CB    . THR A 1 99  ? 24.641 -1.693  70.112  1.00 167.59 ? 96  THR A CB    1 
ATOM   684  O OG1   . THR A 1 99  ? 24.608 -2.693  71.139  1.00 171.28 ? 96  THR A OG1   1 
ATOM   685  C CG2   . THR A 1 99  ? 24.035 -2.258  68.848  1.00 169.48 ? 96  THR A CG2   1 
ATOM   686  N N     . PHE A 1 100 ? 26.725 -0.057  67.857  1.00 151.99 ? 97  PHE A N     1 
ATOM   687  C CA    . PHE A 1 100 ? 26.807 1.083   66.953  1.00 145.77 ? 97  PHE A CA    1 
ATOM   688  C C     . PHE A 1 100 ? 26.621 0.648   65.502  1.00 144.12 ? 97  PHE A C     1 
ATOM   689  O O     . PHE A 1 100 ? 26.367 -0.524  65.226  1.00 150.09 ? 97  PHE A O     1 
ATOM   690  C CB    . PHE A 1 100 ? 28.145 1.807   67.122  1.00 144.85 ? 97  PHE A CB    1 
ATOM   691  C CG    . PHE A 1 100 ? 29.342 0.933   66.880  1.00 146.31 ? 97  PHE A CG    1 
ATOM   692  C CD1   . PHE A 1 100 ? 29.751 0.015   67.833  1.00 150.27 ? 97  PHE A CD1   1 
ATOM   693  C CD2   . PHE A 1 100 ? 30.062 1.033   65.701  1.00 145.71 ? 97  PHE A CD2   1 
ATOM   694  C CE1   . PHE A 1 100 ? 30.851 -0.790  67.614  1.00 154.19 ? 97  PHE A CE1   1 
ATOM   695  C CE2   . PHE A 1 100 ? 31.165 0.231   65.476  1.00 149.20 ? 97  PHE A CE2   1 
ATOM   696  C CZ    . PHE A 1 100 ? 31.559 -0.682  66.434  1.00 154.24 ? 97  PHE A CZ    1 
ATOM   697  N N     . GLY A 1 101 ? 26.746 1.595   64.579  1.00 134.59 ? 98  GLY A N     1 
ATOM   698  C CA    . GLY A 1 101 ? 26.587 1.301   63.167  1.00 128.43 ? 98  GLY A CA    1 
ATOM   699  C C     . GLY A 1 101 ? 26.536 2.546   62.305  1.00 121.95 ? 98  GLY A C     1 
ATOM   700  O O     . GLY A 1 101 ? 25.935 3.552   62.684  1.00 123.46 ? 98  GLY A O     1 
ATOM   701  N N     . ILE A 1 102 ? 27.169 2.475   61.139  1.00 116.43 ? 99  ILE A N     1 
ATOM   702  C CA    . ILE A 1 102 ? 27.200 3.595   60.207  1.00 108.69 ? 99  ILE A CA    1 
ATOM   703  C C     . ILE A 1 102 ? 25.826 3.821   59.586  1.00 104.00 ? 99  ILE A C     1 
ATOM   704  O O     . ILE A 1 102 ? 25.093 2.868   59.321  1.00 103.02 ? 99  ILE A O     1 
ATOM   705  C CB    . ILE A 1 102 ? 28.222 3.355   59.081  1.00 112.78 ? 99  ILE A CB    1 
ATOM   706  C CG1   . ILE A 1 102 ? 29.503 2.736   59.644  1.00 111.05 ? 99  ILE A CG1   1 
ATOM   707  C CG2   . ILE A 1 102 ? 28.522 4.653   58.344  1.00 113.87 ? 99  ILE A CG2   1 
ATOM   708  C CD1   . ILE A 1 102 ? 30.536 2.413   58.591  1.00 108.81 ? 99  ILE A CD1   1 
ATOM   709  N N     . ALA A 1 103 ? 25.484 5.084   59.354  1.00 106.62 ? 100 ALA A N     1 
ATOM   710  C CA    . ALA A 1 103 ? 24.199 5.437   58.760  1.00 109.34 ? 100 ALA A CA    1 
ATOM   711  C C     . ALA A 1 103 ? 24.348 6.569   57.747  1.00 110.07 ? 100 ALA A C     1 
ATOM   712  O O     . ALA A 1 103 ? 25.373 7.249   57.709  1.00 110.16 ? 100 ALA A O     1 
ATOM   713  C CB    . ALA A 1 103 ? 23.205 5.825   59.844  1.00 107.84 ? 100 ALA A CB    1 
ATOM   714  N N     . ARG A 1 104 ? 23.321 6.764   56.926  1.00 94.99  ? 101 ARG A N     1 
ATOM   715  C CA    . ARG A 1 104 ? 23.329 7.831   55.931  1.00 94.78  ? 101 ARG A CA    1 
ATOM   716  C C     . ARG A 1 104 ? 22.460 9.000   56.380  1.00 89.22  ? 101 ARG A C     1 
ATOM   717  O O     . ARG A 1 104 ? 21.264 8.838   56.623  1.00 89.44  ? 101 ARG A O     1 
ATOM   718  C CB    . ARG A 1 104 ? 22.842 7.314   54.576  1.00 97.90  ? 101 ARG A CB    1 
ATOM   719  C CG    . ARG A 1 104 ? 23.650 6.154   54.017  1.00 101.29 ? 101 ARG A CG    1 
ATOM   720  C CD    . ARG A 1 104 ? 23.254 5.862   52.577  1.00 107.74 ? 101 ARG A CD    1 
ATOM   721  N NE    . ARG A 1 104 ? 23.982 4.723   52.025  1.00 106.74 ? 101 ARG A NE    1 
ATOM   722  C CZ    . ARG A 1 104 ? 23.496 3.488   51.958  1.00 106.13 ? 101 ARG A CZ    1 
ATOM   723  N NH1   . ARG A 1 104 ? 22.275 3.228   52.406  1.00 112.74 ? 101 ARG A NH1   1 
ATOM   724  N NH2   . ARG A 1 104 ? 24.229 2.512   51.440  1.00 101.30 ? 101 ARG A NH2   1 
ATOM   725  N N     . VAL A 1 105 ? 23.068 10.176  56.488  1.00 85.19  ? 102 VAL A N     1 
ATOM   726  C CA    . VAL A 1 105 ? 22.350 11.374  56.906  1.00 76.68  ? 102 VAL A CA    1 
ATOM   727  C C     . VAL A 1 105 ? 21.199 11.694  55.956  1.00 78.32  ? 102 VAL A C     1 
ATOM   728  O O     . VAL A 1 105 ? 21.412 11.913  54.764  1.00 86.64  ? 102 VAL A O     1 
ATOM   729  C CB    . VAL A 1 105 ? 23.292 12.590  57.011  1.00 74.52  ? 102 VAL A CB    1 
ATOM   730  C CG1   . VAL A 1 105 ? 22.499 13.887  56.984  1.00 76.54  ? 102 VAL A CG1   1 
ATOM   731  C CG2   . VAL A 1 105 ? 24.134 12.496  58.275  1.00 76.52  ? 102 VAL A CG2   1 
ATOM   732  N N     . PRO A 1 106 ? 19.968 11.708  56.487  1.00 82.77  ? 103 PRO A N     1 
ATOM   733  C CA    . PRO A 1 106 ? 18.772 12.009  55.693  1.00 91.74  ? 103 PRO A CA    1 
ATOM   734  C C     . PRO A 1 106 ? 18.761 13.464  55.242  1.00 90.03  ? 103 PRO A C     1 
ATOM   735  O O     . PRO A 1 106 ? 19.511 14.278  55.779  1.00 81.75  ? 103 PRO A O     1 
ATOM   736  C CB    . PRO A 1 106 ? 17.622 11.765  56.679  1.00 90.89  ? 103 PRO A CB    1 
ATOM   737  C CG    . PRO A 1 106 ? 18.210 10.938  57.778  1.00 89.68  ? 103 PRO A CG    1 
ATOM   738  C CD    . PRO A 1 106 ? 19.632 11.376  57.881  1.00 85.30  ? 103 PRO A CD    1 
ATOM   739  N N     . ARG A 1 107 ? 17.919 13.781  54.264  1.00 86.91  ? 104 ARG A N     1 
ATOM   740  C CA    . ARG A 1 107 ? 17.759 15.156  53.815  1.00 82.27  ? 104 ARG A CA    1 
ATOM   741  C C     . ARG A 1 107 ? 17.358 16.036  54.993  1.00 77.95  ? 104 ARG A C     1 
ATOM   742  O O     . ARG A 1 107 ? 16.792 15.547  55.970  1.00 73.59  ? 104 ARG A O     1 
ATOM   743  C CB    . ARG A 1 107 ? 16.687 15.237  52.730  1.00 81.14  ? 104 ARG A CB    1 
ATOM   744  C CG    . ARG A 1 107 ? 15.329 14.726  53.181  1.00 88.12  ? 104 ARG A CG    1 
ATOM   745  C CD    . ARG A 1 107 ? 14.206 15.289  52.329  1.00 96.87  ? 104 ARG A CD    1 
ATOM   746  N NE    . ARG A 1 107 ? 12.900 14.817  52.780  1.00 100.45 ? 104 ARG A NE    1 
ATOM   747  C CZ    . ARG A 1 107 ? 12.246 15.312  53.826  1.00 99.37  ? 104 ARG A CZ    1 
ATOM   748  N NH1   . ARG A 1 107 ? 12.777 16.297  54.538  1.00 101.68 ? 104 ARG A NH1   1 
ATOM   749  N NH2   . ARG A 1 107 ? 11.062 14.820  54.164  1.00 101.51 ? 104 ARG A NH2   1 
ATOM   750  N N     . PRO A 1 108 ? 17.653 17.342  54.906  1.00 82.41  ? 105 PRO A N     1 
ATOM   751  C CA    . PRO A 1 108 ? 17.236 18.277  55.955  1.00 78.39  ? 105 PRO A CA    1 
ATOM   752  C C     . PRO A 1 108 ? 15.732 18.191  56.192  1.00 81.69  ? 105 PRO A C     1 
ATOM   753  O O     . PRO A 1 108 ? 14.974 18.004  55.241  1.00 85.97  ? 105 PRO A O     1 
ATOM   754  C CB    . PRO A 1 108 ? 17.597 19.643  55.366  1.00 83.85  ? 105 PRO A CB    1 
ATOM   755  C CG    . PRO A 1 108 ? 18.701 19.361  54.408  1.00 91.53  ? 105 PRO A CG    1 
ATOM   756  C CD    . PRO A 1 108 ? 18.405 18.010  53.830  1.00 89.33  ? 105 PRO A CD    1 
ATOM   757  N N     . ALA A 1 109 ? 15.311 18.323  57.445  1.00 81.99  ? 106 ALA A N     1 
ATOM   758  C CA    . ALA A 1 109 ? 13.895 18.238  57.786  1.00 82.39  ? 106 ALA A CA    1 
ATOM   759  C C     . ALA A 1 109 ? 13.109 19.401  57.189  1.00 78.52  ? 106 ALA A C     1 
ATOM   760  O O     . ALA A 1 109 ? 13.644 20.494  57.007  1.00 76.06  ? 106 ALA A O     1 
ATOM   761  C CB    . ALA A 1 109 ? 13.716 18.192  59.296  1.00 76.74  ? 106 ALA A CB    1 
ATOM   762  N N     . ARG A 1 110 ? 11.838 19.158  56.886  1.00 76.82  ? 107 ARG A N     1 
ATOM   763  C CA    . ARG A 1 110 ? 10.970 20.195  56.338  1.00 79.67  ? 107 ARG A CA    1 
ATOM   764  C C     . ARG A 1 110 ? 9.740  20.401  57.218  1.00 80.11  ? 107 ARG A C     1 
ATOM   765  O O     . ARG A 1 110 ? 9.352  19.510  57.976  1.00 76.00  ? 107 ARG A O     1 
ATOM   766  C CB    . ARG A 1 110 ? 10.544 19.844  54.909  1.00 89.51  ? 107 ARG A CB    1 
ATOM   767  C CG    . ARG A 1 110 ? 11.703 19.569  53.962  1.00 90.75  ? 107 ARG A CG    1 
ATOM   768  C CD    . ARG A 1 110 ? 11.268 19.663  52.505  1.00 102.83 ? 107 ARG A CD    1 
ATOM   769  N NE    . ARG A 1 110 ? 10.277 18.651  52.149  1.00 109.61 ? 107 ARG A NE    1 
ATOM   770  C CZ    . ARG A 1 110 ? 10.551 17.536  51.479  1.00 110.64 ? 107 ARG A CZ    1 
ATOM   771  N NH1   . ARG A 1 110 ? 11.793 17.284  51.087  1.00 106.23 ? 107 ARG A NH1   1 
ATOM   772  N NH2   . ARG A 1 110 ? 9.584  16.673  51.199  1.00 114.00 ? 107 ARG A NH2   1 
ATOM   773  N N     . PHE A 1 111 ? 9.132  21.580  57.118  1.00 77.10  ? 108 PHE A N     1 
ATOM   774  C CA    . PHE A 1 111 ? 7.936  21.890  57.893  1.00 82.94  ? 108 PHE A CA    1 
ATOM   775  C C     . PHE A 1 111 ? 6.847  20.849  57.663  1.00 86.76  ? 108 PHE A C     1 
ATOM   776  O O     . PHE A 1 111 ? 6.048  20.565  58.555  1.00 77.40  ? 108 PHE A O     1 
ATOM   777  C CB    . PHE A 1 111 ? 7.405  23.281  57.543  1.00 87.09  ? 108 PHE A CB    1 
ATOM   778  C CG    . PHE A 1 111 ? 8.143  24.403  58.213  1.00 85.66  ? 108 PHE A CG    1 
ATOM   779  C CD1   . PHE A 1 111 ? 8.249  24.452  59.592  1.00 73.13  ? 108 PHE A CD1   1 
ATOM   780  C CD2   . PHE A 1 111 ? 8.714  25.420  57.465  1.00 87.61  ? 108 PHE A CD2   1 
ATOM   781  C CE1   . PHE A 1 111 ? 8.922  25.485  60.213  1.00 75.86  ? 108 PHE A CE1   1 
ATOM   782  C CE2   . PHE A 1 111 ? 9.387  26.458  58.082  1.00 88.80  ? 108 PHE A CE2   1 
ATOM   783  C CZ    . PHE A 1 111 ? 9.492  26.490  59.458  1.00 79.52  ? 108 PHE A CZ    1 
ATOM   784  N N     . GLY A 1 112 ? 6.822  20.286  56.459  1.00 88.01  ? 109 GLY A N     1 
ATOM   785  C CA    . GLY A 1 112 ? 5.844  19.274  56.108  1.00 86.32  ? 109 GLY A CA    1 
ATOM   786  C C     . GLY A 1 112 ? 5.977  18.021  56.951  1.00 86.71  ? 109 GLY A C     1 
ATOM   787  O O     . GLY A 1 112 ? 4.978  17.416  57.340  1.00 88.09  ? 109 GLY A O     1 
ATOM   788  N N     . ASP A 1 113 ? 7.217  17.630  57.233  1.00 83.73  ? 110 ASP A N     1 
ATOM   789  C CA    . ASP A 1 113 ? 7.482  16.451  58.049  1.00 89.46  ? 110 ASP A CA    1 
ATOM   790  C C     . ASP A 1 113 ? 6.738  16.544  59.376  1.00 93.95  ? 110 ASP A C     1 
ATOM   791  O O     . ASP A 1 113 ? 6.060  15.603  59.787  1.00 100.09 ? 110 ASP A O     1 
ATOM   792  C CB    . ASP A 1 113 ? 8.984  16.296  58.302  1.00 89.86  ? 110 ASP A CB    1 
ATOM   793  C CG    . ASP A 1 113 ? 9.788  16.204  57.019  1.00 89.91  ? 110 ASP A CG    1 
ATOM   794  O OD1   . ASP A 1 113 ? 9.176  16.215  55.932  1.00 87.71  ? 110 ASP A OD1   1 
ATOM   795  O OD2   . ASP A 1 113 ? 11.032 16.122  57.099  1.00 91.48  ? 110 ASP A OD2   1 
ATOM   796  N N     . ILE A 1 114 ? 6.868  17.689  60.037  1.00 89.52  ? 111 ILE A N     1 
ATOM   797  C CA    . ILE A 1 114 ? 6.191  17.930  61.304  1.00 86.63  ? 111 ILE A CA    1 
ATOM   798  C C     . ILE A 1 114 ? 4.684  18.031  61.104  1.00 96.27  ? 111 ILE A C     1 
ATOM   799  O O     . ILE A 1 114 ? 3.906  17.462  61.871  1.00 106.00 ? 111 ILE A O     1 
ATOM   800  C CB    . ILE A 1 114 ? 6.685  19.232  61.963  1.00 75.35  ? 111 ILE A CB    1 
ATOM   801  C CG1   . ILE A 1 114 ? 8.212  19.243  62.052  1.00 60.17  ? 111 ILE A CG1   1 
ATOM   802  C CG2   . ILE A 1 114 ? 6.057  19.406  63.340  1.00 81.30  ? 111 ILE A CG2   1 
ATOM   803  C CD1   . ILE A 1 114 ? 8.780  20.529  62.611  1.00 58.05  ? 111 ILE A CD1   1 
ATOM   804  N N     . ALA A 1 115 ? 4.281  18.757  60.067  1.00 80.16  ? 112 ALA A N     1 
ATOM   805  C CA    . ALA A 1 115 ? 2.869  18.998  59.794  1.00 85.11  ? 112 ALA A CA    1 
ATOM   806  C C     . ALA A 1 115 ? 2.108  17.713  59.479  1.00 95.80  ? 112 ALA A C     1 
ATOM   807  O O     . ALA A 1 115 ? 0.878  17.686  59.531  1.00 103.39 ? 112 ALA A O     1 
ATOM   808  C CB    . ALA A 1 115 ? 2.714  19.999  58.657  1.00 83.56  ? 112 ALA A CB    1 
ATOM   809  N N     . SER A 1 116 ? 2.839  16.653  59.150  1.00 95.52  ? 113 SER A N     1 
ATOM   810  C CA    . SER A 1 116 ? 2.217  15.370  58.843  1.00 101.52 ? 113 SER A CA    1 
ATOM   811  C C     . SER A 1 116 ? 2.134  14.489  60.086  1.00 101.37 ? 113 SER A C     1 
ATOM   812  O O     . SER A 1 116 ? 1.157  13.765  60.281  1.00 100.95 ? 113 SER A O     1 
ATOM   813  C CB    . SER A 1 116 ? 2.975  14.652  57.724  1.00 101.16 ? 113 SER A CB    1 
ATOM   814  O OG    . SER A 1 116 ? 4.333  14.450  58.070  1.00 101.94 ? 113 SER A OG    1 
ATOM   815  N N     . ARG A 1 117 ? 3.164  14.556  60.923  1.00 102.86 ? 114 ARG A N     1 
ATOM   816  C CA    . ARG A 1 117 ? 3.167  13.832  62.187  1.00 103.63 ? 114 ARG A CA    1 
ATOM   817  C C     . ARG A 1 117 ? 2.210  14.488  63.173  1.00 104.81 ? 114 ARG A C     1 
ATOM   818  O O     . ARG A 1 117 ? 1.762  15.614  62.959  1.00 104.87 ? 114 ARG A O     1 
ATOM   819  C CB    . ARG A 1 117 ? 4.576  13.782  62.778  1.00 98.40  ? 114 ARG A CB    1 
ATOM   820  C CG    . ARG A 1 117 ? 5.480  12.737  62.148  1.00 99.15  ? 114 ARG A CG    1 
ATOM   821  C CD    . ARG A 1 117 ? 6.930  12.949  62.553  1.00 98.75  ? 114 ARG A CD    1 
ATOM   822  N NE    . ARG A 1 117 ? 7.074  13.144  63.993  1.00 100.18 ? 114 ARG A NE    1 
ATOM   823  C CZ    . ARG A 1 117 ? 7.352  12.173  64.857  1.00 95.35  ? 114 ARG A CZ    1 
ATOM   824  N NH1   . ARG A 1 117 ? 7.520  10.929  64.431  1.00 99.95  ? 114 ARG A NH1   1 
ATOM   825  N NH2   . ARG A 1 117 ? 7.464  12.447  66.150  1.00 79.04  ? 114 ARG A NH2   1 
ATOM   826  N N     . ARG A 1 118 ? 1.901  13.779  64.252  1.00 99.99  ? 115 ARG A N     1 
ATOM   827  C CA    . ARG A 1 118 ? 0.991  14.298  65.265  1.00 98.41  ? 115 ARG A CA    1 
ATOM   828  C C     . ARG A 1 118 ? 1.727  14.619  66.561  1.00 88.87  ? 115 ARG A C     1 
ATOM   829  O O     . ARG A 1 118 ? 2.839  14.146  66.791  1.00 89.17  ? 115 ARG A O     1 
ATOM   830  C CB    . ARG A 1 118 ? -0.136 13.302  65.536  1.00 109.57 ? 115 ARG A CB    1 
ATOM   831  C CG    . ARG A 1 118 ? -0.950 12.923  64.314  1.00 120.52 ? 115 ARG A CG    1 
ATOM   832  C CD    . ARG A 1 118 ? -2.139 12.057  64.697  1.00 129.07 ? 115 ARG A CD    1 
ATOM   833  N NE    . ARG A 1 118 ? -1.738 10.714  65.108  1.00 133.75 ? 115 ARG A NE    1 
ATOM   834  C CZ    . ARG A 1 118 ? -2.574 9.799   65.588  1.00 135.59 ? 115 ARG A CZ    1 
ATOM   835  N NH1   . ARG A 1 118 ? -3.862 10.080  65.722  1.00 136.95 ? 115 ARG A NH1   1 
ATOM   836  N NH2   . ARG A 1 118 ? -2.121 8.602   65.936  1.00 134.88 ? 115 ARG A NH2   1 
ATOM   837  N N     . GLY A 1 119 ? 1.092  15.423  67.407  1.00 79.70  ? 116 GLY A N     1 
ATOM   838  C CA    . GLY A 1 119 ? 1.686  15.826  68.668  1.00 69.56  ? 116 GLY A CA    1 
ATOM   839  C C     . GLY A 1 119 ? 2.110  17.280  68.648  1.00 62.20  ? 116 GLY A C     1 
ATOM   840  O O     . GLY A 1 119 ? 2.341  17.853  67.585  1.00 67.72  ? 116 GLY A O     1 
ATOM   841  N N     . ASP A 1 120 ? 2.211  17.878  69.829  1.00 51.89  ? 117 ASP A N     1 
ATOM   842  C CA    . ASP A 1 120 ? 2.606  19.277  69.948  1.00 60.39  ? 117 ASP A CA    1 
ATOM   843  C C     . ASP A 1 120 ? 3.958  19.531  69.289  1.00 57.30  ? 117 ASP A C     1 
ATOM   844  O O     . ASP A 1 120 ? 4.809  18.644  69.231  1.00 53.45  ? 117 ASP A O     1 
ATOM   845  C CB    . ASP A 1 120 ? 2.654  19.696  71.418  1.00 65.95  ? 117 ASP A CB    1 
ATOM   846  C CG    . ASP A 1 120 ? 1.343  19.451  72.136  1.00 68.79  ? 117 ASP A CG    1 
ATOM   847  O OD1   . ASP A 1 120 ? 0.277  19.584  71.497  1.00 72.66  ? 117 ASP A OD1   1 
ATOM   848  O OD2   . ASP A 1 120 ? 1.378  19.126  73.341  1.00 54.37  ? 117 ASP A OD2   1 
ATOM   849  N N     . VAL A 1 121 ? 4.145  20.750  68.795  1.00 59.37  ? 118 VAL A N     1 
ATOM   850  C CA    . VAL A 1 121 ? 5.388  21.136  68.140  1.00 56.22  ? 118 VAL A CA    1 
ATOM   851  C C     . VAL A 1 121 ? 6.218  22.026  69.057  1.00 60.92  ? 118 VAL A C     1 
ATOM   852  O O     . VAL A 1 121 ? 5.689  22.928  69.704  1.00 67.13  ? 118 VAL A O     1 
ATOM   853  C CB    . VAL A 1 121 ? 5.115  21.894  66.825  1.00 58.42  ? 118 VAL A CB    1 
ATOM   854  C CG1   . VAL A 1 121 ? 6.411  22.125  66.064  1.00 58.52  ? 118 VAL A CG1   1 
ATOM   855  C CG2   . VAL A 1 121 ? 4.119  21.132  65.968  1.00 58.39  ? 118 VAL A CG2   1 
ATOM   856  N N     . VAL A 1 122 ? 7.521  21.768  69.110  1.00 61.13  ? 119 VAL A N     1 
ATOM   857  C CA    . VAL A 1 122 ? 8.426  22.564  69.932  1.00 52.88  ? 119 VAL A CA    1 
ATOM   858  C C     . VAL A 1 122 ? 9.204  23.563  69.083  1.00 56.59  ? 119 VAL A C     1 
ATOM   859  O O     . VAL A 1 122 ? 9.779  23.204  68.056  1.00 60.57  ? 119 VAL A O     1 
ATOM   860  C CB    . VAL A 1 122 ? 9.421  21.676  70.703  1.00 55.28  ? 119 VAL A CB    1 
ATOM   861  C CG1   . VAL A 1 122 ? 10.484 22.531  71.376  1.00 56.26  ? 119 VAL A CG1   1 
ATOM   862  C CG2   . VAL A 1 122 ? 8.687  20.822  71.724  1.00 41.41  ? 119 VAL A CG2   1 
ATOM   863  N N     . VAL A 1 123 ? 9.218  24.818  69.518  1.00 52.88  ? 120 VAL A N     1 
ATOM   864  C CA    . VAL A 1 123 ? 9.918  25.871  68.795  1.00 53.66  ? 120 VAL A CA    1 
ATOM   865  C C     . VAL A 1 123 ? 10.892 26.607  69.708  1.00 56.25  ? 120 VAL A C     1 
ATOM   866  O O     . VAL A 1 123 ? 10.491 27.200  70.709  1.00 53.76  ? 120 VAL A O     1 
ATOM   867  C CB    . VAL A 1 123 ? 8.932  26.888  68.190  1.00 67.03  ? 120 VAL A CB    1 
ATOM   868  C CG1   . VAL A 1 123 ? 9.686  27.979  67.445  1.00 71.01  ? 120 VAL A CG1   1 
ATOM   869  C CG2   . VAL A 1 123 ? 7.945  26.189  67.266  1.00 67.78  ? 120 VAL A CG2   1 
ATOM   870  N N     . LEU A 1 124 ? 12.173 26.560  69.361  1.00 59.02  ? 121 LEU A N     1 
ATOM   871  C CA    . LEU A 1 124 ? 13.200 27.247  70.135  1.00 60.15  ? 121 LEU A CA    1 
ATOM   872  C C     . LEU A 1 124 ? 13.660 28.507  69.412  1.00 63.37  ? 121 LEU A C     1 
ATOM   873  O O     . LEU A 1 124 ? 13.896 28.488  68.204  1.00 71.42  ? 121 LEU A O     1 
ATOM   874  C CB    . LEU A 1 124 ? 14.388 26.318  70.397  1.00 53.89  ? 121 LEU A CB    1 
ATOM   875  C CG    . LEU A 1 124 ? 14.057 24.983  71.067  1.00 50.10  ? 121 LEU A CG    1 
ATOM   876  C CD1   . LEU A 1 124 ? 15.316 24.155  71.267  1.00 49.19  ? 121 LEU A CD1   1 
ATOM   877  C CD2   . LEU A 1 124 ? 13.342 25.206  72.391  1.00 42.04  ? 121 LEU A CD2   1 
ATOM   878  N N     . ASP A 1 125 ? 13.783 29.602  70.155  1.00 58.66  ? 122 ASP A N     1 
ATOM   879  C CA    . ASP A 1 125 ? 14.175 30.881  69.575  1.00 55.59  ? 122 ASP A CA    1 
ATOM   880  C C     . ASP A 1 125 ? 15.435 31.434  70.230  1.00 65.46  ? 122 ASP A C     1 
ATOM   881  O O     . ASP A 1 125 ? 15.406 31.877  71.377  1.00 68.91  ? 122 ASP A O     1 
ATOM   882  C CB    . ASP A 1 125 ? 13.035 31.894  69.700  1.00 64.90  ? 122 ASP A CB    1 
ATOM   883  C CG    . ASP A 1 125 ? 13.397 33.253  69.132  1.00 80.34  ? 122 ASP A CG    1 
ATOM   884  O OD1   . ASP A 1 125 ? 12.755 34.250  69.523  1.00 95.15  ? 122 ASP A OD1   1 
ATOM   885  O OD2   . ASP A 1 125 ? 14.323 33.327  68.297  1.00 64.17  ? 122 ASP A OD2   1 
ATOM   886  N N     . GLY A 1 126 ? 16.541 31.406  69.493  1.00 62.20  ? 123 GLY A N     1 
ATOM   887  C CA    . GLY A 1 126 ? 17.791 31.960  69.977  1.00 61.88  ? 123 GLY A CA    1 
ATOM   888  C C     . GLY A 1 126 ? 18.628 30.974  70.768  1.00 63.48  ? 123 GLY A C     1 
ATOM   889  O O     . GLY A 1 126 ? 19.733 31.299  71.202  1.00 66.33  ? 123 GLY A O     1 
ATOM   890  N N     . VAL A 1 127 ? 18.104 29.768  70.961  1.00 66.95  ? 124 VAL A N     1 
ATOM   891  C CA    . VAL A 1 127 ? 18.832 28.732  71.685  1.00 63.23  ? 124 VAL A CA    1 
ATOM   892  C C     . VAL A 1 127 ? 20.029 28.264  70.867  1.00 64.73  ? 124 VAL A C     1 
ATOM   893  O O     . VAL A 1 127 ? 19.869 27.625  69.828  1.00 72.05  ? 124 VAL A O     1 
ATOM   894  C CB    . VAL A 1 127 ? 17.933 27.526  72.010  1.00 63.52  ? 124 VAL A CB    1 
ATOM   895  C CG1   . VAL A 1 127 ? 18.725 26.459  72.752  1.00 60.71  ? 124 VAL A CG1   1 
ATOM   896  C CG2   . VAL A 1 127 ? 16.729 27.968  72.828  1.00 52.44  ? 124 VAL A CG2   1 
ATOM   897  N N     . LYS A 1 128 ? 21.228 28.584  71.342  1.00 67.03  ? 125 LYS A N     1 
ATOM   898  C CA    . LYS A 1 128 ? 22.447 28.299  70.595  1.00 78.97  ? 125 LYS A CA    1 
ATOM   899  C C     . LYS A 1 128 ? 23.279 27.198  71.242  1.00 81.82  ? 125 LYS A C     1 
ATOM   900  O O     . LYS A 1 128 ? 23.908 26.397  70.550  1.00 86.64  ? 125 LYS A O     1 
ATOM   901  C CB    . LYS A 1 128 ? 23.285 29.570  70.452  1.00 83.69  ? 125 LYS A CB    1 
ATOM   902  C CG    . LYS A 1 128 ? 22.530 30.733  69.833  1.00 89.86  ? 125 LYS A CG    1 
ATOM   903  C CD    . LYS A 1 128 ? 23.303 32.032  69.972  1.00 98.32  ? 125 LYS A CD    1 
ATOM   904  C CE    . LYS A 1 128 ? 22.497 33.207  69.445  1.00 99.13  ? 125 LYS A CE    1 
ATOM   905  N NZ    . LYS A 1 128 ? 22.201 33.066  67.992  1.00 100.84 ? 125 LYS A NZ    1 
ATOM   906  N N     . ILE A 1 129 ? 23.285 27.167  72.571  1.00 70.40  ? 126 ILE A N     1 
ATOM   907  C CA    . ILE A 1 129 ? 24.044 26.163  73.306  1.00 64.01  ? 126 ILE A CA    1 
ATOM   908  C C     . ILE A 1 129 ? 23.579 24.761  72.934  1.00 64.24  ? 126 ILE A C     1 
ATOM   909  O O     . ILE A 1 129 ? 22.450 24.372  73.233  1.00 61.68  ? 126 ILE A O     1 
ATOM   910  C CB    . ILE A 1 129 ? 23.909 26.355  74.826  1.00 65.49  ? 126 ILE A CB    1 
ATOM   911  C CG1   . ILE A 1 129 ? 24.246 27.797  75.211  1.00 66.67  ? 126 ILE A CG1   1 
ATOM   912  C CG2   . ILE A 1 129 ? 24.806 25.375  75.567  1.00 61.42  ? 126 ILE A CG2   1 
ATOM   913  C CD1   . ILE A 1 129 ? 24.064 28.093  76.683  1.00 61.55  ? 126 ILE A CD1   1 
ATOM   914  N N     . VAL A 1 130 ? 24.456 24.007  72.280  1.00 70.59  ? 127 VAL A N     1 
ATOM   915  C CA    . VAL A 1 130 ? 24.119 22.669  71.804  1.00 68.63  ? 127 VAL A CA    1 
ATOM   916  C C     . VAL A 1 130 ? 23.764 21.711  72.939  1.00 69.66  ? 127 VAL A C     1 
ATOM   917  O O     . VAL A 1 130 ? 22.977 20.783  72.752  1.00 71.32  ? 127 VAL A O     1 
ATOM   918  C CB    . VAL A 1 130 ? 25.260 22.067  70.962  1.00 58.23  ? 127 VAL A CB    1 
ATOM   919  C CG1   . VAL A 1 130 ? 25.357 22.777  69.621  1.00 68.56  ? 127 VAL A CG1   1 
ATOM   920  C CG2   . VAL A 1 130 ? 26.579 22.151  71.715  1.00 56.20  ? 127 VAL A CG2   1 
ATOM   921  N N     . GLY A 1 131 ? 24.348 21.935  74.112  1.00 63.38  ? 128 GLY A N     1 
ATOM   922  C CA    . GLY A 1 131 ? 24.064 21.105  75.268  1.00 63.23  ? 128 GLY A CA    1 
ATOM   923  C C     . GLY A 1 131 ? 22.575 21.037  75.543  1.00 61.96  ? 128 GLY A C     1 
ATOM   924  O O     . GLY A 1 131 ? 22.021 19.962  75.776  1.00 51.13  ? 128 GLY A O     1 
ATOM   925  N N     . ASN A 1 132 ? 21.926 22.196  75.507  1.00 61.10  ? 129 ASN A N     1 
ATOM   926  C CA    . ASN A 1 132 ? 20.488 22.283  75.717  1.00 60.91  ? 129 ASN A CA    1 
ATOM   927  C C     . ASN A 1 132 ? 19.707 21.703  74.544  1.00 69.41  ? 129 ASN A C     1 
ATOM   928  O O     . ASN A 1 132 ? 18.824 20.868  74.730  1.00 71.84  ? 129 ASN A O     1 
ATOM   929  C CB    . ASN A 1 132 ? 20.070 23.734  75.957  1.00 64.74  ? 129 ASN A CB    1 
ATOM   930  C CG    . ASN A 1 132 ? 20.660 24.307  77.230  1.00 73.03  ? 129 ASN A CG    1 
ATOM   931  O OD1   . ASN A 1 132 ? 20.841 25.518  77.353  1.00 81.32  ? 129 ASN A OD1   1 
ATOM   932  N ND2   . ASN A 1 132 ? 20.966 23.436  78.186  1.00 67.44  ? 129 ASN A ND2   1 
ATOM   933  N N     . ILE A 1 133 ? 20.040 22.152  73.337  1.00 63.99  ? 130 ILE A N     1 
ATOM   934  C CA    . ILE A 1 133 ? 19.369 21.678  72.131  1.00 65.59  ? 130 ILE A CA    1 
ATOM   935  C C     . ILE A 1 133 ? 19.346 20.155  72.076  1.00 57.92  ? 130 ILE A C     1 
ATOM   936  O O     . ILE A 1 133 ? 18.315 19.551  71.782  1.00 59.29  ? 130 ILE A O     1 
ATOM   937  C CB    . ILE A 1 133 ? 20.040 22.222  70.854  1.00 64.60  ? 130 ILE A CB    1 
ATOM   938  C CG1   . ILE A 1 133 ? 19.951 23.749  70.815  1.00 70.00  ? 130 ILE A CG1   1 
ATOM   939  C CG2   . ILE A 1 133 ? 19.393 21.622  69.616  1.00 59.73  ? 130 ILE A CG2   1 
ATOM   940  C CD1   . ILE A 1 133 ? 20.584 24.366  69.584  1.00 69.75  ? 130 ILE A CD1   1 
ATOM   941  N N     . GLY A 1 134 ? 20.489 19.539  72.364  1.00 53.90  ? 131 GLY A N     1 
ATOM   942  C CA    . GLY A 1 134 ? 20.590 18.091  72.381  1.00 56.18  ? 131 GLY A CA    1 
ATOM   943  C C     . GLY A 1 134 ? 19.647 17.462  73.388  1.00 60.03  ? 131 GLY A C     1 
ATOM   944  O O     . GLY A 1 134 ? 18.880 16.559  73.054  1.00 61.30  ? 131 GLY A O     1 
ATOM   945  N N     . ALA A 1 135 ? 19.704 17.941  74.627  1.00 59.49  ? 132 ALA A N     1 
ATOM   946  C CA    . ALA A 1 135 ? 18.841 17.429  75.686  1.00 57.06  ? 132 ALA A CA    1 
ATOM   947  C C     . ALA A 1 135 ? 17.374 17.683  75.356  1.00 50.78  ? 132 ALA A C     1 
ATOM   948  O O     . ALA A 1 135 ? 16.504 16.869  75.667  1.00 53.32  ? 132 ALA A O     1 
ATOM   949  C CB    . ALA A 1 135 ? 19.205 18.062  77.021  1.00 34.09  ? 132 ALA A CB    1 
ATOM   950  N N     . ILE A 1 136 ? 17.112 18.822  74.723  1.00 41.77  ? 133 ILE A N     1 
ATOM   951  C CA    . ILE A 1 136 ? 15.764 19.184  74.306  1.00 45.14  ? 133 ILE A CA    1 
ATOM   952  C C     . ILE A 1 136 ? 15.235 18.204  73.261  1.00 54.40  ? 133 ILE A C     1 
ATOM   953  O O     . ILE A 1 136 ? 14.034 17.934  73.202  1.00 60.98  ? 133 ILE A O     1 
ATOM   954  C CB    . ILE A 1 136 ? 15.721 20.627  73.762  1.00 49.32  ? 133 ILE A CB    1 
ATOM   955  C CG1   . ILE A 1 136 ? 15.792 21.625  74.920  1.00 43.79  ? 133 ILE A CG1   1 
ATOM   956  C CG2   . ILE A 1 136 ? 14.468 20.858  72.932  1.00 45.10  ? 133 ILE A CG2   1 
ATOM   957  C CD1   . ILE A 1 136 ? 15.859 23.070  74.487  1.00 53.59  ? 133 ILE A CD1   1 
ATOM   958  N N     . VAL A 1 137 ? 16.137 17.666  72.445  1.00 48.75  ? 134 VAL A N     1 
ATOM   959  C CA    . VAL A 1 137 ? 15.761 16.663  71.455  1.00 44.30  ? 134 VAL A CA    1 
ATOM   960  C C     . VAL A 1 137 ? 15.285 15.385  72.138  1.00 47.39  ? 134 VAL A C     1 
ATOM   961  O O     . VAL A 1 137 ? 14.193 14.893  71.857  1.00 50.38  ? 134 VAL A O     1 
ATOM   962  C CB    . VAL A 1 137 ? 16.929 16.327  70.510  1.00 61.40  ? 134 VAL A CB    1 
ATOM   963  C CG1   . VAL A 1 137 ? 16.591 15.111  69.659  1.00 61.64  ? 134 VAL A CG1   1 
ATOM   964  C CG2   . VAL A 1 137 ? 17.263 17.522  69.630  1.00 55.07  ? 134 VAL A CG2   1 
ATOM   965  N N     . ARG A 1 138 ? 16.111 14.853  73.035  1.00 43.21  ? 135 ARG A N     1 
ATOM   966  C CA    . ARG A 1 138 ? 15.763 13.647  73.779  1.00 51.67  ? 135 ARG A CA    1 
ATOM   967  C C     . ARG A 1 138 ? 14.399 13.784  74.445  1.00 52.91  ? 135 ARG A C     1 
ATOM   968  O O     . ARG A 1 138 ? 13.558 12.891  74.352  1.00 56.28  ? 135 ARG A O     1 
ATOM   969  C CB    . ARG A 1 138 ? 16.819 13.344  74.844  1.00 70.94  ? 135 ARG A CB    1 
ATOM   970  C CG    . ARG A 1 138 ? 18.117 12.766  74.311  1.00 76.65  ? 135 ARG A CG    1 
ATOM   971  C CD    . ARG A 1 138 ? 19.018 12.346  75.462  1.00 85.94  ? 135 ARG A CD    1 
ATOM   972  N NE    . ARG A 1 138 ? 18.361 11.376  76.335  1.00 91.15  ? 135 ARG A NE    1 
ATOM   973  C CZ    . ARG A 1 138 ? 18.740 11.113  77.581  1.00 89.26  ? 135 ARG A CZ    1 
ATOM   974  N NH1   . ARG A 1 138 ? 19.771 11.754  78.114  1.00 84.74  ? 135 ARG A NH1   1 
ATOM   975  N NH2   . ARG A 1 138 ? 18.081 10.214  78.299  1.00 92.05  ? 135 ARG A NH2   1 
ATOM   976  N N     . THR A 1 139 ? 14.192 14.908  75.122  1.00 54.25  ? 136 THR A N     1 
ATOM   977  C CA    . THR A 1 139 ? 12.950 15.155  75.846  1.00 54.35  ? 136 THR A CA    1 
ATOM   978  C C     . THR A 1 139 ? 11.748 15.188  74.909  1.00 54.55  ? 136 THR A C     1 
ATOM   979  O O     . THR A 1 139 ? 10.719 14.573  75.185  1.00 56.09  ? 136 THR A O     1 
ATOM   980  C CB    . THR A 1 139 ? 13.013 16.478  76.628  1.00 45.98  ? 136 THR A CB    1 
ATOM   981  O OG1   . THR A 1 139 ? 14.125 16.449  77.530  1.00 40.81  ? 136 THR A OG1   1 
ATOM   982  C CG2   . THR A 1 139 ? 11.733 16.691  77.419  1.00 45.89  ? 136 THR A CG2   1 
ATOM   983  N N     . SER A 1 140 ? 11.883 15.914  73.804  1.00 50.22  ? 137 SER A N     1 
ATOM   984  C CA    . SER A 1 140 ? 10.813 16.011  72.818  1.00 49.84  ? 137 SER A CA    1 
ATOM   985  C C     . SER A 1 140 ? 10.471 14.632  72.268  1.00 59.59  ? 137 SER A C     1 
ATOM   986  O O     . SER A 1 140 ? 9.302  14.258  72.180  1.00 62.14  ? 137 SER A O     1 
ATOM   987  C CB    . SER A 1 140 ? 11.215 16.949  71.679  1.00 57.98  ? 137 SER A CB    1 
ATOM   988  O OG    . SER A 1 140 ? 11.469 18.257  72.161  1.00 51.57  ? 137 SER A OG    1 
ATOM   989  N N     . LEU A 1 141 ? 11.502 13.879  71.901  1.00 52.97  ? 138 LEU A N     1 
ATOM   990  C CA    . LEU A 1 141 ? 11.324 12.525  71.397  1.00 44.19  ? 138 LEU A CA    1 
ATOM   991  C C     . LEU A 1 141 ? 10.619 11.647  72.427  1.00 57.21  ? 138 LEU A C     1 
ATOM   992  O O     . LEU A 1 141 ? 9.591  11.032  72.137  1.00 63.99  ? 138 LEU A O     1 
ATOM   993  C CB    . LEU A 1 141 ? 12.679 11.912  71.038  1.00 40.67  ? 138 LEU A CB    1 
ATOM   994  C CG    . LEU A 1 141 ? 12.675 10.428  70.667  1.00 54.23  ? 138 LEU A CG    1 
ATOM   995  C CD1   . LEU A 1 141 ? 12.095 10.230  69.277  1.00 54.40  ? 138 LEU A CD1   1 
ATOM   996  C CD2   . LEU A 1 141 ? 14.077 9.845   70.754  1.00 59.87  ? 138 LEU A CD2   1 
ATOM   997  N N     . ALA A 1 142 ? 11.176 11.603  73.633  1.00 50.50  ? 139 ALA A N     1 
ATOM   998  C CA    . ALA A 1 142 ? 10.664 10.738  74.691  1.00 47.89  ? 139 ALA A CA    1 
ATOM   999  C C     . ALA A 1 142 ? 9.242  11.088  75.126  1.00 49.08  ? 139 ALA A C     1 
ATOM   1000 O O     . ALA A 1 142 ? 8.478  10.209  75.524  1.00 55.00  ? 139 ALA A O     1 
ATOM   1001 C CB    . ALA A 1 142 ? 11.606 10.759  75.889  1.00 40.16  ? 139 ALA A CB    1 
ATOM   1002 N N     . LEU A 1 143 ? 8.888  12.368  75.049  1.00 53.79  ? 140 LEU A N     1 
ATOM   1003 C CA    . LEU A 1 143 ? 7.576  12.819  75.508  1.00 47.49  ? 140 LEU A CA    1 
ATOM   1004 C C     . LEU A 1 143 ? 6.576  13.021  74.369  1.00 57.50  ? 140 LEU A C     1 
ATOM   1005 O O     . LEU A 1 143 ? 5.526  13.632  74.554  1.00 54.00  ? 140 LEU A O     1 
ATOM   1006 C CB    . LEU A 1 143 ? 7.704  14.090  76.351  1.00 45.65  ? 140 LEU A CB    1 
ATOM   1007 C CG    . LEU A 1 143 ? 8.540  13.945  77.626  1.00 46.60  ? 140 LEU A CG    1 
ATOM   1008 C CD1   . LEU A 1 143 ? 8.538  15.240  78.422  1.00 37.76  ? 140 LEU A CD1   1 
ATOM   1009 C CD2   . LEU A 1 143 ? 8.037  12.787  78.478  1.00 47.71  ? 140 LEU A CD2   1 
ATOM   1010 N N     . GLY A 1 144 ? 6.912  12.505  73.191  1.00 53.48  ? 141 GLY A N     1 
ATOM   1011 C CA    . GLY A 1 144 ? 5.994  12.500  72.066  1.00 65.61  ? 141 GLY A CA    1 
ATOM   1012 C C     . GLY A 1 144 ? 5.722  13.854  71.442  1.00 81.57  ? 141 GLY A C     1 
ATOM   1013 O O     . GLY A 1 144 ? 4.573  14.283  71.343  1.00 82.83  ? 141 GLY A O     1 
ATOM   1014 N N     . ALA A 1 145 ? 6.784  14.529  71.018  1.00 81.36  ? 142 ALA A N     1 
ATOM   1015 C CA    . ALA A 1 145 ? 6.648  15.780  70.285  1.00 73.11  ? 142 ALA A CA    1 
ATOM   1016 C C     . ALA A 1 145 ? 6.747  15.499  68.791  1.00 74.94  ? 142 ALA A C     1 
ATOM   1017 O O     . ALA A 1 145 ? 7.569  14.691  68.359  1.00 78.01  ? 142 ALA A O     1 
ATOM   1018 C CB    . ALA A 1 145 ? 7.716  16.769  70.715  1.00 76.56  ? 142 ALA A CB    1 
ATOM   1019 N N     . SER A 1 146 ? 5.904  16.163  68.007  1.00 73.24  ? 143 SER A N     1 
ATOM   1020 C CA    . SER A 1 146 ? 5.878  15.947  66.565  1.00 77.56  ? 143 SER A CA    1 
ATOM   1021 C C     . SER A 1 146 ? 7.204  16.331  65.911  1.00 78.43  ? 143 SER A C     1 
ATOM   1022 O O     . SER A 1 146 ? 7.675  15.649  65.002  1.00 88.43  ? 143 SER A O     1 
ATOM   1023 C CB    . SER A 1 146 ? 4.726  16.722  65.923  1.00 78.22  ? 143 SER A CB    1 
ATOM   1024 O OG    . SER A 1 146 ? 4.855  18.113  66.156  1.00 83.91  ? 143 SER A OG    1 
ATOM   1025 N N     . GLY A 1 147 ? 7.802  17.421  66.380  1.00 71.82  ? 144 GLY A N     1 
ATOM   1026 C CA    . GLY A 1 147 ? 9.065  17.887  65.838  1.00 74.69  ? 144 GLY A CA    1 
ATOM   1027 C C     . GLY A 1 147 ? 9.545  19.173  66.483  1.00 73.47  ? 144 GLY A C     1 
ATOM   1028 O O     . GLY A 1 147 ? 8.817  19.801  67.252  1.00 77.42  ? 144 GLY A O     1 
ATOM   1029 N N     . ILE A 1 148 ? 10.774 19.568  66.167  1.00 69.45  ? 145 ILE A N     1 
ATOM   1030 C CA    . ILE A 1 148 ? 11.365 20.771  66.741  1.00 60.74  ? 145 ILE A CA    1 
ATOM   1031 C C     . ILE A 1 148 ? 11.770 21.771  65.662  1.00 60.10  ? 145 ILE A C     1 
ATOM   1032 O O     . ILE A 1 148 ? 12.339 21.395  64.637  1.00 67.35  ? 145 ILE A O     1 
ATOM   1033 C CB    . ILE A 1 148 ? 12.604 20.436  67.597  1.00 59.17  ? 145 ILE A CB    1 
ATOM   1034 C CG1   . ILE A 1 148 ? 12.234 19.461  68.717  1.00 49.41  ? 145 ILE A CG1   1 
ATOM   1035 C CG2   . ILE A 1 148 ? 13.216 21.706  68.173  1.00 65.13  ? 145 ILE A CG2   1 
ATOM   1036 C CD1   . ILE A 1 148 ? 13.406 19.059  69.584  1.00 51.85  ? 145 ILE A CD1   1 
ATOM   1037 N N     . ILE A 1 149 ? 11.470 23.044  65.897  1.00 64.71  ? 146 ILE A N     1 
ATOM   1038 C CA    . ILE A 1 149 ? 11.882 24.109  64.991  1.00 62.77  ? 146 ILE A CA    1 
ATOM   1039 C C     . ILE A 1 149 ? 12.976 24.949  65.643  1.00 65.23  ? 146 ILE A C     1 
ATOM   1040 O O     . ILE A 1 149 ? 12.728 25.655  66.621  1.00 69.28  ? 146 ILE A O     1 
ATOM   1041 C CB    . ILE A 1 149 ? 10.698 25.015  64.602  1.00 66.53  ? 146 ILE A CB    1 
ATOM   1042 C CG1   . ILE A 1 149 ? 9.594  24.191  63.935  1.00 65.67  ? 146 ILE A CG1   1 
ATOM   1043 C CG2   . ILE A 1 149 ? 11.161 26.131  63.679  1.00 68.17  ? 146 ILE A CG2   1 
ATOM   1044 C CD1   . ILE A 1 149 ? 8.350  24.988  63.604  1.00 61.23  ? 146 ILE A CD1   1 
ATOM   1045 N N     . LEU A 1 150 ? 14.187 24.863  65.103  1.00 70.55  ? 147 LEU A N     1 
ATOM   1046 C CA    . LEU A 1 150 ? 15.322 25.589  65.662  1.00 65.94  ? 147 LEU A CA    1 
ATOM   1047 C C     . LEU A 1 150 ? 15.531 26.929  64.964  1.00 73.22  ? 147 LEU A C     1 
ATOM   1048 O O     . LEU A 1 150 ? 16.147 27.001  63.900  1.00 73.90  ? 147 LEU A O     1 
ATOM   1049 C CB    . LEU A 1 150 ? 16.596 24.743  65.585  1.00 64.16  ? 147 LEU A CB    1 
ATOM   1050 C CG    . LEU A 1 150 ? 16.581 23.429  66.372  1.00 58.50  ? 147 LEU A CG    1 
ATOM   1051 C CD1   . LEU A 1 150 ? 17.891 22.678  66.192  1.00 55.58  ? 147 LEU A CD1   1 
ATOM   1052 C CD2   . LEU A 1 150 ? 16.305 23.686  67.845  1.00 54.71  ? 147 LEU A CD2   1 
ATOM   1053 N N     . VAL A 1 151 ? 15.010 27.990  65.572  1.00 74.51  ? 148 VAL A N     1 
ATOM   1054 C CA    . VAL A 1 151 ? 15.154 29.335  65.030  1.00 74.05  ? 148 VAL A CA    1 
ATOM   1055 C C     . VAL A 1 151 ? 16.357 30.043  65.642  1.00 70.01  ? 148 VAL A C     1 
ATOM   1056 O O     . VAL A 1 151 ? 16.476 30.135  66.864  1.00 67.73  ? 148 VAL A O     1 
ATOM   1057 C CB    . VAL A 1 151 ? 13.891 30.183  65.279  1.00 72.66  ? 148 VAL A CB    1 
ATOM   1058 C CG1   . VAL A 1 151 ? 14.132 31.628  64.868  1.00 78.35  ? 148 VAL A CG1   1 
ATOM   1059 C CG2   . VAL A 1 151 ? 12.704 29.597  64.531  1.00 73.74  ? 148 VAL A CG2   1 
ATOM   1060 N N     . ASP A 1 152 ? 17.245 30.537  64.785  1.00 82.10  ? 149 ASP A N     1 
ATOM   1061 C CA    . ASP A 1 152 ? 18.427 31.267  65.232  1.00 86.90  ? 149 ASP A CA    1 
ATOM   1062 C C     . ASP A 1 152 ? 19.215 30.465  66.264  1.00 83.44  ? 149 ASP A C     1 
ATOM   1063 O O     . ASP A 1 152 ? 19.350 30.880  67.415  1.00 87.79  ? 149 ASP A O     1 
ATOM   1064 C CB    . ASP A 1 152 ? 18.024 32.626  65.812  1.00 96.81  ? 149 ASP A CB    1 
ATOM   1065 C CG    . ASP A 1 152 ? 19.219 33.466  66.217  1.00 112.34 ? 149 ASP A CG    1 
ATOM   1066 O OD1   . ASP A 1 152 ? 20.232 33.457  65.486  1.00 118.05 ? 149 ASP A OD1   1 
ATOM   1067 O OD2   . ASP A 1 152 ? 19.143 34.140  67.266  1.00 117.38 ? 149 ASP A OD2   1 
ATOM   1068 N N     . SER A 1 153 ? 19.730 29.314  65.847  1.00 80.17  ? 150 SER A N     1 
ATOM   1069 C CA    . SER A 1 153 ? 20.486 28.446  66.743  1.00 78.23  ? 150 SER A CA    1 
ATOM   1070 C C     . SER A 1 153 ? 21.959 28.402  66.357  1.00 86.86  ? 150 SER A C     1 
ATOM   1071 O O     . SER A 1 153 ? 22.770 27.779  67.042  1.00 90.41  ? 150 SER A O     1 
ATOM   1072 C CB    . SER A 1 153 ? 19.903 27.032  66.734  1.00 67.27  ? 150 SER A CB    1 
ATOM   1073 O OG    . SER A 1 153 ? 19.935 26.476  65.431  1.00 66.74  ? 150 SER A OG    1 
ATOM   1074 N N     . ASP A 1 154 ? 22.297 29.066  65.257  1.00 93.14  ? 151 ASP A N     1 
ATOM   1075 C CA    . ASP A 1 154 ? 23.664 29.072  64.746  1.00 100.00 ? 151 ASP A CA    1 
ATOM   1076 C C     . ASP A 1 154 ? 24.135 27.664  64.374  1.00 91.05  ? 151 ASP A C     1 
ATOM   1077 O O     . ASP A 1 154 ? 25.335 27.407  64.284  1.00 91.13  ? 151 ASP A O     1 
ATOM   1078 C CB    . ASP A 1 154 ? 24.622 29.720  65.754  1.00 112.52 ? 151 ASP A CB    1 
ATOM   1079 C CG    . ASP A 1 154 ? 24.369 31.208  65.926  1.00 120.20 ? 151 ASP A CG    1 
ATOM   1080 O OD1   . ASP A 1 154 ? 23.433 31.732  65.285  1.00 124.21 ? 151 ASP A OD1   1 
ATOM   1081 O OD2   . ASP A 1 154 ? 25.106 31.854  66.700  1.00 119.84 ? 151 ASP A OD2   1 
ATOM   1082 N N     . ILE A 1 155 ? 23.182 26.758  64.165  1.00 92.16  ? 152 ILE A N     1 
ATOM   1083 C CA    . ILE A 1 155 ? 23.486 25.405  63.707  1.00 90.09  ? 152 ILE A CA    1 
ATOM   1084 C C     . ILE A 1 155 ? 23.308 25.314  62.201  1.00 91.09  ? 152 ILE A C     1 
ATOM   1085 O O     . ILE A 1 155 ? 22.197 25.460  61.686  1.00 92.97  ? 152 ILE A O     1 
ATOM   1086 C CB    . ILE A 1 155 ? 22.570 24.355  64.361  1.00 85.23  ? 152 ILE A CB    1 
ATOM   1087 C CG1   . ILE A 1 155 ? 22.964 24.130  65.821  1.00 77.81  ? 152 ILE A CG1   1 
ATOM   1088 C CG2   . ILE A 1 155 ? 22.637 23.044  63.591  1.00 83.24  ? 152 ILE A CG2   1 
ATOM   1089 C CD1   . ILE A 1 155 ? 24.364 23.574  65.990  1.00 76.24  ? 152 ILE A CD1   1 
ATOM   1090 N N     . THR A 1 156 ? 24.405 25.055  61.499  1.00 94.88  ? 153 THR A N     1 
ATOM   1091 C CA    . THR A 1 156 ? 24.386 25.036  60.042  1.00 100.92 ? 153 THR A CA    1 
ATOM   1092 C C     . THR A 1 156 ? 23.804 23.740  59.480  1.00 97.68  ? 153 THR A C     1 
ATOM   1093 O O     . THR A 1 156 ? 23.344 23.699  58.338  1.00 100.82 ? 153 THR A O     1 
ATOM   1094 C CB    . THR A 1 156 ? 25.793 25.246  59.463  1.00 109.05 ? 153 THR A CB    1 
ATOM   1095 O OG1   . THR A 1 156 ? 26.638 24.161  59.863  1.00 110.44 ? 153 THR A OG1   1 
ATOM   1096 C CG2   . THR A 1 156 ? 26.380 26.553  59.963  1.00 112.81 ? 153 THR A CG2   1 
ATOM   1097 N N     . SER A 1 157 ? 23.814 22.686  60.289  1.00 91.91  ? 154 SER A N     1 
ATOM   1098 C CA    . SER A 1 157 ? 23.310 21.392  59.848  1.00 95.14  ? 154 SER A CA    1 
ATOM   1099 C C     . SER A 1 157 ? 23.058 20.458  61.024  1.00 96.89  ? 154 SER A C     1 
ATOM   1100 O O     . SER A 1 157 ? 23.890 20.340  61.921  1.00 102.11 ? 154 SER A O     1 
ATOM   1101 C CB    . SER A 1 157 ? 24.292 20.742  58.869  1.00 98.02  ? 154 SER A CB    1 
ATOM   1102 O OG    . SER A 1 157 ? 23.851 19.450  58.485  1.00 96.29  ? 154 SER A OG    1 
ATOM   1103 N N     . ILE A 1 158 ? 21.904 19.797  61.011  1.00 97.12  ? 155 ILE A N     1 
ATOM   1104 C CA    . ILE A 1 158 ? 21.564 18.817  62.037  1.00 95.65  ? 155 ILE A CA    1 
ATOM   1105 C C     . ILE A 1 158 ? 22.655 17.755  62.150  1.00 99.22  ? 155 ILE A C     1 
ATOM   1106 O O     . ILE A 1 158 ? 22.895 17.205  63.226  1.00 96.81  ? 155 ILE A O     1 
ATOM   1107 C CB    . ILE A 1 158 ? 20.205 18.143  61.741  1.00 90.49  ? 155 ILE A CB    1 
ATOM   1108 C CG1   . ILE A 1 158 ? 19.065 18.925  62.398  1.00 80.83  ? 155 ILE A CG1   1 
ATOM   1109 C CG2   . ILE A 1 158 ? 20.194 16.705  62.229  1.00 90.50  ? 155 ILE A CG2   1 
ATOM   1110 C CD1   . ILE A 1 158 ? 18.901 20.332  61.875  1.00 82.36  ? 155 ILE A CD1   1 
ATOM   1111 N N     . ALA A 1 159 ? 23.323 17.487  61.033  1.00 102.40 ? 156 ALA A N     1 
ATOM   1112 C CA    . ALA A 1 159 ? 24.377 16.480  60.983  1.00 102.71 ? 156 ALA A CA    1 
ATOM   1113 C C     . ALA A 1 159 ? 25.529 16.793  61.936  1.00 108.38 ? 156 ALA A C     1 
ATOM   1114 O O     . ALA A 1 159 ? 26.146 15.881  62.485  1.00 116.36 ? 156 ALA A O     1 
ATOM   1115 C CB    . ALA A 1 159 ? 24.893 16.326  59.560  1.00 99.83  ? 156 ALA A CB    1 
ATOM   1116 N N     . ASP A 1 160 ? 25.810 18.080  62.121  1.00 105.13 ? 157 ASP A N     1 
ATOM   1117 C CA    . ASP A 1 160 ? 26.899 18.536  62.987  1.00 104.18 ? 157 ASP A CA    1 
ATOM   1118 C C     . ASP A 1 160 ? 27.230 17.518  64.078  1.00 106.97 ? 157 ASP A C     1 
ATOM   1119 O O     . ASP A 1 160 ? 26.383 17.187  64.907  1.00 104.99 ? 157 ASP A O     1 
ATOM   1120 C CB    . ASP A 1 160 ? 26.546 19.889  63.612  1.00 108.42 ? 157 ASP A CB    1 
ATOM   1121 C CG    . ASP A 1 160 ? 27.744 20.576  64.240  1.00 118.34 ? 157 ASP A CG    1 
ATOM   1122 O OD1   . ASP A 1 160 ? 28.598 19.877  64.825  1.00 124.65 ? 157 ASP A OD1   1 
ATOM   1123 O OD2   . ASP A 1 160 ? 27.826 21.819  64.154  1.00 119.27 ? 157 ASP A OD2   1 
ATOM   1124 N N     . ARG A 1 161 ? 28.466 17.026  64.070  1.00 114.93 ? 158 ARG A N     1 
ATOM   1125 C CA    . ARG A 1 161 ? 28.882 15.966  64.987  1.00 117.13 ? 158 ARG A CA    1 
ATOM   1126 C C     . ARG A 1 161 ? 28.684 16.326  66.456  1.00 113.91 ? 158 ARG A C     1 
ATOM   1127 O O     . ARG A 1 161 ? 28.627 15.445  67.314  1.00 121.44 ? 158 ARG A O     1 
ATOM   1128 C CB    . ARG A 1 161 ? 30.342 15.573  64.746  1.00 125.32 ? 158 ARG A CB    1 
ATOM   1129 C CG    . ARG A 1 161 ? 31.321 16.733  64.794  1.00 132.54 ? 158 ARG A CG    1 
ATOM   1130 C CD    . ARG A 1 161 ? 32.561 16.371  65.599  1.00 138.13 ? 158 ARG A CD    1 
ATOM   1131 N NE    . ARG A 1 161 ? 32.850 14.940  65.556  1.00 141.14 ? 158 ARG A NE    1 
ATOM   1132 C CZ    . ARG A 1 161 ? 33.627 14.360  64.647  1.00 143.82 ? 158 ARG A CZ    1 
ATOM   1133 N NH1   . ARG A 1 161 ? 34.196 15.088  63.698  1.00 145.55 ? 158 ARG A NH1   1 
ATOM   1134 N NH2   . ARG A 1 161 ? 33.832 13.050  64.688  1.00 142.91 ? 158 ARG A NH2   1 
ATOM   1135 N N     . ARG A 1 162 ? 28.588 17.619  66.746  1.00 106.32 ? 159 ARG A N     1 
ATOM   1136 C CA    . ARG A 1 162 ? 28.413 18.073  68.121  1.00 100.93 ? 159 ARG A CA    1 
ATOM   1137 C C     . ARG A 1 162 ? 26.945 18.069  68.536  1.00 91.54  ? 159 ARG A C     1 
ATOM   1138 O O     . ARG A 1 162 ? 26.627 17.925  69.716  1.00 88.33  ? 159 ARG A O     1 
ATOM   1139 C CB    . ARG A 1 162 ? 29.031 19.459  68.319  1.00 103.32 ? 159 ARG A CB    1 
ATOM   1140 C CG    . ARG A 1 162 ? 30.534 19.486  68.102  1.00 115.33 ? 159 ARG A CG    1 
ATOM   1141 C CD    . ARG A 1 162 ? 31.143 20.817  68.506  1.00 121.59 ? 159 ARG A CD    1 
ATOM   1142 N NE    . ARG A 1 162 ? 30.577 21.936  67.757  1.00 124.39 ? 159 ARG A NE    1 
ATOM   1143 C CZ    . ARG A 1 162 ? 29.791 22.868  68.286  1.00 125.63 ? 159 ARG A CZ    1 
ATOM   1144 N NH1   . ARG A 1 162 ? 29.480 22.823  69.574  1.00 127.85 ? 159 ARG A NH1   1 
ATOM   1145 N NH2   . ARG A 1 162 ? 29.322 23.849  67.528  1.00 122.70 ? 159 ARG A NH2   1 
ATOM   1146 N N     . LEU A 1 163 ? 26.052 18.227  67.564  1.00 90.64  ? 160 LEU A N     1 
ATOM   1147 C CA    . LEU A 1 163 ? 24.623 18.145  67.833  1.00 88.74  ? 160 LEU A CA    1 
ATOM   1148 C C     . LEU A 1 163 ? 24.201 16.685  67.950  1.00 100.91 ? 160 LEU A C     1 
ATOM   1149 O O     . LEU A 1 163 ? 23.265 16.355  68.678  1.00 98.28  ? 160 LEU A O     1 
ATOM   1150 C CB    . LEU A 1 163 ? 23.818 18.853  66.740  1.00 79.79  ? 160 LEU A CB    1 
ATOM   1151 C CG    . LEU A 1 163 ? 22.306 18.942  66.961  1.00 71.94  ? 160 LEU A CG    1 
ATOM   1152 C CD1   . LEU A 1 163 ? 21.991 19.440  68.365  1.00 69.33  ? 160 LEU A CD1   1 
ATOM   1153 C CD2   . LEU A 1 163 ? 21.658 19.836  65.914  1.00 72.92  ? 160 LEU A CD2   1 
ATOM   1154 N N     . GLN A 1 164 ? 24.901 15.813  67.230  1.00 108.79 ? 161 GLN A N     1 
ATOM   1155 C CA    . GLN A 1 164 ? 24.662 14.378  67.324  1.00 111.28 ? 161 GLN A CA    1 
ATOM   1156 C C     . GLN A 1 164 ? 25.058 13.879  68.705  1.00 112.24 ? 161 GLN A C     1 
ATOM   1157 O O     . GLN A 1 164 ? 24.270 13.236  69.399  1.00 116.24 ? 161 GLN A O     1 
ATOM   1158 C CB    . GLN A 1 164 ? 25.474 13.627  66.269  1.00 116.03 ? 161 GLN A CB    1 
ATOM   1159 C CG    . GLN A 1 164 ? 25.132 13.974  64.833  1.00 118.35 ? 161 GLN A CG    1 
ATOM   1160 C CD    . GLN A 1 164 ? 26.088 13.334  63.846  1.00 121.14 ? 161 GLN A CD    1 
ATOM   1161 O OE1   . GLN A 1 164 ? 25.764 13.165  62.670  1.00 116.99 ? 161 GLN A OE1   1 
ATOM   1162 N NE2   . GLN A 1 164 ? 27.274 12.972  64.321  1.00 125.14 ? 161 GLN A NE2   1 
ATOM   1163 N N     . ARG A 1 165 ? 26.292 14.182  69.094  1.00 108.24 ? 162 ARG A N     1 
ATOM   1164 C CA    . ARG A 1 165 ? 26.841 13.725  70.363  1.00 103.75 ? 162 ARG A CA    1 
ATOM   1165 C C     . ARG A 1 165 ? 26.050 14.282  71.543  1.00 93.67  ? 162 ARG A C     1 
ATOM   1166 O O     . ARG A 1 165 ? 25.869 13.605  72.555  1.00 92.49  ? 162 ARG A O     1 
ATOM   1167 C CB    . ARG A 1 165 ? 28.313 14.127  70.473  1.00 112.42 ? 162 ARG A CB    1 
ATOM   1168 C CG    . ARG A 1 165 ? 29.128 13.263  71.417  1.00 121.15 ? 162 ARG A CG    1 
ATOM   1169 C CD    . ARG A 1 165 ? 30.615 13.521  71.243  1.00 129.59 ? 162 ARG A CD    1 
ATOM   1170 N NE    . ARG A 1 165 ? 31.030 13.391  69.848  1.00 136.85 ? 162 ARG A NE    1 
ATOM   1171 C CZ    . ARG A 1 165 ? 32.291 13.460  69.434  1.00 142.79 ? 162 ARG A CZ    1 
ATOM   1172 N NH1   . ARG A 1 165 ? 33.268 13.653  70.309  1.00 146.07 ? 162 ARG A NH1   1 
ATOM   1173 N NH2   . ARG A 1 165 ? 32.576 13.332  68.145  1.00 143.25 ? 162 ARG A NH2   1 
ATOM   1174 N N     . ALA A 1 166 ? 25.581 15.518  71.407  1.00 82.85  ? 163 ALA A N     1 
ATOM   1175 C CA    . ALA A 1 166 ? 24.785 16.150  72.452  1.00 75.59  ? 163 ALA A CA    1 
ATOM   1176 C C     . ALA A 1 166 ? 23.380 15.560  72.495  1.00 76.30  ? 163 ALA A C     1 
ATOM   1177 O O     . ALA A 1 166 ? 22.683 15.664  73.505  1.00 71.96  ? 163 ALA A O     1 
ATOM   1178 C CB    . ALA A 1 166 ? 24.725 17.654  72.239  1.00 71.24  ? 163 ALA A CB    1 
ATOM   1179 N N     . SER A 1 167 ? 22.971 14.940  71.393  1.00 74.54  ? 164 SER A N     1 
ATOM   1180 C CA    . SER A 1 167 ? 21.654 14.323  71.303  1.00 80.28  ? 164 SER A CA    1 
ATOM   1181 C C     . SER A 1 167 ? 21.737 12.810  71.473  1.00 89.77  ? 164 SER A C     1 
ATOM   1182 O O     . SER A 1 167 ? 20.743 12.105  71.299  1.00 93.53  ? 164 SER A O     1 
ATOM   1183 C CB    . SER A 1 167 ? 20.992 14.658  69.964  1.00 86.83  ? 164 SER A CB    1 
ATOM   1184 O OG    . SER A 1 167 ? 20.767 16.051  69.835  1.00 90.56  ? 164 SER A OG    1 
ATOM   1185 N N     . ARG A 1 168 ? 22.927 12.317  71.806  1.00 97.44  ? 165 ARG A N     1 
ATOM   1186 C CA    . ARG A 1 168 ? 23.149 10.885  71.991  1.00 107.68 ? 165 ARG A CA    1 
ATOM   1187 C C     . ARG A 1 168 ? 22.964 10.103  70.692  1.00 107.92 ? 165 ARG A C     1 
ATOM   1188 O O     . ARG A 1 168 ? 23.199 8.896   70.647  1.00 117.77 ? 165 ARG A O     1 
ATOM   1189 C CB    . ARG A 1 168 ? 22.217 10.330  73.072  1.00 117.43 ? 165 ARG A CB    1 
ATOM   1190 C CG    . ARG A 1 168 ? 22.699 10.551  74.496  1.00 125.09 ? 165 ARG A CG    1 
ATOM   1191 C CD    . ARG A 1 168 ? 23.668 9.458   74.926  1.00 133.99 ? 165 ARG A CD    1 
ATOM   1192 N NE    . ARG A 1 168 ? 23.973 9.464   76.359  1.00 137.63 ? 165 ARG A NE    1 
ATOM   1193 C CZ    . ARG A 1 168 ? 23.129 9.820   77.326  1.00 139.61 ? 165 ARG A CZ    1 
ATOM   1194 N NH1   . ARG A 1 168 ? 21.889 10.197  77.045  1.00 140.73 ? 165 ARG A NH1   1 
ATOM   1195 N NH2   . ARG A 1 168 ? 23.527 9.784   78.590  1.00 138.96 ? 165 ARG A NH2   1 
ATOM   1196 N N     . GLY A 1 169 ? 22.544 10.798  69.640  1.00 96.93  ? 166 GLY A N     1 
ATOM   1197 C CA    . GLY A 1 169 ? 22.299 10.167  68.356  1.00 84.08  ? 166 GLY A CA    1 
ATOM   1198 C C     . GLY A 1 169 ? 20.822 10.101  68.019  1.00 80.57  ? 166 GLY A C     1 
ATOM   1199 O O     . GLY A 1 169 ? 20.426 9.461   67.044  1.00 87.13  ? 166 GLY A O     1 
ATOM   1200 N N     . TYR A 1 170 ? 20.003 10.765  68.828  1.00 79.79  ? 167 TYR A N     1 
ATOM   1201 C CA    . TYR A 1 170 ? 18.560 10.780  68.614  1.00 81.92  ? 167 TYR A CA    1 
ATOM   1202 C C     . TYR A 1 170 ? 18.142 11.904  67.672  1.00 82.43  ? 167 TYR A C     1 
ATOM   1203 O O     . TYR A 1 170 ? 16.955 12.086  67.400  1.00 86.43  ? 167 TYR A O     1 
ATOM   1204 C CB    . TYR A 1 170 ? 17.818 10.936  69.943  1.00 78.47  ? 167 TYR A CB    1 
ATOM   1205 C CG    . TYR A 1 170 ? 17.929 9.750   70.874  1.00 85.56  ? 167 TYR A CG    1 
ATOM   1206 C CD1   . TYR A 1 170 ? 17.524 8.485   70.472  1.00 92.94  ? 167 TYR A CD1   1 
ATOM   1207 C CD2   . TYR A 1 170 ? 18.417 9.902   72.165  1.00 88.66  ? 167 TYR A CD2   1 
ATOM   1208 C CE1   . TYR A 1 170 ? 17.616 7.401   71.325  1.00 99.91  ? 167 TYR A CE1   1 
ATOM   1209 C CE2   . TYR A 1 170 ? 18.512 8.826   73.025  1.00 92.78  ? 167 TYR A CE2   1 
ATOM   1210 C CZ    . TYR A 1 170 ? 18.111 7.578   72.600  1.00 98.59  ? 167 TYR A CZ    1 
ATOM   1211 O OH    . TYR A 1 170 ? 18.205 6.505   73.456  1.00 99.05  ? 167 TYR A OH    1 
ATOM   1212 N N     . VAL A 1 171 ? 19.118 12.656  67.176  1.00 81.51  ? 168 VAL A N     1 
ATOM   1213 C CA    . VAL A 1 171 ? 18.836 13.828  66.353  1.00 78.99  ? 168 VAL A CA    1 
ATOM   1214 C C     . VAL A 1 171 ? 18.102 13.472  65.059  1.00 77.91  ? 168 VAL A C     1 
ATOM   1215 O O     . VAL A 1 171 ? 17.439 14.319  64.461  1.00 73.93  ? 168 VAL A O     1 
ATOM   1216 C CB    . VAL A 1 171 ? 20.124 14.611  66.025  1.00 78.88  ? 168 VAL A CB    1 
ATOM   1217 C CG1   . VAL A 1 171 ? 20.936 13.881  64.967  1.00 85.69  ? 168 VAL A CG1   1 
ATOM   1218 C CG2   . VAL A 1 171 ? 19.786 16.021  65.569  1.00 74.08  ? 168 VAL A CG2   1 
ATOM   1219 N N     . PHE A 1 172 ? 18.215 12.216  64.634  1.00 79.46  ? 169 PHE A N     1 
ATOM   1220 C CA    . PHE A 1 172 ? 17.558 11.765  63.410  1.00 81.32  ? 169 PHE A CA    1 
ATOM   1221 C C     . PHE A 1 172 ? 16.337 10.898  63.704  1.00 87.83  ? 169 PHE A C     1 
ATOM   1222 O O     . PHE A 1 172 ? 15.945 10.068  62.883  1.00 93.11  ? 169 PHE A O     1 
ATOM   1223 C CB    . PHE A 1 172 ? 18.540 10.994  62.524  1.00 74.47  ? 169 PHE A CB    1 
ATOM   1224 C CG    . PHE A 1 172 ? 19.795 11.753  62.204  1.00 68.81  ? 169 PHE A CG    1 
ATOM   1225 C CD1   . PHE A 1 172 ? 19.747 12.905  61.437  1.00 67.62  ? 169 PHE A CD1   1 
ATOM   1226 C CD2   . PHE A 1 172 ? 21.024 11.309  62.662  1.00 65.11  ? 169 PHE A CD2   1 
ATOM   1227 C CE1   . PHE A 1 172 ? 20.901 13.604  61.140  1.00 70.77  ? 169 PHE A CE1   1 
ATOM   1228 C CE2   . PHE A 1 172 ? 22.181 12.004  62.367  1.00 64.53  ? 169 PHE A CE2   1 
ATOM   1229 C CZ    . PHE A 1 172 ? 22.119 13.153  61.605  1.00 69.50  ? 169 PHE A CZ    1 
ATOM   1230 N N     . SER A 1 173 ? 15.737 11.096  64.874  1.00 83.69  ? 170 SER A N     1 
ATOM   1231 C CA    . SER A 1 173 ? 14.582 10.303  65.283  1.00 77.72  ? 170 SER A CA    1 
ATOM   1232 C C     . SER A 1 173 ? 13.278 11.086  65.146  1.00 72.19  ? 170 SER A C     1 
ATOM   1233 O O     . SER A 1 173 ? 12.189 10.525  65.266  1.00 66.21  ? 170 SER A O     1 
ATOM   1234 C CB    . SER A 1 173 ? 14.754 9.809   66.720  1.00 79.27  ? 170 SER A CB    1 
ATOM   1235 O OG    . SER A 1 173 ? 15.903 8.989   66.842  1.00 79.88  ? 170 SER A OG    1 
ATOM   1236 N N     . LEU A 1 174 ? 13.399 12.385  64.895  1.00 70.70  ? 171 LEU A N     1 
ATOM   1237 C CA    . LEU A 1 174 ? 12.237 13.245  64.709  1.00 68.05  ? 171 LEU A CA    1 
ATOM   1238 C C     . LEU A 1 174 ? 12.624 14.487  63.913  1.00 75.50  ? 171 LEU A C     1 
ATOM   1239 O O     . LEU A 1 174 ? 13.783 14.899  63.926  1.00 88.77  ? 171 LEU A O     1 
ATOM   1240 C CB    . LEU A 1 174 ? 11.631 13.640  66.059  1.00 61.40  ? 171 LEU A CB    1 
ATOM   1241 C CG    . LEU A 1 174 ? 12.386 14.668  66.906  1.00 63.41  ? 171 LEU A CG    1 
ATOM   1242 C CD1   . LEU A 1 174 ? 11.519 15.142  68.063  1.00 66.32  ? 171 LEU A CD1   1 
ATOM   1243 C CD2   . LEU A 1 174 ? 13.704 14.104  67.416  1.00 70.95  ? 171 LEU A CD2   1 
ATOM   1244 N N     . PRO A 1 175 ? 11.650 15.085  63.212  1.00 72.30  ? 172 PRO A N     1 
ATOM   1245 C CA    . PRO A 1 175 ? 11.902 16.259  62.368  1.00 72.35  ? 172 PRO A CA    1 
ATOM   1246 C C     . PRO A 1 175 ? 12.494 17.429  63.147  1.00 73.84  ? 172 PRO A C     1 
ATOM   1247 O O     . PRO A 1 175 ? 11.790 18.072  63.925  1.00 77.82  ? 172 PRO A O     1 
ATOM   1248 C CB    . PRO A 1 175 ? 10.505 16.629  61.858  1.00 72.26  ? 172 PRO A CB    1 
ATOM   1249 C CG    . PRO A 1 175 ? 9.720  15.370  61.948  1.00 71.63  ? 172 PRO A CG    1 
ATOM   1250 C CD    . PRO A 1 175 ? 10.244 14.651  63.151  1.00 70.03  ? 172 PRO A CD    1 
ATOM   1251 N N     . VAL A 1 176 ? 13.780 17.694  62.939  1.00 66.83  ? 173 VAL A N     1 
ATOM   1252 C CA    . VAL A 1 176 ? 14.427 18.863  63.519  1.00 67.70  ? 173 VAL A CA    1 
ATOM   1253 C C     . VAL A 1 176 ? 14.694 19.885  62.420  1.00 78.52  ? 173 VAL A C     1 
ATOM   1254 O O     . VAL A 1 176 ? 15.619 19.725  61.623  1.00 88.06  ? 173 VAL A O     1 
ATOM   1255 C CB    . VAL A 1 176 ? 15.751 18.495  64.213  1.00 71.08  ? 173 VAL A CB    1 
ATOM   1256 C CG1   . VAL A 1 176 ? 16.434 19.745  64.745  1.00 68.15  ? 173 VAL A CG1   1 
ATOM   1257 C CG2   . VAL A 1 176 ? 15.502 17.500  65.337  1.00 59.02  ? 173 VAL A CG2   1 
ATOM   1258 N N     . VAL A 1 177 ? 13.878 20.932  62.379  1.00 77.64  ? 174 VAL A N     1 
ATOM   1259 C CA    . VAL A 1 177 ? 13.926 21.896  61.285  1.00 76.04  ? 174 VAL A CA    1 
ATOM   1260 C C     . VAL A 1 177 ? 14.630 23.200  61.649  1.00 79.55  ? 174 VAL A C     1 
ATOM   1261 O O     . VAL A 1 177 ? 14.198 23.920  62.548  1.00 79.67  ? 174 VAL A O     1 
ATOM   1262 C CB    . VAL A 1 177 ? 12.509 22.238  60.780  1.00 75.45  ? 174 VAL A CB    1 
ATOM   1263 C CG1   . VAL A 1 177 ? 12.570 23.339  59.731  1.00 79.97  ? 174 VAL A CG1   1 
ATOM   1264 C CG2   . VAL A 1 177 ? 11.827 20.998  60.223  1.00 66.62  ? 174 VAL A CG2   1 
ATOM   1265 N N     . LEU A 1 178 ? 15.715 23.497  60.941  1.00 81.94  ? 175 LEU A N     1 
ATOM   1266 C CA    . LEU A 1 178 ? 16.353 24.802  61.037  1.00 85.89  ? 175 LEU A CA    1 
ATOM   1267 C C     . LEU A 1 178 ? 15.521 25.784  60.223  1.00 81.28  ? 175 LEU A C     1 
ATOM   1268 O O     . LEU A 1 178 ? 15.058 25.452  59.133  1.00 88.71  ? 175 LEU A O     1 
ATOM   1269 C CB    . LEU A 1 178 ? 17.780 24.745  60.492  1.00 91.11  ? 175 LEU A CB    1 
ATOM   1270 C CG    . LEU A 1 178 ? 18.704 23.681  61.089  1.00 89.44  ? 175 LEU A CG    1 
ATOM   1271 C CD1   . LEU A 1 178 ? 20.002 23.589  60.300  1.00 88.38  ? 175 LEU A CD1   1 
ATOM   1272 C CD2   . LEU A 1 178 ? 18.981 23.962  62.559  1.00 83.09  ? 175 LEU A CD2   1 
ATOM   1273 N N     . SER A 1 179 ? 15.324 26.989  60.748  1.00 76.83  ? 176 SER A N     1 
ATOM   1274 C CA    . SER A 1 179 ? 14.447 27.950  60.088  1.00 75.16  ? 176 SER A CA    1 
ATOM   1275 C C     . SER A 1 179 ? 14.666 29.386  60.552  1.00 78.01  ? 176 SER A C     1 
ATOM   1276 O O     . SER A 1 179 ? 15.231 29.629  61.618  1.00 78.83  ? 176 SER A O     1 
ATOM   1277 C CB    . SER A 1 179 ? 12.983 27.555  60.306  1.00 65.94  ? 176 SER A CB    1 
ATOM   1278 O OG    . SER A 1 179 ? 12.102 28.529  59.773  1.00 86.15  ? 176 SER A OG    1 
ATOM   1279 N N     . GLY A 1 180 ? 14.215 30.333  59.735  1.00 76.45  ? 177 GLY A N     1 
ATOM   1280 C CA    . GLY A 1 180 ? 14.226 31.735  60.105  1.00 75.87  ? 177 GLY A CA    1 
ATOM   1281 C C     . GLY A 1 180 ? 12.986 32.065  60.913  1.00 77.51  ? 177 GLY A C     1 
ATOM   1282 O O     . GLY A 1 180 ? 12.025 31.297  60.924  1.00 79.74  ? 177 GLY A O     1 
ATOM   1283 N N     . ARG A 1 181 ? 13.004 33.208  61.588  1.00 82.43  ? 178 ARG A N     1 
ATOM   1284 C CA    . ARG A 1 181 ? 11.904 33.593  62.466  1.00 89.14  ? 178 ARG A CA    1 
ATOM   1285 C C     . ARG A 1 181 ? 10.588 33.763  61.707  1.00 90.77  ? 178 ARG A C     1 
ATOM   1286 O O     . ARG A 1 181 ? 9.541  33.295  62.154  1.00 87.51  ? 178 ARG A O     1 
ATOM   1287 C CB    . ARG A 1 181 ? 12.251 34.873  63.228  1.00 93.59  ? 178 ARG A CB    1 
ATOM   1288 C CG    . ARG A 1 181 ? 11.235 35.263  64.290  1.00 97.79  ? 178 ARG A CG    1 
ATOM   1289 C CD    . ARG A 1 181 ? 11.806 36.299  65.248  1.00 100.32 ? 178 ARG A CD    1 
ATOM   1290 N NE    . ARG A 1 181 ? 12.889 35.755  66.063  1.00 99.85  ? 178 ARG A NE    1 
ATOM   1291 C CZ    . ARG A 1 181 ? 14.178 35.842  65.751  1.00 105.90 ? 178 ARG A CZ    1 
ATOM   1292 N NH1   . ARG A 1 181 ? 14.554 36.454  64.637  1.00 116.91 ? 178 ARG A NH1   1 
ATOM   1293 N NH2   . ARG A 1 181 ? 15.093 35.316  66.554  1.00 101.04 ? 178 ARG A NH2   1 
ATOM   1294 N N     . GLU A 1 182 ? 10.650 34.429  60.558  1.00 97.80  ? 179 GLU A N     1 
ATOM   1295 C CA    . GLU A 1 182 ? 9.460  34.677  59.750  1.00 102.61 ? 179 GLU A CA    1 
ATOM   1296 C C     . GLU A 1 182 ? 8.915  33.377  59.171  1.00 97.98  ? 179 GLU A C     1 
ATOM   1297 O O     . GLU A 1 182 ? 7.703  33.175  59.101  1.00 104.09 ? 179 GLU A O     1 
ATOM   1298 C CB    . GLU A 1 182 ? 9.776  35.648  58.610  1.00 114.56 ? 179 GLU A CB    1 
ATOM   1299 C CG    . GLU A 1 182 ? 11.027 36.487  58.816  1.00 119.77 ? 179 GLU A CG    1 
ATOM   1300 C CD    . GLU A 1 182 ? 12.285 35.787  58.328  1.00 123.54 ? 179 GLU A CD    1 
ATOM   1301 O OE1   . GLU A 1 182 ? 12.605 34.696  58.844  1.00 115.74 ? 179 GLU A OE1   1 
ATOM   1302 O OE2   . GLU A 1 182 ? 12.956 36.333  57.427  1.00 134.62 ? 179 GLU A OE2   1 
ATOM   1303 N N     . GLU A 1 183 ? 9.823  32.504  58.751  1.00 93.20  ? 180 GLU A N     1 
ATOM   1304 C CA    . GLU A 1 183 ? 9.452  31.226  58.158  1.00 94.11  ? 180 GLU A CA    1 
ATOM   1305 C C     . GLU A 1 183 ? 8.646  30.384  59.140  1.00 94.62  ? 180 GLU A C     1 
ATOM   1306 O O     . GLU A 1 183 ? 7.638  29.778  58.775  1.00 93.48  ? 180 GLU A O     1 
ATOM   1307 C CB    . GLU A 1 183 ? 10.706 30.466  57.723  1.00 94.95  ? 180 GLU A CB    1 
ATOM   1308 C CG    . GLU A 1 183 ? 11.697 31.313  56.941  1.00 102.99 ? 180 GLU A CG    1 
ATOM   1309 C CD    . GLU A 1 183 ? 13.005 30.593  56.681  1.00 107.08 ? 180 GLU A CD    1 
ATOM   1310 O OE1   . GLU A 1 183 ? 13.993 31.268  56.324  1.00 106.93 ? 180 GLU A OE1   1 
ATOM   1311 O OE2   . GLU A 1 183 ? 13.045 29.354  56.836  1.00 102.10 ? 180 GLU A OE2   1 
ATOM   1312 N N     . ALA A 1 184 ? 9.098  30.356  60.390  1.00 90.31  ? 181 ALA A N     1 
ATOM   1313 C CA    . ALA A 1 184 ? 8.437  29.582  61.434  1.00 85.11  ? 181 ALA A CA    1 
ATOM   1314 C C     . ALA A 1 184 ? 7.099  30.200  61.828  1.00 84.75  ? 181 ALA A C     1 
ATOM   1315 O O     . ALA A 1 184 ? 6.114  29.491  62.032  1.00 77.33  ? 181 ALA A O     1 
ATOM   1316 C CB    . ALA A 1 184 ? 9.342  29.455  62.650  1.00 84.16  ? 181 ALA A CB    1 
ATOM   1317 N N     . ILE A 1 185 ? 7.072  31.525  61.935  1.00 86.69  ? 182 ILE A N     1 
ATOM   1318 C CA    . ILE A 1 185 ? 5.850  32.238  62.293  1.00 90.91  ? 182 ILE A CA    1 
ATOM   1319 C C     . ILE A 1 185 ? 4.755  32.013  61.255  1.00 89.78  ? 182 ILE A C     1 
ATOM   1320 O O     . ILE A 1 185 ? 3.578  31.890  61.595  1.00 88.88  ? 182 ILE A O     1 
ATOM   1321 C CB    . ILE A 1 185 ? 6.102  33.751  62.450  1.00 101.74 ? 182 ILE A CB    1 
ATOM   1322 C CG1   . ILE A 1 185 ? 6.975  34.023  63.676  1.00 103.38 ? 182 ILE A CG1   1 
ATOM   1323 C CG2   . ILE A 1 185 ? 4.785  34.504  62.564  1.00 105.05 ? 182 ILE A CG2   1 
ATOM   1324 C CD1   . ILE A 1 185 ? 7.225  35.493  63.936  1.00 106.06 ? 182 ILE A CD1   1 
ATOM   1325 N N     . ALA A 1 186 ? 5.153  31.953  59.989  1.00 87.29  ? 183 ALA A N     1 
ATOM   1326 C CA    . ALA A 1 186 ? 4.205  31.771  58.895  1.00 100.60 ? 183 ALA A CA    1 
ATOM   1327 C C     . ALA A 1 186 ? 3.629  30.357  58.876  1.00 100.49 ? 183 ALA A C     1 
ATOM   1328 O O     . ALA A 1 186 ? 2.442  30.165  58.616  1.00 96.23  ? 183 ALA A O     1 
ATOM   1329 C CB    . ALA A 1 186 ? 4.865  32.096  57.563  1.00 104.19 ? 183 ALA A CB    1 
ATOM   1330 N N     . PHE A 1 187 ? 4.478  29.374  59.156  1.00 97.65  ? 184 PHE A N     1 
ATOM   1331 C CA    . PHE A 1 187 ? 4.076  27.971  59.131  1.00 88.56  ? 184 PHE A CA    1 
ATOM   1332 C C     . PHE A 1 187 ? 3.074  27.621  60.226  1.00 93.14  ? 184 PHE A C     1 
ATOM   1333 O O     . PHE A 1 187 ? 2.231  26.742  60.047  1.00 98.78  ? 184 PHE A O     1 
ATOM   1334 C CB    . PHE A 1 187 ? 5.304  27.064  59.243  1.00 72.67  ? 184 PHE A CB    1 
ATOM   1335 C CG    . PHE A 1 187 ? 4.975  25.633  59.568  1.00 81.57  ? 184 PHE A CG    1 
ATOM   1336 C CD1   . PHE A 1 187 ? 4.445  24.793  58.604  1.00 88.12  ? 184 PHE A CD1   1 
ATOM   1337 C CD2   . PHE A 1 187 ? 5.204  25.126  60.837  1.00 86.73  ? 184 PHE A CD2   1 
ATOM   1338 C CE1   . PHE A 1 187 ? 4.146  23.477  58.899  1.00 93.02  ? 184 PHE A CE1   1 
ATOM   1339 C CE2   . PHE A 1 187 ? 4.906  23.810  61.138  1.00 89.42  ? 184 PHE A CE2   1 
ATOM   1340 C CZ    . PHE A 1 187 ? 4.377  22.984  60.168  1.00 92.52  ? 184 PHE A CZ    1 
ATOM   1341 N N     . ILE A 1 188 ? 3.170  28.306  61.361  1.00 93.94  ? 185 ILE A N     1 
ATOM   1342 C CA    . ILE A 1 188 ? 2.308  28.010  62.500  1.00 94.49  ? 185 ILE A CA    1 
ATOM   1343 C C     . ILE A 1 188 ? 0.903  28.574  62.310  1.00 102.75 ? 185 ILE A C     1 
ATOM   1344 O O     . ILE A 1 188 ? -0.082 27.976  62.745  1.00 105.31 ? 185 ILE A O     1 
ATOM   1345 C CB    . ILE A 1 188 ? 2.910  28.539  63.815  1.00 84.92  ? 185 ILE A CB    1 
ATOM   1346 C CG1   . ILE A 1 188 ? 4.226  27.821  64.118  1.00 81.25  ? 185 ILE A CG1   1 
ATOM   1347 C CG2   . ILE A 1 188 ? 1.931  28.357  64.964  1.00 84.55  ? 185 ILE A CG2   1 
ATOM   1348 C CD1   . ILE A 1 188 ? 4.862  28.235  65.424  1.00 87.00  ? 185 ILE A CD1   1 
ATOM   1349 N N     . ARG A 1 189 ? 0.816  29.727  61.654  1.00 103.93 ? 186 ARG A N     1 
ATOM   1350 C CA    . ARG A 1 189 ? -0.471 30.344  61.358  1.00 110.84 ? 186 ARG A CA    1 
ATOM   1351 C C     . ARG A 1 189 ? -1.249 29.537  60.324  1.00 109.03 ? 186 ARG A C     1 
ATOM   1352 O O     . ARG A 1 189 ? -2.443 29.286  60.487  1.00 113.47 ? 186 ARG A O     1 
ATOM   1353 C CB    . ARG A 1 189 ? -0.276 31.776  60.857  1.00 113.43 ? 186 ARG A CB    1 
ATOM   1354 C CG    . ARG A 1 189 ? -0.289 32.831  61.949  1.00 108.92 ? 186 ARG A CG    1 
ATOM   1355 C CD    . ARG A 1 189 ? 0.170  34.185  61.422  1.00 112.63 ? 186 ARG A CD    1 
ATOM   1356 N NE    . ARG A 1 189 ? -0.218 34.400  60.030  1.00 123.77 ? 186 ARG A NE    1 
ATOM   1357 C CZ    . ARG A 1 189 ? 0.608  34.258  58.998  1.00 126.98 ? 186 ARG A CZ    1 
ATOM   1358 N NH1   . ARG A 1 189 ? 1.868  33.901  59.204  1.00 130.77 ? 186 ARG A NH1   1 
ATOM   1359 N NH2   . ARG A 1 189 ? 0.177  34.469  57.762  1.00 123.62 ? 186 ARG A NH2   1 
ATOM   1360 N N     . ASP A 1 190 ? -0.559 29.129  59.264  1.00 100.11 ? 187 ASP A N     1 
ATOM   1361 C CA    . ASP A 1 190 ? -1.191 28.418  58.159  1.00 109.01 ? 187 ASP A CA    1 
ATOM   1362 C C     . ASP A 1 190 ? -1.509 26.967  58.507  1.00 103.63 ? 187 ASP A C     1 
ATOM   1363 O O     . ASP A 1 190 ? -2.146 26.260  57.726  1.00 105.19 ? 187 ASP A O     1 
ATOM   1364 C CB    . ASP A 1 190 ? -0.302 28.477  56.915  1.00 118.13 ? 187 ASP A CB    1 
ATOM   1365 C CG    . ASP A 1 190 ? -0.070 29.895  56.432  1.00 124.67 ? 187 ASP A CG    1 
ATOM   1366 O OD1   . ASP A 1 190 ? -0.914 30.769  56.723  1.00 122.16 ? 187 ASP A OD1   1 
ATOM   1367 O OD2   . ASP A 1 190 ? 0.956  30.137  55.761  1.00 127.57 ? 187 ASP A OD2   1 
ATOM   1368 N N     . SER A 1 191 ? -1.065 26.528  59.680  1.00 97.27  ? 188 SER A N     1 
ATOM   1369 C CA    . SER A 1 191 ? -1.302 25.157  60.117  1.00 103.86 ? 188 SER A CA    1 
ATOM   1370 C C     . SER A 1 191 ? -2.461 25.086  61.106  1.00 109.43 ? 188 SER A C     1 
ATOM   1371 O O     . SER A 1 191 ? -2.945 24.002  61.434  1.00 108.76 ? 188 SER A O     1 
ATOM   1372 C CB    . SER A 1 191 ? -0.037 24.563  60.737  1.00 104.33 ? 188 SER A CB    1 
ATOM   1373 O OG    . SER A 1 191 ? -0.188 23.173  60.970  1.00 104.03 ? 188 SER A OG    1 
ATOM   1374 N N     . GLY A 1 192 ? -2.898 26.248  61.580  1.00 111.68 ? 189 GLY A N     1 
ATOM   1375 C CA    . GLY A 1 192 ? -4.034 26.328  62.481  1.00 112.61 ? 189 GLY A CA    1 
ATOM   1376 C C     . GLY A 1 192 ? -3.693 26.045  63.931  1.00 109.49 ? 189 GLY A C     1 
ATOM   1377 O O     . GLY A 1 192 ? -4.542 26.181  64.812  1.00 113.70 ? 189 GLY A O     1 
ATOM   1378 N N     . MET A 1 193 ? -2.449 25.651  64.182  1.00 104.00 ? 190 MET A N     1 
ATOM   1379 C CA    . MET A 1 193 ? -2.007 25.343  65.538  1.00 100.74 ? 190 MET A CA    1 
ATOM   1380 C C     . MET A 1 193 ? -2.060 26.571  66.439  1.00 97.25  ? 190 MET A C     1 
ATOM   1381 O O     . MET A 1 193 ? -1.780 27.687  66.002  1.00 107.71 ? 190 MET A O     1 
ATOM   1382 C CB    . MET A 1 193 ? -0.588 24.772  65.527  1.00 103.88 ? 190 MET A CB    1 
ATOM   1383 C CG    . MET A 1 193 ? -0.474 23.385  64.924  1.00 111.45 ? 190 MET A CG    1 
ATOM   1384 S SD    . MET A 1 193 ? 1.183  22.704  65.119  1.00 80.22  ? 190 MET A SD    1 
ATOM   1385 C CE    . MET A 1 193 ? 2.156  23.931  64.248  1.00 120.18 ? 190 MET A CE    1 
ATOM   1386 N N     . GLN A 1 194 ? -2.420 26.357  67.700  1.00 87.69  ? 191 GLN A N     1 
ATOM   1387 C CA    . GLN A 1 194 ? -2.453 27.434  68.680  1.00 90.16  ? 191 GLN A CA    1 
ATOM   1388 C C     . GLN A 1 194 ? -1.072 27.622  69.298  1.00 88.02  ? 191 GLN A C     1 
ATOM   1389 O O     . GLN A 1 194 ? -0.528 26.707  69.914  1.00 84.86  ? 191 GLN A O     1 
ATOM   1390 C CB    . GLN A 1 194 ? -3.489 27.136  69.766  1.00 95.90  ? 191 GLN A CB    1 
ATOM   1391 C CG    . GLN A 1 194 ? -3.596 28.207  70.838  1.00 103.16 ? 191 GLN A CG    1 
ATOM   1392 C CD    . GLN A 1 194 ? -4.743 27.958  71.798  1.00 111.07 ? 191 GLN A CD    1 
ATOM   1393 O OE1   . GLN A 1 194 ? -5.700 27.256  71.470  1.00 113.88 ? 191 GLN A OE1   1 
ATOM   1394 N NE2   . GLN A 1 194 ? -4.653 28.535  72.990  1.00 110.64 ? 191 GLN A NE2   1 
ATOM   1395 N N     . LEU A 1 195 ? -0.506 28.813  69.125  1.00 89.76  ? 192 LEU A N     1 
ATOM   1396 C CA    . LEU A 1 195 ? 0.843  29.095  69.607  1.00 76.28  ? 192 LEU A CA    1 
ATOM   1397 C C     . LEU A 1 195 ? 0.856  29.504  71.077  1.00 72.88  ? 192 LEU A C     1 
ATOM   1398 O O     . LEU A 1 195 ? 0.141  30.420  71.486  1.00 75.24  ? 192 LEU A O     1 
ATOM   1399 C CB    . LEU A 1 195 ? 1.503  30.179  68.751  1.00 71.60  ? 192 LEU A CB    1 
ATOM   1400 C CG    . LEU A 1 195 ? 2.908  30.623  69.167  1.00 71.71  ? 192 LEU A CG    1 
ATOM   1401 C CD1   . LEU A 1 195 ? 3.851  29.434  69.257  1.00 61.77  ? 192 LEU A CD1   1 
ATOM   1402 C CD2   . LEU A 1 195 ? 3.448  31.665  68.201  1.00 74.76  ? 192 LEU A CD2   1 
ATOM   1403 N N     . MET A 1 196 ? 1.677  28.817  71.865  1.00 68.05  ? 193 MET A N     1 
ATOM   1404 C CA    . MET A 1 196 ? 1.808  29.110  73.286  1.00 61.49  ? 193 MET A CA    1 
ATOM   1405 C C     . MET A 1 196 ? 3.237  29.530  73.612  1.00 58.63  ? 193 MET A C     1 
ATOM   1406 O O     . MET A 1 196 ? 4.180  28.771  73.389  1.00 66.76  ? 193 MET A O     1 
ATOM   1407 C CB    . MET A 1 196 ? 1.424  27.887  74.123  1.00 56.26  ? 193 MET A CB    1 
ATOM   1408 C CG    . MET A 1 196 ? 0.084  27.269  73.749  1.00 60.38  ? 193 MET A CG    1 
ATOM   1409 S SD    . MET A 1 196 ? -1.326 28.312  74.165  1.00 100.25 ? 193 MET A SD    1 
ATOM   1410 C CE    . MET A 1 196 ? -1.365 28.142  75.947  1.00 94.83  ? 193 MET A CE    1 
ATOM   1411 N N     . THR A 1 197 ? 3.393  30.741  74.135  1.00 61.44  ? 194 THR A N     1 
ATOM   1412 C CA    . THR A 1 197 ? 4.706  31.239  74.530  1.00 63.92  ? 194 THR A CA    1 
ATOM   1413 C C     . THR A 1 197 ? 4.942  31.033  76.021  1.00 62.94  ? 194 THR A C     1 
ATOM   1414 O O     . THR A 1 197 ? 4.256  31.626  76.852  1.00 71.70  ? 194 THR A O     1 
ATOM   1415 C CB    . THR A 1 197 ? 4.864  32.738  74.213  1.00 65.91  ? 194 THR A CB    1 
ATOM   1416 O OG1   . THR A 1 197 ? 4.879  32.931  72.794  1.00 83.23  ? 194 THR A OG1   1 
ATOM   1417 C CG2   . THR A 1 197 ? 6.158  33.273  74.807  1.00 55.42  ? 194 THR A CG2   1 
ATOM   1418 N N     . LEU A 1 198 ? 5.915  30.195  76.359  1.00 60.91  ? 195 LEU A N     1 
ATOM   1419 C CA    . LEU A 1 198 ? 6.238  29.947  77.759  1.00 55.28  ? 195 LEU A CA    1 
ATOM   1420 C C     . LEU A 1 198 ? 7.197  30.995  78.312  1.00 53.18  ? 195 LEU A C     1 
ATOM   1421 O O     . LEU A 1 198 ? 8.230  31.285  77.709  1.00 49.76  ? 195 LEU A O     1 
ATOM   1422 C CB    . LEU A 1 198 ? 6.814  28.543  77.951  1.00 58.29  ? 195 LEU A CB    1 
ATOM   1423 C CG    . LEU A 1 198 ? 5.790  27.406  77.958  1.00 62.88  ? 195 LEU A CG    1 
ATOM   1424 C CD1   . LEU A 1 198 ? 5.405  27.019  76.539  1.00 54.85  ? 195 LEU A CD1   1 
ATOM   1425 C CD2   . LEU A 1 198 ? 6.333  26.207  78.713  1.00 70.22  ? 195 LEU A CD2   1 
ATOM   1426 N N     . LYS A 1 199 ? 6.842  31.561  79.460  1.00 48.52  ? 196 LYS A N     1 
ATOM   1427 C CA    . LYS A 1 199 ? 7.658  32.581  80.104  1.00 52.96  ? 196 LYS A CA    1 
ATOM   1428 C C     . LYS A 1 199 ? 7.345  32.615  81.598  1.00 47.39  ? 196 LYS A C     1 
ATOM   1429 O O     . LYS A 1 199 ? 6.220  32.332  82.010  1.00 53.08  ? 196 LYS A O     1 
ATOM   1430 C CB    . LYS A 1 199 ? 7.388  33.953  79.478  1.00 69.77  ? 196 LYS A CB    1 
ATOM   1431 C CG    . LYS A 1 199 ? 8.631  34.815  79.230  1.00 86.34  ? 196 LYS A CG    1 
ATOM   1432 C CD    . LYS A 1 199 ? 9.625  34.774  80.386  1.00 92.10  ? 196 LYS A CD    1 
ATOM   1433 C CE    . LYS A 1 199 ? 10.660 33.669  80.199  1.00 83.43  ? 196 LYS A CE    1 
ATOM   1434 N NZ    . LYS A 1 199 ? 11.508 33.477  81.408  1.00 66.70  ? 196 LYS A NZ    1 
ATOM   1435 N N     . ALA A 1 200 ? 8.344  32.962  82.404  1.00 43.03  ? 197 ALA A N     1 
ATOM   1436 C CA    . ALA A 1 200 ? 8.194  32.992  83.856  1.00 60.04  ? 197 ALA A CA    1 
ATOM   1437 C C     . ALA A 1 200 ? 7.016  33.850  84.318  1.00 74.07  ? 197 ALA A C     1 
ATOM   1438 O O     . ALA A 1 200 ? 6.381  33.549  85.327  1.00 82.17  ? 197 ALA A O     1 
ATOM   1439 C CB    . ALA A 1 200 ? 9.485  33.464  84.514  1.00 60.86  ? 197 ALA A CB    1 
ATOM   1440 N N     . ASP A 1 201 ? 6.730  34.920  83.583  1.00 79.37  ? 198 ASP A N     1 
ATOM   1441 C CA    . ASP A 1 201 ? 5.621  35.802  83.934  1.00 85.02  ? 198 ASP A CA    1 
ATOM   1442 C C     . ASP A 1 201 ? 4.455  35.666  82.958  1.00 78.98  ? 198 ASP A C     1 
ATOM   1443 O O     . ASP A 1 201 ? 3.812  36.654  82.602  1.00 76.00  ? 198 ASP A O     1 
ATOM   1444 C CB    . ASP A 1 201 ? 6.084  37.260  84.012  1.00 97.32  ? 198 ASP A CB    1 
ATOM   1445 C CG    . ASP A 1 201 ? 6.563  37.794  82.677  1.00 111.26 ? 198 ASP A CG    1 
ATOM   1446 O OD1   . ASP A 1 201 ? 6.991  36.984  81.829  1.00 117.33 ? 198 ASP A OD1   1 
ATOM   1447 O OD2   . ASP A 1 201 ? 6.515  39.026  82.477  1.00 116.17 ? 198 ASP A OD2   1 
ATOM   1448 N N     . GLY A 1 202 ? 4.188  34.436  82.529  1.00 80.76  ? 199 GLY A N     1 
ATOM   1449 C CA    . GLY A 1 202 ? 3.074  34.165  81.641  1.00 74.32  ? 199 GLY A CA    1 
ATOM   1450 C C     . GLY A 1 202 ? 1.746  34.304  82.360  1.00 72.70  ? 199 GLY A C     1 
ATOM   1451 O O     . GLY A 1 202 ? 1.693  34.272  83.588  1.00 69.25  ? 199 GLY A O     1 
ATOM   1452 N N     . ASP A 1 203 ? 0.672  34.456  81.592  1.00 75.31  ? 200 ASP A N     1 
ATOM   1453 C CA    . ASP A 1 203 ? -0.659 34.644  82.162  1.00 67.64  ? 200 ASP A CA    1 
ATOM   1454 C C     . ASP A 1 203 ? -1.294 33.319  82.569  1.00 67.24  ? 200 ASP A C     1 
ATOM   1455 O O     . ASP A 1 203 ? -1.926 33.219  83.621  1.00 66.58  ? 200 ASP A O     1 
ATOM   1456 C CB    . ASP A 1 203 ? -1.563 35.374  81.168  1.00 65.63  ? 200 ASP A CB    1 
ATOM   1457 C CG    . ASP A 1 203 ? -1.038 36.749  80.808  1.00 76.39  ? 200 ASP A CG    1 
ATOM   1458 O OD1   . ASP A 1 203 ? -0.650 37.498  81.730  1.00 75.71  ? 200 ASP A OD1   1 
ATOM   1459 O OD2   . ASP A 1 203 ? -1.017 37.082  79.604  1.00 73.09  ? 200 ASP A OD2   1 
ATOM   1460 N N     . ILE A 1 204 ? -1.127 32.305  81.727  1.00 57.40  ? 201 ILE A N     1 
ATOM   1461 C CA    . ILE A 1 204 ? -1.698 30.988  81.986  1.00 59.72  ? 201 ILE A CA    1 
ATOM   1462 C C     . ILE A 1 204 ? -0.699 30.087  82.706  1.00 61.96  ? 201 ILE A C     1 
ATOM   1463 O O     . ILE A 1 204 ? 0.503  30.153  82.456  1.00 69.46  ? 201 ILE A O     1 
ATOM   1464 C CB    . ILE A 1 204 ? -2.137 30.303  80.678  1.00 60.25  ? 201 ILE A CB    1 
ATOM   1465 C CG1   . ILE A 1 204 ? -2.938 31.275  79.809  1.00 77.19  ? 201 ILE A CG1   1 
ATOM   1466 C CG2   . ILE A 1 204 ? -2.943 29.047  80.976  1.00 60.52  ? 201 ILE A CG2   1 
ATOM   1467 C CD1   . ILE A 1 204 ? -4.202 31.783  80.466  1.00 89.85  ? 201 ILE A CD1   1 
ATOM   1468 N N     . SER A 1 205 ? -1.205 29.249  83.604  1.00 44.94  ? 202 SER A N     1 
ATOM   1469 C CA    . SER A 1 205 ? -0.365 28.293  84.313  1.00 50.89  ? 202 SER A CA    1 
ATOM   1470 C C     . SER A 1 205 ? -0.069 27.094  83.422  1.00 48.79  ? 202 SER A C     1 
ATOM   1471 O O     . SER A 1 205 ? -0.898 26.705  82.600  1.00 47.43  ? 202 SER A O     1 
ATOM   1472 C CB    . SER A 1 205 ? -1.044 27.832  85.604  1.00 43.11  ? 202 SER A CB    1 
ATOM   1473 O OG    . SER A 1 205 ? -0.267 26.849  86.266  1.00 57.11  ? 202 SER A OG    1 
ATOM   1474 N N     . VAL A 1 206 ? 1.115  26.512  83.586  1.00 45.70  ? 203 VAL A N     1 
ATOM   1475 C CA    . VAL A 1 206 ? 1.522  25.378  82.763  1.00 43.06  ? 203 VAL A CA    1 
ATOM   1476 C C     . VAL A 1 206 ? 0.646  24.162  83.041  1.00 43.08  ? 203 VAL A C     1 
ATOM   1477 O O     . VAL A 1 206 ? 0.513  23.273  82.200  1.00 52.79  ? 203 VAL A O     1 
ATOM   1478 C CB    . VAL A 1 206 ? 3.003  25.013  82.990  1.00 43.10  ? 203 VAL A CB    1 
ATOM   1479 C CG1   . VAL A 1 206 ? 3.206  24.450  84.388  1.00 33.44  ? 203 VAL A CG1   1 
ATOM   1480 C CG2   . VAL A 1 206 ? 3.475  24.022  81.936  1.00 34.88  ? 203 VAL A CG2   1 
ATOM   1481 N N     . LYS A 1 207 ? 0.043  24.137  84.224  1.00 41.65  ? 204 LYS A N     1 
ATOM   1482 C CA    . LYS A 1 207 ? -0.818 23.032  84.624  1.00 50.11  ? 204 LYS A CA    1 
ATOM   1483 C C     . LYS A 1 207 ? -2.099 23.007  83.795  1.00 57.71  ? 204 LYS A C     1 
ATOM   1484 O O     . LYS A 1 207 ? -2.732 21.962  83.647  1.00 60.18  ? 204 LYS A O     1 
ATOM   1485 C CB    . LYS A 1 207 ? -1.164 23.141  86.111  1.00 57.77  ? 204 LYS A CB    1 
ATOM   1486 C CG    . LYS A 1 207 ? -1.473 21.813  86.780  1.00 74.75  ? 204 LYS A CG    1 
ATOM   1487 C CD    . LYS A 1 207 ? -0.211 20.981  86.938  1.00 83.28  ? 204 LYS A CD    1 
ATOM   1488 C CE    . LYS A 1 207 ? -0.484 19.684  87.681  1.00 89.35  ? 204 LYS A CE    1 
ATOM   1489 N NZ    . LYS A 1 207 ? 0.761  18.889  87.877  1.00 84.16  ? 204 LYS A NZ    1 
ATOM   1490 N N     . GLU A 1 208 ? -2.475 24.162  83.255  1.00 45.08  ? 205 GLU A N     1 
ATOM   1491 C CA    . GLU A 1 208 ? -3.723 24.293  82.509  1.00 58.89  ? 205 GLU A CA    1 
ATOM   1492 C C     . GLU A 1 208 ? -3.577 23.904  81.041  1.00 55.44  ? 205 GLU A C     1 
ATOM   1493 O O     . GLU A 1 208 ? -4.546 23.950  80.283  1.00 56.04  ? 205 GLU A O     1 
ATOM   1494 C CB    . GLU A 1 208 ? -4.259 25.723  82.616  1.00 65.14  ? 205 GLU A CB    1 
ATOM   1495 C CG    . GLU A 1 208 ? -4.761 26.101  83.998  1.00 72.63  ? 205 GLU A CG    1 
ATOM   1496 C CD    . GLU A 1 208 ? -5.138 27.566  84.101  1.00 86.90  ? 205 GLU A CD    1 
ATOM   1497 O OE1   . GLU A 1 208 ? -6.317 27.859  84.393  1.00 90.37  ? 205 GLU A OE1   1 
ATOM   1498 O OE2   . GLU A 1 208 ? -4.257 28.425  83.883  1.00 88.90  ? 205 GLU A OE2   1 
ATOM   1499 N N     . LEU A 1 209 ? -2.368 23.525  80.641  1.00 57.43  ? 206 LEU A N     1 
ATOM   1500 C CA    . LEU A 1 209 ? -2.106 23.176  79.249  1.00 56.82  ? 206 LEU A CA    1 
ATOM   1501 C C     . LEU A 1 209 ? -2.805 21.882  78.842  1.00 56.69  ? 206 LEU A C     1 
ATOM   1502 O O     . LEU A 1 209 ? -3.331 21.773  77.734  1.00 55.06  ? 206 LEU A O     1 
ATOM   1503 C CB    . LEU A 1 209 ? -0.603 23.067  78.990  1.00 64.95  ? 206 LEU A CB    1 
ATOM   1504 C CG    . LEU A 1 209 ? 0.199  24.357  79.165  1.00 65.89  ? 206 LEU A CG    1 
ATOM   1505 C CD1   . LEU A 1 209 ? 1.640  24.154  78.726  1.00 61.52  ? 206 LEU A CD1   1 
ATOM   1506 C CD2   . LEU A 1 209 ? -0.447 25.491  78.385  1.00 53.93  ? 206 LEU A CD2   1 
ATOM   1507 N N     . GLY A 1 210 ? -2.808 20.906  79.744  1.00 58.60  ? 207 GLY A N     1 
ATOM   1508 C CA    . GLY A 1 210 ? -3.431 19.624  79.474  1.00 67.58  ? 207 GLY A CA    1 
ATOM   1509 C C     . GLY A 1 210 ? -4.907 19.739  79.146  1.00 81.12  ? 207 GLY A C     1 
ATOM   1510 O O     . GLY A 1 210 ? -5.485 18.835  78.544  1.00 88.74  ? 207 GLY A O     1 
ATOM   1511 N N     . ASP A 1 211 ? -5.518 20.851  79.543  1.00 89.28  ? 208 ASP A N     1 
ATOM   1512 C CA    . ASP A 1 211 ? -6.941 21.075  79.302  1.00 92.69  ? 208 ASP A CA    1 
ATOM   1513 C C     . ASP A 1 211 ? -7.230 21.445  77.849  1.00 86.96  ? 208 ASP A C     1 
ATOM   1514 O O     . ASP A 1 211 ? -8.319 21.181  77.338  1.00 93.37  ? 208 ASP A O     1 
ATOM   1515 C CB    . ASP A 1 211 ? -7.476 22.168  80.231  1.00 94.72  ? 208 ASP A CB    1 
ATOM   1516 C CG    . ASP A 1 211 ? -7.485 21.745  81.688  1.00 98.77  ? 208 ASP A CG    1 
ATOM   1517 O OD1   . ASP A 1 211 ? -7.530 20.524  81.955  1.00 101.60 ? 208 ASP A OD1   1 
ATOM   1518 O OD2   . ASP A 1 211 ? -7.455 22.635  82.565  1.00 95.87  ? 208 ASP A OD2   1 
ATOM   1519 N N     . ASN A 1 212 ? -6.253 22.060  77.190  1.00 79.95  ? 209 ASN A N     1 
ATOM   1520 C CA    . ASN A 1 212 ? -6.420 22.487  75.804  1.00 77.12  ? 209 ASN A CA    1 
ATOM   1521 C C     . ASN A 1 212 ? -6.522 21.309  74.837  1.00 74.12  ? 209 ASN A C     1 
ATOM   1522 O O     . ASN A 1 212 ? -5.584 20.523  74.704  1.00 64.30  ? 209 ASN A O     1 
ATOM   1523 C CB    . ASN A 1 212 ? -5.281 23.421  75.386  1.00 72.48  ? 209 ASN A CB    1 
ATOM   1524 C CG    . ASN A 1 212 ? -5.541 24.099  74.053  1.00 83.99  ? 209 ASN A CG    1 
ATOM   1525 O OD1   . ASN A 1 212 ? -6.268 23.577  73.208  1.00 80.26  ? 209 ASN A OD1   1 
ATOM   1526 N ND2   . ASN A 1 212 ? -4.942 25.267  73.858  1.00 85.38  ? 209 ASN A ND2   1 
ATOM   1527 N N     . PRO A 1 213 ? -7.669 21.192  74.153  1.00 87.30  ? 210 PRO A N     1 
ATOM   1528 C CA    . PRO A 1 213 ? -7.963 20.092  73.224  1.00 96.34  ? 210 PRO A CA    1 
ATOM   1529 C C     . PRO A 1 213 ? -7.200 20.222  71.902  1.00 94.48  ? 210 PRO A C     1 
ATOM   1530 O O     . PRO A 1 213 ? -6.959 19.225  71.223  1.00 99.41  ? 210 PRO A O     1 
ATOM   1531 C CB    . PRO A 1 213 ? -9.473 20.232  72.972  1.00 104.57 ? 210 PRO A CB    1 
ATOM   1532 C CG    . PRO A 1 213 ? -9.970 21.187  74.035  1.00 106.21 ? 210 PRO A CG    1 
ATOM   1533 C CD    . PRO A 1 213 ? -8.823 22.085  74.340  1.00 93.77  ? 210 PRO A CD    1 
ATOM   1534 N N     . ASP A 1 214 ? -6.831 21.444  71.536  1.00 93.90  ? 211 ASP A N     1 
ATOM   1535 C CA    . ASP A 1 214 ? -6.108 21.683  70.291  1.00 96.00  ? 211 ASP A CA    1 
ATOM   1536 C C     . ASP A 1 214 ? -4.655 21.220  70.373  1.00 96.55  ? 211 ASP A C     1 
ATOM   1537 O O     . ASP A 1 214 ? -4.054 21.198  71.452  1.00 100.59 ? 211 ASP A O     1 
ATOM   1538 C CB    . ASP A 1 214 ? -6.134 23.172  69.950  1.00 103.82 ? 211 ASP A CB    1 
ATOM   1539 C CG    . ASP A 1 214 ? -7.531 23.690  69.710  1.00 113.75 ? 211 ASP A CG    1 
ATOM   1540 O OD1   . ASP A 1 214 ? -8.139 23.316  68.686  1.00 117.63 ? 211 ASP A OD1   1 
ATOM   1541 O OD2   . ASP A 1 214 ? -8.019 24.481  70.542  1.00 113.68 ? 211 ASP A OD2   1 
ATOM   1542 N N     . ARG A 1 215 ? -4.098 20.847  69.224  1.00 93.86  ? 212 ARG A N     1 
ATOM   1543 C CA    . ARG A 1 215 ? -2.670 20.586  69.114  1.00 79.62  ? 212 ARG A CA    1 
ATOM   1544 C C     . ARG A 1 215 ? -1.927 21.898  69.321  1.00 81.61  ? 212 ARG A C     1 
ATOM   1545 O O     . ARG A 1 215 ? -2.301 22.919  68.751  1.00 86.84  ? 212 ARG A O     1 
ATOM   1546 C CB    . ARG A 1 215 ? -2.330 20.000  67.742  1.00 84.89  ? 212 ARG A CB    1 
ATOM   1547 C CG    . ARG A 1 215 ? -0.833 19.892  67.455  1.00 85.07  ? 212 ARG A CG    1 
ATOM   1548 C CD    . ARG A 1 215 ? -0.579 19.249  66.098  1.00 85.13  ? 212 ARG A CD    1 
ATOM   1549 N NE    . ARG A 1 215 ? 0.827  19.302  65.709  1.00 81.27  ? 212 ARG A NE    1 
ATOM   1550 C CZ    . ARG A 1 215 ? 1.314  18.739  64.607  1.00 85.31  ? 212 ARG A CZ    1 
ATOM   1551 N NH1   . ARG A 1 215 ? 0.505  18.079  63.792  1.00 85.51  ? 212 ARG A NH1   1 
ATOM   1552 N NH2   . ARG A 1 215 ? 2.605  18.832  64.320  1.00 85.27  ? 212 ARG A NH2   1 
ATOM   1553 N N     . LEU A 1 216 ? -0.877 21.869  70.134  1.00 83.61  ? 213 LEU A N     1 
ATOM   1554 C CA    . LEU A 1 216 ? -0.170 23.091  70.512  1.00 74.23  ? 213 LEU A CA    1 
ATOM   1555 C C     . LEU A 1 216 ? 1.208  23.254  69.877  1.00 72.17  ? 213 LEU A C     1 
ATOM   1556 O O     . LEU A 1 216 ? 1.864  22.278  69.512  1.00 69.75  ? 213 LEU A O     1 
ATOM   1557 C CB    . LEU A 1 216 ? -0.046 23.188  72.036  1.00 62.84  ? 213 LEU A CB    1 
ATOM   1558 C CG    . LEU A 1 216 ? -1.111 24.028  72.745  1.00 67.16  ? 213 LEU A CG    1 
ATOM   1559 C CD1   . LEU A 1 216 ? -2.487 23.779  72.151  1.00 82.03  ? 213 LEU A CD1   1 
ATOM   1560 C CD2   . LEU A 1 216 ? -1.106 23.763  74.244  1.00 54.89  ? 213 LEU A CD2   1 
ATOM   1561 N N     . ALA A 1 217 ? 1.628  24.509  69.752  1.00 68.13  ? 214 ALA A N     1 
ATOM   1562 C CA    . ALA A 1 217 ? 2.981  24.852  69.338  1.00 61.23  ? 214 ALA A CA    1 
ATOM   1563 C C     . ALA A 1 217 ? 3.672  25.591  70.480  1.00 57.65  ? 214 ALA A C     1 
ATOM   1564 O O     . ALA A 1 217 ? 3.383  26.758  70.742  1.00 57.47  ? 214 ALA A O     1 
ATOM   1565 C CB    . ALA A 1 217 ? 2.952  25.711  68.086  1.00 60.84  ? 214 ALA A CB    1 
ATOM   1566 N N     . LEU A 1 218 ? 4.578  24.903  71.164  1.00 62.62  ? 215 LEU A N     1 
ATOM   1567 C CA    . LEU A 1 218 ? 5.215  25.453  72.354  1.00 59.81  ? 215 LEU A CA    1 
ATOM   1568 C C     . LEU A 1 218 ? 6.484  26.223  72.008  1.00 55.20  ? 215 LEU A C     1 
ATOM   1569 O O     . LEU A 1 218 ? 7.404  25.678  71.400  1.00 53.35  ? 215 LEU A O     1 
ATOM   1570 C CB    . LEU A 1 218 ? 5.530  24.333  73.346  1.00 52.10  ? 215 LEU A CB    1 
ATOM   1571 C CG    . LEU A 1 218 ? 4.400  23.320  73.546  1.00 50.47  ? 215 LEU A CG    1 
ATOM   1572 C CD1   . LEU A 1 218 ? 4.856  22.153  74.407  1.00 53.60  ? 215 LEU A CD1   1 
ATOM   1573 C CD2   . LEU A 1 218 ? 3.179  23.995  74.149  1.00 54.01  ? 215 LEU A CD2   1 
ATOM   1574 N N     . LEU A 1 219 ? 6.526  27.491  72.405  1.00 52.61  ? 216 LEU A N     1 
ATOM   1575 C CA    . LEU A 1 219 ? 7.656  28.361  72.095  1.00 53.65  ? 216 LEU A CA    1 
ATOM   1576 C C     . LEU A 1 219 ? 8.514  28.667  73.320  1.00 50.23  ? 216 LEU A C     1 
ATOM   1577 O O     . LEU A 1 219 ? 7.999  29.018  74.382  1.00 47.94  ? 216 LEU A O     1 
ATOM   1578 C CB    . LEU A 1 219 ? 7.165  29.668  71.469  1.00 61.57  ? 216 LEU A CB    1 
ATOM   1579 C CG    . LEU A 1 219 ? 8.237  30.733  71.231  1.00 58.15  ? 216 LEU A CG    1 
ATOM   1580 C CD1   . LEU A 1 219 ? 9.276  30.237  70.237  1.00 55.60  ? 216 LEU A CD1   1 
ATOM   1581 C CD2   . LEU A 1 219 ? 7.608  32.029  70.751  1.00 62.16  ? 216 LEU A CD2   1 
ATOM   1582 N N     . PHE A 1 220 ? 9.827  28.539  73.158  1.00 50.96  ? 217 PHE A N     1 
ATOM   1583 C CA    . PHE A 1 220 ? 10.771 28.835  74.228  1.00 47.75  ? 217 PHE A CA    1 
ATOM   1584 C C     . PHE A 1 220 ? 11.885 29.740  73.716  1.00 57.01  ? 217 PHE A C     1 
ATOM   1585 O O     . PHE A 1 220 ? 12.446 29.503  72.646  1.00 54.11  ? 217 PHE A O     1 
ATOM   1586 C CB    . PHE A 1 220 ? 11.381 27.545  74.780  1.00 44.53  ? 217 PHE A CB    1 
ATOM   1587 C CG    . PHE A 1 220 ? 10.365 26.540  75.243  1.00 47.99  ? 217 PHE A CG    1 
ATOM   1588 C CD1   . PHE A 1 220 ? 10.032 26.438  76.583  1.00 45.86  ? 217 PHE A CD1   1 
ATOM   1589 C CD2   . PHE A 1 220 ? 9.749  25.693  74.338  1.00 41.24  ? 217 PHE A CD2   1 
ATOM   1590 C CE1   . PHE A 1 220 ? 9.101  25.513  77.010  1.00 50.25  ? 217 PHE A CE1   1 
ATOM   1591 C CE2   . PHE A 1 220 ? 8.816  24.767  74.759  1.00 47.01  ? 217 PHE A CE2   1 
ATOM   1592 C CZ    . PHE A 1 220 ? 8.492  24.676  76.097  1.00 52.46  ? 217 PHE A CZ    1 
ATOM   1593 N N     . GLY A 1 221 ? 12.203 30.778  74.482  1.00 50.91  ? 218 GLY A N     1 
ATOM   1594 C CA    . GLY A 1 221 ? 13.296 31.666  74.133  1.00 62.72  ? 218 GLY A CA    1 
ATOM   1595 C C     . GLY A 1 221 ? 14.607 31.175  74.715  1.00 66.60  ? 218 GLY A C     1 
ATOM   1596 O O     . GLY A 1 221 ? 14.669 30.093  75.299  1.00 55.48  ? 218 GLY A O     1 
ATOM   1597 N N     . SER A 1 222 ? 15.660 31.968  74.553  1.00 74.33  ? 219 SER A N     1 
ATOM   1598 C CA    . SER A 1 222 ? 16.961 31.629  75.115  1.00 72.99  ? 219 SER A CA    1 
ATOM   1599 C C     . SER A 1 222 ? 17.262 32.523  76.311  1.00 80.51  ? 219 SER A C     1 
ATOM   1600 O O     . SER A 1 222 ? 18.062 32.174  77.178  1.00 78.34  ? 219 SER A O     1 
ATOM   1601 C CB    . SER A 1 222 ? 18.057 31.774  74.060  1.00 79.08  ? 219 SER A CB    1 
ATOM   1602 O OG    . SER A 1 222 ? 18.112 33.099  73.561  1.00 86.71  ? 219 SER A OG    1 
ATOM   1603 N N     . GLU A 1 223 ? 16.607 33.679  76.348  1.00 87.76  ? 220 GLU A N     1 
ATOM   1604 C CA    . GLU A 1 223 ? 16.805 34.649  77.415  1.00 88.66  ? 220 GLU A CA    1 
ATOM   1605 C C     . GLU A 1 223 ? 15.657 34.607  78.412  1.00 92.34  ? 220 GLU A C     1 
ATOM   1606 O O     . GLU A 1 223 ? 14.600 34.042  78.134  1.00 90.26  ? 220 GLU A O     1 
ATOM   1607 C CB    . GLU A 1 223 ? 16.906 36.059  76.831  1.00 90.74  ? 220 GLU A CB    1 
ATOM   1608 C CG    . GLU A 1 223 ? 18.028 36.251  75.825  1.00 106.98 ? 220 GLU A CG    1 
ATOM   1609 C CD    . GLU A 1 223 ? 19.382 36.412  76.485  1.00 121.33 ? 220 GLU A CD    1 
ATOM   1610 O OE1   . GLU A 1 223 ? 19.725 35.586  77.356  1.00 126.39 ? 220 GLU A OE1   1 
ATOM   1611 O OE2   . GLU A 1 223 ? 20.105 37.366  76.128  1.00 124.78 ? 220 GLU A OE2   1 
ATOM   1612 N N     . LYS A 1 224 ? 15.871 35.209  79.577  1.00 98.16  ? 221 LYS A N     1 
ATOM   1613 C CA    . LYS A 1 224 ? 14.795 35.398  80.537  1.00 97.75  ? 221 LYS A CA    1 
ATOM   1614 C C     . LYS A 1 224 ? 13.883 36.497  80.013  1.00 105.62 ? 221 LYS A C     1 
ATOM   1615 O O     . LYS A 1 224 ? 12.715 36.591  80.390  1.00 98.85  ? 221 LYS A O     1 
ATOM   1616 C CB    . LYS A 1 224 ? 15.353 35.759  81.913  1.00 99.11  ? 221 LYS A CB    1 
ATOM   1617 C CG    . LYS A 1 224 ? 14.324 35.725  83.029  1.00 103.65 ? 221 LYS A CG    1 
ATOM   1618 C CD    . LYS A 1 224 ? 14.981 35.444  84.371  1.00 107.47 ? 221 LYS A CD    1 
ATOM   1619 C CE    . LYS A 1 224 ? 15.960 36.539  84.756  1.00 110.67 ? 221 LYS A CE    1 
ATOM   1620 N NZ    . LYS A 1 224 ? 15.261 37.800  85.127  1.00 109.51 ? 221 LYS A NZ    1 
ATOM   1621 N N     . GLY A 1 225 ? 14.433 37.320  79.127  1.00 114.71 ? 222 GLY A N     1 
ATOM   1622 C CA    . GLY A 1 225 ? 13.674 38.357  78.455  1.00 120.66 ? 222 GLY A CA    1 
ATOM   1623 C C     . GLY A 1 225 ? 13.212 37.908  77.081  1.00 124.02 ? 222 GLY A C     1 
ATOM   1624 O O     . GLY A 1 225 ? 12.695 38.706  76.299  1.00 126.50 ? 222 GLY A O     1 
ATOM   1625 N N     . GLY A 1 226 ? 13.406 36.625  76.787  1.00 120.75 ? 223 GLY A N     1 
ATOM   1626 C CA    . GLY A 1 226 ? 12.948 36.045  75.536  1.00 110.83 ? 223 GLY A CA    1 
ATOM   1627 C C     . GLY A 1 226 ? 11.591 35.390  75.708  1.00 103.97 ? 223 GLY A C     1 
ATOM   1628 O O     . GLY A 1 226 ? 11.037 35.404  76.807  1.00 110.74 ? 223 GLY A O     1 
ATOM   1629 N N     . PRO A 1 227 ? 11.039 34.819  74.624  1.00 88.31  ? 224 PRO A N     1 
ATOM   1630 C CA    . PRO A 1 227 ? 11.626 34.816  73.279  1.00 90.83  ? 224 PRO A CA    1 
ATOM   1631 C C     . PRO A 1 227 ? 11.421 36.149  72.574  1.00 94.30  ? 224 PRO A C     1 
ATOM   1632 O O     . PRO A 1 227 ? 10.756 37.033  73.112  1.00 98.44  ? 224 PRO A O     1 
ATOM   1633 C CB    . PRO A 1 227 ? 10.825 33.732  72.541  1.00 87.53  ? 224 PRO A CB    1 
ATOM   1634 C CG    . PRO A 1 227 ? 9.983  33.052  73.580  1.00 89.43  ? 224 PRO A CG    1 
ATOM   1635 C CD    . PRO A 1 227 ? 9.787  34.049  74.669  1.00 86.15  ? 224 PRO A CD    1 
ATOM   1636 N N     . SER A 1 228 ? 11.980 36.275  71.374  1.00 92.13  ? 225 SER A N     1 
ATOM   1637 C CA    . SER A 1 228 ? 11.827 37.479  70.566  1.00 92.41  ? 225 SER A CA    1 
ATOM   1638 C C     . SER A 1 228 ? 10.373 37.933  70.532  1.00 88.73  ? 225 SER A C     1 
ATOM   1639 O O     . SER A 1 228 ? 9.484  37.176  70.140  1.00 85.98  ? 225 SER A O     1 
ATOM   1640 C CB    . SER A 1 228 ? 12.332 37.238  69.142  1.00 96.64  ? 225 SER A CB    1 
ATOM   1641 O OG    . SER A 1 228 ? 12.069 38.355  68.310  1.00 108.35 ? 225 SER A OG    1 
ATOM   1642 N N     . ASP A 1 229 ? 10.140 39.174  70.947  1.00 97.03  ? 226 ASP A N     1 
ATOM   1643 C CA    . ASP A 1 229 ? 8.790  39.722  71.027  1.00 105.00 ? 226 ASP A CA    1 
ATOM   1644 C C     . ASP A 1 229 ? 8.093  39.792  69.668  1.00 92.58  ? 226 ASP A C     1 
ATOM   1645 O O     . ASP A 1 229 ? 6.931  40.190  69.578  1.00 78.84  ? 226 ASP A O     1 
ATOM   1646 C CB    . ASP A 1 229 ? 8.810  41.102  71.693  1.00 115.52 ? 226 ASP A CB    1 
ATOM   1647 C CG    . ASP A 1 229 ? 9.865  42.021  71.105  1.00 121.81 ? 226 ASP A CG    1 
ATOM   1648 O OD1   . ASP A 1 229 ? 10.484 41.650  70.085  1.00 122.54 ? 226 ASP A OD1   1 
ATOM   1649 O OD2   . ASP A 1 229 ? 10.076 43.118  71.664  1.00 126.73 ? 226 ASP A OD2   1 
ATOM   1650 N N     . LEU A 1 230 ? 8.803  39.402  68.614  1.00 88.18  ? 227 LEU A N     1 
ATOM   1651 C CA    . LEU A 1 230 ? 8.224  39.367  67.276  1.00 92.61  ? 227 LEU A CA    1 
ATOM   1652 C C     . LEU A 1 230 ? 7.330  38.141  67.099  1.00 97.45  ? 227 LEU A C     1 
ATOM   1653 O O     . LEU A 1 230 ? 6.653  37.996  66.082  1.00 105.35 ? 227 LEU A O     1 
ATOM   1654 C CB    . LEU A 1 230 ? 9.323  39.391  66.212  1.00 100.83 ? 227 LEU A CB    1 
ATOM   1655 C CG    . LEU A 1 230 ? 10.194 40.650  66.188  1.00 107.25 ? 227 LEU A CG    1 
ATOM   1656 C CD1   . LEU A 1 230 ? 11.144 40.625  65.001  1.00 107.01 ? 227 LEU A CD1   1 
ATOM   1657 C CD2   . LEU A 1 230 ? 9.330  41.903  66.159  1.00 104.09 ? 227 LEU A CD2   1 
ATOM   1658 N N     . PHE A 1 231 ? 7.336  37.263  68.097  1.00 96.33  ? 228 PHE A N     1 
ATOM   1659 C CA    . PHE A 1 231 ? 6.474  36.087  68.097  1.00 94.21  ? 228 PHE A CA    1 
ATOM   1660 C C     . PHE A 1 231 ? 5.146  36.390  68.784  1.00 91.89  ? 228 PHE A C     1 
ATOM   1661 O O     . PHE A 1 231 ? 4.252  35.547  68.823  1.00 87.61  ? 228 PHE A O     1 
ATOM   1662 C CB    . PHE A 1 231 ? 7.156  34.918  68.813  1.00 88.66  ? 228 PHE A CB    1 
ATOM   1663 C CG    . PHE A 1 231 ? 8.021  34.072  67.922  1.00 86.78  ? 228 PHE A CG    1 
ATOM   1664 C CD1   . PHE A 1 231 ? 9.386  34.291  67.848  1.00 85.40  ? 228 PHE A CD1   1 
ATOM   1665 C CD2   . PHE A 1 231 ? 7.470  33.046  67.170  1.00 86.26  ? 228 PHE A CD2   1 
ATOM   1666 C CE1   . PHE A 1 231 ? 10.185 33.507  67.033  1.00 85.82  ? 228 PHE A CE1   1 
ATOM   1667 C CE2   . PHE A 1 231 ? 8.263  32.261  66.356  1.00 85.21  ? 228 PHE A CE2   1 
ATOM   1668 C CZ    . PHE A 1 231 ? 9.621  32.492  66.286  1.00 85.57  ? 228 PHE A CZ    1 
ATOM   1669 N N     . GLU A 1 232 ? 5.025  37.599  69.323  1.00 95.78  ? 229 GLU A N     1 
ATOM   1670 C CA    . GLU A 1 232 ? 3.860  37.978  70.119  1.00 102.74 ? 229 GLU A CA    1 
ATOM   1671 C C     . GLU A 1 232 ? 2.535  37.895  69.360  1.00 105.01 ? 229 GLU A C     1 
ATOM   1672 O O     . GLU A 1 232 ? 1.616  37.201  69.794  1.00 101.19 ? 229 GLU A O     1 
ATOM   1673 C CB    . GLU A 1 232 ? 4.047  39.372  70.724  1.00 114.53 ? 229 GLU A CB    1 
ATOM   1674 C CG    . GLU A 1 232 ? 5.005  39.403  71.905  1.00 121.11 ? 229 GLU A CG    1 
ATOM   1675 C CD    . GLU A 1 232 ? 4.457  38.672  73.116  1.00 128.14 ? 229 GLU A CD    1 
ATOM   1676 O OE1   . GLU A 1 232 ? 3.305  38.953  73.510  1.00 133.16 ? 229 GLU A OE1   1 
ATOM   1677 O OE2   . GLU A 1 232 ? 5.180  37.822  73.678  1.00 125.76 ? 229 GLU A OE2   1 
ATOM   1678 N N     . GLU A 1 233 ? 2.434  38.604  68.239  1.00 105.91 ? 230 GLU A N     1 
ATOM   1679 C CA    . GLU A 1 233 ? 1.208  38.585  67.444  1.00 105.53 ? 230 GLU A CA    1 
ATOM   1680 C C     . GLU A 1 233 ? 0.715  37.163  67.204  1.00 108.92 ? 230 GLU A C     1 
ATOM   1681 O O     . GLU A 1 233 ? -0.455 36.855  67.434  1.00 110.33 ? 230 GLU A O     1 
ATOM   1682 C CB    . GLU A 1 233 ? 1.400  39.296  66.103  1.00 101.43 ? 230 GLU A CB    1 
ATOM   1683 C CG    . GLU A 1 233 ? 1.057  40.775  66.119  1.00 108.39 ? 230 GLU A CG    1 
ATOM   1684 C CD    . GLU A 1 233 ? 0.397  41.226  64.829  1.00 129.24 ? 230 GLU A CD    1 
ATOM   1685 O OE1   . GLU A 1 233 ? -0.697 40.713  64.511  1.00 136.71 ? 230 GLU A OE1   1 
ATOM   1686 O OE2   . GLU A 1 233 ? 0.966  42.094  64.135  1.00 133.07 ? 230 GLU A OE2   1 
ATOM   1687 N N     . ALA A 1 234 ? 1.612  36.302  66.735  1.00 106.11 ? 231 ALA A N     1 
ATOM   1688 C CA    . ALA A 1 234 ? 1.271  34.910  66.476  1.00 104.55 ? 231 ALA A CA    1 
ATOM   1689 C C     . ALA A 1 234 ? 0.896  34.195  67.769  1.00 101.48 ? 231 ALA A C     1 
ATOM   1690 O O     . ALA A 1 234 ? -0.036 33.390  67.797  1.00 105.29 ? 231 ALA A O     1 
ATOM   1691 C CB    . ALA A 1 234 ? 2.426  34.200  65.788  1.00 101.83 ? 231 ALA A CB    1 
ATOM   1692 N N     . SER A 1 235 ? 1.626  34.497  68.837  1.00 94.65  ? 232 SER A N     1 
ATOM   1693 C CA    . SER A 1 235 ? 1.360  33.910  70.145  1.00 85.39  ? 232 SER A CA    1 
ATOM   1694 C C     . SER A 1 235 ? -0.024 34.302  70.649  1.00 86.42  ? 232 SER A C     1 
ATOM   1695 O O     . SER A 1 235 ? -0.342 35.487  70.759  1.00 90.90  ? 232 SER A O     1 
ATOM   1696 C CB    . SER A 1 235 ? 2.427  34.340  71.153  1.00 75.14  ? 232 SER A CB    1 
ATOM   1697 O OG    . SER A 1 235 ? 2.131  33.851  72.450  1.00 70.44  ? 232 SER A OG    1 
ATOM   1698 N N     . SER A 1 236 ? -0.842 33.301  70.958  1.00 79.77  ? 233 SER A N     1 
ATOM   1699 C CA    . SER A 1 236 ? -2.203 33.541  71.418  1.00 84.74  ? 233 SER A CA    1 
ATOM   1700 C C     . SER A 1 236 ? -2.327 33.397  72.933  1.00 87.19  ? 233 SER A C     1 
ATOM   1701 O O     . SER A 1 236 ? -3.413 33.557  73.490  1.00 95.36  ? 233 SER A O     1 
ATOM   1702 C CB    . SER A 1 236 ? -3.177 32.592  70.718  1.00 88.01  ? 233 SER A CB    1 
ATOM   1703 O OG    . SER A 1 236 ? -2.849 31.240  70.985  1.00 88.78  ? 233 SER A OG    1 
ATOM   1704 N N     . ALA A 1 237 ? -1.212 33.094  73.592  1.00 73.11  ? 234 ALA A N     1 
ATOM   1705 C CA    . ALA A 1 237 ? -1.204 32.930  75.043  1.00 76.72  ? 234 ALA A CA    1 
ATOM   1706 C C     . ALA A 1 237 ? 0.209  32.774  75.599  1.00 75.94  ? 234 ALA A C     1 
ATOM   1707 O O     . ALA A 1 237 ? 1.102  32.264  74.923  1.00 76.59  ? 234 ALA A O     1 
ATOM   1708 C CB    . ALA A 1 237 ? -2.062 31.740  75.448  1.00 80.30  ? 234 ALA A CB    1 
ATOM   1709 N N     . SER A 1 238 ? 0.398  33.214  76.839  1.00 68.72  ? 235 SER A N     1 
ATOM   1710 C CA    . SER A 1 238 ? 1.673  33.057  77.528  1.00 59.80  ? 235 SER A CA    1 
ATOM   1711 C C     . SER A 1 238 ? 1.528  32.086  78.695  1.00 58.97  ? 235 SER A C     1 
ATOM   1712 O O     . SER A 1 238 ? 0.581  32.179  79.475  1.00 65.99  ? 235 SER A O     1 
ATOM   1713 C CB    . SER A 1 238 ? 2.190  34.411  78.020  1.00 60.54  ? 235 SER A CB    1 
ATOM   1714 O OG    . SER A 1 238 ? 1.267  35.018  78.910  1.00 66.59  ? 235 SER A OG    1 
ATOM   1715 N N     . VAL A 1 239 ? 2.469  31.155  78.812  1.00 51.30  ? 236 VAL A N     1 
ATOM   1716 C CA    . VAL A 1 239 ? 2.389  30.111  79.829  1.00 57.47  ? 236 VAL A CA    1 
ATOM   1717 C C     . VAL A 1 239 ? 3.531  30.200  80.840  1.00 54.19  ? 236 VAL A C     1 
ATOM   1718 O O     . VAL A 1 239 ? 4.697  30.324  80.467  1.00 51.22  ? 236 VAL A O     1 
ATOM   1719 C CB    . VAL A 1 239 ? 2.380  28.710  79.191  1.00 53.59  ? 236 VAL A CB    1 
ATOM   1720 C CG1   . VAL A 1 239 ? 2.258  27.642  80.260  1.00 42.91  ? 236 VAL A CG1   1 
ATOM   1721 C CG2   . VAL A 1 239 ? 1.242  28.599  78.188  1.00 57.67  ? 236 VAL A CG2   1 
ATOM   1722 N N     . SER A 1 240 ? 3.187  30.129  82.122  1.00 52.43  ? 237 SER A N     1 
ATOM   1723 C CA    . SER A 1 240 ? 4.171  30.262  83.190  1.00 44.21  ? 237 SER A CA    1 
ATOM   1724 C C     . SER A 1 240 ? 4.228  29.030  84.087  1.00 49.86  ? 237 SER A C     1 
ATOM   1725 O O     . SER A 1 240 ? 3.198  28.497  84.498  1.00 52.63  ? 237 SER A O     1 
ATOM   1726 C CB    . SER A 1 240 ? 3.876  31.505  84.033  1.00 47.98  ? 237 SER A CB    1 
ATOM   1727 O OG    . SER A 1 240 ? 4.679  31.536  85.199  1.00 56.69  ? 237 SER A OG    1 
ATOM   1728 N N     . ILE A 1 241 ? 5.444  28.585  84.387  1.00 47.29  ? 238 ILE A N     1 
ATOM   1729 C CA    . ILE A 1 241 ? 5.660  27.484  85.315  1.00 34.51  ? 238 ILE A CA    1 
ATOM   1730 C C     . ILE A 1 241 ? 5.877  28.036  86.719  1.00 41.36  ? 238 ILE A C     1 
ATOM   1731 O O     . ILE A 1 241 ? 6.796  28.823  86.945  1.00 50.77  ? 238 ILE A O     1 
ATOM   1732 C CB    . ILE A 1 241 ? 6.883  26.634  84.911  1.00 30.40  ? 238 ILE A CB    1 
ATOM   1733 C CG1   . ILE A 1 241 ? 6.686  26.043  83.515  1.00 35.07  ? 238 ILE A CG1   1 
ATOM   1734 C CG2   . ILE A 1 241 ? 7.130  25.529  85.928  1.00 32.70  ? 238 ILE A CG2   1 
ATOM   1735 C CD1   . ILE A 1 241 ? 7.883  25.273  83.002  1.00 36.90  ? 238 ILE A CD1   1 
ATOM   1736 N N     . PRO A 1 242 ? 5.020  27.633  87.667  1.00 38.94  ? 239 PRO A N     1 
ATOM   1737 C CA    . PRO A 1 242 ? 5.109  28.104  89.053  1.00 37.39  ? 239 PRO A CA    1 
ATOM   1738 C C     . PRO A 1 242 ? 6.459  27.782  89.686  1.00 45.81  ? 239 PRO A C     1 
ATOM   1739 O O     . PRO A 1 242 ? 6.993  26.690  89.494  1.00 44.08  ? 239 PRO A O     1 
ATOM   1740 C CB    . PRO A 1 242 ? 3.995  27.324  89.758  1.00 34.42  ? 239 PRO A CB    1 
ATOM   1741 C CG    . PRO A 1 242 ? 3.026  26.990  88.676  1.00 41.06  ? 239 PRO A CG    1 
ATOM   1742 C CD    . PRO A 1 242 ? 3.860  26.752  87.454  1.00 33.94  ? 239 PRO A CD    1 
ATOM   1743 N N     . MET A 1 243 ? 7.004  28.739  90.428  1.00 46.21  ? 240 MET A N     1 
ATOM   1744 C CA    . MET A 1 243 ? 8.254  28.547  91.151  1.00 44.55  ? 240 MET A CA    1 
ATOM   1745 C C     . MET A 1 243 ? 8.106  29.163  92.533  1.00 55.00  ? 240 MET A C     1 
ATOM   1746 O O     . MET A 1 243 ? 7.073  29.757  92.839  1.00 54.68  ? 240 MET A O     1 
ATOM   1747 C CB    . MET A 1 243 ? 9.413  29.207  90.402  1.00 36.17  ? 240 MET A CB    1 
ATOM   1748 C CG    . MET A 1 243 ? 9.579  28.729  88.968  1.00 37.06  ? 240 MET A CG    1 
ATOM   1749 S SD    . MET A 1 243 ? 10.856 29.634  88.075  1.00 48.19  ? 240 MET A SD    1 
ATOM   1750 C CE    . MET A 1 243 ? 10.209 31.300  88.154  1.00 54.69  ? 240 MET A CE    1 
ATOM   1751 N N     . MET A 1 244 ? 9.129  29.022  93.369  1.00 50.88  ? 241 MET A N     1 
ATOM   1752 C CA    . MET A 1 244 ? 9.108  29.631  94.694  1.00 62.67  ? 241 MET A CA    1 
ATOM   1753 C C     . MET A 1 244 ? 8.901  31.136  94.568  1.00 77.35  ? 241 MET A C     1 
ATOM   1754 O O     . MET A 1 244 ? 8.428  31.794  95.495  1.00 81.72  ? 241 MET A O     1 
ATOM   1755 C CB    . MET A 1 244 ? 10.400 29.325  95.452  1.00 65.96  ? 241 MET A CB    1 
ATOM   1756 C CG    . MET A 1 244 ? 10.607 27.846  95.729  1.00 73.01  ? 241 MET A CG    1 
ATOM   1757 S SD    . MET A 1 244 ? 9.196  27.104  96.573  1.00 83.72  ? 241 MET A SD    1 
ATOM   1758 C CE    . MET A 1 244 ? 9.312  27.889  98.179  1.00 76.77  ? 241 MET A CE    1 
ATOM   1759 N N     . SER A 1 245 ? 9.256  31.665  93.402  1.00 87.18  ? 242 SER A N     1 
ATOM   1760 C CA    . SER A 1 245 ? 9.053  33.070  93.081  1.00 97.20  ? 242 SER A CA    1 
ATOM   1761 C C     . SER A 1 245 ? 9.393  33.297  91.612  1.00 104.29 ? 242 SER A C     1 
ATOM   1762 O O     . SER A 1 245 ? 10.441 32.857  91.140  1.00 105.18 ? 242 SER A O     1 
ATOM   1763 C CB    . SER A 1 245 ? 9.920  33.960  93.973  1.00 92.48  ? 242 SER A CB    1 
ATOM   1764 O OG    . SER A 1 245 ? 11.289 33.608  93.868  1.00 89.15  ? 242 SER A OG    1 
ATOM   1765 N N     . GLN A 1 246 ? 8.505  33.974  90.891  1.00 112.65 ? 243 GLN A N     1 
ATOM   1766 C CA    . GLN A 1 246 ? 8.709  34.223  89.466  1.00 117.20 ? 243 GLN A CA    1 
ATOM   1767 C C     . GLN A 1 246 ? 9.867  35.189  89.234  1.00 124.47 ? 243 GLN A C     1 
ATOM   1768 O O     . GLN A 1 246 ? 10.128 35.604  88.104  1.00 129.54 ? 243 GLN A O     1 
ATOM   1769 C CB    . GLN A 1 246 ? 7.434  34.773  88.821  1.00 114.68 ? 243 GLN A CB    1 
ATOM   1770 C CG    . GLN A 1 246 ? 6.158  34.062  89.249  1.00 112.79 ? 243 GLN A CG    1 
ATOM   1771 C CD    . GLN A 1 246 ? 6.112  32.610  88.816  1.00 103.93 ? 243 GLN A CD    1 
ATOM   1772 O OE1   . GLN A 1 246 ? 6.119  32.305  87.624  1.00 104.41 ? 243 GLN A OE1   1 
ATOM   1773 N NE2   . GLN A 1 246 ? 6.049  31.706  89.787  1.00 82.66  ? 243 GLN A NE2   1 
ATOM   1774 N N     . THR A 1 247 ? 10.556 35.546  90.313  1.00 126.01 ? 244 THR A N     1 
ATOM   1775 C CA    . THR A 1 247 ? 11.698 36.447  90.234  1.00 127.25 ? 244 THR A CA    1 
ATOM   1776 C C     . THR A 1 247 ? 12.875 35.763  89.549  1.00 116.31 ? 244 THR A C     1 
ATOM   1777 O O     . THR A 1 247 ? 13.804 36.420  89.081  1.00 114.02 ? 244 THR A O     1 
ATOM   1778 C CB    . THR A 1 247 ? 12.136 36.918  91.633  1.00 131.45 ? 244 THR A CB    1 
ATOM   1779 O OG1   . THR A 1 247 ? 13.014 38.043  91.510  1.00 134.57 ? 244 THR A OG1   1 
ATOM   1780 C CG2   . THR A 1 247 ? 12.850 35.797  92.375  1.00 127.82 ? 244 THR A CG2   1 
ATOM   1781 N N     . GLU A 1 248 ? 12.826 34.437  89.494  1.00 102.05 ? 245 GLU A N     1 
ATOM   1782 C CA    . GLU A 1 248 ? 13.888 33.651  88.881  1.00 93.54  ? 245 GLU A CA    1 
ATOM   1783 C C     . GLU A 1 248 ? 13.408 33.034  87.575  1.00 82.25  ? 245 GLU A C     1 
ATOM   1784 O O     . GLU A 1 248 ? 12.452 33.520  86.969  1.00 75.40  ? 245 GLU A O     1 
ATOM   1785 C CB    . GLU A 1 248 ? 14.361 32.564  89.847  1.00 98.04  ? 245 GLU A CB    1 
ATOM   1786 C CG    . GLU A 1 248 ? 13.232 31.771  90.483  1.00 98.70  ? 245 GLU A CG    1 
ATOM   1787 C CD    . GLU A 1 248 ? 13.568 31.307  91.886  1.00 101.86 ? 245 GLU A CD    1 
ATOM   1788 O OE1   . GLU A 1 248 ? 14.720 31.517  92.321  1.00 108.53 ? 245 GLU A OE1   1 
ATOM   1789 O OE2   . GLU A 1 248 ? 12.680 30.738  92.556  1.00 96.75  ? 245 GLU A OE2   1 
ATOM   1790 N N     . SER A 1 249 ? 14.071 31.967  87.143  1.00 78.27  ? 246 SER A N     1 
ATOM   1791 C CA    . SER A 1 249 ? 13.693 31.291  85.906  1.00 75.95  ? 246 SER A CA    1 
ATOM   1792 C C     . SER A 1 249 ? 14.337 29.912  85.774  1.00 75.85  ? 246 SER A C     1 
ATOM   1793 O O     . SER A 1 249 ? 15.410 29.658  86.320  1.00 86.12  ? 246 SER A O     1 
ATOM   1794 C CB    . SER A 1 249 ? 14.046 32.155  84.695  1.00 78.46  ? 246 SER A CB    1 
ATOM   1795 O OG    . SER A 1 249 ? 13.442 31.645  83.521  1.00 85.72  ? 246 SER A OG    1 
ATOM   1796 N N     . LEU A 1 250 ? 13.669 29.029  85.039  1.00 59.61  ? 247 LEU A N     1 
ATOM   1797 C CA    . LEU A 1 250 ? 14.135 27.658  84.857  1.00 55.89  ? 247 LEU A CA    1 
ATOM   1798 C C     . LEU A 1 250 ? 15.003 27.507  83.615  1.00 58.94  ? 247 LEU A C     1 
ATOM   1799 O O     . LEU A 1 250 ? 14.907 28.297  82.677  1.00 64.34  ? 247 LEU A O     1 
ATOM   1800 C CB    . LEU A 1 250 ? 12.942 26.701  84.768  1.00 45.79  ? 247 LEU A CB    1 
ATOM   1801 C CG    . LEU A 1 250 ? 12.489 25.984  86.043  1.00 46.82  ? 247 LEU A CG    1 
ATOM   1802 C CD1   . LEU A 1 250 ? 12.621 26.877  87.266  1.00 49.00  ? 247 LEU A CD1   1 
ATOM   1803 C CD2   . LEU A 1 250 ? 11.063 25.472  85.890  1.00 44.52  ? 247 LEU A CD2   1 
ATOM   1804 N N     . ASN A 1 251 ? 15.855 26.486  83.618  1.00 48.18  ? 248 ASN A N     1 
ATOM   1805 C CA    . ASN A 1 251 ? 16.645 26.141  82.443  1.00 34.42  ? 248 ASN A CA    1 
ATOM   1806 C C     . ASN A 1 251 ? 15.719 25.772  81.288  1.00 36.29  ? 248 ASN A C     1 
ATOM   1807 O O     . ASN A 1 251 ? 14.635 25.234  81.507  1.00 48.74  ? 248 ASN A O     1 
ATOM   1808 C CB    . ASN A 1 251 ? 17.599 24.989  82.769  1.00 48.35  ? 248 ASN A CB    1 
ATOM   1809 C CG    . ASN A 1 251 ? 18.348 24.484  81.553  1.00 63.12  ? 248 ASN A CG    1 
ATOM   1810 O OD1   . ASN A 1 251 ? 17.767 23.859  80.667  1.00 69.31  ? 248 ASN A OD1   1 
ATOM   1811 N ND2   . ASN A 1 251 ? 19.650 24.741  81.512  1.00 72.37  ? 248 ASN A ND2   1 
ATOM   1812 N N     . VAL A 1 252 ? 16.141 26.065  80.061  1.00 28.52  ? 249 VAL A N     1 
ATOM   1813 C CA    . VAL A 1 252 ? 15.278 25.875  78.897  1.00 36.76  ? 249 VAL A CA    1 
ATOM   1814 C C     . VAL A 1 252 ? 14.820 24.425  78.717  1.00 40.94  ? 249 VAL A C     1 
ATOM   1815 O O     . VAL A 1 252 ? 13.650 24.169  78.435  1.00 43.67  ? 249 VAL A O     1 
ATOM   1816 C CB    . VAL A 1 252 ? 15.940 26.383  77.596  1.00 36.35  ? 249 VAL A CB    1 
ATOM   1817 C CG1   . VAL A 1 252 ? 17.223 25.619  77.311  1.00 35.87  ? 249 VAL A CG1   1 
ATOM   1818 C CG2   . VAL A 1 252 ? 14.970 26.269  76.428  1.00 29.87  ? 249 VAL A CG2   1 
ATOM   1819 N N     . SER A 1 253 ? 15.739 23.479  78.885  1.00 37.45  ? 250 SER A N     1 
ATOM   1820 C CA    . SER A 1 253 ? 15.405 22.066  78.725  1.00 39.50  ? 250 SER A CA    1 
ATOM   1821 C C     . SER A 1 253 ? 14.471 21.586  79.835  1.00 35.58  ? 250 SER A C     1 
ATOM   1822 O O     . SER A 1 253 ? 13.572 20.782  79.596  1.00 41.74  ? 250 SER A O     1 
ATOM   1823 C CB    . SER A 1 253 ? 16.671 21.208  78.684  1.00 30.78  ? 250 SER A CB    1 
ATOM   1824 O OG    . SER A 1 253 ? 17.351 21.241  79.924  1.00 54.92  ? 250 SER A OG    1 
ATOM   1825 N N     . VAL A 1 254 ? 14.690 22.085  81.047  1.00 28.87  ? 251 VAL A N     1 
ATOM   1826 C CA    . VAL A 1 254 ? 13.834 21.748  82.180  1.00 29.12  ? 251 VAL A CA    1 
ATOM   1827 C C     . VAL A 1 254 ? 12.434 22.318  81.982  1.00 35.58  ? 251 VAL A C     1 
ATOM   1828 O O     . VAL A 1 254 ? 11.434 21.646  82.238  1.00 42.39  ? 251 VAL A O     1 
ATOM   1829 C CB    . VAL A 1 254 ? 14.419 22.274  83.503  1.00 29.51  ? 251 VAL A CB    1 
ATOM   1830 C CG1   . VAL A 1 254 ? 13.399 22.146  84.624  1.00 32.78  ? 251 VAL A CG1   1 
ATOM   1831 C CG2   . VAL A 1 254 ? 15.701 21.529  83.845  1.00 26.57  ? 251 VAL A CG2   1 
ATOM   1832 N N     . SER A 1 255 ? 12.372 23.562  81.521  1.00 36.89  ? 252 SER A N     1 
ATOM   1833 C CA    . SER A 1 255 ? 11.102 24.208  81.223  1.00 37.47  ? 252 SER A CA    1 
ATOM   1834 C C     . SER A 1 255 ? 10.339 23.411  80.171  1.00 39.99  ? 252 SER A C     1 
ATOM   1835 O O     . SER A 1 255 ? 9.127  23.221  80.282  1.00 40.24  ? 252 SER A O     1 
ATOM   1836 C CB    . SER A 1 255 ? 11.332 25.640  80.737  1.00 37.96  ? 252 SER A CB    1 
ATOM   1837 O OG    . SER A 1 255 ? 11.954 26.426  81.740  1.00 43.36  ? 252 SER A OG    1 
ATOM   1838 N N     . LEU A 1 256 ? 11.055 22.943  79.154  1.00 28.40  ? 253 LEU A N     1 
ATOM   1839 C CA    . LEU A 1 256 ? 10.451 22.142  78.096  1.00 30.64  ? 253 LEU A CA    1 
ATOM   1840 C C     . LEU A 1 256 ? 9.890  20.833  78.642  1.00 36.36  ? 253 LEU A C     1 
ATOM   1841 O O     . LEU A 1 256 ? 8.742  20.479  78.372  1.00 41.35  ? 253 LEU A O     1 
ATOM   1842 C CB    . LEU A 1 256 ? 11.470 21.841  76.997  1.00 37.14  ? 253 LEU A CB    1 
ATOM   1843 C CG    . LEU A 1 256 ? 10.990 20.791  75.993  1.00 48.12  ? 253 LEU A CG    1 
ATOM   1844 C CD1   . LEU A 1 256 ? 10.044 21.418  74.981  1.00 42.73  ? 253 LEU A CD1   1 
ATOM   1845 C CD2   . LEU A 1 256 ? 12.158 20.117  75.293  1.00 52.02  ? 253 LEU A CD2   1 
ATOM   1846 N N     . GLY A 1 257 ? 10.711 20.118  79.405  1.00 31.47  ? 254 GLY A N     1 
ATOM   1847 C CA    . GLY A 1 257 ? 10.309 18.850  79.987  1.00 31.29  ? 254 GLY A CA    1 
ATOM   1848 C C     . GLY A 1 257 ? 9.013  18.958  80.764  1.00 39.95  ? 254 GLY A C     1 
ATOM   1849 O O     . GLY A 1 257 ? 8.108  18.142  80.597  1.00 39.67  ? 254 GLY A O     1 
ATOM   1850 N N     . ILE A 1 258 ? 8.924  19.974  81.616  1.00 40.27  ? 255 ILE A N     1 
ATOM   1851 C CA    . ILE A 1 258 ? 7.720  20.214  82.401  1.00 28.68  ? 255 ILE A CA    1 
ATOM   1852 C C     . ILE A 1 258 ? 6.534  20.541  81.495  1.00 42.75  ? 255 ILE A C     1 
ATOM   1853 O O     . ILE A 1 258 ? 5.422  20.058  81.713  1.00 46.00  ? 255 ILE A O     1 
ATOM   1854 C CB    . ILE A 1 258 ? 7.928  21.360  83.409  1.00 25.76  ? 255 ILE A CB    1 
ATOM   1855 C CG1   . ILE A 1 258 ? 9.011  20.987  84.424  1.00 27.34  ? 255 ILE A CG1   1 
ATOM   1856 C CG2   . ILE A 1 258 ? 6.624  21.690  84.113  1.00 38.91  ? 255 ILE A CG2   1 
ATOM   1857 C CD1   . ILE A 1 258 ? 9.272  22.053  85.467  1.00 27.49  ? 255 ILE A CD1   1 
ATOM   1858 N N     . ALA A 1 259 ? 6.784  21.357  80.475  1.00 38.37  ? 256 ALA A N     1 
ATOM   1859 C CA    . ALA A 1 259 ? 5.742  21.759  79.535  1.00 39.78  ? 256 ALA A CA    1 
ATOM   1860 C C     . ALA A 1 259 ? 5.133  20.555  78.823  1.00 44.48  ? 256 ALA A C     1 
ATOM   1861 O O     . ALA A 1 259 ? 3.912  20.401  78.778  1.00 39.26  ? 256 ALA A O     1 
ATOM   1862 C CB    . ALA A 1 259 ? 6.297  22.749  78.521  1.00 30.56  ? 256 ALA A CB    1 
ATOM   1863 N N     . LEU A 1 260 ? 5.990  19.705  78.268  1.00 42.73  ? 257 LEU A N     1 
ATOM   1864 C CA    . LEU A 1 260 ? 5.535  18.502  77.580  1.00 48.40  ? 257 LEU A CA    1 
ATOM   1865 C C     . LEU A 1 260 ? 4.933  17.493  78.554  1.00 49.28  ? 257 LEU A C     1 
ATOM   1866 O O     . LEU A 1 260 ? 3.986  16.783  78.219  1.00 55.50  ? 257 LEU A O     1 
ATOM   1867 C CB    . LEU A 1 260 ? 6.678  17.859  76.792  1.00 38.78  ? 257 LEU A CB    1 
ATOM   1868 C CG    . LEU A 1 260 ? 7.074  18.554  75.488  1.00 53.31  ? 257 LEU A CG    1 
ATOM   1869 C CD1   . LEU A 1 260 ? 8.178  17.783  74.781  1.00 50.81  ? 257 LEU A CD1   1 
ATOM   1870 C CD2   . LEU A 1 260 ? 5.864  18.715  74.580  1.00 47.93  ? 257 LEU A CD2   1 
ATOM   1871 N N     . HIS A 1 261 ? 5.489  17.436  79.759  1.00 45.18  ? 258 HIS A N     1 
ATOM   1872 C CA    . HIS A 1 261 ? 4.986  16.536  80.790  1.00 38.25  ? 258 HIS A CA    1 
ATOM   1873 C C     . HIS A 1 261 ? 3.506  16.782  81.054  1.00 46.31  ? 258 HIS A C     1 
ATOM   1874 O O     . HIS A 1 261 ? 2.732  15.844  81.237  1.00 52.37  ? 258 HIS A O     1 
ATOM   1875 C CB    . HIS A 1 261 ? 5.786  16.702  82.081  1.00 27.18  ? 258 HIS A CB    1 
ATOM   1876 C CG    . HIS A 1 261 ? 5.191  15.991  83.255  1.00 33.30  ? 258 HIS A CG    1 
ATOM   1877 N ND1   . HIS A 1 261 ? 5.205  14.618  83.380  1.00 29.38  ? 258 HIS A ND1   1 
ATOM   1878 C CD2   . HIS A 1 261 ? 4.567  16.463  84.361  1.00 30.50  ? 258 HIS A CD2   1 
ATOM   1879 C CE1   . HIS A 1 261 ? 4.612  14.275  84.511  1.00 39.33  ? 258 HIS A CE1   1 
ATOM   1880 N NE2   . HIS A 1 261 ? 4.218  15.375  85.124  1.00 38.94  ? 258 HIS A NE2   1 
ATOM   1881 N N     . GLU A 1 262 ? 3.117  18.052  81.065  1.00 43.26  ? 259 GLU A N     1 
ATOM   1882 C CA    . GLU A 1 262 ? 1.725  18.426  81.284  1.00 44.63  ? 259 GLU A CA    1 
ATOM   1883 C C     . GLU A 1 262 ? 0.861  18.122  80.062  1.00 54.41  ? 259 GLU A C     1 
ATOM   1884 O O     . GLU A 1 262 ? -0.367 18.150  80.138  1.00 64.23  ? 259 GLU A O     1 
ATOM   1885 C CB    . GLU A 1 262 ? 1.624  19.908  81.646  1.00 37.68  ? 259 GLU A CB    1 
ATOM   1886 C CG    . GLU A 1 262 ? 2.229  20.253  82.993  1.00 42.66  ? 259 GLU A CG    1 
ATOM   1887 C CD    . GLU A 1 262 ? 1.456  19.648  84.147  1.00 47.66  ? 259 GLU A CD    1 
ATOM   1888 O OE1   . GLU A 1 262 ? 0.214  19.564  84.053  1.00 62.64  ? 259 GLU A OE1   1 
ATOM   1889 O OE2   . GLU A 1 262 ? 2.088  19.262  85.152  1.00 51.34  ? 259 GLU A OE2   1 
ATOM   1890 N N     . ARG A 1 263 ? 1.512  17.830  78.940  1.00 49.61  ? 260 ARG A N     1 
ATOM   1891 C CA    . ARG A 1 263 ? 0.815  17.539  77.690  1.00 53.76  ? 260 ARG A CA    1 
ATOM   1892 C C     . ARG A 1 263 ? 0.916  16.059  77.327  1.00 58.03  ? 260 ARG A C     1 
ATOM   1893 O O     . ARG A 1 263 ? 0.495  15.647  76.246  1.00 60.11  ? 260 ARG A O     1 
ATOM   1894 C CB    . ARG A 1 263 ? 1.392  18.385  76.553  1.00 52.86  ? 260 ARG A CB    1 
ATOM   1895 C CG    . ARG A 1 263 ? 1.179  19.883  76.708  1.00 60.32  ? 260 ARG A CG    1 
ATOM   1896 C CD    . ARG A 1 263 ? -0.259 20.271  76.411  1.00 68.46  ? 260 ARG A CD    1 
ATOM   1897 N NE    . ARG A 1 263 ? -0.696 19.780  75.107  1.00 69.72  ? 260 ARG A NE    1 
ATOM   1898 C CZ    . ARG A 1 263 ? -1.854 20.096  74.538  1.00 69.67  ? 260 ARG A CZ    1 
ATOM   1899 N NH1   . ARG A 1 263 ? -2.698 20.911  75.156  1.00 62.03  ? 260 ARG A NH1   1 
ATOM   1900 N NH2   . ARG A 1 263 ? -2.168 19.600  73.349  1.00 76.71  ? 260 ARG A NH2   1 
ATOM   1901 N N     . ILE A 1 264 ? 1.472  15.267  78.238  1.00 56.26  ? 261 ILE A N     1 
ATOM   1902 C CA    . ILE A 1 264 ? 1.756  13.858  77.972  1.00 59.42  ? 261 ILE A CA    1 
ATOM   1903 C C     . ILE A 1 264 ? 0.526  13.070  77.520  1.00 67.51  ? 261 ILE A C     1 
ATOM   1904 O O     . ILE A 1 264 ? 0.632  12.162  76.696  1.00 71.79  ? 261 ILE A O     1 
ATOM   1905 C CB    . ILE A 1 264 ? 2.390  13.167  79.199  1.00 50.46  ? 261 ILE A CB    1 
ATOM   1906 C CG1   . ILE A 1 264 ? 2.968  11.806  78.808  1.00 57.89  ? 261 ILE A CG1   1 
ATOM   1907 C CG2   . ILE A 1 264 ? 1.375  13.027  80.323  1.00 50.17  ? 261 ILE A CG2   1 
ATOM   1908 C CD1   . ILE A 1 264 ? 4.034  11.880  77.738  1.00 48.50  ? 261 ILE A CD1   1 
ATOM   1909 N N     . ASP A 1 265 ? -0.637 13.421  78.060  1.00 64.28  ? 262 ASP A N     1 
ATOM   1910 C CA    . ASP A 1 265 ? -1.880 12.744  77.701  1.00 74.33  ? 262 ASP A CA    1 
ATOM   1911 C C     . ASP A 1 265 ? -2.335 13.103  76.288  1.00 72.08  ? 262 ASP A C     1 
ATOM   1912 O O     . ASP A 1 265 ? -2.912 12.272  75.587  1.00 77.08  ? 262 ASP A O     1 
ATOM   1913 C CB    . ASP A 1 265 ? -2.988 13.072  78.706  1.00 77.61  ? 262 ASP A CB    1 
ATOM   1914 C CG    . ASP A 1 265 ? -2.836 12.318  80.015  1.00 75.14  ? 262 ASP A CG    1 
ATOM   1915 O OD1   . ASP A 1 265 ? -2.266 11.207  80.007  1.00 69.62  ? 262 ASP A OD1   1 
ATOM   1916 O OD2   . ASP A 1 265 ? -3.296 12.837  81.053  1.00 72.67  ? 262 ASP A OD2   1 
ATOM   1917 N N     . ARG A 1 266 ? -2.080 14.342  75.877  1.00 69.49  ? 263 ARG A N     1 
ATOM   1918 C CA    . ARG A 1 266 ? -2.462 14.800  74.543  1.00 69.65  ? 263 ARG A CA    1 
ATOM   1919 C C     . ARG A 1 266 ? -1.503 14.284  73.479  1.00 68.76  ? 263 ARG A C     1 
ATOM   1920 O O     . ARG A 1 266 ? -1.893 14.066  72.333  1.00 78.97  ? 263 ARG A O     1 
ATOM   1921 C CB    . ARG A 1 266 ? -2.515 16.330  74.485  1.00 67.29  ? 263 ARG A CB    1 
ATOM   1922 C CG    . ARG A 1 266 ? -3.539 16.951  75.416  1.00 71.69  ? 263 ARG A CG    1 
ATOM   1923 C CD    . ARG A 1 266 ? -4.936 16.419  75.130  1.00 84.23  ? 263 ARG A CD    1 
ATOM   1924 N NE    . ARG A 1 266 ? -5.841 16.651  76.252  1.00 90.67  ? 263 ARG A NE    1 
ATOM   1925 C CZ    . ARG A 1 266 ? -7.157 16.468  76.206  1.00 94.98  ? 263 ARG A CZ    1 
ATOM   1926 N NH1   . ARG A 1 266 ? -7.734 16.057  75.084  1.00 98.45  ? 263 ARG A NH1   1 
ATOM   1927 N NH2   . ARG A 1 266 ? -7.898 16.701  77.283  1.00 94.51  ? 263 ARG A NH2   1 
ATOM   1928 N N     . ASN A 1 267 ? -0.243 14.104  73.860  1.00 74.08  ? 264 ASN A N     1 
ATOM   1929 C CA    . ASN A 1 267 ? 0.771  13.636  72.925  1.00 74.08  ? 264 ASN A CA    1 
ATOM   1930 C C     . ASN A 1 267 ? 0.785  12.115  72.820  1.00 80.88  ? 264 ASN A C     1 
ATOM   1931 O O     . ASN A 1 267 ? 1.183  11.559  71.797  1.00 84.42  ? 264 ASN A O     1 
ATOM   1932 C CB    . ASN A 1 267 ? 2.148  14.179  73.307  1.00 59.99  ? 264 ASN A CB    1 
ATOM   1933 C CG    . ASN A 1 267 ? 2.219  15.693  73.218  1.00 60.15  ? 264 ASN A CG    1 
ATOM   1934 O OD1   . ASN A 1 267 ? 3.173  16.311  73.692  1.00 71.98  ? 264 ASN A OD1   1 
ATOM   1935 N ND2   . ASN A 1 267 ? 1.205  16.299  72.610  1.00 55.62  ? 264 ASN A ND2   1 
ATOM   1936 N N     . LEU A 1 268 ? 0.351  11.447  73.885  1.00 84.90  ? 265 LEU A N     1 
ATOM   1937 C CA    . LEU A 1 268 ? 0.096  10.014  73.822  1.00 92.41  ? 265 LEU A CA    1 
ATOM   1938 C C     . LEU A 1 268 ? -1.163 9.796   72.995  1.00 104.03 ? 265 LEU A C     1 
ATOM   1939 O O     . LEU A 1 268 ? -1.383 8.718   72.445  1.00 98.21  ? 265 LEU A O     1 
ATOM   1940 C CB    . LEU A 1 268 ? -0.091 9.428   75.222  1.00 89.97  ? 265 LEU A CB    1 
ATOM   1941 C CG    . LEU A 1 268 ? 1.164  9.088   76.028  1.00 90.67  ? 265 LEU A CG    1 
ATOM   1942 C CD1   . LEU A 1 268 ? 0.786  8.587   77.414  1.00 92.87  ? 265 LEU A CD1   1 
ATOM   1943 C CD2   . LEU A 1 268 ? 2.006  8.056   75.299  1.00 88.71  ? 265 LEU A CD2   1 
ATOM   1944 N N     . ALA A 1 269 ? -1.984 10.839  72.915  1.00 115.32 ? 266 ALA A N     1 
ATOM   1945 C CA    . ALA A 1 269 ? -3.219 10.800  72.143  1.00 125.63 ? 266 ALA A CA    1 
ATOM   1946 C C     . ALA A 1 269 ? -2.951 11.063  70.667  1.00 131.32 ? 266 ALA A C     1 
ATOM   1947 O O     . ALA A 1 269 ? -3.817 10.842  69.820  1.00 132.30 ? 266 ALA A O     1 
ATOM   1948 C CB    . ALA A 1 269 ? -4.211 11.817  72.686  1.00 126.60 ? 266 ALA A CB    1 
ATOM   1949 N N     . ALA A 1 270 ? -1.747 11.536  70.367  1.00 132.15 ? 267 ALA A N     1 
ATOM   1950 C CA    . ALA A 1 270 ? -1.393 11.910  69.003  1.00 133.62 ? 267 ALA A CA    1 
ATOM   1951 C C     . ALA A 1 270 ? -0.471 10.887  68.345  1.00 140.53 ? 267 ALA A C     1 
ATOM   1952 O O     . ALA A 1 270 ? -0.059 11.059  67.200  1.00 145.41 ? 267 ALA A O     1 
ATOM   1953 C CB    . ALA A 1 270 ? -0.754 13.291  68.987  1.00 128.56 ? 267 ALA A CB    1 
ATOM   1954 N N     . ASN A 1 271 ? -0.148 9.822   69.071  1.00 140.76 ? 268 ASN A N     1 
ATOM   1955 C CA    . ASN A 1 271 ? 0.716  8.775   68.535  1.00 143.47 ? 268 ASN A CA    1 
ATOM   1956 C C     . ASN A 1 271 ? -0.026 7.462   68.308  1.00 152.20 ? 268 ASN A C     1 
ATOM   1957 O O     . ASN A 1 271 ? -1.217 7.348   68.592  1.00 156.22 ? 268 ASN A O     1 
ATOM   1958 C CB    . ASN A 1 271 ? 1.920  8.543   69.450  1.00 139.47 ? 268 ASN A CB    1 
ATOM   1959 C CG    . ASN A 1 271 ? 2.941  9.661   69.367  1.00 136.67 ? 268 ASN A CG    1 
ATOM   1960 O OD1   . ASN A 1 271 ? 4.141  9.430   69.520  1.00 133.38 ? 268 ASN A OD1   1 
ATOM   1961 N ND2   . ASN A 1 271 ? 2.473  10.878  69.115  1.00 136.64 ? 268 ASN A ND2   1 
ATOM   1962 N N     . ALA B 1 11  ? 31.161 56.316  94.832  1.00 56.23  ? 8   ALA B N     1 
ATOM   1963 C CA    . ALA B 1 11  ? 31.507 55.396  93.751  1.00 65.78  ? 8   ALA B CA    1 
ATOM   1964 C C     . ALA B 1 11  ? 32.991 55.463  93.425  1.00 75.13  ? 8   ALA B C     1 
ATOM   1965 O O     . ALA B 1 11  ? 33.655 56.442  93.745  1.00 81.25  ? 8   ALA B O     1 
ATOM   1966 C CB    . ALA B 1 11  ? 30.675 55.691  92.507  1.00 58.54  ? 8   ALA B CB    1 
ATOM   1967 N N     . ASN B 1 12  ? 33.511 54.416  92.792  1.00 74.10  ? 9   ASN B N     1 
ATOM   1968 C CA    . ASN B 1 12  ? 34.913 54.401  92.386  1.00 80.52  ? 9   ASN B CA    1 
ATOM   1969 C C     . ASN B 1 12  ? 35.078 54.241  90.876  1.00 81.75  ? 9   ASN B C     1 
ATOM   1970 O O     . ASN B 1 12  ? 34.638 53.248  90.298  1.00 72.99  ? 9   ASN B O     1 
ATOM   1971 C CB    . ASN B 1 12  ? 35.697 53.314  93.131  1.00 85.90  ? 9   ASN B CB    1 
ATOM   1972 C CG    . ASN B 1 12  ? 35.469 51.929  92.557  1.00 91.57  ? 9   ASN B CG    1 
ATOM   1973 O OD1   . ASN B 1 12  ? 36.408 51.267  92.115  1.00 87.15  ? 9   ASN B OD1   1 
ATOM   1974 N ND2   . ASN B 1 12  ? 34.217 51.490  92.548  1.00 95.07  ? 9   ASN B ND2   1 
ATOM   1975 N N     . PRO B 1 13  ? 35.693 55.240  90.228  1.00 96.75  ? 10  PRO B N     1 
ATOM   1976 C CA    . PRO B 1 13  ? 35.951 55.220  88.789  1.00 100.32 ? 10  PRO B CA    1 
ATOM   1977 C C     . PRO B 1 13  ? 37.434 55.061  88.455  1.00 98.45  ? 10  PRO B C     1 
ATOM   1978 O O     . PRO B 1 13  ? 37.773 54.819  87.297  1.00 100.39 ? 10  PRO B O     1 
ATOM   1979 C CB    . PRO B 1 13  ? 35.482 56.607  88.375  1.00 107.90 ? 10  PRO B CB    1 
ATOM   1980 C CG    . PRO B 1 13  ? 35.956 57.474  89.531  1.00 115.31 ? 10  PRO B CG    1 
ATOM   1981 C CD    . PRO B 1 13  ? 35.924 56.587  90.781  1.00 110.28 ? 10  PRO B CD    1 
ATOM   1982 N N     . SER B 1 14  ? 38.301 55.189  89.455  1.00 92.91  ? 11  SER B N     1 
ATOM   1983 C CA    . SER B 1 14  ? 39.742 55.184  89.221  1.00 95.51  ? 11  SER B CA    1 
ATOM   1984 C C     . SER B 1 14  ? 40.330 53.774  89.174  1.00 95.50  ? 11  SER B C     1 
ATOM   1985 O O     . SER B 1 14  ? 39.614 52.798  88.952  1.00 79.12  ? 11  SER B O     1 
ATOM   1986 C CB    . SER B 1 14  ? 40.458 56.021  90.284  1.00 99.75  ? 11  SER B CB    1 
ATOM   1987 O OG    . SER B 1 14  ? 41.795 56.301  89.903  1.00 100.97 ? 11  SER B OG    1 
ATOM   1988 N N     . ASP B 1 15  ? 41.641 53.681  89.385  1.00 110.79 ? 12  ASP B N     1 
ATOM   1989 C CA    . ASP B 1 15  ? 42.350 52.408  89.305  1.00 107.97 ? 12  ASP B CA    1 
ATOM   1990 C C     . ASP B 1 15  ? 43.646 52.423  90.110  1.00 111.67 ? 12  ASP B C     1 
ATOM   1991 O O     . ASP B 1 15  ? 44.577 53.157  89.778  1.00 110.07 ? 12  ASP B O     1 
ATOM   1992 C CB    . ASP B 1 15  ? 42.663 52.067  87.846  1.00 99.78  ? 12  ASP B CB    1 
ATOM   1993 C CG    . ASP B 1 15  ? 41.470 51.496  87.112  1.00 88.37  ? 12  ASP B CG    1 
ATOM   1994 O OD1   . ASP B 1 15  ? 40.933 50.464  87.566  1.00 87.69  ? 12  ASP B OD1   1 
ATOM   1995 O OD2   . ASP B 1 15  ? 41.074 52.072  86.076  1.00 79.64  ? 12  ASP B OD2   1 
ATOM   1996 N N     . PRO B 1 16  ? 43.707 51.616  91.180  1.00 115.39 ? 13  PRO B N     1 
ATOM   1997 C CA    . PRO B 1 16  ? 42.563 50.876  91.717  1.00 118.28 ? 13  PRO B CA    1 
ATOM   1998 C C     . PRO B 1 16  ? 41.974 51.618  92.909  1.00 115.28 ? 13  PRO B C     1 
ATOM   1999 O O     . PRO B 1 16  ? 40.965 52.307  92.762  1.00 110.52 ? 13  PRO B O     1 
ATOM   2000 C CB    . PRO B 1 16  ? 43.192 49.558  92.199  1.00 119.79 ? 13  PRO B CB    1 
ATOM   2001 C CG    . PRO B 1 16  ? 44.684 49.659  91.884  1.00 122.57 ? 13  PRO B CG    1 
ATOM   2002 C CD    . PRO B 1 16  ? 44.968 51.116  91.741  1.00 119.87 ? 13  PRO B CD    1 
ATOM   2003 N N     . ALA B 1 17  ? 42.622 51.469  94.064  1.00 119.47 ? 14  ALA B N     1 
ATOM   2004 C CA    . ALA B 1 17  ? 42.228 52.108  95.321  1.00 124.66 ? 14  ALA B CA    1 
ATOM   2005 C C     . ALA B 1 17  ? 42.540 51.169  96.477  1.00 124.70 ? 14  ALA B C     1 
ATOM   2006 O O     . ALA B 1 17  ? 43.111 51.574  97.488  1.00 128.58 ? 14  ALA B O     1 
ATOM   2007 C CB    . ALA B 1 17  ? 40.748 52.461  95.322  1.00 125.12 ? 14  ALA B CB    1 
ATOM   2008 N N     . VAL B 1 18  ? 42.168 49.907  96.284  1.00 123.35 ? 15  VAL B N     1 
ATOM   2009 C CA    . VAL B 1 18  ? 42.212 48.849  97.289  1.00 128.47 ? 15  VAL B CA    1 
ATOM   2010 C C     . VAL B 1 18  ? 41.157 47.859  96.818  1.00 124.73 ? 15  VAL B C     1 
ATOM   2011 O O     . VAL B 1 18  ? 41.079 46.718  97.277  1.00 131.15 ? 15  VAL B O     1 
ATOM   2012 C CB    . VAL B 1 18  ? 41.908 49.368  98.717  1.00 133.34 ? 15  VAL B CB    1 
ATOM   2013 C CG1   . VAL B 1 18  ? 41.009 48.405  99.477  1.00 130.99 ? 15  VAL B CG1   1 
ATOM   2014 C CG2   . VAL B 1 18  ? 43.205 49.611  99.483  1.00 134.67 ? 15  VAL B CG2   1 
ATOM   2015 N N     . GLN B 1 19  ? 40.358 48.327  95.865  1.00 111.60 ? 16  GLN B N     1 
ATOM   2016 C CA    . GLN B 1 19  ? 39.363 47.516  95.178  1.00 108.02 ? 16  GLN B CA    1 
ATOM   2017 C C     . GLN B 1 19  ? 40.007 46.327  94.474  1.00 111.18 ? 16  GLN B C     1 
ATOM   2018 O O     . GLN B 1 19  ? 39.324 45.370  94.109  1.00 111.68 ? 16  GLN B O     1 
ATOM   2019 C CB    . GLN B 1 19  ? 38.599 48.388  94.172  1.00 106.37 ? 16  GLN B CB    1 
ATOM   2020 C CG    . GLN B 1 19  ? 38.023 47.656  92.963  1.00 100.26 ? 16  GLN B CG    1 
ATOM   2021 C CD    . GLN B 1 19  ? 39.026 47.501  91.830  1.00 88.33  ? 16  GLN B CD    1 
ATOM   2022 O OE1   . GLN B 1 19  ? 39.765 46.519  91.767  1.00 79.56  ? 16  GLN B OE1   1 
ATOM   2023 N NE2   . GLN B 1 19  ? 39.043 48.467  90.919  1.00 79.40  ? 16  GLN B NE2   1 
ATOM   2024 N N     . ARG B 1 20  ? 41.323 46.394  94.292  1.00 110.50 ? 17  ARG B N     1 
ATOM   2025 C CA    . ARG B 1 20  ? 42.073 45.344  93.605  1.00 99.33  ? 17  ARG B CA    1 
ATOM   2026 C C     . ARG B 1 20  ? 41.632 43.943  94.023  1.00 76.91  ? 17  ARG B C     1 
ATOM   2027 O O     . ARG B 1 20  ? 41.814 42.980  93.278  1.00 69.09  ? 17  ARG B O     1 
ATOM   2028 C CB    . ARG B 1 20  ? 43.577 45.521  93.838  1.00 104.57 ? 17  ARG B CB    1 
ATOM   2029 C CG    . ARG B 1 20  ? 44.452 44.629  92.971  1.00 105.07 ? 17  ARG B CG    1 
ATOM   2030 C CD    . ARG B 1 20  ? 44.085 44.760  91.499  1.00 100.95 ? 17  ARG B CD    1 
ATOM   2031 N NE    . ARG B 1 20  ? 44.939 43.980  90.600  1.00 98.75  ? 17  ARG B NE    1 
ATOM   2032 C CZ    . ARG B 1 20  ? 45.490 42.802  90.886  1.00 102.23 ? 17  ARG B CZ    1 
ATOM   2033 N NH1   . ARG B 1 20  ? 45.284 42.220  92.058  1.00 104.14 ? 17  ARG B NH1   1 
ATOM   2034 N NH2   . ARG B 1 20  ? 46.247 42.195  89.982  1.00 101.28 ? 17  ARG B NH2   1 
ATOM   2035 N N     . ILE B 1 21  ? 41.052 43.839  95.216  1.00 66.65  ? 18  ILE B N     1 
ATOM   2036 C CA    . ILE B 1 21  ? 40.521 42.575  95.712  1.00 70.65  ? 18  ILE B CA    1 
ATOM   2037 C C     . ILE B 1 21  ? 39.625 41.906  94.672  1.00 65.17  ? 18  ILE B C     1 
ATOM   2038 O O     . ILE B 1 21  ? 39.748 40.709  94.413  1.00 70.91  ? 18  ILE B O     1 
ATOM   2039 C CB    . ILE B 1 21  ? 39.715 42.774  97.010  1.00 78.75  ? 18  ILE B CB    1 
ATOM   2040 C CG1   . ILE B 1 21  ? 40.456 43.712  97.965  1.00 79.59  ? 18  ILE B CG1   1 
ATOM   2041 C CG2   . ILE B 1 21  ? 39.437 41.435  97.676  1.00 77.12  ? 18  ILE B CG2   1 
ATOM   2042 C CD1   . ILE B 1 21  ? 39.669 44.061  99.213  1.00 79.09  ? 18  ILE B CD1   1 
ATOM   2043 N N     . ILE B 1 22  ? 38.725 42.685  94.079  1.00 60.82  ? 19  ILE B N     1 
ATOM   2044 C CA    . ILE B 1 22  ? 37.824 42.172  93.052  1.00 55.20  ? 19  ILE B CA    1 
ATOM   2045 C C     . ILE B 1 22  ? 38.612 41.511  91.927  1.00 55.62  ? 19  ILE B C     1 
ATOM   2046 O O     . ILE B 1 22  ? 38.248 40.440  91.438  1.00 50.47  ? 19  ILE B O     1 
ATOM   2047 C CB    . ILE B 1 22  ? 36.952 43.295  92.454  1.00 45.04  ? 19  ILE B CB    1 
ATOM   2048 C CG1   . ILE B 1 22  ? 36.110 43.961  93.544  1.00 51.44  ? 19  ILE B CG1   1 
ATOM   2049 C CG2   . ILE B 1 22  ? 36.058 42.746  91.355  1.00 37.74  ? 19  ILE B CG2   1 
ATOM   2050 C CD1   . ILE B 1 22  ? 35.216 45.073  93.030  1.00 56.12  ? 19  ILE B CD1   1 
ATOM   2051 N N     . ASP B 1 23  ? 39.700 42.160  91.529  1.00 72.62  ? 20  ASP B N     1 
ATOM   2052 C CA    . ASP B 1 23  ? 40.540 41.682  90.440  1.00 77.48  ? 20  ASP B CA    1 
ATOM   2053 C C     . ASP B 1 23  ? 41.407 40.510  90.897  1.00 82.08  ? 20  ASP B C     1 
ATOM   2054 O O     . ASP B 1 23  ? 42.197 39.969  90.123  1.00 95.35  ? 20  ASP B O     1 
ATOM   2055 C CB    . ASP B 1 23  ? 41.418 42.827  89.928  1.00 87.62  ? 20  ASP B CB    1 
ATOM   2056 C CG    . ASP B 1 23  ? 41.877 42.622  88.498  1.00 95.09  ? 20  ASP B CG    1 
ATOM   2057 O OD1   . ASP B 1 23  ? 42.013 41.456  88.073  1.00 99.26  ? 20  ASP B OD1   1 
ATOM   2058 O OD2   . ASP B 1 23  ? 42.106 43.631  87.798  1.00 92.30  ? 20  ASP B OD2   1 
ATOM   2059 N N     . VAL B 1 24  ? 41.257 40.124  92.160  1.00 72.14  ? 21  VAL B N     1 
ATOM   2060 C CA    . VAL B 1 24  ? 42.018 39.011  92.717  1.00 67.82  ? 21  VAL B CA    1 
ATOM   2061 C C     . VAL B 1 24  ? 41.142 37.775  92.883  1.00 70.20  ? 21  VAL B C     1 
ATOM   2062 O O     . VAL B 1 24  ? 41.558 36.661  92.569  1.00 75.15  ? 21  VAL B O     1 
ATOM   2063 C CB    . VAL B 1 24  ? 42.631 39.365  94.089  1.00 76.06  ? 21  VAL B CB    1 
ATOM   2064 C CG1   . VAL B 1 24  ? 43.367 38.164  94.666  1.00 89.49  ? 21  VAL B CG1   1 
ATOM   2065 C CG2   . VAL B 1 24  ? 43.564 40.557  93.969  1.00 76.85  ? 21  VAL B CG2   1 
ATOM   2066 N N     . THR B 1 25  ? 39.926 37.976  93.378  1.00 60.67  ? 22  THR B N     1 
ATOM   2067 C CA    . THR B 1 25  ? 39.028 36.864  93.662  1.00 60.01  ? 22  THR B CA    1 
ATOM   2068 C C     . THR B 1 25  ? 38.307 36.372  92.411  1.00 51.72  ? 22  THR B C     1 
ATOM   2069 O O     . THR B 1 25  ? 37.599 35.368  92.452  1.00 54.00  ? 22  THR B O     1 
ATOM   2070 C CB    . THR B 1 25  ? 37.972 37.245  94.719  1.00 69.64  ? 22  THR B CB    1 
ATOM   2071 O OG1   . THR B 1 25  ? 36.950 38.047  94.114  1.00 69.99  ? 22  THR B OG1   1 
ATOM   2072 C CG2   . THR B 1 25  ? 38.613 38.016  95.864  1.00 68.21  ? 22  THR B CG2   1 
ATOM   2073 N N     . LYS B 1 26  ? 38.492 37.078  91.301  1.00 55.46  ? 23  LYS B N     1 
ATOM   2074 C CA    . LYS B 1 26  ? 37.774 36.758  90.070  1.00 67.11  ? 23  LYS B CA    1 
ATOM   2075 C C     . LYS B 1 26  ? 38.591 35.911  89.088  1.00 69.21  ? 23  LYS B C     1 
ATOM   2076 O O     . LYS B 1 26  ? 38.127 34.862  88.642  1.00 66.95  ? 23  LYS B O     1 
ATOM   2077 C CB    . LYS B 1 26  ? 37.258 38.036  89.398  1.00 72.70  ? 23  LYS B CB    1 
ATOM   2078 C CG    . LYS B 1 26  ? 36.171 37.812  88.357  1.00 81.65  ? 23  LYS B CG    1 
ATOM   2079 C CD    . LYS B 1 26  ? 36.752 37.458  86.998  1.00 92.54  ? 23  LYS B CD    1 
ATOM   2080 C CE    . LYS B 1 26  ? 35.664 37.385  85.937  1.00 96.84  ? 23  LYS B CE    1 
ATOM   2081 N NZ    . LYS B 1 26  ? 36.225 37.148  84.578  1.00 92.89  ? 23  LYS B NZ    1 
ATOM   2082 N N     . PRO B 1 27  ? 39.810 36.363  88.744  1.00 83.78  ? 24  PRO B N     1 
ATOM   2083 C CA    . PRO B 1 27  ? 40.627 35.616  87.780  1.00 94.77  ? 24  PRO B CA    1 
ATOM   2084 C C     . PRO B 1 27  ? 40.934 34.202  88.260  1.00 96.18  ? 24  PRO B C     1 
ATOM   2085 O O     . PRO B 1 27  ? 40.523 33.818  89.355  1.00 102.12 ? 24  PRO B O     1 
ATOM   2086 C CB    . PRO B 1 27  ? 41.919 36.437  87.705  1.00 96.59  ? 24  PRO B CB    1 
ATOM   2087 C CG    . PRO B 1 27  ? 41.523 37.806  88.131  1.00 98.33  ? 24  PRO B CG    1 
ATOM   2088 C CD    . PRO B 1 27  ? 40.474 37.603  89.180  1.00 94.80  ? 24  PRO B CD    1 
ATOM   2089 N N     . SER B 1 28  ? 41.650 33.437  87.441  1.00 89.43  ? 25  SER B N     1 
ATOM   2090 C CA    . SER B 1 28  ? 42.026 32.076  87.803  1.00 90.30  ? 25  SER B CA    1 
ATOM   2091 C C     . SER B 1 28  ? 43.108 32.081  88.875  1.00 98.22  ? 25  SER B C     1 
ATOM   2092 O O     . SER B 1 28  ? 44.079 31.328  88.797  1.00 92.01  ? 25  SER B O     1 
ATOM   2093 C CB    . SER B 1 28  ? 42.506 31.308  86.572  1.00 90.89  ? 25  SER B CB    1 
ATOM   2094 O OG    . SER B 1 28  ? 41.488 31.240  85.588  1.00 85.60  ? 25  SER B OG    1 
ATOM   2095 N N     . ARG B 1 29  ? 42.935 32.939  89.874  1.00 110.05 ? 26  ARG B N     1 
ATOM   2096 C CA    . ARG B 1 29  ? 43.877 33.038  90.981  1.00 117.07 ? 26  ARG B CA    1 
ATOM   2097 C C     . ARG B 1 29  ? 43.863 31.763  91.814  1.00 115.57 ? 26  ARG B C     1 
ATOM   2098 O O     . ARG B 1 29  ? 43.624 30.672  91.296  1.00 113.73 ? 26  ARG B O     1 
ATOM   2099 C CB    . ARG B 1 29  ? 43.542 34.241  91.866  1.00 122.61 ? 26  ARG B CB    1 
ATOM   2100 C CG    . ARG B 1 29  ? 43.962 35.590  91.296  1.00 126.26 ? 26  ARG B CG    1 
ATOM   2101 C CD    . ARG B 1 29  ? 45.464 35.813  91.407  1.00 129.13 ? 26  ARG B CD    1 
ATOM   2102 N NE    . ARG B 1 29  ? 45.958 35.628  92.769  1.00 132.16 ? 26  ARG B NE    1 
ATOM   2103 C CZ    . ARG B 1 29  ? 46.569 34.529  93.201  1.00 132.90 ? 26  ARG B CZ    1 
ATOM   2104 N NH1   . ARG B 1 29  ? 46.767 33.509  92.377  1.00 131.81 ? 26  ARG B NH1   1 
ATOM   2105 N NH2   . ARG B 1 29  ? 46.985 34.450  94.458  1.00 133.40 ? 26  ARG B NH2   1 
ATOM   2106 N N     . SER B 1 30  ? 44.112 31.907  93.111  1.00 115.51 ? 27  SER B N     1 
ATOM   2107 C CA    . SER B 1 30  ? 44.152 30.757  94.006  1.00 115.95 ? 27  SER B CA    1 
ATOM   2108 C C     . SER B 1 30  ? 43.268 30.929  95.244  1.00 115.93 ? 27  SER B C     1 
ATOM   2109 O O     . SER B 1 30  ? 42.498 30.033  95.593  1.00 113.35 ? 27  SER B O     1 
ATOM   2110 C CB    . SER B 1 30  ? 45.596 30.443  94.414  1.00 118.04 ? 27  SER B CB    1 
ATOM   2111 O OG    . SER B 1 30  ? 46.310 31.619  94.768  1.00 121.30 ? 27  SER B OG    1 
ATOM   2112 N N     . ASN B 1 31  ? 43.386 32.080  95.900  1.00 117.37 ? 28  ASN B N     1 
ATOM   2113 C CA    . ASN B 1 31  ? 42.638 32.359  97.124  1.00 115.59 ? 28  ASN B CA    1 
ATOM   2114 C C     . ASN B 1 31  ? 41.246 31.728  97.149  1.00 106.48 ? 28  ASN B C     1 
ATOM   2115 O O     . ASN B 1 31  ? 40.409 32.005  96.288  1.00 102.71 ? 28  ASN B O     1 
ATOM   2116 C CB    . ASN B 1 31  ? 42.547 33.869  97.361  1.00 115.37 ? 28  ASN B CB    1 
ATOM   2117 C CG    . ASN B 1 31  ? 41.681 34.222  98.555  1.00 113.89 ? 28  ASN B CG    1 
ATOM   2118 O OD1   . ASN B 1 31  ? 40.458 34.084  98.512  1.00 114.32 ? 28  ASN B OD1   1 
ATOM   2119 N ND2   . ASN B 1 31  ? 42.310 34.699  99.623  1.00 108.66 ? 28  ASN B ND2   1 
ATOM   2120 N N     . ILE B 1 32  ? 41.015 30.874  98.142  1.00 97.03  ? 29  ILE B N     1 
ATOM   2121 C CA    . ILE B 1 32  ? 39.740 30.176  98.296  1.00 85.55  ? 29  ILE B CA    1 
ATOM   2122 C C     . ILE B 1 32  ? 38.838 30.861  99.318  1.00 74.34  ? 29  ILE B C     1 
ATOM   2123 O O     . ILE B 1 32  ? 37.619 30.898  99.157  1.00 89.02  ? 29  ILE B O     1 
ATOM   2124 C CB    . ILE B 1 32  ? 39.946 28.694  98.702  1.00 87.88  ? 29  ILE B CB    1 
ATOM   2125 C CG1   . ILE B 1 32  ? 38.616 28.047  99.111  1.00 92.31  ? 29  ILE B CG1   1 
ATOM   2126 C CG2   . ILE B 1 32  ? 40.972 28.580  99.829  1.00 89.32  ? 29  ILE B CG2   1 
ATOM   2127 C CD1   . ILE B 1 32  ? 38.295 28.149  100.598 1.00 92.59  ? 29  ILE B CD1   1 
ATOM   2128 N N     . LYS B 1 33  ? 39.446 31.406  100.367 1.00 55.12  ? 30  LYS B N     1 
ATOM   2129 C CA    . LYS B 1 33  ? 38.704 32.039  101.456 1.00 56.23  ? 30  LYS B CA    1 
ATOM   2130 C C     . LYS B 1 33  ? 37.580 32.961  100.981 1.00 50.29  ? 30  LYS B C     1 
ATOM   2131 O O     . LYS B 1 33  ? 36.563 33.113  101.660 1.00 43.71  ? 30  LYS B O     1 
ATOM   2132 C CB    . LYS B 1 33  ? 39.661 32.798  102.379 1.00 57.41  ? 30  LYS B CB    1 
ATOM   2133 C CG    . LYS B 1 33  ? 40.578 31.890  103.179 1.00 66.86  ? 30  LYS B CG    1 
ATOM   2134 C CD    . LYS B 1 33  ? 41.578 32.688  103.995 1.00 77.46  ? 30  LYS B CD    1 
ATOM   2135 C CE    . LYS B 1 33  ? 42.471 31.775  104.821 1.00 81.96  ? 30  LYS B CE    1 
ATOM   2136 N NZ    . LYS B 1 33  ? 43.522 32.540  105.549 1.00 81.36  ? 30  LYS B NZ    1 
ATOM   2137 N N     . THR B 1 34  ? 37.767 33.574  99.817  1.00 47.17  ? 31  THR B N     1 
ATOM   2138 C CA    . THR B 1 34  ? 36.756 34.458  99.252  1.00 45.64  ? 31  THR B CA    1 
ATOM   2139 C C     . THR B 1 34  ? 36.409 34.060  97.823  1.00 41.33  ? 31  THR B C     1 
ATOM   2140 O O     . THR B 1 34  ? 37.207 33.426  97.131  1.00 42.85  ? 31  THR B O     1 
ATOM   2141 C CB    . THR B 1 34  ? 37.220 35.926  99.254  1.00 44.62  ? 31  THR B CB    1 
ATOM   2142 O OG1   . THR B 1 34  ? 38.376 36.066  98.420  1.00 47.30  ? 31  THR B OG1   1 
ATOM   2143 C CG2   . THR B 1 34  ? 37.557 36.379  100.667 1.00 45.41  ? 31  THR B CG2   1 
ATOM   2144 N N     . THR B 1 35  ? 35.212 34.441  97.388  1.00 32.70  ? 32  THR B N     1 
ATOM   2145 C CA    . THR B 1 35  ? 34.758 34.154  96.034  1.00 31.45  ? 32  THR B CA    1 
ATOM   2146 C C     . THR B 1 35  ? 33.799 35.239  95.554  1.00 39.61  ? 32  THR B C     1 
ATOM   2147 O O     . THR B 1 35  ? 33.246 35.990  96.357  1.00 40.91  ? 32  THR B O     1 
ATOM   2148 C CB    . THR B 1 35  ? 34.051 32.790  95.954  1.00 43.89  ? 32  THR B CB    1 
ATOM   2149 O OG1   . THR B 1 35  ? 33.811 32.452  94.582  1.00 44.52  ? 32  THR B OG1   1 
ATOM   2150 C CG2   . THR B 1 35  ? 32.727 32.833  96.702  1.00 40.55  ? 32  THR B CG2   1 
ATOM   2151 N N     . LEU B 1 36  ? 33.604 35.315  94.242  1.00 33.82  ? 33  LEU B N     1 
ATOM   2152 C CA    . LEU B 1 36  ? 32.729 36.322  93.655  1.00 36.06  ? 33  LEU B CA    1 
ATOM   2153 C C     . LEU B 1 36  ? 31.376 35.731  93.274  1.00 43.50  ? 33  LEU B C     1 
ATOM   2154 O O     . LEU B 1 36  ? 31.304 34.712  92.588  1.00 49.49  ? 33  LEU B O     1 
ATOM   2155 C CB    . LEU B 1 36  ? 33.386 36.947  92.422  1.00 41.73  ? 33  LEU B CB    1 
ATOM   2156 C CG    . LEU B 1 36  ? 32.739 38.220  91.871  1.00 49.90  ? 33  LEU B CG    1 
ATOM   2157 C CD1   . LEU B 1 36  ? 33.045 39.409  92.770  1.00 41.11  ? 33  LEU B CD1   1 
ATOM   2158 C CD2   . LEU B 1 36  ? 33.209 38.488  90.452  1.00 63.39  ? 33  LEU B CD2   1 
ATOM   2159 N N     . ILE B 1 37  ? 30.307 36.376  93.727  1.00 41.27  ? 34  ILE B N     1 
ATOM   2160 C CA    . ILE B 1 37  ? 28.953 35.966  93.372  1.00 30.32  ? 34  ILE B CA    1 
ATOM   2161 C C     . ILE B 1 37  ? 28.283 37.053  92.536  1.00 33.02  ? 34  ILE B C     1 
ATOM   2162 O O     . ILE B 1 37  ? 28.132 38.189  92.986  1.00 44.46  ? 34  ILE B O     1 
ATOM   2163 C CB    . ILE B 1 37  ? 28.106 35.667  94.623  1.00 36.83  ? 34  ILE B CB    1 
ATOM   2164 C CG1   . ILE B 1 37  ? 28.680 34.463  95.375  1.00 42.48  ? 34  ILE B CG1   1 
ATOM   2165 C CG2   . ILE B 1 37  ? 26.658 35.418  94.238  1.00 30.04  ? 34  ILE B CG2   1 
ATOM   2166 C CD1   . ILE B 1 37  ? 27.909 34.091  96.624  1.00 38.62  ? 34  ILE B CD1   1 
ATOM   2167 N N     . GLU B 1 38  ? 27.883 36.697  91.319  1.00 30.66  ? 35  GLU B N     1 
ATOM   2168 C CA    . GLU B 1 38  ? 27.369 37.674  90.364  1.00 41.74  ? 35  GLU B CA    1 
ATOM   2169 C C     . GLU B 1 38  ? 25.844 37.682  90.289  1.00 37.96  ? 35  GLU B C     1 
ATOM   2170 O O     . GLU B 1 38  ? 25.191 36.699  90.633  1.00 34.23  ? 35  GLU B O     1 
ATOM   2171 C CB    . GLU B 1 38  ? 27.950 37.406  88.973  1.00 36.75  ? 35  GLU B CB    1 
ATOM   2172 C CG    . GLU B 1 38  ? 29.459 37.221  88.957  1.00 52.12  ? 35  GLU B CG    1 
ATOM   2173 C CD    . GLU B 1 38  ? 29.977 36.766  87.606  1.00 65.95  ? 35  GLU B CD    1 
ATOM   2174 O OE1   . GLU B 1 38  ? 29.334 37.078  86.581  1.00 64.90  ? 35  GLU B OE1   1 
ATOM   2175 O OE2   . GLU B 1 38  ? 31.031 36.096  87.569  1.00 71.42  ? 35  GLU B OE2   1 
ATOM   2176 N N     . ASP B 1 39  ? 25.293 38.805  89.835  1.00 42.44  ? 36  ASP B N     1 
ATOM   2177 C CA    . ASP B 1 39  ? 23.854 38.952  89.620  1.00 36.73  ? 36  ASP B CA    1 
ATOM   2178 C C     . ASP B 1 39  ? 23.061 39.098  90.921  1.00 37.59  ? 36  ASP B C     1 
ATOM   2179 O O     . ASP B 1 39  ? 23.457 38.582  91.967  1.00 35.64  ? 36  ASP B O     1 
ATOM   2180 C CB    . ASP B 1 39  ? 23.311 37.800  88.768  1.00 45.24  ? 36  ASP B CB    1 
ATOM   2181 C CG    . ASP B 1 39  ? 23.949 37.746  87.389  1.00 58.13  ? 36  ASP B CG    1 
ATOM   2182 O OD1   . ASP B 1 39  ? 24.633 38.720  87.009  1.00 52.73  ? 36  ASP B OD1   1 
ATOM   2183 O OD2   . ASP B 1 39  ? 23.766 36.731  86.685  1.00 66.43  ? 36  ASP B OD2   1 
ATOM   2184 N N     . VAL B 1 40  ? 21.936 39.801  90.837  1.00 44.28  ? 37  VAL B N     1 
ATOM   2185 C CA    . VAL B 1 40  ? 21.151 40.158  92.015  1.00 48.68  ? 37  VAL B CA    1 
ATOM   2186 C C     . VAL B 1 40  ? 20.519 38.961  92.727  1.00 43.32  ? 37  VAL B C     1 
ATOM   2187 O O     . VAL B 1 40  ? 20.620 38.839  93.947  1.00 51.09  ? 37  VAL B O     1 
ATOM   2188 C CB    . VAL B 1 40  ? 20.051 41.191  91.674  1.00 43.63  ? 37  VAL B CB    1 
ATOM   2189 C CG1   . VAL B 1 40  ? 19.199 40.705  90.510  1.00 36.75  ? 37  VAL B CG1   1 
ATOM   2190 C CG2   . VAL B 1 40  ? 19.189 41.475  92.895  1.00 37.15  ? 37  VAL B CG2   1 
ATOM   2191 N N     . GLU B 1 41  ? 19.865 38.086  91.970  1.00 44.01  ? 38  GLU B N     1 
ATOM   2192 C CA    . GLU B 1 41  ? 19.177 36.941  92.564  1.00 46.51  ? 38  GLU B CA    1 
ATOM   2193 C C     . GLU B 1 41  ? 20.119 35.995  93.311  1.00 42.15  ? 38  GLU B C     1 
ATOM   2194 O O     . GLU B 1 41  ? 19.842 35.621  94.450  1.00 42.73  ? 38  GLU B O     1 
ATOM   2195 C CB    . GLU B 1 41  ? 18.354 36.181  91.520  1.00 54.86  ? 38  GLU B CB    1 
ATOM   2196 C CG    . GLU B 1 41  ? 17.075 36.893  91.114  1.00 69.28  ? 38  GLU B CG    1 
ATOM   2197 C CD    . GLU B 1 41  ? 16.233 37.300  92.308  1.00 89.21  ? 38  GLU B CD    1 
ATOM   2198 O OE1   . GLU B 1 41  ? 16.114 36.498  93.259  1.00 98.32  ? 38  GLU B OE1   1 
ATOM   2199 O OE2   . GLU B 1 41  ? 15.688 38.423  92.294  1.00 95.07  ? 38  GLU B OE2   1 
ATOM   2200 N N     . PRO B 1 42  ? 21.232 35.598  92.673  1.00 41.80  ? 39  PRO B N     1 
ATOM   2201 C CA    . PRO B 1 42  ? 22.208 34.780  93.399  1.00 39.65  ? 39  PRO B CA    1 
ATOM   2202 C C     . PRO B 1 42  ? 22.668 35.484  94.670  1.00 45.66  ? 39  PRO B C     1 
ATOM   2203 O O     . PRO B 1 42  ? 22.890 34.829  95.687  1.00 41.49  ? 39  PRO B O     1 
ATOM   2204 C CB    . PRO B 1 42  ? 23.366 34.659  92.406  1.00 29.89  ? 39  PRO B CB    1 
ATOM   2205 C CG    . PRO B 1 42  ? 22.718 34.791  91.070  1.00 30.23  ? 39  PRO B CG    1 
ATOM   2206 C CD    . PRO B 1 42  ? 21.613 35.789  91.262  1.00 42.70  ? 39  PRO B CD    1 
ATOM   2207 N N     . LEU B 1 43  ? 22.799 36.806  94.607  1.00 35.88  ? 40  LEU B N     1 
ATOM   2208 C CA    . LEU B 1 43  ? 23.190 37.594  95.772  1.00 35.23  ? 40  LEU B CA    1 
ATOM   2209 C C     . LEU B 1 43  ? 22.110 37.582  96.850  1.00 33.99  ? 40  LEU B C     1 
ATOM   2210 O O     . LEU B 1 43  ? 22.395 37.339  98.022  1.00 40.60  ? 40  LEU B O     1 
ATOM   2211 C CB    . LEU B 1 43  ? 23.511 39.035  95.369  1.00 41.71  ? 40  LEU B CB    1 
ATOM   2212 C CG    . LEU B 1 43  ? 24.872 39.270  94.710  1.00 43.62  ? 40  LEU B CG    1 
ATOM   2213 C CD1   . LEU B 1 43  ? 25.003 40.711  94.251  1.00 41.82  ? 40  LEU B CD1   1 
ATOM   2214 C CD2   . LEU B 1 43  ? 25.999 38.905  95.663  1.00 33.12  ? 40  LEU B CD2   1 
ATOM   2215 N N     . MET B 1 44  ? 20.873 37.847  96.446  1.00 33.64  ? 41  MET B N     1 
ATOM   2216 C CA    . MET B 1 44  ? 19.746 37.846  97.372  1.00 41.34  ? 41  MET B CA    1 
ATOM   2217 C C     . MET B 1 44  ? 19.623 36.503  98.084  1.00 37.47  ? 41  MET B C     1 
ATOM   2218 O O     . MET B 1 44  ? 19.484 36.449  99.306  1.00 38.06  ? 41  MET B O     1 
ATOM   2219 C CB    . MET B 1 44  ? 18.444 38.169  96.633  1.00 43.07  ? 41  MET B CB    1 
ATOM   2220 C CG    . MET B 1 44  ? 18.421 39.537  95.965  1.00 57.60  ? 41  MET B CG    1 
ATOM   2221 S SD    . MET B 1 44  ? 18.328 40.897  97.145  1.00 57.05  ? 41  MET B SD    1 
ATOM   2222 C CE    . MET B 1 44  ? 16.764 40.539  97.946  1.00 42.59  ? 41  MET B CE    1 
ATOM   2223 N N     . HIS B 1 45  ? 19.676 35.420  97.316  1.00 32.50  ? 42  HIS B N     1 
ATOM   2224 C CA    . HIS B 1 45  ? 19.538 34.080  97.879  1.00 33.40  ? 42  HIS B CA    1 
ATOM   2225 C C     . HIS B 1 45  ? 20.739 33.681  98.733  1.00 37.54  ? 42  HIS B C     1 
ATOM   2226 O O     . HIS B 1 45  ? 20.591 32.970  99.728  1.00 48.25  ? 42  HIS B O     1 
ATOM   2227 C CB    . HIS B 1 45  ? 19.297 33.049  96.775  1.00 35.16  ? 42  HIS B CB    1 
ATOM   2228 C CG    . HIS B 1 45  ? 17.904 33.073  96.223  1.00 40.98  ? 42  HIS B CG    1 
ATOM   2229 N ND1   . HIS B 1 45  ? 17.564 33.783  95.095  1.00 48.95  ? 42  HIS B ND1   1 
ATOM   2230 C CD2   . HIS B 1 45  ? 16.767 32.475  96.653  1.00 41.45  ? 42  HIS B CD2   1 
ATOM   2231 C CE1   . HIS B 1 45  ? 16.274 33.620  94.847  1.00 44.78  ? 42  HIS B CE1   1 
ATOM   2232 N NE2   . HIS B 1 45  ? 15.769 32.832  95.778  1.00 38.86  ? 42  HIS B NE2   1 
ATOM   2233 N N     . SER B 1 46  ? 21.925 34.138  98.340  1.00 35.16  ? 43  SER B N     1 
ATOM   2234 C CA    . SER B 1 46  ? 23.137 33.879  99.109  1.00 32.51  ? 43  SER B CA    1 
ATOM   2235 C C     . SER B 1 46  ? 23.035 34.511  100.491 1.00 40.37  ? 43  SER B C     1 
ATOM   2236 O O     . SER B 1 46  ? 23.245 33.849  101.507 1.00 39.20  ? 43  SER B O     1 
ATOM   2237 C CB    . SER B 1 46  ? 24.368 34.426  98.382  1.00 37.44  ? 43  SER B CB    1 
ATOM   2238 O OG    . SER B 1 46  ? 24.657 33.669  97.219  1.00 30.98  ? 43  SER B OG    1 
ATOM   2239 N N     . ILE B 1 47  ? 22.710 35.799  100.517 1.00 33.23  ? 44  ILE B N     1 
ATOM   2240 C CA    . ILE B 1 47  ? 22.580 36.532  101.769 1.00 37.28  ? 44  ILE B CA    1 
ATOM   2241 C C     . ILE B 1 47  ? 21.534 35.884  102.667 1.00 34.98  ? 44  ILE B C     1 
ATOM   2242 O O     . ILE B 1 47  ? 21.732 35.756  103.875 1.00 52.95  ? 44  ILE B O     1 
ATOM   2243 C CB    . ILE B 1 47  ? 22.203 38.006  101.523 1.00 35.75  ? 44  ILE B CB    1 
ATOM   2244 C CG1   . ILE B 1 47  ? 23.253 38.689  100.645 1.00 35.56  ? 44  ILE B CG1   1 
ATOM   2245 C CG2   . ILE B 1 47  ? 22.059 38.746  102.843 1.00 37.38  ? 44  ILE B CG2   1 
ATOM   2246 C CD1   . ILE B 1 47  ? 22.894 40.110  100.256 1.00 36.71  ? 44  ILE B CD1   1 
ATOM   2247 N N     . ALA B 1 48  ? 20.422 35.472  102.066 1.00 37.48  ? 45  ALA B N     1 
ATOM   2248 C CA    . ALA B 1 48  ? 19.342 34.827  102.802 1.00 45.64  ? 45  ALA B CA    1 
ATOM   2249 C C     . ALA B 1 48  ? 19.797 33.509  103.421 1.00 45.30  ? 45  ALA B C     1 
ATOM   2250 O O     . ALA B 1 48  ? 19.272 33.083  104.450 1.00 51.09  ? 45  ALA B O     1 
ATOM   2251 C CB    . ALA B 1 48  ? 18.145 34.599  101.889 1.00 34.74  ? 45  ALA B CB    1 
ATOM   2252 N N     . ALA B 1 49  ? 20.777 32.869  102.791 1.00 33.16  ? 46  ALA B N     1 
ATOM   2253 C CA    . ALA B 1 49  ? 21.276 31.579  103.253 1.00 34.12  ? 46  ALA B CA    1 
ATOM   2254 C C     . ALA B 1 49  ? 22.372 31.733  104.305 1.00 47.07  ? 46  ALA B C     1 
ATOM   2255 O O     . ALA B 1 49  ? 22.943 30.746  104.768 1.00 44.72  ? 46  ALA B O     1 
ATOM   2256 C CB    . ALA B 1 49  ? 21.780 30.753  102.075 1.00 31.17  ? 46  ALA B CB    1 
ATOM   2257 N N     . GLY B 1 50  ? 22.662 32.976  104.676 1.00 46.68  ? 47  GLY B N     1 
ATOM   2258 C CA    . GLY B 1 50  ? 23.632 33.252  105.719 1.00 37.74  ? 47  GLY B CA    1 
ATOM   2259 C C     . GLY B 1 50  ? 25.048 33.451  105.212 1.00 47.16  ? 47  GLY B C     1 
ATOM   2260 O O     . GLY B 1 50  ? 25.971 33.666  105.999 1.00 46.04  ? 47  GLY B O     1 
ATOM   2261 N N     . VAL B 1 51  ? 25.224 33.374  103.897 1.00 33.65  ? 48  VAL B N     1 
ATOM   2262 C CA    . VAL B 1 51  ? 26.536 33.585  103.295 1.00 34.71  ? 48  VAL B CA    1 
ATOM   2263 C C     . VAL B 1 51  ? 27.068 34.969  103.647 1.00 46.16  ? 48  VAL B C     1 
ATOM   2264 O O     . VAL B 1 51  ? 26.423 35.980  103.370 1.00 49.22  ? 48  VAL B O     1 
ATOM   2265 C CB    . VAL B 1 51  ? 26.490 33.436  101.763 1.00 32.05  ? 48  VAL B CB    1 
ATOM   2266 C CG1   . VAL B 1 51  ? 27.848 33.762  101.160 1.00 34.81  ? 48  VAL B CG1   1 
ATOM   2267 C CG2   . VAL B 1 51  ? 26.052 32.031  101.378 1.00 32.71  ? 48  VAL B CG2   1 
ATOM   2268 N N     . GLU B 1 52  ? 28.244 35.009  104.263 1.00 45.11  ? 49  GLU B N     1 
ATOM   2269 C CA    . GLU B 1 52  ? 28.837 36.271  104.689 1.00 53.02  ? 49  GLU B CA    1 
ATOM   2270 C C     . GLU B 1 52  ? 29.509 37.003  103.534 1.00 51.38  ? 49  GLU B C     1 
ATOM   2271 O O     . GLU B 1 52  ? 30.255 36.408  102.755 1.00 43.73  ? 49  GLU B O     1 
ATOM   2272 C CB    . GLU B 1 52  ? 29.834 36.042  105.826 1.00 59.02  ? 49  GLU B CB    1 
ATOM   2273 C CG    . GLU B 1 52  ? 29.185 35.662  107.145 1.00 65.68  ? 49  GLU B CG    1 
ATOM   2274 C CD    . GLU B 1 52  ? 30.184 35.578  108.280 1.00 76.62  ? 49  GLU B CD    1 
ATOM   2275 O OE1   . GLU B 1 52  ? 31.345 35.193  108.025 1.00 77.99  ? 49  GLU B OE1   1 
ATOM   2276 O OE2   . GLU B 1 52  ? 29.809 35.897  109.428 1.00 83.99  ? 49  GLU B OE2   1 
ATOM   2277 N N     . PHE B 1 53  ? 29.237 38.300  103.432 1.00 49.32  ? 50  PHE B N     1 
ATOM   2278 C CA    . PHE B 1 53  ? 29.790 39.124  102.365 1.00 46.30  ? 50  PHE B CA    1 
ATOM   2279 C C     . PHE B 1 53  ? 30.729 40.191  102.911 1.00 48.54  ? 50  PHE B C     1 
ATOM   2280 O O     . PHE B 1 53  ? 30.485 40.768  103.971 1.00 54.68  ? 50  PHE B O     1 
ATOM   2281 C CB    . PHE B 1 53  ? 28.668 39.784  101.558 1.00 47.07  ? 50  PHE B CB    1 
ATOM   2282 C CG    . PHE B 1 53  ? 28.016 38.868  100.562 1.00 44.61  ? 50  PHE B CG    1 
ATOM   2283 C CD1   . PHE B 1 53  ? 26.946 38.069  100.929 1.00 38.30  ? 50  PHE B CD1   1 
ATOM   2284 C CD2   . PHE B 1 53  ? 28.472 38.810  99.256  1.00 34.65  ? 50  PHE B CD2   1 
ATOM   2285 C CE1   . PHE B 1 53  ? 26.345 37.226  100.012 1.00 41.59  ? 50  PHE B CE1   1 
ATOM   2286 C CE2   . PHE B 1 53  ? 27.876 37.970  98.335  1.00 38.14  ? 50  PHE B CE2   1 
ATOM   2287 C CZ    . PHE B 1 53  ? 26.810 37.177  98.713  1.00 38.97  ? 50  PHE B CZ    1 
ATOM   2288 N N     . ILE B 1 54  ? 31.806 40.444  102.178 1.00 51.66  ? 51  ILE B N     1 
ATOM   2289 C CA    . ILE B 1 54  ? 32.740 41.503  102.526 1.00 53.77  ? 51  ILE B CA    1 
ATOM   2290 C C     . ILE B 1 54  ? 32.208 42.831  102.003 1.00 54.76  ? 51  ILE B C     1 
ATOM   2291 O O     . ILE B 1 54  ? 32.134 43.816  102.736 1.00 61.56  ? 51  ILE B O     1 
ATOM   2292 C CB    . ILE B 1 54  ? 34.133 41.236  101.931 1.00 59.32  ? 51  ILE B CB    1 
ATOM   2293 C CG1   . ILE B 1 54  ? 34.692 39.913  102.464 1.00 56.29  ? 51  ILE B CG1   1 
ATOM   2294 C CG2   . ILE B 1 54  ? 35.077 42.388  102.243 1.00 68.93  ? 51  ILE B CG2   1 
ATOM   2295 C CD1   . ILE B 1 54  ? 36.001 39.502  101.827 1.00 62.75  ? 51  ILE B CD1   1 
ATOM   2296 N N     . GLU B 1 55  ? 31.832 42.845  100.729 1.00 45.13  ? 52  GLU B N     1 
ATOM   2297 C CA    . GLU B 1 55  ? 31.245 44.029  100.117 1.00 45.24  ? 52  GLU B CA    1 
ATOM   2298 C C     . GLU B 1 55  ? 30.497 43.681  98.835  1.00 45.99  ? 52  GLU B C     1 
ATOM   2299 O O     . GLU B 1 55  ? 30.907 42.794  98.088  1.00 46.15  ? 52  GLU B O     1 
ATOM   2300 C CB    . GLU B 1 55  ? 32.321 45.079  99.827  1.00 45.08  ? 52  GLU B CB    1 
ATOM   2301 C CG    . GLU B 1 55  ? 31.769 46.381  99.267  1.00 57.12  ? 52  GLU B CG    1 
ATOM   2302 C CD    . GLU B 1 55  ? 32.753 47.528  99.369  1.00 62.24  ? 52  GLU B CD    1 
ATOM   2303 O OE1   . GLU B 1 55  ? 33.900 47.379  98.897  1.00 48.62  ? 52  GLU B OE1   1 
ATOM   2304 O OE2   . GLU B 1 55  ? 32.376 48.582  99.921  1.00 69.98  ? 52  GLU B OE2   1 
ATOM   2305 N N     . VAL B 1 56  ? 29.395 44.385  98.594  1.00 40.81  ? 53  VAL B N     1 
ATOM   2306 C CA    . VAL B 1 56  ? 28.615 44.217  97.373  1.00 40.11  ? 53  VAL B CA    1 
ATOM   2307 C C     . VAL B 1 56  ? 28.780 45.432  96.461  1.00 43.67  ? 53  VAL B C     1 
ATOM   2308 O O     . VAL B 1 56  ? 28.821 46.569  96.929  1.00 49.35  ? 53  VAL B O     1 
ATOM   2309 C CB    . VAL B 1 56  ? 27.118 44.000  97.685  1.00 45.62  ? 53  VAL B CB    1 
ATOM   2310 C CG1   . VAL B 1 56  ? 26.289 44.056  96.410  1.00 38.41  ? 53  VAL B CG1   1 
ATOM   2311 C CG2   . VAL B 1 56  ? 26.913 42.675  98.404  1.00 42.38  ? 53  VAL B CG2   1 
ATOM   2312 N N     . TYR B 1 57  ? 28.881 45.185  95.160  1.00 42.70  ? 54  TYR B N     1 
ATOM   2313 C CA    . TYR B 1 57  ? 29.094 46.256  94.194  1.00 43.47  ? 54  TYR B CA    1 
ATOM   2314 C C     . TYR B 1 57  ? 27.992 46.308  93.141  1.00 43.99  ? 54  TYR B C     1 
ATOM   2315 O O     . TYR B 1 57  ? 27.138 45.423  93.070  1.00 48.90  ? 54  TYR B O     1 
ATOM   2316 C CB    . TYR B 1 57  ? 30.447 46.090  93.502  1.00 41.02  ? 54  TYR B CB    1 
ATOM   2317 C CG    . TYR B 1 57  ? 31.614 45.944  94.449  1.00 46.63  ? 54  TYR B CG    1 
ATOM   2318 C CD1   . TYR B 1 57  ? 32.025 44.692  94.886  1.00 48.79  ? 54  TYR B CD1   1 
ATOM   2319 C CD2   . TYR B 1 57  ? 32.310 47.058  94.901  1.00 54.92  ? 54  TYR B CD2   1 
ATOM   2320 C CE1   . TYR B 1 57  ? 33.095 44.553  95.750  1.00 53.97  ? 54  TYR B CE1   1 
ATOM   2321 C CE2   . TYR B 1 57  ? 33.381 46.928  95.765  1.00 50.36  ? 54  TYR B CE2   1 
ATOM   2322 C CZ    . TYR B 1 57  ? 33.769 45.674  96.186  1.00 48.95  ? 54  TYR B CZ    1 
ATOM   2323 O OH    . TYR B 1 57  ? 34.835 45.542  97.046  1.00 56.08  ? 54  TYR B OH    1 
ATOM   2324 N N     . GLY B 1 58  ? 28.026 47.353  92.322  1.00 55.45  ? 55  GLY B N     1 
ATOM   2325 C CA    . GLY B 1 58  ? 27.069 47.522  91.245  1.00 57.06  ? 55  GLY B CA    1 
ATOM   2326 C C     . GLY B 1 58  ? 27.548 48.544  90.234  1.00 56.61  ? 55  GLY B C     1 
ATOM   2327 O O     . GLY B 1 58  ? 28.332 49.433  90.563  1.00 61.49  ? 55  GLY B O     1 
ATOM   2328 N N     . SER B 1 59  ? 27.076 48.417  88.999  1.00 56.54  ? 56  SER B N     1 
ATOM   2329 C CA    . SER B 1 59  ? 27.453 49.342  87.937  1.00 62.88  ? 56  SER B CA    1 
ATOM   2330 C C     . SER B 1 59  ? 26.667 50.645  88.051  1.00 70.69  ? 56  SER B C     1 
ATOM   2331 O O     . SER B 1 59  ? 25.458 50.629  88.282  1.00 80.37  ? 56  SER B O     1 
ATOM   2332 C CB    . SER B 1 59  ? 27.218 48.701  86.567  1.00 64.76  ? 56  SER B CB    1 
ATOM   2333 O OG    . SER B 1 59  ? 27.639 49.559  85.522  1.00 71.65  ? 56  SER B OG    1 
ATOM   2334 N N     . ASP B 1 60  ? 27.354 51.772  87.891  1.00 66.03  ? 57  ASP B N     1 
ATOM   2335 C CA    . ASP B 1 60  ? 26.708 53.077  87.995  1.00 76.97  ? 57  ASP B CA    1 
ATOM   2336 C C     . ASP B 1 60  ? 25.879 53.390  86.753  1.00 70.63  ? 57  ASP B C     1 
ATOM   2337 O O     . ASP B 1 60  ? 25.242 54.440  86.669  1.00 74.90  ? 57  ASP B O     1 
ATOM   2338 C CB    . ASP B 1 60  ? 27.740 54.184  88.236  1.00 81.90  ? 57  ASP B CB    1 
ATOM   2339 C CG    . ASP B 1 60  ? 28.559 54.500  86.999  1.00 88.48  ? 57  ASP B CG    1 
ATOM   2340 O OD1   . ASP B 1 60  ? 28.546 53.689  86.049  1.00 91.09  ? 57  ASP B OD1   1 
ATOM   2341 O OD2   . ASP B 1 60  ? 29.220 55.560  86.977  1.00 94.66  ? 57  ASP B OD2   1 
ATOM   2342 N N     . SER B 1 61  ? 25.895 52.476  85.789  1.00 62.54  ? 58  SER B N     1 
ATOM   2343 C CA    . SER B 1 61  ? 25.119 52.641  84.566  1.00 80.28  ? 58  SER B CA    1 
ATOM   2344 C C     . SER B 1 61  ? 23.863 51.780  84.601  1.00 86.07  ? 58  SER B C     1 
ATOM   2345 O O     . SER B 1 61  ? 23.072 51.780  83.659  1.00 90.74  ? 58  SER B O     1 
ATOM   2346 C CB    . SER B 1 61  ? 25.962 52.287  83.341  1.00 86.10  ? 58  SER B CB    1 
ATOM   2347 O OG    . SER B 1 61  ? 26.393 50.937  83.390  1.00 91.44  ? 58  SER B OG    1 
ATOM   2348 N N     . SER B 1 62  ? 23.688 51.046  85.695  1.00 77.28  ? 59  SER B N     1 
ATOM   2349 C CA    . SER B 1 62  ? 22.525 50.184  85.860  1.00 73.33  ? 59  SER B CA    1 
ATOM   2350 C C     . SER B 1 62  ? 21.775 50.516  87.142  1.00 76.09  ? 59  SER B C     1 
ATOM   2351 O O     . SER B 1 62  ? 22.389 50.772  88.177  1.00 79.51  ? 59  SER B O     1 
ATOM   2352 C CB    . SER B 1 62  ? 22.945 48.714  85.876  1.00 73.46  ? 59  SER B CB    1 
ATOM   2353 O OG    . SER B 1 62  ? 21.817 47.857  85.840  1.00 75.50  ? 59  SER B OG    1 
ATOM   2354 N N     . PRO B 1 63  ? 20.436 50.515  87.073  1.00 82.26  ? 60  PRO B N     1 
ATOM   2355 C CA    . PRO B 1 63  ? 19.586 50.772  88.239  1.00 84.95  ? 60  PRO B CA    1 
ATOM   2356 C C     . PRO B 1 63  ? 19.808 49.729  89.327  1.00 76.72  ? 60  PRO B C     1 
ATOM   2357 O O     . PRO B 1 63  ? 19.320 48.604  89.211  1.00 70.01  ? 60  PRO B O     1 
ATOM   2358 C CB    . PRO B 1 63  ? 18.167 50.645  87.673  1.00 91.75  ? 60  PRO B CB    1 
ATOM   2359 C CG    . PRO B 1 63  ? 18.315 50.894  86.211  1.00 93.03  ? 60  PRO B CG    1 
ATOM   2360 C CD    . PRO B 1 63  ? 19.647 50.323  85.844  1.00 87.31  ? 60  PRO B CD    1 
ATOM   2361 N N     . PHE B 1 64  ? 20.542 50.103  90.370  1.00 71.84  ? 61  PHE B N     1 
ATOM   2362 C CA    . PHE B 1 64  ? 20.819 49.197  91.477  1.00 64.88  ? 61  PHE B CA    1 
ATOM   2363 C C     . PHE B 1 64  ? 19.519 48.744  92.137  1.00 65.53  ? 61  PHE B C     1 
ATOM   2364 O O     . PHE B 1 64  ? 18.741 49.567  92.619  1.00 62.73  ? 61  PHE B O     1 
ATOM   2365 C CB    . PHE B 1 64  ? 21.734 49.868  92.502  1.00 54.55  ? 61  PHE B CB    1 
ATOM   2366 C CG    . PHE B 1 64  ? 22.366 48.910  93.470  1.00 52.62  ? 61  PHE B CG    1 
ATOM   2367 C CD1   . PHE B 1 64  ? 21.705 48.536  94.627  1.00 55.54  ? 61  PHE B CD1   1 
ATOM   2368 C CD2   . PHE B 1 64  ? 23.624 48.386  93.224  1.00 47.13  ? 61  PHE B CD2   1 
ATOM   2369 C CE1   . PHE B 1 64  ? 22.285 47.656  95.519  1.00 59.35  ? 61  PHE B CE1   1 
ATOM   2370 C CE2   . PHE B 1 64  ? 24.210 47.505  94.113  1.00 51.48  ? 61  PHE B CE2   1 
ATOM   2371 C CZ    . PHE B 1 64  ? 23.539 47.140  95.262  1.00 48.87  ? 61  PHE B CZ    1 
ATOM   2372 N N     . PRO B 1 65  ? 19.286 47.424  92.161  1.00 62.37  ? 62  PRO B N     1 
ATOM   2373 C CA    . PRO B 1 65  ? 18.040 46.828  92.656  1.00 63.27  ? 62  PRO B CA    1 
ATOM   2374 C C     . PRO B 1 65  ? 17.677 47.288  94.064  1.00 65.46  ? 62  PRO B C     1 
ATOM   2375 O O     . PRO B 1 65  ? 18.418 47.031  95.013  1.00 62.66  ? 62  PRO B O     1 
ATOM   2376 C CB    . PRO B 1 65  ? 18.349 45.327  92.659  1.00 49.07  ? 62  PRO B CB    1 
ATOM   2377 C CG    . PRO B 1 65  ? 19.415 45.161  91.635  1.00 53.31  ? 62  PRO B CG    1 
ATOM   2378 C CD    . PRO B 1 65  ? 20.251 46.401  91.723  1.00 56.46  ? 62  PRO B CD    1 
ATOM   2379 N N     . SER B 1 66  ? 16.540 47.964  94.190  1.00 69.66  ? 63  SER B N     1 
ATOM   2380 C CA    . SER B 1 66  ? 16.041 48.375  95.496  1.00 77.21  ? 63  SER B CA    1 
ATOM   2381 C C     . SER B 1 66  ? 15.400 47.188  96.205  1.00 78.83  ? 63  SER B C     1 
ATOM   2382 O O     . SER B 1 66  ? 14.299 46.764  95.854  1.00 98.81  ? 63  SER B O     1 
ATOM   2383 C CB    . SER B 1 66  ? 15.040 49.523  95.362  1.00 79.53  ? 63  SER B CB    1 
ATOM   2384 O OG    . SER B 1 66  ? 13.887 49.112  94.646  1.00 82.37  ? 63  SER B OG    1 
ATOM   2385 N N     . GLU B 1 67  ? 16.111 46.671  97.203  1.00 58.48  ? 64  GLU B N     1 
ATOM   2386 C CA    . GLU B 1 67  ? 15.734 45.480  97.959  1.00 65.43  ? 64  GLU B CA    1 
ATOM   2387 C C     . GLU B 1 67  ? 17.018 44.715  98.240  1.00 50.81  ? 64  GLU B C     1 
ATOM   2388 O O     . GLU B 1 67  ? 17.157 44.060  99.272  1.00 49.76  ? 64  GLU B O     1 
ATOM   2389 C CB    . GLU B 1 67  ? 14.748 44.595  97.194  1.00 72.24  ? 64  GLU B CB    1 
ATOM   2390 C CG    . GLU B 1 67  ? 15.358 43.823  96.036  1.00 90.77  ? 64  GLU B CG    1 
ATOM   2391 C CD    . GLU B 1 67  ? 14.317 43.088  95.217  1.00 109.85 ? 64  GLU B CD    1 
ATOM   2392 O OE1   . GLU B 1 67  ? 13.119 43.420  95.342  1.00 124.50 ? 64  GLU B OE1   1 
ATOM   2393 O OE2   . GLU B 1 67  ? 14.695 42.181  94.446  1.00 105.68 ? 64  GLU B OE2   1 
ATOM   2394 N N     . LEU B 1 68  ? 17.952 44.806  97.299  1.00 48.84  ? 65  LEU B N     1 
ATOM   2395 C CA    . LEU B 1 68  ? 19.303 44.314  97.499  1.00 53.02  ? 65  LEU B CA    1 
ATOM   2396 C C     . LEU B 1 68  ? 20.014 45.353  98.348  1.00 51.76  ? 65  LEU B C     1 
ATOM   2397 O O     . LEU B 1 68  ? 20.679 45.028  99.332  1.00 50.80  ? 65  LEU B O     1 
ATOM   2398 C CB    . LEU B 1 68  ? 20.016 44.168  96.155  1.00 52.05  ? 65  LEU B CB    1 
ATOM   2399 C CG    . LEU B 1 68  ? 21.115 43.110  96.031  1.00 54.12  ? 65  LEU B CG    1 
ATOM   2400 C CD1   . LEU B 1 68  ? 22.022 43.438  94.857  1.00 44.82  ? 65  LEU B CD1   1 
ATOM   2401 C CD2   . LEU B 1 68  ? 21.925 42.995  97.309  1.00 54.96  ? 65  LEU B CD2   1 
ATOM   2402 N N     . LEU B 1 69  ? 19.857 46.614  97.957  1.00 53.02  ? 66  LEU B N     1 
ATOM   2403 C CA    . LEU B 1 69  ? 20.390 47.731  98.719  1.00 45.26  ? 66  LEU B CA    1 
ATOM   2404 C C     . LEU B 1 69  ? 19.825 47.677  100.132 1.00 56.31  ? 66  LEU B C     1 
ATOM   2405 O O     . LEU B 1 69  ? 20.548 47.860  101.110 1.00 54.04  ? 66  LEU B O     1 
ATOM   2406 C CB    . LEU B 1 69  ? 20.006 49.055  98.054  1.00 61.18  ? 66  LEU B CB    1 
ATOM   2407 C CG    . LEU B 1 69  ? 21.016 50.205  98.112  1.00 67.24  ? 66  LEU B CG    1 
ATOM   2408 C CD1   . LEU B 1 69  ? 20.306 51.538  97.926  1.00 71.62  ? 66  LEU B CD1   1 
ATOM   2409 C CD2   . LEU B 1 69  ? 21.798 50.193  99.415  1.00 73.23  ? 66  LEU B CD2   1 
ATOM   2410 N N     . ASP B 1 70  ? 18.526 47.416  100.229 1.00 51.43  ? 67  ASP B N     1 
ATOM   2411 C CA    . ASP B 1 70  ? 17.852 47.324  101.521 1.00 59.16  ? 67  ASP B CA    1 
ATOM   2412 C C     . ASP B 1 70  ? 18.334 46.118  102.324 1.00 61.66  ? 67  ASP B C     1 
ATOM   2413 O O     . ASP B 1 70  ? 18.671 46.243  103.501 1.00 63.40  ? 67  ASP B O     1 
ATOM   2414 C CB    . ASP B 1 70  ? 16.335 47.263  101.335 1.00 67.96  ? 67  ASP B CB    1 
ATOM   2415 C CG    . ASP B 1 70  ? 15.762 48.558  100.791 1.00 77.73  ? 67  ASP B CG    1 
ATOM   2416 O OD1   . ASP B 1 70  ? 16.533 49.526  100.614 1.00 76.84  ? 67  ASP B OD1   1 
ATOM   2417 O OD2   . ASP B 1 70  ? 14.539 48.609  100.542 1.00 83.57  ? 67  ASP B OD2   1 
ATOM   2418 N N     . LEU B 1 71  ? 18.362 44.952  101.685 1.00 53.61  ? 68  LEU B N     1 
ATOM   2419 C CA    . LEU B 1 71  ? 18.828 43.735  102.343 1.00 48.25  ? 68  LEU B CA    1 
ATOM   2420 C C     . LEU B 1 71  ? 20.236 43.929  102.892 1.00 47.25  ? 68  LEU B C     1 
ATOM   2421 O O     . LEU B 1 71  ? 20.494 43.677  104.070 1.00 60.14  ? 68  LEU B O     1 
ATOM   2422 C CB    . LEU B 1 71  ? 18.796 42.550  101.375 1.00 44.95  ? 68  LEU B CB    1 
ATOM   2423 C CG    . LEU B 1 71  ? 19.321 41.221  101.920 1.00 45.13  ? 68  LEU B CG    1 
ATOM   2424 C CD1   . LEU B 1 71  ? 18.709 40.922  103.280 1.00 49.27  ? 68  LEU B CD1   1 
ATOM   2425 C CD2   . LEU B 1 71  ? 19.046 40.087  100.943 1.00 46.61  ? 68  LEU B CD2   1 
ATOM   2426 N N     . CYS B 1 72  ? 21.142 44.377  102.029 1.00 52.91  ? 69  CYS B N     1 
ATOM   2427 C CA    . CYS B 1 72  ? 22.512 44.659  102.435 1.00 59.26  ? 69  CYS B CA    1 
ATOM   2428 C C     . CYS B 1 72  ? 22.532 45.636  103.604 1.00 61.36  ? 69  CYS B C     1 
ATOM   2429 O O     . CYS B 1 72  ? 23.347 45.511  104.517 1.00 52.53  ? 69  CYS B O     1 
ATOM   2430 C CB    . CYS B 1 72  ? 23.314 45.226  101.263 1.00 42.76  ? 69  CYS B CB    1 
ATOM   2431 S SG    . CYS B 1 72  ? 23.725 44.010  99.990  1.00 47.42  ? 69  CYS B SG    1 
ATOM   2432 N N     . GLY B 1 73  ? 21.623 46.604  103.570 1.00 66.70  ? 70  GLY B N     1 
ATOM   2433 C CA    . GLY B 1 73  ? 21.523 47.596  104.624 1.00 65.87  ? 70  GLY B CA    1 
ATOM   2434 C C     . GLY B 1 73  ? 21.194 46.976  105.967 1.00 63.39  ? 70  GLY B C     1 
ATOM   2435 O O     . GLY B 1 73  ? 21.835 47.278  106.973 1.00 65.43  ? 70  GLY B O     1 
ATOM   2436 N N     . ARG B 1 74  ? 20.194 46.101  105.983 1.00 58.58  ? 71  ARG B N     1 
ATOM   2437 C CA    . ARG B 1 74  ? 19.757 45.469  107.222 1.00 64.79  ? 71  ARG B CA    1 
ATOM   2438 C C     . ARG B 1 74  ? 20.732 44.382  107.666 1.00 69.05  ? 71  ARG B C     1 
ATOM   2439 O O     . ARG B 1 74  ? 20.602 43.828  108.757 1.00 75.61  ? 71  ARG B O     1 
ATOM   2440 C CB    . ARG B 1 74  ? 18.349 44.889  107.067 1.00 64.76  ? 71  ARG B CB    1 
ATOM   2441 C CG    . ARG B 1 74  ? 17.427 45.730  106.197 1.00 78.28  ? 71  ARG B CG    1 
ATOM   2442 C CD    . ARG B 1 74  ? 15.991 45.711  106.702 1.00 91.29  ? 71  ARG B CD    1 
ATOM   2443 N NE    . ARG B 1 74  ? 15.582 44.396  107.188 1.00 104.71 ? 71  ARG B NE    1 
ATOM   2444 C CZ    . ARG B 1 74  ? 15.594 44.039  108.468 1.00 111.72 ? 71  ARG B CZ    1 
ATOM   2445 N NH1   . ARG B 1 74  ? 15.998 44.898  109.394 1.00 106.17 ? 71  ARG B NH1   1 
ATOM   2446 N NH2   . ARG B 1 74  ? 15.204 42.823  108.824 1.00 116.47 ? 71  ARG B NH2   1 
ATOM   2447 N N     . GLN B 1 75  ? 21.709 44.085  106.815 1.00 63.03  ? 72  GLN B N     1 
ATOM   2448 C CA    . GLN B 1 75  ? 22.718 43.078  107.125 1.00 58.86  ? 72  GLN B CA    1 
ATOM   2449 C C     . GLN B 1 75  ? 24.100 43.698  107.312 1.00 62.73  ? 72  GLN B C     1 
ATOM   2450 O O     . GLN B 1 75  ? 25.095 42.985  107.442 1.00 61.58  ? 72  GLN B O     1 
ATOM   2451 C CB    . GLN B 1 75  ? 22.769 42.010  106.030 1.00 56.77  ? 72  GLN B CB    1 
ATOM   2452 C CG    . GLN B 1 75  ? 21.577 41.066  106.016 1.00 53.43  ? 72  GLN B CG    1 
ATOM   2453 C CD    . GLN B 1 75  ? 21.413 40.312  107.323 1.00 65.06  ? 72  GLN B CD    1 
ATOM   2454 O OE1   . GLN B 1 75  ? 21.068 40.894  108.351 1.00 86.79  ? 72  GLN B OE1   1 
ATOM   2455 N NE2   . GLN B 1 75  ? 21.651 39.006  107.286 1.00 62.39  ? 72  GLN B NE2   1 
ATOM   2456 N N     . ASN B 1 76  ? 24.153 45.026  107.322 1.00 63.90  ? 73  ASN B N     1 
ATOM   2457 C CA    . ASN B 1 76  ? 25.410 45.749  107.494 1.00 70.55  ? 73  ASN B CA    1 
ATOM   2458 C C     . ASN B 1 76  ? 26.439 45.436  106.411 1.00 66.90  ? 73  ASN B C     1 
ATOM   2459 O O     . ASN B 1 76  ? 27.643 45.559  106.633 1.00 68.71  ? 73  ASN B O     1 
ATOM   2460 C CB    . ASN B 1 76  ? 26.005 45.481  108.879 1.00 80.33  ? 73  ASN B CB    1 
ATOM   2461 C CG    . ASN B 1 76  ? 25.254 46.197  109.984 1.00 97.16  ? 73  ASN B CG    1 
ATOM   2462 O OD1   . ASN B 1 76  ? 24.342 46.982  109.724 1.00 100.45 ? 73  ASN B OD1   1 
ATOM   2463 N ND2   . ASN B 1 76  ? 25.639 45.933  111.227 1.00 106.11 ? 73  ASN B ND2   1 
ATOM   2464 N N     . ILE B 1 77  ? 25.960 45.033  105.240 1.00 55.44  ? 74  ILE B N     1 
ATOM   2465 C CA    . ILE B 1 77  ? 26.842 44.763  104.111 1.00 59.28  ? 74  ILE B CA    1 
ATOM   2466 C C     . ILE B 1 77  ? 27.126 46.037  103.326 1.00 60.15  ? 74  ILE B C     1 
ATOM   2467 O O     . ILE B 1 77  ? 26.213 46.644  102.768 1.00 66.37  ? 74  ILE B O     1 
ATOM   2468 C CB    . ILE B 1 77  ? 26.244 43.713  103.159 1.00 47.79  ? 74  ILE B CB    1 
ATOM   2469 C CG1   . ILE B 1 77  ? 26.045 42.384  103.890 1.00 41.40  ? 74  ILE B CG1   1 
ATOM   2470 C CG2   . ILE B 1 77  ? 27.144 43.528  101.948 1.00 41.04  ? 74  ILE B CG2   1 
ATOM   2471 C CD1   . ILE B 1 77  ? 25.433 41.303  103.030 1.00 39.53  ? 74  ILE B CD1   1 
ATOM   2472 N N     . PRO B 1 78  ? 28.401 46.447  103.287 1.00 49.78  ? 75  PRO B N     1 
ATOM   2473 C CA    . PRO B 1 78  ? 28.821 47.641  102.547 1.00 49.92  ? 75  PRO B CA    1 
ATOM   2474 C C     . PRO B 1 78  ? 28.556 47.488  101.056 1.00 45.22  ? 75  PRO B C     1 
ATOM   2475 O O     . PRO B 1 78  ? 28.750 46.405  100.506 1.00 53.29  ? 75  PRO B O     1 
ATOM   2476 C CB    . PRO B 1 78  ? 30.330 47.702  102.808 1.00 47.29  ? 75  PRO B CB    1 
ATOM   2477 C CG    . PRO B 1 78  ? 30.539 46.907  104.055 1.00 55.86  ? 75  PRO B CG    1 
ATOM   2478 C CD    . PRO B 1 78  ? 29.524 45.812  103.996 1.00 47.42  ? 75  PRO B CD    1 
ATOM   2479 N N     . VAL B 1 79  ? 28.112 48.562  100.412 1.00 54.32  ? 76  VAL B N     1 
ATOM   2480 C CA    . VAL B 1 79  ? 27.849 48.533  98.979  1.00 55.66  ? 76  VAL B CA    1 
ATOM   2481 C C     . VAL B 1 79  ? 28.342 49.801  98.289  1.00 56.67  ? 76  VAL B C     1 
ATOM   2482 O O     . VAL B 1 79  ? 27.975 50.911  98.673  1.00 59.00  ? 76  VAL B O     1 
ATOM   2483 C CB    . VAL B 1 79  ? 26.350 48.308  98.677  1.00 54.04  ? 76  VAL B CB    1 
ATOM   2484 C CG1   . VAL B 1 79  ? 25.488 48.938  99.759  1.00 66.82  ? 76  VAL B CG1   1 
ATOM   2485 C CG2   . VAL B 1 79  ? 25.992 48.850  97.298  1.00 45.67  ? 76  VAL B CG2   1 
ATOM   2486 N N     . ARG B 1 80  ? 29.183 49.622  97.275  1.00 48.91  ? 77  ARG B N     1 
ATOM   2487 C CA    . ARG B 1 80  ? 29.740 50.739  96.522  1.00 59.17  ? 77  ARG B CA    1 
ATOM   2488 C C     . ARG B 1 80  ? 29.450 50.593  95.032  1.00 63.90  ? 77  ARG B C     1 
ATOM   2489 O O     . ARG B 1 80  ? 29.403 49.481  94.505  1.00 65.67  ? 77  ARG B O     1 
ATOM   2490 C CB    . ARG B 1 80  ? 31.250 50.837  96.745  1.00 61.35  ? 77  ARG B CB    1 
ATOM   2491 C CG    . ARG B 1 80  ? 31.655 51.095  98.186  1.00 64.94  ? 77  ARG B CG    1 
ATOM   2492 C CD    . ARG B 1 80  ? 33.166 51.028  98.355  1.00 67.03  ? 77  ARG B CD    1 
ATOM   2493 N NE    . ARG B 1 80  ? 33.854 52.046  97.566  1.00 79.85  ? 77  ARG B NE    1 
ATOM   2494 C CZ    . ARG B 1 80  ? 35.176 52.151  97.475  1.00 84.67  ? 77  ARG B CZ    1 
ATOM   2495 N NH1   . ARG B 1 80  ? 35.958 51.297  98.123  1.00 85.63  ? 77  ARG B NH1   1 
ATOM   2496 N NH2   . ARG B 1 80  ? 35.717 53.109  96.735  1.00 80.86  ? 77  ARG B NH2   1 
ATOM   2497 N N     . LEU B 1 81  ? 29.258 51.721  94.357  1.00 60.93  ? 78  LEU B N     1 
ATOM   2498 C CA    . LEU B 1 81  ? 29.013 51.717  92.919  1.00 61.86  ? 78  LEU B CA    1 
ATOM   2499 C C     . LEU B 1 81  ? 30.321 51.804  92.138  1.00 54.25  ? 78  LEU B C     1 
ATOM   2500 O O     . LEU B 1 81  ? 31.287 52.417  92.591  1.00 51.55  ? 78  LEU B O     1 
ATOM   2501 C CB    . LEU B 1 81  ? 28.086 52.871  92.526  1.00 68.02  ? 78  LEU B CB    1 
ATOM   2502 C CG    . LEU B 1 81  ? 26.666 52.831  93.096  1.00 73.09  ? 78  LEU B CG    1 
ATOM   2503 C CD1   . LEU B 1 81  ? 25.841 53.995  92.567  1.00 81.43  ? 78  LEU B CD1   1 
ATOM   2504 C CD2   . LEU B 1 81  ? 25.997 51.506  92.769  1.00 70.49  ? 78  LEU B CD2   1 
ATOM   2505 N N     . ILE B 1 82  ? 30.342 51.180  90.964  1.00 58.73  ? 79  ILE B N     1 
ATOM   2506 C CA    . ILE B 1 82  ? 31.506 51.207  90.087  1.00 62.40  ? 79  ILE B CA    1 
ATOM   2507 C C     . ILE B 1 82  ? 31.079 51.637  88.687  1.00 64.09  ? 79  ILE B C     1 
ATOM   2508 O O     . ILE B 1 82  ? 30.067 51.163  88.173  1.00 60.18  ? 79  ILE B O     1 
ATOM   2509 C CB    . ILE B 1 82  ? 32.177 49.822  90.002  1.00 58.46  ? 79  ILE B CB    1 
ATOM   2510 C CG1   . ILE B 1 82  ? 32.379 49.233  91.401  1.00 63.97  ? 79  ILE B CG1   1 
ATOM   2511 C CG2   . ILE B 1 82  ? 33.497 49.915  89.258  1.00 44.94  ? 79  ILE B CG2   1 
ATOM   2512 C CD1   . ILE B 1 82  ? 33.042 47.869  91.403  1.00 59.06  ? 79  ILE B CD1   1 
ATOM   2513 N N     . ASP B 1 83  ? 31.846 52.531  88.069  1.00 72.54  ? 80  ASP B N     1 
ATOM   2514 C CA    . ASP B 1 83  ? 31.477 53.056  86.756  1.00 81.53  ? 80  ASP B CA    1 
ATOM   2515 C C     . ASP B 1 83  ? 31.577 51.990  85.665  1.00 83.30  ? 80  ASP B C     1 
ATOM   2516 O O     . ASP B 1 83  ? 32.271 50.986  85.826  1.00 79.04  ? 80  ASP B O     1 
ATOM   2517 C CB    . ASP B 1 83  ? 32.313 54.287  86.394  1.00 96.34  ? 80  ASP B CB    1 
ATOM   2518 C CG    . ASP B 1 83  ? 33.648 53.927  85.774  1.00 100.80 ? 80  ASP B CG    1 
ATOM   2519 O OD1   . ASP B 1 83  ? 34.235 52.899  86.170  1.00 108.63 ? 80  ASP B OD1   1 
ATOM   2520 O OD2   . ASP B 1 83  ? 34.110 54.680  84.890  1.00 92.70  ? 80  ASP B OD2   1 
ATOM   2521 N N     . SER B 1 84  ? 30.881 52.220  84.556  1.00 92.10  ? 81  SER B N     1 
ATOM   2522 C CA    . SER B 1 84  ? 30.801 51.244  83.472  1.00 91.94  ? 81  SER B CA    1 
ATOM   2523 C C     . SER B 1 84  ? 32.168 50.748  83.014  1.00 87.53  ? 81  SER B C     1 
ATOM   2524 O O     . SER B 1 84  ? 32.441 49.549  83.046  1.00 84.08  ? 81  SER B O     1 
ATOM   2525 C CB    . SER B 1 84  ? 30.048 51.833  82.277  1.00 101.33 ? 81  SER B CB    1 
ATOM   2526 O OG    . SER B 1 84  ? 28.814 52.396  82.678  1.00 107.65 ? 81  SER B OG    1 
ATOM   2527 N N     . SER B 1 85  ? 33.017 51.676  82.585  1.00 92.52  ? 82  SER B N     1 
ATOM   2528 C CA    . SER B 1 85  ? 34.316 51.331  82.013  1.00 91.54  ? 82  SER B CA    1 
ATOM   2529 C C     . SER B 1 85  ? 35.049 50.253  82.809  1.00 83.89  ? 82  SER B C     1 
ATOM   2530 O O     . SER B 1 85  ? 35.554 49.288  82.236  1.00 81.99  ? 82  SER B O     1 
ATOM   2531 C CB    . SER B 1 85  ? 35.194 52.579  81.870  1.00 95.21  ? 82  SER B CB    1 
ATOM   2532 O OG    . SER B 1 85  ? 35.407 53.204  83.123  1.00 97.61  ? 82  SER B OG    1 
ATOM   2533 N N     . ILE B 1 86  ? 35.100 50.415  84.127  1.00 71.33  ? 83  ILE B N     1 
ATOM   2534 C CA    . ILE B 1 86  ? 35.785 49.450  84.981  1.00 68.17  ? 83  ILE B CA    1 
ATOM   2535 C C     . ILE B 1 86  ? 35.045 48.114  85.026  1.00 62.31  ? 83  ILE B C     1 
ATOM   2536 O O     . ILE B 1 86  ? 35.663 47.052  84.966  1.00 64.75  ? 83  ILE B O     1 
ATOM   2537 C CB    . ILE B 1 86  ? 35.984 49.984  86.414  1.00 68.87  ? 83  ILE B CB    1 
ATOM   2538 C CG1   . ILE B 1 86  ? 37.206 50.905  86.479  1.00 75.47  ? 83  ILE B CG1   1 
ATOM   2539 C CG2   . ILE B 1 86  ? 36.172 48.833  87.387  1.00 61.09  ? 83  ILE B CG2   1 
ATOM   2540 C CD1   . ILE B 1 86  ? 37.128 52.114  85.572  1.00 78.06  ? 83  ILE B CD1   1 
ATOM   2541 N N     . VAL B 1 87  ? 33.721 48.174  85.127  1.00 61.02  ? 84  VAL B N     1 
ATOM   2542 C CA    . VAL B 1 87  ? 32.901 46.967  85.135  1.00 64.20  ? 84  VAL B CA    1 
ATOM   2543 C C     . VAL B 1 87  ? 33.054 46.202  83.823  1.00 68.20  ? 84  VAL B C     1 
ATOM   2544 O O     . VAL B 1 87  ? 33.137 44.974  83.816  1.00 61.92  ? 84  VAL B O     1 
ATOM   2545 C CB    . VAL B 1 87  ? 31.414 47.291  85.370  1.00 64.02  ? 84  VAL B CB    1 
ATOM   2546 C CG1   . VAL B 1 87  ? 30.570 46.030  85.263  1.00 56.91  ? 84  VAL B CG1   1 
ATOM   2547 C CG2   . VAL B 1 87  ? 31.224 47.952  86.727  1.00 57.73  ? 84  VAL B CG2   1 
ATOM   2548 N N     . ASN B 1 88  ? 33.092 46.937  82.716  1.00 73.84  ? 85  ASN B N     1 
ATOM   2549 C CA    . ASN B 1 88  ? 33.297 46.339  81.403  1.00 73.98  ? 85  ASN B CA    1 
ATOM   2550 C C     . ASN B 1 88  ? 34.676 45.700  81.293  1.00 64.27  ? 85  ASN B C     1 
ATOM   2551 O O     . ASN B 1 88  ? 34.840 44.657  80.659  1.00 58.00  ? 85  ASN B O     1 
ATOM   2552 C CB    . ASN B 1 88  ? 33.109 47.384  80.301  1.00 88.91  ? 85  ASN B CB    1 
ATOM   2553 C CG    . ASN B 1 88  ? 31.688 47.910  80.231  1.00 97.58  ? 85  ASN B CG    1 
ATOM   2554 O OD1   . ASN B 1 88  ? 31.426 48.945  79.616  1.00 98.08  ? 85  ASN B OD1   1 
ATOM   2555 N ND2   . ASN B 1 88  ? 30.763 47.200  80.864  1.00 99.86  ? 85  ASN B ND2   1 
ATOM   2556 N N     . GLN B 1 89  ? 35.665 46.339  81.911  1.00 66.59  ? 86  GLN B N     1 
ATOM   2557 C CA    . GLN B 1 89  ? 37.016 45.796  81.966  1.00 73.36  ? 86  GLN B CA    1 
ATOM   2558 C C     . GLN B 1 89  ? 36.957 44.410  82.593  1.00 76.76  ? 86  GLN B C     1 
ATOM   2559 O O     . GLN B 1 89  ? 37.503 43.445  82.058  1.00 83.32  ? 86  GLN B O     1 
ATOM   2560 C CB    . GLN B 1 89  ? 37.918 46.708  82.798  1.00 84.52  ? 86  GLN B CB    1 
ATOM   2561 C CG    . GLN B 1 89  ? 39.398 46.604  82.471  1.00 98.35  ? 86  GLN B CG    1 
ATOM   2562 C CD    . GLN B 1 89  ? 39.777 47.386  81.228  1.00 107.80 ? 86  GLN B CD    1 
ATOM   2563 O OE1   . GLN B 1 89  ? 38.924 47.720  80.406  1.00 109.13 ? 86  GLN B OE1   1 
ATOM   2564 N NE2   . GLN B 1 89  ? 41.063 47.687  81.087  1.00 107.50 ? 86  GLN B NE2   1 
ATOM   2565 N N     . LEU B 1 90  ? 36.281 44.325  83.734  1.00 69.01  ? 87  LEU B N     1 
ATOM   2566 C CA    . LEU B 1 90  ? 36.037 43.052  84.396  1.00 65.45  ? 87  LEU B CA    1 
ATOM   2567 C C     . LEU B 1 90  ? 35.021 42.250  83.590  1.00 80.67  ? 87  LEU B C     1 
ATOM   2568 O O     . LEU B 1 90  ? 34.356 42.790  82.707  1.00 95.63  ? 87  LEU B O     1 
ATOM   2569 C CB    . LEU B 1 90  ? 35.508 43.282  85.814  1.00 63.10  ? 87  LEU B CB    1 
ATOM   2570 C CG    . LEU B 1 90  ? 36.487 43.711  86.911  1.00 68.84  ? 87  LEU B CG    1 
ATOM   2571 C CD1   . LEU B 1 90  ? 37.471 44.757  86.411  1.00 67.60  ? 87  LEU B CD1   1 
ATOM   2572 C CD2   . LEU B 1 90  ? 35.720 44.240  88.114  1.00 68.37  ? 87  LEU B CD2   1 
ATOM   2573 N N     . PHE B 1 91  ? 34.909 40.962  83.895  1.00 86.56  ? 88  PHE B N     1 
ATOM   2574 C CA    . PHE B 1 91  ? 33.930 40.097  83.241  1.00 97.22  ? 88  PHE B CA    1 
ATOM   2575 C C     . PHE B 1 91  ? 34.140 40.017  81.730  1.00 107.80 ? 88  PHE B C     1 
ATOM   2576 O O     . PHE B 1 91  ? 35.275 40.040  81.251  1.00 106.63 ? 88  PHE B O     1 
ATOM   2577 C CB    . PHE B 1 91  ? 32.509 40.570  83.552  1.00 89.33  ? 88  PHE B CB    1 
ATOM   2578 C CG    . PHE B 1 91  ? 32.266 40.830  85.011  1.00 78.90  ? 88  PHE B CG    1 
ATOM   2579 C CD1   . PHE B 1 91  ? 32.160 39.780  85.907  1.00 72.69  ? 88  PHE B CD1   1 
ATOM   2580 C CD2   . PHE B 1 91  ? 32.143 42.125  85.487  1.00 69.15  ? 88  PHE B CD2   1 
ATOM   2581 C CE1   . PHE B 1 91  ? 31.938 40.015  87.250  1.00 71.74  ? 88  PHE B CE1   1 
ATOM   2582 C CE2   . PHE B 1 91  ? 31.920 42.367  86.829  1.00 73.73  ? 88  PHE B CE2   1 
ATOM   2583 C CZ    . PHE B 1 91  ? 31.817 41.310  87.712  1.00 71.33  ? 88  PHE B CZ    1 
ATOM   2584 N N     . LYS B 1 92  ? 33.037 39.919  80.991  1.00 118.35 ? 89  LYS B N     1 
ATOM   2585 C CA    . LYS B 1 92  ? 33.078 39.795  79.536  1.00 126.41 ? 89  LYS B CA    1 
ATOM   2586 C C     . LYS B 1 92  ? 33.609 38.411  79.158  1.00 128.88 ? 89  LYS B C     1 
ATOM   2587 O O     . LYS B 1 92  ? 34.539 37.908  79.788  1.00 123.37 ? 89  LYS B O     1 
ATOM   2588 C CB    . LYS B 1 92  ? 33.939 40.912  78.932  1.00 128.85 ? 89  LYS B CB    1 
ATOM   2589 C CG    . LYS B 1 92  ? 33.487 41.402  77.564  1.00 130.29 ? 89  LYS B CG    1 
ATOM   2590 C CD    . LYS B 1 92  ? 34.297 40.771  76.446  1.00 127.04 ? 89  LYS B CD    1 
ATOM   2591 C CE    . LYS B 1 92  ? 35.743 41.234  76.499  1.00 125.84 ? 89  LYS B CE    1 
ATOM   2592 N NZ    . LYS B 1 92  ? 35.844 42.720  76.509  1.00 127.31 ? 89  LYS B NZ    1 
ATOM   2593 N N     . GLY B 1 93  ? 33.027 37.796  78.131  1.00 139.24 ? 90  GLY B N     1 
ATOM   2594 C CA    . GLY B 1 93  ? 32.024 38.440  77.303  1.00 149.91 ? 90  GLY B CA    1 
ATOM   2595 C C     . GLY B 1 93  ? 30.580 38.055  77.560  1.00 157.42 ? 90  GLY B C     1 
ATOM   2596 O O     . GLY B 1 93  ? 29.767 38.050  76.635  1.00 160.42 ? 90  GLY B O     1 
ATOM   2597 N N     . GLU B 1 94  ? 30.249 37.733  78.806  1.00 158.96 ? 91  GLU B N     1 
ATOM   2598 C CA    . GLU B 1 94  ? 28.851 37.571  79.181  1.00 159.51 ? 91  GLU B CA    1 
ATOM   2599 C C     . GLU B 1 94  ? 28.262 38.961  79.381  1.00 158.48 ? 91  GLU B C     1 
ATOM   2600 O O     . GLU B 1 94  ? 27.315 39.151  80.143  1.00 156.07 ? 91  GLU B O     1 
ATOM   2601 C CB    . GLU B 1 94  ? 28.705 36.735  80.454  1.00 158.34 ? 91  GLU B CB    1 
ATOM   2602 C CG    . GLU B 1 94  ? 27.280 36.260  80.715  1.00 157.31 ? 91  GLU B CG    1 
ATOM   2603 C CD    . GLU B 1 94  ? 27.145 35.490  82.013  1.00 154.37 ? 91  GLU B CD    1 
ATOM   2604 O OE1   . GLU B 1 94  ? 26.017 35.062  82.337  1.00 153.23 ? 91  GLU B OE1   1 
ATOM   2605 O OE2   . GLU B 1 94  ? 28.166 35.313  82.710  1.00 151.27 ? 91  GLU B OE2   1 
ATOM   2606 N N     . ARG B 1 95  ? 28.849 39.928  78.682  1.00 157.22 ? 92  ARG B N     1 
ATOM   2607 C CA    . ARG B 1 95  ? 28.447 41.325  78.773  1.00 151.06 ? 92  ARG B CA    1 
ATOM   2608 C C     . ARG B 1 95  ? 28.774 41.911  80.138  1.00 142.47 ? 92  ARG B C     1 
ATOM   2609 O O     . ARG B 1 95  ? 29.789 42.583  80.314  1.00 138.63 ? 92  ARG B O     1 
ATOM   2610 C CB    . ARG B 1 95  ? 26.952 41.484  78.491  1.00 148.55 ? 92  ARG B CB    1 
ATOM   2611 C CG    . ARG B 1 95  ? 26.510 41.004  77.123  1.00 147.25 ? 92  ARG B CG    1 
ATOM   2612 C CD    . ARG B 1 95  ? 25.012 41.177  76.970  1.00 147.28 ? 92  ARG B CD    1 
ATOM   2613 N NE    . ARG B 1 95  ? 24.296 40.642  78.125  1.00 142.76 ? 92  ARG B NE    1 
ATOM   2614 C CZ    . ARG B 1 95  ? 23.012 40.870  78.381  1.00 137.29 ? 92  ARG B CZ    1 
ATOM   2615 N NH1   . ARG B 1 95  ? 22.296 41.630  77.565  1.00 137.01 ? 92  ARG B NH1   1 
ATOM   2616 N NH2   . ARG B 1 95  ? 22.446 40.341  79.457  1.00 133.90 ? 92  ARG B NH2   1 
ATOM   2617 N N     . LYS B 1 96  ? 27.907 41.637  81.105  1.00 136.84 ? 93  LYS B N     1 
ATOM   2618 C CA    . LYS B 1 96  ? 27.976 42.300  82.395  1.00 132.08 ? 93  LYS B CA    1 
ATOM   2619 C C     . LYS B 1 96  ? 27.344 41.450  83.486  1.00 117.68 ? 93  LYS B C     1 
ATOM   2620 O O     . LYS B 1 96  ? 26.377 40.728  83.244  1.00 119.08 ? 93  LYS B O     1 
ATOM   2621 C CB    . LYS B 1 96  ? 27.229 43.628  82.308  1.00 137.48 ? 93  LYS B CB    1 
ATOM   2622 C CG    . LYS B 1 96  ? 25.726 43.447  82.167  1.00 137.72 ? 93  LYS B CG    1 
ATOM   2623 C CD    . LYS B 1 96  ? 25.122 44.419  81.172  1.00 137.71 ? 93  LYS B CD    1 
ATOM   2624 C CE    . LYS B 1 96  ? 23.607 44.289  81.145  1.00 136.60 ? 93  LYS B CE    1 
ATOM   2625 N NZ    . LYS B 1 96  ? 23.179 42.869  81.014  1.00 134.88 ? 93  LYS B NZ    1 
ATOM   2626 N N     . ALA B 1 97  ? 27.899 41.536  84.689  1.00 101.32 ? 94  ALA B N     1 
ATOM   2627 C CA    . ALA B 1 97  ? 27.242 40.984  85.860  1.00 90.42  ? 94  ALA B CA    1 
ATOM   2628 C C     . ALA B 1 97  ? 26.257 42.035  86.348  1.00 88.99  ? 94  ALA B C     1 
ATOM   2629 O O     . ALA B 1 97  ? 25.192 41.714  86.877  1.00 96.33  ? 94  ALA B O     1 
ATOM   2630 C CB    . ALA B 1 97  ? 28.256 40.658  86.938  1.00 85.10  ? 94  ALA B CB    1 
ATOM   2631 N N     . LYS B 1 98  ? 26.632 43.297  86.151  1.00 69.16  ? 95  LYS B N     1 
ATOM   2632 C CA    . LYS B 1 98  ? 25.804 44.445  86.508  1.00 72.83  ? 95  LYS B CA    1 
ATOM   2633 C C     . LYS B 1 98  ? 25.663 44.582  88.021  1.00 70.67  ? 95  LYS B C     1 
ATOM   2634 O O     . LYS B 1 98  ? 25.453 45.678  88.541  1.00 69.66  ? 95  LYS B O     1 
ATOM   2635 C CB    . LYS B 1 98  ? 24.431 44.355  85.837  1.00 73.47  ? 95  LYS B CB    1 
ATOM   2636 C CG    . LYS B 1 98  ? 24.010 45.638  85.142  1.00 86.52  ? 95  LYS B CG    1 
ATOM   2637 C CD    . LYS B 1 98  ? 25.073 46.071  84.140  1.00 94.41  ? 95  LYS B CD    1 
ATOM   2638 C CE    . LYS B 1 98  ? 24.543 47.090  83.140  1.00 96.24  ? 95  LYS B CE    1 
ATOM   2639 N NZ    . LYS B 1 98  ? 24.722 48.496  83.594  1.00 91.87  ? 95  LYS B NZ    1 
ATOM   2640 N N     . THR B 1 99  ? 25.783 43.457  88.718  1.00 62.44  ? 96  THR B N     1 
ATOM   2641 C CA    . THR B 1 99  ? 25.771 43.431  90.172  1.00 55.43  ? 96  THR B CA    1 
ATOM   2642 C C     . THR B 1 99  ? 26.551 42.207  90.642  1.00 52.30  ? 96  THR B C     1 
ATOM   2643 O O     . THR B 1 99  ? 26.461 41.139  90.039  1.00 58.68  ? 96  THR B O     1 
ATOM   2644 C CB    . THR B 1 99  ? 24.336 43.381  90.728  1.00 58.15  ? 96  THR B CB    1 
ATOM   2645 O OG1   . THR B 1 99  ? 23.583 44.487  90.215  1.00 72.33  ? 96  THR B OG1   1 
ATOM   2646 C CG2   . THR B 1 99  ? 24.348 43.450  92.243  1.00 61.95  ? 96  THR B CG2   1 
ATOM   2647 N N     . PHE B 1 100 ? 27.326 42.369  91.709  1.00 38.22  ? 97  PHE B N     1 
ATOM   2648 C CA    . PHE B 1 100 ? 28.158 41.287  92.223  1.00 38.14  ? 97  PHE B CA    1 
ATOM   2649 C C     . PHE B 1 100 ? 28.679 41.621  93.614  1.00 44.67  ? 97  PHE B C     1 
ATOM   2650 O O     . PHE B 1 100 ? 28.654 42.776  94.033  1.00 44.62  ? 97  PHE B O     1 
ATOM   2651 C CB    . PHE B 1 100 ? 29.330 41.020  91.276  1.00 34.27  ? 97  PHE B CB    1 
ATOM   2652 C CG    . PHE B 1 100 ? 30.137 42.244  90.950  1.00 54.86  ? 97  PHE B CG    1 
ATOM   2653 C CD1   . PHE B 1 100 ? 29.760 43.081  89.913  1.00 57.13  ? 97  PHE B CD1   1 
ATOM   2654 C CD2   . PHE B 1 100 ? 31.272 42.559  91.679  1.00 52.36  ? 97  PHE B CD2   1 
ATOM   2655 C CE1   . PHE B 1 100 ? 30.497 44.210  89.609  1.00 47.72  ? 97  PHE B CE1   1 
ATOM   2656 C CE2   . PHE B 1 100 ? 32.015 43.686  91.380  1.00 51.55  ? 97  PHE B CE2   1 
ATOM   2657 C CZ    . PHE B 1 100 ? 31.626 44.513  90.343  1.00 45.99  ? 97  PHE B CZ    1 
ATOM   2658 N N     . GLY B 1 101 ? 29.153 40.604  94.327  1.00 38.35  ? 98  GLY B N     1 
ATOM   2659 C CA    . GLY B 1 101 ? 29.688 40.802  95.661  1.00 35.68  ? 98  GLY B CA    1 
ATOM   2660 C C     . GLY B 1 101 ? 30.819 39.852  96.002  1.00 34.39  ? 98  GLY B C     1 
ATOM   2661 O O     . GLY B 1 101 ? 30.926 38.767  95.430  1.00 34.83  ? 98  GLY B O     1 
ATOM   2662 N N     . ILE B 1 102 ? 31.669 40.268  96.935  1.00 36.50  ? 99  ILE B N     1 
ATOM   2663 C CA    . ILE B 1 102 ? 32.738 39.414  97.434  1.00 40.82  ? 99  ILE B CA    1 
ATOM   2664 C C     . ILE B 1 102 ? 32.263 38.710  98.700  1.00 45.77  ? 99  ILE B C     1 
ATOM   2665 O O     . ILE B 1 102 ? 31.937 39.358  99.692  1.00 45.19  ? 99  ILE B O     1 
ATOM   2666 C CB    . ILE B 1 102 ? 34.008 40.223  97.750  1.00 47.02  ? 99  ILE B CB    1 
ATOM   2667 C CG1   . ILE B 1 102 ? 34.464 41.006  96.516  1.00 52.02  ? 99  ILE B CG1   1 
ATOM   2668 C CG2   . ILE B 1 102 ? 35.115 39.306  98.248  1.00 36.56  ? 99  ILE B CG2   1 
ATOM   2669 C CD1   . ILE B 1 102 ? 35.680 41.876  96.755  1.00 56.98  ? 99  ILE B CD1   1 
ATOM   2670 N N     . ALA B 1 103 ? 32.217 37.382  98.661  1.00 39.36  ? 100 ALA B N     1 
ATOM   2671 C CA    . ALA B 1 103 ? 31.718 36.607  99.791  1.00 43.29  ? 100 ALA B CA    1 
ATOM   2672 C C     . ALA B 1 103 ? 32.762 35.631  100.324 1.00 46.60  ? 100 ALA B C     1 
ATOM   2673 O O     . ALA B 1 103 ? 33.545 35.069  99.561  1.00 55.53  ? 100 ALA B O     1 
ATOM   2674 C CB    . ALA B 1 103 ? 30.453 35.858  99.396  1.00 37.55  ? 100 ALA B CB    1 
ATOM   2675 N N     . ARG B 1 104 ? 32.771 35.437  101.639 1.00 49.55  ? 101 ARG B N     1 
ATOM   2676 C CA    . ARG B 1 104 ? 33.613 34.415  102.244 1.00 46.56  ? 101 ARG B CA    1 
ATOM   2677 C C     . ARG B 1 104 ? 33.023 33.049  101.929 1.00 39.41  ? 101 ARG B C     1 
ATOM   2678 O O     . ARG B 1 104 ? 31.841 32.811  102.171 1.00 42.99  ? 101 ARG B O     1 
ATOM   2679 C CB    . ARG B 1 104 ? 33.685 34.587  103.762 1.00 48.90  ? 101 ARG B CB    1 
ATOM   2680 C CG    . ARG B 1 104 ? 34.027 35.983  104.249 1.00 57.18  ? 101 ARG B CG    1 
ATOM   2681 C CD    . ARG B 1 104 ? 34.333 35.955  105.743 1.00 69.80  ? 101 ARG B CD    1 
ATOM   2682 N NE    . ARG B 1 104 ? 34.148 37.241  106.415 1.00 86.92  ? 101 ARG B NE    1 
ATOM   2683 C CZ    . ARG B 1 104 ? 33.174 38.108  106.152 1.00 106.56 ? 101 ARG B CZ    1 
ATOM   2684 N NH1   . ARG B 1 104 ? 32.259 37.841  105.231 1.00 113.95 ? 101 ARG B NH1   1 
ATOM   2685 N NH2   . ARG B 1 104 ? 33.107 39.247  106.827 1.00 109.85 ? 101 ARG B NH2   1 
ATOM   2686 N N     . VAL B 1 105 ? 33.839 32.153  101.387 1.00 48.61  ? 102 VAL B N     1 
ATOM   2687 C CA    . VAL B 1 105 ? 33.381 30.796  101.111 1.00 44.04  ? 102 VAL B CA    1 
ATOM   2688 C C     . VAL B 1 105 ? 32.937 30.115  102.400 1.00 33.67  ? 102 VAL B C     1 
ATOM   2689 O O     . VAL B 1 105 ? 33.727 29.962  103.330 1.00 49.17  ? 102 VAL B O     1 
ATOM   2690 C CB    . VAL B 1 105 ? 34.474 29.952  100.434 1.00 44.85  ? 102 VAL B CB    1 
ATOM   2691 C CG1   . VAL B 1 105 ? 34.134 28.472  100.523 1.00 32.88  ? 102 VAL B CG1   1 
ATOM   2692 C CG2   . VAL B 1 105 ? 34.651 30.382  98.987  1.00 42.82  ? 102 VAL B CG2   1 
ATOM   2693 N N     . PRO B 1 106 ? 31.661 29.709  102.460 1.00 41.74  ? 103 PRO B N     1 
ATOM   2694 C CA    . PRO B 1 106 ? 31.094 29.097  103.666 1.00 38.58  ? 103 PRO B CA    1 
ATOM   2695 C C     . PRO B 1 106 ? 31.737 27.750  103.977 1.00 35.08  ? 103 PRO B C     1 
ATOM   2696 O O     . PRO B 1 106 ? 32.358 27.148  103.101 1.00 32.41  ? 103 PRO B O     1 
ATOM   2697 C CB    . PRO B 1 106 ? 29.619 28.892  103.296 1.00 33.46  ? 103 PRO B CB    1 
ATOM   2698 C CG    . PRO B 1 106 ? 29.375 29.790  102.120 1.00 43.92  ? 103 PRO B CG    1 
ATOM   2699 C CD    . PRO B 1 106 ? 30.669 29.817  101.378 1.00 31.13  ? 103 PRO B CD    1 
ATOM   2700 N N     . ARG B 1 107 ? 31.594 27.294  105.217 1.00 30.97  ? 104 ARG B N     1 
ATOM   2701 C CA    . ARG B 1 107 ? 32.026 25.955  105.591 1.00 44.36  ? 104 ARG B CA    1 
ATOM   2702 C C     . ARG B 1 107 ? 31.234 24.946  104.773 1.00 40.20  ? 104 ARG B C     1 
ATOM   2703 O O     . ARG B 1 107 ? 30.143 25.254  104.293 1.00 37.04  ? 104 ARG B O     1 
ATOM   2704 C CB    . ARG B 1 107 ? 31.781 25.707  107.080 1.00 45.41  ? 104 ARG B CB    1 
ATOM   2705 C CG    . ARG B 1 107 ? 30.321 25.839  107.482 1.00 38.38  ? 104 ARG B CG    1 
ATOM   2706 C CD    . ARG B 1 107 ? 30.005 25.094  108.766 1.00 40.74  ? 104 ARG B CD    1 
ATOM   2707 N NE    . ARG B 1 107 ? 28.627 25.330  109.185 1.00 30.51  ? 104 ARG B NE    1 
ATOM   2708 C CZ    . ARG B 1 107 ? 27.570 24.737  108.641 1.00 33.49  ? 104 ARG B CZ    1 
ATOM   2709 N NH1   . ARG B 1 107 ? 27.731 23.866  107.655 1.00 30.98  ? 104 ARG B NH1   1 
ATOM   2710 N NH2   . ARG B 1 107 ? 26.350 25.015  109.083 1.00 29.27  ? 104 ARG B NH2   1 
ATOM   2711 N N     . PRO B 1 108 ? 31.782 23.735  104.610 1.00 44.39  ? 105 PRO B N     1 
ATOM   2712 C CA    . PRO B 1 108 ? 31.074 22.663  103.904 1.00 35.12  ? 105 PRO B CA    1 
ATOM   2713 C C     . PRO B 1 108 ? 29.697 22.414  104.515 1.00 39.47  ? 105 PRO B C     1 
ATOM   2714 O O     . PRO B 1 108 ? 29.550 22.442  105.737 1.00 38.98  ? 105 PRO B O     1 
ATOM   2715 C CB    . PRO B 1 108 ? 31.979 21.448  104.124 1.00 37.36  ? 105 PRO B CB    1 
ATOM   2716 C CG    . PRO B 1 108 ? 33.339 22.028  104.321 1.00 35.65  ? 105 PRO B CG    1 
ATOM   2717 C CD    . PRO B 1 108 ? 33.120 23.314  105.061 1.00 36.29  ? 105 PRO B CD    1 
ATOM   2718 N N     . ALA B 1 109 ? 28.699 22.183  103.670 1.00 30.83  ? 106 ALA B N     1 
ATOM   2719 C CA    . ALA B 1 109 ? 27.345 21.942  104.149 1.00 30.63  ? 106 ALA B CA    1 
ATOM   2720 C C     . ALA B 1 109 ? 27.234 20.570  104.801 1.00 37.82  ? 106 ALA B C     1 
ATOM   2721 O O     . ALA B 1 109 ? 27.967 19.643  104.456 1.00 25.11  ? 106 ALA B O     1 
ATOM   2722 C CB    . ALA B 1 109 ? 26.342 22.083  103.015 1.00 23.26  ? 106 ALA B CB    1 
ATOM   2723 N N     . ARG B 1 110 ? 26.310 20.449  105.747 1.00 39.14  ? 107 ARG B N     1 
ATOM   2724 C CA    . ARG B 1 110 ? 26.126 19.211  106.491 1.00 28.40  ? 107 ARG B CA    1 
ATOM   2725 C C     . ARG B 1 110 ? 24.664 18.791  106.496 1.00 32.56  ? 107 ARG B C     1 
ATOM   2726 O O     . ARG B 1 110 ? 23.790 19.559  106.096 1.00 33.49  ? 107 ARG B O     1 
ATOM   2727 C CB    . ARG B 1 110 ? 26.614 19.380  107.931 1.00 29.87  ? 107 ARG B CB    1 
ATOM   2728 C CG    . ARG B 1 110 ? 28.090 19.706  108.056 1.00 33.46  ? 107 ARG B CG    1 
ATOM   2729 C CD    . ARG B 1 110 ? 28.519 19.690  109.510 1.00 44.27  ? 107 ARG B CD    1 
ATOM   2730 N NE    . ARG B 1 110 ? 27.855 20.730  110.290 1.00 43.85  ? 107 ARG B NE    1 
ATOM   2731 C CZ    . ARG B 1 110 ? 28.439 21.860  110.671 1.00 44.68  ? 107 ARG B CZ    1 
ATOM   2732 N NH1   . ARG B 1 110 ? 29.704 22.096  110.346 1.00 36.87  ? 107 ARG B NH1   1 
ATOM   2733 N NH2   . ARG B 1 110 ? 27.763 22.753  111.381 1.00 44.97  ? 107 ARG B NH2   1 
ATOM   2734 N N     . PHE B 1 111 ? 24.403 17.570  106.956 1.00 24.13  ? 108 PHE B N     1 
ATOM   2735 C CA    . PHE B 1 111 ? 23.039 17.069  107.065 1.00 23.88  ? 108 PHE B CA    1 
ATOM   2736 C C     . PHE B 1 111 ? 22.205 17.958  107.979 1.00 28.88  ? 108 PHE B C     1 
ATOM   2737 O O     . PHE B 1 111 ? 21.001 18.119  107.775 1.00 27.70  ? 108 PHE B O     1 
ATOM   2738 C CB    . PHE B 1 111 ? 23.023 15.634  107.597 1.00 26.09  ? 108 PHE B CB    1 
ATOM   2739 C CG    . PHE B 1 111 ? 23.660 14.636  106.675 1.00 35.27  ? 108 PHE B CG    1 
ATOM   2740 C CD1   . PHE B 1 111 ? 23.440 14.695  105.310 1.00 23.33  ? 108 PHE B CD1   1 
ATOM   2741 C CD2   . PHE B 1 111 ? 24.461 13.624  107.177 1.00 25.48  ? 108 PHE B CD2   1 
ATOM   2742 C CE1   . PHE B 1 111 ? 24.021 13.774  104.458 1.00 23.51  ? 108 PHE B CE1   1 
ATOM   2743 C CE2   . PHE B 1 111 ? 25.042 12.699  106.333 1.00 29.63  ? 108 PHE B CE2   1 
ATOM   2744 C CZ    . PHE B 1 111 ? 24.822 12.773  104.971 1.00 31.95  ? 108 PHE B CZ    1 
ATOM   2745 N N     . GLY B 1 112 ? 22.851 18.527  108.991 1.00 25.61  ? 109 GLY B N     1 
ATOM   2746 C CA    . GLY B 1 112 ? 22.171 19.383  109.945 1.00 34.46  ? 109 GLY B CA    1 
ATOM   2747 C C     . GLY B 1 112 ? 21.548 20.599  109.286 1.00 32.60  ? 109 GLY B C     1 
ATOM   2748 O O     . GLY B 1 112 ? 20.518 21.102  109.737 1.00 38.18  ? 109 GLY B O     1 
ATOM   2749 N N     . ASP B 1 113 ? 22.177 21.070  108.215 1.00 31.00  ? 110 ASP B N     1 
ATOM   2750 C CA    . ASP B 1 113 ? 21.674 22.218  107.473 1.00 33.01  ? 110 ASP B CA    1 
ATOM   2751 C C     . ASP B 1 113 ? 20.413 21.853  106.699 1.00 36.96  ? 110 ASP B C     1 
ATOM   2752 O O     . ASP B 1 113 ? 19.577 22.711  106.414 1.00 31.17  ? 110 ASP B O     1 
ATOM   2753 C CB    . ASP B 1 113 ? 22.743 22.745  106.515 1.00 24.79  ? 110 ASP B CB    1 
ATOM   2754 C CG    . ASP B 1 113 ? 23.990 23.214  107.237 1.00 38.51  ? 110 ASP B CG    1 
ATOM   2755 O OD1   . ASP B 1 113 ? 23.873 23.684  108.387 1.00 35.05  ? 110 ASP B OD1   1 
ATOM   2756 O OD2   . ASP B 1 113 ? 25.088 23.115  106.651 1.00 38.60  ? 110 ASP B OD2   1 
ATOM   2757 N N     . ILE B 1 114 ? 20.284 20.574  106.362 1.00 33.42  ? 111 ILE B N     1 
ATOM   2758 C CA    . ILE B 1 114 ? 19.124 20.084  105.628 1.00 23.16  ? 111 ILE B CA    1 
ATOM   2759 C C     . ILE B 1 114 ? 17.992 19.709  106.578 1.00 34.64  ? 111 ILE B C     1 
ATOM   2760 O O     . ILE B 1 114 ? 16.822 19.970  106.299 1.00 36.12  ? 111 ILE B O     1 
ATOM   2761 C CB    . ILE B 1 114 ? 19.481 18.859  104.766 1.00 29.07  ? 111 ILE B CB    1 
ATOM   2762 C CG1   . ILE B 1 114 ? 20.495 19.238  103.686 1.00 23.04  ? 111 ILE B CG1   1 
ATOM   2763 C CG2   . ILE B 1 114 ? 18.233 18.270  104.131 1.00 27.53  ? 111 ILE B CG2   1 
ATOM   2764 C CD1   . ILE B 1 114 ? 20.856 18.091  102.767 1.00 23.75  ? 111 ILE B CD1   1 
ATOM   2765 N N     . ALA B 1 115 ? 18.348 19.100  107.703 1.00 33.04  ? 112 ALA B N     1 
ATOM   2766 C CA    . ALA B 1 115 ? 17.359 18.638  108.670 1.00 45.27  ? 112 ALA B CA    1 
ATOM   2767 C C     . ALA B 1 115 ? 16.577 19.792  109.290 1.00 47.33  ? 112 ALA B C     1 
ATOM   2768 O O     . ALA B 1 115 ? 15.383 19.667  109.561 1.00 53.54  ? 112 ALA B O     1 
ATOM   2769 C CB    . ALA B 1 115 ? 18.027 17.803  109.754 1.00 26.91  ? 112 ALA B CB    1 
ATOM   2770 N N     . SER B 1 116 ? 17.253 20.915  109.512 1.00 40.26  ? 113 SER B N     1 
ATOM   2771 C CA    . SER B 1 116 ? 16.628 22.073  110.144 1.00 44.11  ? 113 SER B CA    1 
ATOM   2772 C C     . SER B 1 116 ? 15.771 22.864  109.159 1.00 53.21  ? 113 SER B C     1 
ATOM   2773 O O     . SER B 1 116 ? 15.044 23.778  109.551 1.00 59.51  ? 113 SER B O     1 
ATOM   2774 C CB    . SER B 1 116 ? 17.686 22.983  110.772 1.00 37.79  ? 113 SER B CB    1 
ATOM   2775 O OG    . SER B 1 116 ? 18.513 23.567  109.781 1.00 47.95  ? 113 SER B OG    1 
ATOM   2776 N N     . ARG B 1 117 ? 15.865 22.513  107.881 1.00 39.82  ? 114 ARG B N     1 
ATOM   2777 C CA    . ARG B 1 117 ? 15.045 23.144  106.854 1.00 45.09  ? 114 ARG B CA    1 
ATOM   2778 C C     . ARG B 1 117 ? 13.863 22.254  106.486 1.00 48.72  ? 114 ARG B C     1 
ATOM   2779 O O     . ARG B 1 117 ? 13.847 21.064  106.799 1.00 59.72  ? 114 ARG B O     1 
ATOM   2780 C CB    . ARG B 1 117 ? 15.880 23.460  105.611 1.00 36.29  ? 114 ARG B CB    1 
ATOM   2781 C CG    . ARG B 1 117 ? 16.789 24.670  105.767 1.00 34.94  ? 114 ARG B CG    1 
ATOM   2782 C CD    . ARG B 1 117 ? 17.849 24.708  104.680 1.00 32.94  ? 114 ARG B CD    1 
ATOM   2783 N NE    . ARG B 1 117 ? 17.267 24.715  103.342 1.00 52.22  ? 114 ARG B NE    1 
ATOM   2784 C CZ    . ARG B 1 117 ? 17.091 25.809  102.610 1.00 60.85  ? 114 ARG B CZ    1 
ATOM   2785 N NH1   . ARG B 1 117 ? 17.456 26.992  103.084 1.00 67.70  ? 114 ARG B NH1   1 
ATOM   2786 N NH2   . ARG B 1 117 ? 16.553 25.721  101.401 1.00 52.25  ? 114 ARG B NH2   1 
ATOM   2787 N N     . ARG B 1 118 ? 12.871 22.840  105.825 1.00 59.27  ? 115 ARG B N     1 
ATOM   2788 C CA    . ARG B 1 118 ? 11.683 22.101  105.419 1.00 52.52  ? 115 ARG B CA    1 
ATOM   2789 C C     . ARG B 1 118 ? 11.608 21.990  103.901 1.00 45.99  ? 115 ARG B C     1 
ATOM   2790 O O     . ARG B 1 118 ? 12.013 22.902  103.182 1.00 51.72  ? 115 ARG B O     1 
ATOM   2791 C CB    . ARG B 1 118 ? 10.422 22.767  105.973 1.00 51.40  ? 115 ARG B CB    1 
ATOM   2792 C CG    . ARG B 1 118 ? 10.174 22.492  107.451 1.00 56.36  ? 115 ARG B CG    1 
ATOM   2793 C CD    . ARG B 1 118 ? 9.119  23.426  108.022 1.00 67.79  ? 115 ARG B CD    1 
ATOM   2794 N NE    . ARG B 1 118 ? 9.631  24.783  108.193 1.00 77.73  ? 115 ARG B NE    1 
ATOM   2795 C CZ    . ARG B 1 118 ? 8.877  25.835  108.494 1.00 86.87  ? 115 ARG B CZ    1 
ATOM   2796 N NH1   . ARG B 1 118 ? 7.569  25.694  108.654 1.00 94.70  ? 115 ARG B NH1   1 
ATOM   2797 N NH2   . ARG B 1 118 ? 9.432  27.032  108.631 1.00 92.87  ? 115 ARG B NH2   1 
ATOM   2798 N N     . GLY B 1 119 ? 11.092 20.864  103.419 1.00 37.73  ? 116 GLY B N     1 
ATOM   2799 C CA    . GLY B 1 119 ? 11.004 20.617  101.992 1.00 32.00  ? 116 GLY B CA    1 
ATOM   2800 C C     . GLY B 1 119 ? 11.748 19.358  101.591 1.00 32.59  ? 116 GLY B C     1 
ATOM   2801 O O     . GLY B 1 119 ? 12.653 18.911  102.296 1.00 30.38  ? 116 GLY B O     1 
ATOM   2802 N N     . ASP B 1 120 ? 11.367 18.788  100.454 1.00 25.17  ? 117 ASP B N     1 
ATOM   2803 C CA    . ASP B 1 120 ? 11.973 17.553  99.971  1.00 29.27  ? 117 ASP B CA    1 
ATOM   2804 C C     . ASP B 1 120 ? 13.484 17.680  99.795  1.00 26.48  ? 117 ASP B C     1 
ATOM   2805 O O     . ASP B 1 120 ? 14.011 18.778  99.629  1.00 30.25  ? 117 ASP B O     1 
ATOM   2806 C CB    . ASP B 1 120 ? 11.321 17.122  98.655  1.00 24.37  ? 117 ASP B CB    1 
ATOM   2807 C CG    . ASP B 1 120 ? 9.851  16.784  98.816  1.00 34.19  ? 117 ASP B CG    1 
ATOM   2808 O OD1   . ASP B 1 120 ? 9.426  16.492  99.953  1.00 28.72  ? 117 ASP B OD1   1 
ATOM   2809 O OD2   . ASP B 1 120 ? 9.121  16.808  97.803  1.00 31.51  ? 117 ASP B OD2   1 
ATOM   2810 N N     . VAL B 1 121 ? 14.174 16.546  99.839  1.00 35.38  ? 118 VAL B N     1 
ATOM   2811 C CA    . VAL B 1 121 ? 15.619 16.523  99.661  1.00 23.89  ? 118 VAL B CA    1 
ATOM   2812 C C     . VAL B 1 121 ? 15.975 15.834  98.349  1.00 24.03  ? 118 VAL B C     1 
ATOM   2813 O O     . VAL B 1 121 ? 15.467 14.755  98.050  1.00 27.33  ? 118 VAL B O     1 
ATOM   2814 C CB    . VAL B 1 121 ? 16.314 15.793  100.824 1.00 26.42  ? 118 VAL B CB    1 
ATOM   2815 C CG1   . VAL B 1 121 ? 17.819 15.741  100.603 1.00 21.16  ? 118 VAL B CG1   1 
ATOM   2816 C CG2   . VAL B 1 121 ? 15.984 16.471  102.146 1.00 26.29  ? 118 VAL B CG2   1 
ATOM   2817 N N     . VAL B 1 122 ? 16.840 16.466  97.562  1.00 23.44  ? 119 VAL B N     1 
ATOM   2818 C CA    . VAL B 1 122 ? 17.300 15.870  96.313  1.00 27.30  ? 119 VAL B CA    1 
ATOM   2819 C C     . VAL B 1 122 ? 18.588 15.083  96.525  1.00 19.97  ? 119 VAL B C     1 
ATOM   2820 O O     . VAL B 1 122 ? 19.589 15.625  96.994  1.00 30.12  ? 119 VAL B O     1 
ATOM   2821 C CB    . VAL B 1 122 ? 17.532 16.929  95.222  1.00 28.12  ? 119 VAL B CB    1 
ATOM   2822 C CG1   . VAL B 1 122 ? 18.106 16.278  93.975  1.00 20.15  ? 119 VAL B CG1   1 
ATOM   2823 C CG2   . VAL B 1 122 ? 16.236 17.653  94.904  1.00 31.75  ? 119 VAL B CG2   1 
ATOM   2824 N N     . VAL B 1 123 ? 18.558 13.802  96.177  1.00 26.79  ? 120 VAL B N     1 
ATOM   2825 C CA    . VAL B 1 123 ? 19.720 12.944  96.358  1.00 24.94  ? 120 VAL B CA    1 
ATOM   2826 C C     . VAL B 1 123 ? 20.244 12.455  95.014  1.00 28.91  ? 120 VAL B C     1 
ATOM   2827 O O     . VAL B 1 123 ? 19.562 11.718  94.303  1.00 36.93  ? 120 VAL B O     1 
ATOM   2828 C CB    . VAL B 1 123 ? 19.394 11.731  97.248  1.00 27.41  ? 120 VAL B CB    1 
ATOM   2829 C CG1   . VAL B 1 123 ? 20.658 10.936  97.548  1.00 22.70  ? 120 VAL B CG1   1 
ATOM   2830 C CG2   . VAL B 1 123 ? 18.724 12.182  98.538  1.00 23.81  ? 120 VAL B CG2   1 
ATOM   2831 N N     . LEU B 1 124 ? 21.457 12.874  94.671  1.00 28.77  ? 121 LEU B N     1 
ATOM   2832 C CA    . LEU B 1 124 ? 22.091 12.457  93.426  1.00 25.63  ? 121 LEU B CA    1 
ATOM   2833 C C     . LEU B 1 124 ? 23.142 11.384  93.688  1.00 28.66  ? 121 LEU B C     1 
ATOM   2834 O O     . LEU B 1 124 ? 23.953 11.508  94.605  1.00 28.53  ? 121 LEU B O     1 
ATOM   2835 C CB    . LEU B 1 124 ? 22.727 13.655  92.719  1.00 23.16  ? 121 LEU B CB    1 
ATOM   2836 C CG    . LEU B 1 124 ? 21.795 14.835  92.435  1.00 36.34  ? 121 LEU B CG    1 
ATOM   2837 C CD1   . LEU B 1 124 ? 22.514 15.906  91.628  1.00 24.28  ? 121 LEU B CD1   1 
ATOM   2838 C CD2   . LEU B 1 124 ? 20.540 14.367  91.715  1.00 22.30  ? 121 LEU B CD2   1 
ATOM   2839 N N     . ASP B 1 125 ? 23.121 10.332  92.877  1.00 34.94  ? 122 ASP B N     1 
ATOM   2840 C CA    . ASP B 1 125 ? 24.046 9.220   93.048  1.00 27.94  ? 122 ASP B CA    1 
ATOM   2841 C C     . ASP B 1 125 ? 24.725 8.862   91.732  1.00 30.84  ? 122 ASP B C     1 
ATOM   2842 O O     . ASP B 1 125 ? 24.094 8.321   90.826  1.00 44.80  ? 122 ASP B O     1 
ATOM   2843 C CB    . ASP B 1 125 ? 23.311 8.000   93.601  1.00 40.60  ? 122 ASP B CB    1 
ATOM   2844 C CG    . ASP B 1 125 ? 24.216 6.794   93.748  1.00 54.90  ? 122 ASP B CG    1 
ATOM   2845 O OD1   . ASP B 1 125 ? 23.698 5.658   93.751  1.00 68.54  ? 122 ASP B OD1   1 
ATOM   2846 O OD2   . ASP B 1 125 ? 25.446 6.983   93.855  1.00 58.77  ? 122 ASP B OD2   1 
ATOM   2847 N N     . GLY B 1 126 ? 26.015 9.165   91.632  1.00 35.41  ? 123 GLY B N     1 
ATOM   2848 C CA    . GLY B 1 126 ? 26.780 8.840   90.442  1.00 36.89  ? 123 GLY B CA    1 
ATOM   2849 C C     . GLY B 1 126 ? 26.795 9.949   89.408  1.00 32.61  ? 123 GLY B C     1 
ATOM   2850 O O     . GLY B 1 126 ? 27.374 9.795   88.332  1.00 42.63  ? 123 GLY B O     1 
ATOM   2851 N N     . VAL B 1 127 ? 26.155 11.067  89.732  1.00 30.33  ? 124 VAL B N     1 
ATOM   2852 C CA    . VAL B 1 127 ? 26.118 12.215  88.831  1.00 32.68  ? 124 VAL B CA    1 
ATOM   2853 C C     . VAL B 1 127 ? 27.399 13.025  88.972  1.00 30.50  ? 124 VAL B C     1 
ATOM   2854 O O     . VAL B 1 127 ? 27.650 13.629  90.015  1.00 43.87  ? 124 VAL B O     1 
ATOM   2855 C CB    . VAL B 1 127 ? 24.902 13.122  89.108  1.00 36.20  ? 124 VAL B CB    1 
ATOM   2856 C CG1   . VAL B 1 127 ? 24.927 14.339  88.192  1.00 31.89  ? 124 VAL B CG1   1 
ATOM   2857 C CG2   . VAL B 1 127 ? 23.609 12.343  88.935  1.00 36.45  ? 124 VAL B CG2   1 
ATOM   2858 N N     . LYS B 1 128 ? 28.206 13.036  87.916  1.00 39.14  ? 125 LYS B N     1 
ATOM   2859 C CA    . LYS B 1 128 ? 29.533 13.639  87.974  1.00 46.97  ? 125 LYS B CA    1 
ATOM   2860 C C     . LYS B 1 128 ? 29.690 14.826  87.028  1.00 48.57  ? 125 LYS B C     1 
ATOM   2861 O O     . LYS B 1 128 ? 30.534 15.695  87.250  1.00 47.45  ? 125 LYS B O     1 
ATOM   2862 C CB    . LYS B 1 128 ? 30.598 12.587  87.664  1.00 45.97  ? 125 LYS B CB    1 
ATOM   2863 C CG    . LYS B 1 128 ? 30.483 11.336  88.513  1.00 36.74  ? 125 LYS B CG    1 
ATOM   2864 C CD    . LYS B 1 128 ? 31.482 10.281  88.075  1.00 56.11  ? 125 LYS B CD    1 
ATOM   2865 C CE    . LYS B 1 128 ? 31.397 9.049   88.958  1.00 60.51  ? 125 LYS B CE    1 
ATOM   2866 N NZ    . LYS B 1 128 ? 31.753 9.358   90.371  1.00 59.12  ? 125 LYS B NZ    1 
ATOM   2867 N N     . ILE B 1 129 ? 28.886 14.854  85.970  1.00 38.86  ? 126 ILE B N     1 
ATOM   2868 C CA    . ILE B 1 129 ? 28.951 15.935  84.993  1.00 38.63  ? 126 ILE B CA    1 
ATOM   2869 C C     . ILE B 1 129 ? 28.495 17.252  85.615  1.00 32.74  ? 126 ILE B C     1 
ATOM   2870 O O     . ILE B 1 129 ? 27.311 17.437  85.895  1.00 30.97  ? 126 ILE B O     1 
ATOM   2871 C CB    . ILE B 1 129 ? 28.096 15.625  83.752  1.00 48.46  ? 126 ILE B CB    1 
ATOM   2872 C CG1   . ILE B 1 129 ? 28.538 14.303  83.121  1.00 47.97  ? 126 ILE B CG1   1 
ATOM   2873 C CG2   . ILE B 1 129 ? 28.192 16.758  82.742  1.00 40.75  ? 126 ILE B CG2   1 
ATOM   2874 C CD1   . ILE B 1 129 ? 27.673 13.857  81.967  1.00 47.59  ? 126 ILE B CD1   1 
ATOM   2875 N N     . VAL B 1 130 ? 29.440 18.164  85.826  1.00 33.24  ? 127 VAL B N     1 
ATOM   2876 C CA    . VAL B 1 130 ? 29.160 19.419  86.522  1.00 39.04  ? 127 VAL B CA    1 
ATOM   2877 C C     . VAL B 1 130 ? 27.994 20.194  85.914  1.00 35.04  ? 127 VAL B C     1 
ATOM   2878 O O     . VAL B 1 130 ? 27.272 20.893  86.623  1.00 38.84  ? 127 VAL B O     1 
ATOM   2879 C CB    . VAL B 1 130 ? 30.403 20.330  86.588  1.00 40.52  ? 127 VAL B CB    1 
ATOM   2880 C CG1   . VAL B 1 130 ? 31.514 19.652  87.375  1.00 44.90  ? 127 VAL B CG1   1 
ATOM   2881 C CG2   . VAL B 1 130 ? 30.871 20.694  85.189  1.00 55.42  ? 127 VAL B CG2   1 
ATOM   2882 N N     . GLY B 1 131 ? 27.812 20.067  84.603  1.00 36.30  ? 128 GLY B N     1 
ATOM   2883 C CA    . GLY B 1 131 ? 26.711 20.724  83.923  1.00 32.19  ? 128 GLY B CA    1 
ATOM   2884 C C     . GLY B 1 131 ? 25.369 20.274  84.466  1.00 43.22  ? 128 GLY B C     1 
ATOM   2885 O O     . GLY B 1 131 ? 24.471 21.087  84.685  1.00 47.58  ? 128 GLY B O     1 
ATOM   2886 N N     . ASN B 1 132 ? 25.234 18.969  84.685  1.00 33.31  ? 129 ASN B N     1 
ATOM   2887 C CA    . ASN B 1 132 ? 24.010 18.406  85.242  1.00 36.83  ? 129 ASN B CA    1 
ATOM   2888 C C     . ASN B 1 132 ? 23.805 18.822  86.694  1.00 38.56  ? 129 ASN B C     1 
ATOM   2889 O O     . ASN B 1 132 ? 22.707 19.214  87.089  1.00 46.63  ? 129 ASN B O     1 
ATOM   2890 C CB    . ASN B 1 132 ? 24.021 16.881  85.127  1.00 32.98  ? 129 ASN B CB    1 
ATOM   2891 C CG    . ASN B 1 132 ? 23.977 16.403  83.690  1.00 47.56  ? 129 ASN B CG    1 
ATOM   2892 O OD1   . ASN B 1 132 ? 24.299 15.252  83.395  1.00 55.89  ? 129 ASN B OD1   1 
ATOM   2893 N ND2   . ASN B 1 132 ? 23.579 17.289  82.785  1.00 46.07  ? 129 ASN B ND2   1 
ATOM   2894 N N     . ILE B 1 133 ? 24.871 18.737  87.483  1.00 34.37  ? 130 ILE B N     1 
ATOM   2895 C CA    . ILE B 1 133 ? 24.819 19.118  88.889  1.00 29.72  ? 130 ILE B CA    1 
ATOM   2896 C C     . ILE B 1 133 ? 24.438 20.586  89.045  1.00 30.62  ? 130 ILE B C     1 
ATOM   2897 O O     . ILE B 1 133 ? 23.612 20.935  89.887  1.00 28.08  ? 130 ILE B O     1 
ATOM   2898 C CB    . ILE B 1 133 ? 26.168 18.871  89.590  1.00 34.85  ? 130 ILE B CB    1 
ATOM   2899 C CG1   . ILE B 1 133 ? 26.614 17.421  89.393  1.00 26.59  ? 130 ILE B CG1   1 
ATOM   2900 C CG2   . ILE B 1 133 ? 26.069 19.210  91.071  1.00 24.39  ? 130 ILE B CG2   1 
ATOM   2901 C CD1   . ILE B 1 133 ? 27.933 17.092  90.064  1.00 27.51  ? 130 ILE B CD1   1 
ATOM   2902 N N     . GLY B 1 134 ? 25.045 21.440  88.227  1.00 26.14  ? 131 GLY B N     1 
ATOM   2903 C CA    . GLY B 1 134 ? 24.773 22.865  88.269  1.00 26.50  ? 131 GLY B CA    1 
ATOM   2904 C C     . GLY B 1 134 ? 23.318 23.180  87.985  1.00 31.94  ? 131 GLY B C     1 
ATOM   2905 O O     . GLY B 1 134 ? 22.657 23.864  88.768  1.00 35.51  ? 131 GLY B O     1 
ATOM   2906 N N     . ALA B 1 135 ? 22.819 22.679  86.859  1.00 26.30  ? 132 ALA B N     1 
ATOM   2907 C CA    . ALA B 1 135 ? 21.425 22.876  86.479  1.00 32.85  ? 132 ALA B CA    1 
ATOM   2908 C C     . ALA B 1 135 ? 20.486 22.322  87.545  1.00 29.69  ? 132 ALA B C     1 
ATOM   2909 O O     . ALA B 1 135 ? 19.451 22.916  87.848  1.00 31.71  ? 132 ALA B O     1 
ATOM   2910 C CB    . ALA B 1 135 ? 21.147 22.221  85.134  1.00 27.27  ? 132 ALA B CB    1 
ATOM   2911 N N     . ILE B 1 136 ? 20.855 21.178  88.112  1.00 26.37  ? 133 ILE B N     1 
ATOM   2912 C CA    . ILE B 1 136 ? 20.064 20.551  89.165  1.00 26.59  ? 133 ILE B CA    1 
ATOM   2913 C C     . ILE B 1 136 ? 20.014 21.420  90.421  1.00 26.29  ? 133 ILE B C     1 
ATOM   2914 O O     . ILE B 1 136 ? 18.996 21.469  91.111  1.00 30.02  ? 133 ILE B O     1 
ATOM   2915 C CB    . ILE B 1 136 ? 20.599 19.144  89.505  1.00 29.37  ? 133 ILE B CB    1 
ATOM   2916 C CG1   . ILE B 1 136 ? 20.098 18.126  88.476  1.00 28.76  ? 133 ILE B CG1   1 
ATOM   2917 C CG2   . ILE B 1 136 ? 20.187 18.735  90.911  1.00 22.03  ? 133 ILE B CG2   1 
ATOM   2918 C CD1   . ILE B 1 136 ? 20.753 16.765  88.586  1.00 46.52  ? 133 ILE B CD1   1 
ATOM   2919 N N     . VAL B 1 137 ? 21.114 22.110  90.710  1.00 22.47  ? 134 VAL B N     1 
ATOM   2920 C CA    . VAL B 1 137 ? 21.154 23.034  91.838  1.00 24.53  ? 134 VAL B CA    1 
ATOM   2921 C C     . VAL B 1 137 ? 20.156 24.170  91.637  1.00 24.36  ? 134 VAL B C     1 
ATOM   2922 O O     . VAL B 1 137 ? 19.393 24.506  92.543  1.00 27.12  ? 134 VAL B O     1 
ATOM   2923 C CB    . VAL B 1 137 ? 22.562 23.624  92.047  1.00 25.14  ? 134 VAL B CB    1 
ATOM   2924 C CG1   . VAL B 1 137 ? 22.510 24.790  93.023  1.00 29.70  ? 134 VAL B CG1   1 
ATOM   2925 C CG2   . VAL B 1 137 ? 23.520 22.551  92.540  1.00 22.44  ? 134 VAL B CG2   1 
ATOM   2926 N N     . ARG B 1 138 ? 20.167 24.754  90.442  1.00 23.88  ? 135 ARG B N     1 
ATOM   2927 C CA    . ARG B 1 138 ? 19.243 25.829  90.096  1.00 27.13  ? 135 ARG B CA    1 
ATOM   2928 C C     . ARG B 1 138 ? 17.790 25.380  90.201  1.00 31.01  ? 135 ARG B C     1 
ATOM   2929 O O     . ARG B 1 138 ? 16.964 26.056  90.812  1.00 37.07  ? 135 ARG B O     1 
ATOM   2930 C CB    . ARG B 1 138 ? 19.507 26.323  88.675  1.00 35.13  ? 135 ARG B CB    1 
ATOM   2931 C CG    . ARG B 1 138 ? 20.817 27.063  88.484  1.00 55.92  ? 135 ARG B CG    1 
ATOM   2932 C CD    . ARG B 1 138 ? 20.886 27.622  87.076  1.00 63.79  ? 135 ARG B CD    1 
ATOM   2933 N NE    . ARG B 1 138 ? 19.771 28.526  86.806  1.00 75.80  ? 135 ARG B NE    1 
ATOM   2934 C CZ    . ARG B 1 138 ? 19.224 28.702  85.608  1.00 74.70  ? 135 ARG B CZ    1 
ATOM   2935 N NH1   . ARG B 1 138 ? 19.680 28.024  84.564  1.00 71.07  ? 135 ARG B NH1   1 
ATOM   2936 N NH2   . ARG B 1 138 ? 18.213 29.547  85.455  1.00 66.14  ? 135 ARG B NH2   1 
ATOM   2937 N N     . THR B 1 139 ? 17.486 24.239  89.590  1.00 28.03  ? 136 THR B N     1 
ATOM   2938 C CA    . THR B 1 139 ? 16.125 23.715  89.572  1.00 26.88  ? 136 THR B CA    1 
ATOM   2939 C C     . THR B 1 139 ? 15.630 23.384  90.975  1.00 28.29  ? 136 THR B C     1 
ATOM   2940 O O     . THR B 1 139 ? 14.483 23.669  91.321  1.00 35.33  ? 136 THR B O     1 
ATOM   2941 C CB    . THR B 1 139 ? 16.022 22.454  88.699  1.00 23.91  ? 136 THR B CB    1 
ATOM   2942 O OG1   . THR B 1 139 ? 16.506 22.743  87.383  1.00 31.77  ? 136 THR B OG1   1 
ATOM   2943 C CG2   . THR B 1 139 ? 14.579 21.981  88.615  1.00 24.16  ? 136 THR B CG2   1 
ATOM   2944 N N     . SER B 1 140 ? 16.498 22.776  91.778  1.00 28.17  ? 137 SER B N     1 
ATOM   2945 C CA    . SER B 1 140 ? 16.144 22.413  93.144  1.00 29.64  ? 137 SER B CA    1 
ATOM   2946 C C     . SER B 1 140 ? 15.783 23.652  93.955  1.00 31.63  ? 137 SER B C     1 
ATOM   2947 O O     . SER B 1 140 ? 14.800 23.657  94.694  1.00 28.35  ? 137 SER B O     1 
ATOM   2948 C CB    . SER B 1 140 ? 17.288 21.651  93.818  1.00 20.93  ? 137 SER B CB    1 
ATOM   2949 O OG    . SER B 1 140 ? 17.519 20.407  93.178  1.00 32.65  ? 137 SER B OG    1 
ATOM   2950 N N     . LEU B 1 141 ? 16.581 24.704  93.806  1.00 23.05  ? 138 LEU B N     1 
ATOM   2951 C CA    . LEU B 1 141 ? 16.332 25.958  94.506  1.00 24.17  ? 138 LEU B CA    1 
ATOM   2952 C C     . LEU B 1 141 ? 15.024 26.598  94.055  1.00 33.55  ? 138 LEU B C     1 
ATOM   2953 O O     . LEU B 1 141 ? 14.235 27.065  94.875  1.00 29.17  ? 138 LEU B O     1 
ATOM   2954 C CB    . LEU B 1 141 ? 17.486 26.939  94.282  1.00 26.49  ? 138 LEU B CB    1 
ATOM   2955 C CG    . LEU B 1 141 ? 17.279 28.342  94.858  1.00 29.11  ? 138 LEU B CG    1 
ATOM   2956 C CD1   . LEU B 1 141 ? 17.253 28.297  96.377  1.00 26.36  ? 138 LEU B CD1   1 
ATOM   2957 C CD2   . LEU B 1 141 ? 18.356 29.294  94.369  1.00 32.88  ? 138 LEU B CD2   1 
ATOM   2958 N N     . ALA B 1 142 ? 14.805 26.615  92.745  1.00 25.88  ? 139 ALA B N     1 
ATOM   2959 C CA    . ALA B 1 142 ? 13.659 27.307  92.166  1.00 36.73  ? 139 ALA B CA    1 
ATOM   2960 C C     . ALA B 1 142 ? 12.335 26.601  92.443  1.00 31.47  ? 139 ALA B C     1 
ATOM   2961 O O     . ALA B 1 142 ? 11.279 27.235  92.453  1.00 50.79  ? 139 ALA B O     1 
ATOM   2962 C CB    . ALA B 1 142 ? 13.857 27.493  90.669  1.00 28.06  ? 139 ALA B CB    1 
ATOM   2963 N N     . LEU B 1 143 ? 12.391 25.293  92.667  1.00 28.55  ? 140 LEU B N     1 
ATOM   2964 C CA    . LEU B 1 143 ? 11.174 24.511  92.865  1.00 38.46  ? 140 LEU B CA    1 
ATOM   2965 C C     . LEU B 1 143 ? 10.922 24.135  94.327  1.00 33.70  ? 140 LEU B C     1 
ATOM   2966 O O     . LEU B 1 143 ? 10.000 23.374  94.626  1.00 35.93  ? 140 LEU B O     1 
ATOM   2967 C CB    . LEU B 1 143 ? 11.172 23.268  91.970  1.00 36.62  ? 140 LEU B CB    1 
ATOM   2968 C CG    . LEU B 1 143 ? 11.055 23.555  90.469  1.00 35.34  ? 140 LEU B CG    1 
ATOM   2969 C CD1   . LEU B 1 143 ? 10.895 22.268  89.674  1.00 25.78  ? 140 LEU B CD1   1 
ATOM   2970 C CD2   . LEU B 1 143 ? 9.896  24.502  90.192  1.00 42.25  ? 140 LEU B CD2   1 
ATOM   2971 N N     . GLY B 1 144 ? 11.740 24.665  95.231  1.00 33.68  ? 141 GLY B N     1 
ATOM   2972 C CA    . GLY B 1 144 ? 11.467 24.555  96.654  1.00 26.11  ? 141 GLY B CA    1 
ATOM   2973 C C     . GLY B 1 144 ? 12.096 23.391  97.397  1.00 36.58  ? 141 GLY B C     1 
ATOM   2974 O O     . GLY B 1 144 ? 11.639 23.028  98.482  1.00 34.18  ? 141 GLY B O     1 
ATOM   2975 N N     . ALA B 1 145 ? 13.140 22.800  96.826  1.00 24.04  ? 142 ALA B N     1 
ATOM   2976 C CA    . ALA B 1 145 ? 13.868 21.742  97.516  1.00 31.18  ? 142 ALA B CA    1 
ATOM   2977 C C     . ALA B 1 145 ? 14.590 22.317  98.729  1.00 40.06  ? 142 ALA B C     1 
ATOM   2978 O O     . ALA B 1 145 ? 15.066 23.452  98.695  1.00 37.29  ? 142 ALA B O     1 
ATOM   2979 C CB    . ALA B 1 145 ? 14.854 21.070  96.577  1.00 23.64  ? 142 ALA B CB    1 
ATOM   2980 N N     . SER B 1 146 ? 14.664 21.534  99.801  1.00 32.93  ? 143 SER B N     1 
ATOM   2981 C CA    . SER B 1 146 ? 15.331 21.971  101.023 1.00 27.40  ? 143 SER B CA    1 
ATOM   2982 C C     . SER B 1 146 ? 16.846 21.922  100.873 1.00 39.46  ? 143 SER B C     1 
ATOM   2983 O O     . SER B 1 146 ? 17.558 22.775  101.399 1.00 27.34  ? 143 SER B O     1 
ATOM   2984 C CB    . SER B 1 146 ? 14.906 21.100  102.205 1.00 29.71  ? 143 SER B CB    1 
ATOM   2985 O OG    . SER B 1 146 ? 15.350 19.763  102.030 1.00 28.00  ? 143 SER B OG    1 
ATOM   2986 N N     . GLY B 1 147 ? 17.332 20.915  100.156 1.00 20.90  ? 144 GLY B N     1 
ATOM   2987 C CA    . GLY B 1 147 ? 18.760 20.731  99.986  1.00 20.44  ? 144 GLY B CA    1 
ATOM   2988 C C     . GLY B 1 147 ? 19.102 19.619  99.018  1.00 21.96  ? 144 GLY B C     1 
ATOM   2989 O O     . GLY B 1 147 ? 18.222 18.926  98.507  1.00 26.41  ? 144 GLY B O     1 
ATOM   2990 N N     . ILE B 1 148 ? 20.395 19.450  98.768  1.00 19.77  ? 145 ILE B N     1 
ATOM   2991 C CA    . ILE B 1 148 ? 20.873 18.433  97.844  1.00 33.42  ? 145 ILE B CA    1 
ATOM   2992 C C     . ILE B 1 148 ? 21.989 17.609  98.470  1.00 30.39  ? 145 ILE B C     1 
ATOM   2993 O O     . ILE B 1 148 ? 22.898 18.151  99.096  1.00 30.74  ? 145 ILE B O     1 
ATOM   2994 C CB    . ILE B 1 148 ? 21.392 19.061  96.537  1.00 25.22  ? 145 ILE B CB    1 
ATOM   2995 C CG1   . ILE B 1 148 ? 20.271 19.821  95.828  1.00 27.48  ? 145 ILE B CG1   1 
ATOM   2996 C CG2   . ILE B 1 148 ? 21.978 17.992  95.628  1.00 22.54  ? 145 ILE B CG2   1 
ATOM   2997 C CD1   . ILE B 1 148 ? 20.702 20.493  94.542  1.00 20.29  ? 145 ILE B CD1   1 
ATOM   2998 N N     . ILE B 1 149 ? 21.913 16.295  98.302  1.00 21.49  ? 146 ILE B N     1 
ATOM   2999 C CA    . ILE B 1 149 ? 22.961 15.406  98.780  1.00 24.82  ? 146 ILE B CA    1 
ATOM   3000 C C     . ILE B 1 149 ? 23.645 14.756  97.587  1.00 26.25  ? 146 ILE B C     1 
ATOM   3001 O O     . ILE B 1 149 ? 23.014 14.035  96.816  1.00 25.70  ? 146 ILE B O     1 
ATOM   3002 C CB    . ILE B 1 149 ? 22.402 14.320  99.719  1.00 29.10  ? 146 ILE B CB    1 
ATOM   3003 C CG1   . ILE B 1 149 ? 21.718 14.963  100.928 1.00 31.57  ? 146 ILE B CG1   1 
ATOM   3004 C CG2   . ILE B 1 149 ? 23.511 13.379  100.169 1.00 23.95  ? 146 ILE B CG2   1 
ATOM   3005 C CD1   . ILE B 1 149 ? 21.117 13.962  101.894 1.00 34.64  ? 146 ILE B CD1   1 
ATOM   3006 N N     . LEU B 1 150 ? 24.936 15.030  97.432  1.00 36.37  ? 147 LEU B N     1 
ATOM   3007 C CA    . LEU B 1 150 ? 25.705 14.493  96.317  1.00 41.45  ? 147 LEU B CA    1 
ATOM   3008 C C     . LEU B 1 150 ? 26.494 13.256  96.732  1.00 30.76  ? 147 LEU B C     1 
ATOM   3009 O O     . LEU B 1 150 ? 27.328 13.315  97.636  1.00 34.39  ? 147 LEU B O     1 
ATOM   3010 C CB    . LEU B 1 150 ? 26.657 15.555  95.762  1.00 31.78  ? 147 LEU B CB    1 
ATOM   3011 C CG    . LEU B 1 150 ? 26.026 16.828  95.193  1.00 30.23  ? 147 LEU B CG    1 
ATOM   3012 C CD1   . LEU B 1 150 ? 27.101 17.746  94.635  1.00 23.80  ? 147 LEU B CD1   1 
ATOM   3013 C CD2   . LEU B 1 150 ? 25.002 16.486  94.123  1.00 24.13  ? 147 LEU B CD2   1 
ATOM   3014 N N     . VAL B 1 151 ? 26.222 12.138  96.069  1.00 25.40  ? 148 VAL B N     1 
ATOM   3015 C CA    . VAL B 1 151 ? 26.943 10.897  96.324  1.00 27.17  ? 148 VAL B CA    1 
ATOM   3016 C C     . VAL B 1 151 ? 27.687 10.449  95.072  1.00 42.28  ? 148 VAL B C     1 
ATOM   3017 O O     . VAL B 1 151 ? 27.106 10.383  93.989  1.00 36.36  ? 148 VAL B O     1 
ATOM   3018 C CB    . VAL B 1 151 ? 25.991 9.770   96.773  1.00 28.68  ? 148 VAL B CB    1 
ATOM   3019 C CG1   . VAL B 1 151 ? 26.765 8.473   96.991  1.00 29.60  ? 148 VAL B CG1   1 
ATOM   3020 C CG2   . VAL B 1 151 ? 25.251 10.174  98.036  1.00 25.99  ? 148 VAL B CG2   1 
ATOM   3021 N N     . ASP B 1 152 ? 28.975 10.152  95.228  1.00 48.57  ? 149 ASP B N     1 
ATOM   3022 C CA    . ASP B 1 152 ? 29.804 9.691   94.118  1.00 41.10  ? 149 ASP B CA    1 
ATOM   3023 C C     . ASP B 1 152 ? 29.802 10.703  92.974  1.00 43.10  ? 149 ASP B C     1 
ATOM   3024 O O     . ASP B 1 152 ? 29.535 10.355  91.824  1.00 45.60  ? 149 ASP B O     1 
ATOM   3025 C CB    . ASP B 1 152 ? 29.318 8.326   93.618  1.00 54.26  ? 149 ASP B CB    1 
ATOM   3026 C CG    . ASP B 1 152 ? 30.312 7.656   92.690  1.00 72.17  ? 149 ASP B CG    1 
ATOM   3027 O OD1   . ASP B 1 152 ? 31.531 7.839   92.888  1.00 87.49  ? 149 ASP B OD1   1 
ATOM   3028 O OD2   . ASP B 1 152 ? 29.873 6.939   91.766  1.00 71.48  ? 149 ASP B OD2   1 
ATOM   3029 N N     . SER B 1 153 ? 30.105 11.957  93.298  1.00 31.25  ? 150 SER B N     1 
ATOM   3030 C CA    . SER B 1 153 ? 30.067 13.033  92.313  1.00 32.49  ? 150 SER B CA    1 
ATOM   3031 C C     . SER B 1 153 ? 31.463 13.501  91.915  1.00 47.65  ? 150 SER B C     1 
ATOM   3032 O O     . SER B 1 153 ? 31.612 14.352  91.038  1.00 46.05  ? 150 SER B O     1 
ATOM   3033 C CB    . SER B 1 153 ? 29.268 14.218  92.856  1.00 31.96  ? 150 SER B CB    1 
ATOM   3034 O OG    . SER B 1 153 ? 29.983 14.883  93.883  1.00 30.34  ? 150 SER B OG    1 
ATOM   3035 N N     . ASP B 1 154 ? 32.480 12.950  92.571  1.00 34.20  ? 151 ASP B N     1 
ATOM   3036 C CA    . ASP B 1 154 ? 33.867 13.337  92.322  1.00 39.36  ? 151 ASP B CA    1 
ATOM   3037 C C     . ASP B 1 154 ? 34.131 14.806  92.657  1.00 44.70  ? 151 ASP B C     1 
ATOM   3038 O O     . ASP B 1 154 ? 35.174 15.354  92.301  1.00 51.31  ? 151 ASP B O     1 
ATOM   3039 C CB    . ASP B 1 154 ? 34.263 13.040  90.873  1.00 47.43  ? 151 ASP B CB    1 
ATOM   3040 C CG    . ASP B 1 154 ? 34.436 11.557  90.610  1.00 69.52  ? 151 ASP B CG    1 
ATOM   3041 O OD1   . ASP B 1 154 ? 34.765 10.815  91.562  1.00 63.62  ? 151 ASP B OD1   1 
ATOM   3042 O OD2   . ASP B 1 154 ? 34.249 11.130  89.452  1.00 82.51  ? 151 ASP B OD2   1 
ATOM   3043 N N     . ILE B 1 155 ? 33.184 15.439  93.342  1.00 45.10  ? 152 ILE B N     1 
ATOM   3044 C CA    . ILE B 1 155 ? 33.357 16.813  93.799  1.00 39.44  ? 152 ILE B CA    1 
ATOM   3045 C C     . ILE B 1 155 ? 33.943 16.822  95.207  1.00 36.01  ? 152 ILE B C     1 
ATOM   3046 O O     . ILE B 1 155 ? 33.362 16.252  96.132  1.00 39.05  ? 152 ILE B O     1 
ATOM   3047 C CB    . ILE B 1 155 ? 32.018 17.578  93.810  1.00 42.56  ? 152 ILE B CB    1 
ATOM   3048 C CG1   . ILE B 1 155 ? 31.352 17.519  92.432  1.00 37.14  ? 152 ILE B CG1   1 
ATOM   3049 C CG2   . ILE B 1 155 ? 32.232 19.021  94.246  1.00 36.62  ? 152 ILE B CG2   1 
ATOM   3050 C CD1   . ILE B 1 155 ? 32.054 18.340  91.375  1.00 47.54  ? 152 ILE B CD1   1 
ATOM   3051 N N     . THR B 1 156 ? 35.095 17.464  95.367  1.00 38.56  ? 153 THR B N     1 
ATOM   3052 C CA    . THR B 1 156 ? 35.749 17.537  96.669  1.00 38.43  ? 153 THR B CA    1 
ATOM   3053 C C     . THR B 1 156 ? 35.269 18.749  97.462  1.00 32.10  ? 153 THR B C     1 
ATOM   3054 O O     . THR B 1 156 ? 35.105 18.679  98.679  1.00 39.35  ? 153 THR B O     1 
ATOM   3055 C CB    . THR B 1 156 ? 37.285 17.595  96.534  1.00 41.21  ? 153 THR B CB    1 
ATOM   3056 O OG1   . THR B 1 156 ? 37.663 18.798  95.853  1.00 44.23  ? 153 THR B OG1   1 
ATOM   3057 C CG2   . THR B 1 156 ? 37.798 16.392  95.758  1.00 44.18  ? 153 THR B CG2   1 
ATOM   3058 N N     . SER B 1 157 ? 35.050 19.858  96.764  1.00 36.97  ? 154 SER B N     1 
ATOM   3059 C CA    . SER B 1 157 ? 34.566 21.078  97.397  1.00 38.17  ? 154 SER B CA    1 
ATOM   3060 C C     . SER B 1 157 ? 33.475 21.723  96.553  1.00 40.60  ? 154 SER B C     1 
ATOM   3061 O O     . SER B 1 157 ? 33.526 21.686  95.323  1.00 42.54  ? 154 SER B O     1 
ATOM   3062 C CB    . SER B 1 157 ? 35.713 22.065  97.616  1.00 47.90  ? 154 SER B CB    1 
ATOM   3063 O OG    . SER B 1 157 ? 35.253 23.244  98.255  1.00 56.82  ? 154 SER B OG    1 
ATOM   3064 N N     . ILE B 1 158 ? 32.494 22.320  97.219  1.00 36.09  ? 155 ILE B N     1 
ATOM   3065 C CA    . ILE B 1 158 ? 31.352 22.908  96.531  1.00 36.22  ? 155 ILE B CA    1 
ATOM   3066 C C     . ILE B 1 158 ? 31.707 24.272  95.938  1.00 39.23  ? 155 ILE B C     1 
ATOM   3067 O O     . ILE B 1 158 ? 30.991 24.797  95.083  1.00 41.34  ? 155 ILE B O     1 
ATOM   3068 C CB    . ILE B 1 158 ? 30.136 23.037  97.477  1.00 39.69  ? 155 ILE B CB    1 
ATOM   3069 C CG1   . ILE B 1 158 ? 28.879 22.497  96.800  1.00 43.82  ? 155 ILE B CG1   1 
ATOM   3070 C CG2   . ILE B 1 158 ? 29.961 24.470  97.962  1.00 46.76  ? 155 ILE B CG2   1 
ATOM   3071 C CD1   . ILE B 1 158 ? 28.975 21.030  96.447  1.00 44.77  ? 155 ILE B CD1   1 
ATOM   3072 N N     . ALA B 1 159 ? 32.825 24.832  96.389  1.00 39.16  ? 156 ALA B N     1 
ATOM   3073 C CA    . ALA B 1 159 ? 33.288 26.128  95.908  1.00 46.03  ? 156 ALA B CA    1 
ATOM   3074 C C     . ALA B 1 159 ? 33.995 26.004  94.562  1.00 49.83  ? 156 ALA B C     1 
ATOM   3075 O O     . ALA B 1 159 ? 34.483 26.992  94.012  1.00 49.04  ? 156 ALA B O     1 
ATOM   3076 C CB    . ALA B 1 159 ? 34.202 26.774  96.932  1.00 51.39  ? 156 ALA B CB    1 
ATOM   3077 N N     . ASP B 1 160 ? 34.053 24.781  94.044  1.00 49.90  ? 157 ASP B N     1 
ATOM   3078 C CA    . ASP B 1 160 ? 34.634 24.533  92.732  1.00 43.00  ? 157 ASP B CA    1 
ATOM   3079 C C     . ASP B 1 160 ? 34.037 25.511  91.729  1.00 36.41  ? 157 ASP B C     1 
ATOM   3080 O O     . ASP B 1 160 ? 32.829 25.505  91.494  1.00 42.63  ? 157 ASP B O     1 
ATOM   3081 C CB    . ASP B 1 160 ? 34.361 23.091  92.300  1.00 47.22  ? 157 ASP B CB    1 
ATOM   3082 C CG    . ASP B 1 160 ? 34.940 22.766  90.939  1.00 61.88  ? 157 ASP B CG    1 
ATOM   3083 O OD1   . ASP B 1 160 ? 35.192 23.702  90.152  1.00 73.78  ? 157 ASP B OD1   1 
ATOM   3084 O OD2   . ASP B 1 160 ? 35.141 21.567  90.656  1.00 71.12  ? 157 ASP B OD2   1 
ATOM   3085 N N     . ARG B 1 161 ? 34.882 26.356  91.145  1.00 39.39  ? 158 ARG B N     1 
ATOM   3086 C CA    . ARG B 1 161 ? 34.394 27.421  90.272  1.00 50.29  ? 158 ARG B CA    1 
ATOM   3087 C C     . ARG B 1 161 ? 33.587 26.888  89.092  1.00 45.86  ? 158 ARG B C     1 
ATOM   3088 O O     . ARG B 1 161 ? 32.639 27.533  88.645  1.00 49.79  ? 158 ARG B O     1 
ATOM   3089 C CB    . ARG B 1 161 ? 35.534 28.323  89.787  1.00 57.38  ? 158 ARG B CB    1 
ATOM   3090 C CG    . ARG B 1 161 ? 36.657 27.599  89.073  1.00 74.90  ? 158 ARG B CG    1 
ATOM   3091 C CD    . ARG B 1 161 ? 37.383 28.524  88.110  1.00 88.89  ? 158 ARG B CD    1 
ATOM   3092 N NE    . ARG B 1 161 ? 37.329 29.920  88.536  1.00 95.07  ? 158 ARG B NE    1 
ATOM   3093 C CZ    . ARG B 1 161 ? 38.052 30.436  89.525  1.00 97.24  ? 158 ARG B CZ    1 
ATOM   3094 N NH1   . ARG B 1 161 ? 38.897 29.672  90.205  1.00 107.89 ? 158 ARG B NH1   1 
ATOM   3095 N NH2   . ARG B 1 161 ? 37.936 31.721  89.828  1.00 73.57  ? 158 ARG B NH2   1 
ATOM   3096 N N     . ARG B 1 162 ? 33.963 25.716  88.589  1.00 47.91  ? 159 ARG B N     1 
ATOM   3097 C CA    . ARG B 1 162 ? 33.190 25.066  87.538  1.00 47.52  ? 159 ARG B CA    1 
ATOM   3098 C C     . ARG B 1 162 ? 31.757 24.838  88.004  1.00 33.62  ? 159 ARG B C     1 
ATOM   3099 O O     . ARG B 1 162 ? 30.809 25.034  87.244  1.00 47.13  ? 159 ARG B O     1 
ATOM   3100 C CB    . ARG B 1 162 ? 33.818 23.730  87.138  1.00 49.17  ? 159 ARG B CB    1 
ATOM   3101 C CG    . ARG B 1 162 ? 35.130 23.842  86.380  1.00 54.92  ? 159 ARG B CG    1 
ATOM   3102 C CD    . ARG B 1 162 ? 35.367 22.597  85.538  1.00 57.22  ? 159 ARG B CD    1 
ATOM   3103 N NE    . ARG B 1 162 ? 35.297 21.375  86.335  1.00 70.73  ? 159 ARG B NE    1 
ATOM   3104 C CZ    . ARG B 1 162 ? 34.989 20.179  85.844  1.00 81.81  ? 159 ARG B CZ    1 
ATOM   3105 N NH1   . ARG B 1 162 ? 34.712 20.041  84.554  1.00 85.90  ? 159 ARG B NH1   1 
ATOM   3106 N NH2   . ARG B 1 162 ? 34.949 19.121  86.644  1.00 82.90  ? 159 ARG B NH2   1 
ATOM   3107 N N     . LEU B 1 163 ? 31.605 24.424  89.258  1.00 32.06  ? 160 LEU B N     1 
ATOM   3108 C CA    . LEU B 1 163 ? 30.284 24.185  89.826  1.00 34.84  ? 160 LEU B CA    1 
ATOM   3109 C C     . LEU B 1 163 ? 29.568 25.502  90.111  1.00 35.71  ? 160 LEU B C     1 
ATOM   3110 O O     . LEU B 1 163 ? 28.363 25.621  89.894  1.00 48.52  ? 160 LEU B O     1 
ATOM   3111 C CB    . LEU B 1 163 ? 30.384 23.346  91.102  1.00 39.34  ? 160 LEU B CB    1 
ATOM   3112 C CG    . LEU B 1 163 ? 29.045 22.932  91.713  1.00 34.58  ? 160 LEU B CG    1 
ATOM   3113 C CD1   . LEU B 1 163 ? 28.168 22.279  90.657  1.00 26.62  ? 160 LEU B CD1   1 
ATOM   3114 C CD2   . LEU B 1 163 ? 29.247 22.003  92.901  1.00 33.88  ? 160 LEU B CD2   1 
ATOM   3115 N N     . GLN B 1 164 ? 30.317 26.489  90.594  1.00 32.57  ? 161 GLN B N     1 
ATOM   3116 C CA    . GLN B 1 164 ? 29.760 27.813  90.843  1.00 43.66  ? 161 GLN B CA    1 
ATOM   3117 C C     . GLN B 1 164 ? 29.170 28.402  89.566  1.00 42.03  ? 161 GLN B C     1 
ATOM   3118 O O     . GLN B 1 164 ? 28.062 28.936  89.572  1.00 44.76  ? 161 GLN B O     1 
ATOM   3119 C CB    . GLN B 1 164 ? 30.823 28.759  91.409  1.00 44.76  ? 161 GLN B CB    1 
ATOM   3120 C CG    . GLN B 1 164 ? 31.283 28.428  92.821  1.00 46.35  ? 161 GLN B CG    1 
ATOM   3121 C CD    . GLN B 1 164 ? 32.065 29.563  93.459  1.00 50.97  ? 161 GLN B CD    1 
ATOM   3122 O OE1   . GLN B 1 164 ? 33.046 29.336  94.167  1.00 49.32  ? 161 GLN B OE1   1 
ATOM   3123 N NE2   . GLN B 1 164 ? 31.633 30.794  93.209  1.00 41.53  ? 161 GLN B NE2   1 
ATOM   3124 N N     . ARG B 1 165 ? 29.918 28.303  88.472  1.00 37.33  ? 162 ARG B N     1 
ATOM   3125 C CA    . ARG B 1 165 ? 29.478 28.861  87.200  1.00 40.59  ? 162 ARG B CA    1 
ATOM   3126 C C     . ARG B 1 165 ? 28.331 28.053  86.603  1.00 38.93  ? 162 ARG B C     1 
ATOM   3127 O O     . ARG B 1 165 ? 27.389 28.616  86.045  1.00 51.76  ? 162 ARG B O     1 
ATOM   3128 C CB    . ARG B 1 165 ? 30.643 28.939  86.211  1.00 54.67  ? 162 ARG B CB    1 
ATOM   3129 C CG    . ARG B 1 165 ? 30.312 29.684  84.930  1.00 74.91  ? 162 ARG B CG    1 
ATOM   3130 C CD    . ARG B 1 165 ? 31.505 29.739  83.993  1.00 97.22  ? 162 ARG B CD    1 
ATOM   3131 N NE    . ARG B 1 165 ? 32.653 30.403  84.604  1.00 112.11 ? 162 ARG B NE    1 
ATOM   3132 C CZ    . ARG B 1 165 ? 33.774 30.700  83.955  1.00 125.13 ? 162 ARG B CZ    1 
ATOM   3133 N NH1   . ARG B 1 165 ? 33.898 30.393  82.671  1.00 132.39 ? 162 ARG B NH1   1 
ATOM   3134 N NH2   . ARG B 1 165 ? 34.770 31.304  84.588  1.00 125.76 ? 162 ARG B NH2   1 
ATOM   3135 N N     . ALA B 1 166 ? 28.415 26.733  86.725  1.00 32.30  ? 163 ALA B N     1 
ATOM   3136 C CA    . ALA B 1 166 ? 27.379 25.847  86.207  1.00 37.99  ? 163 ALA B CA    1 
ATOM   3137 C C     . ALA B 1 166 ? 26.062 26.037  86.953  1.00 34.85  ? 163 ALA B C     1 
ATOM   3138 O O     . ALA B 1 166 ? 24.989 25.750  86.423  1.00 35.96  ? 163 ALA B O     1 
ATOM   3139 C CB    . ALA B 1 166 ? 27.833 24.395  86.292  1.00 31.00  ? 163 ALA B CB    1 
ATOM   3140 N N     . SER B 1 167 ? 26.151 26.527  88.184  1.00 30.10  ? 164 SER B N     1 
ATOM   3141 C CA    . SER B 1 167 ? 24.975 26.704  89.028  1.00 35.77  ? 164 SER B CA    1 
ATOM   3142 C C     . SER B 1 167 ? 24.446 28.133  88.980  1.00 41.48  ? 164 SER B C     1 
ATOM   3143 O O     . SER B 1 167 ? 23.535 28.489  89.727  1.00 42.28  ? 164 SER B O     1 
ATOM   3144 C CB    . SER B 1 167 ? 25.297 26.315  90.472  1.00 29.57  ? 164 SER B CB    1 
ATOM   3145 O OG    . SER B 1 167 ? 25.657 24.947  90.558  1.00 48.86  ? 164 SER B OG    1 
ATOM   3146 N N     . ARG B 1 168 ? 25.021 28.945  88.099  1.00 45.62  ? 165 ARG B N     1 
ATOM   3147 C CA    . ARG B 1 168 ? 24.623 30.343  87.977  1.00 47.75  ? 165 ARG B CA    1 
ATOM   3148 C C     . ARG B 1 168 ? 24.879 31.107  89.271  1.00 41.45  ? 165 ARG B C     1 
ATOM   3149 O O     . ARG B 1 168 ? 24.304 32.171  89.498  1.00 52.17  ? 165 ARG B O     1 
ATOM   3150 C CB    . ARG B 1 168 ? 23.148 30.452  87.582  1.00 52.86  ? 165 ARG B CB    1 
ATOM   3151 C CG    . ARG B 1 168 ? 22.904 30.636  86.096  1.00 64.93  ? 165 ARG B CG    1 
ATOM   3152 C CD    . ARG B 1 168 ? 23.387 32.006  85.638  1.00 88.46  ? 165 ARG B CD    1 
ATOM   3153 N NE    . ARG B 1 168 ? 22.631 32.554  84.510  1.00 91.25  ? 165 ARG B NE    1 
ATOM   3154 C CZ    . ARG B 1 168 ? 22.126 31.846  83.503  1.00 95.19  ? 165 ARG B CZ    1 
ATOM   3155 N NH1   . ARG B 1 168 ? 22.299 30.532  83.437  1.00 89.76  ? 165 ARG B NH1   1 
ATOM   3156 N NH2   . ARG B 1 168 ? 21.454 32.462  82.541  1.00 104.82 ? 165 ARG B NH2   1 
ATOM   3157 N N     . GLY B 1 169 ? 25.742 30.553  90.118  1.00 44.44  ? 166 GLY B N     1 
ATOM   3158 C CA    . GLY B 1 169 ? 26.091 31.180  91.379  1.00 38.88  ? 166 GLY B CA    1 
ATOM   3159 C C     . GLY B 1 169 ? 25.104 30.883  92.492  1.00 39.10  ? 166 GLY B C     1 
ATOM   3160 O O     . GLY B 1 169 ? 25.000 31.640  93.455  1.00 40.79  ? 166 GLY B O     1 
ATOM   3161 N N     . TYR B 1 170 ? 24.380 29.776  92.363  1.00 31.15  ? 167 TYR B N     1 
ATOM   3162 C CA    . TYR B 1 170 ? 23.362 29.411  93.343  1.00 27.39  ? 167 TYR B CA    1 
ATOM   3163 C C     . TYR B 1 170 ? 23.811 28.263  94.246  1.00 32.17  ? 167 TYR B C     1 
ATOM   3164 O O     . TYR B 1 170 ? 23.032 27.764  95.059  1.00 41.89  ? 167 TYR B O     1 
ATOM   3165 C CB    . TYR B 1 170 ? 22.055 29.029  92.641  1.00 28.48  ? 167 TYR B CB    1 
ATOM   3166 C CG    . TYR B 1 170 ? 21.288 30.194  92.051  1.00 34.00  ? 167 TYR B CG    1 
ATOM   3167 C CD1   . TYR B 1 170 ? 20.662 31.123  92.871  1.00 40.10  ? 167 TYR B CD1   1 
ATOM   3168 C CD2   . TYR B 1 170 ? 21.174 30.353  90.676  1.00 32.64  ? 167 TYR B CD2   1 
ATOM   3169 C CE1   . TYR B 1 170 ? 19.952 32.185  92.339  1.00 46.61  ? 167 TYR B CE1   1 
ATOM   3170 C CE2   . TYR B 1 170 ? 20.466 31.412  90.134  1.00 31.18  ? 167 TYR B CE2   1 
ATOM   3171 C CZ    . TYR B 1 170 ? 19.858 32.324  90.970  1.00 43.20  ? 167 TYR B CZ    1 
ATOM   3172 O OH    . TYR B 1 170 ? 19.154 33.377  90.436  1.00 58.13  ? 167 TYR B OH    1 
ATOM   3173 N N     . VAL B 1 171 ? 25.068 27.851  94.106  1.00 25.99  ? 168 VAL B N     1 
ATOM   3174 C CA    . VAL B 1 171 ? 25.576 26.687  94.828  1.00 24.97  ? 168 VAL B CA    1 
ATOM   3175 C C     . VAL B 1 171 ? 25.602 26.883  96.346  1.00 28.73  ? 168 VAL B C     1 
ATOM   3176 O O     . VAL B 1 171 ? 25.727 25.918  97.098  1.00 24.16  ? 168 VAL B O     1 
ATOM   3177 C CB    . VAL B 1 171 ? 26.982 26.279  94.334  1.00 37.69  ? 168 VAL B CB    1 
ATOM   3178 C CG1   . VAL B 1 171 ? 28.040 27.205  94.909  1.00 29.59  ? 168 VAL B CG1   1 
ATOM   3179 C CG2   . VAL B 1 171 ? 27.275 24.833  94.705  1.00 40.32  ? 168 VAL B CG2   1 
ATOM   3180 N N     . PHE B 1 172 ? 25.479 28.130  96.792  1.00 25.94  ? 169 PHE B N     1 
ATOM   3181 C CA    . PHE B 1 172 ? 25.479 28.434  98.220  1.00 26.27  ? 169 PHE B CA    1 
ATOM   3182 C C     . PHE B 1 172 ? 24.086 28.820  98.711  1.00 33.78  ? 169 PHE B C     1 
ATOM   3183 O O     . PHE B 1 172 ? 23.885 29.067  99.900  1.00 31.66  ? 169 PHE B O     1 
ATOM   3184 C CB    . PHE B 1 172 ? 26.462 29.566  98.531  1.00 42.17  ? 169 PHE B CB    1 
ATOM   3185 C CG    . PHE B 1 172 ? 27.855 29.321  98.021  1.00 39.36  ? 169 PHE B CG    1 
ATOM   3186 C CD1   . PHE B 1 172 ? 28.654 28.342  98.588  1.00 27.75  ? 169 PHE B CD1   1 
ATOM   3187 C CD2   . PHE B 1 172 ? 28.369 30.079  96.981  1.00 40.02  ? 169 PHE B CD2   1 
ATOM   3188 C CE1   . PHE B 1 172 ? 29.935 28.117  98.122  1.00 37.25  ? 169 PHE B CE1   1 
ATOM   3189 C CE2   . PHE B 1 172 ? 29.652 29.859  96.511  1.00 43.18  ? 169 PHE B CE2   1 
ATOM   3190 C CZ    . PHE B 1 172 ? 30.435 28.876  97.083  1.00 38.20  ? 169 PHE B CZ    1 
ATOM   3191 N N     . SER B 1 173 ? 23.127 28.873  97.792  1.00 26.21  ? 170 SER B N     1 
ATOM   3192 C CA    . SER B 1 173 ? 21.777 29.318  98.124  1.00 26.76  ? 170 SER B CA    1 
ATOM   3193 C C     . SER B 1 173 ? 20.964 28.234  98.827  1.00 26.74  ? 170 SER B C     1 
ATOM   3194 O O     . SER B 1 173 ? 19.896 28.505  99.376  1.00 33.42  ? 170 SER B O     1 
ATOM   3195 C CB    . SER B 1 173 ? 21.047 29.809  96.873  1.00 30.24  ? 170 SER B CB    1 
ATOM   3196 O OG    . SER B 1 173 ? 21.696 30.943  96.321  1.00 33.48  ? 170 SER B OG    1 
ATOM   3197 N N     . LEU B 1 174 ? 21.469 27.006  98.805  1.00 24.25  ? 171 LEU B N     1 
ATOM   3198 C CA    . LEU B 1 174 ? 20.847 25.914  99.542  1.00 36.27  ? 171 LEU B CA    1 
ATOM   3199 C C     . LEU B 1 174 ? 21.887 24.849  99.852  1.00 32.95  ? 171 LEU B C     1 
ATOM   3200 O O     . LEU B 1 174 ? 22.813 24.638  99.071  1.00 33.65  ? 171 LEU B O     1 
ATOM   3201 C CB    . LEU B 1 174 ? 19.682 25.307  98.756  1.00 26.44  ? 171 LEU B CB    1 
ATOM   3202 C CG    . LEU B 1 174 ? 20.022 24.269  97.683  1.00 27.03  ? 171 LEU B CG    1 
ATOM   3203 C CD1   . LEU B 1 174 ? 18.758 23.577  97.197  1.00 26.64  ? 171 LEU B CD1   1 
ATOM   3204 C CD2   . LEU B 1 174 ? 20.772 24.905  96.524  1.00 27.16  ? 171 LEU B CD2   1 
ATOM   3205 N N     . PRO B 1 175 ? 21.738 24.176  101.001 1.00 31.06  ? 172 PRO B N     1 
ATOM   3206 C CA    . PRO B 1 175 ? 22.698 23.156  101.429 1.00 24.74  ? 172 PRO B CA    1 
ATOM   3207 C C     . PRO B 1 175 ? 22.966 22.114  100.346 1.00 21.20  ? 172 PRO B C     1 
ATOM   3208 O O     . PRO B 1 175 ? 22.058 21.386  99.946  1.00 27.85  ? 172 PRO B O     1 
ATOM   3209 C CB    . PRO B 1 175 ? 22.002 22.508  102.628 1.00 29.00  ? 172 PRO B CB    1 
ATOM   3210 C CG    . PRO B 1 175 ? 21.114 23.578  103.165 1.00 32.78  ? 172 PRO B CG    1 
ATOM   3211 C CD    . PRO B 1 175 ? 20.642 24.352  101.969 1.00 28.58  ? 172 PRO B CD    1 
ATOM   3212 N N     . VAL B 1 176 ? 24.204 22.064  99.867  1.00 21.43  ? 173 VAL B N     1 
ATOM   3213 C CA    . VAL B 1 176 ? 24.636 21.014  98.953  1.00 23.17  ? 173 VAL B CA    1 
ATOM   3214 C C     . VAL B 1 176 ? 25.684 20.164  99.663  1.00 25.56  ? 173 VAL B C     1 
ATOM   3215 O O     . VAL B 1 176 ? 26.849 20.549  99.763  1.00 24.85  ? 173 VAL B O     1 
ATOM   3216 C CB    . VAL B 1 176 ? 25.219 21.589  97.645  1.00 28.27  ? 173 VAL B CB    1 
ATOM   3217 C CG1   . VAL B 1 176 ? 25.662 20.464  96.726  1.00 23.32  ? 173 VAL B CG1   1 
ATOM   3218 C CG2   . VAL B 1 176 ? 24.193 22.474  96.946  1.00 22.24  ? 173 VAL B CG2   1 
ATOM   3219 N N     . VAL B 1 177 ? 25.257 19.009  100.164 1.00 30.45  ? 174 VAL B N     1 
ATOM   3220 C CA    . VAL B 1 177 ? 26.096 18.182  101.025 1.00 27.21  ? 174 VAL B CA    1 
ATOM   3221 C C     . VAL B 1 177 ? 26.851 17.100  100.261 1.00 26.11  ? 174 VAL B C     1 
ATOM   3222 O O     . VAL B 1 177 ? 26.257 16.334  99.501  1.00 34.78  ? 174 VAL B O     1 
ATOM   3223 C CB    . VAL B 1 177 ? 25.255 17.511  102.129 1.00 21.91  ? 174 VAL B CB    1 
ATOM   3224 C CG1   . VAL B 1 177 ? 26.141 16.693  103.057 1.00 25.58  ? 174 VAL B CG1   1 
ATOM   3225 C CG2   . VAL B 1 177 ? 24.478 18.560  102.910 1.00 21.75  ? 174 VAL B CG2   1 
ATOM   3226 N N     . LEU B 1 178 ? 28.164 17.048  100.467 1.00 33.91  ? 175 LEU B N     1 
ATOM   3227 C CA    . LEU B 1 178 ? 28.990 15.980  99.916  1.00 26.82  ? 175 LEU B CA    1 
ATOM   3228 C C     . LEU B 1 178 ? 29.061 14.840  100.925 1.00 29.78  ? 175 LEU B C     1 
ATOM   3229 O O     . LEU B 1 178 ? 29.507 15.031  102.058 1.00 42.96  ? 175 LEU B O     1 
ATOM   3230 C CB    . LEU B 1 178 ? 30.395 16.495  99.592  1.00 27.46  ? 175 LEU B CB    1 
ATOM   3231 C CG    . LEU B 1 178 ? 30.483 17.650  98.588  1.00 34.46  ? 175 LEU B CG    1 
ATOM   3232 C CD1   . LEU B 1 178 ? 31.916 18.145  98.441  1.00 28.83  ? 175 LEU B CD1   1 
ATOM   3233 C CD2   . LEU B 1 178 ? 29.910 17.242  97.238  1.00 27.75  ? 175 LEU B CD2   1 
ATOM   3234 N N     . SER B 1 179 ? 28.619 13.656  100.514 1.00 26.08  ? 176 SER B N     1 
ATOM   3235 C CA    . SER B 1 179 ? 28.481 12.537  101.439 1.00 33.07  ? 176 SER B CA    1 
ATOM   3236 C C     . SER B 1 179 ? 28.775 11.182  100.801 1.00 31.59  ? 176 SER B C     1 
ATOM   3237 O O     . SER B 1 179 ? 28.640 11.010  99.591  1.00 30.81  ? 176 SER B O     1 
ATOM   3238 C CB    . SER B 1 179 ? 27.067 12.526  102.026 1.00 25.42  ? 176 SER B CB    1 
ATOM   3239 O OG    . SER B 1 179 ? 26.809 11.319  102.720 1.00 33.52  ? 176 SER B OG    1 
ATOM   3240 N N     . GLY B 1 180 ? 29.177 10.223  101.630 1.00 32.28  ? 177 GLY B N     1 
ATOM   3241 C CA    . GLY B 1 180 ? 29.306 8.845   101.196 1.00 31.35  ? 177 GLY B CA    1 
ATOM   3242 C C     . GLY B 1 180 ? 27.933 8.207   101.099 1.00 30.65  ? 177 GLY B C     1 
ATOM   3243 O O     . GLY B 1 180 ? 26.968 8.712   101.673 1.00 30.32  ? 177 GLY B O     1 
ATOM   3244 N N     . ARG B 1 181 ? 27.837 7.098   100.374 1.00 45.39  ? 178 ARG B N     1 
ATOM   3245 C CA    . ARG B 1 181 ? 26.553 6.431   100.168 1.00 31.73  ? 178 ARG B CA    1 
ATOM   3246 C C     . ARG B 1 181 ? 25.919 5.971   101.483 1.00 31.87  ? 178 ARG B C     1 
ATOM   3247 O O     . ARG B 1 181 ? 24.741 6.225   101.735 1.00 39.90  ? 178 ARG B O     1 
ATOM   3248 C CB    . ARG B 1 181 ? 26.710 5.253   99.203  1.00 35.45  ? 178 ARG B CB    1 
ATOM   3249 C CG    . ARG B 1 181 ? 25.409 4.545   98.857  1.00 40.35  ? 178 ARG B CG    1 
ATOM   3250 C CD    . ARG B 1 181 ? 25.604 3.546   97.723  1.00 59.62  ? 178 ARG B CD    1 
ATOM   3251 N NE    . ARG B 1 181 ? 25.850 4.203   96.441  1.00 72.95  ? 178 ARG B NE    1 
ATOM   3252 C CZ    . ARG B 1 181 ? 27.057 4.425   95.930  1.00 67.67  ? 178 ARG B CZ    1 
ATOM   3253 N NH1   . ARG B 1 181 ? 28.141 4.041   96.591  1.00 79.05  ? 178 ARG B NH1   1 
ATOM   3254 N NH2   . ARG B 1 181 ? 27.183 5.030   94.757  1.00 46.74  ? 178 ARG B NH2   1 
ATOM   3255 N N     . GLU B 1 182 ? 26.708 5.300   102.317 1.00 40.91  ? 179 GLU B N     1 
ATOM   3256 C CA    . GLU B 1 182 ? 26.217 4.768   103.585 1.00 48.94  ? 179 GLU B CA    1 
ATOM   3257 C C     . GLU B 1 182 ? 25.731 5.871   104.521 1.00 44.48  ? 179 GLU B C     1 
ATOM   3258 O O     . GLU B 1 182 ? 24.694 5.734   105.170 1.00 46.69  ? 179 GLU B O     1 
ATOM   3259 C CB    . GLU B 1 182 ? 27.303 3.943   104.282 1.00 49.59  ? 179 GLU B CB    1 
ATOM   3260 C CG    . GLU B 1 182 ? 27.661 2.638   103.584 1.00 72.26  ? 179 GLU B CG    1 
ATOM   3261 C CD    . GLU B 1 182 ? 28.733 2.805   102.522 1.00 89.55  ? 179 GLU B CD    1 
ATOM   3262 O OE1   . GLU B 1 182 ? 29.032 3.957   102.143 1.00 83.55  ? 179 GLU B OE1   1 
ATOM   3263 O OE2   . GLU B 1 182 ? 29.279 1.778   102.068 1.00 92.62  ? 179 GLU B OE2   1 
ATOM   3264 N N     . GLU B 1 183 ? 26.491 6.959   104.590 1.00 36.43  ? 180 GLU B N     1 
ATOM   3265 C CA    . GLU B 1 183 ? 26.150 8.081   105.455 1.00 30.32  ? 180 GLU B CA    1 
ATOM   3266 C C     . GLU B 1 183 ? 24.834 8.725   105.034 1.00 38.97  ? 180 GLU B C     1 
ATOM   3267 O O     . GLU B 1 183 ? 23.994 9.047   105.877 1.00 43.85  ? 180 GLU B O     1 
ATOM   3268 C CB    . GLU B 1 183 ? 27.270 9.122   105.445 1.00 42.08  ? 180 GLU B CB    1 
ATOM   3269 C CG    . GLU B 1 183 ? 28.589 8.606   105.990 1.00 56.55  ? 180 GLU B CG    1 
ATOM   3270 C CD    . GLU B 1 183 ? 29.710 9.620   105.876 1.00 72.16  ? 180 GLU B CD    1 
ATOM   3271 O OE1   . GLU B 1 183 ? 29.521 10.649  105.194 1.00 71.71  ? 180 GLU B OE1   1 
ATOM   3272 O OE2   . GLU B 1 183 ? 30.783 9.383   106.468 1.00 75.98  ? 180 GLU B OE2   1 
ATOM   3273 N N     . ALA B 1 184 ? 24.662 8.912   103.729 1.00 27.54  ? 181 ALA B N     1 
ATOM   3274 C CA    . ALA B 1 184 ? 23.436 9.493   103.194 1.00 34.89  ? 181 ALA B CA    1 
ATOM   3275 C C     . ALA B 1 184 ? 22.224 8.636   103.540 1.00 27.78  ? 181 ALA B C     1 
ATOM   3276 O O     . ALA B 1 184 ? 21.197 9.148   103.984 1.00 39.94  ? 181 ALA B O     1 
ATOM   3277 C CB    . ALA B 1 184 ? 23.549 9.663   101.683 1.00 26.03  ? 181 ALA B CB    1 
ATOM   3278 N N     . ILE B 1 185 ? 22.350 7.329   103.331 1.00 35.92  ? 182 ILE B N     1 
ATOM   3279 C CA    . ILE B 1 185 ? 21.266 6.399   103.627 1.00 48.18  ? 182 ILE B CA    1 
ATOM   3280 C C     . ILE B 1 185 ? 20.890 6.443   105.104 1.00 40.39  ? 182 ILE B C     1 
ATOM   3281 O O     . ILE B 1 185 ? 19.709 6.449   105.454 1.00 45.96  ? 182 ILE B O     1 
ATOM   3282 C CB    . ILE B 1 185 ? 21.639 4.957   103.239 1.00 42.24  ? 182 ILE B CB    1 
ATOM   3283 C CG1   . ILE B 1 185 ? 21.676 4.808   101.717 1.00 39.59  ? 182 ILE B CG1   1 
ATOM   3284 C CG2   . ILE B 1 185 ? 20.653 3.969   103.841 1.00 41.02  ? 182 ILE B CG2   1 
ATOM   3285 C CD1   . ILE B 1 185 ? 22.084 3.429   101.248 1.00 46.48  ? 182 ILE B CD1   1 
ATOM   3286 N N     . ALA B 1 186 ? 21.903 6.475   105.964 1.00 36.22  ? 183 ALA B N     1 
ATOM   3287 C CA    . ALA B 1 186 ? 21.693 6.515   107.406 1.00 37.60  ? 183 ALA B CA    1 
ATOM   3288 C C     . ALA B 1 186 ? 20.938 7.771   107.820 1.00 37.70  ? 183 ALA B C     1 
ATOM   3289 O O     . ALA B 1 186 ? 20.016 7.712   108.636 1.00 40.29  ? 183 ALA B O     1 
ATOM   3290 C CB    . ALA B 1 186 ? 23.025 6.433   108.135 1.00 34.14  ? 183 ALA B CB    1 
ATOM   3291 N N     . PHE B 1 187 ? 21.337 8.907   107.257 1.00 28.97  ? 184 PHE B N     1 
ATOM   3292 C CA    . PHE B 1 187 ? 20.684 10.175  107.556 1.00 30.26  ? 184 PHE B CA    1 
ATOM   3293 C C     . PHE B 1 187 ? 19.223 10.160  107.132 1.00 28.87  ? 184 PHE B C     1 
ATOM   3294 O O     . PHE B 1 187 ? 18.339 10.510  107.912 1.00 43.68  ? 184 PHE B O     1 
ATOM   3295 C CB    . PHE B 1 187 ? 21.405 11.332  106.864 1.00 32.69  ? 184 PHE B CB    1 
ATOM   3296 C CG    . PHE B 1 187 ? 20.644 12.625  106.905 1.00 35.03  ? 184 PHE B CG    1 
ATOM   3297 C CD1   . PHE B 1 187 ? 20.422 13.272  108.109 1.00 31.73  ? 184 PHE B CD1   1 
ATOM   3298 C CD2   . PHE B 1 187 ? 20.147 13.191  105.743 1.00 30.11  ? 184 PHE B CD2   1 
ATOM   3299 C CE1   . PHE B 1 187 ? 19.720 14.462  108.154 1.00 32.70  ? 184 PHE B CE1   1 
ATOM   3300 C CE2   . PHE B 1 187 ? 19.444 14.382  105.782 1.00 27.51  ? 184 PHE B CE2   1 
ATOM   3301 C CZ    . PHE B 1 187 ? 19.231 15.017  106.989 1.00 28.92  ? 184 PHE B CZ    1 
ATOM   3302 N N     . ILE B 1 188 ? 18.976 9.758   105.890 1.00 31.02  ? 185 ILE B N     1 
ATOM   3303 C CA    . ILE B 1 188 ? 17.619 9.712   105.361 1.00 36.10  ? 185 ILE B CA    1 
ATOM   3304 C C     . ILE B 1 188 ? 16.744 8.788   106.202 1.00 41.06  ? 185 ILE B C     1 
ATOM   3305 O O     . ILE B 1 188 ? 15.599 9.113   106.514 1.00 35.47  ? 185 ILE B O     1 
ATOM   3306 C CB    . ILE B 1 188 ? 17.600 9.241   103.897 1.00 28.81  ? 185 ILE B CB    1 
ATOM   3307 C CG1   . ILE B 1 188 ? 18.341 10.241  103.006 1.00 34.79  ? 185 ILE B CG1   1 
ATOM   3308 C CG2   . ILE B 1 188 ? 16.170 9.057   103.416 1.00 31.53  ? 185 ILE B CG2   1 
ATOM   3309 C CD1   . ILE B 1 188 ? 18.494 9.787   101.572 1.00 30.81  ? 185 ILE B CD1   1 
ATOM   3310 N N     . ARG B 1 189 ? 17.300 7.638   106.569 1.00 40.81  ? 186 ARG B N     1 
ATOM   3311 C CA    . ARG B 1 189 ? 16.592 6.656   107.381 1.00 34.52  ? 186 ARG B CA    1 
ATOM   3312 C C     . ARG B 1 189 ? 16.180 7.219   108.737 1.00 39.98  ? 186 ARG B C     1 
ATOM   3313 O O     . ARG B 1 189 ? 15.009 7.171   109.112 1.00 39.37  ? 186 ARG B O     1 
ATOM   3314 C CB    . ARG B 1 189 ? 17.464 5.414   107.585 1.00 42.46  ? 186 ARG B CB    1 
ATOM   3315 C CG    . ARG B 1 189 ? 16.822 4.345   108.456 1.00 58.39  ? 186 ARG B CG    1 
ATOM   3316 C CD    . ARG B 1 189 ? 17.788 3.208   108.771 1.00 65.35  ? 186 ARG B CD    1 
ATOM   3317 N NE    . ARG B 1 189 ? 18.836 3.611   109.705 1.00 77.55  ? 186 ARG B NE    1 
ATOM   3318 C CZ    . ARG B 1 189 ? 20.115 3.762   109.377 1.00 78.56  ? 186 ARG B CZ    1 
ATOM   3319 N NH1   . ARG B 1 189 ? 20.514 3.535   108.132 1.00 94.18  ? 186 ARG B NH1   1 
ATOM   3320 N NH2   . ARG B 1 189 ? 20.998 4.133   110.294 1.00 51.38  ? 186 ARG B NH2   1 
ATOM   3321 N N     . ASP B 1 190 ? 17.155 7.754   109.463 1.00 38.35  ? 187 ASP B N     1 
ATOM   3322 C CA    . ASP B 1 190 ? 16.945 8.193   110.840 1.00 47.84  ? 187 ASP B CA    1 
ATOM   3323 C C     . ASP B 1 190 ? 16.276 9.562   110.932 1.00 43.60  ? 187 ASP B C     1 
ATOM   3324 O O     . ASP B 1 190 ? 15.939 10.022  112.023 1.00 47.32  ? 187 ASP B O     1 
ATOM   3325 C CB    . ASP B 1 190 ? 18.271 8.207   111.604 1.00 36.30  ? 187 ASP B CB    1 
ATOM   3326 C CG    . ASP B 1 190 ? 18.931 6.843   111.639 1.00 53.61  ? 187 ASP B CG    1 
ATOM   3327 O OD1   . ASP B 1 190 ? 18.211 5.829   111.492 1.00 52.63  ? 187 ASP B OD1   1 
ATOM   3328 O OD2   . ASP B 1 190 ? 20.168 6.782   111.813 1.00 46.56  ? 187 ASP B OD2   1 
ATOM   3329 N N     . SER B 1 191 ? 16.079 10.207  109.787 1.00 38.83  ? 188 SER B N     1 
ATOM   3330 C CA    . SER B 1 191 ? 15.491 11.543  109.758 1.00 44.68  ? 188 SER B CA    1 
ATOM   3331 C C     . SER B 1 191 ? 13.976 11.488  109.598 1.00 50.07  ? 188 SER B C     1 
ATOM   3332 O O     . SER B 1 191 ? 13.294 12.503  109.730 1.00 44.29  ? 188 SER B O     1 
ATOM   3333 C CB    . SER B 1 191 ? 16.110 12.377  108.636 1.00 49.71  ? 188 SER B CB    1 
ATOM   3334 O OG    . SER B 1 191 ? 15.751 13.739  108.760 1.00 67.33  ? 188 SER B OG    1 
ATOM   3335 N N     . GLY B 1 192 ? 13.456 10.298  109.312 1.00 30.18  ? 189 GLY B N     1 
ATOM   3336 C CA    . GLY B 1 192 ? 12.027 10.112  109.148 1.00 31.05  ? 189 GLY B CA    1 
ATOM   3337 C C     . GLY B 1 192 ? 11.537 10.391  107.741 1.00 46.71  ? 189 GLY B C     1 
ATOM   3338 O O     . GLY B 1 192 ? 10.334 10.379  107.484 1.00 56.03  ? 189 GLY B O     1 
ATOM   3339 N N     . MET B 1 193 ? 12.467 10.642  106.825 1.00 31.38  ? 190 MET B N     1 
ATOM   3340 C CA    . MET B 1 193 ? 12.109 10.918  105.439 1.00 35.70  ? 190 MET B CA    1 
ATOM   3341 C C     . MET B 1 193 ? 11.839 9.632   104.664 1.00 35.48  ? 190 MET B C     1 
ATOM   3342 O O     . MET B 1 193 ? 12.374 8.574   104.995 1.00 38.54  ? 190 MET B O     1 
ATOM   3343 C CB    . MET B 1 193 ? 13.208 11.729  104.749 1.00 26.36  ? 190 MET B CB    1 
ATOM   3344 C CG    . MET B 1 193 ? 13.366 13.139  105.289 1.00 41.64  ? 190 MET B CG    1 
ATOM   3345 S SD    . MET B 1 193 ? 14.560 14.114  104.356 1.00 45.46  ? 190 MET B SD    1 
ATOM   3346 C CE    . MET B 1 193 ? 16.062 13.187  104.651 1.00 34.87  ? 190 MET B CE    1 
ATOM   3347 N N     . GLN B 1 194 ? 11.005 9.732   103.633 1.00 35.90  ? 191 GLN B N     1 
ATOM   3348 C CA    . GLN B 1 194 ? 10.684 8.586   102.789 1.00 33.07  ? 191 GLN B CA    1 
ATOM   3349 C C     . GLN B 1 194 ? 11.486 8.618   101.492 1.00 41.38  ? 191 GLN B C     1 
ATOM   3350 O O     . GLN B 1 194 ? 11.249 9.460   100.626 1.00 41.14  ? 191 GLN B O     1 
ATOM   3351 C CB    . GLN B 1 194 ? 9.183  8.544   102.486 1.00 28.60  ? 191 GLN B CB    1 
ATOM   3352 C CG    . GLN B 1 194 ? 8.762  7.416   101.556 1.00 29.39  ? 191 GLN B CG    1 
ATOM   3353 C CD    . GLN B 1 194 ? 7.267  7.399   101.292 1.00 35.16  ? 191 GLN B CD    1 
ATOM   3354 O OE1   . GLN B 1 194 ? 6.543  8.306   101.700 1.00 50.03  ? 191 GLN B OE1   1 
ATOM   3355 N NE2   . GLN B 1 194 ? 6.798  6.363   100.604 1.00 39.05  ? 191 GLN B NE2   1 
ATOM   3356 N N     . LEU B 1 195 ? 12.437 7.698   101.366 1.00 26.69  ? 192 LEU B N     1 
ATOM   3357 C CA    . LEU B 1 195 ? 13.276 7.622   100.176 1.00 34.73  ? 192 LEU B CA    1 
ATOM   3358 C C     . LEU B 1 195 ? 12.469 7.143   98.975  1.00 29.59  ? 192 LEU B C     1 
ATOM   3359 O O     . LEU B 1 195 ? 11.854 6.077   99.013  1.00 34.57  ? 192 LEU B O     1 
ATOM   3360 C CB    . LEU B 1 195 ? 14.468 6.691   100.417 1.00 35.80  ? 192 LEU B CB    1 
ATOM   3361 C CG    . LEU B 1 195 ? 15.480 6.521   99.279  1.00 41.30  ? 192 LEU B CG    1 
ATOM   3362 C CD1   . LEU B 1 195 ? 16.062 7.861   98.860  1.00 35.03  ? 192 LEU B CD1   1 
ATOM   3363 C CD2   . LEU B 1 195 ? 16.587 5.559   99.686  1.00 43.01  ? 192 LEU B CD2   1 
ATOM   3364 N N     . MET B 1 196 ? 12.470 7.942   97.913  1.00 37.40  ? 193 MET B N     1 
ATOM   3365 C CA    . MET B 1 196 ? 11.761 7.593   96.690  1.00 32.22  ? 193 MET B CA    1 
ATOM   3366 C C     . MET B 1 196 ? 12.740 7.503   95.525  1.00 33.50  ? 193 MET B C     1 
ATOM   3367 O O     . MET B 1 196 ? 13.420 8.475   95.199  1.00 31.80  ? 193 MET B O     1 
ATOM   3368 C CB    . MET B 1 196 ? 10.672 8.625   96.393  1.00 38.96  ? 193 MET B CB    1 
ATOM   3369 C CG    . MET B 1 196 ? 9.731  8.885   97.558  1.00 44.14  ? 193 MET B CG    1 
ATOM   3370 S SD    . MET B 1 196 ? 8.655  7.488   97.921  1.00 65.60  ? 193 MET B SD    1 
ATOM   3371 C CE    . MET B 1 196 ? 7.540  7.551   96.522  1.00 50.83  ? 193 MET B CE    1 
ATOM   3372 N N     . THR B 1 197 ? 12.813 6.331   94.904  1.00 36.36  ? 194 THR B N     1 
ATOM   3373 C CA    . THR B 1 197 ? 13.725 6.114   93.788  1.00 36.25  ? 194 THR B CA    1 
ATOM   3374 C C     . THR B 1 197 ? 13.028 6.346   92.455  1.00 36.21  ? 194 THR B C     1 
ATOM   3375 O O     . THR B 1 197 ? 12.155 5.575   92.064  1.00 50.79  ? 194 THR B O     1 
ATOM   3376 C CB    . THR B 1 197 ? 14.289 4.683   93.790  1.00 39.31  ? 194 THR B CB    1 
ATOM   3377 O OG1   . THR B 1 197 ? 14.963 4.431   95.029  1.00 45.91  ? 194 THR B OG1   1 
ATOM   3378 C CG2   . THR B 1 197 ? 15.263 4.496   92.637  1.00 48.32  ? 194 THR B CG2   1 
ATOM   3379 N N     . LEU B 1 198 ? 13.418 7.406   91.755  1.00 35.52  ? 195 LEU B N     1 
ATOM   3380 C CA    . LEU B 1 198 ? 12.833 7.701   90.452  1.00 41.61  ? 195 LEU B CA    1 
ATOM   3381 C C     . LEU B 1 198 ? 13.478 6.876   89.338  1.00 36.07  ? 195 LEU B C     1 
ATOM   3382 O O     . LEU B 1 198 ? 14.696 6.893   89.167  1.00 37.60  ? 195 LEU B O     1 
ATOM   3383 C CB    . LEU B 1 198 ? 12.924 9.197   90.137  1.00 35.02  ? 195 LEU B CB    1 
ATOM   3384 C CG    . LEU B 1 198 ? 11.934 10.087  90.894  1.00 46.12  ? 195 LEU B CG    1 
ATOM   3385 C CD1   . LEU B 1 198 ? 12.524 10.579  92.212  1.00 43.84  ? 195 LEU B CD1   1 
ATOM   3386 C CD2   . LEU B 1 198 ? 11.506 11.259  90.030  1.00 44.52  ? 195 LEU B CD2   1 
ATOM   3387 N N     . LYS B 1 199 ? 12.651 6.149   88.590  1.00 47.25  ? 196 LYS B N     1 
ATOM   3388 C CA    . LYS B 1 199 ? 13.129 5.318   87.489  1.00 47.62  ? 196 LYS B CA    1 
ATOM   3389 C C     . LYS B 1 199 ? 12.062 5.190   86.404  1.00 48.98  ? 196 LYS B C     1 
ATOM   3390 O O     . LYS B 1 199 ? 10.870 5.127   86.700  1.00 51.48  ? 196 LYS B O     1 
ATOM   3391 C CB    . LYS B 1 199 ? 13.506 3.923   87.994  1.00 48.51  ? 196 LYS B CB    1 
ATOM   3392 C CG    . LYS B 1 199 ? 14.754 3.307   87.357  1.00 73.65  ? 196 LYS B CG    1 
ATOM   3393 C CD    . LYS B 1 199 ? 14.884 3.594   85.864  1.00 76.84  ? 196 LYS B CD    1 
ATOM   3394 C CE    . LYS B 1 199 ? 15.702 4.858   85.600  1.00 65.20  ? 196 LYS B CE    1 
ATOM   3395 N NZ    . LYS B 1 199 ? 15.620 5.315   84.186  1.00 38.52  ? 196 LYS B NZ    1 
ATOM   3396 N N     . ALA B 1 200 ? 12.503 5.144   85.150  1.00 63.78  ? 197 ALA B N     1 
ATOM   3397 C CA    . ALA B 1 200 ? 11.608 4.985   84.007  1.00 57.57  ? 197 ALA B CA    1 
ATOM   3398 C C     . ALA B 1 200 ? 10.656 3.803   84.174  1.00 49.57  ? 197 ALA B C     1 
ATOM   3399 O O     . ALA B 1 200 ? 9.511  3.852   83.725  1.00 59.05  ? 197 ALA B O     1 
ATOM   3400 C CB    . ALA B 1 200 ? 12.415 4.835   82.725  1.00 52.39  ? 197 ALA B CB    1 
ATOM   3401 N N     . ASP B 1 201 ? 11.133 2.739   84.813  1.00 47.75  ? 198 ASP B N     1 
ATOM   3402 C CA    . ASP B 1 201 ? 10.307 1.555   85.033  1.00 54.20  ? 198 ASP B CA    1 
ATOM   3403 C C     . ASP B 1 201 ? 9.874  1.434   86.491  1.00 53.78  ? 198 ASP B C     1 
ATOM   3404 O O     . ASP B 1 201 ? 9.815  0.337   87.048  1.00 60.79  ? 198 ASP B O     1 
ATOM   3405 C CB    . ASP B 1 201 ? 11.034 0.285   84.581  1.00 65.00  ? 198 ASP B CB    1 
ATOM   3406 C CG    . ASP B 1 201 ? 12.321 0.040   85.347  1.00 66.75  ? 198 ASP B CG    1 
ATOM   3407 O OD1   . ASP B 1 201 ? 12.780 0.952   86.065  1.00 52.56  ? 198 ASP B OD1   1 
ATOM   3408 O OD2   . ASP B 1 201 ? 12.879 -1.070  85.225  1.00 80.23  ? 198 ASP B OD2   1 
ATOM   3409 N N     . GLY B 1 202 ? 9.565  2.574   87.101  1.00 49.53  ? 199 GLY B N     1 
ATOM   3410 C CA    . GLY B 1 202 ? 9.119  2.606   88.481  1.00 56.81  ? 199 GLY B CA    1 
ATOM   3411 C C     . GLY B 1 202 ? 7.694  2.118   88.639  1.00 51.44  ? 199 GLY B C     1 
ATOM   3412 O O     . GLY B 1 202 ? 6.919  2.137   87.688  1.00 58.42  ? 199 GLY B O     1 
ATOM   3413 N N     . ASP B 1 203 ? 7.352  1.687   89.848  1.00 47.83  ? 200 ASP B N     1 
ATOM   3414 C CA    . ASP B 1 203 ? 6.024  1.166   90.133  1.00 59.17  ? 200 ASP B CA    1 
ATOM   3415 C C     . ASP B 1 203 ? 4.985  2.277   90.175  1.00 64.14  ? 200 ASP B C     1 
ATOM   3416 O O     . ASP B 1 203 ? 3.865  2.110   89.695  1.00 61.43  ? 200 ASP B O     1 
ATOM   3417 C CB    . ASP B 1 203 ? 6.032  0.412   91.463  1.00 40.62  ? 200 ASP B CB    1 
ATOM   3418 C CG    . ASP B 1 203 ? 7.085  -0.679  91.507  1.00 68.01  ? 200 ASP B CG    1 
ATOM   3419 O OD1   . ASP B 1 203 ? 7.462  -1.190  90.427  1.00 74.23  ? 200 ASP B OD1   1 
ATOM   3420 O OD2   . ASP B 1 203 ? 7.535  -1.022  92.623  1.00 60.75  ? 200 ASP B OD2   1 
ATOM   3421 N N     . ILE B 1 204 ? 5.366  3.412   90.749  1.00 55.11  ? 201 ILE B N     1 
ATOM   3422 C CA    . ILE B 1 204 ? 4.430  4.500   90.986  1.00 42.94  ? 201 ILE B CA    1 
ATOM   3423 C C     . ILE B 1 204 ? 4.601  5.631   89.979  1.00 47.57  ? 201 ILE B C     1 
ATOM   3424 O O     . ILE B 1 204 ? 5.721  6.006   89.634  1.00 52.90  ? 201 ILE B O     1 
ATOM   3425 C CB    . ILE B 1 204 ? 4.592  5.065   92.412  1.00 55.07  ? 201 ILE B CB    1 
ATOM   3426 C CG1   . ILE B 1 204 ? 4.555  3.931   93.438  1.00 54.02  ? 201 ILE B CG1   1 
ATOM   3427 C CG2   . ILE B 1 204 ? 3.516  6.097   92.706  1.00 62.28  ? 201 ILE B CG2   1 
ATOM   3428 C CD1   . ILE B 1 204 ? 3.311  3.072   93.343  1.00 56.20  ? 201 ILE B CD1   1 
ATOM   3429 N N     . SER B 1 205 ? 3.481  6.174   89.516  1.00 41.07  ? 202 SER B N     1 
ATOM   3430 C CA    . SER B 1 205 ? 3.507  7.326   88.626  1.00 35.12  ? 202 SER B CA    1 
ATOM   3431 C C     . SER B 1 205 ? 3.947  8.573   89.383  1.00 42.07  ? 202 SER B C     1 
ATOM   3432 O O     . SER B 1 205 ? 3.560  8.778   90.532  1.00 34.46  ? 202 SER B O     1 
ATOM   3433 C CB    . SER B 1 205 ? 2.130  7.553   88.000  1.00 36.84  ? 202 SER B CB    1 
ATOM   3434 O OG    . SER B 1 205 ? 2.094  8.776   87.279  1.00 65.13  ? 202 SER B OG    1 
ATOM   3435 N N     . VAL B 1 206 ? 4.761  9.400   88.735  1.00 37.33  ? 203 VAL B N     1 
ATOM   3436 C CA    . VAL B 1 206 ? 5.247  10.633  89.343  1.00 37.64  ? 203 VAL B CA    1 
ATOM   3437 C C     . VAL B 1 206 ? 4.092  11.580  89.651  1.00 36.20  ? 203 VAL B C     1 
ATOM   3438 O O     . VAL B 1 206 ? 4.218  12.483  90.477  1.00 37.16  ? 203 VAL B O     1 
ATOM   3439 C CB    . VAL B 1 206 ? 6.252  11.352  88.426  1.00 34.26  ? 203 VAL B CB    1 
ATOM   3440 C CG1   . VAL B 1 206 ? 5.556  11.861  87.171  1.00 30.89  ? 203 VAL B CG1   1 
ATOM   3441 C CG2   . VAL B 1 206 ? 6.921  12.495  89.167  1.00 33.30  ? 203 VAL B CG2   1 
ATOM   3442 N N     . LYS B 1 207 ? 2.965  11.364  88.981  1.00 42.29  ? 204 LYS B N     1 
ATOM   3443 C CA    . LYS B 1 207 ? 1.798  12.219  89.146  1.00 47.79  ? 204 LYS B CA    1 
ATOM   3444 C C     . LYS B 1 207 ? 1.154  12.004  90.508  1.00 50.38  ? 204 LYS B C     1 
ATOM   3445 O O     . LYS B 1 207 ? 0.313  12.793  90.939  1.00 52.38  ? 204 LYS B O     1 
ATOM   3446 C CB    . LYS B 1 207 ? 0.778  11.935  88.044  1.00 57.07  ? 204 LYS B CB    1 
ATOM   3447 C CG    . LYS B 1 207 ? -0.062 13.134  87.657  1.00 65.73  ? 204 LYS B CG    1 
ATOM   3448 C CD    . LYS B 1 207 ? 0.779  14.151  86.910  1.00 61.87  ? 204 LYS B CD    1 
ATOM   3449 C CE    . LYS B 1 207 ? -0.045 15.347  86.473  1.00 65.39  ? 204 LYS B CE    1 
ATOM   3450 N NZ    . LYS B 1 207 ? 0.791  16.340  85.743  1.00 53.36  ? 204 LYS B NZ    1 
ATOM   3451 N N     . GLU B 1 208 ? 1.554  10.933  91.184  1.00 48.67  ? 205 GLU B N     1 
ATOM   3452 C CA    . GLU B 1 208 ? 0.970  10.585  92.473  1.00 47.14  ? 205 GLU B CA    1 
ATOM   3453 C C     . GLU B 1 208 ? 1.779  11.146  93.638  1.00 39.84  ? 205 GLU B C     1 
ATOM   3454 O O     . GLU B 1 208 ? 1.398  10.987  94.797  1.00 37.13  ? 205 GLU B O     1 
ATOM   3455 C CB    . GLU B 1 208 ? 0.838  9.066   92.607  1.00 39.23  ? 205 GLU B CB    1 
ATOM   3456 C CG    . GLU B 1 208 ? 0.001  8.418   91.515  1.00 57.85  ? 205 GLU B CG    1 
ATOM   3457 C CD    . GLU B 1 208 ? 0.007  6.904   91.596  1.00 65.69  ? 205 GLU B CD    1 
ATOM   3458 O OE1   . GLU B 1 208 ? 0.435  6.364   92.638  1.00 61.43  ? 205 GLU B OE1   1 
ATOM   3459 O OE2   . GLU B 1 208 ? -0.415 6.253   90.616  1.00 69.09  ? 205 GLU B OE2   1 
ATOM   3460 N N     . LEU B 1 209 ? 2.891  11.806  93.329  1.00 41.30  ? 206 LEU B N     1 
ATOM   3461 C CA    . LEU B 1 209 ? 3.762  12.358  94.363  1.00 39.45  ? 206 LEU B CA    1 
ATOM   3462 C C     . LEU B 1 209 ? 3.080  13.466  95.160  1.00 38.05  ? 206 LEU B C     1 
ATOM   3463 O O     . LEU B 1 209 ? 3.338  13.635  96.351  1.00 32.89  ? 206 LEU B O     1 
ATOM   3464 C CB    . LEU B 1 209 ? 5.065  12.883  93.756  1.00 35.68  ? 206 LEU B CB    1 
ATOM   3465 C CG    . LEU B 1 209 ? 6.077  11.850  93.255  1.00 42.28  ? 206 LEU B CG    1 
ATOM   3466 C CD1   . LEU B 1 209 ? 7.293  12.549  92.666  1.00 29.76  ? 206 LEU B CD1   1 
ATOM   3467 C CD2   . LEU B 1 209 ? 6.491  10.906  94.375  1.00 36.30  ? 206 LEU B CD2   1 
ATOM   3468 N N     . GLY B 1 210 ? 2.211  14.221  94.496  1.00 32.01  ? 207 GLY B N     1 
ATOM   3469 C CA    . GLY B 1 210 ? 1.526  15.331  95.134  1.00 40.57  ? 207 GLY B CA    1 
ATOM   3470 C C     . GLY B 1 210 ? 0.630  14.901  96.279  1.00 45.87  ? 207 GLY B C     1 
ATOM   3471 O O     . GLY B 1 210 ? 0.281  15.705  97.142  1.00 59.22  ? 207 GLY B O     1 
ATOM   3472 N N     . ASP B 1 211 ? 0.260  13.625  96.287  1.00 45.23  ? 208 ASP B N     1 
ATOM   3473 C CA    . ASP B 1 211 ? -0.624 13.087  97.317  1.00 48.80  ? 208 ASP B CA    1 
ATOM   3474 C C     . ASP B 1 211 ? 0.129  12.744  98.602  1.00 40.98  ? 208 ASP B C     1 
ATOM   3475 O O     . ASP B 1 211 ? -0.468 12.655  99.674  1.00 39.71  ? 208 ASP B O     1 
ATOM   3476 C CB    . ASP B 1 211 ? -1.357 11.848  96.795  1.00 64.32  ? 208 ASP B CB    1 
ATOM   3477 C CG    . ASP B 1 211 ? -2.162 12.130  95.540  1.00 82.47  ? 208 ASP B CG    1 
ATOM   3478 O OD1   . ASP B 1 211 ? -2.637 13.275  95.379  1.00 87.85  ? 208 ASP B OD1   1 
ATOM   3479 O OD2   . ASP B 1 211 ? -2.322 11.206  94.714  1.00 84.79  ? 208 ASP B OD2   1 
ATOM   3480 N N     . ASN B 1 212 ? 1.439  12.554  98.487  1.00 38.25  ? 209 ASN B N     1 
ATOM   3481 C CA    . ASN B 1 212 ? 2.258  12.133  99.620  1.00 33.56  ? 209 ASN B CA    1 
ATOM   3482 C C     . ASN B 1 212 ? 2.472  13.252  100.641 1.00 33.65  ? 209 ASN B C     1 
ATOM   3483 O O     . ASN B 1 212 ? 3.014  14.305  100.310 1.00 51.91  ? 209 ASN B O     1 
ATOM   3484 C CB    . ASN B 1 212 ? 3.602  11.596  99.125  1.00 35.78  ? 209 ASN B CB    1 
ATOM   3485 C CG    . ASN B 1 212 ? 4.266  10.671  100.125 1.00 42.96  ? 209 ASN B CG    1 
ATOM   3486 O OD1   . ASN B 1 212 ? 4.158  10.863  101.335 1.00 47.27  ? 209 ASN B OD1   1 
ATOM   3487 N ND2   . ASN B 1 212 ? 4.961  9.659   99.620  1.00 35.75  ? 209 ASN B ND2   1 
ATOM   3488 N N     . PRO B 1 213 ? 2.041  13.021  101.891 1.00 40.85  ? 210 PRO B N     1 
ATOM   3489 C CA    . PRO B 1 213 ? 2.126  14.025  102.958 1.00 38.26  ? 210 PRO B CA    1 
ATOM   3490 C C     . PRO B 1 213 ? 3.480  14.048  103.664 1.00 39.75  ? 210 PRO B C     1 
ATOM   3491 O O     . PRO B 1 213 ? 3.740  14.951  104.458 1.00 41.59  ? 210 PRO B O     1 
ATOM   3492 C CB    . PRO B 1 213 ? 1.045  13.572  103.939 1.00 38.57  ? 210 PRO B CB    1 
ATOM   3493 C CG    . PRO B 1 213 ? 0.958  12.096  103.751 1.00 38.60  ? 210 PRO B CG    1 
ATOM   3494 C CD    . PRO B 1 213 ? 1.386  11.780  102.342 1.00 42.82  ? 210 PRO B CD    1 
ATOM   3495 N N     . ASP B 1 214 ? 4.329  13.068  103.377 1.00 34.05  ? 211 ASP B N     1 
ATOM   3496 C CA    . ASP B 1 214 ? 5.617  12.960  104.051 1.00 33.29  ? 211 ASP B CA    1 
ATOM   3497 C C     . ASP B 1 214 ? 6.701  13.787  103.368 1.00 36.09  ? 211 ASP B C     1 
ATOM   3498 O O     . ASP B 1 214 ? 6.594  14.122  102.189 1.00 33.61  ? 211 ASP B O     1 
ATOM   3499 C CB    . ASP B 1 214 ? 6.058  11.497  104.128 1.00 31.40  ? 211 ASP B CB    1 
ATOM   3500 C CG    . ASP B 1 214 ? 5.130  10.652  104.974 1.00 46.85  ? 211 ASP B CG    1 
ATOM   3501 O OD1   . ASP B 1 214 ? 4.723  11.119  106.058 1.00 54.66  ? 211 ASP B OD1   1 
ATOM   3502 O OD2   . ASP B 1 214 ? 4.813  9.519   104.556 1.00 52.08  ? 211 ASP B OD2   1 
ATOM   3503 N N     . ARG B 1 215 ? 7.743  14.118  104.124 1.00 28.88  ? 212 ARG B N     1 
ATOM   3504 C CA    . ARG B 1 215 ? 8.918  14.759  103.555 1.00 39.96  ? 212 ARG B CA    1 
ATOM   3505 C C     . ARG B 1 215 ? 9.699  13.726  102.753 1.00 32.94  ? 212 ARG B C     1 
ATOM   3506 O O     . ARG B 1 215 ? 10.091 12.684  103.279 1.00 41.03  ? 212 ARG B O     1 
ATOM   3507 C CB    . ARG B 1 215 ? 9.799  15.361  104.650 1.00 27.11  ? 212 ARG B CB    1 
ATOM   3508 C CG    . ARG B 1 215 ? 10.994 16.134  104.112 1.00 30.71  ? 212 ARG B CG    1 
ATOM   3509 C CD    . ARG B 1 215 ? 11.796 16.773  105.232 1.00 25.91  ? 212 ARG B CD    1 
ATOM   3510 N NE    . ARG B 1 215 ? 12.865 17.618  104.713 1.00 31.50  ? 212 ARG B NE    1 
ATOM   3511 C CZ    . ARG B 1 215 ? 13.747 18.260  105.471 1.00 40.97  ? 212 ARG B CZ    1 
ATOM   3512 N NH1   . ARG B 1 215 ? 13.691 18.154  106.791 1.00 38.70  ? 212 ARG B NH1   1 
ATOM   3513 N NH2   . ARG B 1 215 ? 14.685 19.008  104.908 1.00 43.19  ? 212 ARG B NH2   1 
ATOM   3514 N N     . LEU B 1 216 ? 9.919  14.017  101.477 1.00 30.55  ? 213 LEU B N     1 
ATOM   3515 C CA    . LEU B 1 216 ? 10.496 13.041  100.561 1.00 24.21  ? 213 LEU B CA    1 
ATOM   3516 C C     . LEU B 1 216 ? 11.977 13.258  100.283 1.00 36.18  ? 213 LEU B C     1 
ATOM   3517 O O     . LEU B 1 216 ? 12.450 14.391  100.208 1.00 41.09  ? 213 LEU B O     1 
ATOM   3518 C CB    . LEU B 1 216 ? 9.721  13.035  99.241  1.00 32.77  ? 213 LEU B CB    1 
ATOM   3519 C CG    . LEU B 1 216 ? 8.571  12.032  99.117  1.00 36.92  ? 213 LEU B CG    1 
ATOM   3520 C CD1   . LEU B 1 216 ? 7.811  11.884  100.428 1.00 32.81  ? 213 LEU B CD1   1 
ATOM   3521 C CD2   . LEU B 1 216 ? 7.636  12.431  97.984  1.00 36.22  ? 213 LEU B CD2   1 
ATOM   3522 N N     . ALA B 1 217 ? 12.700 12.153  100.139 1.00 25.48  ? 214 ALA B N     1 
ATOM   3523 C CA    . ALA B 1 217 ? 14.061 12.182  99.624  1.00 22.37  ? 214 ALA B CA    1 
ATOM   3524 C C     . ALA B 1 217 ? 14.055 11.578  98.224  1.00 22.31  ? 214 ALA B C     1 
ATOM   3525 O O     . ALA B 1 217 ? 13.997 10.359  98.065  1.00 33.09  ? 214 ALA B O     1 
ATOM   3526 C CB    . ALA B 1 217 ? 14.997 11.409  100.537 1.00 22.54  ? 214 ALA B CB    1 
ATOM   3527 N N     . LEU B 1 218 ? 14.097 12.438  97.212  1.00 22.61  ? 215 LEU B N     1 
ATOM   3528 C CA    . LEU B 1 218 ? 14.023 11.999  95.822  1.00 29.35  ? 215 LEU B CA    1 
ATOM   3529 C C     . LEU B 1 218 ? 15.397 11.592  95.295  1.00 24.79  ? 215 LEU B C     1 
ATOM   3530 O O     . LEU B 1 218 ? 16.309 12.414  95.212  1.00 23.33  ? 215 LEU B O     1 
ATOM   3531 C CB    . LEU B 1 218 ? 13.422 13.103  94.949  1.00 33.29  ? 215 LEU B CB    1 
ATOM   3532 C CG    . LEU B 1 218 ? 12.093 13.680  95.446  1.00 30.01  ? 215 LEU B CG    1 
ATOM   3533 C CD1   . LEU B 1 218 ? 11.685 14.902  94.635  1.00 27.68  ? 215 LEU B CD1   1 
ATOM   3534 C CD2   . LEU B 1 218 ? 11.004 12.619  95.415  1.00 23.10  ? 215 LEU B CD2   1 
ATOM   3535 N N     . LEU B 1 219 ? 15.530 10.320  94.933  1.00 27.06  ? 216 LEU B N     1 
ATOM   3536 C CA    . LEU B 1 219 ? 16.816 9.757   94.532  1.00 34.19  ? 216 LEU B CA    1 
ATOM   3537 C C     . LEU B 1 219 ? 16.949 9.616   93.018  1.00 36.30  ? 216 LEU B C     1 
ATOM   3538 O O     . LEU B 1 219 ? 16.095 9.018   92.362  1.00 31.30  ? 216 LEU B O     1 
ATOM   3539 C CB    . LEU B 1 219 ? 17.023 8.396   95.204  1.00 33.47  ? 216 LEU B CB    1 
ATOM   3540 C CG    . LEU B 1 219 ? 18.319 7.645   94.897  1.00 41.34  ? 216 LEU B CG    1 
ATOM   3541 C CD1   . LEU B 1 219 ? 19.532 8.467   95.303  1.00 35.03  ? 216 LEU B CD1   1 
ATOM   3542 C CD2   . LEU B 1 219 ? 18.325 6.295   95.595  1.00 43.84  ? 216 LEU B CD2   1 
ATOM   3543 N N     . PHE B 1 220 ? 18.031 10.165  92.473  1.00 29.48  ? 217 PHE B N     1 
ATOM   3544 C CA    . PHE B 1 220 ? 18.312 10.079  91.043  1.00 36.25  ? 217 PHE B CA    1 
ATOM   3545 C C     . PHE B 1 220 ? 19.688 9.465   90.788  1.00 34.11  ? 217 PHE B C     1 
ATOM   3546 O O     . PHE B 1 220 ? 20.591 9.577   91.618  1.00 30.84  ? 217 PHE B O     1 
ATOM   3547 C CB    . PHE B 1 220 ? 18.246 11.466  90.400  1.00 31.54  ? 217 PHE B CB    1 
ATOM   3548 C CG    . PHE B 1 220 ? 16.916 12.147  90.556  1.00 31.91  ? 217 PHE B CG    1 
ATOM   3549 C CD1   . PHE B 1 220 ? 15.973 12.099  89.541  1.00 24.20  ? 217 PHE B CD1   1 
ATOM   3550 C CD2   . PHE B 1 220 ? 16.610 12.840  91.716  1.00 22.40  ? 217 PHE B CD2   1 
ATOM   3551 C CE1   . PHE B 1 220 ? 14.750 12.727  89.680  1.00 28.32  ? 217 PHE B CE1   1 
ATOM   3552 C CE2   . PHE B 1 220 ? 15.389 13.469  91.862  1.00 22.06  ? 217 PHE B CE2   1 
ATOM   3553 C CZ    . PHE B 1 220 ? 14.457 13.413  90.842  1.00 31.13  ? 217 PHE B CZ    1 
ATOM   3554 N N     . GLY B 1 221 ? 19.841 8.820   89.635  1.00 30.67  ? 218 GLY B N     1 
ATOM   3555 C CA    . GLY B 1 221 ? 21.119 8.258   89.235  1.00 34.21  ? 218 GLY B CA    1 
ATOM   3556 C C     . GLY B 1 221 ? 21.686 8.977   88.024  1.00 47.93  ? 218 GLY B C     1 
ATOM   3557 O O     . GLY B 1 221 ? 21.207 10.048  87.651  1.00 40.89  ? 218 GLY B O     1 
ATOM   3558 N N     . SER B 1 222 ? 22.709 8.391   87.408  1.00 62.99  ? 219 SER B N     1 
ATOM   3559 C CA    . SER B 1 222 ? 23.323 8.980   86.221  1.00 63.06  ? 219 SER B CA    1 
ATOM   3560 C C     . SER B 1 222 ? 23.085 8.114   84.988  1.00 68.33  ? 219 SER B C     1 
ATOM   3561 O O     . SER B 1 222 ? 23.137 8.596   83.855  1.00 70.12  ? 219 SER B O     1 
ATOM   3562 C CB    . SER B 1 222 ? 24.822 9.195   86.440  1.00 65.25  ? 219 SER B CB    1 
ATOM   3563 O OG    . SER B 1 222 ? 25.467 7.985   86.800  1.00 67.46  ? 219 SER B OG    1 
ATOM   3564 N N     . GLU B 1 223 ? 22.829 6.831   85.221  1.00 73.09  ? 220 GLU B N     1 
ATOM   3565 C CA    . GLU B 1 223 ? 22.517 5.894   84.149  1.00 81.50  ? 220 GLU B CA    1 
ATOM   3566 C C     . GLU B 1 223 ? 21.050 5.493   84.241  1.00 88.68  ? 220 GLU B C     1 
ATOM   3567 O O     . GLU B 1 223 ? 20.434 5.628   85.297  1.00 93.79  ? 220 GLU B O     1 
ATOM   3568 C CB    . GLU B 1 223 ? 23.401 4.651   84.259  1.00 79.95  ? 220 GLU B CB    1 
ATOM   3569 C CG    . GLU B 1 223 ? 24.854 4.946   84.596  1.00 87.37  ? 220 GLU B CG    1 
ATOM   3570 C CD    . GLU B 1 223 ? 25.534 5.805   83.549  1.00 92.87  ? 220 GLU B CD    1 
ATOM   3571 O OE1   . GLU B 1 223 ? 25.066 5.816   82.391  1.00 90.50  ? 220 GLU B OE1   1 
ATOM   3572 O OE2   . GLU B 1 223 ? 26.538 6.467   83.883  1.00 93.28  ? 220 GLU B OE2   1 
ATOM   3573 N N     . LYS B 1 224 ? 20.489 5.000   83.140  1.00 88.49  ? 221 LYS B N     1 
ATOM   3574 C CA    . LYS B 1 224 ? 19.091 4.574   83.125  1.00 95.35  ? 221 LYS B CA    1 
ATOM   3575 C C     . LYS B 1 224 ? 18.874 3.394   84.068  1.00 98.57  ? 221 LYS B C     1 
ATOM   3576 O O     . LYS B 1 224 ? 17.741 3.015   84.360  1.00 89.14  ? 221 LYS B O     1 
ATOM   3577 C CB    . LYS B 1 224 ? 18.646 4.211   81.706  1.00 107.88 ? 221 LYS B CB    1 
ATOM   3578 C CG    . LYS B 1 224 ? 17.158 3.932   81.574  1.00 112.36 ? 221 LYS B CG    1 
ATOM   3579 C CD    . LYS B 1 224 ? 16.767 3.658   80.131  1.00 116.12 ? 221 LYS B CD    1 
ATOM   3580 C CE    . LYS B 1 224 ? 17.567 2.506   79.546  1.00 121.29 ? 221 LYS B CE    1 
ATOM   3581 N NZ    . LYS B 1 224 ? 17.444 1.271   80.367  1.00 124.20 ? 221 LYS B NZ    1 
ATOM   3582 N N     . GLY B 1 225 ? 19.974 2.813   84.535  1.00 111.33 ? 222 GLY B N     1 
ATOM   3583 C CA    . GLY B 1 225 ? 19.922 1.750   85.521  1.00 118.85 ? 222 GLY B CA    1 
ATOM   3584 C C     . GLY B 1 225 ? 20.185 2.272   86.917  1.00 116.76 ? 222 GLY B C     1 
ATOM   3585 O O     . GLY B 1 225 ? 19.822 1.639   87.907  1.00 116.43 ? 222 GLY B O     1 
ATOM   3586 N N     . GLY B 1 226 ? 20.812 3.441   86.987  1.00 106.18 ? 223 GLY B N     1 
ATOM   3587 C CA    . GLY B 1 226 ? 21.082 4.093   88.252  1.00 86.23  ? 223 GLY B CA    1 
ATOM   3588 C C     . GLY B 1 226 ? 19.823 4.522   88.966  1.00 69.08  ? 223 GLY B C     1 
ATOM   3589 O O     . GLY B 1 226 ? 18.759 4.560   88.358  1.00 66.71  ? 223 GLY B O     1 
ATOM   3590 N N     . PRO B 1 227 ? 19.939 4.845   90.262  1.00 56.24  ? 224 PRO B N     1 
ATOM   3591 C CA    . PRO B 1 227 ? 21.199 4.801   91.010  1.00 51.98  ? 224 PRO B CA    1 
ATOM   3592 C C     . PRO B 1 227 ? 21.541 3.400   91.515  1.00 57.17  ? 224 PRO B C     1 
ATOM   3593 O O     . PRO B 1 227 ? 20.804 2.447   91.260  1.00 62.34  ? 224 PRO B O     1 
ATOM   3594 C CB    . PRO B 1 227 ? 20.906 5.717   92.189  1.00 52.23  ? 224 PRO B CB    1 
ATOM   3595 C CG    . PRO B 1 227 ? 19.479 5.410   92.495  1.00 52.44  ? 224 PRO B CG    1 
ATOM   3596 C CD    . PRO B 1 227 ? 18.801 5.158   91.144  1.00 49.38  ? 224 PRO B CD    1 
ATOM   3597 N N     . SER B 1 228 ? 22.657 3.292   92.229  1.00 53.04  ? 225 SER B N     1 
ATOM   3598 C CA    . SER B 1 228 ? 23.128 2.021   92.765  1.00 54.18  ? 225 SER B CA    1 
ATOM   3599 C C     . SER B 1 228 ? 21.987 1.188   93.347  1.00 56.45  ? 225 SER B C     1 
ATOM   3600 O O     . SER B 1 228 ? 21.165 1.688   94.118  1.00 63.84  ? 225 SER B O     1 
ATOM   3601 C CB    . SER B 1 228 ? 24.207 2.265   93.824  1.00 55.75  ? 225 SER B CB    1 
ATOM   3602 O OG    . SER B 1 228 ? 24.625 1.048   94.413  1.00 47.70  ? 225 SER B OG    1 
ATOM   3603 N N     . ASP B 1 229 ? 21.935 -0.081  92.958  1.00 58.90  ? 226 ASP B N     1 
ATOM   3604 C CA    . ASP B 1 229 ? 20.917 -0.996  93.459  1.00 66.18  ? 226 ASP B CA    1 
ATOM   3605 C C     . ASP B 1 229 ? 21.039 -1.162  94.968  1.00 55.93  ? 226 ASP B C     1 
ATOM   3606 O O     . ASP B 1 229 ? 20.118 -1.647  95.624  1.00 67.46  ? 226 ASP B O     1 
ATOM   3607 C CB    . ASP B 1 229 ? 21.035 -2.356  92.770  1.00 79.90  ? 226 ASP B CB    1 
ATOM   3608 C CG    . ASP B 1 229 ? 20.809 -2.271  91.274  1.00 89.57  ? 226 ASP B CG    1 
ATOM   3609 O OD1   . ASP B 1 229 ? 21.646 -2.805  90.516  1.00 96.23  ? 226 ASP B OD1   1 
ATOM   3610 O OD2   . ASP B 1 229 ? 19.801 -1.662  90.854  1.00 87.38  ? 226 ASP B OD2   1 
ATOM   3611 N N     . LEU B 1 230 ? 22.182 -0.759  95.511  1.00 43.59  ? 227 LEU B N     1 
ATOM   3612 C CA    . LEU B 1 230 ? 22.418 -0.825  96.946  1.00 56.64  ? 227 LEU B CA    1 
ATOM   3613 C C     . LEU B 1 230 ? 21.492 0.133   97.690  1.00 61.18  ? 227 LEU B C     1 
ATOM   3614 O O     . LEU B 1 230 ? 21.275 -0.006  98.893  1.00 67.96  ? 227 LEU B O     1 
ATOM   3615 C CB    . LEU B 1 230 ? 23.881 -0.506  97.259  1.00 67.50  ? 227 LEU B CB    1 
ATOM   3616 C CG    . LEU B 1 230 ? 24.917 -1.373  96.537  1.00 72.22  ? 227 LEU B CG    1 
ATOM   3617 C CD1   . LEU B 1 230 ? 26.317 -1.085  97.057  1.00 69.39  ? 227 LEU B CD1   1 
ATOM   3618 C CD2   . LEU B 1 230 ? 24.581 -2.849  96.685  1.00 71.03  ? 227 LEU B CD2   1 
ATOM   3619 N N     . PHE B 1 231 ? 20.950 1.108   96.967  1.00 56.33  ? 228 PHE B N     1 
ATOM   3620 C CA    . PHE B 1 231 ? 19.979 2.037   97.537  1.00 53.76  ? 228 PHE B CA    1 
ATOM   3621 C C     . PHE B 1 231 ? 18.616 1.373   97.725  1.00 67.41  ? 228 PHE B C     1 
ATOM   3622 O O     . PHE B 1 231 ? 17.815 1.809   98.553  1.00 56.82  ? 228 PHE B O     1 
ATOM   3623 C CB    . PHE B 1 231 ? 19.830 3.275   96.650  1.00 41.39  ? 228 PHE B CB    1 
ATOM   3624 C CG    . PHE B 1 231 ? 20.721 4.421   97.043  1.00 37.96  ? 228 PHE B CG    1 
ATOM   3625 C CD1   . PHE B 1 231 ? 21.862 4.713   96.314  1.00 39.07  ? 228 PHE B CD1   1 
ATOM   3626 C CD2   . PHE B 1 231 ? 20.408 5.215   98.134  1.00 36.45  ? 228 PHE B CD2   1 
ATOM   3627 C CE1   . PHE B 1 231 ? 22.677 5.773   96.671  1.00 41.45  ? 228 PHE B CE1   1 
ATOM   3628 C CE2   . PHE B 1 231 ? 21.218 6.275   98.496  1.00 39.83  ? 228 PHE B CE2   1 
ATOM   3629 C CZ    . PHE B 1 231 ? 22.354 6.554   97.764  1.00 38.10  ? 228 PHE B CZ    1 
ATOM   3630 N N     . GLU B 1 232 ? 18.358 0.324   96.947  1.00 76.79  ? 229 GLU B N     1 
ATOM   3631 C CA    . GLU B 1 232 ? 17.076 -0.379  96.988  1.00 72.54  ? 229 GLU B CA    1 
ATOM   3632 C C     . GLU B 1 232 ? 16.652 -0.764  98.402  1.00 70.93  ? 229 GLU B C     1 
ATOM   3633 O O     . GLU B 1 232 ? 15.467 -0.731  98.734  1.00 76.53  ? 229 GLU B O     1 
ATOM   3634 C CB    . GLU B 1 232 ? 17.108 -1.618  96.088  1.00 77.95  ? 229 GLU B CB    1 
ATOM   3635 C CG    . GLU B 1 232 ? 16.678 -1.353  94.654  1.00 90.33  ? 229 GLU B CG    1 
ATOM   3636 C CD    . GLU B 1 232 ? 15.190 -1.084  94.539  1.00 97.26  ? 229 GLU B CD    1 
ATOM   3637 O OE1   . GLU B 1 232 ? 14.402 -1.835  95.151  1.00 88.64  ? 229 GLU B OE1   1 
ATOM   3638 O OE2   . GLU B 1 232 ? 14.810 -0.122  93.837  1.00 100.36 ? 229 GLU B OE2   1 
ATOM   3639 N N     . GLU B 1 233 ? 17.624 -1.133  99.229  1.00 73.00  ? 230 GLU B N     1 
ATOM   3640 C CA    . GLU B 1 233 ? 17.351 -1.473  100.620 1.00 81.08  ? 230 GLU B CA    1 
ATOM   3641 C C     . GLU B 1 233 ? 16.596 -0.359  101.335 1.00 74.65  ? 230 GLU B C     1 
ATOM   3642 O O     . GLU B 1 233 ? 15.521 -0.583  101.891 1.00 70.01  ? 230 GLU B O     1 
ATOM   3643 C CB    . GLU B 1 233 ? 18.650 -1.786  101.364 1.00 92.48  ? 230 GLU B CB    1 
ATOM   3644 C CG    . GLU B 1 233 ? 18.887 -3.267  101.592 1.00 105.95 ? 230 GLU B CG    1 
ATOM   3645 C CD    . GLU B 1 233 ? 17.921 -3.855  102.602 1.00 114.67 ? 230 GLU B CD    1 
ATOM   3646 O OE1   . GLU B 1 233 ? 17.130 -3.084  103.188 1.00 117.23 ? 230 GLU B OE1   1 
ATOM   3647 O OE2   . GLU B 1 233 ? 17.952 -5.084  102.815 1.00 113.10 ? 230 GLU B OE2   1 
ATOM   3648 N N     . ALA B 1 234 ? 17.164 0.841   101.315 1.00 62.19  ? 231 ALA B N     1 
ATOM   3649 C CA    . ALA B 1 234 ? 16.553 1.982   101.983 1.00 49.71  ? 231 ALA B CA    1 
ATOM   3650 C C     . ALA B 1 234 ? 15.349 2.506   101.208 1.00 48.43  ? 231 ALA B C     1 
ATOM   3651 O O     . ALA B 1 234 ? 14.462 3.142   101.779 1.00 46.37  ? 231 ALA B O     1 
ATOM   3652 C CB    . ALA B 1 234 ? 17.580 3.088   102.179 1.00 46.43  ? 231 ALA B CB    1 
ATOM   3653 N N     . SER B 1 235 ? 15.323 2.233   99.907  1.00 42.09  ? 232 SER B N     1 
ATOM   3654 C CA    . SER B 1 235 ? 14.270 2.745   99.035  1.00 49.90  ? 232 SER B CA    1 
ATOM   3655 C C     . SER B 1 235 ? 12.889 2.252   99.451  1.00 52.34  ? 232 SER B C     1 
ATOM   3656 O O     . SER B 1 235 ? 12.675 1.054   99.634  1.00 54.52  ? 232 SER B O     1 
ATOM   3657 C CB    . SER B 1 235 ? 14.540 2.368   97.578  1.00 56.04  ? 232 SER B CB    1 
ATOM   3658 O OG    . SER B 1 235 ? 13.519 2.867   96.731  1.00 45.92  ? 232 SER B OG    1 
ATOM   3659 N N     . SER B 1 236 ? 11.958 3.190   99.590  1.00 51.45  ? 233 SER B N     1 
ATOM   3660 C CA    . SER B 1 236 ? 10.594 2.873   99.992  1.00 44.42  ? 233 SER B CA    1 
ATOM   3661 C C     . SER B 1 236 ? 9.714  2.553   98.785  1.00 48.89  ? 233 SER B C     1 
ATOM   3662 O O     . SER B 1 236 ? 8.814  1.718   98.867  1.00 55.80  ? 233 SER B O     1 
ATOM   3663 C CB    . SER B 1 236 ? 9.994  4.034   100.789 1.00 44.63  ? 233 SER B CB    1 
ATOM   3664 O OG    . SER B 1 236 ? 8.620  3.811   101.059 1.00 49.83  ? 233 SER B OG    1 
ATOM   3665 N N     . ALA B 1 237 ? 9.978  3.220   97.666  1.00 43.48  ? 234 ALA B N     1 
ATOM   3666 C CA    . ALA B 1 237 ? 9.209  2.996   96.447  1.00 47.72  ? 234 ALA B CA    1 
ATOM   3667 C C     . ALA B 1 237 ? 9.929  3.530   95.213  1.00 34.43  ? 234 ALA B C     1 
ATOM   3668 O O     . ALA B 1 237 ? 10.783 4.409   95.314  1.00 34.49  ? 234 ALA B O     1 
ATOM   3669 C CB    . ALA B 1 237 ? 7.827  3.626   96.566  1.00 46.95  ? 234 ALA B CB    1 
ATOM   3670 N N     . SER B 1 238 ? 9.578  2.991   94.050  1.00 40.63  ? 235 SER B N     1 
ATOM   3671 C CA    . SER B 1 238 ? 10.131 3.461   92.786  1.00 36.43  ? 235 SER B CA    1 
ATOM   3672 C C     . SER B 1 238 ? 9.103  4.304   92.033  1.00 42.31  ? 235 SER B C     1 
ATOM   3673 O O     . SER B 1 238 ? 7.962  3.884   91.845  1.00 43.59  ? 235 SER B O     1 
ATOM   3674 C CB    . SER B 1 238 ? 10.588 2.281   91.925  1.00 39.99  ? 235 SER B CB    1 
ATOM   3675 O OG    . SER B 1 238 ? 9.526  1.373   91.694  1.00 54.46  ? 235 SER B OG    1 
ATOM   3676 N N     . VAL B 1 239 ? 9.515  5.494   91.607  1.00 47.03  ? 236 VAL B N     1 
ATOM   3677 C CA    . VAL B 1 239 ? 8.622  6.430   90.930  1.00 34.80  ? 236 VAL B CA    1 
ATOM   3678 C C     . VAL B 1 239 ? 9.006  6.606   89.461  1.00 39.03  ? 236 VAL B C     1 
ATOM   3679 O O     . VAL B 1 239 ? 10.177 6.788   89.138  1.00 41.90  ? 236 VAL B O     1 
ATOM   3680 C CB    . VAL B 1 239 ? 8.632  7.800   91.632  1.00 37.30  ? 236 VAL B CB    1 
ATOM   3681 C CG1   . VAL B 1 239 ? 7.731  8.786   90.905  1.00 28.86  ? 236 VAL B CG1   1 
ATOM   3682 C CG2   . VAL B 1 239 ? 8.204  7.648   93.083  1.00 32.89  ? 236 VAL B CG2   1 
ATOM   3683 N N     . SER B 1 240 ? 8.014  6.555   88.576  1.00 32.19  ? 237 SER B N     1 
ATOM   3684 C CA    . SER B 1 240 ? 8.262  6.624   87.139  1.00 34.68  ? 237 SER B CA    1 
ATOM   3685 C C     . SER B 1 240 ? 7.607  7.828   86.468  1.00 42.90  ? 237 SER B C     1 
ATOM   3686 O O     . SER B 1 240 ? 6.476  8.192   86.791  1.00 46.54  ? 237 SER B O     1 
ATOM   3687 C CB    . SER B 1 240 ? 7.780  5.343   86.456  1.00 45.05  ? 237 SER B CB    1 
ATOM   3688 O OG    . SER B 1 240 ? 7.818  5.480   85.046  1.00 57.20  ? 237 SER B OG    1 
ATOM   3689 N N     . ILE B 1 241 ? 8.323  8.436   85.527  1.00 44.27  ? 238 ILE B N     1 
ATOM   3690 C CA    . ILE B 1 241 ? 7.778  9.524   84.722  1.00 32.75  ? 238 ILE B CA    1 
ATOM   3691 C C     . ILE B 1 241 ? 7.296  8.980   83.383  1.00 44.29  ? 238 ILE B C     1 
ATOM   3692 O O     . ILE B 1 241 ? 8.095  8.492   82.584  1.00 50.64  ? 238 ILE B O     1 
ATOM   3693 C CB    . ILE B 1 241 ? 8.821  10.630  84.470  1.00 33.80  ? 238 ILE B CB    1 
ATOM   3694 C CG1   . ILE B 1 241 ? 9.367  11.161  85.797  1.00 29.59  ? 238 ILE B CG1   1 
ATOM   3695 C CG2   . ILE B 1 241 ? 8.217  11.759  83.643  1.00 32.05  ? 238 ILE B CG2   1 
ATOM   3696 C CD1   . ILE B 1 241 ? 10.479 12.173  85.637  1.00 28.58  ? 238 ILE B CD1   1 
ATOM   3697 N N     . PRO B 1 242 ? 5.980  9.057   83.137  1.00 47.56  ? 239 PRO B N     1 
ATOM   3698 C CA    . PRO B 1 242 ? 5.374  8.524   81.913  1.00 45.53  ? 239 PRO B CA    1 
ATOM   3699 C C     . PRO B 1 242 ? 6.016  9.081   80.647  1.00 49.99  ? 239 PRO B C     1 
ATOM   3700 O O     . PRO B 1 242 ? 6.203  10.292  80.523  1.00 48.06  ? 239 PRO B O     1 
ATOM   3701 C CB    . PRO B 1 242 ? 3.918  8.988   82.015  1.00 49.23  ? 239 PRO B CB    1 
ATOM   3702 C CG    . PRO B 1 242 ? 3.678  9.146   83.474  1.00 47.20  ? 239 PRO B CG    1 
ATOM   3703 C CD    . PRO B 1 242 ? 4.975  9.644   84.041  1.00 51.67  ? 239 PRO B CD    1 
ATOM   3704 N N     . MET B 1 243 ? 6.356  8.190   79.722  1.00 57.95  ? 240 MET B N     1 
ATOM   3705 C CA    . MET B 1 243 ? 6.893  8.576   78.424  1.00 55.96  ? 240 MET B CA    1 
ATOM   3706 C C     . MET B 1 243 ? 6.134  7.825   77.337  1.00 49.36  ? 240 MET B C     1 
ATOM   3707 O O     . MET B 1 243 ? 5.271  7.000   77.640  1.00 52.58  ? 240 MET B O     1 
ATOM   3708 C CB    . MET B 1 243 ? 8.387  8.255   78.344  1.00 51.13  ? 240 MET B CB    1 
ATOM   3709 C CG    . MET B 1 243 ? 9.228  8.921   79.425  1.00 53.28  ? 240 MET B CG    1 
ATOM   3710 S SD    . MET B 1 243 ? 10.950 8.376   79.423  1.00 60.85  ? 240 MET B SD    1 
ATOM   3711 C CE    . MET B 1 243 ? 10.760 6.639   79.823  1.00 66.11  ? 240 MET B CE    1 
ATOM   3712 N N     . MET B 1 244 ? 6.446  8.109   76.077  1.00 61.77  ? 241 MET B N     1 
ATOM   3713 C CA    . MET B 1 244 ? 5.821  7.394   74.969  1.00 74.18  ? 241 MET B CA    1 
ATOM   3714 C C     . MET B 1 244 ? 5.931  5.895   75.210  1.00 81.97  ? 241 MET B C     1 
ATOM   3715 O O     . MET B 1 244 ? 4.950  5.159   75.105  1.00 93.39  ? 241 MET B O     1 
ATOM   3716 C CB    . MET B 1 244 ? 6.477  7.772   73.642  1.00 76.74  ? 241 MET B CB    1 
ATOM   3717 C CG    . MET B 1 244 ? 6.359  9.247   73.305  1.00 82.11  ? 241 MET B CG    1 
ATOM   3718 S SD    . MET B 1 244 ? 4.689  9.871   73.572  1.00 105.42 ? 241 MET B SD    1 
ATOM   3719 C CE    . MET B 1 244 ? 3.756  8.830   72.456  1.00 137.02 ? 241 MET B CE    1 
ATOM   3720 N N     . SER B 1 245 ? 7.141  5.455   75.535  1.00 73.44  ? 242 SER B N     1 
ATOM   3721 C CA    . SER B 1 245 ? 7.381  4.096   75.994  1.00 76.30  ? 242 SER B CA    1 
ATOM   3722 C C     . SER B 1 245 ? 8.319  4.178   77.189  1.00 69.56  ? 242 SER B C     1 
ATOM   3723 O O     . SER B 1 245 ? 9.041  5.161   77.346  1.00 60.37  ? 242 SER B O     1 
ATOM   3724 C CB    . SER B 1 245 ? 7.994  3.242   74.882  1.00 81.88  ? 242 SER B CB    1 
ATOM   3725 O OG    . SER B 1 245 ? 9.252  3.753   74.476  1.00 89.98  ? 242 SER B OG    1 
ATOM   3726 N N     . GLN B 1 246 ? 8.305  3.159   78.039  1.00 76.69  ? 243 GLN B N     1 
ATOM   3727 C CA    . GLN B 1 246 ? 9.133  3.183   79.238  1.00 81.12  ? 243 GLN B CA    1 
ATOM   3728 C C     . GLN B 1 246 ? 10.517 2.595   78.983  1.00 87.38  ? 243 GLN B C     1 
ATOM   3729 O O     . GLN B 1 246 ? 11.256 2.292   79.920  1.00 88.24  ? 243 GLN B O     1 
ATOM   3730 C CB    . GLN B 1 246 ? 8.437  2.461   80.393  1.00 84.72  ? 243 GLN B CB    1 
ATOM   3731 C CG    . GLN B 1 246 ? 7.103  3.080   80.780  1.00 86.48  ? 243 GLN B CG    1 
ATOM   3732 C CD    . GLN B 1 246 ? 7.200  4.576   81.020  1.00 79.14  ? 243 GLN B CD    1 
ATOM   3733 O OE1   . GLN B 1 246 ? 8.193  5.069   81.557  1.00 77.14  ? 243 GLN B OE1   1 
ATOM   3734 N NE2   . GLN B 1 246 ? 6.164  5.306   80.624  1.00 61.60  ? 243 GLN B NE2   1 
ATOM   3735 N N     . THR B 1 247 ? 10.862 2.441   77.709  1.00 89.19  ? 244 THR B N     1 
ATOM   3736 C CA    . THR B 1 247 ? 12.180 1.953   77.328  1.00 94.39  ? 244 THR B CA    1 
ATOM   3737 C C     . THR B 1 247 ? 13.120 3.127   77.090  1.00 94.02  ? 244 THR B C     1 
ATOM   3738 O O     . THR B 1 247 ? 14.340 2.966   77.071  1.00 93.46  ? 244 THR B O     1 
ATOM   3739 C CB    . THR B 1 247 ? 12.122 1.092   76.054  1.00 112.87 ? 244 THR B CB    1 
ATOM   3740 O OG1   . THR B 1 247 ? 13.376 0.425   75.866  1.00 123.08 ? 244 THR B OG1   1 
ATOM   3741 C CG2   . THR B 1 247 ? 11.826 1.959   74.840  1.00 112.87 ? 244 THR B CG2   1 
ATOM   3742 N N     . GLU B 1 248 ? 12.541 4.311   76.908  1.00 97.39  ? 245 GLU B N     1 
ATOM   3743 C CA    . GLU B 1 248 ? 13.325 5.523   76.718  1.00 98.12  ? 245 GLU B CA    1 
ATOM   3744 C C     . GLU B 1 248 ? 13.948 5.928   78.044  1.00 92.48  ? 245 GLU B C     1 
ATOM   3745 O O     . GLU B 1 248 ? 14.246 5.085   78.890  1.00 89.99  ? 245 GLU B O     1 
ATOM   3746 C CB    . GLU B 1 248 ? 12.443 6.674   76.229  1.00 100.46 ? 245 GLU B CB    1 
ATOM   3747 C CG    . GLU B 1 248 ? 11.094 6.263   75.669  1.00 108.81 ? 245 GLU B CG    1 
ATOM   3748 C CD    . GLU B 1 248 ? 11.124 6.010   74.179  1.00 119.17 ? 245 GLU B CD    1 
ATOM   3749 O OE1   . GLU B 1 248 ? 12.166 5.549   73.673  1.00 125.33 ? 245 GLU B OE1   1 
ATOM   3750 O OE2   . GLU B 1 248 ? 10.099 6.273   73.514  1.00 119.89 ? 245 GLU B OE2   1 
ATOM   3751 N N     . SER B 1 249 ? 14.127 7.234   78.216  1.00 87.86  ? 246 SER B N     1 
ATOM   3752 C CA    . SER B 1 249 ? 14.616 7.805   79.464  1.00 77.46  ? 246 SER B CA    1 
ATOM   3753 C C     . SER B 1 249 ? 14.779 9.310   79.310  1.00 64.65  ? 246 SER B C     1 
ATOM   3754 O O     . SER B 1 249 ? 14.810 9.830   78.194  1.00 71.94  ? 246 SER B O     1 
ATOM   3755 C CB    . SER B 1 249 ? 15.950 7.178   79.867  1.00 80.26  ? 246 SER B CB    1 
ATOM   3756 O OG    . SER B 1 249 ? 16.976 7.558   78.969  1.00 95.69  ? 246 SER B OG    1 
ATOM   3757 N N     . LEU B 1 250 ? 14.881 10.007  80.435  1.00 51.13  ? 247 LEU B N     1 
ATOM   3758 C CA    . LEU B 1 250 ? 15.046 11.454  80.426  1.00 52.63  ? 247 LEU B CA    1 
ATOM   3759 C C     . LEU B 1 250 ? 16.382 11.854  81.039  1.00 50.06  ? 247 LEU B C     1 
ATOM   3760 O O     . LEU B 1 250 ? 16.962 11.104  81.825  1.00 39.54  ? 247 LEU B O     1 
ATOM   3761 C CB    . LEU B 1 250 ? 13.902 12.126  81.192  1.00 52.36  ? 247 LEU B CB    1 
ATOM   3762 C CG    . LEU B 1 250 ? 12.667 12.573  80.405  1.00 55.29  ? 247 LEU B CG    1 
ATOM   3763 C CD1   . LEU B 1 250 ? 12.408 11.671  79.210  1.00 65.22  ? 247 LEU B CD1   1 
ATOM   3764 C CD2   . LEU B 1 250 ? 11.446 12.639  81.313  1.00 49.89  ? 247 LEU B CD2   1 
ATOM   3765 N N     . ASN B 1 251 ? 16.869 13.032  80.664  1.00 44.94  ? 248 ASN B N     1 
ATOM   3766 C CA    . ASN B 1 251 ? 18.050 13.606  81.293  1.00 40.38  ? 248 ASN B CA    1 
ATOM   3767 C C     . ASN B 1 251 ? 17.773 13.787  82.780  1.00 47.19  ? 248 ASN B C     1 
ATOM   3768 O O     . ASN B 1 251 ? 16.679 14.197  83.164  1.00 43.47  ? 248 ASN B O     1 
ATOM   3769 C CB    . ASN B 1 251 ? 18.402 14.945  80.640  1.00 43.07  ? 248 ASN B CB    1 
ATOM   3770 C CG    . ASN B 1 251 ? 19.691 15.543  81.179  1.00 73.17  ? 248 ASN B CG    1 
ATOM   3771 O OD1   . ASN B 1 251 ? 19.833 15.765  82.381  1.00 79.56  ? 248 ASN B OD1   1 
ATOM   3772 N ND2   . ASN B 1 251 ? 20.633 15.819  80.284  1.00 82.59  ? 248 ASN B ND2   1 
ATOM   3773 N N     . VAL B 1 252 ? 18.759 13.470  83.614  1.00 39.75  ? 249 VAL B N     1 
ATOM   3774 C CA    . VAL B 1 252 ? 18.575 13.507  85.062  1.00 33.28  ? 249 VAL B CA    1 
ATOM   3775 C C     . VAL B 1 252 ? 18.047 14.857  85.550  1.00 30.59  ? 249 VAL B C     1 
ATOM   3776 O O     . VAL B 1 252 ? 17.182 14.913  86.424  1.00 33.71  ? 249 VAL B O     1 
ATOM   3777 C CB    . VAL B 1 252 ? 19.873 13.143  85.816  1.00 28.41  ? 249 VAL B CB    1 
ATOM   3778 C CG1   . VAL B 1 252 ? 21.018 14.046  85.384  1.00 31.41  ? 249 VAL B CG1   1 
ATOM   3779 C CG2   . VAL B 1 252 ? 19.654 13.225  87.320  1.00 26.07  ? 249 VAL B CG2   1 
ATOM   3780 N N     . SER B 1 253 ? 18.562 15.941  84.976  1.00 26.80  ? 250 SER B N     1 
ATOM   3781 C CA    . SER B 1 253 ? 18.123 17.285  85.346  1.00 36.95  ? 250 SER B CA    1 
ATOM   3782 C C     . SER B 1 253 ? 16.675 17.526  84.937  1.00 30.74  ? 250 SER B C     1 
ATOM   3783 O O     . SER B 1 253 ? 15.926 18.205  85.640  1.00 39.34  ? 250 SER B O     1 
ATOM   3784 C CB    . SER B 1 253 ? 19.027 18.342  84.709  1.00 26.69  ? 250 SER B CB    1 
ATOM   3785 O OG    . SER B 1 253 ? 18.945 18.290  83.295  1.00 80.00  ? 250 SER B OG    1 
ATOM   3786 N N     . VAL B 1 254 ? 16.290 16.973  83.792  1.00 30.48  ? 251 VAL B N     1 
ATOM   3787 C CA    . VAL B 1 254 ? 14.917 17.080  83.318  1.00 28.14  ? 251 VAL B CA    1 
ATOM   3788 C C     . VAL B 1 254 ? 13.991 16.250  84.201  1.00 27.39  ? 251 VAL B C     1 
ATOM   3789 O O     . VAL B 1 254 ? 12.897 16.689  84.555  1.00 42.65  ? 251 VAL B O     1 
ATOM   3790 C CB    . VAL B 1 254 ? 14.781 16.625  81.852  1.00 42.68  ? 251 VAL B CB    1 
ATOM   3791 C CG1   . VAL B 1 254 ? 13.316 16.495  81.469  1.00 30.82  ? 251 VAL B CG1   1 
ATOM   3792 C CG2   . VAL B 1 254 ? 15.499 17.598  80.926  1.00 31.19  ? 251 VAL B CG2   1 
ATOM   3793 N N     . SER B 1 255 ? 14.440 15.051  84.559  1.00 27.26  ? 252 SER B N     1 
ATOM   3794 C CA    . SER B 1 255 ? 13.671 14.179  85.438  1.00 26.78  ? 252 SER B CA    1 
ATOM   3795 C C     . SER B 1 255 ? 13.460 14.836  86.795  1.00 28.41  ? 252 SER B C     1 
ATOM   3796 O O     . SER B 1 255 ? 12.390 14.717  87.393  1.00 26.51  ? 252 SER B O     1 
ATOM   3797 C CB    . SER B 1 255 ? 14.374 12.831  85.609  1.00 32.62  ? 252 SER B CB    1 
ATOM   3798 O OG    . SER B 1 255 ? 14.430 12.127  84.381  1.00 43.12  ? 252 SER B OG    1 
ATOM   3799 N N     . LEU B 1 256 ? 14.489 15.530  87.275  1.00 29.59  ? 253 LEU B N     1 
ATOM   3800 C CA    . LEU B 1 256 ? 14.414 16.240  88.546  1.00 23.32  ? 253 LEU B CA    1 
ATOM   3801 C C     . LEU B 1 256 ? 13.359 17.335  88.500  1.00 23.56  ? 253 LEU B C     1 
ATOM   3802 O O     . LEU B 1 256 ? 12.574 17.495  89.435  1.00 28.44  ? 253 LEU B O     1 
ATOM   3803 C CB    . LEU B 1 256 ? 15.763 16.866  88.896  1.00 39.32  ? 253 LEU B CB    1 
ATOM   3804 C CG    . LEU B 1 256 ? 15.729 17.737  90.154  1.00 30.98  ? 253 LEU B CG    1 
ATOM   3805 C CD1   . LEU B 1 256 ? 15.684 16.869  91.402  1.00 22.69  ? 253 LEU B CD1   1 
ATOM   3806 C CD2   . LEU B 1 256 ? 16.916 18.682  90.198  1.00 49.27  ? 253 LEU B CD2   1 
ATOM   3807 N N     . GLY B 1 257 ? 13.359 18.095  87.409  1.00 24.38  ? 254 GLY B N     1 
ATOM   3808 C CA    . GLY B 1 257 ? 12.435 19.201  87.249  1.00 25.04  ? 254 GLY B CA    1 
ATOM   3809 C C     . GLY B 1 257 ? 10.991 18.754  87.329  1.00 25.66  ? 254 GLY B C     1 
ATOM   3810 O O     . GLY B 1 257 ? 10.177 19.371  88.014  1.00 29.02  ? 254 GLY B O     1 
ATOM   3811 N N     . ILE B 1 258 ? 10.674 17.672  86.627  1.00 26.24  ? 255 ILE B N     1 
ATOM   3812 C CA    . ILE B 1 258 ? 9.318  17.139  86.620  1.00 33.15  ? 255 ILE B CA    1 
ATOM   3813 C C     . ILE B 1 258 ? 8.897  16.642  88.002  1.00 39.96  ? 255 ILE B C     1 
ATOM   3814 O O     . ILE B 1 258 ? 7.792  16.933  88.462  1.00 28.90  ? 255 ILE B O     1 
ATOM   3815 C CB    . ILE B 1 258 ? 9.167  16.008  85.588  1.00 28.09  ? 255 ILE B CB    1 
ATOM   3816 C CG1   . ILE B 1 258 ? 9.468  16.537  84.183  1.00 30.80  ? 255 ILE B CG1   1 
ATOM   3817 C CG2   . ILE B 1 258 ? 7.769  15.410  85.651  1.00 29.86  ? 255 ILE B CG2   1 
ATOM   3818 C CD1   . ILE B 1 258 ? 9.334  15.502  83.089  1.00 30.56  ? 255 ILE B CD1   1 
ATOM   3819 N N     . ALA B 1 259 ? 9.783  15.902  88.663  1.00 34.73  ? 256 ALA B N     1 
ATOM   3820 C CA    . ALA B 1 259 ? 9.491  15.363  89.988  1.00 35.63  ? 256 ALA B CA    1 
ATOM   3821 C C     . ALA B 1 259 ? 9.206  16.477  90.990  1.00 28.08  ? 256 ALA B C     1 
ATOM   3822 O O     . ALA B 1 259 ? 8.210  16.434  91.713  1.00 41.89  ? 256 ALA B O     1 
ATOM   3823 C CB    . ALA B 1 259 ? 10.640 14.495  90.472  1.00 24.06  ? 256 ALA B CB    1 
ATOM   3824 N N     . LEU B 1 260 ? 10.085 17.472  91.030  1.00 30.39  ? 257 LEU B N     1 
ATOM   3825 C CA    . LEU B 1 260 ? 9.909  18.607  91.928  1.00 29.95  ? 257 LEU B CA    1 
ATOM   3826 C C     . LEU B 1 260 ? 8.676  19.420  91.547  1.00 29.82  ? 257 LEU B C     1 
ATOM   3827 O O     . LEU B 1 260 ? 8.015  20.000  92.407  1.00 30.35  ? 257 LEU B O     1 
ATOM   3828 C CB    . LEU B 1 260 ? 11.156 19.495  91.935  1.00 27.85  ? 257 LEU B CB    1 
ATOM   3829 C CG    . LEU B 1 260 ? 12.385 18.915  92.639  1.00 31.97  ? 257 LEU B CG    1 
ATOM   3830 C CD1   . LEU B 1 260 ? 13.554 19.888  92.582  1.00 38.96  ? 257 LEU B CD1   1 
ATOM   3831 C CD2   . LEU B 1 260 ? 12.056 18.546  94.079  1.00 28.77  ? 257 LEU B CD2   1 
ATOM   3832 N N     . HIS B 1 261 ? 8.371  19.454  90.254  1.00 26.25  ? 258 HIS B N     1 
ATOM   3833 C CA    . HIS B 1 261 ? 7.190  20.152  89.758  1.00 27.92  ? 258 HIS B CA    1 
ATOM   3834 C C     . HIS B 1 261 ? 5.914  19.554  90.341  1.00 28.85  ? 258 HIS B C     1 
ATOM   3835 O O     . HIS B 1 261 ? 4.978  20.275  90.686  1.00 38.21  ? 258 HIS B O     1 
ATOM   3836 C CB    . HIS B 1 261 ? 7.148  20.104  88.229  1.00 28.68  ? 258 HIS B CB    1 
ATOM   3837 C CG    . HIS B 1 261 ? 5.866  20.606  87.641  1.00 30.68  ? 258 HIS B CG    1 
ATOM   3838 N ND1   . HIS B 1 261 ? 5.521  21.940  87.636  1.00 31.95  ? 258 HIS B ND1   1 
ATOM   3839 C CD2   . HIS B 1 261 ? 4.852  19.953  87.025  1.00 31.92  ? 258 HIS B CD2   1 
ATOM   3840 C CE1   . HIS B 1 261 ? 4.346  22.087  87.050  1.00 33.90  ? 258 HIS B CE1   1 
ATOM   3841 N NE2   . HIS B 1 261 ? 3.918  20.896  86.669  1.00 33.87  ? 258 HIS B NE2   1 
ATOM   3842 N N     . GLU B 1 262 ? 5.884  18.230  90.452  1.00 32.58  ? 259 GLU B N     1 
ATOM   3843 C CA    . GLU B 1 262 ? 4.725  17.534  90.997  1.00 37.97  ? 259 GLU B CA    1 
ATOM   3844 C C     . GLU B 1 262 ? 4.625  17.718  92.507  1.00 42.68  ? 259 GLU B C     1 
ATOM   3845 O O     . GLU B 1 262 ? 3.562  17.525  93.097  1.00 44.29  ? 259 GLU B O     1 
ATOM   3846 C CB    . GLU B 1 262 ? 4.790  16.046  90.651  1.00 39.85  ? 259 GLU B CB    1 
ATOM   3847 C CG    . GLU B 1 262 ? 4.663  15.756  89.166  1.00 35.62  ? 259 GLU B CG    1 
ATOM   3848 C CD    . GLU B 1 262 ? 3.297  16.125  88.624  1.00 41.80  ? 259 GLU B CD    1 
ATOM   3849 O OE1   . GLU B 1 262 ? 2.340  16.190  89.423  1.00 43.55  ? 259 GLU B OE1   1 
ATOM   3850 O OE2   . GLU B 1 262 ? 3.179  16.348  87.402  1.00 51.91  ? 259 GLU B OE2   1 
ATOM   3851 N N     . ARG B 1 263 ? 5.739  18.098  93.125  1.00 33.06  ? 260 ARG B N     1 
ATOM   3852 C CA    . ARG B 1 263 ? 5.796  18.276  94.571  1.00 29.37  ? 260 ARG B CA    1 
ATOM   3853 C C     . ARG B 1 263 ? 5.718  19.746  94.973  1.00 28.78  ? 260 ARG B C     1 
ATOM   3854 O O     . ARG B 1 263 ? 5.790  20.076  96.158  1.00 35.99  ? 260 ARG B O     1 
ATOM   3855 C CB    . ARG B 1 263 ? 7.082  17.658  95.127  1.00 26.75  ? 260 ARG B CB    1 
ATOM   3856 C CG    . ARG B 1 263 ? 7.125  16.142  95.060  1.00 25.79  ? 260 ARG B CG    1 
ATOM   3857 C CD    . ARG B 1 263 ? 6.208  15.526  96.099  1.00 34.72  ? 260 ARG B CD    1 
ATOM   3858 N NE    . ARG B 1 263 ? 6.645  15.842  97.455  1.00 29.67  ? 260 ARG B NE    1 
ATOM   3859 C CZ    . ARG B 1 263 ? 6.010  15.456  98.557  1.00 39.52  ? 260 ARG B CZ    1 
ATOM   3860 N NH1   . ARG B 1 263 ? 4.902  14.735  98.470  1.00 32.08  ? 260 ARG B NH1   1 
ATOM   3861 N NH2   . ARG B 1 263 ? 6.486  15.792  99.748  1.00 33.44  ? 260 ARG B NH2   1 
ATOM   3862 N N     . ILE B 1 264 ? 5.564  20.624  93.987  1.00 29.28  ? 261 ILE B N     1 
ATOM   3863 C CA    . ILE B 1 264 ? 5.626  22.064  94.233  1.00 30.24  ? 261 ILE B CA    1 
ATOM   3864 C C     . ILE B 1 264 ? 4.695  22.527  95.354  1.00 45.58  ? 261 ILE B C     1 
ATOM   3865 O O     . ILE B 1 264 ? 5.067  23.372  96.167  1.00 48.22  ? 261 ILE B O     1 
ATOM   3866 C CB    . ILE B 1 264 ? 5.357  22.883  92.947  1.00 35.30  ? 261 ILE B CB    1 
ATOM   3867 C CG1   . ILE B 1 264 ? 5.751  24.345  93.155  1.00 37.27  ? 261 ILE B CG1   1 
ATOM   3868 C CG2   . ILE B 1 264 ? 3.902  22.766  92.515  1.00 33.34  ? 261 ILE B CG2   1 
ATOM   3869 C CD1   . ILE B 1 264 ? 7.229  24.545  93.371  1.00 38.94  ? 261 ILE B CD1   1 
ATOM   3870 N N     . ASP B 1 265 ? 3.490  21.969  95.400  1.00 37.49  ? 262 ASP B N     1 
ATOM   3871 C CA    . ASP B 1 265 ? 2.517  22.341  96.423  1.00 36.13  ? 262 ASP B CA    1 
ATOM   3872 C C     . ASP B 1 265 ? 2.920  21.834  97.806  1.00 46.14  ? 262 ASP B C     1 
ATOM   3873 O O     . ASP B 1 265 ? 2.774  22.544  98.801  1.00 46.83  ? 262 ASP B O     1 
ATOM   3874 C CB    . ASP B 1 265 ? 1.121  21.834  96.053  1.00 47.57  ? 262 ASP B CB    1 
ATOM   3875 C CG    . ASP B 1 265 ? 0.491  22.633  94.929  1.00 66.90  ? 262 ASP B CG    1 
ATOM   3876 O OD1   . ASP B 1 265 ? 0.537  23.881  94.984  1.00 66.14  ? 262 ASP B OD1   1 
ATOM   3877 O OD2   . ASP B 1 265 ? -0.054 22.013  93.992  1.00 72.60  ? 262 ASP B OD2   1 
ATOM   3878 N N     . ARG B 1 266 ? 3.423  20.604  97.867  1.00 41.13  ? 263 ARG B N     1 
ATOM   3879 C CA    . ARG B 1 266 ? 3.864  20.027  99.133  1.00 33.09  ? 263 ARG B CA    1 
ATOM   3880 C C     . ARG B 1 266 ? 5.070  20.774  99.690  1.00 43.13  ? 263 ARG B C     1 
ATOM   3881 O O     . ARG B 1 266 ? 5.226  20.902  100.905 1.00 50.52  ? 263 ARG B O     1 
ATOM   3882 C CB    . ARG B 1 266 ? 4.198  18.542  98.970  1.00 31.51  ? 263 ARG B CB    1 
ATOM   3883 C CG    . ARG B 1 266 ? 2.991  17.646  98.758  1.00 33.45  ? 263 ARG B CG    1 
ATOM   3884 C CD    . ARG B 1 266 ? 2.115  17.572  100.001 1.00 34.69  ? 263 ARG B CD    1 
ATOM   3885 N NE    . ARG B 1 266 ? 1.029  16.611  99.828  1.00 46.83  ? 263 ARG B NE    1 
ATOM   3886 C CZ    . ARG B 1 266 ? 0.133  16.312  100.763 1.00 59.22  ? 263 ARG B CZ    1 
ATOM   3887 N NH1   . ARG B 1 266 ? 0.184  16.899  101.951 1.00 61.18  ? 263 ARG B NH1   1 
ATOM   3888 N NH2   . ARG B 1 266 ? -0.817 15.423  100.508 1.00 60.62  ? 263 ARG B NH2   1 
ATOM   3889 N N     . ASN B 1 267 ? 5.924  21.264  98.795  1.00 30.35  ? 264 ASN B N     1 
ATOM   3890 C CA    . ASN B 1 267 ? 7.117  21.996  99.204  1.00 39.19  ? 264 ASN B CA    1 
ATOM   3891 C C     . ASN B 1 267 ? 6.832  23.465  99.498  1.00 45.89  ? 264 ASN B C     1 
ATOM   3892 O O     . ASN B 1 267 ? 7.633  24.145  100.138 1.00 50.16  ? 264 ASN B O     1 
ATOM   3893 C CB    . ASN B 1 267 ? 8.224  21.857  98.157  1.00 30.29  ? 264 ASN B CB    1 
ATOM   3894 C CG    . ASN B 1 267 ? 8.862  20.482  98.167  1.00 32.89  ? 264 ASN B CG    1 
ATOM   3895 O OD1   . ASN B 1 267 ? 9.293  19.975  97.132  1.00 33.44  ? 264 ASN B OD1   1 
ATOM   3896 N ND2   . ASN B 1 267 ? 8.918  19.866  99.342  1.00 25.95  ? 264 ASN B ND2   1 
ATOM   3897 N N     . LEU B 1 268 ? 5.691  23.950  99.022  1.00 46.74  ? 265 LEU B N     1 
ATOM   3898 C CA    . LEU B 1 268 ? 5.234  25.291  99.361  1.00 63.59  ? 265 LEU B CA    1 
ATOM   3899 C C     . LEU B 1 268 ? 4.516  25.254  100.704 1.00 68.25  ? 265 LEU B C     1 
ATOM   3900 O O     . LEU B 1 268 ? 4.647  26.168  101.519 1.00 64.17  ? 265 LEU B O     1 
ATOM   3901 C CB    . LEU B 1 268 ? 4.301  25.837  98.280  1.00 73.60  ? 265 LEU B CB    1 
ATOM   3902 C CG    . LEU B 1 268 ? 4.960  26.437  97.036  1.00 78.45  ? 265 LEU B CG    1 
ATOM   3903 C CD1   . LEU B 1 268 ? 3.912  26.786  95.994  1.00 76.67  ? 265 LEU B CD1   1 
ATOM   3904 C CD2   . LEU B 1 268 ? 5.772  27.663  97.412  1.00 74.19  ? 265 LEU B CD2   1 
ATOM   3905 N N     . ALA B 1 269 ? 3.756  24.187  100.925 1.00 60.12  ? 266 ALA B N     1 
ATOM   3906 C CA    . ALA B 1 269 ? 3.062  23.987  102.190 1.00 55.53  ? 266 ALA B CA    1 
ATOM   3907 C C     . ALA B 1 269 ? 4.065  23.812  103.323 1.00 65.95  ? 266 ALA B C     1 
ATOM   3908 O O     . ALA B 1 269 ? 3.835  24.260  104.447 1.00 69.31  ? 266 ALA B O     1 
ATOM   3909 C CB    . ALA B 1 269 ? 2.142  22.780  102.104 1.00 51.14  ? 266 ALA B CB    1 
ATOM   3910 N N     . ALA B 1 270 ? 5.180  23.157  103.016 1.00 61.05  ? 267 ALA B N     1 
ATOM   3911 C CA    . ALA B 1 270 ? 6.240  22.936  103.991 1.00 59.56  ? 267 ALA B CA    1 
ATOM   3912 C C     . ALA B 1 270 ? 6.830  24.261  104.459 1.00 74.39  ? 267 ALA B C     1 
ATOM   3913 O O     . ALA B 1 270 ? 7.332  24.369  105.579 1.00 85.67  ? 267 ALA B O     1 
ATOM   3914 C CB    . ALA B 1 270 ? 7.327  22.048  103.398 1.00 43.43  ? 267 ALA B CB    1 
ATOM   3915 N N     . ASN B 1 271 ? 6.764  25.265  103.589 1.00 73.40  ? 268 ASN B N     1 
ATOM   3916 C CA    . ASN B 1 271 ? 7.287  26.595  103.883 1.00 75.86  ? 268 ASN B CA    1 
ATOM   3917 C C     . ASN B 1 271 ? 6.177  27.596  104.174 1.00 82.77  ? 268 ASN B C     1 
ATOM   3918 O O     . ASN B 1 271 ? 4.991  27.289  104.044 1.00 80.93  ? 268 ASN B O     1 
ATOM   3919 C CB    . ASN B 1 271 ? 8.132  27.104  102.715 1.00 70.71  ? 268 ASN B CB    1 
ATOM   3920 C CG    . ASN B 1 271 ? 9.396  26.293  102.512 1.00 71.17  ? 268 ASN B CG    1 
ATOM   3921 O OD1   . ASN B 1 271 ? 9.888  26.163  101.392 1.00 84.36  ? 268 ASN B OD1   1 
ATOM   3922 N ND2   . ASN B 1 271 ? 9.929  25.744  103.597 1.00 60.96  ? 268 ASN B ND2   1 
HETATM 3923 N N     . SAM C 2 .   ? 18.729 31.575  82.362  1.00 128.31 ? 270 SAM A N     1 
HETATM 3924 C CA    . SAM C 2 .   ? 18.290 30.197  82.178  1.00 126.91 ? 270 SAM A CA    1 
HETATM 3925 C C     . SAM C 2 .   ? 19.356 29.359  81.479  1.00 135.43 ? 270 SAM A C     1 
HETATM 3926 O O     . SAM C 2 .   ? 19.325 29.167  80.264  1.00 135.56 ? 270 SAM A O     1 
HETATM 3927 O OXT   . SAM C 2 .   ? 20.272 28.844  82.118  1.00 142.13 ? 270 SAM A OXT   1 
HETATM 3928 C CB    . SAM C 2 .   ? 16.999 30.174  81.373  1.00 118.45 ? 270 SAM A CB    1 
HETATM 3929 C CG    . SAM C 2 .   ? 17.033 31.064  80.138  1.00 114.89 ? 270 SAM A CG    1 
HETATM 3930 S SD    . SAM C 2 .   ? 15.379 31.322  79.456  1.00 118.74 ? 270 SAM A SD    1 
HETATM 3931 C CE    . SAM C 2 .   ? 14.595 32.190  80.837  1.00 96.17  ? 270 SAM A CE    1 
HETATM 3932 C "C5'" . SAM C 2 .   ? 14.636 29.688  79.666  1.00 95.48  ? 270 SAM A "C5'" 1 
HETATM 3933 C "C4'" . SAM C 2 .   ? 13.521 29.455  78.660  1.00 83.89  ? 270 SAM A "C4'" 1 
HETATM 3934 O "O4'" . SAM C 2 .   ? 12.592 28.546  79.220  1.00 73.63  ? 270 SAM A "O4'" 1 
HETATM 3935 C "C3'" . SAM C 2 .   ? 12.788 30.755  78.369  1.00 77.79  ? 270 SAM A "C3'" 1 
HETATM 3936 O "O3'" . SAM C 2 .   ? 12.915 31.109  77.016  1.00 84.11  ? 270 SAM A "O3'" 1 
HETATM 3937 C "C2'" . SAM C 2 .   ? 11.338 30.498  78.697  1.00 71.53  ? 270 SAM A "C2'" 1 
HETATM 3938 O "O2'" . SAM C 2 .   ? 10.594 30.437  77.504  1.00 66.95  ? 270 SAM A "O2'" 1 
HETATM 3939 C "C1'" . SAM C 2 .   ? 11.318 29.143  79.377  1.00 75.58  ? 270 SAM A "C1'" 1 
HETATM 3940 N N9    . SAM C 2 .   ? 11.049 29.331  80.814  1.00 78.49  ? 270 SAM A N9    1 
HETATM 3941 C C8    . SAM C 2 .   ? 11.976 29.649  81.773  1.00 59.83  ? 270 SAM A C8    1 
HETATM 3942 N N7    . SAM C 2 .   ? 11.348 29.741  82.968  1.00 58.54  ? 270 SAM A N7    1 
HETATM 3943 C C5    . SAM C 2 .   ? 10.033 29.492  82.784  1.00 64.49  ? 270 SAM A C5    1 
HETATM 3944 C C6    . SAM C 2 .   ? 8.959  29.459  83.662  1.00 57.66  ? 270 SAM A C6    1 
HETATM 3945 N N6    . SAM C 2 .   ? 9.139  29.704  84.957  1.00 54.54  ? 270 SAM A N6    1 
HETATM 3946 N N1    . SAM C 2 .   ? 7.702  29.172  83.179  1.00 52.65  ? 270 SAM A N1    1 
HETATM 3947 C C2    . SAM C 2 .   ? 7.516  28.918  81.835  1.00 55.80  ? 270 SAM A C2    1 
HETATM 3948 N N3    . SAM C 2 .   ? 8.590  28.952  80.969  1.00 54.60  ? 270 SAM A N3    1 
HETATM 3949 C C4    . SAM C 2 .   ? 9.830  29.232  81.434  1.00 69.81  ? 270 SAM A C4    1 
HETATM 3950 N N     . SAM D 2 .   ? 21.601 6.828   80.155  1.00 164.83 ? 270 SAM B N     1 
HETATM 3951 C CA    . SAM D 2 .   ? 20.144 6.779   80.114  1.00 162.25 ? 270 SAM B CA    1 
HETATM 3952 C C     . SAM D 2 .   ? 19.607 6.405   78.736  1.00 163.20 ? 270 SAM B C     1 
HETATM 3953 O O     . SAM D 2 .   ? 19.110 5.296   78.534  1.00 161.13 ? 270 SAM B O     1 
HETATM 3954 O OXT   . SAM D 2 .   ? 19.654 7.197   77.795  1.00 165.72 ? 270 SAM B OXT   1 
HETATM 3955 C CB    . SAM D 2 .   ? 19.543 8.099   80.586  1.00 159.56 ? 270 SAM B CB    1 
HETATM 3956 C CG    . SAM D 2 .   ? 20.266 8.730   81.771  1.00 157.96 ? 270 SAM B CG    1 
HETATM 3957 S SD    . SAM D 2 .   ? 19.532 8.160   83.325  1.00 114.59 ? 270 SAM B SD    1 
HETATM 3958 C CE    . SAM D 2 .   ? 17.823 7.957   82.768  1.00 80.33  ? 270 SAM B CE    1 
HETATM 3959 C "C5'" . SAM D 2 .   ? 19.447 9.682   84.303  1.00 80.93  ? 270 SAM B "C5'" 1 
HETATM 3960 C "C4'" . SAM D 2 .   ? 18.516 9.606   85.512  1.00 78.00  ? 270 SAM B "C4'" 1 
HETATM 3961 O "O4'" . SAM D 2 .   ? 17.239 10.148  85.219  1.00 76.31  ? 270 SAM B "O4'" 1 
HETATM 3962 C "C3'" . SAM D 2 .   ? 18.297 8.177   85.991  1.00 77.17  ? 270 SAM B "C3'" 1 
HETATM 3963 O "O3'" . SAM D 2 .   ? 19.073 7.902   87.130  1.00 77.01  ? 270 SAM B "O3'" 1 
HETATM 3964 C "C2'" . SAM D 2 .   ? 16.826 8.098   86.337  1.00 75.49  ? 270 SAM B "C2'" 1 
HETATM 3965 O "O2'" . SAM D 2 .   ? 16.674 7.955   87.728  1.00 72.48  ? 270 SAM B "O2'" 1 
HETATM 3966 C "C1'" . SAM D 2 .   ? 16.229 9.424   85.898  1.00 73.96  ? 270 SAM B "C1'" 1 
HETATM 3967 N N9    . SAM D 2 .   ? 15.090 9.188   84.992  1.00 73.33  ? 270 SAM B N9    1 
HETATM 3968 C C8    . SAM D 2 .   ? 15.151 9.142   83.626  1.00 79.35  ? 270 SAM B C8    1 
HETATM 3969 N N7    . SAM D 2 .   ? 13.915 8.901   83.142  1.00 73.78  ? 270 SAM B N7    1 
HETATM 3970 C C5    . SAM D 2 .   ? 13.063 8.789   84.182  1.00 71.24  ? 270 SAM B C5    1 
HETATM 3971 C C6    . SAM D 2 .   ? 11.700 8.546   84.239  1.00 82.94  ? 270 SAM B C6    1 
HETATM 3972 N N6    . SAM D 2 .   ? 11.009 8.376   83.115  1.00 69.44  ? 270 SAM B N6    1 
HETATM 3973 N N1    . SAM D 2 .   ? 11.073 8.480   85.465  1.00 74.64  ? 270 SAM B N1    1 
HETATM 3974 C C2    . SAM D 2 .   ? 11.804 8.659   86.621  1.00 72.21  ? 270 SAM B C2    1 
HETATM 3975 N N3    . SAM D 2 .   ? 13.162 8.901   86.557  1.00 68.45  ? 270 SAM B N3    1 
HETATM 3976 C C4    . SAM D 2 .   ? 13.785 8.968   85.354  1.00 70.89  ? 270 SAM B C4    1 
HETATM 3977 O O     . HOH E 3 .   ? 4.122  15.366  76.071  1.00 54.58  ? 271 HOH A O     1 
HETATM 3978 O O     . HOH E 3 .   ? 16.835 25.286  86.034  1.00 41.42  ? 272 HOH A O     1 
HETATM 3979 O O     . HOH E 3 .   ? 14.829 19.035  77.678  1.00 48.17  ? 273 HOH A O     1 
HETATM 3980 O O     . HOH E 3 .   ? 17.059 27.845  68.969  1.00 61.73  ? 274 HOH A O     1 
HETATM 3981 O O     . HOH E 3 .   ? 1.324  14.943  83.339  1.00 43.70  ? 275 HOH A O     1 
HETATM 3982 O O     . HOH E 3 .   ? 5.752  24.351  88.945  1.00 56.74  ? 276 HOH A O     1 
HETATM 3983 O O     . HOH E 3 .   ? 11.900 44.194  73.520  1.00 67.65  ? 277 HOH A O     1 
HETATM 3984 O O     . HOH E 3 .   ? 3.643  36.190  59.468  1.00 76.17  ? 278 HOH A O     1 
HETATM 3985 O O     . HOH E 3 .   ? 20.825 27.971  61.731  1.00 64.82  ? 279 HOH A O     1 
HETATM 3986 O O     . HOH E 3 .   ? 5.818  10.658  67.762  1.00 57.57  ? 280 HOH A O     1 
HETATM 3987 O O     . HOH E 3 .   ? 4.832  12.233  82.038  1.00 66.44  ? 281 HOH A O     1 
HETATM 3988 O O     . HOH E 3 .   ? 2.210  12.317  83.630  1.00 52.81  ? 282 HOH A O     1 
HETATM 3989 O O     . HOH E 3 .   ? 34.620 -3.808  74.533  1.00 75.80  ? 283 HOH A O     1 
HETATM 3990 O O     . HOH E 3 .   ? 21.025 33.461  78.555  1.00 78.44  ? 284 HOH A O     1 
HETATM 3991 O O     . HOH E 3 .   ? -5.034 18.266  72.952  1.00 74.82  ? 285 HOH A O     1 
HETATM 3992 O O     . HOH E 3 .   ? -1.170 26.168  89.090  1.00 54.78  ? 286 HOH A O     1 
HETATM 3993 O O     . HOH F 3 .   ? 24.696 31.049  96.224  1.00 37.22  ? 271 HOH B O     1 
HETATM 3994 O O     . HOH F 3 .   ? 26.092 12.944  92.367  1.00 40.81  ? 272 HOH B O     1 
HETATM 3995 O O     . HOH F 3 .   ? 31.044 21.809  107.863 1.00 31.69  ? 273 HOH B O     1 
HETATM 3996 O O     . HOH F 3 .   ? 29.379 18.854  102.305 1.00 25.74  ? 274 HOH B O     1 
HETATM 3997 O O     . HOH F 3 .   ? 8.655  20.974  94.709  1.00 29.20  ? 275 HOH B O     1 
HETATM 3998 O O     . HOH F 3 .   ? 22.727 27.135  102.002 1.00 39.09  ? 276 HOH B O     1 
HETATM 3999 O O     . HOH F 3 .   ? 16.841 1.766   94.359  1.00 53.42  ? 277 HOH B O     1 
HETATM 4000 O O     . HOH F 3 .   ? 14.288 26.517  97.927  1.00 47.39  ? 278 HOH B O     1 
HETATM 4001 O O     . HOH F 3 .   ? 17.380 20.296  86.799  1.00 43.19  ? 279 HOH B O     1 
HETATM 4002 O O     . HOH F 3 .   ? 25.351 12.884  84.881  1.00 40.09  ? 280 HOH B O     1 
HETATM 4003 O O     . HOH F 3 .   ? 30.385 9.941   97.759  1.00 37.41  ? 281 HOH B O     1 
HETATM 4004 O O     . HOH F 3 .   ? 29.450 21.387  100.985 1.00 23.24  ? 282 HOH B O     1 
HETATM 4005 O O     . HOH F 3 .   ? 2.210  16.990  105.312 1.00 40.18  ? 283 HOH B O     1 
HETATM 4006 O O     . HOH F 3 .   ? 32.022 21.833  100.050 1.00 33.18  ? 284 HOH B O     1 
HETATM 4007 O O     . HOH F 3 .   ? 34.235 19.987  101.188 1.00 37.03  ? 285 HOH B O     1 
HETATM 4008 O O     . HOH F 3 .   ? 25.361 24.851  99.372  1.00 34.11  ? 286 HOH B O     1 
HETATM 4009 O O     . HOH F 3 .   ? 2.451  20.686  89.762  1.00 37.05  ? 287 HOH B O     1 
HETATM 4010 O O     . HOH F 3 .   ? 30.114 13.583  96.231  1.00 48.24  ? 288 HOH B O     1 
HETATM 4011 O O     . HOH F 3 .   ? 32.556 11.447  107.073 1.00 41.61  ? 289 HOH B O     1 
HETATM 4012 O O     . HOH F 3 .   ? 29.438 14.300  105.302 1.00 44.90  ? 290 HOH B O     1 
HETATM 4013 O O     . HOH F 3 .   ? 19.556 37.889  89.032  1.00 39.76  ? 291 HOH B O     1 
HETATM 4014 O O     . HOH F 3 .   ? 3.948  5.557   99.895  1.00 50.83  ? 292 HOH B O     1 
HETATM 4015 O O     . HOH F 3 .   ? 24.627 9.769   108.676 1.00 38.56  ? 293 HOH B O     1 
HETATM 4016 O O     . HOH F 3 .   ? 27.223 15.836  106.454 1.00 53.66  ? 294 HOH B O     1 
HETATM 4017 O O     . HOH F 3 .   ? 8.867  10.656  109.816 1.00 40.31  ? 295 HOH B O     1 
HETATM 4018 O O     . HOH F 3 .   ? 7.843  18.220  101.744 1.00 53.52  ? 296 HOH B O     1 
HETATM 4019 O O     . HOH F 3 .   ? 36.485 21.551  101.917 1.00 44.61  ? 297 HOH B O     1 
HETATM 4020 O O     . HOH F 3 .   ? 25.701 34.344  88.256  1.00 64.10  ? 298 HOH B O     1 
HETATM 4021 O O     . HOH F 3 .   ? 1.223  19.157  103.153 1.00 44.45  ? 299 HOH B O     1 
HETATM 4022 O O     . HOH F 3 .   ? 30.024 32.722  104.441 1.00 51.04  ? 300 HOH B O     1 
HETATM 4023 O O     . HOH F 3 .   ? 23.255 35.399  82.715  1.00 70.19  ? 301 HOH B O     1 
HETATM 4024 O O     . HOH F 3 .   ? 31.244 24.769  84.432  1.00 49.92  ? 302 HOH B O     1 
HETATM 4025 O O     . HOH F 3 .   ? 13.073 -1.882  100.450 1.00 54.88  ? 303 HOH B O     1 
HETATM 4026 O O     . HOH F 3 .   ? 30.808 26.542  100.604 1.00 69.43  ? 304 HOH B O     1 
HETATM 4027 O O     . HOH F 3 .   ? 16.057 14.377  78.301  1.00 39.30  ? 305 HOH B O     1 
HETATM 4028 O O     . HOH F 3 .   ? 43.187 45.768  98.665  1.00 63.82  ? 306 HOH B O     1 
HETATM 4029 O O     . HOH F 3 .   ? 35.787 8.224   91.599  1.00 58.10  ? 307 HOH B O     1 
HETATM 4030 O O     . HOH F 3 .   ? 12.707 5.249   103.100 1.00 42.68  ? 308 HOH B O     1 
HETATM 4031 O O     . HOH F 3 .   ? 31.689 55.749  97.592  1.00 68.84  ? 309 HOH B O     1 
HETATM 4032 O O     . HOH F 3 .   ? 40.067 18.102  93.926  1.00 56.66  ? 310 HOH B O     1 
HETATM 4033 O O     . HOH F 3 .   ? 24.567 48.971  102.930 1.00 53.67  ? 311 HOH B O     1 
HETATM 4034 O O     . HOH F 3 .   ? 25.753 29.695  104.570 1.00 58.57  ? 312 HOH B O     1 
HETATM 4035 O O     . HOH F 3 .   ? 7.863  0.648   94.739  1.00 56.09  ? 313 HOH B O     1 
HETATM 4036 O O     . HOH F 3 .   ? 17.542 2.888   87.128  1.00 69.38  ? 314 HOH B O     1 
HETATM 4037 O O     . HOH F 3 .   ? 8.423  1.808   103.072 1.00 61.28  ? 315 HOH B O     1 
HETATM 4038 O O     . HOH F 3 .   ? 0.232  20.494  100.481 1.00 63.44  ? 316 HOH B O     1 
HETATM 4039 O O     . HOH F 3 .   ? 26.797 25.848  101.823 1.00 42.60  ? 317 HOH B O     1 
HETATM 4040 O O     . HOH F 3 .   ? 25.897 28.674  101.628 1.00 60.80  ? 318 HOH B O     1 
HETATM 4041 O O     . HOH F 3 .   ? 17.576 41.929  110.126 1.00 70.15  ? 319 HOH B O     1 
HETATM 4042 O O     . HOH F 3 .   ? 32.950 24.767  100.619 1.00 60.49  ? 320 HOH B O     1 
HETATM 4043 O O     . HOH F 3 .   ? 46.869 31.053  97.277  1.00 67.35  ? 321 HOH B O     1 
HETATM 4044 O O     . HOH F 3 .   ? 15.899 4.368   111.582 1.00 66.06  ? 322 HOH B O     1 
HETATM 4045 O O     . HOH F 3 .   ? 28.428 13.622  107.970 1.00 50.62  ? 323 HOH B O     1 
HETATM 4046 O O     . HOH F 3 .   ? 31.957 17.594  102.955 1.00 49.80  ? 324 HOH B O     1 
HETATM 4047 O O     . HOH F 3 .   ? 18.047 30.928  99.933  1.00 61.63  ? 325 HOH B O     1 
HETATM 4048 O O     . HOH F 3 .   ? 36.725 5.966   93.392  1.00 76.92  ? 326 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ALA A 11  ? 2.4451 1.0491 1.1875 0.2553  0.1041  -0.2204 8   ALA A N     
2    C CA    . ALA A 11  ? 2.5241 1.1416 1.2638 0.2764  0.0924  -0.1944 8   ALA A CA    
3    C C     . ALA A 11  ? 2.6018 1.2820 1.3664 0.3098  0.0833  -0.1847 8   ALA A C     
4    O O     . ALA A 11  ? 2.5925 1.2622 1.3460 0.3344  0.0873  -0.1934 8   ALA A O     
5    C CB    . ALA A 11  ? 2.5745 1.1170 1.2688 0.2869  0.0956  -0.1892 8   ALA A CB    
6    N N     . ASN A 12  ? 2.6997 1.4449 1.4971 0.3107  0.0706  -0.1660 9   ASN A N     
7    C CA    . ASN A 12  ? 2.8036 1.6169 1.6290 0.3404  0.0606  -0.1540 9   ASN A CA    
8    C C     . ASN A 12  ? 2.8235 1.6791 1.6642 0.3503  0.0440  -0.1227 9   ASN A C     
9    O O     . ASN A 12  ? 2.7560 1.6519 1.6231 0.3301  0.0354  -0.1146 9   ASN A O     
10   C CB    . ASN A 12  ? 2.8118 1.6855 1.6764 0.3310  0.0616  -0.1690 9   ASN A CB    
11   C CG    . ASN A 12  ? 2.7747 1.6802 1.6671 0.2967  0.0575  -0.1682 9   ASN A CG    
12   O OD1   . ASN A 12  ? 2.8209 1.6919 1.6980 0.2762  0.0573  -0.1622 9   ASN A OD1   
13   N ND2   . ASN A 12  ? 2.6805 1.6521 1.6136 0.2908  0.0542  -0.1744 9   ASN A ND2   
14   N N     . PRO A 13  ? 2.9084 1.7532 1.7316 0.3813  0.0389  -0.1044 10  PRO A N     
15   C CA    . PRO A 13  ? 2.8881 1.7764 1.7258 0.3957  0.0221  -0.0721 10  PRO A CA    
16   C C     . PRO A 13  ? 2.8395 1.8051 1.7105 0.4246  0.0133  -0.0616 10  PRO A C     
17   O O     . PRO A 13  ? 2.8519 1.8462 1.7276 0.4485  0.0014  -0.0344 10  PRO A O     
18   C CB    . PRO A 13  ? 2.9373 1.7649 1.7345 0.4141  0.0238  -0.0593 10  PRO A CB    
19   C CG    . PRO A 13  ? 2.9949 1.7462 1.7568 0.4076  0.0413  -0.0865 10  PRO A CG    
20   C CD    . PRO A 13  ? 2.9827 1.7598 1.7649 0.4002  0.0491  -0.1122 10  PRO A CD    
21   N N     . SER A 14  ? 2.7689 1.7685 1.6628 0.4223  0.0189  -0.0820 11  SER A N     
22   C CA    . SER A 14  ? 2.6974 1.7688 1.6215 0.4507  0.0124  -0.0750 11  SER A CA    
23   C C     . SER A 14  ? 2.6903 1.8447 1.6636 0.4361  -0.0006 -0.0668 11  SER A C     
24   O O     . SER A 14  ? 2.6392 1.7939 1.6251 0.4023  0.0005  -0.0784 11  SER A O     
25   C CB    . SER A 14  ? 2.6257 1.6803 1.5402 0.4637  0.0270  -0.1025 11  SER A CB    
26   O OG    . SER A 14  ? 2.5272 1.6516 1.4696 0.4924  0.0215  -0.0960 11  SER A OG    
27   N N     . ASP A 15  ? 2.7170 1.9424 1.7182 0.4622  -0.0133 -0.0459 12  ASP A N     
28   C CA    . ASP A 15  ? 2.6727 1.9831 1.7229 0.4522  -0.0277 -0.0360 12  ASP A CA    
29   C C     . ASP A 15  ? 2.7609 2.1357 1.8383 0.4791  -0.0283 -0.0386 12  ASP A C     
30   O O     . ASP A 15  ? 2.7874 2.1626 1.8514 0.5147  -0.0264 -0.0299 12  ASP A O     
31   C CB    . ASP A 15  ? 2.5719 1.9163 1.6346 0.4538  -0.0483 -0.0002 12  ASP A CB    
32   C CG    . ASP A 15  ? 2.5211 1.8131 1.5630 0.4232  -0.0500 0.0025  12  ASP A CG    
33   O OD1   . ASP A 15  ? 2.5707 1.8051 1.5919 0.3999  -0.0351 -0.0231 12  ASP A OD1   
34   O OD2   . ASP A 15  ? 2.4346 1.7434 1.4804 0.4224  -0.0666 0.0309  12  ASP A OD2   
35   N N     . PRO A 16  ? 2.8188 2.2491 1.9347 0.4625  -0.0306 -0.0503 13  PRO A N     
36   C CA    . PRO A 16  ? 2.8156 2.2452 1.9476 0.4210  -0.0316 -0.0619 13  PRO A CA    
37   C C     . PRO A 16  ? 2.8347 2.1907 1.9380 0.3991  -0.0112 -0.0949 13  PRO A C     
38   O O     . PRO A 16  ? 2.8427 2.1791 1.9484 0.3650  -0.0090 -0.1044 13  PRO A O     
39   C CB    . PRO A 16  ? 2.7500 2.2685 1.9337 0.4180  -0.0402 -0.0632 13  PRO A CB    
40   C CG    . PRO A 16  ? 2.7451 2.3181 1.9416 0.4581  -0.0481 -0.0442 13  PRO A CG    
41   C CD    . PRO A 16  ? 2.8102 2.3167 1.9602 0.4845  -0.0347 -0.0491 13  PRO A CD    
42   N N     . ALA A 17  ? 2.8214 2.1375 1.8974 0.4190  0.0031  -0.1114 14  ALA A N     
43   C CA    . ALA A 17  ? 2.7801 2.0248 1.8267 0.4006  0.0217  -0.1418 14  ALA A CA    
44   C C     . ALA A 17  ? 2.6574 1.9272 1.7328 0.3677  0.0263  -0.1626 14  ALA A C     
45   O O     . ALA A 17  ? 2.7012 1.9167 1.7569 0.3456  0.0403  -0.1859 14  ALA A O     
46   C CB    . ALA A 17  ? 2.8229 1.9883 1.8296 0.3864  0.0263  -0.1393 14  ALA A CB    
47   N N     . VAL A 18  ? 2.4894 1.8423 1.6120 0.3644  0.0137  -0.1528 15  VAL A N     
48   C CA    . VAL A 18  ? 2.3633 1.7513 1.5195 0.3351  0.0162  -0.1699 15  VAL A CA    
49   C C     . VAL A 18  ? 2.3782 1.7357 1.5323 0.2963  0.0179  -0.1742 15  VAL A C     
50   O O     . VAL A 18  ? 2.3429 1.7414 1.5312 0.2715  0.0150  -0.1802 15  VAL A O     
51   C CB    . VAL A 18  ? 2.3104 1.6784 1.4585 0.3355  0.0326  -0.1993 15  VAL A CB    
52   C CG1   . VAL A 18  ? 2.2379 1.6551 1.4270 0.3077  0.0332  -0.2134 15  VAL A CG1   
53   C CG2   . VAL A 18  ? 2.3042 1.6954 1.4485 0.3760  0.0322  -0.1964 15  VAL A CG2   
54   N N     . GLN A 19  ? 2.4399 1.7264 1.5540 0.2915  0.0226  -0.1708 16  GLN A N     
55   C CA    . GLN A 19  ? 2.4610 1.7161 1.5693 0.2571  0.0245  -0.1734 16  GLN A CA    
56   C C     . GLN A 19  ? 2.4070 1.7192 1.5468 0.2498  0.0052  -0.1502 16  GLN A C     
57   O O     . GLN A 19  ? 2.3187 1.6182 1.4598 0.2225  0.0036  -0.1496 16  GLN A O     
58   C CB    . GLN A 19  ? 2.5593 1.7273 1.6169 0.2560  0.0330  -0.1729 16  GLN A CB    
59   C CG    . GLN A 19  ? 2.5607 1.7219 1.6085 0.2566  0.0199  -0.1470 16  GLN A CG    
60   C CD    . GLN A 19  ? 2.5313 1.7363 1.5889 0.2897  0.0042  -0.1210 16  GLN A CD    
61   O OE1   . GLN A 19  ? 2.4630 1.7070 1.5387 0.2884  -0.0127 -0.0981 16  GLN A OE1   
62   N NE2   . GLN A 19  ? 2.5776 1.7763 1.6226 0.3199  0.0094  -0.1236 16  GLN A NE2   
63   N N     . ARG A 20  ? 2.4619 1.8374 1.6264 0.2749  -0.0099 -0.1308 17  ARG A N     
64   C CA    . ARG A 20  ? 2.4558 1.8904 1.6510 0.2715  -0.0313 -0.1057 17  ARG A CA    
65   C C     . ARG A 20  ? 2.3484 1.8302 1.5838 0.2419  -0.0359 -0.1140 17  ARG A C     
66   O O     . ARG A 20  ? 2.2853 1.8264 1.5529 0.2390  -0.0550 -0.0951 17  ARG A O     
67   C CB    . ARG A 20  ? 2.4890 1.9861 1.7046 0.3056  -0.0457 -0.0836 17  ARG A CB    
68   C CG    . ARG A 20  ? 2.5388 2.0118 1.7268 0.3288  -0.0543 -0.0575 17  ARG A CG    
69   C CD    . ARG A 20  ? 2.5311 2.0193 1.7277 0.3133  -0.0731 -0.0337 17  ARG A CD    
70   N NE    . ARG A 20  ? 2.5123 2.0774 1.7578 0.2994  -0.0881 -0.0285 17  ARG A NE    
71   C CZ    . ARG A 20  ? 2.4607 2.1040 1.7417 0.3181  -0.1048 -0.0088 17  ARG A CZ    
72   N NH1   . ARG A 20  ? 2.4737 2.1295 1.7464 0.3527  -0.1079 0.0078  17  ARG A NH1   
73   N NH2   . ARG A 20  ? 2.3740 2.0840 1.6991 0.3026  -0.1186 -0.0051 17  ARG A NH2   
74   N N     . ILE A 21  ? 2.3086 1.7643 1.5424 0.2197  -0.0189 -0.1413 18  ILE A N     
75   C CA    . ILE A 21  ? 2.2129 1.7047 1.4815 0.1893  -0.0209 -0.1505 18  ILE A CA    
76   C C     . ILE A 21  ? 2.2052 1.6757 1.4650 0.1688  -0.0291 -0.1385 18  ILE A C     
77   O O     . ILE A 21  ? 2.2001 1.7203 1.4926 0.1550  -0.0436 -0.1291 18  ILE A O     
78   C CB    . ILE A 21  ? 2.2028 1.6600 1.4651 0.1684  0.0006  -0.1811 18  ILE A CB    
79   C CG1   . ILE A 21  ? 2.2384 1.6609 1.4745 0.1902  0.0145  -0.1946 18  ILE A CG1   
80   C CG2   . ILE A 21  ? 2.0967 1.6190 1.4081 0.1492  -0.0022 -0.1906 18  ILE A CG2   
81   C CD1   . ILE A 21  ? 2.2286 1.5999 1.4473 0.1693  0.0354  -0.2225 18  ILE A CD1   
82   N N     . ILE A 22  ? 2.2028 1.5978 1.4169 0.1671  -0.0201 -0.1389 19  ILE A N     
83   C CA    . ILE A 22  ? 2.1266 1.4909 1.3242 0.1489  -0.0259 -0.1286 19  ILE A CA    
84   C C     . ILE A 22  ? 2.1940 1.6044 1.4081 0.1592  -0.0511 -0.0988 19  ILE A C     
85   O O     . ILE A 22  ? 2.2410 1.6554 1.4600 0.1407  -0.0614 -0.0904 19  ILE A O     
86   C CB    . ILE A 22  ? 2.0298 1.3075 1.1740 0.1509  -0.0133 -0.1309 19  ILE A CB    
87   C CG1   . ILE A 22  ? 2.0081 1.2754 1.1321 0.1850  -0.0177 -0.1161 19  ILE A CG1   
88   C CG2   . ILE A 22  ? 2.0014 1.2294 1.1280 0.1354  0.0101  -0.1590 19  ILE A CG2   
89   C CD1   . ILE A 22  ? 2.0712 1.2543 1.1439 0.1888  -0.0050 -0.1193 19  ILE A CD1   
90   N N     . ASP A 23  ? 2.2085 1.6532 1.4301 0.1890  -0.0615 -0.0824 20  ASP A N     
91   C CA    . ASP A 23  ? 2.2074 1.6963 1.4434 0.2008  -0.0864 -0.0512 20  ASP A CA    
92   C C     . ASP A 23  ? 2.0639 1.6426 1.3539 0.1990  -0.1026 -0.0445 20  ASP A C     
93   O O     . ASP A 23  ? 1.9912 1.6214 1.3006 0.2142  -0.1240 -0.0182 20  ASP A O     
94   C CB    . ASP A 23  ? 2.3267 1.8063 1.5418 0.2348  -0.0899 -0.0330 20  ASP A CB    
95   C CG    . ASP A 23  ? 2.4255 1.9233 1.6394 0.2429  -0.1132 0.0010  20  ASP A CG    
96   O OD1   . ASP A 23  ? 2.4330 1.9733 1.6591 0.2700  -0.1255 0.0224  20  ASP A OD1   
97   O OD2   . ASP A 23  ? 2.4716 1.9414 1.6719 0.2222  -0.1195 0.0070  20  ASP A OD2   
98   N N     . VAL A 24  ? 2.0402 1.6381 1.3551 0.1797  -0.0929 -0.0676 21  VAL A N     
99   C CA    . VAL A 24  ? 2.0352 1.7166 1.4029 0.1736  -0.1072 -0.0639 21  VAL A CA    
100  C C     . VAL A 24  ? 2.0818 1.7610 1.4654 0.1389  -0.1015 -0.0822 21  VAL A C     
101  O O     . VAL A 24  ? 2.0629 1.8053 1.4896 0.1277  -0.1140 -0.0797 21  VAL A O     
102  C CB    . VAL A 24  ? 2.0098 1.7371 1.4017 0.1929  -0.1012 -0.0730 21  VAL A CB    
103  C CG1   . VAL A 24  ? 1.8952 1.7139 1.3437 0.1876  -0.1182 -0.0660 21  VAL A CG1   
104  C CG2   . VAL A 24  ? 2.0823 1.8060 1.4546 0.2290  -0.1038 -0.0568 21  VAL A CG2   
105  N N     . THR A 25  ? 2.1456 1.7522 1.4943 0.1223  -0.0825 -0.0997 22  THR A N     
106  C CA    . THR A 25  ? 2.1637 1.7609 1.5223 0.0899  -0.0752 -0.1161 22  THR A CA    
107  C C     . THR A 25  ? 2.2447 1.8007 1.5774 0.0760  -0.0821 -0.1051 22  THR A C     
108  O O     . THR A 25  ? 2.2135 1.7930 1.5664 0.0563  -0.0921 -0.1029 22  THR A O     
109  C CB    . THR A 25  ? 2.1840 1.7329 1.5252 0.0779  -0.0474 -0.1452 22  THR A CB    
110  O OG1   . THR A 25  ? 2.2501 1.7195 1.5395 0.0833  -0.0349 -0.1471 22  THR A OG1   
111  C CG2   . THR A 25  ? 2.1644 1.7481 1.5264 0.0923  -0.0403 -0.1569 22  THR A CG2   
112  N N     . LYS A 26  ? 2.3730 1.8669 1.6601 0.0867  -0.0770 -0.0984 23  LYS A N     
113  C CA    . LYS A 26  ? 2.4665 1.9175 1.7243 0.0758  -0.0837 -0.0868 23  LYS A CA    
114  C C     . LYS A 26  ? 2.5885 2.0892 1.8668 0.0807  -0.1132 -0.0592 23  LYS A C     
115  O O     . LYS A 26  ? 2.6470 2.1479 1.9280 0.0620  -0.1232 -0.0548 23  LYS A O     
116  C CB    . LYS A 26  ? 2.4315 1.8100 1.6381 0.0884  -0.0734 -0.0835 23  LYS A CB    
117  C CG    . LYS A 26  ? 2.3954 1.7084 1.5649 0.0688  -0.0659 -0.0867 23  LYS A CG    
118  C CD    . LYS A 26  ? 2.3285 1.6585 1.5024 0.0597  -0.0879 -0.0672 23  LYS A CD    
119  C CE    . LYS A 26  ? 2.2675 1.5535 1.4217 0.0329  -0.0782 -0.0790 23  LYS A CE    
120  N NZ    . LYS A 26  ? 2.2075 1.5163 1.3907 0.0134  -0.0652 -0.1021 23  LYS A NZ    
121  N N     . PRO A 27  ? 2.5921 2.1347 1.8839 0.1063  -0.1277 -0.0398 24  PRO A N     
122  C CA    . PRO A 27  ? 2.5299 2.1246 1.8437 0.1109  -0.1576 -0.0114 24  PRO A CA    
123  C C     . PRO A 27  ? 2.3838 2.0455 1.7468 0.0945  -0.1695 -0.0149 24  PRO A C     
124  O O     . PRO A 27  ? 2.3333 2.0170 1.7207 0.0875  -0.1557 -0.0366 24  PRO A O     
125  C CB    . PRO A 27  ? 2.5444 2.1732 1.8653 0.1430  -0.1657 0.0067  24  PRO A CB    
126  C CG    . PRO A 27  ? 2.5948 2.1655 1.8807 0.1558  -0.1409 -0.0091 24  PRO A CG    
127  C CD    . PRO A 27  ? 2.6031 2.1437 1.8872 0.1329  -0.1181 -0.0413 24  PRO A CD    
128  N N     . SER A 28  ? 2.3197 2.0124 1.6967 0.0880  -0.1956 0.0065  25  SER A N     
129  C CA    . SER A 28  ? 2.2144 1.9728 1.6391 0.0731  -0.2106 0.0063  25  SER A CA    
130  C C     . SER A 28  ? 2.1142 1.9528 1.5823 0.0917  -0.2225 0.0170  25  SER A C     
131  O O     . SER A 28  ? 2.0380 1.9138 1.5152 0.1079  -0.2457 0.0456  25  SER A O     
132  C CB    . SER A 28  ? 2.1930 1.9553 1.6155 0.0609  -0.2368 0.0270  25  SER A CB    
133  O OG    . SER A 28  ? 2.1801 1.9543 1.5930 0.0801  -0.2586 0.0586  25  SER A OG    
134  N N     . ARG A 29  ? 2.1274 1.9932 1.6221 0.0893  -0.2066 -0.0051 26  ARG A N     
135  C CA    . ARG A 29  ? 2.1426 2.0816 1.6761 0.1082  -0.2142 0.0020  26  ARG A CA    
136  C C     . ARG A 29  ? 2.1069 2.1188 1.6952 0.0920  -0.2253 -0.0026 26  ARG A C     
137  O O     . ARG A 29  ? 2.0751 2.1134 1.6815 0.0776  -0.2471 0.0108  26  ARG A O     
138  C CB    . ARG A 29  ? 2.1688 2.0839 1.6875 0.1242  -0.1880 -0.0175 26  ARG A CB    
139  C CG    . ARG A 29  ? 2.2214 2.0515 1.6833 0.1337  -0.1718 -0.0206 26  ARG A CG    
140  C CD    . ARG A 29  ? 2.2253 2.0515 1.6677 0.1537  -0.1906 0.0113  26  ARG A CD    
141  N NE    . ARG A 29  ? 2.2200 2.0753 1.6664 0.1861  -0.1916 0.0229  26  ARG A NE    
142  C CZ    . ARG A 29  ? 2.1688 2.0995 1.6497 0.2024  -0.2136 0.0470  26  ARG A CZ    
143  N NH1   . ARG A 29  ? 2.1187 2.1028 1.6335 0.1882  -0.2377 0.0624  26  ARG A NH1   
144  N NH2   . ARG A 29  ? 2.1663 2.1192 1.6473 0.2332  -0.2117 0.0565  26  ARG A NH2   
145  N N     . SER A 30  ? 2.1264 2.1695 1.7402 0.0940  -0.2106 -0.0216 27  SER A N     
146  C CA    . SER A 30  ? 2.1244 2.2454 1.7943 0.0821  -0.2216 -0.0243 27  SER A CA    
147  C C     . SER A 30  ? 2.1448 2.2511 1.8265 0.0529  -0.2039 -0.0533 27  SER A C     
148  O O     . SER A 30  ? 2.0713 2.2005 1.7768 0.0312  -0.2164 -0.0518 27  SER A O     
149  C CB    . SER A 30  ? 2.1235 2.3065 1.8222 0.1054  -0.2223 -0.0210 27  SER A CB    
150  O OG    . SER A 30  ? 2.1864 2.3240 1.8558 0.1188  -0.1953 -0.0404 27  SER A OG    
151  N N     . ASN A 31  ? 2.2369 2.3053 1.9019 0.0525  -0.1756 -0.0788 28  ASN A N     
152  C CA    . ASN A 31  ? 2.2471 2.3058 1.9255 0.0256  -0.1577 -0.1055 28  ASN A CA    
153  C C     . ASN A 31  ? 2.2574 2.2344 1.8947 0.0067  -0.1411 -0.1187 28  ASN A C     
154  O O     . ASN A 31  ? 2.3324 2.2479 1.9234 0.0167  -0.1361 -0.1134 28  ASN A O     
155  C CB    . ASN A 31  ? 2.2473 2.3184 1.9368 0.0317  -0.1375 -0.1262 28  ASN A CB    
156  C CG    . ASN A 31  ? 2.2926 2.3044 1.9356 0.0535  -0.1200 -0.1318 28  ASN A CG    
157  O OD1   . ASN A 31  ? 2.3274 2.3109 1.9397 0.0717  -0.1276 -0.1145 28  ASN A OD1   
158  N ND2   . ASN A 31  ? 2.2834 2.2755 1.9209 0.0514  -0.0972 -0.1556 28  ASN A ND2   
159  N N     . ILE A 32  ? 2.1268 2.1056 1.7822 -0.0205 -0.1326 -0.1354 29  ILE A N     
160  C CA    . ILE A 32  ? 2.0055 1.9167 1.6280 -0.0404 -0.1188 -0.1463 29  ILE A CA    
161  C C     . ILE A 32  ? 1.8626 1.7249 1.4655 -0.0505 -0.0873 -0.1729 29  ILE A C     
162  O O     . ILE A 32  ? 1.8293 1.6377 1.4071 -0.0681 -0.0728 -0.1837 29  ILE A O     
163  C CB    . ILE A 32  ? 1.9741 1.9151 1.6265 -0.0649 -0.1308 -0.1454 29  ILE A CB    
164  C CG1   . ILE A 32  ? 1.9914 1.8623 1.6050 -0.0812 -0.1205 -0.1514 29  ILE A CG1   
165  C CG2   . ILE A 32  ? 1.9319 1.9226 1.6310 -0.0814 -0.1225 -0.1625 29  ILE A CG2   
166  C CD1   . ILE A 32  ? 1.9174 1.8106 1.5570 -0.1055 -0.1280 -0.1542 29  ILE A CD1   
167  N N     . LYS A 33  ? 1.7524 1.6332 1.3660 -0.0392 -0.0772 -0.1827 30  LYS A N     
168  C CA    . LYS A 33  ? 1.6458 1.4843 1.2433 -0.0491 -0.0492 -0.2073 30  LYS A CA    
169  C C     . LYS A 33  ? 1.6322 1.3808 1.1713 -0.0477 -0.0326 -0.2122 30  LYS A C     
170  O O     . LYS A 33  ? 1.7329 1.4414 1.2542 -0.0663 -0.0259 -0.2160 30  LYS A O     
171  C CB    . LYS A 33  ? 1.6080 1.4784 1.2214 -0.0332 -0.0436 -0.2150 30  LYS A CB    
172  C CG    . LYS A 33  ? 1.5375 1.4783 1.2055 -0.0475 -0.0457 -0.2239 30  LYS A CG    
173  C CD    . LYS A 33  ? 1.5576 1.5284 1.2379 -0.0300 -0.0406 -0.2311 30  LYS A CD    
174  C CE    . LYS A 33  ? 1.5202 1.5395 1.2448 -0.0499 -0.0341 -0.2468 30  LYS A CE    
175  N NZ    . LYS A 33  ? 1.4345 1.5159 1.2064 -0.0675 -0.0516 -0.2377 30  LYS A NZ    
176  N N     . THR A 34  ? 1.5602 1.2778 1.0696 -0.0251 -0.0262 -0.2120 31  THR A N     
177  C CA    . THR A 34  ? 1.6216 1.2545 1.0762 -0.0227 -0.0106 -0.2167 31  THR A CA    
178  C C     . THR A 34  ? 1.6531 1.2543 1.0804 -0.0211 -0.0222 -0.1990 31  THR A C     
179  O O     . THR A 34  ? 1.6678 1.3118 1.1172 -0.0205 -0.0436 -0.1822 31  THR A O     
180  C CB    . THR A 34  ? 1.6215 1.2301 1.0507 0.0036  -0.0036 -0.2187 31  THR A CB    
181  O OG1   . THR A 34  ? 1.5757 1.2312 1.0189 0.0299  -0.0239 -0.1985 31  THR A OG1   
182  C CG2   . THR A 34  ? 1.5463 1.1661 0.9905 -0.0009 0.0121  -0.2400 31  THR A CG2   
183  N N     . THR A 35  ? 1.6709 1.1963 1.0494 -0.0211 -0.0087 -0.2025 32  THR A N     
184  C CA    . THR A 35  ? 1.6318 1.1189 0.9790 -0.0204 -0.0174 -0.1871 32  THR A CA    
185  C C     . THR A 35  ? 1.6618 1.0687 0.9554 -0.0136 -0.0018 -0.1909 32  THR A C     
186  O O     . THR A 35  ? 1.6908 1.0684 0.9717 -0.0136 0.0166  -0.2073 32  THR A O     
187  C CB    . THR A 35  ? 1.5213 1.0054 0.8757 -0.0473 -0.0175 -0.1901 32  THR A CB    
188  O OG1   . THR A 35  ? 1.5843 1.0385 0.9104 -0.0446 -0.0297 -0.1731 32  THR A OG1   
189  C CG2   . THR A 35  ? 1.4292 0.8648 0.7661 -0.0681 0.0087  -0.2117 32  THR A CG2   
190  N N     . LEU A 36  ? 1.6040 0.9746 0.8657 -0.0084 -0.0100 -0.1754 33  LEU A N     
191  C CA    . LEU A 36  ? 1.6076 0.9019 0.8184 -0.0029 0.0033  -0.1772 33  LEU A CA    
192  C C     . LEU A 36  ? 1.5779 0.8226 0.7621 -0.0251 0.0116  -0.1806 33  LEU A C     
193  O O     . LEU A 36  ? 1.5515 0.8087 0.7399 -0.0325 -0.0020 -0.1689 33  LEU A O     
194  C CB    . LEU A 36  ? 1.5746 0.8607 0.7648 0.0235  -0.0113 -0.1555 33  LEU A CB    
195  C CG    . LEU A 36  ? 1.6936 0.9155 0.8406 0.0375  0.0025  -0.1592 33  LEU A CG    
196  C CD1   . LEU A 36  ? 1.7173 0.9646 0.8768 0.0605  0.0041  -0.1629 33  LEU A CD1   
197  C CD2   . LEU A 36  ? 1.7269 0.9122 0.8391 0.0490  -0.0079 -0.1383 33  LEU A CD2   
198  N N     . ILE A 37  ? 1.6011 0.7894 0.7572 -0.0353 0.0336  -0.1961 34  ILE A N     
199  C CA    . ILE A 37  ? 1.7188 0.8574 0.8471 -0.0554 0.0442  -0.1998 34  ILE A CA    
200  C C     . ILE A 37  ? 1.9154 0.9841 0.9926 -0.0463 0.0500  -0.1937 34  ILE A C     
201  O O     . ILE A 37  ? 1.9288 0.9664 0.9878 -0.0365 0.0607  -0.2006 34  ILE A O     
202  C CB    . ILE A 37  ? 1.6923 0.8220 0.8298 -0.0787 0.0654  -0.2212 34  ILE A CB    
203  C CG1   . ILE A 37  ? 1.5495 0.7451 0.7363 -0.0922 0.0593  -0.2258 34  ILE A CG1   
204  C CG2   . ILE A 37  ? 1.7836 0.8529 0.8848 -0.0960 0.0793  -0.2245 34  ILE A CG2   
205  C CD1   . ILE A 37  ? 1.5405 0.7313 0.7390 -0.1167 0.0793  -0.2447 34  ILE A CD1   
206  N N     . GLU A 38  ? 2.0219 1.0653 1.0754 -0.0497 0.0424  -0.1808 35  GLU A N     
207  C CA    . GLU A 38  ? 2.1965 1.1755 1.2021 -0.0420 0.0462  -0.1729 35  GLU A CA    
208  C C     . GLU A 38  ? 2.2876 1.2094 1.2629 -0.0626 0.0660  -0.1843 35  GLU A C     
209  O O     . GLU A 38  ? 2.2854 1.2183 1.2763 -0.0830 0.0758  -0.1963 35  GLU A O     
210  C CB    . GLU A 38  ? 2.2987 1.2804 1.2923 -0.0323 0.0252  -0.1499 35  GLU A CB    
211  C CG    . GLU A 38  ? 2.3607 1.3912 1.3768 -0.0089 0.0049  -0.1340 35  GLU A CG    
212  C CD    . GLU A 38  ? 2.4137 1.4410 1.4138 -0.0003 -0.0159 -0.1094 35  GLU A CD    
213  O OE1   . GLU A 38  ? 2.4779 1.4482 1.4371 -0.0026 -0.0119 -0.1037 35  GLU A OE1   
214  O OE2   . GLU A 38  ? 2.3775 1.4596 1.4061 0.0081  -0.0369 -0.0950 35  GLU A OE2   
215  N N     . ASP A 39  ? 2.3808 1.2427 1.3135 -0.0567 0.0718  -0.1795 36  ASP A N     
216  C CA    . ASP A 39  ? 2.4178 1.2222 1.3173 -0.0744 0.0892  -0.1868 36  ASP A CA    
217  C C     . ASP A 39  ? 2.3911 1.1802 1.2942 -0.0867 0.1100  -0.2066 36  ASP A C     
218  O O     . ASP A 39  ? 2.3151 1.1466 1.2532 -0.0901 0.1123  -0.2175 36  ASP A O     
219  C CB    . ASP A 39  ? 2.3842 1.1939 1.2839 -0.0918 0.0867  -0.1838 36  ASP A CB    
220  C CG    . ASP A 39  ? 2.4169 1.2260 1.3021 -0.0818 0.0668  -0.1634 36  ASP A CG    
221  O OD1   . ASP A 39  ? 2.3958 1.1956 1.2681 -0.0623 0.0566  -0.1508 36  ASP A OD1   
222  O OD2   . ASP A 39  ? 2.4667 1.2838 1.3525 -0.0932 0.0610  -0.1596 36  ASP A OD2   
223  N N     . VAL A 40  ? 2.4427 1.1709 1.3088 -0.0940 0.1244  -0.2104 37  VAL A N     
224  C CA    . VAL A 40  ? 2.4166 1.1215 1.2796 -0.1055 0.1431  -0.2268 37  VAL A CA    
225  C C     . VAL A 40  ? 2.3750 1.1024 1.2613 -0.1303 0.1549  -0.2388 37  VAL A C     
226  O O     . VAL A 40  ? 2.3115 1.0572 1.2200 -0.1373 0.1635  -0.2520 37  VAL A O     
227  C CB    . VAL A 40  ? 2.4387 1.0716 1.2551 -0.1081 0.1539  -0.2255 37  VAL A CB    
228  C CG1   . VAL A 40  ? 2.4627 1.0692 1.2526 -0.1145 0.1514  -0.2134 37  VAL A CG1   
229  C CG2   . VAL A 40  ? 2.4496 1.0579 1.2621 -0.1273 0.1734  -0.2409 37  VAL A CG2   
230  N N     . GLU A 41  ? 2.4059 1.1317 1.2868 -0.1431 0.1552  -0.2337 38  GLU A N     
231  C CA    . GLU A 41  ? 2.3570 1.1008 1.2569 -0.1663 0.1674  -0.2436 38  GLU A CA    
232  C C     . GLU A 41  ? 2.1302 0.9418 1.0804 -0.1689 0.1614  -0.2501 38  GLU A C     
233  O O     . GLU A 41  ? 2.0607 0.8872 1.0319 -0.1829 0.1738  -0.2628 38  GLU A O     
234  C CB    . GLU A 41  ? 2.4478 1.1738 1.3280 -0.1767 0.1684  -0.2361 38  GLU A CB    
235  C CG    . GLU A 41  ? 2.5774 1.2411 1.4160 -0.1872 0.1843  -0.2362 38  GLU A CG    
236  C CD    . GLU A 41  ? 2.5866 1.2452 1.4335 -0.2084 0.2048  -0.2491 38  GLU A CD    
237  O OE1   . GLU A 41  ? 2.6029 1.2356 1.4307 -0.2234 0.2172  -0.2484 38  GLU A OE1   
238  O OE2   . GLU A 41  ? 2.5440 1.2250 1.4162 -0.2100 0.2084  -0.2591 38  GLU A OE2   
239  N N     . PRO A 42  ? 2.0087 0.8623 0.9789 -0.1563 0.1418  -0.2405 39  PRO A N     
240  C CA    . PRO A 42  ? 1.9483 0.8692 0.9677 -0.1589 0.1343  -0.2453 39  PRO A CA    
241  C C     . PRO A 42  ? 2.0694 1.0093 1.1112 -0.1570 0.1413  -0.2577 39  PRO A C     
242  O O     . PRO A 42  ? 2.0679 1.0509 1.1467 -0.1688 0.1448  -0.2670 39  PRO A O     
243  C CB    . PRO A 42  ? 1.8136 0.7660 0.8421 -0.1396 0.1100  -0.2300 39  PRO A CB    
244  C CG    . PRO A 42  ? 1.8034 0.7081 0.7897 -0.1358 0.1060  -0.2174 39  PRO A CG    
245  C CD    . PRO A 42  ? 1.9492 0.7911 0.8979 -0.1401 0.1247  -0.2235 39  PRO A CD    
246  N N     . LEU A 43  ? 2.1505 1.0574 1.1690 -0.1422 0.1430  -0.2576 40  LEU A N     
247  C CA    . LEU A 43  ? 2.1930 1.1113 1.2267 -0.1382 0.1490  -0.2695 40  LEU A CA    
248  C C     . LEU A 43  ? 2.2260 1.1271 1.2615 -0.1622 0.1694  -0.2843 40  LEU A C     
249  O O     . LEU A 43  ? 2.2035 1.1428 1.2725 -0.1706 0.1732  -0.2948 40  LEU A O     
250  C CB    . LEU A 43  ? 2.1962 1.0747 1.1987 -0.1166 0.1469  -0.2660 40  LEU A CB    
251  C CG    . LEU A 43  ? 2.1707 1.0677 1.1723 -0.0905 0.1271  -0.2502 40  LEU A CG    
252  C CD1   . LEU A 43  ? 2.1999 1.0489 1.1661 -0.0709 0.1281  -0.2470 40  LEU A CD1   
253  C CD2   . LEU A 43  ? 2.1212 1.0905 1.1685 -0.0806 0.1144  -0.2501 40  LEU A CD2   
254  N N     . MET A 44  ? 2.2654 1.1103 1.2651 -0.1737 0.1819  -0.2840 41  MET A N     
255  C CA    . MET A 44  ? 2.2368 1.0605 1.2339 -0.1971 0.2012  -0.2952 41  MET A CA    
256  C C     . MET A 44  ? 2.0412 0.9156 1.0792 -0.2165 0.2058  -0.3014 41  MET A C     
257  O O     . MET A 44  ? 1.8046 0.6990 0.8660 -0.2272 0.2136  -0.3124 41  MET A O     
258  C CB    . MET A 44  ? 2.3642 1.1271 1.3189 -0.2068 0.2119  -0.2903 41  MET A CB    
259  C CG    . MET A 44  ? 2.4425 1.1484 1.3560 -0.1923 0.2111  -0.2865 41  MET A CG    
260  S SD    . MET A 44  ? 4.0504 2.7266 2.9562 -0.1974 0.2229  -0.3000 41  MET A SD    
261  C CE    . MET A 44  ? 2.7355 1.3860 1.6328 -0.2301 0.2432  -0.3040 41  MET A CE    
262  N N     . HIS A 45  ? 2.1291 1.0233 1.1750 -0.2211 0.2005  -0.2942 42  HIS A N     
263  C CA    . HIS A 45  ? 2.2094 1.1497 1.2927 -0.2393 0.2046  -0.2991 42  HIS A CA    
264  C C     . HIS A 45  ? 2.2425 1.2490 1.3733 -0.2336 0.1930  -0.3032 42  HIS A C     
265  O O     . HIS A 45  ? 2.2571 1.3017 1.4228 -0.2499 0.1991  -0.3108 42  HIS A O     
266  C CB    . HIS A 45  ? 2.2345 1.1756 1.3108 -0.2438 0.2008  -0.2904 42  HIS A CB    
267  C CG    . HIS A 45  ? 2.3425 1.2278 1.3795 -0.2553 0.2160  -0.2883 42  HIS A CG    
268  N ND1   . HIS A 45  ? 2.4126 1.2579 1.4110 -0.2459 0.2109  -0.2777 42  HIS A ND1   
269  C CD2   . HIS A 45  ? 2.3951 1.2593 1.4258 -0.2755 0.2360  -0.2943 42  HIS A CD2   
270  C CE1   . HIS A 45  ? 2.4963 1.2989 1.4663 -0.2595 0.2273  -0.2779 42  HIS A CE1   
271  N NE2   . HIS A 45  ? 2.4913 1.3049 1.4804 -0.2775 0.2427  -0.2874 42  HIS A NE2   
272  N N     . SER A 46  ? 2.2470 1.2687 1.3798 -0.2107 0.1763  -0.2972 43  SER A N     
273  C CA    . SER A 46  ? 2.1558 1.2410 1.3324 -0.2031 0.1646  -0.2999 43  SER A CA    
274  C C     . SER A 46  ? 2.1421 1.2319 1.3322 -0.2100 0.1764  -0.3139 43  SER A C     
275  O O     . SER A 46  ? 2.1616 1.3002 1.3922 -0.2214 0.1776  -0.3212 43  SER A O     
276  C CB    . SER A 46  ? 2.0656 1.1632 1.2379 -0.1756 0.1448  -0.2886 43  SER A CB    
277  O OG    . SER A 46  ? 1.9596 1.0667 1.1289 -0.1712 0.1306  -0.2750 43  SER A OG    
278  N N     . ILE A 47  ? 2.0749 1.1120 1.2301 -0.2036 0.1845  -0.3174 44  ILE A N     
279  C CA    . ILE A 47  ? 2.0662 1.0967 1.2262 -0.2103 0.1956  -0.3306 44  ILE A CA    
280  C C     . ILE A 47  ? 2.0445 1.0632 1.2090 -0.2400 0.2137  -0.3382 44  ILE A C     
281  O O     . ILE A 47  ? 1.9280 0.9639 1.1136 -0.2526 0.2215  -0.3487 44  ILE A O     
282  C CB    . ILE A 47  ? 2.1167 1.0879 1.2340 -0.1951 0.1983  -0.3317 44  ILE A CB    
283  C CG1   . ILE A 47  ? 2.1478 1.1234 1.2545 -0.1653 0.1813  -0.3207 44  ILE A CG1   
284  C CG2   . ILE A 47  ? 2.1095 1.0787 1.2331 -0.1982 0.2058  -0.3453 44  ILE A CG2   
285  C CD1   . ILE A 47  ? 2.2368 1.1538 1.3009 -0.1484 0.1832  -0.3205 44  ILE A CD1   
286  N N     . ALA A 48  ? 2.0640 1.0539 1.2082 -0.2510 0.2203  -0.3320 45  ALA A N     
287  C CA    . ALA A 48  ? 2.1319 1.1095 1.2777 -0.2783 0.2380  -0.3365 45  ALA A CA    
288  C C     . ALA A 48  ? 2.2248 1.2635 1.4171 -0.2931 0.2377  -0.3384 45  ALA A C     
289  O O     . ALA A 48  ? 2.2841 1.3201 1.4806 -0.3141 0.2507  -0.3389 45  ALA A O     
290  C CB    . ALA A 48  ? 2.1345 1.0589 1.2397 -0.2830 0.2455  -0.3285 45  ALA A CB    
291  N N     . ALA A 49  ? 2.2017 1.2965 1.4295 -0.2818 0.2227  -0.3386 46  ALA A N     
292  C CA    . ALA A 49  ? 2.0997 1.2564 1.3748 -0.2946 0.2200  -0.3403 46  ALA A CA    
293  C C     . ALA A 49  ? 2.0977 1.3037 1.4125 -0.2951 0.2164  -0.3490 46  ALA A C     
294  O O     . ALA A 49  ? 2.0982 1.3329 1.4436 -0.3155 0.2257  -0.3559 46  ALA A O     
295  C CB    . ALA A 49  ? 2.0254 1.2099 1.3095 -0.2827 0.2027  -0.3298 46  ALA A CB    
296  N N     . GLY A 50  ? 2.1096 1.3260 1.4236 -0.2722 0.2031  -0.3481 47  GLY A N     
297  C CA    . GLY A 50  ? 2.1035 1.3664 1.4521 -0.2693 0.1985  -0.3560 47  GLY A CA    
298  C C     . GLY A 50  ? 2.0373 1.3309 1.3941 -0.2414 0.1788  -0.3499 47  GLY A C     
299  O O     . GLY A 50  ? 1.8719 1.2149 1.2620 -0.2363 0.1720  -0.3543 47  GLY A O     
300  N N     . VAL A 51  ? 2.0802 1.3455 1.4067 -0.2234 0.1696  -0.3387 48  VAL A N     
301  C CA    . VAL A 51  ? 2.0077 1.2992 1.3386 -0.1959 0.1505  -0.3298 48  VAL A CA    
302  C C     . VAL A 51  ? 2.0644 1.3314 1.3749 -0.1779 0.1528  -0.3356 48  VAL A C     
303  O O     . VAL A 51  ? 2.0581 1.2675 1.3346 -0.1829 0.1670  -0.3427 48  VAL A O     
304  C CB    . VAL A 51  ? 1.9192 1.1858 1.2224 -0.1833 0.1397  -0.3147 48  VAL A CB    
305  C CG1   . VAL A 51  ? 1.8098 1.1083 1.1206 -0.1556 0.1191  -0.3031 48  VAL A CG1   
306  C CG2   . VAL A 51  ? 1.9328 1.2179 1.2515 -0.2003 0.1374  -0.3098 48  VAL A CG2   
307  N N     . GLU A 52  ? 2.0326 1.3439 1.3635 -0.1567 0.1384  -0.3319 49  GLU A N     
308  C CA    . GLU A 52  ? 2.0309 1.3245 1.3442 -0.1363 0.1394  -0.3371 49  GLU A CA    
309  C C     . GLU A 52  ? 1.9287 1.2107 1.2189 -0.1062 0.1256  -0.3229 49  GLU A C     
310  O O     . GLU A 52  ? 1.8791 1.2100 1.1928 -0.0942 0.1084  -0.3101 49  GLU A O     
311  C CB    . GLU A 52  ? 2.0883 1.4435 1.4436 -0.1348 0.1360  -0.3453 49  GLU A CB    
312  C CG    . GLU A 52  ? 2.1443 1.5248 1.5316 -0.1654 0.1467  -0.3567 49  GLU A CG    
313  C CD    . GLU A 52  ? 2.1578 1.5935 1.5826 -0.1642 0.1445  -0.3658 49  GLU A CD    
314  O OE1   . GLU A 52  ? 2.1481 1.5834 1.5627 -0.1410 0.1403  -0.3678 49  GLU A OE1   
315  O OE2   . GLU A 52  ? 2.1375 1.6168 1.6017 -0.1862 0.1471  -0.3708 49  GLU A OE2   
316  N N     . PHE A 53  ? 1.8467 1.0640 1.0910 -0.0944 0.1325  -0.3241 50  PHE A N     
317  C CA    . PHE A 53  ? 1.7787 0.9785 0.9975 -0.0662 0.1210  -0.3102 50  PHE A CA    
318  C C     . PHE A 53  ? 1.8036 1.0091 1.0178 -0.0396 0.1181  -0.3136 50  PHE A C     
319  O O     . PHE A 53  ? 1.8075 0.9742 1.0010 -0.0403 0.1304  -0.3273 50  PHE A O     
320  C CB    . PHE A 53  ? 1.7870 0.9102 0.9563 -0.0691 0.1288  -0.3064 50  PHE A CB    
321  C CG    . PHE A 53  ? 1.8153 0.9348 0.9840 -0.0858 0.1269  -0.2974 50  PHE A CG    
322  C CD1   . PHE A 53  ? 1.8026 0.9202 0.9821 -0.1149 0.1388  -0.3061 50  PHE A CD1   
323  C CD2   . PHE A 53  ? 1.7491 0.8664 0.9053 -0.0720 0.1130  -0.2798 50  PHE A CD2   
324  C CE1   . PHE A 53  ? 1.7800 0.8933 0.9571 -0.1287 0.1375  -0.2983 50  PHE A CE1   
325  C CE2   . PHE A 53  ? 1.7112 0.8226 0.8640 -0.0868 0.1108  -0.2721 50  PHE A CE2   
326  C CZ    . PHE A 53  ? 1.7294 0.8385 0.8921 -0.1145 0.1233  -0.2819 50  PHE A CZ    
327  N N     . ILE A 54  ? 1.7245 0.9782 0.9572 -0.0160 0.1014  -0.3005 51  ILE A N     
328  C CA    . ILE A 54  ? 1.6122 0.8750 0.8400 0.0131  0.0977  -0.3012 51  ILE A CA    
329  C C     . ILE A 54  ? 1.7074 0.8932 0.8819 0.0280  0.1052  -0.3019 51  ILE A C     
330  O O     . ILE A 54  ? 1.7490 0.9083 0.9061 0.0380  0.1134  -0.3141 51  ILE A O     
331  C CB    . ILE A 54  ? 1.5696 0.8956 0.8236 0.0368  0.0774  -0.2823 51  ILE A CB    
332  C CG1   . ILE A 54  ? 1.5485 0.9537 0.8574 0.0225  0.0684  -0.2815 51  ILE A CG1   
333  C CG2   . ILE A 54  ? 1.5730 0.9053 0.8182 0.0694  0.0748  -0.2819 51  ILE A CG2   
334  C CD1   . ILE A 54  ? 1.5676 1.0398 0.9056 0.0435  0.0468  -0.2617 51  ILE A CD1   
335  N N     . GLU A 55  ? 1.8740 1.0229 1.0221 0.0289  0.1018  -0.2887 52  GLU A N     
336  C CA    . GLU A 55  ? 1.9313 1.0059 1.0289 0.0411  0.1081  -0.2876 52  GLU A CA    
337  C C     . GLU A 55  ? 1.9974 1.0373 1.0715 0.0346  0.1047  -0.2732 52  GLU A C     
338  O O     . GLU A 55  ? 1.9846 1.0628 1.0775 0.0357  0.0913  -0.2578 52  GLU A O     
339  C CB    . GLU A 55  ? 1.8589 0.9402 0.9470 0.0774  0.1005  -0.2810 52  GLU A CB    
340  C CG    . GLU A 55  ? 1.9542 0.9584 0.9911 0.0914  0.1076  -0.2821 52  GLU A CG    
341  C CD    . GLU A 55  ? 2.1255 1.1364 1.1539 0.1273  0.1027  -0.2792 52  GLU A CD    
342  O OE1   . GLU A 55  ? 2.1564 1.2142 1.2021 0.1489  0.0885  -0.2616 52  GLU A OE1   
343  O OE2   . GLU A 55  ? 2.2371 1.2060 1.2408 0.1342  0.1126  -0.2938 52  GLU A OE2   
344  N N     . VAL A 56  ? 2.0387 1.0052 1.0708 0.0275  0.1163  -0.2780 53  VAL A N     
345  C CA    . VAL A 56  ? 2.0316 0.9579 1.0364 0.0212  0.1148  -0.2655 53  VAL A CA    
346  C C     . VAL A 56  ? 2.1288 1.0099 1.0957 0.0469  0.1111  -0.2551 53  VAL A C     
347  O O     . VAL A 56  ? 2.1123 0.9577 1.0574 0.0588  0.1182  -0.2643 53  VAL A O     
348  C CB    . VAL A 56  ? 2.0304 0.9076 1.0161 -0.0088 0.1308  -0.2765 53  VAL A CB    
349  C CG1   . VAL A 56  ? 2.0405 0.8646 0.9889 -0.0113 0.1308  -0.2645 53  VAL A CG1   
350  C CG2   . VAL A 56  ? 1.7865 0.7090 0.8093 -0.0346 0.1333  -0.2824 53  VAL A CG2   
351  N N     . TYR A 57  ? 2.2100 1.0920 1.1686 0.0553  0.0994  -0.2356 54  TYR A N     
352  C CA    . TYR A 57  ? 2.2944 1.1363 1.2188 0.0790  0.0950  -0.2230 54  TYR A CA    
353  C C     . TYR A 57  ? 2.3911 1.1725 1.2790 0.0654  0.0993  -0.2165 54  TYR A C     
354  O O     . TYR A 57  ? 2.4076 1.1788 1.2963 0.0386  0.1064  -0.2222 54  TYR A O     
355  C CB    . TYR A 57  ? 2.2533 1.1471 1.1968 0.1038  0.0762  -0.2025 54  TYR A CB    
356  C CG    . TYR A 57  ? 2.2478 1.2064 1.2286 0.1187  0.0709  -0.2067 54  TYR A CG    
357  C CD1   . TYR A 57  ? 2.1703 1.1970 1.1952 0.1075  0.0628  -0.2057 54  TYR A CD1   
358  C CD2   . TYR A 57  ? 2.2905 1.2421 1.2620 0.1442  0.0737  -0.2117 54  TYR A CD2   
359  C CE1   . TYR A 57  ? 2.1453 1.2333 1.2051 0.1205  0.0576  -0.2091 54  TYR A CE1   
360  C CE2   . TYR A 57  ? 2.2452 1.2569 1.2498 0.1585  0.0692  -0.2155 54  TYR A CE2   
361  C CZ    . TYR A 57  ? 2.1841 1.2650 1.2335 0.1462  0.0611  -0.2139 54  TYR A CZ    
362  O OH    . TYR A 57  ? 2.1255 1.2683 1.2088 0.1599  0.0563  -0.2171 54  TYR A OH    
363  N N     . GLY A 58  ? 2.4718 1.2143 1.3280 0.0842  0.0953  -0.2040 55  GLY A N     
364  C CA    . GLY A 58  ? 2.5911 1.2758 1.4113 0.0731  0.0987  -0.1966 55  GLY A CA    
365  C C     . GLY A 58  ? 2.7269 1.3836 1.5198 0.0972  0.0901  -0.1785 55  GLY A C     
366  O O     . GLY A 58  ? 2.7246 1.3830 1.5144 0.1228  0.0876  -0.1771 55  GLY A O     
367  N N     . SER A 59  ? 2.8540 1.4847 1.6265 0.0893  0.0858  -0.1643 56  SER A N     
368  C CA    . SER A 59  ? 2.9298 1.5325 1.6759 0.1094  0.0774  -0.1450 56  SER A CA    
369  C C     . SER A 59  ? 3.0346 1.5684 1.7427 0.1154  0.0887  -0.1524 56  SER A C     
370  O O     . SER A 59  ? 3.0100 1.4997 1.6995 0.0946  0.1018  -0.1658 56  SER A O     
371  C CB    . SER A 59  ? 2.8950 1.4880 1.6290 0.0966  0.0696  -0.1283 56  SER A CB    
372  O OG    . SER A 59  ? 2.9178 1.4947 1.6321 0.1165  0.0588  -0.1069 56  SER A OG    
373  N N     . ASP A 60  ? 3.1752 1.7007 1.8720 0.1440  0.0831  -0.1427 57  ASP A N     
374  C CA    . ASP A 60  ? 3.3403 1.8027 2.0024 0.1536  0.0921  -0.1497 57  ASP A CA    
375  C C     . ASP A 60  ? 3.4156 1.8140 2.0401 0.1399  0.0960  -0.1428 57  ASP A C     
376  O O     . ASP A 60  ? 3.4635 1.8170 2.0694 0.1200  0.1083  -0.1569 57  ASP A O     
377  C CB    . ASP A 60  ? 3.3985 1.8707 2.0586 0.1899  0.0847  -0.1397 57  ASP A CB    
378  C CG    . ASP A 60  ? 3.4357 1.9288 2.0969 0.2050  0.0695  -0.1118 57  ASP A CG    
379  O OD1   . ASP A 60  ? 3.4506 1.9626 2.1206 0.1881  0.0627  -0.1011 57  ASP A OD1   
380  O OD2   . ASP A 60  ? 3.4488 1.9390 2.1015 0.2339  0.0642  -0.1001 57  ASP A OD2   
381  N N     . SER A 61  ? 3.4123 1.8075 2.0258 0.1502  0.0851  -0.1202 58  SER A N     
382  C CA    . SER A 61  ? 3.4385 1.7759 2.0167 0.1384  0.0874  -0.1115 58  SER A CA    
383  C C     . SER A 61  ? 3.3870 1.7234 1.9665 0.1064  0.0916  -0.1152 58  SER A C     
384  O O     . SER A 61  ? 3.3982 1.7347 1.9705 0.0995  0.0840  -0.0993 58  SER A O     
385  C CB    . SER A 61  ? 3.4485 1.7866 2.0162 0.1578  0.0737  -0.0850 58  SER A CB    
386  O OG    . SER A 61  ? 3.3849 1.7814 1.9796 0.1587  0.0601  -0.0705 58  SER A OG    
387  N N     . SER A 62  ? 3.3199 1.6550 1.9080 0.0874  0.1039  -0.1362 59  SER A N     
388  C CA    . SER A 62  ? 3.2437 1.5799 1.8351 0.0575  0.1103  -0.1421 59  SER A CA    
389  C C     . SER A 62  ? 3.2485 1.5791 1.8482 0.0414  0.1248  -0.1654 59  SER A C     
390  O O     . SER A 62  ? 3.1811 1.5569 1.8118 0.0444  0.1247  -0.1757 59  SER A O     
391  C CB    . SER A 62  ? 3.0965 1.4943 1.7188 0.0546  0.0991  -0.1334 59  SER A CB    
392  O OG    . SER A 62  ? 3.0459 1.4446 1.6711 0.0270  0.1058  -0.1399 59  SER A OG    
393  N N     . PRO A 63  ? 3.3110 1.5864 1.8829 0.0235  0.1367  -0.1727 60  PRO A N     
394  C CA    . PRO A 63  ? 3.3004 1.5601 1.8740 0.0068  0.1505  -0.1927 60  PRO A CA    
395  C C     . PRO A 63  ? 3.1624 1.4797 1.7752 -0.0041 0.1529  -0.2043 60  PRO A C     
396  O O     . PRO A 63  ? 3.1238 1.4796 1.7557 -0.0126 0.1485  -0.1983 60  PRO A O     
397  C CB    . PRO A 63  ? 3.3602 1.5726 1.9064 -0.0178 0.1598  -0.1915 60  PRO A CB    
398  C CG    . PRO A 63  ? 3.3948 1.5742 1.9127 -0.0058 0.1520  -0.1735 60  PRO A CG    
399  C CD    . PRO A 63  ? 3.3594 1.5859 1.8970 0.0160  0.1370  -0.1602 60  PRO A CD    
400  N N     . PHE A 64  ? 3.0598 1.3816 1.6837 -0.0039 0.1594  -0.2206 61  PHE A N     
401  C CA    . PHE A 64  ? 2.9534 1.3293 1.6153 -0.0142 0.1621  -0.2323 61  PHE A CA    
402  C C     . PHE A 64  ? 2.9087 1.2704 1.5703 -0.0462 0.1758  -0.2426 61  PHE A C     
403  O O     . PHE A 64  ? 2.9786 1.2871 1.6128 -0.0573 0.1851  -0.2478 61  PHE A O     
404  C CB    . PHE A 64  ? 2.9165 1.3074 1.5914 0.0024  0.1617  -0.2444 61  PHE A CB    
405  C CG    . PHE A 64  ? 2.8069 1.2682 1.5261 0.0021  0.1585  -0.2506 61  PHE A CG    
406  C CD1   . PHE A 64  ? 2.7480 1.2244 1.4862 -0.0193 0.1685  -0.2664 61  PHE A CD1   
407  C CD2   . PHE A 64  ? 2.7266 1.2402 1.4692 0.0227  0.1448  -0.2394 61  PHE A CD2   
408  C CE1   . PHE A 64  ? 2.6574 1.1995 1.4376 -0.0202 0.1652  -0.2718 61  PHE A CE1   
409  C CE2   . PHE A 64  ? 2.6294 1.2093 1.4139 0.0219  0.1409  -0.2444 61  PHE A CE2   
410  C CZ    . PHE A 64  ? 2.6125 1.2066 1.4160 0.0004  0.1512  -0.2610 61  PHE A CZ    
411  N N     . PRO A 65  ? 2.7693 1.1795 1.4616 -0.0610 0.1768  -0.2446 62  PRO A N     
412  C CA    . PRO A 65  ? 2.7332 1.1374 1.4288 -0.0911 0.1900  -0.2526 62  PRO A CA    
413  C C     . PRO A 65  ? 2.7823 1.1840 1.4879 -0.1021 0.2002  -0.2697 62  PRO A C     
414  O O     . PRO A 65  ? 2.7654 1.2169 1.5060 -0.1043 0.1998  -0.2781 62  PRO A O     
415  C CB    . PRO A 65  ? 2.5977 1.0612 1.3267 -0.0979 0.1852  -0.2490 62  PRO A CB    
416  C CG    . PRO A 65  ? 2.5553 1.0658 1.3089 -0.0738 0.1708  -0.2451 62  PRO A CG    
417  C CD    . PRO A 65  ? 2.6329 1.1079 1.3594 -0.0495 0.1645  -0.2383 62  PRO A CD    
418  N N     . SER A 66  ? 2.8453 1.1892 1.5200 -0.1096 0.2084  -0.2741 63  SER A N     
419  C CA    . SER A 66  ? 2.8296 1.1638 1.5091 -0.1230 0.2177  -0.2892 63  SER A CA    
420  C C     . SER A 66  ? 2.8512 1.2143 1.5546 -0.1514 0.2280  -0.2941 63  SER A C     
421  O O     . SER A 66  ? 2.8363 1.1878 1.5301 -0.1674 0.2337  -0.2869 63  SER A O     
422  C CB    . SER A 66  ? 2.7697 1.0321 1.4084 -0.1272 0.2229  -0.2905 63  SER A CB    
423  O OG    . SER A 66  ? 2.7317 0.9628 1.3498 -0.1467 0.2298  -0.2824 63  SER A OG    
424  N N     . GLU A 67  ? 2.8503 1.2512 1.5843 -0.1569 0.2305  -0.3060 64  GLU A N     
425  C CA    . GLU A 67  ? 2.7931 1.2331 1.5579 -0.1814 0.2391  -0.3111 64  GLU A CA    
426  C C     . GLU A 67  ? 2.7649 1.2739 1.5721 -0.1708 0.2311  -0.3148 64  GLU A C     
427  O O     . GLU A 67  ? 2.7664 1.3089 1.6025 -0.1824 0.2356  -0.3251 64  GLU A O     
428  C CB    . GLU A 67  ? 2.7175 1.1547 1.4764 -0.1973 0.2444  -0.3012 64  GLU A CB    
429  C CG    . GLU A 67  ? 2.6440 1.1231 1.4351 -0.2209 0.2535  -0.3056 64  GLU A CG    
430  C CD    . GLU A 67  ? 2.6612 1.1418 1.4467 -0.2318 0.2574  -0.2956 64  GLU A CD    
431  O OE1   . GLU A 67  ? 2.6921 1.1474 1.4518 -0.2198 0.2511  -0.2851 64  GLU A OE1   
432  O OE2   . GLU A 67  ? 2.6464 1.1530 1.4526 -0.2522 0.2667  -0.2980 64  GLU A OE2   
433  N N     . LEU A 68  ? 2.7208 1.2516 1.5320 -0.1491 0.2184  -0.3051 65  LEU A N     
434  C CA    . LEU A 68  ? 2.6822 1.2769 1.5310 -0.1348 0.2078  -0.3062 65  LEU A CA    
435  C C     . LEU A 68  ? 2.7855 1.3826 1.6401 -0.1242 0.2078  -0.3184 65  LEU A C     
436  O O     . LEU A 68  ? 2.7714 1.4212 1.6618 -0.1228 0.2050  -0.3253 65  LEU A O     
437  C CB    . LEU A 68  ? 2.6563 1.2610 1.4991 -0.1101 0.1930  -0.2918 65  LEU A CB    
438  C CG    . LEU A 68  ? 2.5921 1.2661 1.4733 -0.1023 0.1805  -0.2856 65  LEU A CG    
439  C CD1   . LEU A 68  ? 2.5784 1.2603 1.4534 -0.0720 0.1651  -0.2736 65  LEU A CD1   
440  C CD2   . LEU A 68  ? 2.5580 1.2858 1.4808 -0.1089 0.1822  -0.2978 65  LEU A CD2   
441  N N     . LEU A 69  ? 2.8666 1.4049 1.6847 -0.1167 0.2105  -0.3210 66  LEU A N     
442  C CA    . LEU A 69  ? 2.8974 1.4262 1.7125 -0.1057 0.2106  -0.3330 66  LEU A CA    
443  C C     . LEU A 69  ? 2.9254 1.4592 1.7553 -0.1314 0.2217  -0.3467 66  LEU A C     
444  O O     . LEU A 69  ? 2.9435 1.5091 1.7958 -0.1273 0.2205  -0.3571 66  LEU A O     
445  C CB    . LEU A 69  ? 2.9517 1.4101 1.7204 -0.0924 0.2103  -0.3315 66  LEU A CB    
446  C CG    . LEU A 69  ? 2.9468 1.3931 1.6970 -0.0671 0.1999  -0.3169 66  LEU A CG    
447  C CD1   . LEU A 69  ? 3.0141 1.3841 1.7170 -0.0642 0.2025  -0.3138 66  LEU A CD1   
448  C CD2   . LEU A 69  ? 2.9229 1.4077 1.6894 -0.0361 0.1889  -0.3163 66  LEU A CD2   
449  N N     . ASP A 70  ? 2.9215 1.4247 1.7386 -0.1580 0.2323  -0.3458 67  ASP A N     
450  C CA    . ASP A 70  ? 2.9292 1.4345 1.7588 -0.1851 0.2433  -0.3562 67  ASP A CA    
451  C C     . ASP A 70  ? 2.8780 1.4566 1.7572 -0.1943 0.2435  -0.3602 67  ASP A C     
452  O O     . ASP A 70  ? 2.8662 1.4658 1.7653 -0.2021 0.2465  -0.3714 67  ASP A O     
453  C CB    . ASP A 70  ? 2.9612 1.4254 1.7693 -0.2112 0.2544  -0.3508 67  ASP A CB    
454  C CG    . ASP A 70  ? 3.0738 1.4657 1.8337 -0.2043 0.2538  -0.3460 67  ASP A CG    
455  O OD1   . ASP A 70  ? 3.1089 1.4887 1.8524 -0.1811 0.2451  -0.3383 67  ASP A OD1   
456  O OD2   . ASP A 70  ? 3.1201 1.4677 1.8589 -0.2227 0.2615  -0.3489 67  ASP A OD2   
457  N N     . LEU A 71  ? 2.8597 1.4761 1.7581 -0.1937 0.2397  -0.3509 68  LEU A N     
458  C CA    . LEU A 71  ? 2.7976 1.4844 1.7437 -0.2020 0.2384  -0.3532 68  LEU A CA    
459  C C     . LEU A 71  ? 2.7123 1.4477 1.6833 -0.1770 0.2251  -0.3550 68  LEU A C     
460  O O     . LEU A 71  ? 2.6539 1.4520 1.6659 -0.1799 0.2208  -0.3555 68  LEU A O     
461  C CB    . LEU A 71  ? 2.8384 1.5445 1.7939 -0.2120 0.2388  -0.3427 68  LEU A CB    
462  C CG    . LEU A 71  ? 2.8751 1.5535 1.8191 -0.2404 0.2536  -0.3414 68  LEU A CG    
463  C CD1   . LEU A 71  ? 2.9161 1.5223 1.8108 -0.2394 0.2578  -0.3360 68  LEU A CD1   
464  C CD2   . LEU A 71  ? 2.8332 1.5475 1.7974 -0.2496 0.2536  -0.3339 68  LEU A CD2   
465  N N     . CYS A 72  ? 2.7203 1.4272 1.6665 -0.1521 0.2186  -0.3550 69  CYS A N     
466  C CA    . CYS A 72  ? 2.6629 1.4124 1.6292 -0.1263 0.2070  -0.3565 69  CYS A CA    
467  C C     . CYS A 72  ? 2.6917 1.4193 1.6465 -0.1191 0.2100  -0.3700 69  CYS A C     
468  O O     . CYS A 72  ? 2.6347 1.3970 1.6060 -0.0989 0.2025  -0.3738 69  CYS A O     
469  C CB    . CYS A 72  ? 2.6879 1.4310 1.6374 -0.0981 0.1947  -0.3427 69  CYS A CB    
470  S SG    . CYS A 72  ? 3.0198 1.8168 1.9973 -0.0982 0.1840  -0.3271 69  CYS A SG    
471  N N     . GLY A 73  ? 2.7880 1.4575 1.7135 -0.1356 0.2205  -0.3767 70  GLY A N     
472  C CA    . GLY A 73  ? 2.8255 1.4671 1.7363 -0.1323 0.2234  -0.3900 70  GLY A CA    
473  C C     . GLY A 73  ? 2.8033 1.4708 1.7414 -0.1595 0.2317  -0.4011 70  GLY A C     
474  O O     . GLY A 73  ? 2.7606 1.4380 1.7059 -0.1553 0.2312  -0.4127 70  GLY A O     
475  N N     . ARG A 74  ? 2.7997 1.4785 1.7527 -0.1873 0.2395  -0.3969 71  ARG A N     
476  C CA    . ARG A 74  ? 2.7554 1.4604 1.7363 -0.2158 0.2483  -0.4050 71  ARG A CA    
477  C C     . ARG A 74  ? 2.6406 1.4280 1.6740 -0.2150 0.2434  -0.4060 71  ARG A C     
478  O O     . ARG A 74  ? 2.5535 1.3736 1.6166 -0.2358 0.2491  -0.4129 71  ARG A O     
479  C CB    . ARG A 74  ? 2.7654 1.4452 1.7382 -0.2458 0.2598  -0.3991 71  ARG A CB    
480  C CG    . ARG A 74  ? 2.8598 1.4597 1.7827 -0.2503 0.2646  -0.3974 71  ARG A CG    
481  C CD    . ARG A 74  ? 2.8804 1.4606 1.7964 -0.2780 0.2757  -0.3891 71  ARG A CD    
482  N NE    . ARG A 74  ? 2.8590 1.4594 1.7815 -0.2726 0.2737  -0.3776 71  ARG A NE    
483  C CZ    . ARG A 74  ? 2.8793 1.4564 1.7872 -0.2885 0.2815  -0.3683 71  ARG A CZ    
484  N NH1   . ARG A 74  ? 2.8915 1.4262 1.7790 -0.3110 0.2917  -0.3681 71  ARG A NH1   
485  N NH2   . ARG A 74  ? 2.8886 1.4844 1.8013 -0.2819 0.2785  -0.3587 71  ARG A NH2   
486  N N     . GLN A 75  ? 2.6445 1.4656 1.6893 -0.1914 0.2320  -0.3980 72  GLN A N     
487  C CA    . GLN A 75  ? 2.6130 1.5132 1.7069 -0.1876 0.2245  -0.3972 72  GLN A CA    
488  C C     . GLN A 75  ? 2.5443 1.4681 1.6419 -0.1548 0.2122  -0.3983 72  GLN A C     
489  O O     . GLN A 75  ? 2.4165 1.4049 1.5506 -0.1445 0.2024  -0.3943 72  GLN A O     
490  C CB    . GLN A 75  ? 2.6565 1.5846 1.7659 -0.1910 0.2202  -0.3841 72  GLN A CB    
491  C CG    . GLN A 75  ? 2.7549 1.6364 1.8392 -0.2114 0.2306  -0.3786 72  GLN A CG    
492  C CD    . GLN A 75  ? 2.8089 1.6881 1.9051 -0.2441 0.2449  -0.3859 72  GLN A CD    
493  O OE1   . GLN A 75  ? 2.8755 1.7036 1.9431 -0.2600 0.2554  -0.3845 72  GLN A OE1   
494  N NE2   . GLN A 75  ? 2.7598 1.6959 1.8990 -0.2546 0.2451  -0.3926 72  GLN A NE2   
495  N N     . ASN A 76  ? 2.6127 1.4839 1.6719 -0.1381 0.2125  -0.4031 73  ASN A N     
496  C CA    . ASN A 76  ? 2.5889 1.4738 1.6443 -0.1038 0.2021  -0.4034 73  ASN A CA    
497  C C     . ASN A 76  ? 2.5656 1.4930 1.6372 -0.0822 0.1890  -0.3882 73  ASN A C     
498  O O     . ASN A 76  ? 2.5877 1.5791 1.6941 -0.0691 0.1799  -0.3866 73  ASN A O     
499  C CB    . ASN A 76  ? 2.5065 1.4325 1.5887 -0.1023 0.2018  -0.4164 73  ASN A CB    
500  C CG    . ASN A 76  ? 2.5959 1.4646 1.6447 -0.1049 0.2093  -0.4305 73  ASN A CG    
501  O OD1   . ASN A 76  ? 2.6662 1.4924 1.6989 -0.1314 0.2194  -0.4353 73  ASN A OD1   
502  N ND2   . ASN A 76  ? 2.5669 1.4341 1.6044 -0.0771 0.2039  -0.4367 73  ASN A ND2   
503  N N     . ILE A 77  ? 2.4656 1.3572 1.5115 -0.0792 0.1876  -0.3762 74  ILE A N     
504  C CA    . ILE A 77  ? 2.3391 1.2599 1.3926 -0.0588 0.1745  -0.3600 74  ILE A CA    
505  C C     . ILE A 77  ? 2.3278 1.1950 1.3378 -0.0327 0.1708  -0.3532 74  ILE A C     
506  O O     . ILE A 77  ? 2.3557 1.1595 1.3287 -0.0405 0.1775  -0.3518 74  ILE A O     
507  C CB    . ILE A 77  ? 2.2285 1.1591 1.2920 -0.0784 0.1743  -0.3496 74  ILE A CB    
508  C CG1   . ILE A 77  ? 2.1327 1.1161 1.2399 -0.1042 0.1783  -0.3561 74  ILE A CG1   
509  C CG2   . ILE A 77  ? 2.1406 1.0982 1.2093 -0.0576 0.1591  -0.3320 74  ILE A CG2   
510  C CD1   . ILE A 77  ? 2.0588 1.0537 1.1767 -0.1228 0.1783  -0.3469 74  ILE A CD1   
511  N N     . PRO A 78  ? 2.2589 1.1531 1.2739 -0.0013 0.1602  -0.3481 75  PRO A N     
512  C CA    . PRO A 78  ? 2.2147 1.0621 1.1905 0.0267  0.1566  -0.3418 75  PRO A CA    
513  C C     . PRO A 78  ? 2.1787 1.0096 1.1387 0.0320  0.1499  -0.3231 75  PRO A C     
514  O O     . PRO A 78  ? 1.9907 0.8647 0.9769 0.0239  0.1429  -0.3124 75  PRO A O     
515  C CB    . PRO A 78  ? 2.2299 1.1274 1.2254 0.0572  0.1470  -0.3404 75  PRO A CB    
516  C CG    . PRO A 78  ? 2.2615 1.2398 1.3089 0.0471  0.1404  -0.3373 75  PRO A CG    
517  C CD    . PRO A 78  ? 2.2445 1.2192 1.3047 0.0094  0.1504  -0.3462 75  PRO A CD    
518  N N     . VAL A 79  ? 2.2577 1.0255 1.1746 0.0453  0.1514  -0.3191 76  VAL A N     
519  C CA    . VAL A 79  ? 2.2492 0.9947 1.1465 0.0510  0.1453  -0.3012 76  VAL A CA    
520  C C     . VAL A 79  ? 2.3356 1.0511 1.2037 0.0842  0.1394  -0.2929 76  VAL A C     
521  O O     . VAL A 79  ? 2.3375 1.0066 1.1779 0.0934  0.1456  -0.3033 76  VAL A O     
522  C CB    . VAL A 79  ? 2.2393 0.9268 1.1093 0.0240  0.1556  -0.3029 76  VAL A CB    
523  C CG1   . VAL A 79  ? 2.3011 0.9324 1.1445 0.0144  0.1680  -0.3195 76  VAL A CG1   
524  C CG2   . VAL A 79  ? 2.2063 0.8570 1.0463 0.0341  0.1501  -0.2858 76  VAL A CG2   
525  N N     . ARG A 80  ? 2.3815 1.1229 1.2552 0.1019  0.1269  -0.2734 77  ARG A N     
526  C CA    . ARG A 80  ? 2.4906 1.2100 1.3399 0.1345  0.1205  -0.2622 77  ARG A CA    
527  C C     . ARG A 80  ? 2.5609 1.2647 1.3948 0.1373  0.1124  -0.2408 77  ARG A C     
528  O O     . ARG A 80  ? 2.5732 1.3137 1.4288 0.1248  0.1054  -0.2302 77  ARG A O     
529  C CB    . ARG A 80  ? 2.4680 1.2496 1.3451 0.1628  0.1111  -0.2582 77  ARG A CB    
530  C CG    . ARG A 80  ? 2.4146 1.2110 1.3043 0.1638  0.1184  -0.2790 77  ARG A CG    
531  C CD    . ARG A 80  ? 2.3054 1.1781 1.2315 0.1868  0.1083  -0.2736 77  ARG A CD    
532  N NE    . ARG A 80  ? 2.3086 1.1798 1.2195 0.2241  0.1006  -0.2595 77  ARG A NE    
533  C CZ    . ARG A 80  ? 2.2596 1.1962 1.1983 0.2488  0.0897  -0.2479 77  ARG A CZ    
534  N NH1   . ARG A 80  ? 2.1866 1.1949 1.1701 0.2394  0.0845  -0.2492 77  ARG A NH1   
535  N NH2   . ARG A 80  ? 2.2675 1.1991 1.1900 0.2830  0.0838  -0.2341 77  ARG A NH2   
536  N N     . LEU A 81  ? 2.6174 1.2659 1.4134 0.1536  0.1130  -0.2344 78  LEU A N     
537  C CA    . LEU A 81  ? 2.6598 1.2875 1.4374 0.1566  0.1057  -0.2139 78  LEU A CA    
538  C C     . LEU A 81  ? 2.7106 1.3854 1.5036 0.1854  0.0902  -0.1926 78  LEU A C     
539  O O     . LEU A 81  ? 2.7363 1.4249 1.5309 0.2135  0.0876  -0.1922 78  LEU A O     
540  C CB    . LEU A 81  ? 2.7108 1.2571 1.4410 0.1594  0.1129  -0.2151 78  LEU A CB    
541  C CG    . LEU A 81  ? 2.7192 1.2122 1.4290 0.1286  0.1264  -0.2302 78  LEU A CG    
542  C CD1   . LEU A 81  ? 2.7704 1.1859 1.4343 0.1341  0.1309  -0.2287 78  LEU A CD1   
543  C CD2   . LEU A 81  ? 2.6687 1.1768 1.3905 0.1004  0.1265  -0.2246 78  LEU A CD2   
544  N N     . ILE A 82  ? 2.7844 1.4836 1.5877 0.1782  0.0796  -0.1744 79  ILE A N     
545  C CA    . ILE A 82  ? 2.9047 1.6442 1.7196 0.2027  0.0634  -0.1504 79  ILE A CA    
546  C C     . ILE A 82  ? 3.0892 1.7767 1.8677 0.2089  0.0602  -0.1331 79  ILE A C     
547  O O     . ILE A 82  ? 3.1728 1.8046 1.9240 0.1889  0.0686  -0.1385 79  ILE A O     
548  C CB    . ILE A 82  ? 2.8811 1.6867 1.7337 0.1907  0.0506  -0.1394 79  ILE A CB    
549  C CG1   . ILE A 82  ? 2.8875 1.7339 1.7737 0.1735  0.0565  -0.1591 79  ILE A CG1   
550  C CG2   . ILE A 82  ? 2.8384 1.6980 1.7103 0.2181  0.0330  -0.1157 79  ILE A CG2   
551  C CD1   . ILE A 82  ? 2.9025 1.7928 1.8119 0.1955  0.0557  -0.1661 79  ILE A CD1   
552  N N     . ASP A 83  ? 3.1761 1.8829 1.9547 0.2363  0.0481  -0.1116 80  ASP A N     
553  C CA    . ASP A 83  ? 3.2866 1.9493 2.0332 0.2432  0.0435  -0.0925 80  ASP A CA    
554  C C     . ASP A 83  ? 3.3695 2.0523 2.1237 0.2277  0.0307  -0.0731 80  ASP A C     
555  O O     . ASP A 83  ? 3.3425 2.0882 2.1306 0.2259  0.0192  -0.0652 80  ASP A O     
556  C CB    . ASP A 83  ? 3.2516 1.9204 1.9916 0.2805  0.0372  -0.0772 80  ASP A CB    
557  C CG    . ASP A 83  ? 3.1544 1.9039 1.9337 0.3006  0.0252  -0.0666 80  ASP A CG    
558  O OD1   . ASP A 83  ? 3.0804 1.8789 1.8926 0.2864  0.0234  -0.0758 80  ASP A OD1   
559  O OD2   . ASP A 83  ? 3.1473 1.9124 1.9253 0.3308  0.0174  -0.0484 80  ASP A OD2   
560  N N     . SER A 84  ? 3.4593 2.0876 2.1809 0.2163  0.0323  -0.0654 81  SER A N     
561  C CA    . SER A 84  ? 3.4436 2.0804 2.1655 0.1998  0.0212  -0.0485 81  SER A CA    
562  C C     . SER A 84  ? 3.4558 2.1430 2.1954 0.2193  0.0008  -0.0202 81  SER A C     
563  O O     . SER A 84  ? 3.4544 2.1625 2.2013 0.2072  -0.0120 -0.0052 81  SER A O     
564  C CB    . SER A 84  ? 3.4330 1.9986 2.1132 0.1868  0.0271  -0.0449 81  SER A CB    
565  O OG    . SER A 84  ? 3.4045 1.9319 2.0725 0.1619  0.0434  -0.0680 81  SER A OG    
566  N N     . SER A 85  ? 3.4532 2.1594 2.1986 0.2499  -0.0025 -0.0122 82  SER A N     
567  C CA    . SER A 85  ? 3.3838 2.1434 2.1487 0.2707  -0.0216 0.0159  82  SER A CA    
568  C C     . SER A 85  ? 3.2609 2.0984 2.0714 0.2700  -0.0304 0.0138  82  SER A C     
569  O O     . SER A 85  ? 3.2832 2.1716 2.1152 0.2751  -0.0491 0.0367  82  SER A O     
570  C CB    . SER A 85  ? 3.4245 2.1753 2.1777 0.3053  -0.0211 0.0265  82  SER A CB    
571  O OG    . SER A 85  ? 3.4382 2.1925 2.1983 0.3181  -0.0083 0.0040  82  SER A OG    
572  N N     . ILE A 86  ? 3.0944 1.9407 1.9194 0.2630  -0.0176 -0.0131 83  ILE A N     
573  C CA    . ILE A 86  ? 2.8609 1.7793 1.7299 0.2598  -0.0241 -0.0182 83  ILE A CA    
574  C C     . ILE A 86  ? 2.8634 1.7835 1.7430 0.2251  -0.0211 -0.0325 83  ILE A C     
575  O O     . ILE A 86  ? 2.8103 1.7882 1.7237 0.2167  -0.0331 -0.0274 83  ILE A O     
576  C CB    . ILE A 86  ? 2.6525 1.5897 1.5354 0.2769  -0.0133 -0.0372 83  ILE A CB    
577  C CG1   . ILE A 86  ? 2.5548 1.5259 1.4449 0.3142  -0.0225 -0.0178 83  ILE A CG1   
578  C CG2   . ILE A 86  ? 2.5639 1.5582 1.4872 0.2620  -0.0140 -0.0517 83  ILE A CG2   
579  C CD1   . ILE A 86  ? 2.5776 1.4960 1.4300 0.3323  -0.0219 -0.0024 83  ILE A CD1   
580  N N     . VAL A 87  ? 2.9049 1.7616 1.7554 0.2053  -0.0054 -0.0497 84  VAL A N     
581  C CA    . VAL A 87  ? 2.8542 1.7054 1.7096 0.1728  -0.0009 -0.0620 84  VAL A CA    
582  C C     . VAL A 87  ? 2.8597 1.7320 1.7202 0.1636  -0.0191 -0.0400 84  VAL A C     
583  O O     . VAL A 87  ? 2.8652 1.7688 1.7478 0.1443  -0.0239 -0.0440 84  VAL A O     
584  C CB    . VAL A 87  ? 2.8265 1.6013 1.6440 0.1550  0.0174  -0.0780 84  VAL A CB    
585  C CG1   . VAL A 87  ? 2.7593 1.5280 1.5786 0.1232  0.0205  -0.0855 84  VAL A CG1   
586  C CG2   . VAL A 87  ? 2.8287 1.5829 1.6428 0.1589  0.0346  -0.1019 84  VAL A CG2   
587  N N     . ASN A 88  ? 2.8324 1.6865 1.6715 0.1777  -0.0298 -0.0163 85  ASN A N     
588  C CA    . ASN A 88  ? 2.7244 1.5947 1.5644 0.1708  -0.0491 0.0074  85  ASN A CA    
589  C C     . ASN A 88  ? 2.7023 1.6403 1.5728 0.1918  -0.0703 0.0311  85  ASN A C     
590  O O     . ASN A 88  ? 2.7190 1.6814 1.5963 0.1872  -0.0898 0.0525  85  ASN A O     
591  C CB    . ASN A 88  ? 2.6960 1.5027 1.4923 0.1694  -0.0487 0.0206  85  ASN A CB    
592  C CG    . ASN A 88  ? 2.6793 1.4215 1.4456 0.1473  -0.0290 -0.0005 85  ASN A CG    
593  O OD1   . ASN A 88  ? 2.6966 1.3813 1.4264 0.1474  -0.0236 0.0046  85  ASN A OD1   
594  N ND2   . ASN A 88  ? 2.6362 1.3891 1.4187 0.1281  -0.0184 -0.0233 85  ASN A ND2   
595  N N     . GLN A 89  ? 2.6784 1.6460 1.5663 0.2150  -0.0670 0.0277  86  GLN A N     
596  C CA    . GLN A 89  ? 2.6672 1.7065 1.5887 0.2359  -0.0854 0.0483  86  GLN A CA    
597  C C     . GLN A 89  ? 2.6825 1.7833 1.6446 0.2195  -0.0954 0.0437  86  GLN A C     
598  O O     . GLN A 89  ? 2.6774 1.8428 1.6707 0.2302  -0.1145 0.0629  86  GLN A O     
599  C CB    . GLN A 89  ? 2.6396 1.6932 1.5683 0.2642  -0.0762 0.0415  86  GLN A CB    
600  C CG    . GLN A 89  ? 2.5223 1.6563 1.4896 0.2867  -0.0925 0.0595  86  GLN A CG    
601  C CD    . GLN A 89  ? 2.4728 1.6167 1.4316 0.3102  -0.1084 0.0940  86  GLN A CD    
602  O OE1   . GLN A 89  ? 2.4821 1.5962 1.4191 0.3012  -0.1175 0.1117  86  GLN A OE1   
603  N NE2   . GLN A 89  ? 2.4085 1.5951 1.3842 0.3408  -0.1117 0.1044  86  GLN A NE2   
604  N N     . LEU A 90  ? 2.6884 1.7691 1.6503 0.1932  -0.0828 0.0192  87  LEU A N     
605  C CA    . LEU A 90  ? 2.6073 1.7415 1.6071 0.1759  -0.0896 0.0115  87  LEU A CA    
606  C C     . LEU A 90  ? 2.6683 1.7736 1.6555 0.1457  -0.0896 0.0059  87  LEU A C     
607  O O     . LEU A 90  ? 2.6115 1.7501 1.6258 0.1279  -0.0916 -0.0046 87  LEU A O     
608  C CB    . LEU A 90  ? 2.5061 1.6585 1.5278 0.1745  -0.0728 -0.0163 87  LEU A CB    
609  C CG    . LEU A 90  ? 2.4131 1.6146 1.4601 0.2016  -0.0743 -0.0147 87  LEU A CG    
610  C CD1   . LEU A 90  ? 2.3522 1.6329 1.4378 0.2111  -0.0991 0.0091  87  LEU A CD1   
611  C CD2   . LEU A 90  ? 2.4179 1.5791 1.4335 0.2279  -0.0670 -0.0087 87  LEU A CD2   
612  N N     . PHE A 91  ? 2.8083 1.8523 1.7545 0.1404  -0.0871 0.0131  88  PHE A N     
613  C CA    . PHE A 91  ? 2.9132 1.9212 1.8412 0.1129  -0.0835 0.0055  88  PHE A CA    
614  C C     . PHE A 91  ? 2.9862 1.9719 1.8890 0.1096  -0.1004 0.0303  88  PHE A C     
615  O O     . PHE A 91  ? 2.9401 1.9367 1.8387 0.1282  -0.1156 0.0552  88  PHE A O     
616  C CB    . PHE A 91  ? 2.9782 1.9213 1.8763 0.1015  -0.0571 -0.0186 88  PHE A CB    
617  C CG    . PHE A 91  ? 2.9650 1.9244 1.8864 0.0890  -0.0410 -0.0461 88  PHE A CG    
618  C CD1   . PHE A 91  ? 2.9556 1.8915 1.8708 0.0625  -0.0292 -0.0628 88  PHE A CD1   
619  C CD2   . PHE A 91  ? 2.9353 1.9339 1.8845 0.1038  -0.0375 -0.0546 88  PHE A CD2   
620  C CE1   . PHE A 91  ? 2.9144 1.8659 1.8516 0.0502  -0.0145 -0.0866 88  PHE A CE1   
621  C CE2   . PHE A 91  ? 2.8965 1.9096 1.8669 0.0912  -0.0231 -0.0792 88  PHE A CE2   
622  C CZ    . PHE A 91  ? 2.8843 1.8740 1.8492 0.0639  -0.0117 -0.0948 88  PHE A CZ    
623  N N     . LYS A 92  ? 3.1160 2.0703 2.0014 0.0859  -0.0975 0.0233  89  LYS A N     
624  C CA    . LYS A 92  ? 3.2495 2.1739 2.1056 0.0792  -0.1115 0.0433  89  LYS A CA    
625  C C     . LYS A 92  ? 3.3658 2.2491 2.2006 0.0528  -0.1005 0.0275  89  LYS A C     
626  O O     . LYS A 92  ? 3.3484 2.2593 2.2058 0.0376  -0.1004 0.0150  89  LYS A O     
627  C CB    . LYS A 92  ? 3.2130 2.1933 2.0933 0.0845  -0.1414 0.0691  89  LYS A CB    
628  C CG    . LYS A 92  ? 3.1844 2.1995 2.0889 0.0649  -0.1513 0.0629  89  LYS A CG    
629  C CD    . LYS A 92  ? 3.1651 2.2165 2.1058 0.0597  -0.1372 0.0373  89  LYS A CD    
630  C CE    . LYS A 92  ? 3.1454 2.1981 2.0931 0.0344  -0.1350 0.0223  89  LYS A CE    
631  N NZ    . LYS A 92  ? 3.1177 2.2031 2.0999 0.0273  -0.1201 -0.0026 89  LYS A NZ    
632  N N     . GLY A 93  ? 3.4857 2.3037 2.2770 0.0477  -0.0906 0.0280  90  GLY A N     
633  C CA    . GLY A 93  ? 3.5446 2.3215 2.3126 0.0243  -0.0788 0.0140  90  GLY A CA    
634  C C     . GLY A 93  ? 3.6283 2.3334 2.3488 0.0212  -0.0660 0.0146  90  GLY A C     
635  O O     . GLY A 93  ? 3.6362 2.3189 2.3313 0.0253  -0.0792 0.0358  90  GLY A O     
636  N N     . GLU A 94  ? 3.6980 2.3668 2.4059 0.0135  -0.0414 -0.0069 91  GLU A N     
637  C CA    . GLU A 94  ? 3.7188 2.4093 2.4540 0.0076  -0.0246 -0.0317 91  GLU A CA    
638  C C     . GLU A 94  ? 3.6868 2.4462 2.4691 0.0193  -0.0343 -0.0325 91  GLU A C     
639  O O     . GLU A 94  ? 3.6542 2.4554 2.4650 0.0089  -0.0401 -0.0379 91  GLU A O     
640  C CB    . GLU A 94  ? 3.7198 2.3978 2.4512 -0.0173 -0.0129 -0.0483 91  GLU A CB    
641  C CG    . GLU A 94  ? 3.7048 2.4064 2.4422 -0.0270 -0.0306 -0.0384 91  GLU A CG    
642  C CD    . GLU A 94  ? 3.6571 2.4205 2.4402 -0.0322 -0.0355 -0.0479 91  GLU A CD    
643  O OE1   . GLU A 94  ? 3.6509 2.4214 2.4507 -0.0411 -0.0173 -0.0693 91  GLU A OE1   
644  O OE2   . GLU A 94  ? 3.6234 2.4282 2.4259 -0.0282 -0.0583 -0.0333 91  GLU A OE2   
645  N N     . ARG A 95  ? 3.6736 2.4465 2.4649 0.0410  -0.0357 -0.0273 92  ARG A N     
646  C CA    . ARG A 95  ? 3.6875 2.4125 2.4481 0.0550  -0.0273 -0.0232 92  ARG A CA    
647  C C     . ARG A 95  ? 3.6528 2.3365 2.3997 0.0477  -0.0020 -0.0473 92  ARG A C     
648  O O     . ARG A 95  ? 3.6726 2.3497 2.4197 0.0634  0.0052  -0.0523 92  ARG A O     
649  C CB    . ARG A 95  ? 3.7187 2.4003 2.4411 0.0548  -0.0362 -0.0027 92  ARG A CB    
650  C CG    . ARG A 95  ? 3.7365 2.3726 2.4298 0.0704  -0.0297 0.0040  92  ARG A CG    
651  C CD    . ARG A 95  ? 3.7022 2.3751 2.4128 0.0978  -0.0439 0.0222  92  ARG A CD    
652  N NE    . ARG A 95  ? 3.6570 2.3702 2.3808 0.1009  -0.0686 0.0467  92  ARG A NE    
653  C CZ    . ARG A 95  ? 3.5947 2.3734 2.3578 0.1041  -0.0819 0.0499  92  ARG A CZ    
654  N NH1   . ARG A 95  ? 3.5801 2.3920 2.3735 0.1048  -0.0719 0.0298  92  ARG A NH1   
655  N NH2   . ARG A 95  ? 3.5468 2.3577 2.3188 0.1059  -0.1059 0.0740  92  ARG A NH2   
656  N N     . LYS A 96  ? 3.5758 2.2316 2.3102 0.0243  0.0111  -0.0616 93  LYS A N     
657  C CA    . LYS A 96  ? 3.4828 2.1020 2.2059 0.0150  0.0342  -0.0833 93  LYS A CA    
658  C C     . LYS A 96  ? 3.3725 2.0224 2.1250 -0.0018 0.0446  -0.1040 93  LYS A C     
659  O O     . LYS A 96  ? 3.4259 2.0439 2.1662 -0.0188 0.0627  -0.1199 93  LYS A O     
660  C CB    . LYS A 96  ? 3.4530 2.0045 2.1319 0.0027  0.0448  -0.0827 93  LYS A CB    
661  C CG    . LYS A 96  ? 3.3465 1.8887 2.0173 -0.0212 0.0491  -0.0873 93  LYS A CG    
662  C CD    . LYS A 96  ? 3.2981 1.7842 1.9396 -0.0369 0.0703  -0.1003 93  LYS A CD    
663  C CE    . LYS A 96  ? 3.2900 1.7260 1.8997 -0.0249 0.0736  -0.0935 93  LYS A CE    
664  N NZ    . LYS A 96  ? 3.2827 1.6699 1.8701 -0.0388 0.0941  -0.1078 93  LYS A NZ    
665  N N     . ALA A 97  ? 3.1748 1.8881 1.9670 0.0026  0.0328  -0.1027 94  ALA A N     
666  C CA    . ALA A 97  ? 2.9926 1.7409 1.8176 -0.0105 0.0421  -0.1219 94  ALA A CA    
667  C C     . ALA A 97  ? 2.9586 1.6800 1.7771 -0.0088 0.0608  -0.1392 94  ALA A C     
668  O O     . ALA A 97  ? 2.9339 1.6512 1.7601 -0.0262 0.0763  -0.1573 94  ALA A O     
669  C CB    . ALA A 97  ? 2.8885 1.7094 1.7575 -0.0004 0.0257  -0.1165 94  ALA A CB    
670  N N     . LYS A 98  ? 2.9695 1.6717 1.7729 0.0125  0.0586  -0.1325 95  LYS A N     
671  C CA    . LYS A 98  ? 2.9837 1.6489 1.7721 0.0167  0.0744  -0.1465 95  LYS A CA    
672  C C     . LYS A 98  ? 2.9071 1.6077 1.7275 0.0151  0.0822  -0.1651 95  LYS A C     
673  O O     . LYS A 98  ? 2.8601 1.5789 1.6914 0.0352  0.0792  -0.1663 95  LYS A O     
674  C CB    . LYS A 98  ? 3.0499 1.6510 1.8026 -0.0026 0.0904  -0.1541 95  LYS A CB    
675  C CG    . LYS A 98  ? 3.1560 1.6985 1.8674 0.0083  0.0908  -0.1435 95  LYS A CG    
676  C CD    . LYS A 98  ? 3.2019 1.7526 1.9053 0.0222  0.0725  -0.1196 95  LYS A CD    
677  C CE    . LYS A 98  ? 3.3006 1.7901 1.9620 0.0290  0.0741  -0.1091 95  LYS A CE    
678  N NZ    . LYS A 98  ? 3.3218 1.8199 1.9758 0.0428  0.0559  -0.0845 95  LYS A NZ    
679  N N     . THR A 99  ? 2.8973 1.6073 1.7321 -0.0088 0.0925  -0.1793 96  THR A N     
680  C CA    . THR A 99  ? 2.8732 1.6084 1.7345 -0.0147 0.1024  -0.1981 96  THR A CA    
681  C C     . THR A 99  ? 2.7706 1.5785 1.6786 -0.0189 0.0932  -0.1991 96  THR A C     
682  O O     . THR A 99  ? 2.7787 1.6027 1.6979 -0.0369 0.0920  -0.1985 96  THR A O     
683  C CB    . THR A 99  ? 2.9425 1.6366 1.7885 -0.0396 0.1222  -0.2140 96  THR A CB    
684  O OG1   . THR A 99  ? 3.0265 1.6530 1.8281 -0.0390 0.1287  -0.2099 96  THR A OG1   
685  C CG2   . THR A 99  ? 2.9574 1.6618 1.8203 -0.0420 0.1326  -0.2322 96  THR A CG2   
686  N N     . PHE A 100 ? 2.6628 1.5144 1.5976 -0.0018 0.0865  -0.2006 97  PHE A N     
687  C CA    . PHE A 100 ? 2.5442 1.4686 1.5258 -0.0043 0.0768  -0.2012 97  PHE A CA    
688  C C     . PHE A 100 ? 2.5051 1.4590 1.5116 0.0018  0.0828  -0.2161 97  PHE A C     
689  O O     . PHE A 100 ? 2.6010 1.5154 1.5864 0.0067  0.0948  -0.2268 97  PHE A O     
690  C CB    . PHE A 100 ? 2.5150 1.4795 1.5091 0.0140  0.0542  -0.1792 97  PHE A CB    
691  C CG    . PHE A 100 ? 2.5392 1.4987 1.5212 0.0437  0.0473  -0.1687 97  PHE A CG    
692  C CD1   . PHE A 100 ? 2.6234 1.5232 1.5628 0.0533  0.0499  -0.1605 97  PHE A CD1   
693  C CD2   . PHE A 100 ? 2.5025 1.5181 1.5159 0.0625  0.0384  -0.1665 97  PHE A CD2   
694  C CE1   . PHE A 100 ? 2.6783 1.5734 1.6067 0.0815  0.0441  -0.1503 97  PHE A CE1   
695  C CE2   . PHE A 100 ? 2.5517 1.5637 1.5535 0.0915  0.0329  -0.1563 97  PHE A CE2   
696  C CZ    . PHE A 100 ? 2.6500 1.6012 1.6092 0.1011  0.0358  -0.1482 97  PHE A CZ    
697  N N     . GLY A 101 ? 2.3468 1.3694 1.3975 0.0011  0.0738  -0.2166 98  GLY A N     
698  C CA    . GLY A 101 ? 2.2486 1.3053 1.3258 0.0062  0.0784  -0.2302 98  GLY A CA    
699  C C     . GLY A 101 ? 2.1238 1.2576 1.2521 -0.0012 0.0687  -0.2304 98  GLY A C     
700  O O     . GLY A 101 ? 2.1326 1.2822 1.2760 -0.0218 0.0672  -0.2300 98  GLY A O     
701  N N     . ILE A 102 ? 2.0290 1.2110 1.1837 0.0164  0.0620  -0.2309 99  ILE A N     
702  C CA    . ILE A 102 ? 1.8880 1.1477 1.0938 0.0112  0.0516  -0.2305 99  ILE A CA    
703  C C     . ILE A 102 ? 1.8192 1.0870 1.0455 -0.0155 0.0663  -0.2509 99  ILE A C     
704  O O     . ILE A 102 ? 1.8265 1.0537 1.0340 -0.0216 0.0834  -0.2668 99  ILE A O     
705  C CB    . ILE A 102 ? 1.9163 1.2251 1.1436 0.0381  0.0419  -0.2260 99  ILE A CB    
706  C CG1   . ILE A 102 ? 1.9112 1.1983 1.1099 0.0670  0.0324  -0.2080 99  ILE A CG1   
707  C CG2   . ILE A 102 ? 1.8846 1.2778 1.1641 0.0351  0.0257  -0.2187 99  ILE A CG2   
708  C CD1   . ILE A 102 ? 1.8620 1.1942 1.0780 0.0962  0.0241  -0.2023 99  ILE A CD1   
709  N N     . ALA A 103 ? 1.8221 1.1422 1.0869 -0.0319 0.0590  -0.2496 100 ALA A N     
710  C CA    . ALA A 103 ? 1.8435 1.1783 1.1325 -0.0581 0.0718  -0.2668 100 ALA A CA    
711  C C     . ALA A 103 ? 1.8065 1.2248 1.1509 -0.0618 0.0591  -0.2652 100 ALA A C     
712  O O     . ALA A 103 ? 1.7866 1.2496 1.1496 -0.0475 0.0392  -0.2489 100 ALA A O     
713  C CB    . ALA A 103 ? 1.8433 1.1389 1.1152 -0.0827 0.0811  -0.2690 100 ALA A CB    
714  N N     . ARG A 104 ? 1.6718 1.2551 0.6823 -0.0215 0.0971  -0.1257 101 ARG A N     
715  C CA    . ARG A 104 ? 1.6714 1.2645 0.6651 -0.0342 0.1119  -0.1138 101 ARG A CA    
716  C C     . ARG A 104 ? 1.5761 1.2019 0.6118 -0.0543 0.0944  -0.0899 101 ARG A C     
717  O O     . ARG A 104 ? 1.5861 1.1988 0.6132 -0.0692 0.0612  -0.0799 101 ARG A O     
718  C CB    . ARG A 104 ? 1.7623 1.2957 0.6619 -0.0420 0.1063  -0.1170 101 ARG A CB    
719  C CG    . ARG A 104 ? 1.8367 1.3284 0.6833 -0.0216 0.1251  -0.1409 101 ARG A CG    
720  C CD    . ARG A 104 ? 1.9692 1.4044 0.7199 -0.0300 0.1235  -0.1439 101 ARG A CD    
721  N NE    . ARG A 104 ? 1.9913 1.3797 0.6848 -0.0098 0.1418  -0.1675 101 ARG A NE    
722  C CZ    . ARG A 104 ? 2.0209 1.3511 0.6605 -0.0105 0.1217  -0.1817 101 ARG A CZ    
723  N NH1   . ARG A 104 ? 2.1090 1.4256 0.7492 -0.0335 0.0830  -0.1753 101 ARG A NH1   
724  N NH2   . ARG A 104 ? 1.9932 1.2777 0.5781 0.0110  0.1420  -0.2032 101 ARG A NH2   
725  N N     . VAL A 105 ? 1.4957 1.1638 0.5772 -0.0550 0.1182  -0.0818 102 VAL A N     
726  C CA    . VAL A 105 ? 1.3664 1.0616 0.4855 -0.0709 0.1064  -0.0592 102 VAL A CA    
727  C C     . VAL A 105 ? 1.4183 1.0806 0.4768 -0.0860 0.0864  -0.0419 102 VAL A C     
728  O O     . VAL A 105 ? 1.5521 1.1874 0.5526 -0.0864 0.1029  -0.0402 102 VAL A O     
729  C CB    . VAL A 105 ? 1.3094 1.0450 0.4769 -0.0712 0.1412  -0.0556 102 VAL A CB    
730  C CG1   . VAL A 105 ? 1.3302 1.0719 0.5061 -0.0875 0.1341  -0.0301 102 VAL A CG1   
731  C CG2   . VAL A 105 ? 1.2922 1.0768 0.5385 -0.0593 0.1488  -0.0698 102 VAL A CG2   
732  N N     . PRO A 106 ? 1.4691 1.1355 0.5403 -0.0972 0.0504  -0.0296 103 PRO A N     
733  C CA    . PRO A 106 ? 1.6057 1.2521 0.6279 -0.1097 0.0251  -0.0140 103 PRO A CA    
734  C C     . PRO A 106 ? 1.5808 1.2380 0.6021 -0.1113 0.0403  0.0074  103 PRO A C     
735  O O     . PRO A 106 ? 1.4501 1.1344 0.5217 -0.1082 0.0665  0.0110  103 PRO A O     
736  C CB    . PRO A 106 ? 1.5756 1.2408 0.6369 -0.1198 -0.0113 -0.0074 103 PRO A CB    
737  C CG    . PRO A 106 ? 1.5430 1.2167 0.6475 -0.1119 -0.0063 -0.0233 103 PRO A CG    
738  C CD    . PRO A 106 ? 1.4726 1.1644 0.6041 -0.0971 0.0315  -0.0309 103 PRO A CD    
739  N N     . ARG A 107 ? 1.5687 1.2028 0.5307 -0.1157 0.0238  0.0205  104 ARG A N     
740  C CA    . ARG A 107 ? 1.5136 1.1483 0.4638 -0.1145 0.0355  0.0439  104 ARG A CA    
741  C C     . ARG A 107 ? 1.4206 1.0953 0.4457 -0.1171 0.0284  0.0592  104 ARG A C     
742  O O     . ARG A 107 ? 1.3415 1.0412 0.4134 -0.1213 0.0031  0.0554  104 ARG A O     
743  C CB    . ARG A 107 ? 1.5330 1.1411 0.4089 -0.1150 0.0075  0.0557  104 ARG A CB    
744  C CG    . ARG A 107 ? 1.6090 1.2374 0.5017 -0.1235 -0.0412 0.0570  104 ARG A CG    
745  C CD    . ARG A 107 ? 1.7390 1.3612 0.5805 -0.1209 -0.0695 0.0748  104 ARG A CD    
746  N NE    . ARG A 107 ? 1.7659 1.4179 0.6329 -0.1310 -0.1154 0.0740  104 ARG A NE    
747  C CZ    . ARG A 107 ? 1.7150 1.4093 0.6513 -0.1330 -0.1294 0.0867  104 ARG A CZ    
748  N NH1   . ARG A 107 ? 1.7239 1.4320 0.7077 -0.1255 -0.1029 0.1004  104 ARG A NH1   
749  N NH2   . ARG A 107 ? 1.7251 1.4483 0.6836 -0.1439 -0.1686 0.0842  104 ARG A NH2   
750  N N     . PRO A 108 ? 1.4742 1.1500 0.5070 -0.1151 0.0529  0.0763  105 PRO A N     
751  C CA    . PRO A 108 ? 1.3921 1.0988 0.4876 -0.1166 0.0473  0.0916  105 PRO A CA    
752  C C     . PRO A 108 ? 1.4291 1.1489 0.5259 -0.1168 0.0022  0.1046  105 PRO A C     
753  O O     . PRO A 108 ? 1.5097 1.2102 0.5465 -0.1146 -0.0195 0.1109  105 PRO A O     
754  C CB    . PRO A 108 ? 1.4772 1.1618 0.5470 -0.1144 0.0791  0.1101  105 PRO A CB    
755  C CG    . PRO A 108 ? 1.5990 1.2554 0.6234 -0.1145 0.1144  0.0974  105 PRO A CG    
756  C CD    . PRO A 108 ? 1.5907 1.2334 0.5702 -0.1119 0.0902  0.0821  105 PRO A CD    
757  N N     . ALA A 109 ? 1.3985 1.1535 0.5633 -0.1190 -0.0116 0.1075  106 ALA A N     
758  C CA    . ALA A 109 ? 1.3923 1.1684 0.5697 -0.1201 -0.0514 0.1187  106 ALA A CA    
759  C C     . ALA A 109 ? 1.3558 1.1254 0.5024 -0.1107 -0.0591 0.1447  106 ALA A C     
760  O O     . ALA A 109 ? 1.3334 1.0855 0.4711 -0.1043 -0.0304 0.1574  106 ALA A O     
761  C CB    . ALA A 109 ? 1.2827 1.0950 0.5380 -0.1230 -0.0581 0.1167  106 ALA A CB    
762  N N     . ARG A 110 ? 1.3353 1.1186 0.4649 -0.1094 -0.0974 0.1519  107 ARG A N     
763  C CA    . ARG A 110 ? 1.3818 1.1639 0.4814 -0.0950 -0.1107 0.1768  107 ARG A CA    
764  C C     . ARG A 110 ? 1.3535 1.1826 0.5079 -0.0926 -0.1415 0.1874  107 ARG A C     
765  O O     . ARG A 110 ? 1.2760 1.1355 0.4761 -0.1057 -0.1597 0.1739  107 ARG A O     
766  C CB    . ARG A 110 ? 1.5418 1.3003 0.5589 -0.0903 -0.1300 0.1766  107 ARG A CB    
767  C CG    . ARG A 110 ? 1.5940 1.3040 0.5499 -0.0917 -0.0989 0.1657  107 ARG A CG    
768  C CD    . ARG A 110 ? 1.7885 1.4670 0.6514 -0.0804 -0.1133 0.1732  107 ARG A CD    
769  N NE    . ARG A 110 ? 1.8732 1.5721 0.7193 -0.0875 -0.1592 0.1602  107 ARG A NE    
770  C CZ    . ARG A 110 ? 1.9086 1.5852 0.7099 -0.0980 -0.1649 0.1377  107 ARG A CZ    
771  N NH1   . ARG A 110 ? 1.8768 1.5127 0.6466 -0.0991 -0.1269 0.1268  107 ARG A NH1   
772  N NH2   . ARG A 110 ? 1.9490 1.6446 0.7378 -0.1078 -0.2077 0.1247  107 ARG A NH2   
773  N N     . PHE A 111 ? 1.3168 1.1488 0.4640 -0.0748 -0.1450 0.2118  108 PHE A N     
774  C CA    . PHE A 111 ? 1.3583 1.2371 0.5560 -0.0682 -0.1721 0.2236  108 PHE A CA    
775  C C     . PHE A 111 ? 1.3925 1.3097 0.5943 -0.0780 -0.2153 0.2126  108 PHE A C     
776  O O     . PHE A 111 ? 1.2387 1.2019 0.5003 -0.0845 -0.2345 0.2109  108 PHE A O     
777  C CB    . PHE A 111 ? 1.4229 1.2920 0.5942 -0.0419 -0.1714 0.2521  108 PHE A CB    
778  C CG    . PHE A 111 ? 1.4064 1.2498 0.5985 -0.0355 -0.1330 0.2639  108 PHE A CG    
779  C CD1   . PHE A 111 ? 1.2141 1.0840 0.4807 -0.0433 -0.1250 0.2589  108 PHE A CD1   
780  C CD2   . PHE A 111 ? 1.4685 1.2582 0.6021 -0.0225 -0.1041 0.2795  108 PHE A CD2   
781  C CE1   . PHE A 111 ? 1.2504 1.0968 0.5353 -0.0395 -0.0913 0.2668  108 PHE A CE1   
782  C CE2   . PHE A 111 ? 1.4860 1.2494 0.6387 -0.0209 -0.0675 0.2881  108 PHE A CE2   
783  C CZ    . PHE A 111 ? 1.3326 1.1262 0.5624 -0.0299 -0.0624 0.2806  108 PHE A CZ    
784  N N     . GLY A 112 ? 1.4366 1.3340 0.5734 -0.0805 -0.2291 0.2040  109 GLY A N     
785  C CA    . GLY A 112 ? 1.4054 1.3353 0.5391 -0.0937 -0.2702 0.1897  109 GLY A CA    
786  C C     . GLY A 112 ? 1.3897 1.3333 0.5717 -0.1211 -0.2718 0.1660  109 GLY A C     
787  O O     . GLY A 112 ? 1.3803 1.3670 0.5998 -0.1349 -0.3010 0.1586  109 GLY A O     
788  N N     . ASP A 113 ? 1.3649 1.2715 0.5451 -0.1283 -0.2393 0.1540  110 ASP A N     
789  C CA    . ASP A 113 ? 1.4243 1.3331 0.6416 -0.1491 -0.2368 0.1327  110 ASP A CA    
790  C C     . ASP A 113 ? 1.4402 1.3946 0.7349 -0.1539 -0.2460 0.1388  110 ASP A C     
791  O O     . ASP A 113 ? 1.5026 1.4776 0.8228 -0.1730 -0.2655 0.1264  110 ASP A O     
792  C CB    . ASP A 113 ? 1.4438 1.3140 0.6567 -0.1474 -0.1978 0.1228  110 ASP A CB    
793  C CG    . ASP A 113 ? 1.4844 1.3094 0.6222 -0.1424 -0.1829 0.1164  110 ASP A CG    
794  O OD1   . ASP A 113 ? 1.4771 1.2953 0.5601 -0.1402 -0.2044 0.1193  110 ASP A OD1   
795  O OD2   . ASP A 113 ? 1.5146 1.3132 0.6481 -0.1397 -0.1499 0.1078  110 ASP A OD2   
796  N N     . ILE A 114 ? 1.3688 1.3349 0.6978 -0.1375 -0.2297 0.1577  111 ILE A N     
797  C CA    . ILE A 114 ? 1.2954 1.3023 0.6941 -0.1380 -0.2349 0.1656  111 ILE A CA    
798  C C     . ILE A 114 ? 1.3958 1.4520 0.8099 -0.1381 -0.2705 0.1742  111 ILE A C     
799  O O     . ILE A 114 ? 1.4909 1.5834 0.9534 -0.1524 -0.2847 0.1689  111 ILE A O     
800  C CB    . ILE A 114 ? 1.1453 1.1483 0.5692 -0.1190 -0.2089 0.1832  111 ILE A CB    
801  C CG1   . ILE A 114 ? 0.9710 0.9332 0.3819 -0.1191 -0.1739 0.1732  111 ILE A CG1   
802  C CG2   . ILE A 114 ? 1.1853 1.2258 0.6778 -0.1189 -0.2120 0.1893  111 ILE A CG2   
803  C CD1   . ILE A 114 ? 0.9397 0.8945 0.3716 -0.1051 -0.1470 0.1869  111 ILE A CD1   
804  N N     . ALA A 115 ? 1.2051 1.2633 0.5771 -0.1213 -0.2840 0.1874  112 ALA A N     
805  C CA    . ALA A 115 ? 1.2454 1.3573 0.6312 -0.1150 -0.3197 0.1965  112 ALA A CA    
806  C C     . ALA A 115 ? 1.3701 1.5103 0.7595 -0.1424 -0.3513 0.1747  112 ALA A C     
807  O O     . ALA A 115 ? 1.4355 1.6347 0.8582 -0.1451 -0.3813 0.1764  112 ALA A O     
808  C CB    . ALA A 115 ? 1.2495 1.3489 0.5764 -0.0871 -0.3275 0.2146  112 ALA A CB    
809  N N     . SER A 116 ? 1.3916 1.4902 0.7473 -0.1631 -0.3437 0.1530  113 SER A N     
810  C CA    . SER A 116 ? 1.4642 1.5769 0.8162 -0.1930 -0.3699 0.1294  113 SER A CA    
811  C C     . SER A 116 ? 1.4406 1.5609 0.8501 -0.2178 -0.3603 0.1174  113 SER A C     
812  O O     . SER A 116 ? 1.4128 1.5701 0.8527 -0.2421 -0.3827 0.1057  113 SER A O     
813  C CB    . SER A 116 ? 1.5042 1.5609 0.7783 -0.2007 -0.3679 0.1116  113 SER A CB    
814  O OG    . SER A 116 ? 1.5369 1.5388 0.7975 -0.1984 -0.3304 0.1070  113 SER A OG    
815  N N     . ARG A 117 ? 1.4667 1.5519 0.8897 -0.2116 -0.3265 0.1198  114 ARG A N     
816  C CA    . ARG A 117 ? 1.4601 1.5459 0.9315 -0.2285 -0.3143 0.1119  114 ARG A CA    
817  C C     . ARG A 117 ? 1.4329 1.5762 0.9732 -0.2234 -0.3195 0.1282  114 ARG A C     
818  O O     . ARG A 117 ? 1.4193 1.5953 0.9699 -0.2016 -0.3273 0.1470  114 ARG A O     
819  C CB    . ARG A 117 ? 1.4129 1.4492 0.8767 -0.2182 -0.2792 0.1093  114 ARG A CB    
820  C CG    . ARG A 117 ? 1.4596 1.4398 0.8677 -0.2279 -0.2706 0.0880  114 ARG A CG    
821  C CD    . ARG A 117 ? 1.4689 1.4122 0.8708 -0.2104 -0.2370 0.0872  114 ARG A CD    
822  N NE    . ARG A 117 ? 1.4640 1.4206 0.9218 -0.2048 -0.2222 0.0935  114 ARG A NE    
823  C CZ    . ARG A 117 ? 1.4058 1.3414 0.8755 -0.2131 -0.2133 0.0813  114 ARG A CZ    
824  N NH1   . ARG A 117 ? 1.4901 1.3874 0.9202 -0.2280 -0.2164 0.0620  114 ARG A NH1   
825  N NH2   . ARG A 117 ? 1.1799 1.1278 0.6954 -0.2048 -0.2009 0.0884  114 ARG A NH2   
826  N N     . ARG A 118 ? 1.3548 1.5062 0.9382 -0.2417 -0.3134 0.1214  115 ARG A N     
827  C CA    . ARG A 118 ? 1.2951 1.4996 0.9444 -0.2384 -0.3149 0.1354  115 ARG A CA    
828  C C     . ARG A 118 ? 1.1728 1.3551 0.8489 -0.2249 -0.2842 0.1435  115 ARG A C     
829  O O     . ARG A 118 ? 1.2024 1.3328 0.8529 -0.2244 -0.2645 0.1339  115 ARG A O     
830  C CB    . ARG A 118 ? 1.4138 1.6531 1.0963 -0.2719 -0.3317 0.1224  115 ARG A CB    
831  C CG    . ARG A 118 ? 1.5492 1.8188 1.2112 -0.2891 -0.3658 0.1103  115 ARG A CG    
832  C CD    . ARG A 118 ? 1.6273 1.9417 1.3351 -0.3254 -0.3805 0.0971  115 ARG A CD    
833  N NE    . ARG A 118 ? 1.7110 1.9695 1.4014 -0.3566 -0.3650 0.0774  115 ARG A NE    
834  C CZ    . ARG A 118 ? 1.7172 1.9939 1.4407 -0.3934 -0.3678 0.0641  115 ARG A CZ    
835  N NH1   . ARG A 118 ? 1.6871 2.0459 1.4703 -0.4048 -0.3862 0.0672  115 ARG A NH1   
836  N NH2   . ARG A 118 ? 1.7388 1.9509 1.4352 -0.4183 -0.3506 0.0477  115 ARG A NH2   
837  N N     . GLY A 119 ? 1.0259 1.2497 0.7527 -0.2122 -0.2813 0.1600  116 GLY A N     
838  C CA    . GLY A 119 ? 0.8946 1.1017 0.6466 -0.1980 -0.2549 0.1676  116 GLY A CA    
839  C C     . GLY A 119 ? 0.8016 1.0092 0.5527 -0.1667 -0.2448 0.1855  116 GLY A C     
840  O O     . GLY A 119 ? 0.8857 1.0857 0.6014 -0.1554 -0.2514 0.1903  116 GLY A O     
841  N N     . ASP A 120 ? 0.6581 0.8698 0.4436 -0.1531 -0.2273 0.1951  117 ASP A N     
842  C CA    . ASP A 120 ? 0.7675 0.9741 0.5531 -0.1256 -0.2147 0.2107  117 ASP A CA    
843  C C     . ASP A 120 ? 0.7595 0.9178 0.4999 -0.1195 -0.2006 0.2048  117 ASP A C     
844  O O     . ASP A 120 ? 0.7279 0.8550 0.4481 -0.1316 -0.1934 0.1880  117 ASP A O     
845  C CB    . ASP A 120 ? 0.8238 1.0334 0.6485 -0.1154 -0.1964 0.2166  117 ASP A CB    
846  C CG    . ASP A 120 ? 0.8284 1.0857 0.6994 -0.1215 -0.2051 0.2227  117 ASP A CG    
847  O OD1   . ASP A 120 ? 0.8588 1.1602 0.7418 -0.1225 -0.2254 0.2296  117 ASP A OD1   
848  O OD2   . ASP A 120 ? 0.6393 0.8917 0.5346 -0.1243 -0.1912 0.2201  117 ASP A OD2   
849  N N     . VAL A 121 ? 0.7936 0.9447 0.5173 -0.0999 -0.1947 0.2188  118 VAL A N     
850  C CA    . VAL A 121 ? 0.7818 0.8894 0.4648 -0.0952 -0.1773 0.2147  118 VAL A CA    
851  C C     . VAL A 121 ? 0.8416 0.9305 0.5426 -0.0836 -0.1509 0.2172  118 VAL A C     
852  O O     . VAL A 121 ? 0.9073 1.0101 0.6333 -0.0696 -0.1476 0.2314  118 VAL A O     
853  C CB    . VAL A 121 ? 0.8259 0.9274 0.4662 -0.0831 -0.1855 0.2282  118 VAL A CB    
854  C CG1   . VAL A 121 ? 0.8584 0.9124 0.4528 -0.0830 -0.1644 0.2222  118 VAL A CG1   
855  C CG2   . VAL A 121 ? 0.8208 0.9505 0.4471 -0.0926 -0.2168 0.2256  118 VAL A CG2   
856  N N     . VAL A 122 ? 0.8584 0.9173 0.5471 -0.0893 -0.1323 0.2019  119 VAL A N     
857  C CA    . VAL A 122 ? 0.7530 0.7970 0.4594 -0.0819 -0.1082 0.1993  119 VAL A CA    
858  C C     . VAL A 122 ? 0.8205 0.8348 0.4948 -0.0772 -0.0891 0.2038  119 VAL A C     
859  O O     . VAL A 122 ? 0.8890 0.8849 0.5274 -0.0838 -0.0853 0.1969  119 VAL A O     
860  C CB    . VAL A 122 ? 0.7805 0.8178 0.5019 -0.0895 -0.0992 0.1773  119 VAL A CB    
861  C CG1   . VAL A 122 ? 0.7913 0.8174 0.5289 -0.0835 -0.0759 0.1707  119 VAL A CG1   
862  C CG2   . VAL A 122 ? 0.5887 0.6458 0.3388 -0.0925 -0.1122 0.1751  119 VAL A CG2   
863  N N     . VAL A 123 ? 0.7732 0.7785 0.4574 -0.0662 -0.0747 0.2152  120 VAL A N     
864  C CA    . VAL A 123 ? 0.8055 0.7755 0.4579 -0.0635 -0.0519 0.2209  120 VAL A CA    
865  C C     . VAL A 123 ? 0.8342 0.7910 0.5120 -0.0663 -0.0262 0.2107  120 VAL A C     
866  O O     . VAL A 123 ? 0.7913 0.7546 0.4965 -0.0579 -0.0253 0.2162  120 VAL A O     
867  C CB    . VAL A 123 ? 0.9872 0.9472 0.6126 -0.0460 -0.0574 0.2473  120 VAL A CB    
868  C CG1   . VAL A 123 ? 1.0672 0.9792 0.6516 -0.0439 -0.0295 0.2543  120 VAL A CG1   
869  C CG2   . VAL A 123 ? 0.9976 0.9781 0.5997 -0.0430 -0.0866 0.2551  120 VAL A CG2   
870  N N     . LEU A 124 ? 0.8777 0.8181 0.5469 -0.0784 -0.0051 0.1942  121 LEU A N     
871  C CA    . LEU A 124 ? 0.8856 0.8185 0.5811 -0.0849 0.0192  0.1802  121 LEU A CA    
872  C C     . LEU A 124 ? 0.9503 0.8425 0.6151 -0.0887 0.0475  0.1890  121 LEU A C     
873  O O     . LEU A 124 ? 1.0732 0.9437 0.6967 -0.0924 0.0564  0.1941  121 LEU A O     
874  C CB    . LEU A 124 ? 0.7931 0.7443 0.5101 -0.0962 0.0245  0.1520  121 LEU A CB    
875  C CG    . LEU A 124 ? 0.7285 0.7088 0.4663 -0.0921 0.0001  0.1426  121 LEU A CG    
876  C CD1   . LEU A 124 ? 0.7075 0.7010 0.4605 -0.0977 0.0074  0.1154  121 LEU A CD1   
877  C CD2   . LEU A 124 ? 0.6109 0.6059 0.3807 -0.0827 -0.0111 0.1479  121 LEU A CD2   
878  N N     . ASP A 125 ? 0.8906 0.7672 0.5710 -0.0880 0.0633  0.1906  122 ASP A N     
879  C CA    . ASP A 125 ? 0.8784 0.7069 0.5270 -0.0929 0.0937  0.1997  122 ASP A CA    
880  C C     . ASP A 125 ? 0.9945 0.8186 0.6740 -0.1126 0.1215  0.1757  122 ASP A C     
881  O O     . ASP A 125 ? 1.0252 0.8562 0.7369 -0.1114 0.1209  0.1684  122 ASP A O     
882  C CB    . ASP A 125 ? 1.0124 0.8138 0.6398 -0.0727 0.0899  0.2270  122 ASP A CB    
883  C CG    . ASP A 125 ? 1.2423 0.9818 0.8285 -0.0758 0.1236  0.2383  122 ASP A CG    
884  O OD1   . ASP A 125 ? 1.4432 1.1538 1.0183 -0.0609 0.1282  0.2547  122 ASP A OD1   
885  O OD2   . ASP A 125 ? 1.0530 0.7694 0.6156 -0.0928 0.1478  0.2310  122 ASP A OD2   
886  N N     . GLY A 126 ? 0.9594 0.7744 0.6294 -0.1312 0.1460  0.1620  123 GLY A N     
887  C CA    . GLY A 126 ? 0.9442 0.7606 0.6462 -0.1537 0.1743  0.1368  123 GLY A CA    
888  C C     . GLY A 126 ? 0.9269 0.8014 0.6838 -0.1602 0.1629  0.1052  123 GLY A C     
889  O O     . GLY A 126 ? 0.9463 0.8361 0.7380 -0.1786 0.1823  0.0795  123 GLY A O     
890  N N     . VAL A 127 ? 0.9577 0.8643 0.7217 -0.1448 0.1316  0.1061  124 VAL A N     
891  C CA    . VAL A 127 ? 0.8799 0.8356 0.6868 -0.1448 0.1190  0.0787  124 VAL A CA    
892  C C     . VAL A 127 ? 0.8939 0.8634 0.7022 -0.1580 0.1381  0.0595  124 VAL A C     
893  O O     . VAL A 127 ? 1.0015 0.9611 0.7752 -0.1548 0.1361  0.0683  124 VAL A O     
894  C CB    . VAL A 127 ? 0.8777 0.8532 0.6827 -0.1261 0.0843  0.0865  124 VAL A CB    
895  C CG1   . VAL A 127 ? 0.8166 0.8332 0.6570 -0.1225 0.0734  0.0594  124 VAL A CG1   
896  C CG2   . VAL A 127 ? 0.7392 0.7066 0.5467 -0.1130 0.0679  0.1051  124 VAL A CG2   
897  N N     . LYS A 128 ? 0.9009 0.8958 0.7503 -0.1727 0.1565  0.0319  125 LYS A N     
898  C CA    . LYS A 128 ? 1.0430 1.0564 0.9011 -0.1867 0.1802  0.0117  125 LYS A CA    
899  C C     . LYS A 128 ? 1.0450 1.1168 0.9472 -0.1778 0.1657  -0.0179 125 LYS A C     
900  O O     . LYS A 128 ? 1.1017 1.1906 0.9998 -0.1760 0.1721  -0.0286 125 LYS A O     
901  C CB    . LYS A 128 ? 1.1024 1.1028 0.9748 -0.2139 0.2185  0.0008  125 LYS A CB    
902  C CG    . LYS A 128 ? 1.2198 1.1529 1.0418 -0.2202 0.2364  0.0305  125 LYS A CG    
903  C CD    . LYS A 128 ? 1.3277 1.2418 1.1661 -0.2488 0.2738  0.0179  125 LYS A CD    
904  C CE    . LYS A 128 ? 1.3826 1.2200 1.1639 -0.2502 0.2915  0.0494  125 LYS A CE    
905  N NZ    . LYS A 128 ? 1.4389 1.2359 1.1567 -0.2452 0.3041  0.0736  125 LYS A NZ    
906  N N     . ILE A 129 ? 0.8783 0.9782 0.8184 -0.1696 0.1467  -0.0309 126 ILE A N     
907  C CA    . ILE A 129 ? 0.7669 0.9200 0.7450 -0.1557 0.1304  -0.0582 126 ILE A CA    
908  C C     . ILE A 129 ? 0.7810 0.9304 0.7293 -0.1342 0.1092  -0.0490 126 ILE A C     
909  O O     . ILE A 129 ? 0.7642 0.8911 0.6882 -0.1210 0.0862  -0.0286 126 ILE A O     
910  C CB    . ILE A 129 ? 0.7681 0.9417 0.7784 -0.1460 0.1097  -0.0689 126 ILE A CB    
911  C CG1   . ILE A 129 ? 0.7773 0.9453 0.8108 -0.1692 0.1299  -0.0777 126 ILE A CG1   
912  C CG2   . ILE A 129 ? 0.6863 0.9148 0.7323 -0.1286 0.0937  -0.0983 126 ILE A CG2   
913  C CD1   . ILE A 129 ? 0.6994 0.8813 0.7578 -0.1602 0.1105  -0.0880 126 ILE A CD1   
914  N N     . VAL A 130 ? 0.8532 1.0246 0.8041 -0.1318 0.1187  -0.0651 127 VAL A N     
915  C CA    . VAL A 130 ? 0.8433 1.0041 0.7603 -0.1135 0.1027  -0.0588 127 VAL A CA    
916  C C     . VAL A 130 ? 0.8499 1.0226 0.7744 -0.0891 0.0713  -0.0629 127 VAL A C     
917  O O     . VAL A 130 ? 0.8915 1.0383 0.7802 -0.0775 0.0538  -0.0489 127 VAL A O     
918  C CB    . VAL A 130 ? 0.7029 0.8863 0.6231 -0.1128 0.1217  -0.0788 127 VAL A CB    
919  C CG1   . VAL A 130 ? 0.8528 1.0079 0.7443 -0.1345 0.1527  -0.0677 127 VAL A CG1   
920  C CG2   . VAL A 130 ? 0.6362 0.8812 0.6178 -0.1103 0.1289  -0.1129 127 VAL A CG2   
921  N N     . GLY A 131 ? 0.7433 0.9531 0.7116 -0.0823 0.0648  -0.0828 128 GLY A N     
922  C CA    . GLY A 131 ? 0.7382 0.9553 0.7091 -0.0573 0.0372  -0.0864 128 GLY A CA    
923  C C     . GLY A 131 ? 0.7470 0.9219 0.6852 -0.0552 0.0203  -0.0570 128 GLY A C     
924  O O     . GLY A 131 ? 0.6239 0.7817 0.5370 -0.0390 0.0027  -0.0497 128 GLY A O     
925  N N     . ASN A 132 ? 0.7419 0.8993 0.6805 -0.0717 0.0276  -0.0407 129 ASN A N     
926  C CA    . ASN A 132 ? 0.7585 0.8834 0.6723 -0.0699 0.0138  -0.0128 129 ASN A CA    
927  C C     . ASN A 132 ? 0.8899 0.9855 0.7617 -0.0740 0.0112  0.0072  129 ASN A C     
928  O O     . ASN A 132 ? 0.9323 1.0133 0.7840 -0.0656 -0.0069 0.0191  129 ASN A O     
929  C CB    . ASN A 132 ? 0.8073 0.9210 0.7313 -0.0829 0.0240  -0.0018 129 ASN A CB    
930  C CG    . ASN A 132 ? 0.8919 1.0300 0.8531 -0.0796 0.0229  -0.0215 129 ASN A CG    
931  O OD1   . ASN A 132 ? 0.9935 1.1273 0.9689 -0.0939 0.0377  -0.0239 129 ASN A OD1   
932  N ND2   . ASN A 132 ? 0.8100 0.9697 0.7826 -0.0601 0.0053  -0.0362 129 ASN A ND2   
933  N N     . ILE A 133 ? 0.8293 0.9155 0.6864 -0.0882 0.0300  0.0097  130 ILE A N     
934  C CA    . ILE A 133 ? 0.8736 0.9322 0.6864 -0.0921 0.0272  0.0266  130 ILE A CA    
935  C C     . ILE A 133 ? 0.7834 0.8396 0.5778 -0.0802 0.0115  0.0192  130 ILE A C     
936  O O     . ILE A 133 ? 0.8173 0.8526 0.5828 -0.0800 -0.0045 0.0344  130 ILE A O     
937  C CB    . ILE A 133 ? 0.8700 0.9189 0.6656 -0.1059 0.0530  0.0249  130 ILE A CB    
938  C CG1   . ILE A 133 ? 0.9400 0.9771 0.7427 -0.1190 0.0712  0.0356  130 ILE A CG1   
939  C CG2   . ILE A 133 ? 0.8351 0.8553 0.5791 -0.1072 0.0472  0.0397  130 ILE A CG2   
940  C CD1   . ILE A 133 ? 0.9500 0.9696 0.7305 -0.1338 0.1011  0.0361  130 ILE A CD1   
941  N N     . GLY A 134 ? 0.7195 0.7976 0.5310 -0.0701 0.0165  -0.0052 131 GLY A N     
942  C CA    . GLY A 134 ? 0.7582 0.8278 0.5486 -0.0552 0.0044  -0.0138 131 GLY A CA    
943  C C     . GLY A 134 ? 0.8131 0.8695 0.5984 -0.0452 -0.0182 -0.0043 131 GLY A C     
944  O O     . GLY A 134 ? 0.8499 0.8781 0.6012 -0.0459 -0.0299 0.0050  131 GLY A O     
945  N N     . ALA A 135 ? 0.7892 0.8645 0.6068 -0.0375 -0.0231 -0.0076 132 ALA A N     
946  C CA    . ALA A 135 ? 0.7644 0.8265 0.5771 -0.0275 -0.0406 0.0019  132 ALA A CA    
947  C C     . ALA A 135 ? 0.6972 0.7385 0.4936 -0.0423 -0.0480 0.0281  132 ALA A C     
948  O O     . ALA A 135 ? 0.7418 0.7638 0.5203 -0.0407 -0.0605 0.0375  132 ALA A O     
949  C CB    . ALA A 135 ? 0.4540 0.5401 0.3012 -0.0165 -0.0428 -0.0069 132 ALA A CB    
950  N N     . ILE A 136 ? 0.5796 0.6253 0.3822 -0.0563 -0.0393 0.0393  133 ILE A N     
951  C CA    . ILE A 136 ? 0.6309 0.6642 0.4202 -0.0669 -0.0469 0.0637  133 ILE A CA    
952  C C     . ILE A 136 ? 0.7669 0.7808 0.5191 -0.0745 -0.0558 0.0688  133 ILE A C     
953  O O     . ILE A 136 ? 0.8555 0.8632 0.5981 -0.0807 -0.0695 0.0839  133 ILE A O     
954  C CB    . ILE A 136 ? 0.6808 0.7166 0.4765 -0.0758 -0.0339 0.0743  133 ILE A CB    
955  C CG1   . ILE A 136 ? 0.5958 0.6436 0.4243 -0.0707 -0.0291 0.0738  133 ILE A CG1   
956  C CG2   . ILE A 136 ? 0.6393 0.6629 0.4113 -0.0831 -0.0427 0.0979  133 ILE A CG2   
957  C CD1   . ILE A 136 ? 0.7210 0.7625 0.5527 -0.0791 -0.0127 0.0823  133 ILE A CD1   
958  N N     . VAL A 137 ? 0.7044 0.7110 0.4370 -0.0746 -0.0477 0.0543  134 VAL A N     
959  C CA    . VAL A 137 ? 0.6692 0.6526 0.3612 -0.0813 -0.0555 0.0550  134 VAL A CA    
960  C C     . VAL A 137 ? 0.7172 0.6844 0.3989 -0.0771 -0.0695 0.0517  134 VAL A C     
961  O O     . VAL A 137 ? 0.7654 0.7195 0.4292 -0.0888 -0.0830 0.0621  134 VAL A O     
962  C CB    . VAL A 137 ? 0.8951 0.8716 0.5663 -0.0792 -0.0406 0.0383  134 VAL A CB    
963  C CG1   . VAL A 137 ? 0.9236 0.8700 0.5484 -0.0837 -0.0497 0.0352  134 VAL A CG1   
964  C CG2   . VAL A 137 ? 0.8131 0.7959 0.4834 -0.0878 -0.0237 0.0442  134 VAL A CG2   
965  N N     . ARG A 138 ? 0.6606 0.6284 0.3526 -0.0604 -0.0659 0.0365  135 ARG A N     
966  C CA    . ARG A 138 ? 0.7813 0.7247 0.4573 -0.0532 -0.0754 0.0338  135 ARG A CA    
967  C C     . ARG A 138 ? 0.7936 0.7366 0.4803 -0.0634 -0.0862 0.0521  135 ARG A C     
968  O O     . ARG A 138 ? 0.8517 0.7707 0.5159 -0.0743 -0.0946 0.0569  135 ARG A O     
969  C CB    . ARG A 138 ? 1.0190 0.9685 0.7081 -0.0280 -0.0710 0.0176  135 ARG A CB    
970  C CG    . ARG A 138 ? 1.0966 1.0442 0.7717 -0.0133 -0.0619 -0.0034 135 ARG A CG    
971  C CD    . ARG A 138 ? 1.2077 1.1636 0.8940 0.0160  -0.0624 -0.0188 135 ARG A CD    
972  N NE    . ARG A 138 ? 1.2950 1.2132 0.9550 0.0251  -0.0720 -0.0124 135 ARG A NE    
973  C CZ    . ARG A 138 ? 1.2696 1.1879 0.9339 0.0503  -0.0760 -0.0184 135 ARG A CZ    
974  N NH1   . ARG A 138 ? 1.1867 1.1477 0.8855 0.0685  -0.0745 -0.0331 135 ARG A NH1   
975  N NH2   . ARG A 138 ? 1.3299 1.2050 0.9624 0.0567  -0.0812 -0.0103 135 ARG A NH2   
976  N N     . THR A 139 ? 0.7900 0.7597 0.5115 -0.0607 -0.0844 0.0612  136 THR A N     
977  C CA    . THR A 139 ? 0.7844 0.7595 0.5212 -0.0668 -0.0918 0.0784  136 THR A CA    
978  C C     . THR A 139 ? 0.7889 0.7667 0.5171 -0.0874 -0.1012 0.0931  136 THR A C     
979  O O     . THR A 139 ? 0.8112 0.7830 0.5368 -0.0978 -0.1094 0.1007  136 THR A O     
980  C CB    . THR A 139 ? 0.6579 0.6589 0.4302 -0.0585 -0.0864 0.0844  136 THR A CB    
981  O OG1   . THR A 139 ? 0.5882 0.5923 0.3702 -0.0398 -0.0807 0.0680  136 THR A OG1   
982  C CG2   . THR A 139 ? 0.6497 0.6567 0.4371 -0.0616 -0.0918 0.1019  136 THR A CG2   
983  N N     . SER A 140 ? 0.7324 0.7203 0.4556 -0.0933 -0.0998 0.0964  137 SER A N     
984  C CA    . SER A 140 ? 0.7295 0.7234 0.4409 -0.1090 -0.1116 0.1092  137 SER A CA    
985  C C     . SER A 140 ? 0.8714 0.8420 0.5506 -0.1228 -0.1216 0.1010  137 SER A C     
986  O O     . SER A 140 ? 0.9009 0.8784 0.5818 -0.1378 -0.1347 0.1087  137 SER A O     
987  C CB    . SER A 140 ? 0.8351 0.8335 0.5341 -0.1091 -0.1060 0.1128  137 SER A CB    
988  O OG    . SER A 140 ? 0.7403 0.7535 0.4657 -0.0994 -0.0949 0.1204  137 SER A OG    
989  N N     . LEU A 141 ? 0.8060 0.7498 0.4568 -0.1181 -0.1146 0.0840  138 LEU A N     
990  C CA    . LEU A 141 ? 0.7183 0.6293 0.3313 -0.1296 -0.1212 0.0736  138 LEU A CA    
991  C C     . LEU A 141 ? 0.8866 0.7825 0.5046 -0.1355 -0.1252 0.0748  138 LEU A C     
992  O O     . LEU A 141 ? 0.9780 0.8674 0.5861 -0.1569 -0.1363 0.0774  138 LEU A O     
993  C CB    . LEU A 141 ? 0.6925 0.5764 0.2765 -0.1163 -0.1093 0.0548  138 LEU A CB    
994  C CG    . LEU A 141 ? 0.8945 0.7327 0.4331 -0.1231 -0.1125 0.0415  138 LEU A CG    
995  C CD1   . LEU A 141 ? 0.9106 0.7402 0.4161 -0.1436 -0.1232 0.0410  138 LEU A CD1   
996  C CD2   . LEU A 141 ? 0.9802 0.7954 0.4992 -0.1003 -0.0984 0.0236  138 LEU A CD2   
997  N N     . ALA A 142 ? 0.7986 0.6892 0.4309 -0.1171 -0.1157 0.0723  139 ALA A N     
998  C CA    . ALA A 142 ? 0.7748 0.6413 0.4034 -0.1188 -0.1148 0.0737  139 ALA A CA    
999  C C     . ALA A 142 ? 0.7715 0.6634 0.4299 -0.1362 -0.1214 0.0903  139 ALA A C     
1000 O O     . ALA A 142 ? 0.8565 0.7273 0.5058 -0.1512 -0.1218 0.0916  139 ALA A O     
1001 C CB    . ALA A 142 ? 0.6775 0.5361 0.3123 -0.0905 -0.1047 0.0680  139 ALA A CB    
1002 N N     . LEU A 143 ? 0.8049 0.7408 0.4982 -0.1340 -0.1245 0.1028  140 LEU A N     
1003 C CA    . LEU A 143 ? 0.7034 0.6707 0.4301 -0.1449 -0.1295 0.1189  140 LEU A CA    
1004 C C     . LEU A 143 ? 0.8192 0.8149 0.5507 -0.1655 -0.1451 0.1252  140 LEU A C     
1005 O O     . LEU A 143 ? 0.7509 0.7853 0.5155 -0.1706 -0.1511 0.1389  140 LEU A O     
1006 C CB    . LEU A 143 ? 0.6595 0.6544 0.4206 -0.1253 -0.1226 0.1294  140 LEU A CB    
1007 C CG    . LEU A 143 ? 0.6791 0.6531 0.4386 -0.1043 -0.1106 0.1229  140 LEU A CG    
1008 C CD1   . LEU A 143 ? 0.5473 0.5481 0.3393 -0.0885 -0.1051 0.1320  140 LEU A CD1   
1009 C CD2   . LEU A 143 ? 0.7077 0.6519 0.4530 -0.1101 -0.1065 0.1226  140 LEU A CD2   
1010 N N     . GLY A 144 ? 0.7857 0.7634 0.4827 -0.1751 -0.1522 0.1144  141 GLY A N     
1011 C CA    . GLY A 144 ? 0.9334 0.9335 0.6259 -0.1949 -0.1702 0.1169  141 GLY A CA    
1012 C C     . GLY A 144 ? 1.1167 1.1568 0.8257 -0.1847 -0.1777 0.1308  141 GLY A C     
1013 O O     . GLY A 144 ? 1.1102 1.1912 0.8457 -0.1914 -0.1905 0.1423  141 GLY A O     
1014 N N     . ALA A 145 ? 1.1237 1.1514 0.8162 -0.1676 -0.1684 0.1296  142 ALA A N     
1015 C CA    . ALA A 145 ? 1.0108 1.0618 0.7052 -0.1575 -0.1721 0.1427  142 ALA A CA    
1016 C C     . ALA A 145 ? 1.0531 1.0915 0.7029 -0.1657 -0.1829 0.1365  142 ALA A C     
1017 O O     . ALA A 145 ? 1.1150 1.1186 0.7304 -0.1700 -0.1771 0.1206  142 ALA A O     
1018 C CB    . ALA A 145 ? 1.0545 1.0972 0.7570 -0.1373 -0.1522 0.1452  142 ALA A CB    
1019 N N     . SER A 146 ? 1.0232 1.0891 0.6705 -0.1651 -0.1988 0.1488  143 SER A N     
1020 C CA    . SER A 146 ? 1.0972 1.1524 0.6971 -0.1712 -0.2119 0.1440  143 SER A CA    
1021 C C     . SER A 146 ? 1.1334 1.1519 0.6947 -0.1591 -0.1924 0.1399  143 SER A C     
1022 O O     . SER A 146 ? 1.2844 1.2748 0.8008 -0.1661 -0.1934 0.1268  143 SER A O     
1023 C CB    . SER A 146 ? 1.0909 1.1860 0.6953 -0.1663 -0.2337 0.1599  143 SER A CB    
1024 O OG    . SER A 146 ? 1.1557 1.2591 0.7735 -0.1430 -0.2221 0.1788  143 SER A OG    
1025 N N     . GLY A 147 ? 1.0437 1.0623 0.6229 -0.1423 -0.1730 0.1500  144 GLY A N     
1026 C CA    . GLY A 147 ? 1.0992 1.0884 0.6501 -0.1336 -0.1504 0.1459  144 GLY A CA    
1027 C C     . GLY A 147 ? 1.0735 1.0666 0.6515 -0.1195 -0.1300 0.1568  144 GLY A C     
1028 O O     . GLY A 147 ? 1.1041 1.1205 0.7169 -0.1133 -0.1350 0.1700  144 GLY A O     
1029 N N     . ILE A 148 ? 1.0354 1.0056 0.5977 -0.1156 -0.1056 0.1501  145 ILE A N     
1030 C CA    . ILE A 148 ? 0.9173 0.8869 0.5036 -0.1069 -0.0833 0.1563  145 ILE A CA    
1031 C C     . ILE A 148 ? 0.9302 0.8753 0.4779 -0.1029 -0.0663 0.1663  145 ILE A C     
1032 O O     . ILE A 148 ? 1.0427 0.9669 0.5496 -0.1071 -0.0589 0.1588  145 ILE A O     
1033 C CB    . ILE A 148 ? 0.8884 0.8575 0.5025 -0.1075 -0.0648 0.1363  145 ILE A CB    
1034 C CG1   . ILE A 148 ? 0.7497 0.7341 0.3936 -0.1082 -0.0793 0.1281  145 ILE A CG1   
1035 C CG2   . ILE A 148 ? 0.9549 0.9250 0.5948 -0.1025 -0.0426 0.1394  145 ILE A CG2   
1036 C CD1   . ILE A 148 ? 0.7726 0.7581 0.4394 -0.1036 -0.0654 0.1083  145 ILE A CD1   
1037 N N     . ILE A 149 ? 0.9865 0.9293 0.5428 -0.0940 -0.0581 0.1836  146 ILE A N     
1038 C CA    . ILE A 149 ? 0.9859 0.8963 0.5029 -0.0897 -0.0367 0.1950  146 ILE A CA    
1039 C C     . ILE A 149 ? 1.0120 0.9113 0.5552 -0.0936 -0.0043 0.1876  146 ILE A C     
1040 O O     . ILE A 149 ? 1.0491 0.9566 0.6265 -0.0887 -0.0018 0.1932  146 ILE A O     
1041 C CB    . ILE A 149 ? 1.0421 0.9485 0.5372 -0.0743 -0.0500 0.2217  146 ILE A CB    
1042 C CG1   . ILE A 149 ? 1.0316 0.9582 0.5053 -0.0721 -0.0851 0.2261  146 ILE A CG1   
1043 C CG2   . ILE A 149 ? 1.0946 0.9560 0.5398 -0.0682 -0.0245 0.2351  146 ILE A CG2   
1044 C CD1   . ILE A 149 ? 0.9775 0.9130 0.4362 -0.0531 -0.1036 0.2507  146 ILE A CD1   
1045 N N     . LEU A 150 ? 1.0899 0.9724 0.6180 -0.1031 0.0211  0.1733  147 LEU A N     
1046 C CA    . LEU A 150 ? 1.0231 0.9018 0.5806 -0.1114 0.0525  0.1614  147 LEU A CA    
1047 C C     . LEU A 150 ? 1.1409 0.9782 0.6630 -0.1128 0.0808  0.1770  147 LEU A C     
1048 O O     . LEU A 150 ? 1.1718 0.9828 0.6533 -0.1189 0.1019  0.1760  147 LEU A O     
1049 C CB    . LEU A 150 ? 0.9915 0.8836 0.5627 -0.1212 0.0667  0.1343  147 LEU A CB    
1050 C CG    . LEU A 150 ? 0.8985 0.8229 0.5013 -0.1179 0.0439  0.1172  147 LEU A CG    
1051 C CD1   . LEU A 150 ? 0.8553 0.7902 0.4661 -0.1223 0.0602  0.0913  147 LEU A CD1   
1052 C CD2   . LEU A 150 ? 0.8256 0.7736 0.4796 -0.1135 0.0340  0.1154  147 LEU A CD2   
1053 N N     . VAL A 151 ? 1.1569 0.9837 0.6906 -0.1064 0.0833  0.1916  148 VAL A N     
1054 C CA    . VAL A 151 ? 1.1796 0.9576 0.6763 -0.1065 0.1120  0.2078  148 VAL A CA    
1055 C C     . VAL A 151 ? 1.1193 0.8907 0.6500 -0.1254 0.1471  0.1898  148 VAL A C     
1056 O O     . VAL A 151 ? 1.0642 0.8618 0.6474 -0.1281 0.1423  0.1775  148 VAL A O     
1057 C CB    . VAL A 151 ? 1.1717 0.9343 0.6547 -0.0862 0.0974  0.2347  148 VAL A CB    
1058 C CG1   . VAL A 151 ? 1.2769 0.9797 0.7203 -0.0854 0.1312  0.2505  148 VAL A CG1   
1059 C CG2   . VAL A 151 ? 1.1935 0.9665 0.6418 -0.0683 0.0634  0.2519  148 VAL A CG2   
1060 N N     . ASP A 152 ? 1.2942 1.0314 0.7940 -0.1393 0.1830  0.1874  149 ASP A N     
1061 C CA    . ASP A 152 ? 1.3461 1.0777 0.8779 -0.1622 0.2200  0.1685  149 ASP A CA    
1062 C C     . ASP A 152 ? 1.2578 1.0510 0.8615 -0.1719 0.2112  0.1359  149 ASP A C     
1063 O O     . ASP A 152 ? 1.2919 1.1024 0.9415 -0.1762 0.2096  0.1248  149 ASP A O     
1064 C CB    . ASP A 152 ? 1.4852 1.1791 1.0142 -0.1608 0.2324  0.1825  149 ASP A CB    
1065 C CG    . ASP A 152 ? 1.6759 1.3585 1.2342 -0.1891 0.2724  0.1618  149 ASP A CG    
1066 O OD1   . ASP A 152 ? 1.7535 1.4287 1.3032 -0.2091 0.3040  0.1497  149 ASP A OD1   
1067 O OD2   . ASP A 152 ? 1.7291 1.4113 1.3195 -0.1923 0.2731  0.1564  149 ASP A OD2   
1068 N N     . SER A 153 ? 1.2046 1.0280 0.8134 -0.1729 0.2050  0.1204  150 SER A N     
1069 C CA    . SER A 153 ? 1.1409 1.0211 0.8104 -0.1761 0.1950  0.0903  150 SER A CA    
1070 C C     . SER A 153 ? 1.2377 1.1353 0.9275 -0.1951 0.2290  0.0646  150 SER A C     
1071 O O     . SER A 153 ? 1.2485 1.1965 0.9903 -0.1968 0.2249  0.0370  150 SER A O     
1072 C CB    . SER A 153 ? 0.9958 0.9001 0.6598 -0.1589 0.1591  0.0903  150 SER A CB    
1073 O OG    . SER A 153 ? 1.0125 0.8972 0.6261 -0.1575 0.1638  0.0960  150 SER A OG    
1074 N N     . ASP A 154 ? 1.3449 1.2014 0.9924 -0.2077 0.2632  0.0740  151 ASP A N     
1075 C CA    . ASP A 154 ? 1.4215 1.2930 1.0851 -0.2276 0.3010  0.0513  151 ASP A CA    
1076 C C     . ASP A 154 ? 1.2938 1.2031 0.9627 -0.2171 0.2898  0.0347  151 ASP A C     
1077 O O     . ASP A 154 ? 1.2714 1.2163 0.9747 -0.2283 0.3133  0.0086  151 ASP A O     
1078 C CB    . ASP A 154 ? 1.5449 1.4521 1.2784 -0.2485 0.3195  0.0243  151 ASP A CB    
1079 C CG    . ASP A 154 ? 1.6631 1.5209 1.3831 -0.2645 0.3422  0.0380  151 ASP A CG    
1080 O OD1   . ASP A 154 ? 1.7559 1.5521 1.4116 -0.2550 0.3427  0.0702  151 ASP A OD1   
1081 O OD2   . ASP A 154 ? 1.6340 1.5135 1.4057 -0.2854 0.3589  0.0156  151 ASP A OD2   
1082 N N     . ILE A 155 ? 1.3215 1.2232 0.9567 -0.1958 0.2545  0.0487  152 ILE A N     
1083 C CA    . ILE A 155 ? 1.2918 1.2141 0.9171 -0.1845 0.2435  0.0358  152 ILE A CA    
1084 C C     . ILE A 155 ? 1.3449 1.2209 0.8951 -0.1837 0.2582  0.0514  152 ILE A C     
1085 O O     . ILE A 155 ? 1.3998 1.2366 0.8960 -0.1748 0.2402  0.0774  152 ILE A O     
1086 C CB    . ILE A 155 ? 1.2235 1.1613 0.8534 -0.1645 0.1971  0.0389  152 ILE A CB    
1087 C CG1   . ILE A 155 ? 1.0900 1.0769 0.7897 -0.1608 0.1834  0.0182  152 ILE A CG1   
1088 C CG2   . ILE A 155 ? 1.2109 1.1461 0.8056 -0.1535 0.1872  0.0324  152 ILE A CG2   
1089 C CD1   . ILE A 155 ? 1.0409 1.0732 0.7826 -0.1617 0.2000  -0.0141 152 ILE A CD1   
1090 N N     . THR A 156 ? 1.3915 1.2752 0.9383 -0.1915 0.2902  0.0347  153 THR A N     
1091 C CA    . THR A 156 ? 1.5087 1.3454 0.9803 -0.1916 0.3106  0.0477  153 THR A CA    
1092 C C     . THR A 156 ? 1.4856 1.3138 0.9118 -0.1726 0.2797  0.0496  153 THR A C     
1093 O O     . THR A 156 ? 1.5655 1.3480 0.9172 -0.1680 0.2815  0.0660  153 THR A O     
1094 C CB    . THR A 156 ? 1.6041 1.4516 1.0876 -0.2079 0.3611  0.0285  153 THR A CB    
1095 O OG1   . THR A 156 ? 1.5864 1.4911 1.1189 -0.2004 0.3566  -0.0017 153 THR A OG1   
1096 C CG2   . THR A 156 ? 1.6356 1.4881 1.1625 -0.2323 0.3945  0.0244  153 THR A CG2   
1097 N N     . SER A 157 ? 1.3857 1.2541 0.8524 -0.1615 0.2511  0.0325  154 SER A N     
1098 C CA    . SER A 157 ? 1.4437 1.3013 0.8699 -0.1463 0.2231  0.0308  154 SER A CA    
1099 C C     . SER A 157 ? 1.4386 1.3316 0.9112 -0.1350 0.1887  0.0181  154 SER A C     
1100 O O     . SER A 157 ? 1.4699 1.4058 1.0040 -0.1335 0.1956  -0.0023 154 SER A O     
1101 C CB    . SER A 157 ? 1.4918 1.3439 0.8885 -0.1441 0.2508  0.0142  154 SER A CB    
1102 O OG    . SER A 157 ? 1.4885 1.3257 0.8444 -0.1301 0.2244  0.0097  154 SER A OG    
1103 N N     . ILE A 158 ? 1.4579 1.3326 0.8995 -0.1272 0.1520  0.0297  155 ILE A N     
1104 C CA    . ILE A 158 ? 1.4214 1.3182 0.8946 -0.1173 0.1211  0.0199  155 ILE A CA    
1105 C C     . ILE A 158 ? 1.4556 1.3711 0.9433 -0.1064 0.1311  -0.0074 155 ILE A C     
1106 O O     . ILE A 158 ? 1.4014 1.3447 0.9322 -0.0963 0.1185  -0.0207 155 ILE A O     
1107 C CB    . ILE A 158 ? 1.3796 1.2498 0.8086 -0.1149 0.0851  0.0340  155 ILE A CB    
1108 C CG1   . ILE A 158 ? 1.2487 1.1248 0.6976 -0.1184 0.0640  0.0554  155 ILE A CG1   
1109 C CG2   . ILE A 158 ? 1.3773 1.2511 0.8101 -0.1056 0.0651  0.0174  155 ILE A CG2   
1110 C CD1   . ILE A 158 ? 1.2785 1.1392 0.7117 -0.1245 0.0813  0.0751  155 ILE A CD1   
1111 N N     . ALA A 159 ? 1.5147 1.4131 0.9630 -0.1058 0.1549  -0.0153 156 ALA A N     
1112 C CA    . ALA A 159 ? 1.5110 1.4249 0.9666 -0.0919 0.1675  -0.0411 156 ALA A CA    
1113 C C     . ALA A 159 ? 1.5382 1.5091 1.0706 -0.0878 0.1849  -0.0611 156 ALA A C     
1114 O O     . ALA A 159 ? 1.6233 1.6184 1.1796 -0.0694 0.1799  -0.0815 156 ALA A O     
1115 C CB    . ALA A 159 ? 1.5029 1.3884 0.9016 -0.0929 0.1951  -0.0445 156 ALA A CB    
1116 N N     . ASP A 160 ? 1.4786 1.4692 1.0467 -0.1042 0.2050  -0.0560 157 ASP A N     
1117 C CA    . ASP A 160 ? 1.4217 1.4707 1.0659 -0.1057 0.2220  -0.0770 157 ASP A CA    
1118 C C     . ASP A 160 ? 1.4323 1.5172 1.1150 -0.0821 0.1987  -0.0967 157 ASP A C     
1119 O O     . ASP A 160 ? 1.4100 1.4854 1.0937 -0.0745 0.1660  -0.0878 157 ASP A O     
1120 C CB    . ASP A 160 ? 1.4620 1.5177 1.1399 -0.1246 0.2239  -0.0645 157 ASP A CB    
1121 C CG    . ASP A 160 ? 1.5445 1.6568 1.2952 -0.1344 0.2487  -0.0876 157 ASP A CG    
1122 O OD1   . ASP A 160 ? 1.5932 1.7551 1.3878 -0.1188 0.2455  -0.1135 157 ASP A OD1   
1123 O OD2   . ASP A 160 ? 1.5539 1.6607 1.3171 -0.1574 0.2712  -0.0806 157 ASP A OD2   
1124 N N     . ARG A 161 ? 1.5094 1.6352 1.2222 -0.0690 0.2170  -0.1232 158 ARG A N     
1125 C CA    . ARG A 161 ? 1.5184 1.6740 1.2579 -0.0399 0.1967  -0.1425 158 ARG A CA    
1126 C C     . ARG A 161 ? 1.4491 1.6372 1.2418 -0.0366 0.1729  -0.1446 158 ARG A C     
1127 O O     . ARG A 161 ? 1.5406 1.7348 1.3387 -0.0116 0.1482  -0.1521 158 ARG A O     
1128 C CB    . ARG A 161 ? 1.5943 1.8004 1.3669 -0.0247 0.2231  -0.1721 158 ARG A CB    
1129 C CG    . ARG A 161 ? 1.6444 1.9092 1.4822 -0.0455 0.2549  -0.1866 158 ARG A CG    
1130 C CD    . ARG A 161 ? 1.6649 2.0096 1.5737 -0.0236 0.2566  -0.2200 158 ARG A CD    
1131 N NE    . ARG A 161 ? 1.7132 2.0533 1.5962 0.0150  0.2447  -0.2316 158 ARG A NE    
1132 C CZ    . ARG A 161 ? 1.7499 2.0972 1.6173 0.0279  0.2706  -0.2452 158 ARG A CZ    
1133 N NH1   . ARG A 161 ? 1.7643 2.1257 1.6405 0.0037  0.3112  -0.2487 158 ARG A NH1   
1134 N NH2   . ARG A 161 ? 1.7517 2.0874 1.5910 0.0659  0.2582  -0.2551 158 ARG A NH2   
1135 N N     . ARG A 162 ? 1.3366 1.5400 1.1629 -0.0608 0.1819  -0.1381 159 ARG A N     
1136 C CA    . ARG A 162 ? 1.2430 1.4751 1.1170 -0.0593 0.1615  -0.1410 159 ARG A CA    
1137 C C     . ARG A 162 ? 1.1513 1.3358 0.9909 -0.0610 0.1323  -0.1136 159 ARG A C     
1138 O O     . ARG A 162 ? 1.0995 1.2955 0.9609 -0.0493 0.1083  -0.1146 159 ARG A O     
1139 C CB    . ARG A 162 ? 1.2430 1.5125 1.1702 -0.0850 0.1854  -0.1500 159 ARG A CB    
1140 C CG    . ARG A 162 ? 1.3578 1.6896 1.3348 -0.0854 0.2137  -0.1815 159 ARG A CG    
1141 C CD    . ARG A 162 ? 1.4033 1.7761 1.4404 -0.1138 0.2346  -0.1947 159 ARG A CD    
1142 N NE    . ARG A 162 ? 1.4663 1.7883 1.4717 -0.1460 0.2577  -0.1713 159 ARG A NE    
1143 C CZ    . ARG A 162 ? 1.4920 1.7863 1.4951 -0.1611 0.2487  -0.1545 159 ARG A CZ    
1144 N NH1   . ARG A 162 ? 1.5040 1.8178 1.5359 -0.1491 0.2177  -0.1592 159 ARG A NH1   
1145 N NH2   . ARG A 162 ? 1.4835 1.7274 1.4513 -0.1857 0.2716  -0.1326 159 ARG A NH2   
1146 N N     . LEU A 163 ? 1.1749 1.3082 0.9606 -0.0744 0.1345  -0.0898 160 LEU A N     
1147 C CA    . LEU A 163 ? 1.1746 1.2685 0.9288 -0.0757 0.1069  -0.0648 160 LEU A CA    
1148 C C     . LEU A 163 ? 1.3473 1.4187 1.0681 -0.0560 0.0835  -0.0661 160 LEU A C     
1149 O O     . LEU A 163 ? 1.3212 1.3770 1.0359 -0.0515 0.0582  -0.0546 160 LEU A O     
1150 C CB    . LEU A 163 ? 1.0900 1.1427 0.7991 -0.0948 0.1153  -0.0402 160 LEU A CB    
1151 C CG    . LEU A 163 ? 1.0092 1.0312 0.6931 -0.0974 0.0878  -0.0144 160 LEU A CG    
1152 C CD1   . LEU A 163 ? 0.9533 0.9976 0.6834 -0.0948 0.0737  -0.0126 160 LEU A CD1   
1153 C CD2   . LEU A 163 ? 1.0458 1.0348 0.6900 -0.1123 0.0975  0.0084  160 LEU A CD2   
1154 N N     . GLN A 164 ? 1.4565 1.5232 1.1539 -0.0448 0.0945  -0.0805 161 GLN A N     
1155 C CA    . GLN A 164 ? 1.5090 1.5481 1.1709 -0.0250 0.0765  -0.0852 161 GLN A CA    
1156 C C     . GLN A 164 ? 1.4998 1.5662 1.1985 -0.0016 0.0618  -0.0989 161 GLN A C     
1157 O O     . GLN A 164 ? 1.5648 1.6052 1.2467 0.0064  0.0387  -0.0905 161 GLN A O     
1158 C CB    . GLN A 164 ? 1.5834 1.6121 1.2129 -0.0150 0.0954  -0.1001 161 GLN A CB    
1159 C CG    . GLN A 164 ? 1.6404 1.6355 1.2211 -0.0342 0.1101  -0.0878 161 GLN A CG    
1160 C CD    . GLN A 164 ? 1.6868 1.6764 1.2396 -0.0231 0.1340  -0.1050 161 GLN A CD    
1161 O OE1   . GLN A 164 ? 1.6670 1.6163 1.1619 -0.0314 0.1411  -0.0976 161 GLN A OE1   
1162 N NE2   . GLN A 164 ? 1.7099 1.7420 1.3029 -0.0020 0.1462  -0.1287 161 GLN A NE2   
1163 N N     . ARG A 165 ? 1.4147 1.5347 1.1631 0.0094  0.0760  -0.1208 162 ARG A N     
1164 C CA    . ARG A 165 ? 1.3356 1.4882 1.1183 0.0366  0.0620  -0.1373 162 ARG A CA    
1165 C C     . ARG A 165 ? 1.2005 1.3545 1.0041 0.0311  0.0415  -0.1246 162 ARG A C     
1166 O O     . ARG A 165 ? 1.1891 1.3361 0.9889 0.0532  0.0217  -0.1265 162 ARG A O     
1167 C CB    . ARG A 165 ? 1.4033 1.6250 1.2432 0.0453  0.0811  -0.1650 162 ARG A CB    
1168 C CG    . ARG A 165 ? 1.4959 1.7506 1.3567 0.0845  0.0681  -0.1873 162 ARG A CG    
1169 C CD    . ARG A 165 ? 1.5598 1.8883 1.4756 0.0934  0.0891  -0.2172 162 ARG A CD    
1170 N NE    . ARG A 165 ? 1.6620 1.9813 1.5564 0.0840  0.1179  -0.2199 162 ARG A NE    
1171 C CZ    . ARG A 165 ? 1.7046 2.0821 1.6386 0.0911  0.1421  -0.2449 162 ARG A CZ    
1172 N NH1   . ARG A 165 ? 1.6981 2.1528 1.6993 0.1075  0.1384  -0.2709 162 ARG A NH1   
1173 N NH2   . ARG A 165 ? 1.7250 2.0863 1.6316 0.0824  0.1702  -0.2450 162 ARG A NH2   
1174 N N     . ALA A 166 ? 1.0562 1.2146 0.8770 0.0034  0.0481  -0.1111 163 ALA A N     
1175 C CA    . ALA A 166 ? 0.9586 1.1161 0.7972 -0.0025 0.0317  -0.0981 163 ALA A CA    
1176 C C     . ALA A 166 ? 1.0003 1.1054 0.7934 -0.0045 0.0122  -0.0741 163 ALA A C     
1177 O O     . ALA A 166 ? 0.9446 1.0443 0.7453 -0.0012 -0.0040 -0.0645 163 ALA A O     
1178 C CB    . ALA A 166 ? 0.8895 1.0616 0.7555 -0.0298 0.0472  -0.0912 163 ALA A CB    
1179 N N     . SER A 167 ? 1.0059 1.0741 0.7523 -0.0109 0.0146  -0.0658 164 SER A N     
1180 C CA    . SER A 167 ? 1.1076 1.1302 0.8126 -0.0170 -0.0033 -0.0464 164 SER A CA    
1181 C C     . SER A 167 ? 1.2496 1.2417 0.9197 0.0028  -0.0127 -0.0553 164 SER A C     
1182 O O     . SER A 167 ? 1.3237 1.2744 0.9556 -0.0044 -0.0252 -0.0434 164 SER A O     
1183 C CB    . SER A 167 ? 1.2101 1.2081 0.8809 -0.0394 0.0019  -0.0311 164 SER A CB    
1184 O OG    . SER A 167 ? 1.2440 1.2588 0.9380 -0.0556 0.0104  -0.0190 164 SER A OG    
1185 N N     . ARG A 168 ? 1.3356 1.3482 1.0185 0.0280  -0.0061 -0.0772 165 ARG A N     
1186 C CA    . ARG A 168 ? 1.4888 1.4680 1.1344 0.0528  -0.0124 -0.0868 165 ARG A CA    
1187 C C     . ARG A 168 ? 1.5249 1.4599 1.1158 0.0452  -0.0060 -0.0865 165 ARG A C     
1188 O O     . ARG A 168 ? 1.6747 1.5735 1.2267 0.0647  -0.0075 -0.0957 165 ARG A O     
1189 C CB    . ARG A 168 ? 1.6284 1.5750 1.2582 0.0582  -0.0314 -0.0747 165 ARG A CB    
1190 C CG    . ARG A 168 ? 1.7032 1.6811 1.3686 0.0818  -0.0388 -0.0823 165 ARG A CG    
1191 C CD    . ARG A 168 ? 1.8242 1.7950 1.4720 0.1213  -0.0397 -0.1012 165 ARG A CD    
1192 N NE    . ARG A 168 ? 1.8574 1.8471 1.5249 0.1482  -0.0515 -0.1068 165 ARG A NE    
1193 C CZ    . ARG A 168 ? 1.8838 1.8642 1.5567 0.1413  -0.0626 -0.0920 165 ARG A CZ    
1194 N NH1   . ARG A 168 ? 1.9083 1.8651 1.5736 0.1085  -0.0637 -0.0704 165 ARG A NH1   
1195 N NH2   . ARG A 168 ? 1.8663 1.8626 1.5509 0.1696  -0.0728 -0.0994 165 ARG A NH2   
1196 N N     . GLY A 169 ? 1.3887 1.3224 0.9718 0.0185  0.0011  -0.0761 166 GLY A N     
1197 C CA    . GLY A 169 ? 1.2583 1.1504 0.7861 0.0091  0.0056  -0.0757 166 GLY A CA    
1198 C C     . GLY A 169 ? 1.2363 1.0925 0.7325 -0.0164 -0.0117 -0.0559 166 GLY A C     
1199 O O     . GLY A 169 ? 1.3496 1.1663 0.7947 -0.0261 -0.0139 -0.0560 166 GLY A O     
1200 N N     . TYR A 170 ? 1.2105 1.0831 0.7380 -0.0271 -0.0243 -0.0404 167 TYR A N     
1201 C CA    . TYR A 170 ? 1.2508 1.1021 0.7596 -0.0504 -0.0416 -0.0220 167 TYR A CA    
1202 C C     . TYR A 170 ? 1.2515 1.1187 0.7617 -0.0694 -0.0388 -0.0085 167 TYR A C     
1203 O O     . TYR A 170 ? 1.3082 1.1681 0.8075 -0.0870 -0.0541 0.0069  167 TYR A O     
1204 C CB    . TYR A 170 ? 1.1935 1.0546 0.7336 -0.0506 -0.0548 -0.0109 167 TYR A CB    
1205 C CG    . TYR A 170 ? 1.2979 1.1297 0.8234 -0.0338 -0.0596 -0.0192 167 TYR A CG    
1206 C CD1   . TYR A 170 ? 1.4258 1.2054 0.9001 -0.0387 -0.0647 -0.0236 167 TYR A CD1   
1207 C CD2   . TYR A 170 ? 1.3198 1.1714 0.8775 -0.0128 -0.0589 -0.0229 167 TYR A CD2   
1208 C CE1   . TYR A 170 ? 1.5334 1.2760 0.9867 -0.0225 -0.0663 -0.0297 167 TYR A CE1   
1209 C CE2   . TYR A 170 ? 1.3902 1.2088 0.9264 0.0062  -0.0626 -0.0286 167 TYR A CE2   
1210 C CZ    . TYR A 170 ? 1.5005 1.2620 0.9834 0.0015  -0.0650 -0.0311 167 TYR A CZ    
1211 O OH    . TYR A 170 ? 1.5301 1.2489 0.9843 0.0213  -0.0659 -0.0355 167 TYR A OH    
1212 N N     . VAL A 171 ? 1.2283 1.1175 0.7514 -0.0651 -0.0185 -0.0145 168 VAL A N     
1213 C CA    . VAL A 171 ? 1.1939 1.0925 0.7149 -0.0800 -0.0114 -0.0004 168 VAL A CA    
1214 C C     . VAL A 171 ? 1.2106 1.0759 0.6737 -0.0929 -0.0200 0.0066  168 VAL A C     
1215 O O     . VAL A 171 ? 1.1633 1.0300 0.6160 -0.1041 -0.0236 0.0232  168 VAL A O     
1216 C CB    . VAL A 171 ? 1.1775 1.1002 0.7192 -0.0755 0.0175  -0.0105 168 VAL A CB    
1217 C CG1   . VAL A 171 ? 1.2835 1.1872 0.7851 -0.0695 0.0334  -0.0259 168 VAL A CG1   
1218 C CG2   . VAL A 171 ? 1.1124 1.0424 0.6599 -0.0898 0.0265  0.0071  168 VAL A CG2   
1219 N N     . PHE A 172 ? 1.2548 1.0879 0.6766 -0.0895 -0.0241 -0.0066 169 PHE A N     
1220 C CA    . PHE A 172 ? 1.3093 1.1087 0.6717 -0.1020 -0.0342 -0.0043 169 PHE A CA    
1221 C C     . PHE A 172 ? 1.4034 1.1828 0.7508 -0.1147 -0.0620 -0.0012 169 PHE A C     
1222 O O     . PHE A 172 ? 1.4990 1.2439 0.7950 -0.1239 -0.0718 -0.0082 169 PHE A O     
1223 C CB    . PHE A 172 ? 1.2469 1.0180 0.5644 -0.0922 -0.0167 -0.0232 169 PHE A CB    
1224 C CG    . PHE A 172 ? 1.1619 0.9558 0.4968 -0.0819 0.0144  -0.0289 169 PHE A CG    
1225 C CD1   . PHE A 172 ? 1.1465 0.9485 0.4744 -0.0913 0.0261  -0.0156 169 PHE A CD1   
1226 C CD2   . PHE A 172 ? 1.1030 0.9103 0.4604 -0.0624 0.0328  -0.0481 169 PHE A CD2   
1227 C CE1   . PHE A 172 ? 1.1747 0.9953 0.5190 -0.0862 0.0587  -0.0216 169 PHE A CE1   
1228 C CE2   . PHE A 172 ? 1.0785 0.9144 0.4588 -0.0562 0.0628  -0.0557 169 PHE A CE2   
1229 C CZ    . PHE A 172 ? 1.1417 0.9830 0.5160 -0.0705 0.0772  -0.0426 169 PHE A CZ    
1230 N N     . SER A 173 ? 1.3293 1.1297 0.7209 -0.1166 -0.0731 0.0081  170 SER A N     
1231 C CA    . SER A 173 ? 1.2607 1.0462 0.6461 -0.1311 -0.0954 0.0109  170 SER A CA    
1232 C C     . SER A 173 ? 1.1760 0.9888 0.5782 -0.1477 -0.1144 0.0301  170 SER A C     
1233 O O     . SER A 173 ? 1.1028 0.9114 0.5014 -0.1646 -0.1338 0.0324  170 SER A O     
1234 C CB    . SER A 173 ? 1.2700 1.0550 0.6869 -0.1204 -0.0934 0.0074  170 SER A CB    
1235 O OG    . SER A 173 ? 1.2928 1.0521 0.6903 -0.1009 -0.0787 -0.0109 170 SER A OG    
1236 N N     . LEU A 174 ? 1.1415 0.9823 0.5623 -0.1425 -0.1076 0.0434  171 LEU A N     
1237 C CA    . LEU A 174 ? 1.0947 0.9620 0.5288 -0.1515 -0.1244 0.0629  171 LEU A CA    
1238 C C     . LEU A 174 ? 1.1902 1.0650 0.6135 -0.1439 -0.1119 0.0740  171 LEU A C     
1239 O O     . LEU A 174 ? 1.3578 1.2289 0.7860 -0.1335 -0.0872 0.0684  171 LEU A O     
1240 C CB    . LEU A 174 ? 0.9820 0.8788 0.4720 -0.1503 -0.1297 0.0741  171 LEU A CB    
1241 C CG    . LEU A 174 ? 0.9873 0.9035 0.5184 -0.1348 -0.1107 0.0793  171 LEU A CG    
1242 C CD1   . LEU A 174 ? 0.9997 0.9431 0.5769 -0.1345 -0.1192 0.0929  171 LEU A CD1   
1243 C CD2   . LEU A 174 ? 1.0861 0.9887 0.6209 -0.1226 -0.0927 0.0608  171 LEU A CD2   
1244 N N     . PRO A 175 ? 1.1514 1.0368 0.5589 -0.1486 -0.1285 0.0893  172 PRO A N     
1245 C CA    . PRO A 175 ? 1.1607 1.0429 0.5454 -0.1402 -0.1167 0.1026  172 PRO A CA    
1246 C C     . PRO A 175 ? 1.1610 1.0571 0.5876 -0.1299 -0.0940 0.1119  172 PRO A C     
1247 O O     . PRO A 175 ? 1.1906 1.1109 0.6552 -0.1271 -0.1023 0.1256  172 PRO A O     
1248 C CB    . PRO A 175 ? 1.1579 1.0575 0.5303 -0.1432 -0.1452 0.1188  172 PRO A CB    
1249 C CG    . PRO A 175 ? 1.1488 1.0531 0.5196 -0.1592 -0.1707 0.1065  172 PRO A CG    
1250 C CD    . PRO A 175 ? 1.1172 1.0183 0.5255 -0.1619 -0.1593 0.0941  172 PRO A CD    
1251 N N     . VAL A 176 ? 1.0789 0.9609 0.4994 -0.1253 -0.0648 0.1029  173 VAL A N     
1252 C CA    . VAL A 176 ? 1.0749 0.9671 0.5303 -0.1198 -0.0409 0.1088  173 VAL A CA    
1253 C C     . VAL A 176 ? 1.2329 1.1026 0.6478 -0.1180 -0.0220 0.1211  173 VAL A C     
1254 O O     . VAL A 176 ? 1.3709 1.2205 0.7544 -0.1194 -0.0005 0.1110  173 VAL A O     
1255 C CB    . VAL A 176 ? 1.1044 1.0043 0.5920 -0.1174 -0.0194 0.0874  173 VAL A CB    
1256 C CG1   . VAL A 176 ? 1.0511 0.9633 0.5748 -0.1160 0.0051  0.0904  173 VAL A CG1   
1257 C CG2   . VAL A 176 ? 0.9363 0.8505 0.4555 -0.1154 -0.0367 0.0772  173 VAL A CG2   
1258 N N     . VAL A 177 ? 1.2224 1.0928 0.6350 -0.1132 -0.0284 0.1434  174 VAL A N     
1259 C CA    . VAL A 177 ? 1.2290 1.0692 0.5911 -0.1086 -0.0132 0.1593  174 VAL A CA    
1260 C C     . VAL A 177 ? 1.2706 1.1001 0.6520 -0.1081 0.0199  0.1662  174 VAL A C     
1261 O O     . VAL A 177 ? 1.2551 1.0979 0.6740 -0.1042 0.0167  0.1760  174 VAL A O     
1262 C CB    . VAL A 177 ? 1.2311 1.0721 0.5635 -0.0991 -0.0427 0.1813  174 VAL A CB    
1263 C CG1   . VAL A 177 ? 1.3202 1.1234 0.5949 -0.0893 -0.0255 0.2005  174 VAL A CG1   
1264 C CG2   . VAL A 177 ? 1.1252 0.9744 0.4317 -0.1039 -0.0747 0.1723  174 VAL A CG2   
1265 N N     . LEU A 178 ? 1.3184 1.1221 0.6729 -0.1135 0.0537  0.1598  175 LEU A N     
1266 C CA    . LEU A 178 ? 1.3728 1.1570 0.7334 -0.1173 0.0889  0.1671  175 LEU A CA    
1267 C C     . LEU A 178 ? 1.3465 1.0924 0.6494 -0.1060 0.0875  0.1961  175 LEU A C     
1268 O O     . LEU A 178 ? 1.4675 1.1934 0.7098 -0.0984 0.0749  0.2046  175 LEU A O     
1269 C CB    . LEU A 178 ? 1.4461 1.2179 0.7978 -0.1291 0.1280  0.1497  175 LEU A CB    
1270 C CG    . LEU A 178 ? 1.3965 1.2058 0.7959 -0.1349 0.1300  0.1198  175 LEU A CG    
1271 C CD1   . LEU A 178 ? 1.3924 1.1912 0.7745 -0.1433 0.1682  0.1043  175 LEU A CD1   
1272 C CD2   . LEU A 178 ? 1.2789 1.1247 0.7534 -0.1382 0.1290  0.1091  175 LEU A CD2   
1273 N N     . SER A 179 ? 1.2896 1.0228 0.6070 -0.1026 0.0997  0.2108  176 SER A N     
1274 C CA    . SER A 179 ? 1.2994 0.9948 0.5615 -0.0858 0.0961  0.2403  176 SER A CA    
1275 C C     . SER A 179 ? 1.3438 1.0075 0.6127 -0.0859 0.1258  0.2529  176 SER A C     
1276 O O     . SER A 179 ? 1.3281 1.0104 0.6565 -0.0986 0.1394  0.2388  176 SER A O     
1277 C CB    . SER A 179 ? 1.1704 0.8967 0.4383 -0.0687 0.0489  0.2524  176 SER A CB    
1278 O OG    . SER A 179 ? 1.4521 1.1489 0.6722 -0.0472 0.0429  0.2809  176 SER A OG    
1279 N N     . GLY A 180 ? 1.3633 0.9752 0.5662 -0.0708 0.1356  0.2790  177 GLY A N     
1280 C CA    . GLY A 180 ? 1.3719 0.9421 0.5686 -0.0671 0.1618  0.2948  177 GLY A CA    
1281 C C     . GLY A 180 ? 1.3765 0.9691 0.5992 -0.0454 0.1298  0.3099  177 GLY A C     
1282 O O     . GLY A 180 ? 1.3874 1.0225 0.6199 -0.0318 0.0883  0.3126  177 GLY A O     
1283 N N     . ARG A 181 ? 1.4447 1.0085 0.6789 -0.0431 0.1505  0.3186  178 ARG A N     
1284 C CA    . ARG A 181 ? 1.5131 1.0976 0.7761 -0.0218 0.1253  0.3315  178 ARG A CA    
1285 C C     . ARG A 181 ? 1.5535 1.1314 0.7638 0.0131  0.0956  0.3599  178 ARG A C     
1286 O O     . ARG A 181 ? 1.4838 1.1142 0.7269 0.0286  0.0574  0.3633  178 ARG A O     
1287 C CB    . ARG A 181 ? 1.5802 1.1223 0.8535 -0.0257 0.1579  0.3352  178 ARG A CB    
1288 C CG    . ARG A 181 ? 1.6141 1.1784 0.9232 -0.0047 0.1361  0.3449  178 ARG A CG    
1289 C CD    . ARG A 181 ? 1.6499 1.1798 0.9819 -0.0168 0.1683  0.3380  178 ARG A CD    
1290 N NE    . ARG A 181 ? 1.6107 1.1767 1.0064 -0.0497 0.1785  0.3045  178 ARG A NE    
1291 C CZ    . ARG A 181 ? 1.6944 1.2405 1.0888 -0.0794 0.2123  0.2863  178 ARG A CZ    
1292 N NH1   . ARG A 181 ? 1.8760 1.3603 1.2057 -0.0829 0.2428  0.2993  178 ARG A NH1   
1293 N NH2   . ARG A 181 ? 1.5976 1.1867 1.0548 -0.1044 0.2163  0.2549  178 ARG A NH2   
1294 N N     . GLU A 182 ? 1.6909 1.2058 0.8193 0.0259  0.1138  0.3796  179 GLU A N     
1295 C CA    . GLU A 182 ? 1.7746 1.2799 0.8442 0.0634  0.0859  0.4069  179 GLU A CA    
1296 C C     . GLU A 182 ? 1.6960 1.2591 0.7676 0.0653  0.0432  0.3984  179 GLU A C     
1297 O O     . GLU A 182 ? 1.7592 1.3623 0.8332 0.0902  0.0029  0.4095  179 GLU A O     
1298 C CB    . GLU A 182 ? 1.9886 1.4043 0.9600 0.0766  0.1184  0.4294  179 GLU A CB    
1299 C CG    . GLU A 182 ? 2.0786 1.4296 1.0424 0.0501  0.1761  0.4234  179 GLU A CG    
1300 C CD    . GLU A 182 ? 2.1257 1.4770 1.0914 0.0146  0.2012  0.3999  179 GLU A CD    
1301 O OE1   . GLU A 182 ? 1.9818 1.4006 1.0150 -0.0060 0.1838  0.3732  179 GLU A OE1   
1302 O OE2   . GLU A 182 ? 2.3118 1.5936 1.2094 0.0086  0.2403  0.4085  179 GLU A OE2   
1303 N N     . GLU A 183 ? 1.6341 1.2020 0.7050 0.0384  0.0531  0.3771  180 GLU A N     
1304 C CA    . GLU A 183 ? 1.6324 1.2446 0.6986 0.0357  0.0173  0.3655  180 GLU A CA    
1305 C C     . GLU A 183 ? 1.5869 1.2772 0.7312 0.0327  -0.0220 0.3533  180 GLU A C     
1306 O O     . GLU A 183 ? 1.5607 1.2909 0.7000 0.0447  -0.0626 0.3560  180 GLU A O     
1307 C CB    . GLU A 183 ? 1.6494 1.2500 0.7084 0.0067  0.0413  0.3422  180 GLU A CB    
1308 C CG    . GLU A 183 ? 1.7976 1.3228 0.7927 0.0020  0.0903  0.3506  180 GLU A CG    
1309 C CD    . GLU A 183 ? 1.8472 1.3709 0.8505 -0.0274 0.1181  0.3250  180 GLU A CD    
1310 O OE1   . GLU A 183 ? 1.8718 1.3445 0.8465 -0.0396 0.1653  0.3260  180 GLU A OE1   
1311 O OE2   . GLU A 183 ? 1.7562 1.3288 0.7943 -0.0382 0.0944  0.3036  180 GLU A OE2   
1312 N N     . ALA A 184 ? 1.5016 1.2130 0.7167 0.0157  -0.0088 0.3392  181 ALA A N     
1313 C CA    . ALA A 184 ? 1.3892 1.1672 0.6772 0.0110  -0.0390 0.3276  181 ALA A CA    
1314 C C     . ALA A 184 ? 1.3721 1.1743 0.6737 0.0389  -0.0630 0.3487  181 ALA A C     
1315 O O     . ALA A 184 ? 1.2486 1.1079 0.5817 0.0430  -0.0992 0.3464  181 ALA A O     
1316 C CB    . ALA A 184 ? 1.3529 1.1409 0.7040 -0.0111 -0.0168 0.3076  181 ALA A CB    
1317 N N     . ILE A 185 ? 1.4192 1.1773 0.6972 0.0578  -0.0409 0.3686  182 ILE A N     
1318 C CA    . ILE A 185 ? 1.4641 1.2397 0.7504 0.0898  -0.0594 0.3901  182 ILE A CA    
1319 C C     . ILE A 185 ? 1.4553 1.2551 0.7007 0.1153  -0.0967 0.4046  182 ILE A C     
1320 O O     . ILE A 185 ? 1.4137 1.2701 0.6932 0.1334  -0.1288 0.4112  182 ILE A O     
1321 C CB    . ILE A 185 ? 1.6352 1.3427 0.8876 0.1074  -0.0249 0.4095  182 ILE A CB    
1322 C CG1   . ILE A 185 ? 1.6423 1.3389 0.9468 0.0837  0.0053  0.3932  182 ILE A CG1   
1323 C CG2   . ILE A 185 ? 1.6755 1.3953 0.9206 0.1489  -0.0453 0.4349  182 ILE A CG2   
1324 C CD1   . ILE A 185 ? 1.7092 1.3366 0.9841 0.0962  0.0404  0.4087  182 ILE A CD1   
1325 N N     . ALA A 186 ? 1.4615 1.2211 0.6343 0.1167  -0.0923 0.4084  183 ALA A N     
1326 C CA    . ALA A 186 ? 1.6407 1.4180 0.7637 0.1421  -0.1283 0.4208  183 ALA A CA    
1327 C C     . ALA A 186 ? 1.5994 1.4536 0.7652 0.1245  -0.1696 0.3999  183 ALA A C     
1328 O O     . ALA A 186 ? 1.5258 1.4327 0.6978 0.1440  -0.2095 0.4061  183 ALA A O     
1329 C CB    . ALA A 186 ? 1.7424 1.4478 0.7687 0.1478  -0.1088 0.4299  183 ALA A CB    
1330 N N     . PHE A 187 ? 1.5517 1.4118 0.7469 0.0878  -0.1593 0.3743  184 PHE A N     
1331 C CA    . PHE A 187 ? 1.4059 1.3244 0.6345 0.0666  -0.1925 0.3524  184 PHE A CA    
1332 C C     . PHE A 187 ? 1.4125 1.4035 0.7229 0.0649  -0.2174 0.3485  184 PHE A C     
1333 O O     . PHE A 187 ? 1.4583 1.5052 0.7895 0.0579  -0.2535 0.3386  184 PHE A O     
1334 C CB    . PHE A 187 ? 1.2085 1.1073 0.4454 0.0318  -0.1706 0.3271  184 PHE A CB    
1335 C CG    . PHE A 187 ? 1.2890 1.2399 0.5705 0.0074  -0.1976 0.3034  184 PHE A CG    
1336 C CD1   . PHE A 187 ? 1.3771 1.3462 0.6247 0.0032  -0.2295 0.2948  184 PHE A CD1   
1337 C CD2   . PHE A 187 ? 1.3221 1.2988 0.6746 -0.0116 -0.1901 0.2892  184 PHE A CD2   
1338 C CE1   . PHE A 187 ? 1.4135 1.4226 0.6983 -0.0222 -0.2516 0.2721  184 PHE A CE1   
1339 C CE2   . PHE A 187 ? 1.3322 1.3468 0.7187 -0.0341 -0.2114 0.2686  184 PHE A CE2   
1340 C CZ    . PHE A 187 ? 1.3776 1.4069 0.7309 -0.0408 -0.2412 0.2599  184 PHE A CZ    
1341 N N     . ILE A 188 ? 1.4083 1.3971 0.7639 0.0697  -0.1966 0.3552  185 ILE A N     
1342 C CA    . ILE A 188 ? 1.3683 1.4207 0.8011 0.0678  -0.2134 0.3517  185 ILE A CA    
1343 C C     . ILE A 188 ? 1.4563 1.5535 0.8940 0.1012  -0.2425 0.3713  185 ILE A C     
1344 O O     . ILE A 188 ? 1.4471 1.6149 0.9393 0.0970  -0.2701 0.3652  185 ILE A O     
1345 C CB    . ILE A 188 ? 1.2389 1.2725 0.7151 0.0627  -0.1812 0.3506  185 ILE A CB    
1346 C CG1   . ILE A 188 ? 1.1985 1.2057 0.6829 0.0302  -0.1583 0.3274  185 ILE A CG1   
1347 C CG2   . ILE A 188 ? 1.1899 1.2849 0.7379 0.0659  -0.1965 0.3506  185 ILE A CG2   
1348 C CD1   . ILE A 188 ? 1.2610 1.2555 0.7889 0.0236  -0.1307 0.3220  185 ILE A CD1   
1349 N N     . ARG A 189 ? 1.5044 1.5601 0.8843 0.1349  -0.2352 0.3946  186 ARG A N     
1350 C CA    . ARG A 189 ? 1.5806 1.6752 0.9557 0.1743  -0.2632 0.4148  186 ARG A CA    
1351 C C     . ARG A 189 ? 1.5463 1.6926 0.9039 0.1750  -0.3074 0.4077  186 ARG A C     
1352 O O     . ARG A 189 ? 1.5611 1.7862 0.9641 0.1855  -0.3415 0.4074  186 ARG A O     
1353 C CB    . ARG A 189 ? 1.6608 1.6839 0.9652 0.2126  -0.2414 0.4424  186 ARG A CB    
1354 C CG    . ARG A 189 ? 1.6018 1.6024 0.9344 0.2297  -0.2140 0.4559  186 ARG A CG    
1355 C CD    . ARG A 189 ? 1.7063 1.6146 0.9585 0.2590  -0.1836 0.4802  186 ARG A CD    
1356 N NE    . ARG A 189 ? 1.8799 1.7703 1.0526 0.2882  -0.2036 0.4960  186 ARG A NE    
1357 C CZ    . ARG A 189 ? 1.9635 1.7961 1.0650 0.2763  -0.1907 0.4942  186 ARG A CZ    
1358 N NH1   . ARG A 189 ? 2.0232 1.8160 1.1294 0.2357  -0.1576 0.4766  186 ARG A NH1   
1359 N NH2   . ARG A 189 ? 1.9519 1.7684 0.9767 0.3068  -0.2108 0.5095  186 ARG A NH2   
1360 N N     . ASP A 190 ? 1.4692 1.5727 0.7618 0.1628  -0.3061 0.4003  187 ASP A N     
1361 C CA    . ASP A 190 ? 1.5801 1.7207 0.8410 0.1639  -0.3474 0.3923  187 ASP A CA    
1362 C C     . ASP A 190 ? 1.4696 1.6755 0.7924 0.1236  -0.3714 0.3631  187 ASP A C     
1363 O O     . ASP A 190 ? 1.4797 1.7275 0.7895 0.1185  -0.4090 0.3515  187 ASP A O     
1364 C CB    . ASP A 190 ? 1.7531 1.8184 0.9169 0.1648  -0.3342 0.3941  187 ASP A CB    
1365 C CG    . ASP A 190 ? 1.8838 1.8783 0.9748 0.2051  -0.3106 0.4244  187 ASP A CG    
1366 O OD1   . ASP A 190 ? 1.8412 1.8565 0.9437 0.2418  -0.3204 0.4451  187 ASP A OD1   
1367 O OD2   . ASP A 190 ? 1.9701 1.8860 0.9908 0.2005  -0.2804 0.4276  187 ASP A OD2   
1368 N N     . SER A 191 ? 1.3662 1.5770 0.7525 0.0951  -0.3494 0.3505  188 SER A N     
1369 C CA    . SER A 191 ? 1.4150 1.6750 0.8561 0.0561  -0.3658 0.3240  188 SER A CA    
1370 C C     . SER A 191 ? 1.4307 1.7710 0.9563 0.0574  -0.3828 0.3248  188 SER A C     
1371 O O     . SER A 191 ? 1.3893 1.7802 0.9631 0.0271  -0.4004 0.3050  188 SER A O     
1372 C CB    . SER A 191 ? 1.4338 1.6458 0.8846 0.0241  -0.3315 0.3078  188 SER A CB    
1373 O OG    . SER A 191 ? 1.4080 1.6518 0.8928 -0.0120 -0.3463 0.2824  188 SER A OG    
1374 N N     . GLY A 192 ? 1.4513 1.7996 0.9925 0.0924  -0.3748 0.3478  189 GLY A N     
1375 C CA    . GLY A 192 ? 1.4115 1.8371 1.0301 0.1002  -0.3882 0.3513  189 GLY A CA    
1376 C C     . GLY A 192 ? 1.3516 1.7759 1.0325 0.0776  -0.3603 0.3438  189 GLY A C     
1377 O O     . GLY A 192 ? 1.3650 1.8455 1.1095 0.0844  -0.3636 0.3479  189 GLY A O     
1378 N N     . MET A 193 ? 1.3094 1.6712 0.9711 0.0527  -0.3325 0.3323  190 MET A N     
1379 C CA    . MET A 193 ? 1.2538 1.6083 0.9656 0.0330  -0.3068 0.3239  190 MET A CA    
1380 C C     . MET A 193 ? 1.2075 1.5493 0.9383 0.0619  -0.2839 0.3431  190 MET A C     
1381 O O     . MET A 193 ? 1.3691 1.6683 1.0549 0.0907  -0.2725 0.3607  190 MET A O     
1382 C CB    . MET A 193 ? 1.3251 1.6153 1.0066 0.0071  -0.2831 0.3081  190 MET A CB    
1383 C CG    . MET A 193 ? 1.4224 1.7199 1.0921 -0.0254 -0.3005 0.2854  190 MET A CG    
1384 S SD    . MET A 193 ? 1.0587 1.2870 0.7023 -0.0504 -0.2700 0.2666  190 MET A SD    
1385 C CE    . MET A 193 ? 1.6089 1.7727 1.1847 -0.0262 -0.2478 0.2816  190 MET A CE    
1386 N N     . GLN A 194 ? 1.0552 1.4286 0.8479 0.0541  -0.2753 0.3394  191 GLN A N     
1387 C CA    . GLN A 194 ? 1.0849 1.4442 0.8966 0.0791  -0.2522 0.3545  191 GLN A CA    
1388 C C     . GLN A 194 ? 1.0872 1.3761 0.8813 0.0670  -0.2181 0.3473  191 GLN A C     
1389 O O     . GLN A 194 ? 1.0414 1.3261 0.8567 0.0383  -0.2104 0.3292  191 GLN A O     
1390 C CB    . GLN A 194 ? 1.1114 1.5372 0.9951 0.0776  -0.2570 0.3537  191 GLN A CB    
1391 C CG    . GLN A 194 ? 1.2014 1.6138 1.1045 0.1045  -0.2332 0.3680  191 GLN A CG    
1392 C CD    . GLN A 194 ? 1.2548 1.7384 1.2269 0.1069  -0.2379 0.3692  191 GLN A CD    
1393 O OE1   . GLN A 194 ? 1.2555 1.8095 1.2621 0.0967  -0.2630 0.3641  191 GLN A OE1   
1394 N NE2   . GLN A 194 ? 1.2484 1.7146 1.2408 0.1192  -0.2127 0.3746  191 GLN A NE2   
1395 N N     . LEU A 195 ? 1.1410 1.3744 0.8952 0.0891  -0.1978 0.3607  192 LEU A N     
1396 C CA    . LEU A 195 ? 0.9969 1.1670 0.7345 0.0767  -0.1659 0.3520  192 LEU A CA    
1397 C C     . LEU A 195 ? 0.9404 1.1097 0.7192 0.0812  -0.1468 0.3513  192 LEU A C     
1398 O O     . LEU A 195 ? 0.9644 1.1412 0.7531 0.1092  -0.1435 0.3677  192 LEU A O     
1399 C CB    . LEU A 195 ? 0.9803 1.0857 0.6546 0.0929  -0.1488 0.3646  192 LEU A CB    
1400 C CG    . LEU A 195 ? 1.0079 1.0502 0.6665 0.0789  -0.1139 0.3548  192 LEU A CG    
1401 C CD1   . LEU A 195 ? 0.8771 0.9219 0.5481 0.0445  -0.1119 0.3295  192 LEU A CD1   
1402 C CD2   . LEU A 195 ? 1.0899 1.0679 0.6829 0.0922  -0.0955 0.3683  192 LEU A CD2   
1403 N N     . MET A 196 ? 0.8759 1.0346 0.6750 0.0562  -0.1346 0.3320  193 MET A N     
1404 C CA    . MET A 196 ? 0.7833 0.9374 0.6155 0.0589  -0.1171 0.3282  193 MET A CA    
1405 C C     . MET A 196 ? 0.7729 0.8698 0.5850 0.0488  -0.0911 0.3158  193 MET A C     
1406 O O     . MET A 196 ? 0.8825 0.9672 0.6868 0.0261  -0.0887 0.2982  193 MET A O     
1407 C CB    . MET A 196 ? 0.6878 0.8850 0.5649 0.0405  -0.1267 0.3154  193 MET A CB    
1408 C CG    . MET A 196 ? 0.7103 0.9706 0.6135 0.0406  -0.1524 0.3221  193 MET A CG    
1409 S SD    . MET A 196 ? 1.1916 1.4936 1.1239 0.0765  -0.1556 0.3450  193 MET A SD    
1410 C CE    . MET A 196 ? 1.1071 1.4135 1.0824 0.0730  -0.1354 0.3384  193 MET A CE    
1411 N N     . THR A 197 ? 0.8223 0.8853 0.6267 0.0658  -0.0713 0.3236  194 THR A N     
1412 C CA    . THR A 197 ? 0.8747 0.8881 0.6660 0.0543  -0.0461 0.3095  194 THR A CA    
1413 C C     . THR A 197 ? 0.8474 0.8691 0.6748 0.0496  -0.0387 0.2953  194 THR A C     
1414 O O     . THR A 197 ? 0.9520 0.9780 0.7944 0.0681  -0.0345 0.3044  194 THR A O     
1415 C CB    . THR A 197 ? 0.9301 0.8898 0.6843 0.0717  -0.0254 0.3237  194 THR A CB    
1416 O OG1   . THR A 197 ? 1.1707 1.1109 0.8805 0.0751  -0.0284 0.3355  194 THR A OG1   
1417 C CG2   . THR A 197 ? 0.8137 0.7283 0.5639 0.0558  0.0014  0.3056  194 THR A CG2   
1418 N N     . LEU A 198 ? 0.8180 0.8406 0.6559 0.0276  -0.0370 0.2728  195 LEU A N     
1419 C CA    . LEU A 198 ? 0.7360 0.7635 0.6011 0.0250  -0.0315 0.2579  195 LEU A CA    
1420 C C     . LEU A 198 ? 0.7259 0.7123 0.5824 0.0245  -0.0093 0.2469  195 LEU A C     
1421 O O     . LEU A 198 ? 0.6972 0.6575 0.5360 0.0108  0.0024  0.2365  195 LEU A O     
1422 C CB    . LEU A 198 ? 0.7633 0.8103 0.6411 0.0065  -0.0413 0.2387  195 LEU A CB    
1423 C CG    . LEU A 198 ? 0.8027 0.8890 0.6974 0.0044  -0.0605 0.2451  195 LEU A CG    
1424 C CD1   . LEU A 198 ? 0.7028 0.8010 0.5801 -0.0023 -0.0747 0.2533  195 LEU A CD1   
1425 C CD2   . LEU A 198 ? 0.8900 0.9821 0.7961 -0.0076 -0.0636 0.2264  195 LEU A CD2   
1426 N N     . LYS A 199 ? 0.6644 0.6456 0.5335 0.0381  -0.0024 0.2480  196 LYS A N     
1427 C CA    . LYS A 199 ? 0.7364 0.6782 0.5977 0.0367  0.0175  0.2355  196 LYS A CA    
1428 C C     . LYS A 199 ? 0.6573 0.6059 0.5375 0.0483  0.0182  0.2293  196 LYS A C     
1429 O O     . LYS A 199 ? 0.7164 0.6904 0.6098 0.0642  0.0100  0.2441  196 LYS A O     
1430 C CB    . LYS A 199 ? 0.9738 0.8727 0.8046 0.0485  0.0333  0.2527  196 LYS A CB    
1431 C CG    . LYS A 199 ? 1.2066 1.0570 1.0168 0.0311  0.0562  0.2377  196 LYS A CG    
1432 C CD    . LYS A 199 ? 1.2728 1.1225 1.1040 0.0168  0.0624  0.2079  196 LYS A CD    
1433 C CE    . LYS A 199 ? 1.1464 1.0273 0.9963 -0.0053 0.0538  0.1850  196 LYS A CE    
1434 N NZ    . LYS A 199 ? 0.9232 0.8150 0.7961 -0.0130 0.0533  0.1562  196 LYS A NZ    
1435 N N     . ALA A 200 ? 0.6084 0.5365 0.4899 0.0398  0.0284  0.2065  197 ALA A N     
1436 C CA    . ALA A 200 ? 0.8197 0.7494 0.7121 0.0509  0.0290  0.1974  197 ALA A CA    
1437 C C     . ALA A 200 ? 1.0039 0.9204 0.8901 0.0761  0.0367  0.2182  197 ALA A C     
1438 O O     . ALA A 200 ? 1.0975 1.0296 0.9949 0.0901  0.0337  0.2207  197 ALA A O     
1439 C CB    . ALA A 200 ? 0.8383 0.7453 0.7289 0.0379  0.0384  0.1681  197 ALA A CB    
1440 N N     . ASP A 201 ? 1.0885 0.9736 0.9536 0.0838  0.0484  0.2335  198 ASP A N     
1441 C CA    . ASP A 201 ? 1.1679 1.0383 1.0242 0.1123  0.0567  0.2542  198 ASP A CA    
1442 C C     . ASP A 201 ? 1.0816 0.9797 0.9397 0.1288  0.0467  0.2827  198 ASP A C     
1443 O O     . ASP A 201 ? 1.0587 0.9324 0.8967 0.1512  0.0556  0.3019  198 ASP A O     
1444 C CB    . ASP A 201 ? 1.3560 1.1611 1.1807 0.1154  0.0794  0.2504  198 ASP A CB    
1445 C CG    . ASP A 201 ? 1.5523 1.3246 1.3504 0.1040  0.0883  0.2569  198 ASP A CG    
1446 O OD1   . ASP A 201 ? 1.6180 1.4163 1.4236 0.0859  0.0775  0.2538  198 ASP A OD1   
1447 O OD2   . ASP A 201 ? 1.6444 1.3600 1.4095 0.1139  0.1078  0.2654  198 ASP A OD2   
1448 N N     . GLY A 202 ? 1.0801 1.0282 0.9602 0.1185  0.0276  0.2844  199 GLY A N     
1449 C CA    . GLY A 202 ? 0.9839 0.9690 0.8710 0.1311  0.0137  0.3073  199 GLY A CA    
1450 C C     . GLY A 202 ? 0.9453 0.9621 0.8548 0.1576  0.0129  0.3231  199 GLY A C     
1451 O O     . GLY A 202 ? 0.8979 0.9135 0.8196 0.1623  0.0211  0.3151  199 GLY A O     
1452 N N     . ASP A 203 ? 0.9664 1.0140 0.8810 0.1764  0.0028  0.3449  200 ASP A N     
1453 C CA    . ASP A 203 ? 0.8474 0.9341 0.7884 0.2042  0.0026  0.3608  200 ASP A CA    
1454 C C     . ASP A 203 ? 0.8056 0.9582 0.7912 0.1902  -0.0106 0.3570  200 ASP A C     
1455 O O     . ASP A 203 ? 0.7820 0.9560 0.7919 0.2008  -0.0024 0.3586  200 ASP A O     
1456 C CB    . ASP A 203 ? 0.8215 0.9203 0.7517 0.2334  -0.0044 0.3847  200 ASP A CB    
1457 C CG    . ASP A 203 ? 0.9999 1.0234 0.8789 0.2503  0.0130  0.3915  200 ASP A CG    
1458 O OD1   . ASP A 203 ? 1.0124 0.9874 0.8767 0.2570  0.0343  0.3847  200 ASP A OD1   
1459 O OD2   . ASP A 203 ? 0.9728 0.9817 0.8224 0.2566  0.0064  0.4031  200 ASP A OD2   
1460 N N     . ILE A 204 ? 0.6693 0.8495 0.6621 0.1658  -0.0289 0.3519  201 ILE A N     
1461 C CA    . ILE A 204 ? 0.6677 0.9034 0.6981 0.1476  -0.0406 0.3473  201 ILE A CA    
1462 C C     . ILE A 204 ? 0.7054 0.9175 0.7312 0.1215  -0.0357 0.3261  201 ILE A C     
1463 O O     . ILE A 204 ? 0.8238 0.9935 0.8218 0.1090  -0.0335 0.3128  201 ILE A O     
1464 C CB    . ILE A 204 ? 0.6576 0.9357 0.6960 0.1349  -0.0646 0.3517  201 ILE A CB    
1465 C CG1   . ILE A 204 ? 0.8687 1.1635 0.9006 0.1647  -0.0725 0.3720  201 ILE A CG1   
1466 C CG2   . ILE A 204 ? 0.6270 0.9646 0.7077 0.1162  -0.0744 0.3480  201 ILE A CG2   
1467 C CD1   . ILE A 204 ? 1.0034 1.3414 1.0693 0.1945  -0.0673 0.3867  201 ILE A CD1   
1468 N N     . SER A 205 ? 0.4718 0.7117 0.5240 0.1145  -0.0329 0.3230  202 SER A N     
1469 C CA    . SER A 205 ? 0.5572 0.7751 0.6014 0.0941  -0.0295 0.3048  202 SER A CA    
1470 C C     . SER A 205 ? 0.5264 0.7577 0.5697 0.0662  -0.0462 0.2965  202 SER A C     
1471 O O     . SER A 205 ? 0.4890 0.7622 0.5509 0.0591  -0.0599 0.3049  202 SER A O     
1472 C CB    . SER A 205 ? 0.4465 0.6807 0.5109 0.0984  -0.0173 0.3064  202 SER A CB    
1473 O OG    . SER A 205 ? 0.6368 0.8462 0.6868 0.0820  -0.0149 0.2904  202 SER A OG    
1474 N N     . VAL A 206 ? 0.5060 0.7030 0.5273 0.0516  -0.0459 0.2787  203 VAL A N     
1475 C CA    . VAL A 206 ? 0.4740 0.6744 0.4878 0.0273  -0.0596 0.2691  203 VAL A CA    
1476 C C     . VAL A 206 ? 0.4570 0.6879 0.4919 0.0119  -0.0633 0.2708  203 VAL A C     
1477 O O     . VAL A 206 ? 0.5753 0.8202 0.6102 -0.0085 -0.0765 0.2671  203 VAL A O     
1478 C CB    . VAL A 206 ? 0.4970 0.6563 0.4843 0.0195  -0.0567 0.2487  203 VAL A CB    
1479 C CG1   . VAL A 206 ? 0.3802 0.5245 0.3657 0.0230  -0.0472 0.2402  203 VAL A CG1   
1480 C CG2   . VAL A 206 ? 0.3972 0.5561 0.3719 -0.0015 -0.0697 0.2397  203 VAL A CG2   
1481 N N     . LYS A 207 ? 0.4313 0.6693 0.4818 0.0205  -0.0499 0.2757  204 LYS A N     
1482 C CA    . LYS A 207 ? 0.5235 0.7864 0.5941 0.0042  -0.0473 0.2777  204 LYS A CA    
1483 C C     . LYS A 207 ? 0.5874 0.9107 0.6946 -0.0034 -0.0586 0.2895  204 LYS A C     
1484 O O     . LYS A 207 ? 0.6045 0.9530 0.7291 -0.0272 -0.0624 0.2873  204 LYS A O     
1485 C CB    . LYS A 207 ? 0.6218 0.8759 0.6973 0.0179  -0.0265 0.2816  204 LYS A CB    
1486 C CG    . LYS A 207 ? 0.8390 1.0872 0.9138 -0.0009 -0.0174 0.2780  204 LYS A CG    
1487 C CD    . LYS A 207 ? 0.9787 1.1738 1.0116 -0.0086 -0.0201 0.2616  204 LYS A CD    
1488 C CE    . LYS A 207 ? 1.0659 1.2415 1.0873 -0.0235 -0.0079 0.2595  204 LYS A CE    
1489 N NZ    . LYS A 207 ? 1.0334 1.1548 1.0095 -0.0241 -0.0109 0.2443  204 LYS A NZ    
1490 N N     . GLU A 208 ? 0.4167 0.7621 0.5340 0.0170  -0.0641 0.3010  205 GLU A N     
1491 C CA    . GLU A 208 ? 0.5582 0.9679 0.7116 0.0175  -0.0770 0.3126  205 GLU A CA    
1492 C C     . GLU A 208 ? 0.5142 0.9358 0.6565 0.0011  -0.1014 0.3080  205 GLU A C     
1493 O O     . GLU A 208 ? 0.4945 0.9717 0.6632 0.0007  -0.1175 0.3149  205 GLU A O     
1494 C CB    . GLU A 208 ? 0.6281 1.0543 0.7925 0.0532  -0.0719 0.3286  205 GLU A CB    
1495 C CG    . GLU A 208 ? 0.7158 1.1452 0.8984 0.0709  -0.0485 0.3350  205 GLU A CG    
1496 C CD    . GLU A 208 ? 0.8955 1.3273 1.0790 0.1093  -0.0417 0.3495  205 GLU A CD    
1497 O OE1   . GLU A 208 ? 0.9091 1.3936 1.1310 0.1255  -0.0366 0.3615  205 GLU A OE1   
1498 O OE2   . GLU A 208 ? 0.9505 1.3308 1.0964 0.1231  -0.0399 0.3485  205 GLU A OE2   
1499 N N     . LEU A 209 ? 0.5691 0.9409 0.6722 -0.0108 -0.1045 0.2953  206 LEU A N     
1500 C CA    . LEU A 209 ? 0.5670 0.9410 0.6510 -0.0249 -0.1251 0.2901  206 LEU A CA    
1501 C C     . LEU A 209 ? 0.5474 0.9565 0.6500 -0.0558 -0.1386 0.2823  206 LEU A C     
1502 O O     . LEU A 209 ? 0.5137 0.9576 0.6207 -0.0630 -0.1598 0.2831  206 LEU A O     
1503 C CB    . LEU A 209 ? 0.7050 1.0184 0.7446 -0.0295 -0.1213 0.2772  206 LEU A CB    
1504 C CG    . LEU A 209 ? 0.7359 1.0129 0.7547 -0.0055 -0.1091 0.2813  206 LEU A CG    
1505 C CD1   . LEU A 209 ? 0.7084 0.9384 0.6907 -0.0148 -0.1068 0.2663  206 LEU A CD1   
1506 C CD2   . LEU A 209 ? 0.5773 0.8749 0.5969 0.0157  -0.1163 0.2984  206 LEU A CD2   
1507 N N     . GLY A 210 ? 0.5734 0.9699 0.6832 -0.0742 -0.1260 0.2742  207 GLY A N     
1508 C CA    . GLY A 210 ? 0.6747 1.0940 0.7990 -0.1078 -0.1339 0.2651  207 GLY A CA    
1509 C C     . GLY A 210 ? 0.8028 1.3013 0.9781 -0.1131 -0.1456 0.2727  207 GLY A C     
1510 O O     . GLY A 210 ? 0.8848 1.4131 1.0740 -0.1428 -0.1594 0.2635  207 GLY A O     
1511 N N     . ASP A 211 ? 0.8849 1.4188 1.0886 -0.0838 -0.1402 0.2882  208 ASP A N     
1512 C CA    . ASP A 211 ? 0.8818 1.5002 1.1398 -0.0820 -0.1509 0.2960  208 ASP A CA    
1513 C C     . ASP A 211 ? 0.7981 1.4535 1.0524 -0.0758 -0.1822 0.2974  208 ASP A C     
1514 O O     . ASP A 211 ? 0.8411 1.5700 1.1364 -0.0866 -0.2002 0.2958  208 ASP A O     
1515 C CB    . ASP A 211 ? 0.8908 1.5316 1.1766 -0.0474 -0.1332 0.3124  208 ASP A CB    
1516 C CG    . ASP A 211 ? 0.9465 1.5646 1.2417 -0.0542 -0.1030 0.3115  208 ASP A CG    
1517 O OD1   . ASP A 211 ? 0.9846 1.5935 1.2822 -0.0887 -0.0967 0.3004  208 ASP A OD1   
1518 O OD2   . ASP A 211 ? 0.9142 1.5189 1.2096 -0.0242 -0.0845 0.3221  208 ASP A OD2   
1519 N N     . ASN A 212 ? 0.7426 1.3481 0.9470 -0.0582 -0.1882 0.2997  209 ASN A N     
1520 C CA    . ASN A 212 ? 0.7049 1.3328 0.8924 -0.0477 -0.2157 0.3030  209 ASN A CA    
1521 C C     . ASN A 212 ? 0.6647 1.3070 0.8444 -0.0840 -0.2385 0.2858  209 ASN A C     
1522 O O     . ASN A 212 ? 0.5716 1.1574 0.7140 -0.1063 -0.2339 0.2724  209 ASN A O     
1523 C CB    . ASN A 212 ? 0.6869 1.2487 0.8184 -0.0228 -0.2104 0.3096  209 ASN A CB    
1524 C CG    . ASN A 212 ? 0.8342 1.4142 0.9427 -0.0028 -0.2343 0.3185  209 ASN A CG    
1525 O OD1   . ASN A 212 ? 0.7657 1.3969 0.8868 -0.0152 -0.2606 0.3132  209 ASN A OD1   
1526 N ND2   . ASN A 212 ? 0.8793 1.4145 0.9504 0.0280  -0.2251 0.3313  209 ASN A ND2   
1527 N N     . PRO A 213 ? 0.7943 1.5140 1.0088 -0.0886 -0.2639 0.2851  210 PRO A N     
1528 C CA    . PRO A 213 ? 0.9015 1.6452 1.1138 -0.1250 -0.2886 0.2666  210 PRO A CA    
1529 C C     . PRO A 213 ? 0.9125 1.6160 1.0613 -0.1188 -0.3082 0.2633  210 PRO A C     
1530 O O     . PRO A 213 ? 0.9882 1.6761 1.1130 -0.1501 -0.3212 0.2454  210 PRO A O     
1531 C CB    . PRO A 213 ? 0.9494 1.7993 1.2245 -0.1228 -0.3105 0.2686  210 PRO A CB    
1532 C CG    . PRO A 213 ? 0.9473 1.8249 1.2633 -0.0901 -0.2896 0.2873  210 PRO A CG    
1533 C CD    . PRO A 213 ? 0.8350 1.6295 1.0984 -0.0590 -0.2697 0.3003  210 PRO A CD    
1534 N N     . ASP A 214 ? 0.9223 1.6050 1.0406 -0.0789 -0.3082 0.2803  211 ASP A N     
1535 C CA    . ASP A 214 ? 0.9842 1.6251 1.0383 -0.0700 -0.3224 0.2798  211 ASP A CA    
1536 C C     . ASP A 214 ? 1.0367 1.5904 1.0413 -0.0855 -0.3020 0.2697  211 ASP A C     
1537 O O     . ASP A 214 ? 1.0974 1.6145 1.1100 -0.0873 -0.2748 0.2696  211 ASP A O     
1538 C CB    . ASP A 214 ? 1.0922 1.7279 1.1245 -0.0223 -0.3229 0.3027  211 ASP A CB    
1539 C CG    . ASP A 214 ? 1.1749 1.8980 1.2493 0.0011  -0.3465 0.3133  211 ASP A CG    
1540 O OD1   . ASP A 214 ? 1.2093 1.9792 1.2808 -0.0052 -0.3794 0.3060  211 ASP A OD1   
1541 O OD2   . ASP A 214 ? 1.1544 1.9007 1.2641 0.0276  -0.3327 0.3282  211 ASP A OD2   
1542 N N     . ARG A 215 ? 1.0300 1.5533 0.9830 -0.0949 -0.3158 0.2603  212 ARG A N     
1543 C CA    . ARG A 215 ? 0.8927 1.3372 0.7954 -0.1022 -0.2970 0.2522  212 ARG A CA    
1544 C C     . ARG A 215 ? 0.9391 1.3426 0.8192 -0.0692 -0.2759 0.2691  212 ARG A C     
1545 O O     . ARG A 215 ? 1.0058 1.4216 0.8721 -0.0408 -0.2844 0.2855  212 ARG A O     
1546 C CB    . ARG A 215 ? 0.9836 1.4081 0.8336 -0.1157 -0.3161 0.2397  212 ARG A CB    
1547 C CG    . ARG A 215 ? 1.0299 1.3772 0.8253 -0.1173 -0.2959 0.2329  212 ARG A CG    
1548 C CD    . ARG A 215 ? 1.0547 1.3834 0.7966 -0.1306 -0.3140 0.2198  212 ARG A CD    
1549 N NE    . ARG A 215 ? 1.0459 1.3065 0.7355 -0.1272 -0.2932 0.2153  212 ARG A NE    
1550 C CZ    . ARG A 215 ? 1.1251 1.3554 0.7609 -0.1372 -0.3008 0.2031  212 ARG A CZ    
1551 N NH1   . ARG A 215 ? 1.1220 1.3811 0.7460 -0.1519 -0.3309 0.1933  212 ARG A NH1   
1552 N NH2   . ARG A 215 ? 1.1573 1.3307 0.7517 -0.1329 -0.2781 0.1991  212 ARG A NH2   
1553 N N     . LEU A 216 ? 0.9828 1.3365 0.8574 -0.0725 -0.2487 0.2644  213 LEU A N     
1554 C CA    . LEU A 216 ? 0.8813 1.1971 0.7418 -0.0466 -0.2261 0.2771  213 LEU A CA    
1555 C C     . LEU A 216 ? 0.8935 1.1474 0.7015 -0.0478 -0.2120 0.2709  213 LEU A C     
1556 O O     . LEU A 216 ? 0.8769 1.1092 0.6642 -0.0692 -0.2129 0.2540  213 LEU A O     
1557 C CB    . LEU A 216 ? 0.7256 1.0378 0.6242 -0.0450 -0.2046 0.2769  213 LEU A CB    
1558 C CG    . LEU A 216 ? 0.7532 1.1067 0.6920 -0.0223 -0.2037 0.2939  213 LEU A CG    
1559 C CD1   . LEU A 216 ? 0.9100 1.3320 0.8746 -0.0226 -0.2310 0.2991  213 LEU A CD1   
1560 C CD2   . LEU A 216 ? 0.5856 0.9393 0.5605 -0.0272 -0.1851 0.2899  213 LEU A CD2   
1561 N N     . ALA A 217 ? 0.8593 1.0837 0.6456 -0.0245 -0.1971 0.2846  214 ALA A N     
1562 C CA    . ALA A 217 ? 0.8052 0.9718 0.5497 -0.0259 -0.1763 0.2793  214 ALA A CA    
1563 C C     . ALA A 217 ? 0.7623 0.9029 0.5253 -0.0186 -0.1491 0.2795  214 ALA A C     
1564 O O     . ALA A 217 ? 0.7622 0.8953 0.5262 0.0029  -0.1400 0.2952  214 ALA A O     
1565 C CB    . ALA A 217 ? 0.8241 0.9693 0.5182 -0.0083 -0.1793 0.2940  214 ALA A CB    
1566 N N     . LEU A 218 ? 0.8261 0.9520 0.6012 -0.0352 -0.1371 0.2609  215 LEU A N     
1567 C CA    . LEU A 218 ? 0.7894 0.8976 0.5855 -0.0303 -0.1155 0.2568  215 LEU A CA    
1568 C C     . LEU A 218 ? 0.7553 0.8187 0.5234 -0.0301 -0.0926 0.2517  215 LEU A C     
1569 O O     . LEU A 218 ? 0.7446 0.7910 0.4917 -0.0437 -0.0878 0.2379  215 LEU A O     
1570 C CB    . LEU A 218 ? 0.6799 0.7971 0.5024 -0.0446 -0.1154 0.2392  215 LEU A CB    
1571 C CG    . LEU A 218 ? 0.6390 0.7944 0.4843 -0.0535 -0.1349 0.2403  215 LEU A CG    
1572 C CD1   . LEU A 218 ? 0.6769 0.8257 0.5340 -0.0676 -0.1314 0.2231  215 LEU A CD1   
1573 C CD2   . LEU A 218 ? 0.6622 0.8510 0.5389 -0.0379 -0.1386 0.2577  215 LEU A CD2   
1574 N N     . LEU A 219 ? 0.7292 0.7728 0.4972 -0.0155 -0.0766 0.2621  216 LEU A N     
1575 C CA    . LEU A 219 ? 0.7654 0.7647 0.5084 -0.0182 -0.0515 0.2578  216 LEU A CA    
1576 C C     . LEU A 219 ? 0.7167 0.7053 0.4866 -0.0233 -0.0334 0.2418  216 LEU A C     
1577 O O     . LEU A 219 ? 0.6761 0.6742 0.4710 -0.0126 -0.0336 0.2457  216 LEU A O     
1578 C CB    . LEU A 219 ? 0.8857 0.8572 0.5964 0.0009  -0.0437 0.2808  216 LEU A CB    
1579 C CG    . LEU A 219 ? 0.8696 0.7872 0.5528 -0.0034 -0.0126 0.2784  216 LEU A CG    
1580 C CD1   . LEU A 219 ? 0.8516 0.7529 0.5080 -0.0224 -0.0034 0.2657  216 LEU A CD1   
1581 C CD2   . LEU A 219 ? 0.9442 0.8268 0.5910 0.0196  -0.0042 0.3038  216 LEU A CD2   
1582 N N     . PHE A 220 ? 0.7334 0.7049 0.4980 -0.0389 -0.0178 0.2227  217 PHE A N     
1583 C CA    . PHE A 220 ? 0.6861 0.6521 0.4761 -0.0450 -0.0023 0.2035  217 PHE A CA    
1584 C C     . PHE A 220 ? 0.8208 0.7522 0.5932 -0.0565 0.0248  0.1955  217 PHE A C     
1585 O O     . PHE A 220 ? 0.7954 0.7166 0.5441 -0.0667 0.0319  0.1926  217 PHE A O     
1586 C CB    . PHE A 220 ? 0.6288 0.6211 0.4419 -0.0540 -0.0119 0.1811  217 PHE A CB    
1587 C CG    . PHE A 220 ? 0.6590 0.6789 0.4856 -0.0477 -0.0346 0.1873  217 PHE A CG    
1588 C CD1   . PHE A 220 ? 0.6190 0.6515 0.4721 -0.0397 -0.0384 0.1845  217 PHE A CD1   
1589 C CD2   . PHE A 220 ? 0.5750 0.6062 0.3856 -0.0515 -0.0508 0.1947  217 PHE A CD2   
1590 C CE1   . PHE A 220 ? 0.6633 0.7181 0.5279 -0.0367 -0.0548 0.1903  217 PHE A CE1   
1591 C CE2   . PHE A 220 ? 0.6351 0.6909 0.4600 -0.0507 -0.0691 0.1986  217 PHE A CE2   
1592 C CZ    . PHE A 220 ? 0.6912 0.7582 0.5437 -0.0439 -0.0696 0.1970  217 PHE A CZ    
1593 N N     . GLY A 221 ? 0.7467 0.6582 0.5294 -0.0562 0.0417  0.1912  218 GLY A N     
1594 C CA    . GLY A 221 ? 0.9111 0.7895 0.6824 -0.0721 0.0707  0.1804  218 GLY A CA    
1595 C C     . GLY A 221 ? 0.9407 0.8434 0.7462 -0.0895 0.0767  0.1475  218 GLY A C     
1596 O O     . GLY A 221 ? 0.7794 0.7192 0.6095 -0.0859 0.0577  0.1352  218 GLY A O     
1597 N N     . SER A 222 ? 1.0454 0.9273 0.8516 -0.1079 0.1038  0.1327  219 SER A N     
1598 C CA    . SER A 222 ? 1.0055 0.9178 0.8498 -0.1242 0.1100  0.0988  219 SER A CA    
1599 C C     . SER A 222 ? 1.0950 1.0009 0.9631 -0.1288 0.1180  0.0837  219 SER A C     
1600 O O     . SER A 222 ? 1.0436 0.9843 0.9485 -0.1343 0.1124  0.0555  219 SER A O     
1601 C CB    . SER A 222 ? 1.0881 0.9925 0.9240 -0.1462 0.1360  0.0872  219 SER A CB    
1602 O OG    . SER A 222 ? 1.2115 1.0636 1.0196 -0.1579 0.1654  0.0979  219 SER A OG    
1603 N N     . GLU A 223 ? 1.2104 1.0701 1.0539 -0.1245 0.1303  0.1020  220 GLU A N     
1604 C CA    . GLU A 223 ? 1.2233 1.0651 1.0802 -0.1291 0.1403  0.0890  220 GLU A CA    
1605 C C     . GLU A 223 ? 1.2689 1.1131 1.1266 -0.1027 0.1195  0.1031  220 GLU A C     
1606 O O     . GLU A 223 ? 1.2437 1.0969 1.0888 -0.0826 0.1019  0.1272  220 GLU A O     
1607 C CB    . GLU A 223 ? 1.2822 1.0599 1.1057 -0.1421 0.1733  0.0988  220 GLU A CB    
1608 C CG    . GLU A 223 ? 1.4928 1.2603 1.3117 -0.1711 0.2012  0.0862  220 GLU A CG    
1609 C CD    . GLU A 223 ? 1.6500 1.4457 1.5144 -0.1996 0.2135  0.0455  220 GLU A CD    
1610 O OE1   . GLU A 223 ? 1.6812 1.5340 1.5871 -0.1945 0.1898  0.0234  220 GLU A OE1   
1611 O OE2   . GLU A 223 ? 1.7078 1.4682 1.5653 -0.2271 0.2471  0.0352  220 GLU A OE2   
1612 N N     . LYS A 224 ? 1.3397 1.1773 1.2128 -0.1040 0.1225  0.0866  221 LYS A N     
1613 C CA    . LYS A 224 ? 1.3384 1.1687 1.2070 -0.0791 0.1098  0.1004  221 LYS A CA    
1614 C C     . LYS A 224 ? 1.4696 1.2443 1.2990 -0.0672 0.1254  0.1300  221 LYS A C     
1615 O O     . LYS A 224 ? 1.3886 1.1588 1.2083 -0.0413 0.1154  0.1516  221 LYS A O     
1616 C CB    . LYS A 224 ? 1.3470 1.1819 1.2370 -0.0834 0.1092  0.0722  221 LYS A CB    
1617 C CG    . LYS A 224 ? 1.4054 1.2402 1.2927 -0.0563 0.0948  0.0831  221 LYS A CG    
1618 C CD    . LYS A 224 ? 1.4373 1.2978 1.3485 -0.0572 0.0833  0.0519  221 LYS A CD    
1619 C CE    . LYS A 224 ? 1.4851 1.3200 1.3999 -0.0799 0.1013  0.0234  221 LYS A CE    
1620 N NZ    . LYS A 224 ? 1.4998 1.2758 1.3853 -0.0717 0.1178  0.0359  221 LYS A NZ    
1621 N N     . GLY A 225 ? 1.6070 1.3390 1.4125 -0.0853 0.1516  0.1310  222 GLY A N     
1622 C CA    . GLY A 225 ? 1.7181 1.3895 1.4770 -0.0723 0.1688  0.1604  222 GLY A CA    
1623 C C     . GLY A 225 ? 1.7688 1.4422 1.5012 -0.0640 0.1639  0.1858  222 GLY A C     
1624 O O     . GLY A 225 ? 1.8322 1.4548 1.5194 -0.0525 0.1781  0.2108  222 GLY A O     
1625 N N     . GLY A 226 ? 1.7011 1.4298 1.4571 -0.0683 0.1435  0.1789  223 GLY A N     
1626 C CA    . GLY A 226 ? 1.5810 1.3173 1.3127 -0.0608 0.1343  0.1996  223 GLY A CA    
1627 C C     . GLY A 226 ? 1.4812 1.2513 1.2181 -0.0328 0.1043  0.2206  223 GLY A C     
1628 O O     . GLY A 226 ? 1.5542 1.3399 1.3133 -0.0194 0.0941  0.2198  223 GLY A O     
1629 N N     . PRO A 227 ? 1.2855 1.0681 1.0016 -0.0248 0.0909  0.2383  224 PRO A N     
1630 C CA    . PRO A 227 ? 1.3366 1.0962 1.0182 -0.0376 0.1037  0.2412  224 PRO A CA    
1631 C C     . PRO A 227 ? 1.4205 1.1131 1.0493 -0.0284 0.1277  0.2627  224 PRO A C     
1632 O O     . PRO A 227 ? 1.4849 1.1507 1.1045 -0.0096 0.1321  0.2761  224 PRO A O     
1633 C CB    . PRO A 227 ? 1.2841 1.0820 0.9597 -0.0264 0.0748  0.2542  224 PRO A CB    
1634 C CG    . PRO A 227 ? 1.2788 1.1244 0.9946 -0.0141 0.0490  0.2535  224 PRO A CG    
1635 C CD    . PRO A 227 ? 1.2405 1.0652 0.9674 -0.0040 0.0610  0.2546  224 PRO A CD    
1636 N N     . SER A 228 ? 1.4162 1.0780 1.0062 -0.0397 0.1446  0.2666  225 SER A N     
1637 C CA    . SER A 228 ? 1.4646 1.0537 0.9928 -0.0302 0.1698  0.2891  225 SER A CA    
1638 C C     . SER A 228 ? 1.4296 1.0095 0.9324 0.0094  0.1519  0.3201  225 SER A C     
1639 O O     . SER A 228 ? 1.3796 1.0030 0.8843 0.0280  0.1206  0.3326  225 SER A O     
1640 C CB    . SER A 228 ? 1.5399 1.1079 1.0241 -0.0405 0.1816  0.2943  225 SER A CB    
1641 O OG    . SER A 228 ? 1.7365 1.2292 1.1512 -0.0263 0.2046  0.3200  225 SER A OG    
1642 N N     . ASP A 229 ? 1.5610 1.0851 1.0406 0.0223  0.1721  0.3311  226 ASP A N     
1643 C CA    . ASP A 229 ? 1.6724 1.1870 1.1300 0.0641  0.1581  0.3596  226 ASP A CA    
1644 C C     . ASP A 229 ? 1.5402 1.0379 0.9395 0.0905  0.1481  0.3886  226 ASP A C     
1645 O O     . ASP A 229 ? 1.3726 0.8705 0.7525 0.1294  0.1329  0.4133  226 ASP A O     
1646 C CB    . ASP A 229 ? 1.8361 1.2813 1.2717 0.0725  0.1869  0.3642  226 ASP A CB    
1647 C CG    . ASP A 229 ? 1.9603 1.3209 1.3470 0.0486  0.2298  0.3607  226 ASP A CG    
1648 O OD1   . ASP A 229 ? 1.9790 1.3336 1.3434 0.0308  0.2378  0.3592  226 ASP A OD1   
1649 O OD2   . ASP A 229 ? 2.0497 1.3471 1.4184 0.0466  0.2575  0.3588  226 ASP A OD2   
1650 N N     . LEU A 230 ? 1.4981 0.9835 0.8690 0.0712  0.1563  0.3849  227 LEU A N     
1651 C CA    . LEU A 230 ? 1.5792 1.0496 0.8899 0.0949  0.1449  0.4097  227 LEU A CA    
1652 C C     . LEU A 230 ? 1.6011 1.1573 0.9443 0.1073  0.0983  0.4107  227 LEU A C     
1653 O O     . LEU A 230 ? 1.7138 1.2740 1.0151 0.1303  0.0791  0.4296  227 LEU A O     
1654 C CB    . LEU A 230 ? 1.7149 1.1374 0.9790 0.0693  0.1733  0.4047  227 LEU A CB    
1655 C CG    . LEU A 230 ? 1.8406 1.1707 1.0638 0.0539  0.2238  0.4054  227 LEU A CG    
1656 C CD1   . LEU A 230 ? 1.8691 1.1551 1.0418 0.0316  0.2523  0.4040  227 LEU A CD1   
1657 C CD2   . LEU A 230 ? 1.8415 1.1046 1.0087 0.0931  0.2329  0.4359  227 LEU A CD2   
1658 N N     . PHE A 231 ? 1.5407 1.1632 0.9562 0.0913  0.0806  0.3895  228 PHE A N     
1659 C CA    . PHE A 231 ? 1.4750 1.1772 0.9273 0.0982  0.0395  0.3879  228 PHE A CA    
1660 C C     . PHE A 231 ? 1.4259 1.1621 0.9035 0.1310  0.0192  0.4036  228 PHE A C     
1661 O O     . PHE A 231 ? 1.3380 1.1422 0.8484 0.1388  -0.0139 0.4046  228 PHE A O     
1662 C CB    . PHE A 231 ? 1.3685 1.1197 0.8804 0.0651  0.0330  0.3578  228 PHE A CB    
1663 C CG    . PHE A 231 ? 1.3496 1.1023 0.8453 0.0403  0.0346  0.3435  228 PHE A CG    
1664 C CD1   . PHE A 231 ? 1.3471 1.0627 0.8352 0.0139  0.0669  0.3267  228 PHE A CD1   
1665 C CD2   . PHE A 231 ? 1.3315 1.1248 0.8211 0.0427  0.0045  0.3451  228 PHE A CD2   
1666 C CE1   . PHE A 231 ? 1.3559 1.0750 0.8301 -0.0064 0.0704  0.3133  228 PHE A CE1   
1667 C CE2   . PHE A 231 ? 1.3256 1.1160 0.7961 0.0217  0.0072  0.3313  228 PHE A CE2   
1668 C CZ    . PHE A 231 ? 1.3451 1.0985 0.8076 -0.0013 0.0409  0.3162  228 PHE A CZ    
1669 N N     . GLU A 232 ? 1.4962 1.1842 0.9587 0.1493  0.0409  0.4149  229 GLU A N     
1670 C CA    . GLU A 232 ? 1.5659 1.2827 1.0552 0.1815  0.0276  0.4281  229 GLU A CA    
1671 C C     . GLU A 232 ? 1.5866 1.3428 1.0606 0.2189  -0.0036 0.4517  229 GLU A C     
1672 O O     . GLU A 232 ? 1.4954 1.3284 1.0208 0.2268  -0.0319 0.4503  229 GLU A O     
1673 C CB    . GLU A 232 ? 1.7480 1.3921 1.2115 0.1957  0.0602  0.4359  229 GLU A CB    
1674 C CG    . GLU A 232 ? 1.8230 1.4545 1.3242 0.1639  0.0817  0.4093  229 GLU A CG    
1675 C CD    . GLU A 232 ? 1.8654 1.5681 1.4352 0.1640  0.0614  0.3975  229 GLU A CD    
1676 O OE1   . GLU A 232 ? 1.9170 1.6441 1.4985 0.1974  0.0493  0.4138  229 GLU A OE1   
1677 O OE2   . GLU A 232 ? 1.8116 1.5449 1.4219 0.1323  0.0589  0.3722  229 GLU A OE2   
1678 N N     . GLU A 233 ? 1.6389 1.3433 1.0419 0.2421  0.0019  0.4729  230 GLU A N     
1679 C CA    . GLU A 233 ? 1.6281 1.3704 1.0110 0.2816  -0.0302 0.4949  230 GLU A CA    
1680 C C     . GLU A 233 ? 1.6237 1.4601 1.0545 0.2658  -0.0695 0.4817  230 GLU A C     
1681 O O     . GLU A 233 ? 1.6040 1.5131 1.0748 0.2869  -0.0991 0.4873  230 GLU A O     
1682 C CB    . GLU A 233 ? 1.6311 1.3014 0.9215 0.3022  -0.0201 0.5157  230 GLU A CB    
1683 C CG    . GLU A 233 ? 1.7629 1.3581 0.9973 0.3446  0.0023  0.5420  230 GLU A CG    
1684 C CD    . GLU A 233 ? 2.0606 1.6318 1.2180 0.3889  -0.0129 0.5701  230 GLU A CD    
1685 O OE1   . GLU A 233 ? 2.1211 1.7727 1.3007 0.4152  -0.0549 0.5767  230 GLU A OE1   
1686 O OE2   . GLU A 233 ? 2.1700 1.6422 1.2437 0.3973  0.0173  0.5850  230 GLU A OE2   
1687 N N     . ALA A 234 ? 1.5904 1.4243 1.0168 0.2280  -0.0682 0.4631  231 ALA A N     
1688 C CA    . ALA A 234 ? 1.5326 1.4429 0.9969 0.2083  -0.1020 0.4480  231 ALA A CA    
1689 C C     . ALA A 234 ? 1.4442 1.4199 0.9917 0.1928  -0.1116 0.4323  231 ALA A C     
1690 O O     . ALA A 234 ? 1.4540 1.5047 1.0418 0.1938  -0.1430 0.4292  231 ALA A O     
1691 C CB    . ALA A 234 ? 1.5159 1.3990 0.9541 0.1726  -0.0925 0.4306  231 ALA A CB    
1692 N N     . SER A 235 ? 1.3598 1.3057 0.9307 0.1777  -0.0838 0.4216  232 SER A N     
1693 C CA    . SER A 235 ? 1.2026 1.1984 0.8433 0.1652  -0.0881 0.4077  232 SER A CA    
1694 C C     . SER A 235 ? 1.1898 1.2327 0.8612 0.1992  -0.1028 0.4241  232 SER A C     
1695 O O     . SER A 235 ? 1.2666 1.2741 0.9131 0.2318  -0.0896 0.4424  232 SER A O     
1696 C CB    . SER A 235 ? 1.0856 1.0338 0.7355 0.1480  -0.0555 0.3940  232 SER A CB    
1697 O OG    . SER A 235 ? 0.9923 0.9827 0.7012 0.1411  -0.0590 0.3826  232 SER A OG    
1698 N N     . SER A 236 ? 1.0613 1.1830 0.7865 0.1914  -0.1283 0.4170  233 SER A N     
1699 C CA    . SER A 236 ? 1.0915 1.2727 0.8557 0.2209  -0.1430 0.4302  233 SER A CA    
1700 C C     . SER A 236 ? 1.0976 1.2984 0.9166 0.2136  -0.1290 0.4213  233 SER A C     
1701 O O     . SER A 236 ? 1.1710 1.4230 1.0292 0.2357  -0.1361 0.4303  233 SER A O     
1702 C CB    . SER A 236 ? 1.0971 1.3596 0.8873 0.2175  -0.1804 0.4286  233 SER A CB    
1703 O OG    . SER A 236 ? 1.0857 1.3775 0.9100 0.1751  -0.1877 0.4057  233 SER A OG    
1704 N N     . ALA A 237 ? 0.9318 1.0936 0.7525 0.1843  -0.1091 0.4033  234 ALA A N     
1705 C CA    . ALA A 237 ? 0.9599 1.1320 0.8231 0.1773  -0.0954 0.3935  234 ALA A CA    
1706 C C     . ALA A 237 ? 0.9713 1.0909 0.8232 0.1496  -0.0744 0.3734  234 ALA A C     
1707 O O     . ALA A 237 ? 0.9935 1.0930 0.8238 0.1258  -0.0758 0.3617  234 ALA A O     
1708 C CB    . ALA A 237 ? 0.9606 1.2105 0.8798 0.1634  -0.1148 0.3866  234 ALA A CB    
1709 N N     . SER A 238 ? 0.8812 0.9817 0.7481 0.1542  -0.0555 0.3684  235 SER A N     
1710 C CA    . SER A 238 ? 0.7825 0.8439 0.6457 0.1302  -0.0386 0.3468  235 SER A CA    
1711 C C     . SER A 238 ? 0.7459 0.8436 0.6512 0.1175  -0.0421 0.3333  235 SER A C     
1712 O O     . SER A 238 ? 0.8160 0.9431 0.7483 0.1342  -0.0419 0.3417  235 SER A O     
1713 C CB    . SER A 238 ? 0.8217 0.8202 0.6583 0.1437  -0.0126 0.3483  235 SER A CB    
1714 O OG    . SER A 238 ? 0.8899 0.8979 0.7424 0.1714  -0.0069 0.3597  235 SER A OG    
1715 N N     . VAL A 239 ? 0.6492 0.7428 0.5572 0.0898  -0.0438 0.3130  236 VAL A N     
1716 C CA    . VAL A 239 ? 0.7081 0.8288 0.6467 0.0779  -0.0473 0.3007  236 VAL A CA    
1717 C C     . VAL A 239 ? 0.6801 0.7654 0.6134 0.0701  -0.0324 0.2808  236 VAL A C     
1718 O O     . VAL A 239 ? 0.6590 0.7140 0.5731 0.0569  -0.0267 0.2670  236 VAL A O     
1719 C CB    . VAL A 239 ? 0.6463 0.7974 0.5927 0.0548  -0.0654 0.2932  236 VAL A CB    
1720 C CG1   . VAL A 239 ? 0.4966 0.6661 0.4675 0.0439  -0.0660 0.2825  236 VAL A CG1   
1721 C CG2   . VAL A 239 ? 0.6822 0.8739 0.6351 0.0607  -0.0836 0.3096  236 VAL A CG2   
1722 N N     . SER A 240 ? 0.6497 0.7419 0.6007 0.0788  -0.0261 0.2785  237 SER A N     
1723 C CA    . SER A 240 ? 0.5577 0.6196 0.5023 0.0757  -0.0147 0.2591  237 SER A CA    
1724 C C     . SER A 240 ? 0.6190 0.6984 0.5772 0.0675  -0.0200 0.2478  237 SER A C     
1725 O O     . SER A 240 ? 0.6382 0.7467 0.6148 0.0724  -0.0227 0.2585  237 SER A O     
1726 C CB    . SER A 240 ? 0.6158 0.6526 0.5547 0.0976  0.0013  0.2646  237 SER A CB    
1727 O OG    . SER A 240 ? 0.7353 0.7493 0.6694 0.0955  0.0092  0.2445  237 SER A OG    
1728 N N     . ILE A 241 ? 0.5956 0.6573 0.5440 0.0557  -0.0203 0.2259  238 ILE A N     
1729 C CA    . ILE A 241 ? 0.4311 0.4980 0.3822 0.0526  -0.0240 0.2143  238 ILE A CA    
1730 C C     . ILE A 241 ? 0.5265 0.5733 0.4717 0.0679  -0.0135 0.2058  238 ILE A C     
1731 O O     . ILE A 241 ? 0.6569 0.6801 0.5919 0.0690  -0.0081 0.1909  238 ILE A O     
1732 C CB    . ILE A 241 ? 0.3844 0.4451 0.3255 0.0369  -0.0319 0.1942  238 ILE A CB    
1733 C CG1   . ILE A 241 ? 0.4385 0.5145 0.3795 0.0218  -0.0419 0.2011  238 ILE A CG1   
1734 C CG2   . ILE A 241 ? 0.4159 0.4745 0.3521 0.0393  -0.0351 0.1831  238 ILE A CG2   
1735 C CD1   . ILE A 241 ? 0.4679 0.5367 0.3974 0.0085  -0.0473 0.1820  238 ILE A CD1   
1736 N N     . PRO A 242 ? 0.4909 0.5468 0.4416 0.0786  -0.0095 0.2143  239 PRO A N     
1737 C CA    . PRO A 242 ? 0.4819 0.5171 0.4216 0.0957  0.0008  0.2074  239 PRO A CA    
1738 C C     . PRO A 242 ? 0.6015 0.6161 0.5229 0.0936  -0.0042 0.1810  239 PRO A C     
1739 O O     . PRO A 242 ? 0.5790 0.5993 0.4964 0.0842  -0.0141 0.1721  239 PRO A O     
1740 C CB    . PRO A 242 ? 0.4361 0.4883 0.3836 0.1020  0.0058  0.2214  239 PRO A CB    
1741 C CG    . PRO A 242 ? 0.5002 0.5879 0.4721 0.0914  0.0005  0.2396  239 PRO A CG    
1742 C CD    . PRO A 242 ? 0.4116 0.4985 0.3793 0.0739  -0.0128 0.2309  239 PRO A CD    
1743 N N     . MET A 243 ? 0.6182 0.6096 0.5279 0.1035  0.0020  0.1676  240 MET A N     
1744 C CA    . MET A 243 ? 0.6064 0.5851 0.5014 0.1045  -0.0048 0.1400  240 MET A CA    
1745 C C     . MET A 243 ? 0.7521 0.7086 0.6291 0.1239  0.0031  0.1339  240 MET A C     
1746 O O     . MET A 243 ? 0.7504 0.7002 0.6272 0.1358  0.0157  0.1515  240 MET A O     
1747 C CB    . MET A 243 ? 0.4993 0.4747 0.4004 0.0890  -0.0073 0.1213  240 MET A CB    
1748 C CG    . MET A 243 ? 0.5005 0.4932 0.4143 0.0708  -0.0125 0.1275  240 MET A CG    
1749 S SD    . MET A 243 ? 0.6419 0.6274 0.5618 0.0514  -0.0082 0.1080  240 MET A SD    
1750 C CE    . MET A 243 ? 0.7375 0.6909 0.6497 0.0574  0.0097  0.1205  240 MET A CE    
1751 N N     . MET A 244 ? 0.7085 0.6553 0.5692 0.1292  -0.0050 0.1082  241 MET A N     
1752 C CA    . MET A 244 ? 0.8735 0.7964 0.7111 0.1477  0.0003  0.0983  241 MET A CA    
1753 C C     . MET A 244 ? 1.0655 0.9681 0.9053 0.1465  0.0134  0.0991  241 MET A C     
1754 O O     . MET A 244 ? 1.1350 1.0140 0.9560 0.1633  0.0237  0.1004  241 MET A O     
1755 C CB    . MET A 244 ? 0.9211 0.8423 0.7427 0.1522  -0.0149 0.0662  241 MET A CB    
1756 C CG    . MET A 244 ? 1.0115 0.9425 0.8201 0.1604  -0.0266 0.0658  241 MET A CG    
1757 S SD    . MET A 244 ? 1.1607 1.0750 0.9453 0.1793  -0.0132 0.0943  241 MET A SD    
1758 C CE    . MET A 244 ? 1.0953 0.9790 0.8426 0.2046  -0.0094 0.0792  241 MET A CE    
1759 N N     . SER A 245 ? 1.1826 1.0893 1.0405 0.1276  0.0147  0.0989  242 SER A N     
1760 C CA    . SER A 245 ? 1.3192 1.1991 1.1748 0.1253  0.0294  0.1027  242 SER A CA    
1761 C C     . SER A 245 ? 1.4012 1.2881 1.2734 0.1039  0.0305  0.1075  242 SER A C     
1762 O O     . SER A 245 ? 1.4036 1.3062 1.2864 0.0860  0.0211  0.0892  242 SER A O     
1763 C CB    . SER A 245 ? 1.2748 1.1261 1.1130 0.1248  0.0313  0.0728  242 SER A CB    
1764 O OG    . SER A 245 ? 1.2235 1.0922 1.0717 0.1072  0.0174  0.0428  242 SER A OG    
1765 N N     . GLN A 246 ? 1.5107 1.3863 1.3832 0.1083  0.0423  0.1322  243 GLN A N     
1766 C CA    . GLN A 246 ? 1.5657 1.4420 1.4455 0.0917  0.0447  0.1405  243 GLN A CA    
1767 C C     . GLN A 246 ? 1.6706 1.5160 1.5426 0.0726  0.0540  0.1174  243 GLN A C     
1768 O O     . GLN A 246 ? 1.7389 1.5734 1.6099 0.0582  0.0615  0.1229  243 GLN A O     
1769 C CB    . GLN A 246 ? 1.5368 1.4069 1.4135 0.1068  0.0538  0.1730  243 GLN A CB    
1770 C CG    . GLN A 246 ? 1.4985 1.3999 1.3869 0.1262  0.0492  0.1942  243 GLN A CG    
1771 C CD    . GLN A 246 ? 1.3660 1.3099 1.2731 0.1146  0.0330  0.1969  243 GLN A CD    
1772 O OE1   . GLN A 246 ? 1.3645 1.3238 1.2790 0.1024  0.0263  0.2050  243 GLN A OE1   
1773 N NE2   . GLN A 246 ? 1.0913 1.0489 1.0006 0.1191  0.0277  0.1903  243 GLN A NE2   
1774 N N     . THR A 247 ? 1.6973 1.5281 1.5624 0.0716  0.0543  0.0906  244 THR A N     
1775 C CA    . THR A 247 ? 1.7225 1.5279 1.5846 0.0493  0.0634  0.0633  244 THR A CA    
1776 C C     . THR A 247 ? 1.5649 1.4042 1.4501 0.0246  0.0540  0.0436  244 THR A C     
1777 O O     . THR A 247 ? 1.5387 1.3649 1.4288 0.0002  0.0645  0.0250  244 THR A O     
1778 C CB    . THR A 247 ? 1.7855 1.5733 1.6355 0.0543  0.0621  0.0357  244 THR A CB    
1779 O OG1   . THR A 247 ? 1.8381 1.5921 1.6830 0.0308  0.0758  0.0119  244 THR A OG1   
1780 C CG2   . THR A 247 ? 1.7211 1.5514 1.5842 0.0561  0.0396  0.0127  244 THR A CG2   
1781 N N     . GLU A 248 ? 1.3658 1.2471 1.2646 0.0309  0.0364  0.0476  245 GLU A N     
1782 C CA    . GLU A 248 ? 1.2396 1.1555 1.1590 0.0131  0.0268  0.0300  245 GLU A CA    
1783 C C     . GLU A 248 ? 1.0912 1.0196 1.0140 0.0091  0.0266  0.0552  245 GLU A C     
1784 O O     . GLU A 248 ? 1.0154 0.9231 0.9262 0.0146  0.0363  0.0826  245 GLU A O     
1785 C CB    . GLU A 248 ? 1.2836 1.2321 1.2092 0.0250  0.0061  0.0111  245 GLU A CB    
1786 C CG    . GLU A 248 ? 1.2961 1.2463 1.2077 0.0504  -0.0018 0.0338  245 GLU A CG    
1787 C CD    . GLU A 248 ? 1.3377 1.2941 1.2384 0.0679  -0.0150 0.0145  245 GLU A CD    
1788 O OE1   . GLU A 248 ? 1.4164 1.3835 1.3237 0.0613  -0.0224 -0.0181 245 GLU A OE1   
1789 O OE2   . GLU A 248 ? 1.2800 1.2313 1.1647 0.0884  -0.0175 0.0314  245 GLU A OE2   
1790 N N     . SER A 249 ? 1.0249 0.9872 0.9619 0.0018  0.0149  0.0450  246 SER A N     
1791 C CA    . SER A 249 ? 0.9918 0.9654 0.9287 -0.0031 0.0130  0.0652  246 SER A CA    
1792 C C     . SER A 249 ? 0.9755 0.9836 0.9230 -0.0041 -0.0024 0.0524  246 SER A C     
1793 O O     . SER A 249 ? 1.0953 1.1218 1.0548 -0.0061 -0.0087 0.0240  246 SER A O     
1794 C CB    . SER A 249 ? 1.0314 0.9852 0.9644 -0.0227 0.0306  0.0688  246 SER A CB    
1795 O OG    . SER A 249 ? 1.1247 1.0831 1.0493 -0.0232 0.0284  0.0924  246 SER A OG    
1796 N N     . LEU A 250 ? 0.7689 0.7855 0.7107 -0.0018 -0.0089 0.0725  247 LEU A N     
1797 C CA    . LEU A 250 ? 0.7131 0.7531 0.6575 -0.0008 -0.0221 0.0637  247 LEU A CA    
1798 C C     . LEU A 250 ? 0.7466 0.7964 0.6963 -0.0184 -0.0170 0.0546  247 LEU A C     
1799 O O     . LEU A 250 ? 0.8213 0.8566 0.7667 -0.0313 -0.0038 0.0644  247 LEU A O     
1800 C CB    . LEU A 250 ? 0.5885 0.6294 0.5219 0.0083  -0.0311 0.0877  247 LEU A CB    
1801 C CG    . LEU A 250 ? 0.6039 0.6446 0.5305 0.0262  -0.0397 0.0884  247 LEU A CG    
1802 C CD1   . LEU A 250 ? 0.6350 0.6653 0.5616 0.0375  -0.0354 0.0784  247 LEU A CD1   
1803 C CD2   . LEU A 250 ? 0.5770 0.6165 0.4982 0.0292  -0.0413 0.1158  247 LEU A CD2   
1804 N N     . ASN A 251 ? 0.6012 0.6727 0.5565 -0.0165 -0.0261 0.0363  248 ASN A N     
1805 C CA    . ASN A 251 ? 0.4220 0.5051 0.3807 -0.0302 -0.0209 0.0279  248 ASN A CA    
1806 C C     . ASN A 251 ? 0.4569 0.5262 0.3957 -0.0354 -0.0207 0.0542  248 ASN A C     
1807 O O     . ASN A 251 ? 0.6205 0.6835 0.5479 -0.0264 -0.0306 0.0729  248 ASN A O     
1808 C CB    . ASN A 251 ? 0.5877 0.6962 0.5530 -0.0201 -0.0326 0.0050  248 ASN A CB    
1809 C CG    . ASN A 251 ? 0.7704 0.8910 0.7368 -0.0308 -0.0266 -0.0028 248 ASN A CG    
1810 O OD1   . ASN A 251 ? 0.8599 0.9675 0.8060 -0.0336 -0.0280 0.0143  248 ASN A OD1   
1811 N ND2   . ASN A 251 ? 0.8704 1.0181 0.8613 -0.0372 -0.0197 -0.0304 248 ASN A ND2   
1812 N N     . VAL A 252 ? 0.3612 0.4270 0.2954 -0.0507 -0.0088 0.0547  249 VAL A N     
1813 C CA    . VAL A 252 ? 0.4780 0.5298 0.3890 -0.0553 -0.0095 0.0787  249 VAL A CA    
1814 C C     . VAL A 252 ? 0.5327 0.5914 0.4315 -0.0492 -0.0262 0.0835  249 VAL A C     
1815 O O     . VAL A 252 ? 0.5735 0.6261 0.4597 -0.0476 -0.0348 0.1046  249 VAL A O     
1816 C CB    . VAL A 252 ? 0.4792 0.5217 0.3801 -0.0716 0.0079  0.0766  249 VAL A CB    
1817 C CG1   . VAL A 252 ? 0.4628 0.5264 0.3736 -0.0767 0.0109  0.0512  249 VAL A CG1   
1818 C CG2   . VAL A 252 ? 0.4126 0.4388 0.2835 -0.0730 0.0045  0.1021  249 VAL A CG2   
1819 N N     . SER A 253 ? 0.4829 0.5546 0.3854 -0.0457 -0.0305 0.0629  250 SER A N     
1820 C CA    . SER A 253 ? 0.5156 0.5845 0.4006 -0.0403 -0.0437 0.0653  250 SER A CA    
1821 C C     . SER A 253 ? 0.4681 0.5319 0.3519 -0.0286 -0.0553 0.0753  250 SER A C     
1822 O O     . SER A 253 ? 0.5542 0.6091 0.4228 -0.0309 -0.0637 0.0886  250 SER A O     
1823 C CB    . SER A 253 ? 0.4011 0.4814 0.2872 -0.0344 -0.0437 0.0405  250 SER A CB    
1824 O OG    . SER A 253 ? 0.6955 0.7910 0.6003 -0.0200 -0.0472 0.0224  250 SER A OG    
1825 N N     . VAL A 254 ? 0.3764 0.4453 0.2753 -0.0177 -0.0546 0.0677  251 VAL A N     
1826 C CA    . VAL A 254 ? 0.3832 0.4447 0.2785 -0.0055 -0.0617 0.0775  251 VAL A CA    
1827 C C     . VAL A 254 ? 0.4658 0.5231 0.3627 -0.0113 -0.0601 0.1035  251 VAL A C     
1828 O O     . VAL A 254 ? 0.5557 0.6091 0.4460 -0.0101 -0.0657 0.1173  251 VAL A O     
1829 C CB    . VAL A 254 ? 0.3827 0.4493 0.2895 0.0089  -0.0612 0.0623  251 VAL A CB    
1830 C CG1   . VAL A 254 ? 0.4304 0.4851 0.3299 0.0210  -0.0642 0.0762  251 VAL A CG1   
1831 C CG2   . VAL A 254 ? 0.3422 0.4195 0.2478 0.0205  -0.0673 0.0363  251 VAL A CG2   
1832 N N     . SER A 255 ? 0.4794 0.5375 0.3848 -0.0173 -0.0513 0.1097  252 SER A N     
1833 C CA    . SER A 255 ? 0.4868 0.5436 0.3931 -0.0183 -0.0501 0.1343  252 SER A CA    
1834 C C     . SER A 255 ? 0.5205 0.5828 0.4159 -0.0278 -0.0594 0.1477  252 SER A C     
1835 O O     . SER A 255 ? 0.5193 0.5905 0.4190 -0.0266 -0.0654 0.1646  252 SER A O     
1836 C CB    . SER A 255 ? 0.4957 0.5431 0.4035 -0.0216 -0.0374 0.1379  252 SER A CB    
1837 O OG    . SER A 255 ? 0.5628 0.6036 0.4809 -0.0158 -0.0290 0.1240  252 SER A OG    
1838 N N     . LEU A 256 ? 0.3792 0.4385 0.2612 -0.0378 -0.0603 0.1384  253 LEU A N     
1839 C CA    . LEU A 256 ? 0.4121 0.4735 0.2784 -0.0482 -0.0703 0.1470  253 LEU A CA    
1840 C C     . LEU A 256 ? 0.4853 0.5473 0.3491 -0.0494 -0.0803 0.1465  253 LEU A C     
1841 O O     . LEU A 256 ? 0.5450 0.6164 0.4099 -0.0564 -0.0889 0.1602  253 LEU A O     
1842 C CB    . LEU A 256 ? 0.5034 0.5566 0.3512 -0.0568 -0.0667 0.1341  253 LEU A CB    
1843 C CG    . LEU A 256 ? 0.6509 0.7013 0.4762 -0.0673 -0.0784 0.1375  253 LEU A CG    
1844 C CD1   . LEU A 256 ? 0.5839 0.6399 0.3997 -0.0723 -0.0838 0.1568  253 LEU A CD1   
1845 C CD2   . LEU A 256 ? 0.7105 0.7495 0.5165 -0.0714 -0.0738 0.1190  253 LEU A CD2   
1846 N N     . GLY A 257 ? 0.4281 0.4797 0.2878 -0.0424 -0.0788 0.1299  254 GLY A N     
1847 C CA    . GLY A 257 ? 0.4332 0.4734 0.2821 -0.0421 -0.0844 0.1289  254 GLY A CA    
1848 C C     . GLY A 257 ? 0.5358 0.5838 0.3985 -0.0417 -0.0848 0.1458  254 GLY A C     
1849 O O     . GLY A 257 ? 0.5336 0.5812 0.3922 -0.0536 -0.0898 0.1536  254 GLY A O     
1850 N N     . ILE A 258 ? 0.5316 0.5872 0.4114 -0.0292 -0.0783 0.1503  255 ILE A N     
1851 C CA    . ILE A 258 ? 0.3764 0.4419 0.2713 -0.0257 -0.0754 0.1665  255 ILE A CA    
1852 C C     . ILE A 258 ? 0.5415 0.6321 0.4508 -0.0370 -0.0809 0.1842  255 ILE A C     
1853 O O     . ILE A 258 ? 0.5743 0.6789 0.4947 -0.0440 -0.0827 0.1950  255 ILE A O     
1854 C CB    . ILE A 258 ? 0.3358 0.4011 0.2419 -0.0083 -0.0666 0.1663  255 ILE A CB    
1855 C CG1   . ILE A 258 ? 0.3667 0.4131 0.2591 0.0050  -0.0647 0.1475  255 ILE A CG1   
1856 C CG2   . ILE A 258 ? 0.4929 0.5707 0.4149 -0.0030 -0.0614 0.1844  255 ILE A CG2   
1857 C CD1   . ILE A 258 ? 0.3669 0.4112 0.2665 0.0209  -0.0578 0.1433  255 ILE A CD1   
1858 N N     . ALA A 259 ? 0.4843 0.5813 0.3925 -0.0386 -0.0831 0.1866  256 ALA A N     
1859 C CA    . ALA A 259 ? 0.4913 0.6123 0.4079 -0.0440 -0.0910 0.2031  256 ALA A CA    
1860 C C     . ALA A 259 ? 0.5490 0.6806 0.4602 -0.0631 -0.1039 0.2028  256 ALA A C     
1861 O O     . ALA A 259 ? 0.4671 0.6274 0.3972 -0.0690 -0.1105 0.2144  256 ALA A O     
1862 C CB    . ALA A 259 ? 0.3809 0.4951 0.2850 -0.0411 -0.0893 0.2047  256 ALA A CB    
1863 N N     . LEU A 260 ? 0.5425 0.6522 0.4288 -0.0730 -0.1068 0.1879  257 LEU A N     
1864 C CA    . LEU A 260 ? 0.6183 0.7284 0.4922 -0.0928 -0.1181 0.1841  257 LEU A CA    
1865 C C     . LEU A 260 ? 0.6286 0.7339 0.5099 -0.1008 -0.1151 0.1832  257 LEU A C     
1866 O O     . LEU A 260 ? 0.7008 0.8202 0.5877 -0.1198 -0.1230 0.1860  257 LEU A O     
1867 C CB    . LEU A 260 ? 0.5171 0.5985 0.3578 -0.0981 -0.1191 0.1676  257 LEU A CB    
1868 C CG    . LEU A 260 ? 0.7054 0.7893 0.5307 -0.0981 -0.1225 0.1687  257 LEU A CG    
1869 C CD1   . LEU A 260 ? 0.6937 0.7500 0.4867 -0.1033 -0.1206 0.1513  257 LEU A CD1   
1870 C CD2   . LEU A 260 ? 0.6272 0.7384 0.4555 -0.1075 -0.1380 0.1819  257 LEU A CD2   
1871 N N     . HIS A 261 ? 0.5842 0.6687 0.4636 -0.0870 -0.1030 0.1787  258 HIS A N     
1872 C CA    . HIS A 261 ? 0.5013 0.5721 0.3800 -0.0913 -0.0959 0.1795  258 HIS A CA    
1873 C C     . HIS A 261 ? 0.5799 0.6874 0.4920 -0.1001 -0.0951 0.1954  258 HIS A C     
1874 O O     . HIS A 261 ? 0.6560 0.7631 0.5708 -0.1187 -0.0932 0.1966  258 HIS A O     
1875 C CB    . HIS A 261 ? 0.3723 0.4185 0.2418 -0.0689 -0.0842 0.1740  258 HIS A CB    
1876 C CG    . HIS A 261 ? 0.4569 0.4863 0.3221 -0.0688 -0.0735 0.1788  258 HIS A CG    
1877 N ND1   . HIS A 261 ? 0.4287 0.4224 0.2653 -0.0800 -0.0704 0.1728  258 HIS A ND1   
1878 C CD2   . HIS A 261 ? 0.4133 0.4513 0.2944 -0.0584 -0.0625 0.1894  258 HIS A CD2   
1879 C CE1   . HIS A 261 ? 0.5599 0.5399 0.3944 -0.0776 -0.0571 0.1803  258 HIS A CE1   
1880 N NE2   . HIS A 261 ? 0.5363 0.5448 0.3984 -0.0643 -0.0521 0.1902  258 HIS A NE2   
1881 N N     . GLU A 262 ? 0.5223 0.6613 0.4600 -0.0867 -0.0953 0.2071  259 GLU A N     
1882 C CA    . GLU A 262 ? 0.5132 0.6954 0.4873 -0.0895 -0.0946 0.2224  259 GLU A CA    
1883 C C     . GLU A 262 ? 0.6203 0.8393 0.6078 -0.1100 -0.1118 0.2251  259 GLU A C     
1884 O O     . GLU A 262 ? 0.7185 0.9815 0.7403 -0.1176 -0.1139 0.2345  259 GLU A O     
1885 C CB    . GLU A 262 ? 0.4138 0.6126 0.4053 -0.0643 -0.0891 0.2338  259 GLU A CB    
1886 C CG    . GLU A 262 ? 0.4894 0.6592 0.4723 -0.0452 -0.0730 0.2308  259 GLU A CG    
1887 C CD    . GLU A 262 ? 0.5487 0.7201 0.5422 -0.0475 -0.0599 0.2360  259 GLU A CD    
1888 O OE1   . GLU A 262 ? 0.7150 0.9257 0.7392 -0.0572 -0.0595 0.2471  259 GLU A OE1   
1889 O OE2   . GLU A 262 ? 0.6151 0.7497 0.5858 -0.0390 -0.0495 0.2287  259 GLU A OE2   
1890 N N     . ARG A 263 ? 0.5735 0.7771 0.5343 -0.1184 -0.1241 0.2156  260 ARG A N     
1891 C CA    . ARG A 263 ? 0.6146 0.8487 0.5793 -0.1366 -0.1433 0.2154  260 ARG A CA    
1892 C C     . ARG A 263 ? 0.6847 0.8937 0.6264 -0.1648 -0.1479 0.2002  260 ARG A C     
1893 O O     . ARG A 263 ? 0.7073 0.9330 0.6436 -0.1832 -0.1650 0.1952  260 ARG A O     
1894 C CB    . ARG A 263 ? 0.6106 0.8429 0.5548 -0.1243 -0.1536 0.2171  260 ARG A CB    
1895 C CG    . ARG A 263 ? 0.6928 0.9452 0.6538 -0.0978 -0.1498 0.2331  260 ARG A CG    
1896 C CD    . ARG A 263 ? 0.7649 1.0762 0.7602 -0.0961 -0.1627 0.2468  260 ARG A CD    
1897 N NE    . ARG A 263 ? 0.7766 1.1104 0.7621 -0.1123 -0.1855 0.2425  260 ARG A NE    
1898 C CZ    . ARG A 263 ? 0.7489 1.1390 0.7591 -0.1100 -0.2034 0.2516  260 ARG A CZ    
1899 N NH1   . ARG A 263 ? 0.6262 1.0562 0.6744 -0.0906 -0.1991 0.2664  260 ARG A NH1   
1900 N NH2   . ARG A 263 ? 0.8368 1.2449 0.8329 -0.1252 -0.2263 0.2448  260 ARG A NH2   
1901 N N     . ILE A 264 ? 0.6829 0.8481 0.6067 -0.1667 -0.1327 0.1926  261 ILE A N     
1902 C CA    . ILE A 264 ? 0.7473 0.8721 0.6384 -0.1890 -0.1331 0.1778  261 ILE A CA    
1903 C C     . ILE A 264 ? 0.8350 0.9867 0.7432 -0.2229 -0.1422 0.1754  261 ILE A C     
1904 O O     . ILE A 264 ? 0.9055 1.0356 0.7864 -0.2445 -0.1515 0.1622  261 ILE A O     
1905 C CB    . ILE A 264 ? 0.6587 0.7316 0.5271 -0.1808 -0.1137 0.1732  261 ILE A CB    
1906 C CG1   . ILE A 264 ? 0.7861 0.8046 0.6086 -0.1958 -0.1134 0.1572  261 ILE A CG1   
1907 C CG2   . ILE A 264 ? 0.6411 0.7280 0.5371 -0.1874 -0.0997 0.1834  261 ILE A CG2   
1908 C CD1   . ILE A 264 ? 0.6825 0.6850 0.4753 -0.1877 -0.1237 0.1461  261 ILE A CD1   
1909 N N     . ASP A 265 ? 0.7625 0.9628 0.7169 -0.2281 -0.1391 0.1867  262 ASP A N     
1910 C CA    . ASP A 265 ? 0.8680 1.1065 0.8499 -0.2625 -0.1472 0.1830  262 ASP A CA    
1911 C C     . ASP A 265 ? 0.8202 1.1068 0.8118 -0.2699 -0.1756 0.1802  262 ASP A C     
1912 O O     . ASP A 265 ? 0.8793 1.1784 0.8710 -0.3021 -0.1888 0.1680  262 ASP A O     
1913 C CB    . ASP A 265 ? 0.8768 1.1614 0.9108 -0.2638 -0.1337 0.1956  262 ASP A CB    
1914 C CG    . ASP A 265 ? 0.8672 1.1015 0.8864 -0.2688 -0.1054 0.1958  262 ASP A CG    
1915 O OD1   . ASP A 265 ? 0.8329 1.0046 0.8079 -0.2842 -0.0992 0.1838  262 ASP A OD1   
1916 O OD2   . ASP A 265 ? 0.8199 1.0739 0.8673 -0.2552 -0.0886 0.2084  262 ASP A OD2   
1917 N N     . ARG A 266 ? 0.7780 1.0883 0.7741 -0.2402 -0.1847 0.1910  263 ARG A N     
1918 C CA    . ARG A 266 ? 0.7661 1.1173 0.7630 -0.2399 -0.2114 0.1910  263 ARG A CA    
1919 C C     . ARG A 266 ? 0.7896 1.0928 0.7302 -0.2463 -0.2212 0.1770  263 ARG A C     
1920 O O     . ARG A 266 ? 0.9153 1.2400 0.8453 -0.2600 -0.2440 0.1697  263 ARG A O     
1921 C CB    . ARG A 266 ? 0.7204 1.1030 0.7332 -0.2034 -0.2142 0.2093  263 ARG A CB    
1922 C CG    . ARG A 266 ? 0.7401 1.1755 0.8082 -0.1925 -0.2060 0.2237  263 ARG A CG    
1923 C CD    . ARG A 266 ? 0.8609 1.3654 0.9741 -0.2185 -0.2213 0.2197  263 ARG A CD    
1924 N NE    . ARG A 266 ? 0.9104 1.4574 1.0774 -0.2155 -0.2051 0.2296  263 ARG A NE    
1925 C CZ    . ARG A 266 ? 0.9214 1.5444 1.1431 -0.2320 -0.2141 0.2290  263 ARG A CZ    
1926 N NH1   . ARG A 266 ? 0.9482 1.6147 1.1779 -0.2531 -0.2424 0.2178  263 ARG A NH1   
1927 N NH2   . ARG A 266 ? 0.8880 1.5461 1.1569 -0.2273 -0.1946 0.2385  263 ARG A NH2   
1928 N N     . ASN A 267 ? 0.8899 1.1306 0.7940 -0.2347 -0.2043 0.1725  264 ASN A N     
1929 C CA    . ASN A 267 ? 0.9232 1.1171 0.7743 -0.2370 -0.2091 0.1591  264 ASN A CA    
1930 C C     . ASN A 267 ? 1.0313 1.1862 0.8557 -0.2677 -0.2084 0.1408  264 ASN A C     
1931 O O     . ASN A 267 ? 1.0983 1.2272 0.8823 -0.2782 -0.2188 0.1275  264 ASN A O     
1932 C CB    . ASN A 267 ? 0.7661 0.9187 0.5944 -0.2093 -0.1919 0.1608  264 ASN A CB    
1933 C CG    . ASN A 267 ? 0.7535 0.9337 0.5983 -0.1823 -0.1918 0.1767  264 ASN A CG    
1934 O OD1   . ASN A 267 ? 0.9133 1.0703 0.7516 -0.1618 -0.1767 0.1788  264 ASN A OD1   
1935 N ND2   . ASN A 267 ? 0.6728 0.9024 0.5379 -0.1818 -0.2087 0.1872  264 ASN A ND2   
1936 N N     . LEU A 268 ? 1.0794 1.2245 0.9217 -0.2815 -0.1940 0.1403  265 LEU A N     
1937 C CA    . LEU A 268 ? 1.1940 1.3030 1.0141 -0.3154 -0.1919 0.1243  265 LEU A CA    
1938 C C     . LEU A 268 ? 1.3144 1.4779 1.1604 -0.3471 -0.2143 0.1183  265 LEU A C     
1939 O O     . LEU A 268 ? 1.2569 1.3962 1.0785 -0.3791 -0.2210 0.1009  265 LEU A O     
1940 C CB    . LEU A 268 ? 1.1690 1.2504 0.9990 -0.3212 -0.1674 0.1277  265 LEU A CB    
1941 C CG    . LEU A 268 ? 1.2150 1.2260 1.0040 -0.2973 -0.1468 0.1260  265 LEU A CG    
1942 C CD1   . LEU A 268 ? 1.2480 1.2356 1.0451 -0.3019 -0.1237 0.1321  265 LEU A CD1   
1943 C CD2   . LEU A 268 ? 1.2313 1.1785 0.9607 -0.3047 -0.1487 0.1080  265 LEU A CD2   
1944 N N     . ALA A 269 ? 1.4162 1.6541 1.3111 -0.3368 -0.2265 0.1318  266 ALA A N     
1945 C CA    . ALA A 269 ? 1.5133 1.8192 1.4410 -0.3609 -0.2516 0.1267  266 ALA A CA    
1946 C C     . ALA A 269 ? 1.5950 1.9069 1.4876 -0.3551 -0.2786 0.1200  266 ALA A C     
1947 O O     . ALA A 269 ? 1.5879 1.9463 1.4924 -0.3765 -0.3042 0.1103  266 ALA A O     
1948 C CB    . ALA A 269 ? 1.4772 1.8622 1.4707 -0.3464 -0.2534 0.1445  266 ALA A CB    
1949 N N     . ALA A 270 ? 1.6354 1.9015 1.4844 -0.3265 -0.2724 0.1243  267 ALA A N     
1950 C CA    . ALA A 270 ? 1.6675 1.9326 1.4770 -0.3162 -0.2928 0.1210  267 ALA A CA    
1951 C C     . ALA A 270 ? 1.7998 1.9944 1.5452 -0.3296 -0.2903 0.1014  267 ALA A C     
1952 O O     . ALA A 270 ? 1.8797 2.0623 1.5828 -0.3223 -0.3036 0.0966  267 ALA A O     
1953 C CB    . ALA A 270 ? 1.6037 1.8715 1.4097 -0.2751 -0.2862 0.1401  267 ALA A CB    
1954 N N     . ASN A 271 ? 1.8233 1.9675 1.5572 -0.3471 -0.2717 0.0906  268 ASN A N     
1955 C CA    . ASN A 271 ? 1.9025 1.9747 1.5739 -0.3575 -0.2668 0.0716  268 ASN A CA    
1956 C C     . ASN A 271 ? 2.0217 2.0785 1.6826 -0.4015 -0.2748 0.0513  268 ASN A C     
1957 O O     . ASN A 271 ? 2.0402 2.1475 1.7478 -0.4267 -0.2835 0.0512  268 ASN A O     
1958 C CB    . ASN A 271 ? 1.8792 1.8902 1.5300 -0.3365 -0.2378 0.0734  268 ASN A CB    
1959 C CG    . ASN A 271 ? 1.8451 1.8574 1.4904 -0.2981 -0.2302 0.0852  268 ASN A CG    
1960 O OD1   . ASN A 271 ? 1.8304 1.7938 1.4437 -0.2810 -0.2140 0.0796  268 ASN A OD1   
1961 N ND2   . ASN A 271 ? 1.8158 1.8840 1.4921 -0.2842 -0.2412 0.1008  268 ASN A ND2   
1962 N N     . ALA B 11  ? 0.9612 0.4152 0.7602 -0.1194 0.1630  -0.0286 8   ALA B N     
1963 C CA    . ALA B 11  ? 1.0655 0.5545 0.8793 -0.1130 0.1504  -0.0123 8   ALA B CA    
1964 C C     . ALA B 11  ? 1.1799 0.6774 0.9972 -0.1361 0.1472  -0.0135 8   ALA B C     
1965 O O     . ALA B 11  ? 1.2695 0.7386 1.0793 -0.1544 0.1567  -0.0234 8   ALA B O     
1966 C CB    . ALA B 11  ? 0.9777 0.4509 0.7958 -0.0893 0.1558  0.0068  8   ALA B CB    
1967 N N     . ASN B 12  ? 1.1494 0.6859 0.9801 -0.1355 0.1348  -0.0038 9   ASN B N     
1968 C CA    . ASN B 12  ? 1.2243 0.7719 1.0633 -0.1556 0.1329  -0.0028 9   ASN B CA    
1969 C C     . ASN B 12  ? 1.2372 0.7869 1.0820 -0.1452 0.1355  0.0160  9   ASN B C     
1970 O O     . ASN B 12  ? 1.1153 0.6919 0.9660 -0.1295 0.1266  0.0264  9   ASN B O     
1971 C CB    . ASN B 12  ? 1.2733 0.8663 1.1241 -0.1699 0.1170  -0.0103 9   ASN B CB    
1972 C CG    . ASN B 12  ? 1.3270 0.9610 1.1913 -0.1551 0.1052  0.0017  9   ASN B CG    
1973 O OD1   . ASN B 12  ? 1.2566 0.9187 1.1359 -0.1634 0.0991  0.0068  9   ASN B OD1   
1974 N ND2   . ASN B 12  ? 1.3714 1.0084 1.2323 -0.1332 0.1028  0.0059  9   ASN B ND2   
1975 N N     . PRO B 13  ? 1.4386 0.9575 1.2799 -0.1542 0.1486  0.0203  10  PRO B N     
1976 C CA    . PRO B 13  ? 1.4849 1.0001 1.3268 -0.1465 0.1538  0.0382  10  PRO B CA    
1977 C C     . PRO B 13  ? 1.4515 0.9824 1.3068 -0.1677 0.1554  0.0385  10  PRO B C     
1978 O O     . PRO B 13  ? 1.4745 1.0090 1.3307 -0.1626 0.1593  0.0526  10  PRO B O     
1979 C CB    . PRO B 13  ? 1.6030 1.0659 1.4307 -0.1402 0.1708  0.0435  10  PRO B CB    
1980 C CG    . PRO B 13  ? 1.7043 1.1458 1.5312 -0.1618 0.1777  0.0245  10  PRO B CG    
1981 C CD    . PRO B 13  ? 1.6270 1.1039 1.4594 -0.1686 0.1623  0.0091  10  PRO B CD    
1982 N N     . SER B 14  ? 1.3749 0.9151 1.2403 -0.1912 0.1523  0.0233  11  SER B N     
1983 C CA    . SER B 14  ? 1.3973 0.9509 1.2806 -0.2132 0.1546  0.0230  11  SER B CA    
1984 C C     . SER B 14  ? 1.3731 0.9791 1.2764 -0.2149 0.1406  0.0260  11  SER B C     
1985 O O     . SER B 14  ? 1.1590 0.7871 1.0601 -0.1964 0.1317  0.0322  11  SER B O     
1986 C CB    . SER B 14  ? 1.4542 0.9940 1.3417 -0.2394 0.1565  0.0053  11  SER B CB    
1987 O OG    . SER B 14  ? 1.4620 1.0058 1.3686 -0.2605 0.1625  0.0068  11  SER B OG    
1988 N N     . ASP B 15  ? 1.5529 1.1785 1.4783 -0.2374 0.1391  0.0218  12  ASP B N     
1989 C CA    . ASP B 15  ? 1.4930 1.1672 1.4422 -0.2403 0.1282  0.0258  12  ASP B CA    
1990 C C     . ASP B 15  ? 1.5235 1.2208 1.4987 -0.2677 0.1214  0.0159  12  ASP B C     
1991 O O     . ASP B 15  ? 1.5036 1.1875 1.4912 -0.2848 0.1321  0.0162  12  ASP B O     
1992 C CB    . ASP B 15  ? 1.3872 1.0631 1.3407 -0.2310 0.1391  0.0425  12  ASP B CB    
1993 C CG    . ASP B 15  ? 1.2503 0.9234 1.1840 -0.2036 0.1375  0.0527  12  ASP B CG    
1994 O OD1   . ASP B 15  ? 1.2308 0.9334 1.1678 -0.1935 0.1234  0.0503  12  ASP B OD1   
1995 O OD2   . ASP B 15  ? 1.1564 0.7981 1.0716 -0.1924 0.1500  0.0635  12  ASP B OD2   
1996 N N     . PRO B 16  ? 1.5559 1.2883 1.5402 -0.2722 0.1031  0.0076  13  PRO B N     
1997 C CA    . PRO B 16  ? 1.5939 1.3375 1.5626 -0.2538 0.0920  0.0058  13  PRO B CA    
1998 C C     . PRO B 16  ? 1.5710 1.2912 1.5179 -0.2596 0.0886  -0.0099 13  PRO B C     
1999 O O     . PRO B 16  ? 1.5307 1.2145 1.4541 -0.2469 0.0982  -0.0108 13  PRO B O     
2000 C CB    . PRO B 16  ? 1.5871 1.3833 1.5813 -0.2581 0.0757  0.0071  13  PRO B CB    
2001 C CG    . PRO B 16  ? 1.6064 1.4190 1.6317 -0.2788 0.0785  0.0099  13  PRO B CG    
2002 C CD    . PRO B 16  ? 1.5891 1.3603 1.6052 -0.2931 0.0918  0.0040  13  PRO B CD    
2003 N N     . ALA B 17  ? 1.6143 1.3556 1.5693 -0.2788 0.0751  -0.0217 14  ALA B N     
2004 C CA    . ALA B 17  ? 1.6942 1.4158 1.6266 -0.2883 0.0708  -0.0389 14  ALA B CA    
2005 C C     . ALA B 17  ? 1.6791 1.4414 1.6176 -0.2964 0.0500  -0.0451 14  ALA B C     
2006 O O     . ALA B 17  ? 1.7294 1.4923 1.6637 -0.3180 0.0411  -0.0588 14  ALA B O     
2007 C CB    . ALA B 17  ? 1.7206 1.4091 1.6242 -0.2667 0.0800  -0.0400 14  ALA B CB    
2008 N N     . VAL B 18  ? 1.6477 1.4434 1.5958 -0.2789 0.0424  -0.0343 15  VAL B N     
2009 C CA    . VAL B 18  ? 1.6984 1.5323 1.6504 -0.2797 0.0242  -0.0362 15  VAL B CA    
2010 C C     . VAL B 18  ? 1.6478 1.4932 1.5982 -0.2522 0.0257  -0.0252 15  VAL B C     
2011 O O     . VAL B 18  ? 1.7145 1.5946 1.6740 -0.2460 0.0137  -0.0210 15  VAL B O     
2012 C CB    . VAL B 18  ? 1.7748 1.5932 1.6982 -0.2913 0.0173  -0.0536 15  VAL B CB    
2013 C CG1   . VAL B 18  ? 1.7435 1.5797 1.6537 -0.2758 0.0088  -0.0528 15  VAL B CG1   
2014 C CG2   . VAL B 18  ? 1.7822 1.6179 1.7169 -0.3205 0.0034  -0.0625 15  VAL B CG2   
2015 N N     . GLN B 19  ? 1.4950 1.3104 1.4350 -0.2360 0.0406  -0.0199 16  GLN B N     
2016 C CA    . GLN B 19  ? 1.4470 1.2699 1.3872 -0.2104 0.0429  -0.0090 16  GLN B CA    
2017 C C     . GLN B 19  ? 1.4645 1.3266 1.4331 -0.2067 0.0373  0.0034  16  GLN B C     
2018 O O     . GLN B 19  ? 1.4642 1.3423 1.4367 -0.1884 0.0351  0.0110  16  GLN B O     
2019 C CB    . GLN B 19  ? 1.4443 1.2272 1.3700 -0.1970 0.0586  -0.0044 16  GLN B CB    
2020 C CG    . GLN B 19  ? 1.3618 1.1535 1.2939 -0.1754 0.0613  0.0100  16  GLN B CG    
2021 C CD    . GLN B 19  ? 1.2022 1.0030 1.1509 -0.1809 0.0662  0.0199  16  GLN B CD    
2022 O OE1   . GLN B 19  ? 1.0719 0.9086 1.0426 -0.1852 0.0592  0.0241  16  GLN B OE1   
2023 N NE2   . GLN B 19  ? 1.1037 0.8709 1.0423 -0.1799 0.0797  0.0246  16  GLN B NE2   
2024 N N     . ARG B 20  ? 1.4439 1.3209 1.4338 -0.2246 0.0359  0.0050  17  ARG B N     
2025 C CA    . ARG B 20  ? 1.2807 1.1930 1.3004 -0.2227 0.0336  0.0164  17  ARG B CA    
2026 C C     . ARG B 20  ? 0.9821 0.9292 1.0109 -0.2097 0.0222  0.0208  17  ARG B C     
2027 O O     . ARG B 20  ? 0.8694 0.8388 0.9171 -0.2004 0.0234  0.0308  17  ARG B O     
2028 C CB    . ARG B 20  ? 1.3319 1.2633 1.3781 -0.2464 0.0295  0.0153  17  ARG B CB    
2029 C CG    . ARG B 20  ? 1.3167 1.2788 1.3966 -0.2452 0.0323  0.0276  17  ARG B CG    
2030 C CD    . ARG B 20  ? 1.2748 1.2144 1.3465 -0.2308 0.0496  0.0365  17  ARG B CD    
2031 N NE    . ARG B 20  ? 1.2292 1.1929 1.3298 -0.2301 0.0559  0.0472  17  ARG B NE    
2032 C CZ    . ARG B 20  ? 1.2497 1.2549 1.3798 -0.2302 0.0471  0.0519  17  ARG B CZ    
2033 N NH1   . ARG B 20  ? 1.2647 1.2937 1.3985 -0.2309 0.0302  0.0479  17  ARG B NH1   
2034 N NH2   . ARG B 20  ? 1.2237 1.2454 1.3791 -0.2290 0.0566  0.0613  17  ARG B NH2   
2035 N N     . ILE B 21  ? 0.8562 0.8059 0.8704 -0.2094 0.0125  0.0130  18  ILE B N     
2036 C CA    . ILE B 21  ? 0.8952 0.8738 0.9154 -0.1967 0.0030  0.0170  18  ILE B CA    
2037 C C     . ILE B 21  ? 0.8258 0.8031 0.8473 -0.1740 0.0101  0.0257  18  ILE B C     
2038 O O     . ILE B 21  ? 0.8818 0.8889 0.9237 -0.1662 0.0062  0.0336  18  ILE B O     
2039 C CB    . ILE B 21  ? 1.0094 0.9783 1.0043 -0.1961 -0.0030 0.0071  18  ILE B CB    
2040 C CG1   . ILE B 21  ? 1.0271 0.9861 1.0110 -0.2195 -0.0086 -0.0046 18  ILE B CG1   
2041 C CG2   . ILE B 21  ? 0.9741 0.9773 0.9789 -0.1873 -0.0137 0.0122  18  ILE B CG2   
2042 C CD1   . ILE B 21  ? 1.0368 0.9791 0.9893 -0.2201 -0.0116 -0.0163 18  ILE B CD1   
2043 N N     . ILE B 22  ? 0.7894 0.7318 0.7897 -0.1637 0.0203  0.0242  19  ILE B N     
2044 C CA    . ILE B 22  ? 0.7199 0.6587 0.7188 -0.1430 0.0253  0.0319  19  ILE B CA    
2045 C C     . ILE B 22  ? 0.7127 0.6689 0.7317 -0.1426 0.0287  0.0414  19  ILE B C     
2046 O O     . ILE B 22  ? 0.6380 0.6125 0.6670 -0.1297 0.0269  0.0472  19  ILE B O     
2047 C CB    . ILE B 22  ? 0.6129 0.5102 0.5880 -0.1342 0.0356  0.0309  19  ILE B CB    
2048 C CG1   . ILE B 22  ? 0.7072 0.5843 0.6631 -0.1332 0.0353  0.0211  19  ILE B CG1   
2049 C CG2   . ILE B 22  ? 0.5214 0.4174 0.4952 -0.1137 0.0379  0.0394  19  ILE B CG2   
2050 C CD1   . ILE B 22  ? 0.7868 0.6230 0.7228 -0.1233 0.0460  0.0209  19  ILE B CD1   
2051 N N     . ASP B 23  ? 0.9281 0.8776 0.9535 -0.1574 0.0348  0.0422  20  ASP B N     
2052 C CA    . ASP B 23  ? 0.9796 0.9413 1.0231 -0.1585 0.0417  0.0508  20  ASP B CA    
2053 C C     . ASP B 23  ? 1.0128 1.0173 1.0885 -0.1645 0.0337  0.0539  20  ASP B C     
2054 O O     . ASP B 23  ? 1.1691 1.1885 1.2653 -0.1659 0.0399  0.0608  20  ASP B O     
2055 C CB    . ASP B 23  ? 1.1160 1.0552 1.1578 -0.1731 0.0528  0.0509  20  ASP B CB    
2056 C CG    . ASP B 23  ? 1.2104 1.1457 1.2571 -0.1689 0.0657  0.0604  20  ASP B CG    
2057 O OD1   . ASP B 23  ? 1.2496 1.2100 1.3117 -0.1612 0.0648  0.0658  20  ASP B OD1   
2058 O OD2   . ASP B 23  ? 1.1892 1.0946 1.2233 -0.1733 0.0780  0.0625  20  ASP B OD2   
2059 N N     . VAL B 24  ? 0.8792 0.9025 0.9591 -0.1675 0.0208  0.0494  21  VAL B N     
2060 C CA    . VAL B 24  ? 0.8007 0.8651 0.9111 -0.1721 0.0115  0.0539  21  VAL B CA    
2061 C C     . VAL B 24  ? 0.8240 0.9060 0.9373 -0.1547 0.0064  0.0573  21  VAL B C     
2062 O O     . VAL B 24  ? 0.8692 0.9781 1.0080 -0.1503 0.0063  0.0645  21  VAL B O     
2063 C CB    . VAL B 24  ? 0.8996 0.9766 1.0139 -0.1896 -0.0013 0.0481  21  VAL B CB    
2064 C CG1   . VAL B 24  ? 1.0441 1.1651 1.1908 -0.1924 -0.0124 0.0551  21  VAL B CG1   
2065 C CG2   . VAL B 24  ? 0.9143 0.9758 1.0301 -0.2090 0.0029  0.0438  21  VAL B CG2   
2066 N N     . THR B 25  ? 0.7167 0.7827 0.8059 -0.1451 0.0036  0.0520  22  THR B N     
2067 C CA    . THR B 25  ? 0.7019 0.7836 0.7947 -0.1297 -0.0010 0.0544  22  THR B CA    
2068 C C     . THR B 25  ? 0.5999 0.6738 0.6914 -0.1132 0.0066  0.0584  22  THR B C     
2069 O O     . THR B 25  ? 0.6218 0.7093 0.7205 -0.1006 0.0039  0.0607  22  THR B O     
2070 C CB    . THR B 25  ? 0.8362 0.9043 0.9057 -0.1256 -0.0057 0.0473  22  THR B CB    
2071 O OG1   . THR B 25  ? 0.8593 0.8939 0.9060 -0.1157 0.0022  0.0438  22  THR B OG1   
2072 C CG2   . THR B 25  ? 0.8220 0.8877 0.8822 -0.1435 -0.0122 0.0406  22  THR B CG2   
2073 N N     . LYS B 26  ? 0.6580 0.7097 0.7396 -0.1139 0.0160  0.0593  23  LYS B N     
2074 C CA    . LYS B 26  ? 0.8120 0.8523 0.8855 -0.0992 0.0220  0.0625  23  LYS B CA    
2075 C C     . LYS B 26  ? 0.8271 0.8832 0.9194 -0.0993 0.0285  0.0685  23  LYS B C     
2076 O O     . LYS B 26  ? 0.7922 0.8599 0.8917 -0.0880 0.0281  0.0705  23  LYS B O     
2077 C CB    . LYS B 26  ? 0.9048 0.9071 0.9502 -0.0966 0.0286  0.0610  23  LYS B CB    
2078 C CG    . LYS B 26  ? 1.0275 1.0163 1.0586 -0.0795 0.0302  0.0637  23  LYS B CG    
2079 C CD    . LYS B 26  ? 1.1657 1.1532 1.1971 -0.0786 0.0383  0.0693  23  LYS B CD    
2080 C CE    . LYS B 26  ? 1.2325 1.2032 1.2438 -0.0629 0.0379  0.0716  23  LYS B CE    
2081 N NZ    . LYS B 26  ? 1.1871 1.1514 1.1908 -0.0627 0.0469  0.0763  23  LYS B NZ    
2082 N N     . PRO B 27  ? 1.0088 1.0643 1.1100 -0.1124 0.0358  0.0710  24  PRO B N     
2083 C CA    . PRO B 27  ? 1.1378 1.2059 1.2571 -0.1125 0.0452  0.0766  24  PRO B CA    
2084 C C     . PRO B 27  ? 1.1332 1.2374 1.2840 -0.1098 0.0403  0.0796  24  PRO B C     
2085 O O     . PRO B 27  ? 1.2011 1.3208 1.3584 -0.1082 0.0290  0.0780  24  PRO B O     
2086 C CB    . PRO B 27  ? 1.1585 1.2234 1.2880 -0.1295 0.0526  0.0784  24  PRO B CB    
2087 C CG    . PRO B 27  ? 1.1980 1.2354 1.3028 -0.1352 0.0502  0.0732  24  PRO B CG    
2088 C CD    . PRO B 27  ? 1.1548 1.1964 1.2507 -0.1279 0.0372  0.0682  24  PRO B CD    
2089 N N     . SER B 28  ? 1.0376 1.1534 1.2071 -0.1090 0.0503  0.0842  25  SER B N     
2090 C CA    . SER B 28  ? 1.0265 1.1752 1.2293 -0.1060 0.0482  0.0882  25  SER B CA    
2091 C C     . SER B 28  ? 1.1074 1.2833 1.3410 -0.1193 0.0414  0.0922  25  SER B C     
2092 O O     . SER B 28  ? 1.0092 1.2096 1.2773 -0.1224 0.0460  0.0986  25  SER B O     
2093 C CB    . SER B 28  ? 1.0300 1.1800 1.2434 -0.1015 0.0633  0.0913  25  SER B CB    
2094 O OG    . SER B 28  ? 0.9812 1.1073 1.1639 -0.0898 0.0671  0.0873  25  SER B OG    
2095 N N     . ARG B 29  ? 1.2630 1.4342 1.4843 -0.1271 0.0302  0.0885  26  ARG B N     
2096 C CA    . ARG B 29  ? 1.3357 1.5316 1.5808 -0.1410 0.0201  0.0912  26  ARG B CA    
2097 C C     . ARG B 29  ? 1.2975 1.5264 1.5674 -0.1351 0.0105  0.0969  26  ARG B C     
2098 O O     . ARG B 29  ? 1.2667 1.5048 1.5497 -0.1232 0.0166  0.1007  26  ARG B O     
2099 C CB    . ARG B 29  ? 1.4204 1.5990 1.6393 -0.1504 0.0105  0.0836  26  ARG B CB    
2100 C CG    . ARG B 29  ? 1.4806 1.6319 1.6850 -0.1616 0.0189  0.0797  26  ARG B CG    
2101 C CD    . ARG B 29  ? 1.4997 1.6702 1.7365 -0.1791 0.0196  0.0837  26  ARG B CD    
2102 N NE    . ARG B 29  ? 1.5231 1.7214 1.7769 -0.1898 0.0022  0.0841  26  ARG B NE    
2103 C CZ    . ARG B 29  ? 1.5081 1.7442 1.7971 -0.1890 -0.0048 0.0926  26  ARG B CZ    
2104 N NH1   . ARG B 29  ? 1.4821 1.7314 1.7945 -0.1782 0.0059  0.1003  26  ARG B NH1   
2105 N NH2   . ARG B 29  ? 1.5031 1.7626 1.8029 -0.1990 -0.0224 0.0935  26  ARG B NH2   
2106 N N     . SER B 30  ? 1.2897 1.5349 1.5643 -0.1438 -0.0043 0.0974  27  SER B N     
2107 C CA    . SER B 30  ? 1.2775 1.5539 1.5742 -0.1389 -0.0143 0.1047  27  SER B CA    
2108 C C     . SER B 30  ? 1.2872 1.5596 1.5580 -0.1375 -0.0275 0.1004  27  SER B C     
2109 O O     . SER B 30  ? 1.2522 1.5320 1.5227 -0.1251 -0.0295 0.1031  27  SER B O     
2110 C CB    . SER B 30  ? 1.2789 1.5892 1.6167 -0.1507 -0.0201 0.1141  27  SER B CB    
2111 O OG    . SER B 30  ? 1.3233 1.6290 1.6565 -0.1688 -0.0262 0.1100  27  SER B OG    
2112 N N     . ASN B 31  ? 1.3169 1.5765 1.5659 -0.1506 -0.0351 0.0933  28  ASN B N     
2113 C CA    . ASN B 31  ? 1.3060 1.5590 1.5270 -0.1513 -0.0461 0.0881  28  ASN B CA    
2114 C C     . ASN B 31  ? 1.1990 1.4424 1.4044 -0.1331 -0.0421 0.0870  28  ASN B C     
2115 O O     . ASN B 31  ? 1.1644 1.3834 1.3546 -0.1236 -0.0319 0.0819  28  ASN B O     
2116 C CB    . ASN B 31  ? 1.3236 1.5470 1.5129 -0.1637 -0.0471 0.0762  28  ASN B CB    
2117 C CG    . ASN B 31  ? 1.3203 1.5310 1.4761 -0.1636 -0.0548 0.0689  28  ASN B CG    
2118 O OD1   . ASN B 31  ? 1.3377 1.5318 1.4743 -0.1495 -0.0490 0.0658  28  ASN B OD1   
2119 N ND2   . ASN B 31  ? 1.2541 1.4722 1.4025 -0.1798 -0.0677 0.0658  28  ASN B ND2   
2120 N N     . ILE B 32  ? 1.0708 1.3343 1.2815 -0.1285 -0.0505 0.0926  29  ILE B N     
2121 C CA    . ILE B 32  ? 0.9304 1.1884 1.1316 -0.1122 -0.0467 0.0927  29  ILE B CA    
2122 C C     . ILE B 32  ? 0.8072 1.0457 0.9718 -0.1129 -0.0506 0.0846  29  ILE B C     
2123 O O     . ILE B 32  ? 1.0047 1.2244 1.1534 -0.1011 -0.0436 0.0798  29  ILE B O     
2124 C CB    . ILE B 32  ? 0.9392 1.2293 1.1704 -0.1045 -0.0501 0.1052  29  ILE B CB    
2125 C CG1   . ILE B 32  ? 1.0011 1.2853 1.2212 -0.0898 -0.0470 0.1050  29  ILE B CG1   
2126 C CG2   . ILE B 32  ? 0.9455 1.2615 1.1867 -0.1166 -0.0646 0.1129  29  ILE B CG2   
2127 C CD1   . ILE B 32  ? 1.0111 1.2976 1.2095 -0.0929 -0.0562 0.1056  29  ILE B CD1   
2128 N N     . LYS B 33  ? 0.5664 0.8095 0.7183 -0.1272 -0.0616 0.0828  30  LYS B N     
2129 C CA    . LYS B 33  ? 0.5993 0.8235 0.7139 -0.1297 -0.0647 0.0745  30  LYS B CA    
2130 C C     . LYS B 33  ? 0.5454 0.7321 0.6333 -0.1230 -0.0530 0.0630  30  LYS B C     
2131 O O     . LYS B 33  ? 0.4751 0.6464 0.5392 -0.1166 -0.0498 0.0581  30  LYS B O     
2132 C CB    . LYS B 33  ? 0.6175 0.8454 0.7184 -0.1498 -0.0778 0.0706  30  LYS B CB    
2133 C CG    . LYS B 33  ? 0.7177 0.9832 0.8394 -0.1554 -0.0925 0.0830  30  LYS B CG    
2134 C CD    . LYS B 33  ? 0.8543 1.1248 0.9642 -0.1771 -0.1078 0.0785  30  LYS B CD    
2135 C CE    . LYS B 33  ? 0.8911 1.2010 1.0222 -0.1820 -0.1249 0.0926  30  LYS B CE    
2136 N NZ    . LYS B 33  ? 0.8833 1.2015 1.0067 -0.2047 -0.1425 0.0884  30  LYS B NZ    
2137 N N     . THR B 34  ? 0.5091 0.6811 0.6019 -0.1239 -0.0459 0.0598  31  THR B N     
2138 C CA    . THR B 34  ? 0.5087 0.6460 0.5795 -0.1167 -0.0354 0.0511  31  THR B CA    
2139 C C     . THR B 34  ? 0.4493 0.5843 0.5367 -0.1041 -0.0270 0.0552  31  THR B C     
2140 O O     . THR B 34  ? 0.4538 0.6080 0.5665 -0.1054 -0.0271 0.0621  31  THR B O     
2141 C CB    . THR B 34  ? 0.5113 0.6228 0.5612 -0.1315 -0.0343 0.0415  31  THR B CB    
2142 O OG1   . THR B 34  ? 0.5354 0.6559 0.6058 -0.1411 -0.0345 0.0452  31  THR B OG1   
2143 C CG2   . THR B 34  ? 0.5285 0.6395 0.5575 -0.1458 -0.0433 0.0352  31  THR B CG2   
2144 N N     . THR B 35  ? 0.3529 0.4640 0.4256 -0.0920 -0.0195 0.0508  32  THR B N     
2145 C CA    . THR B 35  ? 0.3356 0.4414 0.4181 -0.0802 -0.0132 0.0536  32  THR B CA    
2146 C C     . THR B 35  ? 0.4579 0.5295 0.5177 -0.0736 -0.0067 0.0477  32  THR B C     
2147 O O     . THR B 35  ? 0.4868 0.5405 0.5269 -0.0746 -0.0054 0.0414  32  THR B O     
2148 C CB    . THR B 35  ? 0.4802 0.6056 0.5818 -0.0660 -0.0137 0.0590  32  THR B CB    
2149 O OG1   . THR B 35  ? 0.4862 0.6086 0.5970 -0.0573 -0.0092 0.0610  32  THR B OG1   
2150 C CG2   . THR B 35  ? 0.4453 0.5607 0.5348 -0.0560 -0.0122 0.0554  32  THR B CG2   
2151 N N     . LEU B 36  ? 0.3870 0.4490 0.4490 -0.0666 -0.0024 0.0500  33  LEU B N     
2152 C CA    . LEU B 36  ? 0.4322 0.4629 0.4751 -0.0592 0.0029  0.0469  33  LEU B CA    
2153 C C     . LEU B 36  ? 0.5243 0.5558 0.5727 -0.0413 0.0025  0.0486  33  LEU B C     
2154 O O     . LEU B 36  ? 0.5891 0.6377 0.6537 -0.0348 0.0004  0.0527  33  LEU B O     
2155 C CB    . LEU B 36  ? 0.5108 0.5266 0.5480 -0.0635 0.0076  0.0493  33  LEU B CB    
2156 C CG    . LEU B 36  ? 0.6336 0.6137 0.6486 -0.0588 0.0133  0.0476  33  LEU B CG    
2157 C CD1   . LEU B 36  ? 0.5343 0.4942 0.5334 -0.0706 0.0164  0.0409  33  LEU B CD1   
2158 C CD2   . LEU B 36  ? 0.8097 0.7787 0.8201 -0.0588 0.0179  0.0529  33  LEU B CD2   
2159 N N     . ILE B 37  ? 0.5061 0.5191 0.5427 -0.0338 0.0051  0.0450  34  ILE B N     
2160 C CA    . ILE B 37  ? 0.3648 0.3776 0.4094 -0.0169 0.0045  0.0466  34  ILE B CA    
2161 C C     . ILE B 37  ? 0.4134 0.3972 0.4439 -0.0093 0.0076  0.0472  34  ILE B C     
2162 O O     . ILE B 37  ? 0.5718 0.5313 0.5861 -0.0117 0.0132  0.0436  34  ILE B O     
2163 C CB    . ILE B 37  ? 0.4441 0.4625 0.4929 -0.0117 0.0061  0.0438  34  ILE B CB    
2164 C CG1   . ILE B 37  ? 0.5006 0.5490 0.5644 -0.0170 0.0024  0.0458  34  ILE B CG1   
2165 C CG2   . ILE B 37  ? 0.3549 0.3713 0.4152 0.0054  0.0064  0.0455  34  ILE B CG2   
2166 C CD1   . ILE B 37  ? 0.4492 0.5031 0.5150 -0.0122 0.0051  0.0442  34  ILE B CD1   
2167 N N     . GLU B 38  ? 0.3812 0.3667 0.4170 -0.0001 0.0039  0.0519  35  GLU B N     
2168 C CA    . GLU B 38  ? 0.5349 0.4944 0.5564 0.0073  0.0050  0.0550  35  GLU B CA    
2169 C C     . GLU B 38  ? 0.4854 0.4414 0.5156 0.0239  0.0022  0.0566  35  GLU B C     
2170 O O     . GLU B 38  ? 0.4244 0.4015 0.4746 0.0304  -0.0017 0.0559  35  GLU B O     
2171 C CB    . GLU B 38  ? 0.4732 0.4337 0.4896 0.0061  0.0023  0.0598  35  GLU B CB    
2172 C CG    . GLU B 38  ? 0.6656 0.6341 0.6807 -0.0094 0.0060  0.0592  35  GLU B CG    
2173 C CD    . GLU B 38  ? 0.8411 0.8122 0.8526 -0.0095 0.0056  0.0635  35  GLU B CD    
2174 O OE1   . GLU B 38  ? 0.8370 0.7930 0.8357 -0.0001 0.0033  0.0674  35  GLU B OE1   
2175 O OE2   . GLU B 38  ? 0.9015 0.8894 0.9226 -0.0188 0.0079  0.0634  35  GLU B OE2   
2176 N N     . ASP B 39  ? 0.5552 0.4846 0.5729 0.0308  0.0046  0.0596  36  ASP B N     
2177 C CA    . ASP B 39  ? 0.4807 0.4057 0.5092 0.0476  0.0013  0.0631  36  ASP B CA    
2178 C C     . ASP B 39  ? 0.4879 0.4123 0.5278 0.0521  0.0081  0.0585  36  ASP B C     
2179 O O     . ASP B 39  ? 0.4577 0.3950 0.5013 0.0442  0.0118  0.0528  36  ASP B O     
2180 C CB    . ASP B 39  ? 0.5752 0.5235 0.6203 0.0558  -0.0104 0.0663  36  ASP B CB    
2181 C CG    . ASP B 39  ? 0.7453 0.6893 0.7743 0.0529  -0.0159 0.0708  36  ASP B CG    
2182 O OD1   . ASP B 39  ? 0.6920 0.6130 0.6987 0.0473  -0.0103 0.0734  36  ASP B OD1   
2183 O OD2   . ASP B 39  ? 0.8414 0.8035 0.8792 0.0560  -0.0246 0.0714  36  ASP B OD2   
2184 N N     . VAL B 40  ? 0.5761 0.4849 0.6213 0.0655  0.0102  0.0617  37  VAL B N     
2185 C CA    . VAL B 40  ? 0.6316 0.5330 0.6851 0.0708  0.0205  0.0575  37  VAL B CA    
2186 C C     . VAL B 40  ? 0.5460 0.4755 0.6246 0.0751  0.0191  0.0552  37  VAL B C     
2187 O O     . VAL B 40  ? 0.6446 0.5754 0.7212 0.0698  0.0281  0.0490  37  VAL B O     
2188 C CB    . VAL B 40  ? 0.5737 0.4521 0.6320 0.0859  0.0241  0.0631  37  VAL B CB    
2189 C CG1   . VAL B 40  ? 0.4752 0.3683 0.5528 0.0995  0.0099  0.0722  37  VAL B CG1   
2190 C CG2   . VAL B 40  ? 0.4903 0.3615 0.5599 0.0922  0.0371  0.0584  37  VAL B CG2   
2191 N N     . GLU B 41  ? 0.5401 0.4908 0.6411 0.0842  0.0080  0.0600  38  GLU B N     
2192 C CA    . GLU B 41  ? 0.5539 0.5306 0.6828 0.0889  0.0073  0.0585  38  GLU B CA    
2193 C C     . GLU B 41  ? 0.4937 0.4884 0.6193 0.0762  0.0092  0.0538  38  GLU B C     
2194 O O     . GLU B 41  ? 0.4961 0.4978 0.6296 0.0759  0.0173  0.0508  38  GLU B O     
2195 C CB    . GLU B 41  ? 0.6450 0.6407 0.7989 0.0992  -0.0064 0.0635  38  GLU B CB    
2196 C CG    . GLU B 41  ? 0.8257 0.8115 0.9952 0.1148  -0.0085 0.0693  38  GLU B CG    
2197 C CD    . GLU B 41  ? 1.0755 1.0541 1.2599 0.1219  0.0063  0.0674  38  GLU B CD    
2198 O OE1   . GLU B 41  ? 1.1813 1.1754 1.3790 0.1194  0.0131  0.0631  38  GLU B OE1   
2199 O OE2   . GLU B 41  ? 1.1578 1.1141 1.3403 0.1305  0.0124  0.0707  38  GLU B OE2   
2200 N N     . PRO B 42  ? 0.4906 0.4928 0.6050 0.0660  0.0023  0.0541  39  PRO B N     
2201 C CA    . PRO B 42  ? 0.4582 0.4773 0.5711 0.0542  0.0040  0.0512  39  PRO B CA    
2202 C C     . PRO B 42  ? 0.5453 0.5504 0.6391 0.0457  0.0141  0.0465  39  PRO B C     
2203 O O     . PRO B 42  ? 0.4868 0.5056 0.5840 0.0409  0.0173  0.0447  39  PRO B O     
2204 C CB    . PRO B 42  ? 0.3378 0.3590 0.4388 0.0451  -0.0024 0.0526  39  PRO B CB    
2205 C CG    . PRO B 42  ? 0.3429 0.3588 0.4469 0.0548  -0.0103 0.0565  39  PRO B CG    
2206 C CD    . PRO B 42  ? 0.5069 0.5039 0.6114 0.0658  -0.0068 0.0579  39  PRO B CD    
2207 N N     . LEU B 43  ? 0.4378 0.4148 0.5105 0.0436  0.0191  0.0445  40  LEU B N     
2208 C CA    . LEU B 43  ? 0.4427 0.4020 0.4940 0.0346  0.0288  0.0381  40  LEU B CA    
2209 C C     . LEU B 43  ? 0.4258 0.3816 0.4840 0.0431  0.0389  0.0354  40  LEU B C     
2210 O O     . LEU B 43  ? 0.5116 0.4709 0.5602 0.0359  0.0442  0.0310  40  LEU B O     
2211 C CB    . LEU B 43  ? 0.5428 0.4699 0.5719 0.0308  0.0332  0.0363  40  LEU B CB    
2212 C CG    . LEU B 43  ? 0.5723 0.4976 0.5874 0.0171  0.0280  0.0370  40  LEU B CG    
2213 C CD1   . LEU B 43  ? 0.5674 0.4583 0.5634 0.0154  0.0340  0.0364  40  LEU B CD1   
2214 C CD2   . LEU B 43  ? 0.4380 0.3758 0.4446 0.0005  0.0272  0.0320  40  LEU B CD2   
2215 N N     . MET B 44  ? 0.4181 0.3670 0.4930 0.0585  0.0416  0.0385  41  MET B N     
2216 C CA    . MET B 44  ? 0.5130 0.4583 0.5995 0.0684  0.0533  0.0367  41  MET B CA    
2217 C C     . MET B 44  ? 0.4493 0.4226 0.5518 0.0679  0.0531  0.0375  41  MET B C     
2218 O O     . MET B 44  ? 0.4610 0.4305 0.5546 0.0656  0.0641  0.0335  41  MET B O     
2219 C CB    . MET B 44  ? 0.5281 0.4688 0.6394 0.0860  0.0532  0.0423  41  MET B CB    
2220 C CG    . MET B 44  ? 0.7269 0.6377 0.8241 0.0891  0.0550  0.0438  41  MET B CG    
2221 S SD    . MET B 44  ? 0.7409 0.6133 0.8133 0.0864  0.0760  0.0353  41  MET B SD    
2222 C CE    . MET B 44  ? 0.5456 0.4242 0.6486 0.1029  0.0890  0.0361  41  MET B CE    
2223 N N     . HIS B 45  ? 0.3702 0.3699 0.4948 0.0699  0.0412  0.0426  42  HIS B N     
2224 C CA    . HIS B 45  ? 0.3663 0.3926 0.5101 0.0702  0.0412  0.0445  42  HIS B CA    
2225 C C     . HIS B 45  ? 0.4231 0.4565 0.5465 0.0558  0.0414  0.0426  42  HIS B C     
2226 O O     . HIS B 45  ? 0.5537 0.5983 0.6812 0.0554  0.0474  0.0434  42  HIS B O     
2227 C CB    . HIS B 45  ? 0.3711 0.4212 0.5436 0.0754  0.0288  0.0492  42  HIS B CB    
2228 C CG    . HIS B 45  ? 0.4346 0.4865 0.6358 0.0903  0.0277  0.0519  42  HIS B CG    
2229 N ND1   . HIS B 45  ? 0.5390 0.5803 0.7407 0.0965  0.0196  0.0541  42  HIS B ND1   
2230 C CD2   . HIS B 45  ? 0.4264 0.4904 0.6583 0.1001  0.0333  0.0536  42  HIS B CD2   
2231 C CE1   . HIS B 45  ? 0.4735 0.5219 0.7062 0.1095  0.0185  0.0570  42  HIS B CE1   
2232 N NE2   . HIS B 45  ? 0.3870 0.4494 0.6400 0.1117  0.0272  0.0564  42  HIS B NE2   
2233 N N     . SER B 46  ? 0.4020 0.4295 0.5045 0.0441  0.0348  0.0410  43  SER B N     
2234 C CA    . SER B 46  ? 0.3719 0.4069 0.4565 0.0296  0.0329  0.0397  43  SER B CA    
2235 C C     . SER B 46  ? 0.4856 0.5033 0.5451 0.0251  0.0436  0.0340  43  SER B C     
2236 O O     . SER B 46  ? 0.4683 0.4979 0.5233 0.0210  0.0455  0.0351  43  SER B O     
2237 C CB    . SER B 46  ? 0.4411 0.4707 0.5109 0.0179  0.0251  0.0388  43  SER B CB    
2238 O OG    . SER B 46  ? 0.3469 0.3941 0.4359 0.0200  0.0163  0.0438  43  SER B OG    
2239 N N     . ILE B 47  ? 0.4110 0.3988 0.4526 0.0259  0.0509  0.0281  44  ILE B N     
2240 C CA    . ILE B 47  ? 0.4790 0.4447 0.4929 0.0212  0.0629  0.0204  44  ILE B CA    
2241 C C     . ILE B 47  ? 0.4442 0.4161 0.4686 0.0314  0.0740  0.0220  44  ILE B C     
2242 O O     . ILE B 47  ? 0.6800 0.6491 0.6828 0.0249  0.0802  0.0188  44  ILE B O     
2243 C CB    . ILE B 47  ? 0.4764 0.4066 0.4753 0.0235  0.0717  0.0141  44  ILE B CB    
2244 C CG1   . ILE B 47  ? 0.4805 0.4024 0.4683 0.0129  0.0625  0.0132  44  ILE B CG1   
2245 C CG2   . ILE B 47  ? 0.5159 0.4204 0.4838 0.0180  0.0859  0.0043  44  ILE B CG2   
2246 C CD1   . ILE B 47  ? 0.5107 0.3972 0.4868 0.0161  0.0711  0.0090  44  ILE B CD1   
2247 N N     . ALA B 48  ? 0.4621 0.4424 0.5195 0.0469  0.0764  0.0271  45  ALA B N     
2248 C CA    . ALA B 48  ? 0.5574 0.5448 0.6320 0.0576  0.0883  0.0295  45  ALA B CA    
2249 C C     . ALA B 48  ? 0.5427 0.5567 0.6220 0.0527  0.0844  0.0347  45  ALA B C     
2250 O O     . ALA B 48  ? 0.6163 0.6312 0.6937 0.0560  0.0963  0.0357  45  ALA B O     
2251 C CB    . ALA B 48  ? 0.4032 0.3987 0.5182 0.0738  0.0881  0.0346  45  ALA B CB    
2252 N N     . ALA B 49  ? 0.3800 0.4144 0.4654 0.0453  0.0691  0.0388  46  ALA B N     
2253 C CA    . ALA B 49  ? 0.3806 0.4413 0.4746 0.0414  0.0645  0.0455  46  ALA B CA    
2254 C C     . ALA B 49  ? 0.5572 0.6152 0.6158 0.0269  0.0625  0.0438  46  ALA B C     
2255 O O     . ALA B 49  ? 0.5194 0.5984 0.5814 0.0227  0.0575  0.0505  46  ALA B O     
2256 C CB    . ALA B 49  ? 0.3266 0.4106 0.4471 0.0412  0.0506  0.0508  46  ALA B CB    
2257 N N     . GLY B 50  ? 0.5722 0.6040 0.5973 0.0192  0.0657  0.0349  47  GLY B N     
2258 C CA    . GLY B 50  ? 0.4729 0.4996 0.4613 0.0042  0.0628  0.0314  47  GLY B CA    
2259 C C     . GLY B 50  ? 0.5915 0.6268 0.5734 -0.0102 0.0467  0.0313  47  GLY B C     
2260 O O     . GLY B 50  ? 0.5867 0.6213 0.5415 -0.0243 0.0408  0.0287  47  GLY B O     
2261 N N     . VAL B 51  ? 0.4094 0.4529 0.4161 -0.0070 0.0396  0.0341  48  VAL B N     
2262 C CA    . VAL B 51  ? 0.4212 0.4721 0.4257 -0.0197 0.0268  0.0343  48  VAL B CA    
2263 C C     . VAL B 51  ? 0.5864 0.6102 0.5571 -0.0326 0.0278  0.0239  48  VAL B C     
2264 O O     . VAL B 51  ? 0.6376 0.6338 0.5989 -0.0282 0.0366  0.0172  48  VAL B O     
2265 C CB    . VAL B 51  ? 0.3764 0.4337 0.4077 -0.0130 0.0223  0.0378  48  VAL B CB    
2266 C CG1   . VAL B 51  ? 0.4111 0.4726 0.4387 -0.0264 0.0125  0.0378  48  VAL B CG1   
2267 C CG2   . VAL B 51  ? 0.3647 0.4485 0.4295 -0.0024 0.0206  0.0465  48  VAL B CG2   
2268 N N     . GLU B 52  ? 0.5761 0.6078 0.5301 -0.0487 0.0184  0.0229  49  GLU B N     
2269 C CA    . GLU B 52  ? 0.6953 0.7023 0.6170 -0.0638 0.0181  0.0119  49  GLU B CA    
2270 C C     . GLU B 52  ? 0.6745 0.6739 0.6040 -0.0700 0.0139  0.0101  49  GLU B C     
2271 O O     . GLU B 52  ? 0.5620 0.5844 0.5149 -0.0720 0.0048  0.0177  49  GLU B O     
2272 C CB    . GLU B 52  ? 0.7739 0.7936 0.6749 -0.0799 0.0077  0.0114  49  GLU B CB    
2273 C CG    . GLU B 52  ? 0.8668 0.8833 0.7456 -0.0765 0.0142  0.0108  49  GLU B CG    
2274 C CD    . GLU B 52  ? 1.0112 1.0371 0.8630 -0.0936 0.0020  0.0098  49  GLU B CD    
2275 O OE1   . GLU B 52  ? 1.0150 1.0663 0.8817 -0.1036 -0.0139 0.0162  49  GLU B OE1   
2276 O OE2   . GLU B 52  ? 1.1226 1.1306 0.9381 -0.0970 0.0084  0.0028  49  GLU B OE2   
2277 N N     . PHE B 53  ? 0.6663 0.6316 0.5761 -0.0726 0.0222  0.0002  50  PHE B N     
2278 C CA    . PHE B 53  ? 0.6308 0.5833 0.5449 -0.0780 0.0209  -0.0014 50  PHE B CA    
2279 C C     . PHE B 53  ? 0.6743 0.6080 0.5618 -0.0984 0.0187  -0.0120 50  PHE B C     
2280 O O     . PHE B 53  ? 0.7687 0.6820 0.6271 -0.1045 0.0242  -0.0222 50  PHE B O     
2281 C CB    . PHE B 53  ? 0.6476 0.5748 0.5662 -0.0626 0.0327  -0.0020 50  PHE B CB    
2282 C CG    . PHE B 53  ? 0.5996 0.5462 0.5491 -0.0457 0.0308  0.0086  50  PHE B CG    
2283 C CD1   . PHE B 53  ? 0.5120 0.4694 0.4740 -0.0314 0.0350  0.0122  50  PHE B CD1   
2284 C CD2   . PHE B 53  ? 0.4661 0.4192 0.4312 -0.0448 0.0254  0.0146  50  PHE B CD2   
2285 C CE1   . PHE B 53  ? 0.5379 0.5131 0.5290 -0.0174 0.0322  0.0206  50  PHE B CE1   
2286 C CE2   . PHE B 53  ? 0.4966 0.4660 0.4865 -0.0305 0.0229  0.0228  50  PHE B CE2   
2287 C CZ    . PHE B 53  ? 0.4987 0.4797 0.5024 -0.0172 0.0255  0.0254  50  PHE B CZ    
2288 N N     . ILE B 54  ? 0.7084 0.6484 0.6059 -0.1096 0.0114  -0.0101 51  ILE B N     
2289 C CA    . ILE B 54  ? 0.7476 0.6699 0.6254 -0.1301 0.0091  -0.0201 51  ILE B CA    
2290 C C     . ILE B 54  ? 0.7784 0.6590 0.6432 -0.1273 0.0229  -0.0274 51  ILE B C     
2291 O O     . ILE B 54  ? 0.8836 0.7345 0.7208 -0.1366 0.0294  -0.0400 51  ILE B O     
2292 C CB    . ILE B 54  ? 0.8028 0.7496 0.7014 -0.1434 -0.0027 -0.0142 51  ILE B CB    
2293 C CG1   . ILE B 54  ? 0.7452 0.7338 0.6598 -0.1455 -0.0162 -0.0055 51  ILE B CG1   
2294 C CG2   . ILE B 54  ? 0.9365 0.8644 0.8183 -0.1656 -0.0048 -0.0251 51  ILE B CG2   
2295 C CD1   . ILE B 54  ? 0.8085 0.8248 0.7508 -0.1556 -0.0262 0.0024  51  ILE B CD1   
2296 N N     . GLU B 55  ? 0.6511 0.5287 0.5348 -0.1142 0.0274  -0.0192 52  GLU B N     
2297 C CA    . GLU B 55  ? 0.6682 0.5077 0.5430 -0.1082 0.0402  -0.0226 52  GLU B CA    
2298 C C     . GLU B 55  ? 0.6695 0.5129 0.5652 -0.0883 0.0428  -0.0108 52  GLU B C     
2299 O O     . GLU B 55  ? 0.6553 0.5265 0.5716 -0.0856 0.0346  -0.0014 52  GLU B O     
2300 C CB    . GLU B 55  ? 0.6753 0.4960 0.5416 -0.1268 0.0408  -0.0282 52  GLU B CB    
2301 C CG    . GLU B 55  ? 0.8457 0.6234 0.7012 -0.1215 0.0553  -0.0313 52  GLU B CG    
2302 C CD    . GLU B 55  ? 0.9232 0.6764 0.7652 -0.1427 0.0583  -0.0407 52  GLU B CD    
2303 O OE1   . GLU B 55  ? 0.7408 0.5110 0.5955 -0.1558 0.0505  -0.0370 52  GLU B OE1   
2304 O OE2   . GLU B 55  ? 1.0409 0.7572 0.8611 -0.1465 0.0696  -0.0520 52  GLU B OE2   
2305 N N     . VAL B 56  ? 0.6150 0.4301 0.5054 -0.0744 0.0542  -0.0116 53  VAL B N     
2306 C CA    . VAL B 56  ? 0.6003 0.4157 0.5079 -0.0557 0.0554  -0.0006 53  VAL B CA    
2307 C C     . VAL B 56  ? 0.6588 0.4419 0.5585 -0.0565 0.0625  0.0011  53  VAL B C     
2308 O O     . VAL B 56  ? 0.7477 0.4980 0.6294 -0.0637 0.0724  -0.0074 53  VAL B O     
2309 C CB    . VAL B 56  ? 0.6692 0.4808 0.5834 -0.0362 0.0617  0.0006  53  VAL B CB    
2310 C CG1   . VAL B 56  ? 0.5739 0.3816 0.5041 -0.0179 0.0617  0.0114  53  VAL B CG1   
2311 C CG2   . VAL B 56  ? 0.6132 0.4584 0.5387 -0.0335 0.0553  0.0017  53  VAL B CG2   
2312 N N     . TYR B 57  ? 0.6400 0.4307 0.5518 -0.0494 0.0581  0.0121  54  TYR B N     
2313 C CA    . TYR B 57  ? 0.6621 0.4235 0.5658 -0.0497 0.0647  0.0163  54  TYR B CA    
2314 C C     . TYR B 57  ? 0.6688 0.4225 0.5801 -0.0281 0.0653  0.0276  54  TYR B C     
2315 O O     . TYR B 57  ? 0.7191 0.4940 0.6450 -0.0141 0.0591  0.0319  54  TYR B O     
2316 C CB    . TYR B 57  ? 0.6264 0.3994 0.5326 -0.0641 0.0600  0.0199  54  TYR B CB    
2317 C CG    . TYR B 57  ? 0.6936 0.4803 0.5979 -0.0859 0.0561  0.0106  54  TYR B CG    
2318 C CD1   . TYR B 57  ? 0.7034 0.5289 0.6215 -0.0895 0.0453  0.0112  54  TYR B CD1   
2319 C CD2   . TYR B 57  ? 0.8119 0.5729 0.7019 -0.1030 0.0626  0.0017  54  TYR B CD2   
2320 C CE1   . TYR B 57  ? 0.7643 0.6043 0.6820 -0.1089 0.0397  0.0044  54  TYR B CE1   
2321 C CE2   . TYR B 57  ? 0.7496 0.5251 0.6389 -0.1238 0.0566  -0.0067 54  TYR B CE2   
2322 C CZ    . TYR B 57  ? 0.7136 0.5295 0.6168 -0.1263 0.0444  -0.0047 54  TYR B CZ    
2323 O OH    . TYR B 57  ? 0.7983 0.6305 0.7021 -0.1465 0.0363  -0.0115 54  TYR B OH    
2324 N N     . GLY B 58  ? 0.8273 0.5507 0.7290 -0.0259 0.0722  0.0330  55  GLY B N     
2325 C CA    . GLY B 58  ? 0.8491 0.5633 0.7554 -0.0061 0.0712  0.0454  55  GLY B CA    
2326 C C     . GLY B 58  ? 0.8578 0.5425 0.7507 -0.0084 0.0776  0.0530  55  GLY B C     
2327 O O     . GLY B 58  ? 0.9314 0.5928 0.8122 -0.0233 0.0870  0.0469  55  GLY B O     
2328 N N     . SER B 59  ? 0.8564 0.5413 0.7504 0.0058  0.0722  0.0665  56  SER B N     
2329 C CA    . SER B 59  ? 0.9513 0.6074 0.8304 0.0058  0.0783  0.0765  56  SER B CA    
2330 C C     . SER B 59  ? 1.0651 0.6820 0.9388 0.0159  0.0896  0.0797  56  SER B C     
2331 O O     . SER B 59  ? 1.1840 0.8010 1.0687 0.0327  0.0879  0.0821  56  SER B O     
2332 C CB    . SER B 59  ? 0.9710 0.6409 0.8487 0.0174  0.0676  0.0901  56  SER B CB    
2333 O OG    . SER B 59  ? 1.0737 0.7154 0.9334 0.0171  0.0742  0.1009  56  SER B OG    
2334 N N     . ASP B 60  ? 1.0221 0.6052 0.8815 0.0058  0.1023  0.0800  57  ASP B N     
2335 C CA    . ASP B 60  ? 1.1760 0.7178 1.0305 0.0144  0.1155  0.0831  57  ASP B CA    
2336 C C     . ASP B 60  ? 1.1005 0.6300 0.9533 0.0357  0.1120  0.1028  57  ASP B C     
2337 O O     . ASP B 60  ? 1.1662 0.6621 1.0176 0.0467  0.1220  0.1094  57  ASP B O     
2338 C CB    . ASP B 60  ? 1.2543 0.7625 1.0950 -0.0046 0.1309  0.0765  57  ASP B CB    
2339 C CG    . ASP B 60  ? 1.3453 0.8420 1.1743 -0.0094 0.1331  0.0890  57  ASP B CG    
2340 O OD1   . ASP B 60  ? 1.3708 0.8907 1.1995 -0.0019 0.1217  0.0999  57  ASP B OD1   
2341 O OD2   . ASP B 60  ? 1.4380 0.9012 1.2574 -0.0211 0.1474  0.0876  57  ASP B OD2   
2342 N N     . SER B 61  ? 0.9893 0.5452 0.8416 0.0415  0.0976  0.1124  58  SER B N     
2343 C CA    . SER B 61  ? 1.2181 0.7664 1.0658 0.0610  0.0904  0.1313  58  SER B CA    
2344 C C     . SER B 61  ? 1.2752 0.8524 1.1427 0.0790  0.0751  0.1341  58  SER B C     
2345 O O     . SER B 61  ? 1.3342 0.9115 1.2018 0.0962  0.0650  0.1492  58  SER B O     
2346 C CB    . SER B 61  ? 1.2961 0.8498 1.1253 0.0554  0.0854  0.1406  58  SER B CB    
2347 O OG    . SER B 61  ? 1.3486 0.9418 1.1839 0.0477  0.0741  0.1329  58  SER B OG    
2348 N N     . SER B 62  ? 1.1500 0.7519 1.0345 0.0745  0.0731  0.1199  59  SER B N     
2349 C CA    . SER B 62  ? 1.0827 0.7134 0.9901 0.0897  0.0604  0.1209  59  SER B CA    
2350 C C     . SER B 62  ? 1.1141 0.7381 1.0388 0.0942  0.0706  0.1116  59  SER B C     
2351 O O     . SER B 62  ? 1.1624 0.7775 1.0814 0.0795  0.0825  0.0976  59  SER B O     
2352 C CB    . SER B 62  ? 1.0687 0.7404 0.9819 0.0815  0.0477  0.1140  59  SER B CB    
2353 O OG    . SER B 62  ? 1.0780 0.7769 1.0137 0.0962  0.0346  0.1165  59  SER B OG    
2354 N N     . PRO B 63  ? 1.1836 0.8121 1.1298 0.1145  0.0661  0.1193  60  PRO B N     
2355 C CA    . PRO B 63  ? 1.2131 0.8361 1.1786 0.1214  0.0772  0.1116  60  PRO B CA    
2356 C C     . PRO B 63  ? 1.0966 0.7485 1.0698 0.1104  0.0765  0.0959  60  PRO B C     
2357 O O     . PRO B 63  ? 0.9940 0.6806 0.9853 0.1163  0.0632  0.0971  60  PRO B O     
2358 C CB    . PRO B 63  ? 1.2866 0.9206 1.2788 0.1454  0.0670  0.1257  60  PRO B CB    
2359 C CG    . PRO B 63  ? 1.3095 0.9371 1.2879 0.1514  0.0548  0.1424  60  PRO B CG    
2360 C CD    . PRO B 63  ? 1.2422 0.8798 1.1953 0.1321  0.0502  0.1366  60  PRO B CD    
2361 N N     . PHE B 64  ? 1.0447 0.6816 1.0034 0.0942  0.0903  0.0814  61  PHE B N     
2362 C CA    . PHE B 64  ? 0.9474 0.6086 0.9091 0.0831  0.0902  0.0673  61  PHE B CA    
2363 C C     . PHE B 64  ? 0.9423 0.6174 0.9301 0.0984  0.0923  0.0665  61  PHE B C     
2364 O O     . PHE B 64  ? 0.9129 0.5634 0.9073 0.1083  0.1065  0.0658  61  PHE B O     
2365 C CB    . PHE B 64  ? 0.8318 0.4696 0.7711 0.0638  0.1045  0.0524  61  PHE B CB    
2366 C CG    . PHE B 64  ? 0.7998 0.4641 0.7354 0.0486  0.1006  0.0398  61  PHE B CG    
2367 C CD1   . PHE B 64  ? 0.8318 0.5035 0.7749 0.0519  0.1070  0.0313  61  PHE B CD1   
2368 C CD2   . PHE B 64  ? 0.7280 0.4096 0.6533 0.0316  0.0914  0.0377  61  PHE B CD2   
2369 C CE1   . PHE B 64  ? 0.8740 0.5694 0.8118 0.0386  0.1029  0.0216  61  PHE B CE1   
2370 C CE2   . PHE B 64  ? 0.7751 0.4820 0.6989 0.0185  0.0869  0.0281  61  PHE B CE2   
2371 C CZ    . PHE B 64  ? 0.7381 0.4517 0.6669 0.0221  0.0921  0.0204  61  PHE B CZ    
2372 N N     . PRO B 65  ? 0.8838 0.5978 0.8883 0.1003  0.0796  0.0665  62  PRO B N     
2373 C CA    . PRO B 65  ? 0.8791 0.6116 0.9132 0.1149  0.0800  0.0673  62  PRO B CA    
2374 C C     . PRO B 65  ? 0.9135 0.6279 0.9459 0.1138  0.1001  0.0559  62  PRO B C     
2375 O O     . PRO B 65  ? 0.8835 0.5994 0.8977 0.0980  0.1055  0.0436  62  PRO B O     
2376 C CB    . PRO B 65  ? 0.6827 0.4562 0.7257 0.1085  0.0660  0.0649  62  PRO B CB    
2377 C CG    . PRO B 65  ? 0.7408 0.5188 0.7660 0.0984  0.0540  0.0689  62  PRO B CG    
2378 C CD    . PRO B 65  ? 0.8019 0.5440 0.7994 0.0878  0.0655  0.0656  62  PRO B CD    
2379 N N     . SER B 66  ? 0.9662 0.6634 1.0170 0.1307  0.1111  0.0605  63  SER B N     
2380 C CA    . SER B 66  ? 1.0680 0.7467 1.1188 0.1320  0.1326  0.0499  63  SER B CA    
2381 C C     . SER B 66  ? 1.0703 0.7815 1.1432 0.1362  0.1316  0.0469  63  SER B C     
2382 O O     . SER B 66  ? 1.3052 1.0350 1.4140 0.1533  0.1270  0.0563  63  SER B O     
2383 C CB    . SER B 66  ? 1.1024 0.7504 1.1688 0.1499  0.1471  0.0567  63  SER B CB    
2384 O OG    . SER B 66  ? 1.1177 0.7882 1.2237 0.1704  0.1367  0.0712  63  SER B OG    
2385 N N     . GLU B 67  ? 0.8175 0.5350 0.8693 0.1202  0.1355  0.0344  64  GLU B N     
2386 C CA    . GLU B 67  ? 0.8908 0.6382 0.9571 0.1207  0.1351  0.0312  64  GLU B CA    
2387 C C     . GLU B 67  ? 0.7078 0.4730 0.7497 0.1006  0.1244  0.0246  64  GLU B C     
2388 O O     . GLU B 67  ? 0.6933 0.4696 0.7278 0.0935  0.1293  0.0174  64  GLU B O     
2389 C CB    . GLU B 67  ? 0.9519 0.7322 1.0608 0.1370  0.1221  0.0435  64  GLU B CB    
2390 C CG    . GLU B 67  ? 1.1766 0.9839 1.2882 0.1324  0.0980  0.0506  64  GLU B CG    
2391 C CD    . GLU B 67  ? 1.3953 1.2310 1.5476 0.1482  0.0845  0.0617  64  GLU B CD    
2392 O OE1   . GLU B 67  ? 1.5727 1.4043 1.7536 0.1644  0.0926  0.0665  64  GLU B OE1   
2393 O OE2   . GLU B 67  ? 1.3322 1.1942 1.4889 0.1442  0.0661  0.0653  64  GLU B OE2   
2394 N N     . LEU B 68  ? 0.6859 0.4536 0.7162 0.0920  0.1103  0.0283  65  LEU B N     
2395 C CA    . LEU B 68  ? 0.7423 0.5223 0.7497 0.0722  0.1015  0.0225  65  LEU B CA    
2396 C C     . LEU B 68  ? 0.7489 0.4956 0.7222 0.0575  0.1145  0.0104  65  LEU B C     
2397 O O     . LEU B 68  ? 0.7415 0.4930 0.6955 0.0431  0.1159  0.0009  65  LEU B O     
2398 C CB    . LEU B 68  ? 0.7265 0.5169 0.7344 0.0689  0.0851  0.0307  65  LEU B CB    
2399 C CG    . LEU B 68  ? 0.7443 0.5642 0.7477 0.0549  0.0716  0.0299  65  LEU B CG    
2400 C CD1   . LEU B 68  ? 0.6315 0.4468 0.6247 0.0482  0.0627  0.0351  65  LEU B CD1   
2401 C CD2   . LEU B 68  ? 0.7621 0.5818 0.7446 0.0382  0.0770  0.0188  65  LEU B CD2   
2402 N N     . LEU B 69  ? 0.7788 0.4910 0.7447 0.0613  0.1235  0.0109  66  LEU B N     
2403 C CA    . LEU B 69  ? 0.7032 0.3782 0.6384 0.0483  0.1380  -0.0016 66  LEU B CA    
2404 C C     . LEU B 69  ? 0.8489 0.5152 0.7754 0.0486  0.1537  -0.0128 66  LEU B C     
2405 O O     . LEU B 69  ? 0.8338 0.4891 0.7304 0.0313  0.1585  -0.0259 66  LEU B O     
2406 C CB    . LEU B 69  ? 0.9169 0.5548 0.8527 0.0573  0.1481  0.0028  66  LEU B CB    
2407 C CG    . LEU B 69  ? 1.0153 0.6181 0.9214 0.0402  0.1551  -0.0057 66  LEU B CG    
2408 C CD1   . LEU B 69  ? 1.0845 0.6444 0.9922 0.0520  0.1729  -0.0040 66  LEU B CD1   
2409 C CD2   . LEU B 69  ? 1.1028 0.6997 0.9797 0.0192  0.1601  -0.0235 66  LEU B CD2   
2410 N N     . ASP B 70  ? 0.7765 0.4482 0.7294 0.0680  0.1617  -0.0072 67  ASP B N     
2411 C CA    . ASP B 70  ? 0.8791 0.5423 0.8265 0.0709  0.1795  -0.0162 67  ASP B CA    
2412 C C     . ASP B 70  ? 0.9038 0.5973 0.8416 0.0599  0.1716  -0.0204 67  ASP B C     
2413 O O     . ASP B 70  ? 0.9407 0.6206 0.8477 0.0479  0.1815  -0.0328 67  ASP B O     
2414 C CB    . ASP B 70  ? 0.9769 0.6428 0.9624 0.0952  0.1895  -0.0072 67  ASP B CB    
2415 C CG    . ASP B 70  ? 1.1094 0.7405 1.1034 0.1074  0.2014  -0.0034 67  ASP B CG    
2416 O OD1   . ASP B 70  ? 1.1166 0.7184 1.0846 0.0964  0.2039  -0.0087 67  ASP B OD1   
2417 O OD2   . ASP B 70  ? 1.1710 0.8043 1.2000 0.1280  0.2084  0.0056  67  ASP B OD2   
2418 N N     . LEU B 71  ? 0.7804 0.5137 0.7430 0.0640  0.1540  -0.0098 68  LEU B N     
2419 C CA    . LEU B 71  ? 0.7039 0.4677 0.6618 0.0550  0.1458  -0.0111 68  LEU B CA    
2420 C C     . LEU B 71  ? 0.7058 0.4638 0.6256 0.0318  0.1397  -0.0208 68  LEU B C     
2421 O O     . LEU B 71  ? 0.8774 0.6342 0.7734 0.0221  0.1450  -0.0290 68  LEU B O     
2422 C CB    . LEU B 71  ? 0.6378 0.4419 0.6282 0.0614  0.1269  0.0013  68  LEU B CB    
2423 C CG    . LEU B 71  ? 0.6292 0.4662 0.6194 0.0531  0.1178  0.0022  68  LEU B CG    
2424 C CD1   . LEU B 71  ? 0.6854 0.5188 0.6677 0.0554  0.1337  -0.0030 68  LEU B CD1   
2425 C CD2   . LEU B 71  ? 0.6241 0.4965 0.6505 0.0621  0.1029  0.0136  68  LEU B CD2   
2426 N N     . CYS B 72  ? 0.7805 0.5350 0.6949 0.0227  0.1285  -0.0193 69  CYS B N     
2427 C CA    . CYS B 72  ? 0.8728 0.6223 0.7565 0.0001  0.1218  -0.0280 69  CYS B CA    
2428 C C     . CYS B 72  ? 0.9234 0.6360 0.7718 -0.0096 0.1381  -0.0434 69  CYS B C     
2429 O O     . CYS B 72  ? 0.8202 0.5346 0.6410 -0.0271 0.1344  -0.0525 69  CYS B O     
2430 C CB    . CYS B 72  ? 0.6650 0.4089 0.5509 -0.0061 0.1124  -0.0239 69  CYS B CB    
2431 S SG    . CYS B 72  ? 0.6997 0.4867 0.6155 -0.0019 0.0917  -0.0090 69  CYS B SG    
2432 N N     . GLY B 73  ? 1.0018 0.6809 0.8514 0.0019  0.1560  -0.0462 70  GLY B N     
2433 C CA    . GLY B 73  ? 1.0157 0.6547 0.8322 -0.0057 0.1748  -0.0620 70  GLY B CA    
2434 C C     . GLY B 73  ? 0.9886 0.6330 0.7870 -0.0077 0.1829  -0.0691 70  GLY B C     
2435 O O     . GLY B 73  ? 1.0326 0.6614 0.7921 -0.0254 0.1855  -0.0829 70  GLY B O     
2436 N N     . ARG B 74  ? 0.9112 0.5774 0.7372 0.0100  0.1865  -0.0595 71  ARG B N     
2437 C CA    . ARG B 74  ? 0.9932 0.6641 0.8046 0.0106  0.1968  -0.0641 71  ARG B CA    
2438 C C     . ARG B 74  ? 1.0403 0.7447 0.8385 -0.0039 0.1779  -0.0621 71  ARG B C     
2439 O O     . ARG B 74  ? 1.1285 0.8373 0.9072 -0.0068 0.1838  -0.0655 71  ARG B O     
2440 C CB    . ARG B 74  ? 0.9755 0.6592 0.8257 0.0342  0.2080  -0.0537 71  ARG B CB    
2441 C CG    . ARG B 74  ? 1.1432 0.8078 1.0231 0.0518  0.2183  -0.0487 71  ARG B CG    
2442 C CD    . ARG B 74  ? 1.3041 0.9596 1.2049 0.0709  0.2416  -0.0471 71  ARG B CD    
2443 N NE    . ARG B 74  ? 1.4580 1.1465 1.3741 0.0758  0.2400  -0.0409 71  ARG B NE    
2444 C CZ    . ARG B 74  ? 1.5584 1.2415 1.4451 0.0691  0.2523  -0.0487 71  ARG B CZ    
2445 N NH1   . ARG B 74  ? 1.5164 1.1626 1.3548 0.0564  0.2660  -0.0643 71  ARG B NH1   
2446 N NH2   . ARG B 74  ? 1.6027 1.3160 1.5067 0.0746  0.2512  -0.0409 71  ARG B NH2   
2447 N N     . GLN B 75  ? 0.9527 0.6802 0.7620 -0.0124 0.1562  -0.0558 72  GLN B N     
2448 C CA    . GLN B 75  ? 0.8911 0.6520 0.6934 -0.0256 0.1373  -0.0524 72  GLN B CA    
2449 C C     . GLN B 75  ? 0.9532 0.7050 0.7252 -0.0492 0.1259  -0.0618 72  GLN B C     
2450 O O     . GLN B 75  ? 0.9301 0.7101 0.6997 -0.0615 0.1081  -0.0581 72  GLN B O     
2451 C CB    . GLN B 75  ? 0.8374 0.6380 0.6815 -0.0164 0.1214  -0.0366 72  GLN B CB    
2452 C CG    . GLN B 75  ? 0.7785 0.5980 0.6536 0.0030  0.1282  -0.0271 72  GLN B CG    
2453 C CD    . GLN B 75  ? 0.9287 0.7566 0.7867 0.0008  0.1344  -0.0285 72  GLN B CD    
2454 O OE1   . GLN B 75  ? 1.2233 1.0236 1.0507 -0.0017 0.1507  -0.0386 72  GLN B OE1   
2455 N NE2   . GLN B 75  ? 0.8765 0.7410 0.7531 0.0019  0.1226  -0.0181 72  GLN B NE2   
2456 N N     . ASN B 76  ? 0.9879 0.7003 0.7397 -0.0555 0.1365  -0.0735 73  ASN B N     
2457 C CA    . ASN B 76  ? 1.0854 0.7851 0.8101 -0.0790 0.1274  -0.0841 73  ASN B CA    
2458 C C     . ASN B 76  ? 1.0221 0.7492 0.7707 -0.0859 0.1072  -0.0745 73  ASN B C     
2459 O O     . ASN B 76  ? 1.0477 0.7813 0.7817 -0.1064 0.0941  -0.0796 73  ASN B O     
2460 C CB    . ASN B 76  ? 1.2215 0.9236 0.9071 -0.0965 0.1225  -0.0942 73  ASN B CB    
2461 C CG    . ASN B 76  ? 1.4604 1.1223 1.1091 -0.0962 0.1448  -0.1092 73  ASN B CG    
2462 O OD1   . ASN B 76  ? 1.5106 1.1410 1.1650 -0.0836 0.1649  -0.1128 73  ASN B OD1   
2463 N ND2   . ASN B 76  ? 1.5866 1.2485 1.1967 -0.1099 0.1417  -0.1177 73  ASN B ND2   
2464 N N     . ILE B 77  ? 0.8594 0.6023 0.6448 -0.0691 0.1050  -0.0608 74  ILE B N     
2465 C CA    . ILE B 77  ? 0.8933 0.6585 0.7006 -0.0738 0.0893  -0.0516 74  ILE B CA    
2466 C C     . ILE B 77  ? 0.9158 0.6496 0.7198 -0.0782 0.0948  -0.0552 74  ILE B C     
2467 O O     . ILE B 77  ? 0.9992 0.7104 0.8121 -0.0631 0.1071  -0.0526 74  ILE B O     
2468 C CB    . ILE B 77  ? 0.7250 0.5207 0.5699 -0.0549 0.0836  -0.0358 74  ILE B CB    
2469 C CG1   . ILE B 77  ? 0.6312 0.4590 0.4827 -0.0513 0.0783  -0.0310 74  ILE B CG1   
2470 C CG2   . ILE B 77  ? 0.6276 0.4409 0.4910 -0.0597 0.0703  -0.0274 74  ILE B CG2   
2471 C CD1   . ILE B 77  ? 0.5854 0.4425 0.4741 -0.0341 0.0732  -0.0173 74  ILE B CD1   
2472 N N     . PRO B 78  ? 0.7886 0.5213 0.5815 -0.0991 0.0858  -0.0604 75  PRO B N     
2473 C CA    . PRO B 78  ? 0.8012 0.5044 0.5912 -0.1058 0.0912  -0.0634 75  PRO B CA    
2474 C C     . PRO B 78  ? 0.7293 0.4408 0.5482 -0.0905 0.0894  -0.0482 75  PRO B C     
2475 O O     . PRO B 78  ? 0.8122 0.5598 0.6526 -0.0853 0.0773  -0.0370 75  PRO B O     
2476 C CB    . PRO B 78  ? 0.7668 0.4819 0.5479 -0.1315 0.0777  -0.0692 75  PRO B CB    
2477 C CG    . PRO B 78  ? 0.8730 0.6099 0.6394 -0.1396 0.0689  -0.0742 75  PRO B CG    
2478 C CD    . PRO B 78  ? 0.7527 0.5125 0.5366 -0.1179 0.0701  -0.0632 75  PRO B CD    
2479 N N     . VAL B 79  ? 0.8563 0.5333 0.6742 -0.0835 0.1016  -0.0476 76  VAL B N     
2480 C CA    . VAL B 79  ? 0.8647 0.5455 0.7047 -0.0692 0.0998  -0.0329 76  VAL B CA    
2481 C C     . VAL B 79  ? 0.8916 0.5380 0.7237 -0.0765 0.1075  -0.0335 76  VAL B C     
2482 O O     . VAL B 79  ? 0.9391 0.5463 0.7562 -0.0772 0.1222  -0.0419 76  VAL B O     
2483 C CB    . VAL B 79  ? 0.8394 0.5187 0.6952 -0.0434 0.1062  -0.0246 76  VAL B CB    
2484 C CG1   . VAL B 79  ? 1.0157 0.6662 0.8568 -0.0391 0.1227  -0.0356 76  VAL B CG1   
2485 C CG2   . VAL B 79  ? 0.7340 0.3992 0.6023 -0.0302 0.1082  -0.0122 76  VAL B CG2   
2486 N N     . ARG B 80  ? 0.7853 0.4454 0.6277 -0.0818 0.0991  -0.0246 77  ARG B N     
2487 C CA    . ARG B 80  ? 0.9272 0.5570 0.7640 -0.0891 0.1066  -0.0230 77  ARG B CA    
2488 C C     . ARG B 80  ? 0.9810 0.6148 0.8322 -0.0732 0.1045  -0.0056 77  ARG B C     
2489 O O     . ARG B 80  ? 0.9870 0.6552 0.8530 -0.0655 0.0929  0.0035  77  ARG B O     
2490 C CB    . ARG B 80  ? 0.9537 0.5916 0.7858 -0.1153 0.1003  -0.0300 77  ARG B CB    
2491 C CG    . ARG B 80  ? 1.0073 0.6390 0.8210 -0.1340 0.1003  -0.0480 77  ARG B CG    
2492 C CD    . ARG B 80  ? 1.0277 0.6760 0.8433 -0.1596 0.0900  -0.0529 77  ARG B CD    
2493 N NE    . ARG B 80  ? 1.1982 0.8205 1.0151 -0.1697 0.0979  -0.0516 77  ARG B NE    
2494 C CZ    . ARG B 80  ? 1.2532 0.8864 1.0774 -0.1914 0.0917  -0.0540 77  ARG B CZ    
2495 N NH1   . ARG B 80  ? 1.2505 0.9211 1.0818 -0.2047 0.0761  -0.0573 77  ARG B NH1   
2496 N NH2   . ARG B 80  ? 1.2132 0.8200 1.0393 -0.1995 0.1015  -0.0521 77  ARG B NH2   
2497 N N     . LEU B 81  ? 0.9575 0.5546 0.8028 -0.0686 0.1159  -0.0009 78  LEU B N     
2498 C CA    . LEU B 81  ? 0.9670 0.5631 0.8203 -0.0543 0.1141  0.0163  78  LEU B CA    
2499 C C     . LEU B 81  ? 0.8699 0.4694 0.7218 -0.0697 0.1120  0.0206  78  LEU B C     
2500 O O     . LEU B 81  ? 0.8426 0.4288 0.6871 -0.0902 0.1172  0.0110  78  LEU B O     
2501 C CB    . LEU B 81  ? 1.0603 0.6152 0.9090 -0.0391 0.1275  0.0222  78  LEU B CB    
2502 C CG    . LEU B 81  ? 1.1237 0.6742 0.9793 -0.0200 0.1316  0.0212  78  LEU B CG    
2503 C CD1   . LEU B 81  ? 1.2428 0.7533 1.0979 -0.0043 0.1447  0.0299  78  LEU B CD1   
2504 C CD2   . LEU B 81  ? 1.0710 0.6625 0.9447 -0.0050 0.1169  0.0297  78  LEU B CD2   
2505 N N     . ILE B 82  ? 0.9183 0.5356 0.7775 -0.0601 0.1048  0.0346  79  ILE B N     
2506 C CA    . ILE B 82  ? 0.9640 0.5842 0.8225 -0.0720 0.1051  0.0407  79  ILE B CA    
2507 C C     . ILE B 82  ? 0.9944 0.5947 0.8462 -0.0567 0.1092  0.0573  79  ILE B C     
2508 O O     . ILE B 82  ? 0.9410 0.5500 0.7957 -0.0368 0.1023  0.0663  79  ILE B O     
2509 C CB    . ILE B 82  ? 0.8945 0.5602 0.7665 -0.0778 0.0922  0.0413  79  ILE B CB    
2510 C CG1   . ILE B 82  ? 0.9543 0.6435 0.8328 -0.0885 0.0854  0.0277  79  ILE B CG1   
2511 C CG2   . ILE B 82  ? 0.7221 0.3897 0.5957 -0.0927 0.0955  0.0456  79  ILE B CG2   
2512 C CD1   . ILE B 82  ? 0.8719 0.6055 0.7665 -0.0936 0.0733  0.0291  79  ILE B CD1   
2513 N N     . ASP B 83  ? 1.1133 0.6869 0.9560 -0.0663 0.1199  0.0618  80  ASP B N     
2514 C CA    . ASP B 83  ? 1.2387 0.7887 1.0705 -0.0522 0.1250  0.0788  80  ASP B CA    
2515 C C     . ASP B 83  ? 1.2516 0.8296 1.0839 -0.0443 0.1146  0.0901  80  ASP B C     
2516 O O     . ASP B 83  ? 1.1830 0.7946 1.0254 -0.0541 0.1074  0.0849  80  ASP B O     
2517 C CB    . ASP B 83  ? 1.4421 0.9546 1.2638 -0.0653 0.1412  0.0811  80  ASP B CB    
2518 C CG    . ASP B 83  ? 1.4932 1.0198 1.3168 -0.0812 0.1427  0.0839  80  ASP B CG    
2519 O OD1   . ASP B 83  ? 1.5754 1.1398 1.4121 -0.0908 0.1331  0.0767  80  ASP B OD1   
2520 O OD2   . ASP B 83  ? 1.4031 0.9025 1.2164 -0.0837 0.1546  0.0942  80  ASP B OD2   
2521 N N     . SER B 84  ? 1.3719 0.9349 1.1925 -0.0267 0.1139  0.1056  81  SER B N     
2522 C CA    . SER B 84  ? 1.3638 0.9494 1.1799 -0.0175 0.1035  0.1158  81  SER B CA    
2523 C C     . SER B 84  ? 1.3036 0.9034 1.1188 -0.0341 0.1072  0.1150  81  SER B C     
2524 O O     . SER B 84  ? 1.2447 0.8797 1.0702 -0.0366 0.0981  0.1108  81  SER B O     
2525 C CB    . SER B 84  ? 1.4976 1.0572 1.2953 0.0007  0.1038  0.1338  81  SER B CB    
2526 O OG    . SER B 84  ? 1.5810 1.1257 1.3836 0.0165  0.1020  0.1361  81  SER B OG    
2527 N N     . SER B 85  ? 1.3796 0.9513 1.1844 -0.0450 0.1220  0.1195  82  SER B N     
2528 C CA    . SER B 85  ? 1.3640 0.9452 1.1689 -0.0598 0.1288  0.1211  82  SER B CA    
2529 C C     . SER B 85  ? 1.2456 0.8679 1.0740 -0.0734 0.1217  0.1082  82  SER B C     
2530 O O     . SER B 85  ? 1.2122 0.8586 1.0443 -0.0748 0.1189  0.1107  82  SER B O     
2531 C CB    . SER B 85  ? 1.4240 0.9703 1.2232 -0.0741 0.1473  0.1235  82  SER B CB    
2532 O OG    . SER B 85  ? 1.4523 0.9914 1.2649 -0.0876 0.1507  0.1096  82  SER B OG    
2533 N N     . ILE B 86  ? 1.0793 0.7084 0.9225 -0.0831 0.1191  0.0948  83  ILE B N     
2534 C CA    . ILE B 86  ? 1.0191 0.6866 0.8843 -0.0960 0.1111  0.0837  83  ILE B CA    
2535 C C     . ILE B 86  ? 0.9313 0.6325 0.8037 -0.0821 0.0964  0.0835  83  ILE B C     
2536 O O     . ILE B 86  ? 0.9469 0.6800 0.8335 -0.0872 0.0917  0.0822  83  ILE B O     
2537 C CB    . ILE B 86  ? 1.0261 0.6906 0.9002 -0.1101 0.1108  0.0692  83  ILE B CB    
2538 C CG1   . ILE B 86  ? 1.1146 0.7611 0.9920 -0.1319 0.1230  0.0661  83  ILE B CG1   
2539 C CG2   . ILE B 86  ? 0.9073 0.6135 0.8001 -0.1154 0.0976  0.0598  83  ILE B CG2   
2540 C CD1   . ILE B 86  ? 1.1680 0.7703 1.0276 -0.1285 0.1385  0.0759  83  ILE B CD1   
2541 N N     . VAL B 87  ? 0.9198 0.6135 0.7851 -0.0646 0.0901  0.0851  84  VAL B N     
2542 C CA    . VAL B 87  ? 0.9475 0.6708 0.8211 -0.0509 0.0766  0.0852  84  VAL B CA    
2543 C C     . VAL B 87  ? 0.9969 0.7307 0.8638 -0.0442 0.0741  0.0947  84  VAL B C     
2544 O O     . VAL B 87  ? 0.9026 0.6681 0.7819 -0.0431 0.0662  0.0922  84  VAL B O     
2545 C CB    . VAL B 87  ? 0.9507 0.6616 0.8202 -0.0327 0.0716  0.0868  84  VAL B CB    
2546 C CG1   . VAL B 87  ? 0.8468 0.5883 0.7271 -0.0192 0.0578  0.0875  84  VAL B CG1   
2547 C CG2   . VAL B 87  ? 0.8729 0.5731 0.7474 -0.0390 0.0757  0.0757  84  VAL B CG2   
2548 N N     . ASN B 88  ? 1.0849 0.7901 0.9305 -0.0399 0.0818  0.1056  85  ASN B N     
2549 C CA    . ASN B 88  ? 1.0899 0.7991 0.9219 -0.0347 0.0815  0.1145  85  ASN B CA    
2550 C C     . ASN B 88  ? 0.9568 0.6851 0.8002 -0.0507 0.0887  0.1111  85  ASN B C     
2551 O O     . ASN B 88  ? 0.8708 0.6186 0.7145 -0.0478 0.0856  0.1124  85  ASN B O     
2552 C CB    . ASN B 88  ? 1.3013 0.9722 1.1047 -0.0276 0.0897  0.1280  85  ASN B CB    
2553 C CG    . ASN B 88  ? 1.4196 1.0740 1.2139 -0.0090 0.0813  0.1342  85  ASN B CG    
2554 O OD1   . ASN B 88  ? 1.4436 1.0646 1.2184 -0.0025 0.0876  0.1454  85  ASN B OD1   
2555 N ND2   . ASN B 88  ? 1.4351 1.1133 1.2457 0.0001  0.0675  0.1280  85  ASN B ND2   
2556 N N     . GLN B 89  ? 0.9845 0.7070 0.8388 -0.0678 0.0987  0.1065  86  GLN B N     
2557 C CA    . GLN B 89  ? 1.0571 0.8006 0.9298 -0.0841 0.1052  0.1033  86  GLN B CA    
2558 C C     . GLN B 89  ? 1.0787 0.8634 0.9743 -0.0829 0.0930  0.0960  86  GLN B C     
2559 O O     . GLN B 89  ? 1.1523 0.9573 1.0560 -0.0840 0.0947  0.0976  86  GLN B O     
2560 C CB    . GLN B 89  ? 1.1970 0.9315 1.0828 -0.1031 0.1134  0.0974  86  GLN B CB    
2561 C CG    . GLN B 89  ? 1.3641 1.1076 1.2653 -0.1201 0.1252  0.0989  86  GLN B CG    
2562 C CD    . GLN B 89  ? 1.5017 1.2123 1.3818 -0.1203 0.1423  0.1101  86  GLN B CD    
2563 O OE1   . GLN B 89  ? 1.5364 1.2224 1.3877 -0.1051 0.1431  0.1187  86  GLN B OE1   
2564 N NE2   . GLN B 89  ? 1.4931 1.2033 1.3882 -0.1374 0.1560  0.1111  86  GLN B NE2   
2565 N N     . LEU B 90  ? 0.9738 0.7690 0.8794 -0.0804 0.0823  0.0883  87  LEU B N     
2566 C CA    . LEU B 90  ? 0.9098 0.7414 0.8355 -0.0772 0.0706  0.0826  87  LEU B CA    
2567 C C     . LEU B 90  ? 1.1039 0.9410 1.0202 -0.0592 0.0631  0.0869  87  LEU B C     
2568 O O     . LEU B 90  ? 1.3092 1.1218 1.2024 -0.0485 0.0642  0.0938  87  LEU B O     
2569 C CB    . LEU B 90  ? 0.8757 0.7121 0.8097 -0.0788 0.0630  0.0739  87  LEU B CB    
2570 C CG    . LEU B 90  ? 0.9422 0.7841 0.8893 -0.0982 0.0649  0.0663  87  LEU B CG    
2571 C CD1   . LEU B 90  ? 0.9363 0.7547 0.8776 -0.1117 0.0777  0.0689  87  LEU B CD1   
2572 C CD2   . LEU B 90  ? 0.9408 0.7737 0.8831 -0.0971 0.0601  0.0580  87  LEU B CD2   
2573 N N     . PHE B 91  ? 1.1618 1.0309 1.0963 -0.0563 0.0550  0.0832  88  PHE B N     
2574 C CA    . PHE B 91  ? 1.2957 1.1729 1.2252 -0.0409 0.0465  0.0851  88  PHE B CA    
2575 C C     . PHE B 91  ? 1.4417 1.3050 1.3494 -0.0370 0.0524  0.0921  88  PHE B C     
2576 O O     . PHE B 91  ? 1.4277 1.2889 1.3348 -0.0472 0.0640  0.0943  88  PHE B O     
2577 C CB    . PHE B 91  ? 1.2025 1.0676 1.1242 -0.0274 0.0378  0.0851  88  PHE B CB    
2578 C CG    . PHE B 91  ? 1.0633 0.9349 0.9998 -0.0310 0.0352  0.0782  88  PHE B CG    
2579 C CD1   . PHE B 91  ? 0.9670 0.8691 0.9258 -0.0316 0.0284  0.0723  88  PHE B CD1   
2580 C CD2   . PHE B 91  ? 0.9521 0.7972 0.8782 -0.0340 0.0405  0.0774  88  PHE B CD2   
2581 C CE1   . PHE B 91  ? 0.9508 0.8570 0.9182 -0.0351 0.0267  0.0661  88  PHE B CE1   
2582 C CE2   . PHE B 91  ? 1.0059 0.8543 0.9412 -0.0380 0.0392  0.0697  88  PHE B CE2   
2583 C CZ    . PHE B 91  ? 0.9589 0.8380 0.9133 -0.0386 0.0321  0.0642  88  PHE B CZ    
2584 N N     . LYS B 92  ? 1.5841 1.4383 1.4742 -0.0224 0.0441  0.0957  89  LYS B N     
2585 C CA    . LYS B 92  ? 1.6999 1.5398 1.5633 -0.0175 0.0472  0.1021  89  LYS B CA    
2586 C C     . LYS B 92  ? 1.7197 1.5836 1.5936 -0.0205 0.0487  0.0975  89  LYS B C     
2587 O O     . LYS B 92  ? 1.6349 1.5187 1.5339 -0.0311 0.0550  0.0931  89  LYS B O     
2588 C CB    . LYS B 92  ? 1.7475 1.5579 1.5901 -0.0253 0.0625  0.1095  89  LYS B CB    
2589 C CG    . LYS B 92  ? 1.7881 1.5699 1.5924 -0.0157 0.0632  0.1196  89  LYS B CG    
2590 C CD    . LYS B 92  ? 1.7528 1.5335 1.5407 -0.0199 0.0735  0.1215  89  LYS B CD    
2591 C CE    . LYS B 92  ? 1.7374 1.5113 1.5327 -0.0355 0.0936  0.1230  89  LYS B CE    
2592 N NZ    . LYS B 92  ? 1.7711 1.5134 1.5526 -0.0381 0.1017  0.1309  89  LYS B NZ    
2593 N N     . GLY B 93  ? 1.8580 1.7196 1.7131 -0.0114 0.0427  0.0985  90  GLY B N     
2594 C CA    . GLY B 93  ? 2.0112 1.8494 1.8353 0.0005  0.0343  0.1055  90  GLY B CA    
2595 C C     . GLY B 93  ? 2.0996 1.9495 1.9320 0.0135  0.0151  0.1032  90  GLY B C     
2596 O O     . GLY B 93  ? 2.1487 1.9885 1.9582 0.0235  0.0048  0.1075  90  GLY B O     
2597 N N     . GLU B 94  ? 2.1012 1.9724 1.9663 0.0132  0.0100  0.0969  91  GLU B N     
2598 C CA    . GLU B 94  ? 2.1011 1.9813 1.9780 0.0255  -0.0057 0.0957  91  GLU B CA    
2599 C C     . GLU B 94  ? 2.0995 1.9556 1.9665 0.0319  -0.0065 0.1032  91  GLU B C     
2600 O O     . GLU B 94  ? 2.0613 1.9229 1.9458 0.0396  -0.0138 0.1022  91  GLU B O     
2601 C CB    . GLU B 94  ? 2.0644 1.9739 1.9780 0.0232  -0.0085 0.0871  91  GLU B CB    
2602 C CG    . GLU B 94  ? 2.0414 1.9645 1.9712 0.0355  -0.0235 0.0851  91  GLU B CG    
2603 C CD    . GLU B 94  ? 1.9838 1.9333 1.9481 0.0333  -0.0238 0.0779  91  GLU B CD    
2604 O OE1   . GLU B 94  ? 1.9593 1.9213 1.9413 0.0425  -0.0339 0.0760  91  GLU B OE1   
2605 O OE2   . GLU B 94  ? 1.9385 1.8965 1.9128 0.0224  -0.0142 0.0748  91  GLU B OE2   
2606 N N     . ARG B 95  ? 2.1020 1.9301 1.9417 0.0289  0.0030  0.1112  92  ARG B N     
2607 C CA    . ARG B 95  ? 2.0369 1.8373 1.8654 0.0342  0.0054  0.1194  92  ARG B CA    
2608 C C     . ARG B 95  ? 1.9212 1.7214 1.7707 0.0264  0.0140  0.1139  92  ARG B C     
2609 O O     . ARG B 95  ? 1.8792 1.6651 1.7231 0.0146  0.0276  0.1141  92  ARG B O     
2610 C CB    . ARG B 95  ? 2.0062 1.8044 1.8338 0.0514  -0.0107 0.1252  92  ARG B CB    
2611 C CG    . ARG B 95  ? 1.9983 1.7949 1.8015 0.0593  -0.0225 0.1309  92  ARG B CG    
2612 C CD    . ARG B 95  ? 1.9960 1.7945 1.8054 0.0759  -0.0406 0.1369  92  ARG B CD    
2613 N NE    . ARG B 95  ? 1.9171 1.7411 1.7658 0.0790  -0.0464 0.1283  92  ARG B NE    
2614 C CZ    . ARG B 95  ? 1.8405 1.6690 1.7071 0.0925  -0.0582 0.1321  92  ARG B CZ    
2615 N NH1   . ARG B 95  ? 1.8485 1.6589 1.6984 0.1046  -0.0673 0.1450  92  ARG B NH1   
2616 N NH2   . ARG B 95  ? 1.7781 1.6291 1.6802 0.0942  -0.0604 0.1239  92  ARG B NH2   
2617 N N     . LYS B 96  ? 1.8367 1.6526 1.7099 0.0325  0.0062  0.1084  93  LYS B N     
2618 C CA    . LYS B 96  ? 1.7733 1.5844 1.6607 0.0273  0.0133  0.1032  93  LYS B CA    
2619 C C     . LYS B 96  ? 1.5724 1.4113 1.4878 0.0302  0.0064  0.0946  93  LYS B C     
2620 O O     . LYS B 96  ? 1.5815 1.4359 1.5072 0.0415  -0.0051 0.0953  93  LYS B O     
2621 C CB    . LYS B 96  ? 1.8557 1.6358 1.7321 0.0371  0.0156  0.1109  93  LYS B CB    
2622 C CG    . LYS B 96  ? 1.8535 1.6396 1.7397 0.0554  0.0023  0.1151  93  LYS B CG    
2623 C CD    . LYS B 96  ? 1.8694 1.6275 1.7354 0.0678  -0.0002 0.1290  93  LYS B CD    
2624 C CE    . LYS B 96  ? 1.8470 1.6138 1.7295 0.0860  -0.0142 0.1336  93  LYS B CE    
2625 N NZ    . LYS B 96  ? 1.8083 1.6098 1.7065 0.0883  -0.0285 0.1279  93  LYS B NZ    
2626 N N     . ALA B 97  ? 1.3591 1.2040 1.2865 0.0193  0.0133  0.0868  94  ALA B N     
2627 C CA    . ALA B 97  ? 1.2072 1.0716 1.1568 0.0225  0.0094  0.0798  94  ALA B CA    
2628 C C     . ALA B 97  ? 1.1968 1.0391 1.1452 0.0320  0.0123  0.0811  94  ALA B C     
2629 O O     . ALA B 97  ? 1.2809 1.1333 1.2458 0.0425  0.0078  0.0795  94  ALA B O     
2630 C CB    . ALA B 97  ? 1.1319 1.0107 1.0908 0.0070  0.0147  0.0717  94  ALA B CB    
2631 N N     . LYS B 98  ? 0.9622 0.7731 0.8925 0.0283  0.0214  0.0844  95  LYS B N     
2632 C CA    . LYS B 98  ? 1.0187 0.8025 0.9461 0.0371  0.0271  0.0865  95  LYS B CA    
2633 C C     . LYS B 98  ? 0.9873 0.7727 0.9250 0.0321  0.0337  0.0756  95  LYS B C     
2634 O O     . LYS B 98  ? 0.9859 0.7438 0.9169 0.0321  0.0438  0.0734  95  LYS B O     
2635 C CB    . LYS B 98  ? 1.0239 0.8088 0.9588 0.0574  0.0173  0.0954  95  LYS B CB    
2636 C CG    . LYS B 98  ? 1.2055 0.9559 1.1258 0.0670  0.0214  0.1064  95  LYS B CG    
2637 C CD    . LYS B 98  ? 1.3199 1.0529 1.2143 0.0581  0.0256  0.1126  95  LYS B CD    
2638 C CE    . LYS B 98  ? 1.3585 1.0615 1.2368 0.0708  0.0257  0.1274  95  LYS B CE    
2639 N NZ    . LYS B 98  ? 1.3177 0.9842 1.1886 0.0680  0.0415  0.1283  95  LYS B NZ    
2640 N N     . THR B 99  ? 0.8679 0.6841 0.8205 0.0276  0.0287  0.0687  96  THR B N     
2641 C CA    . THR B 99  ? 0.7758 0.5962 0.7341 0.0212  0.0343  0.0585  96  THR B CA    
2642 C C     . THR B 99  ? 0.7219 0.5754 0.6900 0.0103  0.0287  0.0536  96  THR B C     
2643 O O     . THR B 99  ? 0.7906 0.6683 0.7708 0.0151  0.0201  0.0575  96  THR B O     
2644 C CB    . THR B 99  ? 0.8051 0.6262 0.7782 0.0370  0.0350  0.0582  96  THR B CB    
2645 O OG1   . THR B 99  ? 0.9961 0.7879 0.9643 0.0490  0.0398  0.0647  96  THR B OG1   
2646 C CG2   . THR B 99  ? 0.8535 0.6738 0.8262 0.0299  0.0433  0.0474  96  THR B CG2   
2647 N N     . PHE B 100 ? 0.5452 0.3991 0.5079 -0.0044 0.0333  0.0453  97  PHE B N     
2648 C CA    . PHE B 100 ? 0.5305 0.4154 0.5030 -0.0152 0.0278  0.0422  97  PHE B CA    
2649 C C     . PHE B 100 ? 0.6170 0.4990 0.5812 -0.0289 0.0317  0.0328  97  PHE B C     
2650 O O     . PHE B 100 ? 0.6314 0.4845 0.5793 -0.0336 0.0397  0.0275  97  PHE B O     
2651 C CB    . PHE B 100 ? 0.4788 0.3722 0.4511 -0.0245 0.0251  0.0466  97  PHE B CB    
2652 C CG    . PHE B 100 ? 0.7544 0.6203 0.7096 -0.0356 0.0326  0.0462  97  PHE B CG    
2653 C CD1   . PHE B 100 ? 0.7961 0.6352 0.7392 -0.0276 0.0368  0.0526  97  PHE B CD1   
2654 C CD2   . PHE B 100 ? 0.7234 0.5902 0.6756 -0.0543 0.0349  0.0400  97  PHE B CD2   
2655 C CE1   . PHE B 100 ? 0.6909 0.5030 0.6193 -0.0379 0.0453  0.0530  97  PHE B CE1   
2656 C CE2   . PHE B 100 ? 0.7260 0.5673 0.6654 -0.0656 0.0423  0.0391  97  PHE B CE2   
2657 C CZ    . PHE B 100 ? 0.6689 0.4819 0.5964 -0.0573 0.0486  0.0457  97  PHE B CZ    
2658 N N     . GLY B 101 ? 0.5240 0.4349 0.4983 -0.0355 0.0260  0.0310  98  GLY B N     
2659 C CA    . GLY B 101 ? 0.4934 0.4049 0.4576 -0.0492 0.0269  0.0227  98  GLY B CA    
2660 C C     . GLY B 101 ? 0.4626 0.4060 0.4381 -0.0614 0.0184  0.0242  98  GLY B C     
2661 O O     . GLY B 101 ? 0.4533 0.4221 0.4480 -0.0559 0.0131  0.0311  98  GLY B O     
2662 N N     . ILE B 102 ? 0.4938 0.4355 0.4576 -0.0782 0.0169  0.0176  99  ILE B N     
2663 C CA    . ILE B 102 ? 0.5340 0.5073 0.5097 -0.0901 0.0075  0.0198  99  ILE B CA    
2664 C C     . ILE B 102 ? 0.5927 0.5806 0.5656 -0.0874 0.0043  0.0180  99  ILE B C     
2665 O O     . ILE B 102 ? 0.5989 0.5686 0.5494 -0.0918 0.0078  0.0096  99  ILE B O     
2666 C CB    . ILE B 102 ? 0.6176 0.5845 0.5845 -0.1115 0.0051  0.0143  99  ILE B CB    
2667 C CG1   . ILE B 102 ? 0.6866 0.6352 0.6548 -0.1144 0.0110  0.0165  99  ILE B CG1   
2668 C CG2   . ILE B 102 ? 0.4675 0.4704 0.4512 -0.1228 -0.0063 0.0184  99  ILE B CG2   
2669 C CD1   . ILE B 102 ? 0.7540 0.6942 0.7169 -0.1360 0.0102  0.0110  99  ILE B CD1   
2670 N N     . ALA B 103 ? 0.4941 0.5128 0.4886 -0.0802 -0.0011 0.0259  100 ALA B N     
2671 C CA    . ALA B 103 ? 0.5394 0.5726 0.5329 -0.0760 -0.0029 0.0266  100 ALA B CA    
2672 C C     . ALA B 103 ? 0.5655 0.6322 0.5728 -0.0852 -0.0135 0.0328  100 ALA B C     
2673 O O     . ALA B 103 ? 0.6646 0.7508 0.6945 -0.0873 -0.0179 0.0396  100 ALA B O     
2674 C CB    . ALA B 103 ? 0.4601 0.4980 0.4688 -0.0564 0.0019  0.0311  100 ALA B CB    
2675 N N     . ARG B 104 ? 0.6716 0.5402 0.6710 -0.2306 -0.1198 0.1715  101 ARG B N     
2676 C CA    . ARG B 104 ? 0.6051 0.5376 0.6262 -0.2362 -0.1091 0.1823  101 ARG B CA    
2677 C C     . ARG B 104 ? 0.4921 0.4639 0.5416 -0.2049 -0.0863 0.1780  101 ARG B C     
2678 O O     . ARG B 104 ? 0.5458 0.4964 0.5914 -0.1803 -0.0794 0.1569  101 ARG B O     
2679 C CB    . ARG B 104 ? 0.6441 0.5664 0.6474 -0.2457 -0.1166 0.1685  101 ARG B CB    
2680 C CG    . ARG B 104 ? 0.7791 0.6473 0.7460 -0.2742 -0.1403 0.1643  101 ARG B CG    
2681 C CD    . ARG B 104 ? 0.9430 0.8162 0.8929 -0.2888 -0.1459 0.1543  101 ARG B CD    
2682 N NE    . ARG B 104 ? 1.1971 1.0017 1.1039 -0.3053 -0.1651 0.1349  101 ARG B NE    
2683 C CZ    . ARG B 104 ? 1.4752 1.2123 1.3614 -0.2897 -0.1705 0.1121  101 ARG B CZ    
2684 N NH1   . ARG B 104 ? 1.5642 1.2961 1.4693 -0.2587 -0.1590 0.1076  101 ARG B NH1   
2685 N NH2   . ARG B 104 ? 1.5512 1.2244 1.3982 -0.3049 -0.1885 0.0932  101 ARG B NH2   
2686 N N     . VAL B 105 ? 0.5796 0.6090 0.6583 -0.2058 -0.0747 0.1974  102 VAL B N     
2687 C CA    . VAL B 105 ? 0.5017 0.5652 0.6064 -0.1778 -0.0546 0.1936  102 VAL B CA    
2688 C C     . VAL B 105 ? 0.3672 0.4379 0.4741 -0.1666 -0.0513 0.1806  102 VAL B C     
2689 O O     . VAL B 105 ? 0.5538 0.6492 0.6651 -0.1819 -0.0573 0.1891  102 VAL B O     
2690 C CB    . VAL B 105 ? 0.4809 0.6054 0.6179 -0.1802 -0.0430 0.2147  102 VAL B CB    
2691 C CG1   . VAL B 105 ? 0.3100 0.4659 0.4734 -0.1529 -0.0256 0.2095  102 VAL B CG1   
2692 C CG2   . VAL B 105 ? 0.4564 0.5798 0.5907 -0.1865 -0.0403 0.2245  102 VAL B CG2   
2693 N N     . PRO B 106 ? 0.4769 0.5288 0.5802 -0.1421 -0.0430 0.1617  103 PRO B N     
2694 C CA    . PRO B 106 ? 0.4351 0.4940 0.5367 -0.1333 -0.0397 0.1489  103 PRO B CA    
2695 C C     . PRO B 106 ? 0.3636 0.4746 0.4945 -0.1299 -0.0318 0.1639  103 PRO B C     
2696 O O     . PRO B 106 ? 0.3121 0.4517 0.4678 -0.1251 -0.0243 0.1785  103 PRO B O     
2697 C CB    . PRO B 106 ? 0.3792 0.4150 0.4771 -0.1076 -0.0308 0.1301  103 PRO B CB    
2698 C CG    . PRO B 106 ? 0.5258 0.5281 0.6149 -0.1066 -0.0354 0.1302  103 PRO B CG    
2699 C CD    . PRO B 106 ? 0.3520 0.3784 0.4523 -0.1239 -0.0372 0.1533  103 PRO B CD    
2700 N N     . ARG B 107 ? 0.3086 0.4317 0.4364 -0.1327 -0.0341 0.1600  104 ARG B N     
2701 C CA    . ARG B 107 ? 0.4545 0.6208 0.6103 -0.1272 -0.0294 0.1742  104 ARG B CA    
2702 C C     . ARG B 107 ? 0.3954 0.5642 0.5678 -0.1007 -0.0152 0.1697  104 ARG B C     
2703 O O     . ARG B 107 ? 0.3700 0.5094 0.5279 -0.0883 -0.0101 0.1533  104 ARG B O     
2704 C CB    . ARG B 107 ? 0.4698 0.6432 0.6123 -0.1369 -0.0360 0.1699  104 ARG B CB    
2705 C CG    . ARG B 107 ? 0.3976 0.5441 0.5164 -0.1254 -0.0305 0.1450  104 ARG B CG    
2706 C CD    . ARG B 107 ? 0.4221 0.5901 0.5357 -0.1311 -0.0322 0.1448  104 ARG B CD    
2707 N NE    . ARG B 107 ? 0.3065 0.4555 0.3970 -0.1220 -0.0254 0.1198  104 ARG B NE    
2708 C CZ    . ARG B 107 ? 0.3418 0.4889 0.4416 -0.1007 -0.0145 0.1121  104 ARG B CZ    
2709 N NH1   . ARG B 107 ? 0.2976 0.4546 0.4249 -0.0869 -0.0094 0.1259  104 ARG B NH1   
2710 N NH2   . ARG B 107 ? 0.2979 0.4349 0.3794 -0.0935 -0.0084 0.0900  104 ARG B NH2   
2711 N N     . PRO B 108 ? 0.4269 0.6294 0.6304 -0.0917 -0.0099 0.1843  105 PRO B N     
2712 C CA    . PRO B 108 ? 0.3051 0.5070 0.5223 -0.0684 0.0021  0.1798  105 PRO B CA    
2713 C C     . PRO B 108 ? 0.3726 0.5557 0.5716 -0.0615 0.0028  0.1645  105 PRO B C     
2714 O O     . PRO B 108 ? 0.3681 0.5566 0.5562 -0.0726 -0.0044 0.1636  105 PRO B O     
2715 C CB    . PRO B 108 ? 0.3098 0.5483 0.5616 -0.0634 0.0023  0.1980  105 PRO B CB    
2716 C CG    . PRO B 108 ? 0.2755 0.5400 0.5391 -0.0809 -0.0052 0.2140  105 PRO B CG    
2717 C CD    . PRO B 108 ? 0.3024 0.5447 0.5317 -0.1027 -0.0163 0.2063  105 PRO B CD    
2718 N N     . ALA B 109 ? 0.2704 0.4353 0.4656 -0.0454 0.0115  0.1533  106 ALA B N     
2719 C CA    . ALA B 109 ? 0.2763 0.4298 0.4578 -0.0388 0.0132  0.1398  106 ALA B CA    
2720 C C     . ALA B 109 ? 0.3559 0.5299 0.5512 -0.0363 0.0125  0.1490  106 ALA B C     
2721 O O     . ALA B 109 ? 0.1825 0.3704 0.4011 -0.0308 0.0135  0.1627  106 ALA B O     
2722 C CB    . ALA B 109 ? 0.1921 0.3238 0.3680 -0.0242 0.0204  0.1285  106 ALA B CB    
2723 N N     . ARG B 110 ? 0.3767 0.5526 0.5577 -0.0405 0.0106  0.1414  107 ARG B N     
2724 C CA    . ARG B 110 ? 0.2318 0.4259 0.4213 -0.0433 0.0069  0.1523  107 ARG B CA    
2725 C C     . ARG B 110 ? 0.2892 0.4790 0.4688 -0.0369 0.0117  0.1417  107 ARG B C     
2726 O O     . ARG B 110 ? 0.3098 0.4860 0.4767 -0.0302 0.0177  0.1248  107 ARG B O     
2727 C CB    . ARG B 110 ? 0.2470 0.4606 0.4274 -0.0638 -0.0031 0.1596  107 ARG B CB    
2728 C CG    . ARG B 110 ? 0.2847 0.5093 0.4773 -0.0736 -0.0107 0.1741  107 ARG B CG    
2729 C CD    . ARG B 110 ? 0.4179 0.6638 0.6006 -0.0964 -0.0229 0.1843  107 ARG B CD    
2730 N NE    . ARG B 110 ? 0.4273 0.6645 0.5743 -0.1091 -0.0221 0.1643  107 ARG B NE    
2731 C CZ    . ARG B 110 ? 0.4459 0.6764 0.5752 -0.1239 -0.0273 0.1584  107 ARG B CZ    
2732 N NH1   . ARG B 110 ? 0.3397 0.5762 0.4849 -0.1303 -0.0343 0.1740  107 ARG B NH1   
2733 N NH2   . ARG B 110 ? 0.4649 0.6833 0.5605 -0.1326 -0.0255 0.1363  107 ARG B NH2   
2734 N N     . PHE B 111 ? 0.1760 0.3780 0.3630 -0.0399 0.0075  0.1534  108 PHE B N     
2735 C CA    . PHE B 111 ? 0.1750 0.3792 0.3532 -0.0386 0.0104  0.1470  108 PHE B CA    
2736 C C     . PHE B 111 ? 0.2414 0.4583 0.3974 -0.0473 0.0135  0.1311  108 PHE B C     
2737 O O     . PHE B 111 ? 0.2283 0.4465 0.3777 -0.0410 0.0201  0.1181  108 PHE B O     
2738 C CB    . PHE B 111 ? 0.1963 0.4112 0.3836 -0.0461 0.0015  0.1659  108 PHE B CB    
2739 C CG    . PHE B 111 ? 0.3107 0.5090 0.5204 -0.0335 -0.0007 0.1776  108 PHE B CG    
2740 C CD1   . PHE B 111 ? 0.1654 0.3424 0.3786 -0.0170 0.0083  0.1673  108 PHE B CD1   
2741 C CD2   . PHE B 111 ? 0.1791 0.3829 0.4061 -0.0379 -0.0123 0.1983  108 PHE B CD2   
2742 C CE1   . PHE B 111 ? 0.1670 0.3286 0.3978 -0.0047 0.0084  0.1740  108 PHE B CE1   
2743 C CE2   . PHE B 111 ? 0.2298 0.4166 0.4793 -0.0227 -0.0132 0.2057  108 PHE B CE2   
2744 C CZ    . PHE B 111 ? 0.2661 0.4318 0.5160 -0.0058 -0.0016 0.1918  108 PHE B CZ    
2745 N N     . GLY B 112 ? 0.2000 0.4279 0.3449 -0.0619 0.0089  0.1314  109 GLY B N     
2746 C CA    . GLY B 112 ? 0.3163 0.5557 0.4371 -0.0707 0.0130  0.1131  109 GLY B CA    
2747 C C     . GLY B 112 ? 0.3021 0.5204 0.4162 -0.0549 0.0218  0.0890  109 GLY B C     
2748 O O     . GLY B 112 ? 0.3741 0.6012 0.4755 -0.0522 0.0290  0.0699  109 GLY B O     
2749 N N     . ASP B 113 ? 0.2874 0.4794 0.4111 -0.0445 0.0209  0.0906  110 ASP B N     
2750 C CA    . ASP B 113 ? 0.3228 0.4895 0.4419 -0.0305 0.0254  0.0723  110 ASP B CA    
2751 C C     . ASP B 113 ? 0.3696 0.5369 0.4979 -0.0145 0.0318  0.0669  110 ASP B C     
2752 O O     . ASP B 113 ? 0.3009 0.4572 0.4261 -0.0024 0.0355  0.0499  110 ASP B O     
2753 C CB    . ASP B 113 ? 0.2247 0.3671 0.3503 -0.0286 0.0211  0.0800  110 ASP B CB    
2754 C CG    . ASP B 113 ? 0.4006 0.5444 0.5181 -0.0462 0.0133  0.0865  110 ASP B CG    
2755 O OD1   . ASP B 113 ? 0.3612 0.5108 0.4595 -0.0578 0.0113  0.0760  110 ASP B OD1   
2756 O OD2   . ASP B 113 ? 0.3983 0.5401 0.5281 -0.0496 0.0094  0.1018  110 ASP B OD2   
2757 N N     . ILE B 114 ? 0.3168 0.4957 0.4574 -0.0147 0.0315  0.0820  111 ILE B N     
2758 C CA    . ILE B 114 ? 0.1837 0.3647 0.3318 -0.0038 0.0354  0.0800  111 ILE B CA    
2759 C C     . ILE B 114 ? 0.3200 0.5327 0.4633 -0.0094 0.0389  0.0744  111 ILE B C     
2760 O O     . ILE B 114 ? 0.3350 0.5559 0.4816 0.0004  0.0439  0.0637  111 ILE B O     
2761 C CB    . ILE B 114 ? 0.2569 0.4306 0.4169 -0.0026 0.0328  0.0972  111 ILE B CB    
2762 C CG1   . ILE B 114 ? 0.1870 0.3360 0.3522 0.0039  0.0325  0.1007  111 ILE B CG1   
2763 C CG2   . ILE B 114 ? 0.2353 0.4121 0.3988 0.0035  0.0347  0.0961  111 ILE B CG2   
2764 C CD1   . ILE B 114 ? 0.1954 0.3360 0.3711 0.0079  0.0326  0.1124  111 ILE B CD1   
2765 N N     . ALA B 115 ? 0.2948 0.5292 0.4314 -0.0264 0.0358  0.0834  112 ALA B N     
2766 C CA    . ALA B 115 ? 0.4398 0.7105 0.5696 -0.0370 0.0388  0.0814  112 ALA B CA    
2767 C C     . ALA B 115 ? 0.4643 0.7506 0.5833 -0.0316 0.0487  0.0556  112 ALA B C     
2768 O O     . ALA B 115 ? 0.5324 0.8486 0.6531 -0.0299 0.0558  0.0476  112 ALA B O     
2769 C CB    . ALA B 115 ? 0.2037 0.4926 0.3261 -0.0595 0.0308  0.0990  112 ALA B CB    
2770 N N     . SER B 116 ? 0.3850 0.6512 0.4937 -0.0287 0.0491  0.0421  113 SER B N     
2771 C CA    . SER B 116 ? 0.4356 0.7085 0.5321 -0.0218 0.0580  0.0141  113 SER B CA    
2772 C C     . SER B 116 ? 0.5517 0.8073 0.6628 0.0040  0.0625  -0.0012 113 SER B C     
2773 O O     . SER B 116 ? 0.6307 0.8921 0.7385 0.0160  0.0705  -0.0260 113 SER B O     
2774 C CB    . SER B 116 ? 0.3692 0.6209 0.4457 -0.0309 0.0541  0.0053  113 SER B CB    
2775 O OG    . SER B 116 ? 0.5097 0.7192 0.5928 -0.0224 0.0468  0.0099  113 SER B OG    
2776 N N     . ARG B 117 ? 0.3839 0.6182 0.5110 0.0127  0.0570  0.0133  114 ARG B N     
2777 C CA    . ARG B 117 ? 0.4507 0.6700 0.5926 0.0344  0.0580  0.0044  114 ARG B CA    
2778 C C     . ARG B 117 ? 0.4810 0.7315 0.6385 0.0376  0.0610  0.0118  114 ARG B C     
2779 O O     . ARG B 117 ? 0.6131 0.8867 0.7692 0.0222  0.0601  0.0273  114 ARG B O     
2780 C CB    . ARG B 117 ? 0.3524 0.5286 0.4979 0.0392  0.0493  0.0151  114 ARG B CB    
2781 C CG    . ARG B 117 ? 0.3509 0.4931 0.4836 0.0389  0.0447  0.0056  114 ARG B CG    
2782 C CD    . ARG B 117 ? 0.3354 0.4465 0.4696 0.0353  0.0366  0.0221  114 ARG B CD    
2783 N NE    . ARG B 117 ? 0.5797 0.6777 0.7265 0.0478  0.0341  0.0277  114 ARG B NE    
2784 C CZ    . ARG B 117 ? 0.6989 0.7664 0.8468 0.0584  0.0280  0.0220  114 ARG B CZ    
2785 N NH1   . ARG B 117 ? 0.7975 0.8401 0.9348 0.0592  0.0236  0.0092  114 ARG B NH1   
2786 N NH2   . ARG B 117 ? 0.5893 0.6487 0.7472 0.0666  0.0243  0.0301  114 ARG B NH2   
2787 N N     . ARG B 118 ? 0.6095 0.8601 0.7824 0.0566  0.0625  0.0023  115 ARG B N     
2788 C CA    . ARG B 118 ? 0.5079 0.7905 0.6973 0.0590  0.0640  0.0098  115 ARG B CA    
2789 C C     . ARG B 118 ? 0.4311 0.6856 0.6307 0.0664  0.0549  0.0228  115 ARG B C     
2790 O O     . ARG B 118 ? 0.5159 0.7334 0.7159 0.0776  0.0497  0.0190  115 ARG B O     
2791 C CB    . ARG B 118 ? 0.4767 0.7964 0.6799 0.0742  0.0736  -0.0108 115 ARG B CB    
2792 C CG    . ARG B 118 ? 0.5279 0.8935 0.7201 0.0617  0.0850  -0.0210 115 ARG B CG    
2793 C CD    . ARG B 118 ? 0.6576 1.0555 0.8626 0.0815  0.0975  -0.0486 115 ARG B CD    
2794 N NE    . ARG B 118 ? 0.7996 1.1573 0.9966 0.0979  0.0983  -0.0719 115 ARG B NE    
2795 C CZ    . ARG B 118 ? 0.9084 1.2748 1.1176 0.1221  0.1069  -0.0998 115 ARG B CZ    
2796 N NH1   . ARG B 118 ? 0.9809 1.4026 1.2146 0.1341  0.1172  -0.1075 115 ARG B NH1   
2797 N NH2   . ARG B 118 ? 1.0035 1.3235 1.2017 0.1347  0.1046  -0.1201 115 ARG B NH2   
2798 N N     . GLY B 119 ? 0.3195 0.5902 0.5241 0.0574  0.0519  0.0388  116 GLY B N     
2799 C CA    . GLY B 119 ? 0.2536 0.4996 0.4625 0.0602  0.0434  0.0511  116 GLY B CA    
2800 C C     . GLY B 119 ? 0.2706 0.5003 0.4672 0.0437  0.0391  0.0683  116 GLY B C     
2801 O O     . GLY B 119 ? 0.2471 0.4733 0.4338 0.0335  0.0407  0.0717  116 GLY B O     
2802 N N     . ASP B 120 ? 0.1800 0.3988 0.3774 0.0415  0.0329  0.0788  117 ASP B N     
2803 C CA    . ASP B 120 ? 0.2425 0.4417 0.4280 0.0285  0.0290  0.0919  117 ASP B CA    
2804 C C     . ASP B 120 ? 0.2209 0.3878 0.3973 0.0293  0.0305  0.0923  117 ASP B C     
2805 O O     . ASP B 120 ? 0.2734 0.4259 0.4500 0.0382  0.0320  0.0851  117 ASP B O     
2806 C CB    . ASP B 120 ? 0.1849 0.3727 0.3685 0.0265  0.0221  0.0993  117 ASP B CB    
2807 C CG    . ASP B 120 ? 0.2933 0.5181 0.4876 0.0217  0.0188  0.1032  117 ASP B CG    
2808 O OD1   . ASP B 120 ? 0.2105 0.4701 0.4106 0.0155  0.0225  0.1027  117 ASP B OD1   
2809 O OD2   . ASP B 120 ? 0.2593 0.4819 0.4560 0.0221  0.0121  0.1079  117 ASP B OD2   
2810 N N     . VAL B 121 ? 0.3394 0.4955 0.5095 0.0198  0.0291  0.1016  118 VAL B N     
2811 C CA    . VAL B 121 ? 0.2028 0.3356 0.3694 0.0213  0.0311  0.1034  118 VAL B CA    
2812 C C     . VAL B 121 ? 0.2160 0.3216 0.3756 0.0218  0.0303  0.1074  118 VAL B C     
2813 O O     . VAL B 121 ? 0.2608 0.3617 0.4159 0.0155  0.0263  0.1125  118 VAL B O     
2814 C CB    . VAL B 121 ? 0.2308 0.3736 0.3995 0.0127  0.0302  0.1105  118 VAL B CB    
2815 C CG1   . VAL B 121 ? 0.1695 0.2939 0.3405 0.0157  0.0318  0.1139  118 VAL B CG1   
2816 C CG2   . VAL B 121 ? 0.2192 0.3907 0.3892 0.0092  0.0321  0.1048  118 VAL B CG2   
2817 N N     . VAL B 122 ? 0.2153 0.3032 0.3719 0.0277  0.0338  0.1045  119 VAL B N     
2818 C CA    . VAL B 122 ? 0.2748 0.3402 0.4223 0.0280  0.0359  0.1054  119 VAL B CA    
2819 C C     . VAL B 122 ? 0.1826 0.2411 0.3353 0.0296  0.0402  0.1083  119 VAL B C     
2820 O O     . VAL B 122 ? 0.3058 0.3714 0.4671 0.0320  0.0434  0.1093  119 VAL B O     
2821 C CB    . VAL B 122 ? 0.2914 0.3456 0.4315 0.0311  0.0377  0.1022  119 VAL B CB    
2822 C CG1   . VAL B 122 ? 0.2009 0.2366 0.3283 0.0296  0.0425  0.1013  119 VAL B CG1   
2823 C CG2   . VAL B 122 ? 0.3363 0.3951 0.4749 0.0316  0.0309  0.1013  119 VAL B CG2   
2824 N N     . VAL B 123 ? 0.2751 0.3191 0.4238 0.0283  0.0392  0.1098  120 VAL B N     
2825 C CA    . VAL B 123 ? 0.2510 0.2870 0.4094 0.0334  0.0421  0.1122  120 VAL B CA    
2826 C C     . VAL B 123 ? 0.3117 0.3258 0.4608 0.0396  0.0499  0.1043  120 VAL B C     
2827 O O     . VAL B 123 ? 0.4252 0.4192 0.5587 0.0362  0.0475  0.1001  120 VAL B O     
2828 C CB    . VAL B 123 ? 0.2817 0.3146 0.4453 0.0281  0.0330  0.1206  120 VAL B CB    
2829 C CG1   . VAL B 123 ? 0.2191 0.2445 0.3989 0.0361  0.0336  0.1251  120 VAL B CG1   
2830 C CG2   . VAL B 123 ? 0.2256 0.2854 0.3936 0.0189  0.0268  0.1271  120 VAL B CG2   
2831 N N     . LEU B 124 ? 0.3051 0.3254 0.4624 0.0469  0.0593  0.1019  121 LEU B N     
2832 C CA    . LEU B 124 ? 0.2726 0.2794 0.4217 0.0533  0.0701  0.0923  121 LEU B CA    
2833 C C     . LEU B 124 ? 0.3059 0.3085 0.4745 0.0658  0.0744  0.0915  121 LEU B C     
2834 O O     . LEU B 124 ? 0.2900 0.3114 0.4827 0.0700  0.0730  0.1003  121 LEU B O     
2835 C CB    . LEU B 124 ? 0.2377 0.2594 0.3830 0.0518  0.0789  0.0905  121 LEU B CB    
2836 C CG    . LEU B 124 ? 0.4093 0.4322 0.5390 0.0415  0.0725  0.0928  121 LEU B CG    
2837 C CD1   . LEU B 124 ? 0.2557 0.2878 0.3792 0.0375  0.0789  0.0932  121 LEU B CD1   
2838 C CD2   . LEU B 124 ? 0.2449 0.2491 0.3532 0.0356  0.0671  0.0888  121 LEU B CD2   
2839 N N     . ASP B 125 ? 0.3976 0.3742 0.5558 0.0719  0.0786  0.0807  122 ASP B N     
2840 C CA    . ASP B 125 ? 0.3056 0.2721 0.4841 0.0876  0.0818  0.0778  122 ASP B CA    
2841 C C     . ASP B 125 ? 0.3482 0.3055 0.5182 0.0991  0.0990  0.0593  122 ASP B C     
2842 O O     . ASP B 125 ? 0.5440 0.4721 0.6859 0.0957  0.1007  0.0463  122 ASP B O     
2843 C CB    . ASP B 125 ? 0.4772 0.4125 0.6529 0.0852  0.0669  0.0819  122 ASP B CB    
2844 C CG    . ASP B 125 ? 0.6572 0.5738 0.8549 0.1033  0.0670  0.0792  122 ASP B CG    
2845 O OD1   . ASP B 125 ? 0.8458 0.7241 1.0344 0.1028  0.0566  0.0772  122 ASP B OD1   
2846 O OD2   . ASP B 125 ? 0.6893 0.6290 0.9147 0.1180  0.0764  0.0797  122 ASP B OD2   
2847 N N     . GLY B 126 ? 0.3889 0.3742 0.5824 0.1112  0.1120  0.0580  123 GLY B N     
2848 C CA    . GLY B 126 ? 0.4088 0.3951 0.5979 0.1233  0.1315  0.0393  123 GLY B CA    
2849 C C     . GLY B 126 ? 0.3557 0.3628 0.5207 0.1105  0.1434  0.0345  123 GLY B C     
2850 O O     . GLY B 126 ? 0.4837 0.4973 0.6389 0.1162  0.1613  0.0185  123 GLY B O     
2851 N N     . VAL B 127 ? 0.3268 0.3440 0.4815 0.0928  0.1330  0.0481  124 VAL B N     
2852 C CA    . VAL B 127 ? 0.3586 0.3920 0.4911 0.0782  0.1392  0.0482  124 VAL B CA    
2853 C C     . VAL B 127 ? 0.3093 0.3842 0.4652 0.0795  0.1485  0.0559  124 VAL B C     
2854 O O     . VAL B 127 ? 0.4663 0.5571 0.6435 0.0771  0.1392  0.0708  124 VAL B O     
2855 C CB    . VAL B 127 ? 0.4118 0.4364 0.5271 0.0611  0.1227  0.0596  124 VAL B CB    
2856 C CG1   . VAL B 127 ? 0.3596 0.3975 0.4544 0.0461  0.1257  0.0628  124 VAL B CG1   
2857 C CG2   . VAL B 127 ? 0.4335 0.4244 0.5272 0.0571  0.1129  0.0543  124 VAL B CG2   
2858 N N     . LYS B 128 ? 0.4142 0.5085 0.5643 0.0814  0.1671  0.0455  125 LYS B N     
2859 C CA    . LYS B 128 ? 0.4898 0.6298 0.6652 0.0825  0.1779  0.0526  125 LYS B CA    
2860 C C     . LYS B 128 ? 0.5111 0.6721 0.6620 0.0611  0.1831  0.0574  125 LYS B C     
2861 O O     . LYS B 128 ? 0.4802 0.6759 0.6469 0.0528  0.1842  0.0706  125 LYS B O     
2862 C CB    . LYS B 128 ? 0.4628 0.6207 0.6630 0.1055  0.1973  0.0379  125 LYS B CB    
2863 C CG    . LYS B 128 ? 0.3465 0.4783 0.5710 0.1270  0.1900  0.0343  125 LYS B CG    
2864 C CD    . LYS B 128 ? 0.5797 0.7234 0.8287 0.1532  0.2091  0.0167  125 LYS B CD    
2865 C CE    . LYS B 128 ? 0.6370 0.7498 0.9123 0.1743  0.1978  0.0164  125 LYS B CE    
2866 N NZ    . LYS B 128 ? 0.6007 0.7331 0.9126 0.1735  0.1809  0.0417  125 LYS B NZ    
2867 N N     . ILE B 129 ? 0.4086 0.5480 0.5197 0.0497  0.1844  0.0485  126 ILE B N     
2868 C CA    . ILE B 129 ? 0.4095 0.5652 0.4932 0.0265  0.1867  0.0552  126 ILE B CA    
2869 C C     . ILE B 129 ? 0.3368 0.4869 0.4202 0.0102  0.1653  0.0768  126 ILE B C     
2870 O O     . ILE B 129 ? 0.3295 0.4472 0.4000 0.0065  0.1485  0.0804  126 ILE B O     
2871 C CB    . ILE B 129 ? 0.5570 0.6883 0.5960 0.0160  0.1895  0.0425  126 ILE B CB    
2872 C CG1   . ILE B 129 ? 0.5523 0.6830 0.5874 0.0328  0.2113  0.0167  126 ILE B CG1   
2873 C CG2   . ILE B 129 ? 0.4630 0.6124 0.4729 -0.0109 0.1895  0.0530  126 ILE B CG2   
2874 C CD1   . ILE B 129 ? 0.5730 0.6750 0.5604 0.0217  0.2133  0.0017  126 ILE B CD1   
2875 N N     . VAL B 130 ? 0.3276 0.5098 0.4258 0.0005  0.1660  0.0906  127 VAL B N     
2876 C CA    . VAL B 130 ? 0.4033 0.5767 0.5032 -0.0134 0.1456  0.1092  127 VAL B CA    
2877 C C     . VAL B 130 ? 0.3743 0.5166 0.4406 -0.0296 0.1299  0.1149  127 VAL B C     
2878 O O     . VAL B 130 ? 0.4295 0.5487 0.4977 -0.0318 0.1111  0.1235  127 VAL B O     
2879 C CB    . VAL B 130 ? 0.4048 0.6164 0.5182 -0.0274 0.1481  0.1238  127 VAL B CB    
2880 C CG1   . VAL B 130 ? 0.4358 0.6810 0.5894 -0.0108 0.1593  0.1221  127 VAL B CG1   
2881 C CG2   . VAL B 130 ? 0.5937 0.8294 0.6825 -0.0460 0.1600  0.1252  127 VAL B CG2   
2882 N N     . GLY B 131 ? 0.3999 0.5431 0.4362 -0.0405 0.1375  0.1099  128 GLY B N     
2883 C CA    . GLY B 131 ? 0.3673 0.4832 0.3725 -0.0566 0.1213  0.1175  128 GLY B CA    
2884 C C     . GLY B 131 ? 0.5182 0.5996 0.5245 -0.0443 0.1083  0.1123  128 GLY B C     
2885 O O     . GLY B 131 ? 0.5817 0.6420 0.5841 -0.0499 0.0885  0.1230  128 GLY B O     
2886 N N     . ASN B 132 ? 0.3920 0.4686 0.4050 -0.0274 0.1189  0.0961  129 ASN B N     
2887 C CA    . ASN B 132 ? 0.4451 0.4941 0.4601 -0.0178 0.1074  0.0920  129 ASN B CA    
2888 C C     . ASN B 132 ? 0.4583 0.5046 0.5021 -0.0083 0.0956  0.0995  129 ASN B C     
2889 O O     . ASN B 132 ? 0.5661 0.5960 0.6095 -0.0087 0.0801  0.1045  129 ASN B O     
2890 C CB    . ASN B 132 ? 0.3995 0.4406 0.4131 -0.0044 0.1202  0.0739  129 ASN B CB    
2891 C CG    . ASN B 132 ? 0.5973 0.6343 0.5753 -0.0145 0.1309  0.0622  129 ASN B CG    
2892 O OD1   . ASN B 132 ? 0.7060 0.7379 0.6797 -0.0041 0.1453  0.0443  129 ASN B OD1   
2893 N ND2   . ASN B 132 ? 0.5875 0.6246 0.5384 -0.0352 0.1230  0.0721  129 ASN B ND2   
2894 N N     . ILE B 133 ? 0.3904 0.4561 0.4596 -0.0001 0.1033  0.1001  130 ILE B N     
2895 C CA    . ILE B 133 ? 0.3234 0.3893 0.4164 0.0062  0.0932  0.1064  130 ILE B CA    
2896 C C     . ILE B 133 ? 0.3397 0.3968 0.4268 -0.0052 0.0778  0.1177  130 ILE B C     
2897 O O     . ILE B 133 ? 0.3097 0.3537 0.4034 -0.0007 0.0657  0.1186  130 ILE B O     
2898 C CB    . ILE B 133 ? 0.3709 0.4629 0.4905 0.0129  0.1026  0.1081  130 ILE B CB    
2899 C CG1   . ILE B 133 ? 0.2610 0.3590 0.3904 0.0277  0.1173  0.0964  130 ILE B CG1   
2900 C CG2   . ILE B 133 ? 0.2322 0.3235 0.3712 0.0164  0.0913  0.1141  130 ILE B CG2   
2901 C CD1   . ILE B 133 ? 0.2521 0.3792 0.4139 0.0371  0.1255  0.0995  130 ILE B CD1   
2902 N N     . GLY B 134 ? 0.2846 0.3491 0.3593 -0.0201 0.0780  0.1259  131 GLY B N     
2903 C CA    . GLY B 134 ? 0.2963 0.3464 0.3640 -0.0321 0.0611  0.1378  131 GLY B CA    
2904 C C     . GLY B 134 ? 0.3781 0.4014 0.4339 -0.0310 0.0464  0.1384  131 GLY B C     
2905 O O     . GLY B 134 ? 0.4256 0.4331 0.4906 -0.0255 0.0329  0.1399  131 GLY B O     
2906 N N     . ALA B 135 ? 0.3144 0.3347 0.3501 -0.0362 0.0491  0.1368  132 ALA B N     
2907 C CA    . ALA B 135 ? 0.4073 0.4077 0.4333 -0.0365 0.0344  0.1396  132 ALA B CA    
2908 C C     . ALA B 135 ? 0.3624 0.3583 0.4073 -0.0191 0.0313  0.1311  132 ALA B C     
2909 O O     . ALA B 135 ? 0.3895 0.3740 0.4412 -0.0145 0.0168  0.1346  132 ALA B O     
2910 C CB    . ALA B 135 ? 0.3454 0.3465 0.3441 -0.0473 0.0393  0.1379  132 ALA B CB    
2911 N N     . ILE B 136 ? 0.3136 0.3203 0.3681 -0.0097 0.0448  0.1208  133 ILE B N     
2912 C CA    . ILE B 136 ? 0.3110 0.3175 0.3817 0.0030  0.0425  0.1146  133 ILE B CA    
2913 C C     . ILE B 136 ? 0.3003 0.3083 0.3902 0.0096  0.0352  0.1161  133 ILE B C     
2914 O O     . ILE B 136 ? 0.3445 0.3519 0.4442 0.0171  0.0282  0.1135  133 ILE B O     
2915 C CB    . ILE B 136 ? 0.3417 0.3558 0.4183 0.0099  0.0560  0.1058  133 ILE B CB    
2916 C CG1   . ILE B 136 ? 0.3442 0.3484 0.4003 0.0060  0.0596  0.0999  133 ILE B CG1   
2917 C CG2   . ILE B 136 ? 0.2405 0.2595 0.3371 0.0196  0.0528  0.1037  133 ILE B CG2   
2918 C CD1   . ILE B 136 ? 0.5681 0.5721 0.6274 0.0136  0.0725  0.0898  133 ILE B CD1   
2919 N N     . VAL B 137 ? 0.2494 0.2612 0.3434 0.0056  0.0372  0.1196  134 VAL B N     
2920 C CA    . VAL B 137 ? 0.2725 0.2809 0.3787 0.0090  0.0296  0.1195  134 VAL B CA    
2921 C C     . VAL B 137 ? 0.2780 0.2666 0.3810 0.0102  0.0141  0.1220  134 VAL B C     
2922 O O     . VAL B 137 ? 0.3102 0.2959 0.4244 0.0204  0.0086  0.1155  134 VAL B O     
2923 C CB    . VAL B 137 ? 0.2776 0.2921 0.3855 -0.0001 0.0321  0.1251  134 VAL B CB    
2924 C CG1   . VAL B 137 ? 0.3381 0.3396 0.4506 -0.0002 0.0208  0.1244  134 VAL B CG1   
2925 C CG2   . VAL B 137 ? 0.2314 0.2693 0.3518 0.0032  0.0456  0.1228  134 VAL B CG2   
2926 N N     . ARG B 138 ? 0.2808 0.2573 0.3691 -0.0002 0.0070  0.1315  135 ARG B N     
2927 C CA    . ARG B 138 ? 0.3296 0.2847 0.4167 0.0011  -0.0107 0.1372  135 ARG B CA    
2928 C C     . ARG B 138 ? 0.3739 0.3333 0.4710 0.0137  -0.0147 0.1322  135 ARG B C     
2929 O O     . ARG B 138 ? 0.4482 0.4005 0.5599 0.0261  -0.0242 0.1283  135 ARG B O     
2930 C CB    . ARG B 138 ? 0.4412 0.3859 0.5079 -0.0162 -0.0185 0.1517  135 ARG B CB    
2931 C CG    . ARG B 138 ? 0.7088 0.6499 0.7659 -0.0323 -0.0190 0.1606  135 ARG B CG    
2932 C CD    . ARG B 138 ? 0.8189 0.7508 0.8539 -0.0520 -0.0293 0.1772  135 ARG B CD    
2933 N NE    . ARG B 138 ? 0.9795 0.8838 1.0166 -0.0484 -0.0521 0.1855  135 ARG B NE    
2934 C CZ    . ARG B 138 ? 0.9730 0.8706 0.9946 -0.0602 -0.0640 0.1992  135 ARG B CZ    
2935 N NH1   . ARG B 138 ? 0.9286 0.8449 0.9268 -0.0776 -0.0532 0.2036  135 ARG B NH1   
2936 N NH2   . ARG B 138 ? 0.8700 0.7432 0.8997 -0.0542 -0.0867 0.2081  135 ARG B NH2   
2937 N N     . THR B 139 ? 0.3348 0.3065 0.4237 0.0103  -0.0075 0.1319  136 THR B N     
2938 C CA    . THR B 139 ? 0.3151 0.2947 0.4115 0.0175  -0.0122 0.1302  136 THR B CA    
2939 C C     . THR B 139 ? 0.3207 0.3157 0.4382 0.0317  -0.0074 0.1192  136 THR B C     
2940 O O     . THR B 139 ? 0.4023 0.4048 0.5353 0.0418  -0.0149 0.1176  136 THR B O     
2941 C CB    . THR B 139 ? 0.2812 0.2671 0.3601 0.0078  -0.0053 0.1306  136 THR B CB    
2942 O OG1   . THR B 139 ? 0.3921 0.3677 0.4472 -0.0076 -0.0078 0.1393  136 THR B OG1   
2943 C CG2   . THR B 139 ? 0.2793 0.2740 0.3646 0.0110  -0.0134 0.1319  136 THR B CG2   
2944 N N     . SER B 140 ? 0.3159 0.3193 0.4350 0.0319  0.0051  0.1127  137 SER B N     
2945 C CA    . SER B 140 ? 0.3237 0.3441 0.4585 0.0409  0.0098  0.1040  137 SER B CA    
2946 C C     . SER B 140 ? 0.3459 0.3626 0.4932 0.0511  0.0033  0.0979  137 SER B C     
2947 O O     . SER B 140 ? 0.2944 0.3272 0.4557 0.0610  0.0028  0.0909  137 SER B O     
2948 C CB    . SER B 140 ? 0.2112 0.2389 0.3451 0.0373  0.0211  0.1015  137 SER B CB    
2949 O OG    . SER B 140 ? 0.3622 0.3911 0.4875 0.0320  0.0275  0.1037  137 SER B OG    
2950 N N     . LEU B 141 ? 0.2462 0.2420 0.3877 0.0482  -0.0015 0.0999  138 LEU B N     
2951 C CA    . LEU B 141 ? 0.2621 0.2445 0.4119 0.0577  -0.0092 0.0922  138 LEU B CA    
2952 C C     . LEU B 141 ? 0.3788 0.3554 0.5406 0.0699  -0.0212 0.0927  138 LEU B C     
2953 O O     . LEU B 141 ? 0.3159 0.2989 0.4937 0.0853  -0.0222 0.0807  138 LEU B O     
2954 C CB    . LEU B 141 ? 0.3042 0.2601 0.4421 0.0478  -0.0153 0.0973  138 LEU B CB    
2955 C CG    . LEU B 141 ? 0.3449 0.2745 0.4868 0.0562  -0.0266 0.0892  138 LEU B CG    
2956 C CD1   . LEU B 141 ? 0.3039 0.2460 0.4517 0.0638  -0.0182 0.0718  138 LEU B CD1   
2957 C CD2   . LEU B 141 ? 0.4076 0.3071 0.5346 0.0413  -0.0367 0.0994  138 LEU B CD2   
2958 N N     . ALA B 142 ? 0.2872 0.2542 0.4420 0.0629  -0.0301 0.1065  139 ALA B N     
2959 C CA    . ALA B 142 ? 0.4227 0.3824 0.5903 0.0728  -0.0455 0.1119  139 ALA B CA    
2960 C C     . ALA B 142 ? 0.3388 0.3315 0.5256 0.0838  -0.0427 0.1077  139 ALA B C     
2961 O O     . ALA B 142 ? 0.5750 0.5716 0.7833 0.0990  -0.0528 0.1069  139 ALA B O     
2962 C CB    . ALA B 142 ? 0.3244 0.2667 0.4751 0.0574  -0.0573 0.1306  139 ALA B CB    
2963 N N     . LEU B 143 ? 0.2957 0.3126 0.4763 0.0758  -0.0300 0.1060  140 LEU B N     
2964 C CA    . LEU B 143 ? 0.4053 0.4552 0.6007 0.0803  -0.0284 0.1054  140 LEU B CA    
2965 C C     . LEU B 143 ? 0.3311 0.4096 0.5397 0.0886  -0.0160 0.0911  140 LEU B C     
2966 O O     . LEU B 143 ? 0.3448 0.4560 0.5643 0.0886  -0.0131 0.0913  140 LEU B O     
2967 C CB    . LEU B 143 ? 0.3866 0.4412 0.5637 0.0629  -0.0270 0.1156  140 LEU B CB    
2968 C CG    . LEU B 143 ? 0.3811 0.4173 0.5444 0.0527  -0.0403 0.1301  140 LEU B CG    
2969 C CD1   . LEU B 143 ? 0.2650 0.3066 0.4081 0.0357  -0.0382 0.1360  140 LEU B CD1   
2970 C CD2   . LEU B 143 ? 0.4591 0.5005 0.6456 0.0648  -0.0570 0.1369  140 LEU B CD2   
2971 N N     . GLY B 144 ? 0.3355 0.4031 0.5410 0.0924  -0.0096 0.0800  141 GLY B N     
2972 C CA    . GLY B 144 ? 0.2274 0.3215 0.4432 0.0997  0.0008  0.0654  141 GLY B CA    
2973 C C     . GLY B 144 ? 0.3586 0.4687 0.5628 0.0862  0.0121  0.0654  141 GLY B C     
2974 O O     . GLY B 144 ? 0.3154 0.4563 0.5268 0.0876  0.0197  0.0575  141 GLY B O     
2975 N N     . ALA B 145 ? 0.2115 0.3029 0.3988 0.0732  0.0129  0.0748  142 ALA B N     
2976 C CA    . ALA B 145 ? 0.3012 0.4028 0.4807 0.0624  0.0212  0.0763  142 ALA B CA    
2977 C C     . ALA B 145 ? 0.4138 0.5164 0.5920 0.0633  0.0258  0.0667  142 ALA B C     
2978 O O     . ALA B 145 ? 0.3867 0.4678 0.5622 0.0678  0.0224  0.0615  142 ALA B O     
2979 C CB    . ALA B 145 ? 0.2170 0.2986 0.3827 0.0524  0.0218  0.0862  142 ALA B CB    
2980 N N     . SER B 146 ? 0.3158 0.4418 0.4937 0.0566  0.0318  0.0656  143 SER B N     
2981 C CA    . SER B 146 ? 0.2458 0.3763 0.4190 0.0536  0.0354  0.0575  143 SER B CA    
2982 C C     . SER B 146 ? 0.4080 0.5185 0.5727 0.0448  0.0343  0.0654  143 SER B C     
2983 O O     . SER B 146 ? 0.2600 0.3600 0.4188 0.0428  0.0331  0.0597  143 SER B O     
2984 C CB    . SER B 146 ? 0.2630 0.4287 0.4371 0.0454  0.0404  0.0571  143 SER B CB    
2985 O OG    . SER B 146 ? 0.2415 0.4091 0.4134 0.0340  0.0390  0.0724  143 SER B OG    
2986 N N     . GLY B 147 ? 0.1745 0.2807 0.3389 0.0395  0.0345  0.0778  144 GLY B N     
2987 C CA    . GLY B 147 ? 0.1730 0.2688 0.3350 0.0331  0.0352  0.0858  144 GLY B CA    
2988 C C     . GLY B 147 ? 0.1937 0.2837 0.3568 0.0320  0.0373  0.0952  144 GLY B C     
2989 O O     . GLY B 147 ? 0.2502 0.3408 0.4124 0.0336  0.0368  0.0961  144 GLY B O     
2990 N N     . ILE B 148 ? 0.1669 0.2523 0.3320 0.0291  0.0396  0.1014  145 ILE B N     
2991 C CA    . ILE B 148 ? 0.3413 0.4207 0.5080 0.0307  0.0439  0.1067  145 ILE B CA    
2992 C C     . ILE B 148 ? 0.2952 0.3850 0.4744 0.0293  0.0457  0.1142  145 ILE B C     
2993 O O     . ILE B 148 ? 0.2944 0.3939 0.4796 0.0253  0.0446  0.1178  145 ILE B O     
2994 C CB    . ILE B 148 ? 0.2441 0.3106 0.4036 0.0309  0.0470  0.1067  145 ILE B CB    
2995 C CG1   . ILE B 148 ? 0.2804 0.3346 0.4292 0.0320  0.0420  0.1027  145 ILE B CG1   
2996 C CG2   . ILE B 148 ? 0.2111 0.2743 0.3709 0.0334  0.0544  0.1083  145 ILE B CG2   
2997 C CD1   . ILE B 148 ? 0.1971 0.2386 0.3352 0.0282  0.0423  0.1055  145 ILE B CD1   
2998 N N     . ILE B 149 ? 0.1822 0.2685 0.3657 0.0322  0.0465  0.1173  146 ILE B N     
2999 C CA    . ILE B 149 ? 0.2168 0.3099 0.4165 0.0342  0.0464  0.1256  146 ILE B CA    
3000 C C     . ILE B 149 ? 0.2372 0.3192 0.4408 0.0434  0.0546  0.1230  146 ILE B C     
3001 O O     . ILE B 149 ? 0.2396 0.3036 0.4331 0.0466  0.0562  0.1175  146 ILE B O     
3002 C CB    . ILE B 149 ? 0.2689 0.3643 0.4723 0.0301  0.0384  0.1323  146 ILE B CB    
3003 C CG1   . ILE B 149 ? 0.2963 0.4094 0.4936 0.0198  0.0330  0.1328  146 ILE B CG1   
3004 C CG2   . ILE B 149 ? 0.1959 0.2949 0.4192 0.0337  0.0353  0.1433  146 ILE B CG2   
3005 C CD1   . ILE B 149 ? 0.3323 0.4536 0.5302 0.0110  0.0247  0.1415  146 ILE B CD1   
3006 N N     . LEU B 150 ? 0.3565 0.4514 0.5740 0.0467  0.0602  0.1263  147 LEU B N     
3007 C CA    . LEU B 150 ? 0.4198 0.5120 0.6431 0.0567  0.0713  0.1216  147 LEU B CA    
3008 C C     . LEU B 150 ? 0.2749 0.3706 0.5233 0.0679  0.0709  0.1268  147 LEU B C     
3009 O O     . LEU B 150 ? 0.3066 0.4231 0.5768 0.0673  0.0662  0.1382  147 LEU B O     
3010 C CB    . LEU B 150 ? 0.2906 0.4008 0.5160 0.0533  0.0788  0.1226  147 LEU B CB    
3011 C CG    . LEU B 150 ? 0.2815 0.3837 0.4834 0.0427  0.0773  0.1192  147 LEU B CG    
3012 C CD1   . LEU B 150 ? 0.1934 0.3131 0.3976 0.0363  0.0831  0.1234  147 LEU B CD1   
3013 C CD2   . LEU B 150 ? 0.2190 0.2989 0.3991 0.0441  0.0798  0.1099  147 LEU B CD2   
3014 N N     . VAL B 151 ? 0.2157 0.2887 0.4605 0.0776  0.0743  0.1188  148 VAL B N     
3015 C CA    . VAL B 151 ? 0.2314 0.2998 0.5010 0.0919  0.0732  0.1219  148 VAL B CA    
3016 C C     . VAL B 151 ? 0.4223 0.4874 0.6967 0.1078  0.0898  0.1077  148 VAL B C     
3017 O O     . VAL B 151 ? 0.3626 0.4082 0.6107 0.1068  0.0976  0.0933  148 VAL B O     
3018 C CB    . VAL B 151 ? 0.2632 0.3011 0.5252 0.0900  0.0603  0.1243  148 VAL B CB    
3019 C CG1   . VAL B 151 ? 0.2701 0.2958 0.5589 0.1063  0.0565  0.1281  148 VAL B CG1   
3020 C CG2   . VAL B 151 ? 0.2274 0.2758 0.4843 0.0732  0.0461  0.1375  148 VAL B CG2   
3021 N N     . ASP B 152 ? 0.4831 0.5710 0.7913 0.1219  0.0953  0.1118  149 ASP B N     
3022 C CA    . ASP B 152 ? 0.3834 0.4764 0.7017 0.1399  0.1138  0.0967  149 ASP B CA    
3023 C C     . ASP B 152 ? 0.4124 0.5199 0.7055 0.1303  0.1291  0.0863  149 ASP B C     
3024 O O     . ASP B 152 ? 0.4571 0.5473 0.7280 0.1343  0.1411  0.0684  149 ASP B O     
3025 C CB    . ASP B 152 ? 0.5679 0.6167 0.8770 0.1536  0.1139  0.0819  149 ASP B CB    
3026 C CG    . ASP B 152 ? 0.7872 0.8412 1.1139 0.1777  0.1330  0.0643  149 ASP B CG    
3027 O OD1   . ASP B 152 ? 0.9552 1.0498 1.3193 0.1896  0.1407  0.0703  149 ASP B OD1   
3028 O OD2   . ASP B 152 ? 0.7979 0.8170 1.1009 0.1844  0.1406  0.0438  149 ASP B OD2   
3029 N N     . SER B 153 ? 0.2519 0.3892 0.5463 0.1155  0.1270  0.0983  150 SER B N     
3030 C CA    . SER B 153 ? 0.2720 0.4210 0.5416 0.1021  0.1368  0.0935  150 SER B CA    
3031 C C     . SER B 153 ? 0.4412 0.6364 0.7330 0.1042  0.1509  0.0966  150 SER B C     
3032 O O     . SER B 153 ? 0.4223 0.6321 0.6953 0.0914  0.1596  0.0946  150 SER B O     
3033 C CB    . SER B 153 ? 0.2739 0.4166 0.5237 0.0816  0.1225  0.1039  150 SER B CB    
3034 O OG    . SER B 153 ? 0.2373 0.4065 0.5089 0.0753  0.1148  0.1194  150 SER B OG    
3035 N N     . ASP B 154 ? 0.2484 0.4693 0.5817 0.1187  0.1517  0.1038  151 ASP B N     
3036 C CA    . ASP B 154 ? 0.2865 0.5603 0.6489 0.1211  0.1643  0.1095  151 ASP B CA    
3037 C C     . ASP B 154 ? 0.3484 0.6466 0.7035 0.0953  0.1563  0.1265  151 ASP B C     
3038 O O     . ASP B 154 ? 0.4119 0.7551 0.7826 0.0895  0.1658  0.1330  151 ASP B O     
3039 C CB    . ASP B 154 ? 0.3869 0.6744 0.7410 0.1304  0.1889  0.0901  151 ASP B CB    
3040 C CG    . ASP B 154 ? 0.6655 0.9375 1.0383 0.1604  0.1990  0.0723  151 ASP B CG    
3041 O OD1   . ASP B 154 ? 0.5795 0.8494 0.9883 0.1767  0.1888  0.0806  151 ASP B OD1   
3042 O OD2   . ASP B 154 ? 0.8417 1.1015 1.1918 0.1671  0.2160  0.0501  151 ASP B OD2   
3043 N N     . ILE B 155 ? 0.3713 0.6399 0.7026 0.0796  0.1386  0.1332  152 ILE B N     
3044 C CA    . ILE B 155 ? 0.2984 0.5794 0.6209 0.0561  0.1279  0.1475  152 ILE B CA    
3045 C C     . ILE B 155 ? 0.2394 0.5386 0.5903 0.0538  0.1140  0.1639  152 ILE B C     
3046 O O     . ILE B 155 ? 0.2841 0.5620 0.6375 0.0591  0.1025  0.1654  152 ILE B O     
3047 C CB    . ILE B 155 ? 0.3649 0.6045 0.6477 0.0420  0.1164  0.1438  152 ILE B CB    
3048 C CG1   . ILE B 155 ? 0.3124 0.5329 0.5659 0.0423  0.1268  0.1301  152 ILE B CG1   
3049 C CG2   . ILE B 155 ? 0.2909 0.5366 0.5638 0.0194  0.1046  0.1562  152 ILE B CG2   
3050 C CD1   . ILE B 155 ? 0.4388 0.6849 0.6827 0.0286  0.1368  0.1330  152 ILE B CD1   
3051 N N     . THR B 156 ? 0.2510 0.5921 0.6219 0.0431  0.1141  0.1777  153 THR B N     
3052 C CA    . THR B 156 ? 0.2335 0.5963 0.6302 0.0371  0.0996  0.1954  153 THR B CA    
3053 C C     . THR B 156 ? 0.1697 0.5125 0.5376 0.0116  0.0822  0.2021  153 THR B C     
3054 O O     . THR B 156 ? 0.2628 0.5990 0.6334 0.0066  0.0675  0.2094  153 THR B O     
3055 C CB    . THR B 156 ? 0.2355 0.6586 0.6719 0.0369  0.1065  0.2091  153 THR B CB    
3056 O OG1   . THR B 156 ? 0.2738 0.7143 0.6926 0.0146  0.1104  0.2132  153 THR B OG1   
3057 C CG2   . THR B 156 ? 0.2552 0.6999 0.7234 0.0661  0.1258  0.1991  153 THR B CG2   
3058 N N     . SER B 157 ? 0.2445 0.5765 0.5837 -0.0047 0.0834  0.1991  154 SER B N     
3059 C CA    . SER B 157 ? 0.2780 0.5839 0.5884 -0.0265 0.0672  0.2020  154 SER B CA    
3060 C C     . SER B 157 ? 0.3342 0.6003 0.6080 -0.0299 0.0684  0.1896  154 SER B C     
3061 O O     . SER B 157 ? 0.3592 0.6301 0.6270 -0.0275 0.0803  0.1855  154 SER B O     
3062 C CB    . SER B 157 ? 0.3887 0.7252 0.7061 -0.0500 0.0600  0.2188  154 SER B CB    
3063 O OG    . SER B 157 ? 0.5226 0.8266 0.8096 -0.0706 0.0432  0.2191  154 SER B OG    
3064 N N     . ILE B 158 ? 0.2974 0.5265 0.5472 -0.0357 0.0557  0.1837  155 ILE B N     
3065 C CA    . ILE B 158 ? 0.3218 0.5127 0.5418 -0.0361 0.0540  0.1729  155 ILE B CA    
3066 C C     . ILE B 158 ? 0.3685 0.5516 0.5705 -0.0569 0.0471  0.1802  155 ILE B C     
3067 O O     . ILE B 158 ? 0.4111 0.5681 0.5916 -0.0591 0.0455  0.1758  155 ILE B O     
3068 C CB    . ILE B 158 ? 0.3814 0.5400 0.5868 -0.0317 0.0441  0.1627  155 ILE B CB    
3069 C CG1   . ILE B 158 ? 0.4448 0.5811 0.6392 -0.0172 0.0496  0.1506  155 ILE B CG1   
3070 C CG2   . ILE B 158 ? 0.4859 0.6201 0.6705 -0.0479 0.0297  0.1622  155 ILE B CG2   
3071 C CD1   . ILE B 158 ? 0.4462 0.5977 0.6573 -0.0015 0.0616  0.1485  155 ILE B CD1   
3072 N N     . ALA B 159 ? 0.3569 0.5630 0.5680 -0.0741 0.0409  0.1935  156 ALA B N     
3073 C CA    . ALA B 159 ? 0.4519 0.6511 0.6460 -0.0985 0.0315  0.2038  156 ALA B CA    
3074 C C     . ALA B 159 ? 0.4873 0.7190 0.6869 -0.1040 0.0446  0.2121  156 ALA B C     
3075 O O     . ALA B 159 ? 0.4812 0.7145 0.6675 -0.1273 0.0377  0.2241  156 ALA B O     
3076 C CB    . ALA B 159 ? 0.5139 0.7256 0.7130 -0.1186 0.0183  0.2157  156 ALA B CB    
3077 N N     . ASP B 160 ? 0.4737 0.7309 0.6914 -0.0838 0.0633  0.2052  157 ASP B N     
3078 C CA    . ASP B 160 ? 0.3744 0.6643 0.5951 -0.0861 0.0797  0.2078  157 ASP B CA    
3079 C C     . ASP B 160 ? 0.3129 0.5727 0.4980 -0.1031 0.0728  0.2099  157 ASP B C     
3080 O O     . ASP B 160 ? 0.4122 0.6305 0.5770 -0.0944 0.0684  0.1993  157 ASP B O     
3081 C CB    . ASP B 160 ? 0.4198 0.7200 0.6545 -0.0583 0.0988  0.1928  157 ASP B CB    
3082 C CG    . ASP B 160 ? 0.5937 0.9286 0.8288 -0.0589 0.1189  0.1907  157 ASP B CG    
3083 O OD1   . ASP B 160 ? 0.7488 1.0906 0.9639 -0.0823 0.1168  0.2003  157 ASP B OD1   
3084 O OD2   . ASP B 160 ? 0.6979 1.0522 0.9521 -0.0365 0.1365  0.1790  157 ASP B OD2   
3085 N N     . ARG B 161 ? 0.3450 0.6278 0.5238 -0.1290 0.0703  0.2258  158 ARG B N     
3086 C CA    . ARG B 161 ? 0.5050 0.7565 0.6493 -0.1501 0.0584  0.2330  158 ARG B CA    
3087 C C     . ARG B 161 ? 0.4582 0.6997 0.5847 -0.1401 0.0699  0.2223  158 ARG B C     
3088 O O     . ARG B 161 ? 0.5313 0.7297 0.6307 -0.1467 0.0562  0.2232  158 ARG B O     
3089 C CB    . ARG B 161 ? 0.5852 0.8694 0.7256 -0.1833 0.0541  0.2549  158 ARG B CB    
3090 C CG    . ARG B 161 ? 0.7756 1.1322 0.9379 -0.1840 0.0789  0.2584  158 ARG B CG    
3091 C CD    . ARG B 161 ? 0.9495 1.3333 1.0945 -0.2202 0.0760  0.2791  158 ARG B CD    
3092 N NE    . ARG B 161 ? 1.0484 1.3915 1.1724 -0.2493 0.0462  0.2966  158 ARG B NE    
3093 C CZ    . ARG B 161 ? 1.0689 1.4194 1.2064 -0.2633 0.0328  0.3084  158 ARG B CZ    
3094 N NH1   . ARG B 161 ? 1.1740 1.5759 1.3492 -0.2509 0.0458  0.3072  158 ARG B NH1   
3095 N NH2   . ARG B 161 ? 0.7927 1.0972 0.9055 -0.2902 0.0048  0.3219  158 ARG B NH2   
3096 N N     . ARG B 162 ? 0.4662 0.7464 0.6080 -0.1241 0.0939  0.2121  159 ARG B N     
3097 C CA    . ARG B 162 ? 0.4713 0.7404 0.5940 -0.1142 0.1055  0.1988  159 ARG B CA    
3098 C C     . ARG B 162 ? 0.3163 0.5319 0.4291 -0.0970 0.0940  0.1870  159 ARG B C     
3099 O O     . ARG B 162 ? 0.5058 0.6925 0.5923 -0.1007 0.0883  0.1846  159 ARG B O     
3100 C CB    . ARG B 162 ? 0.4707 0.7835 0.6141 -0.0947 0.1332  0.1849  159 ARG B CB    
3101 C CG    . ARG B 162 ? 0.5200 0.8947 0.6719 -0.1097 0.1503  0.1930  159 ARG B CG    
3102 C CD    . ARG B 162 ? 0.5374 0.9420 0.6949 -0.0902 0.1789  0.1730  159 ARG B CD    
3103 N NE    . ARG B 162 ? 0.6999 1.0992 0.8885 -0.0562 0.1864  0.1572  159 ARG B NE    
3104 C CZ    . ARG B 162 ? 0.8425 1.2359 1.0300 -0.0331 0.2036  0.1350  159 ARG B CZ    
3105 N NH1   . ARG B 162 ? 0.9050 1.2991 1.0599 -0.0406 0.2166  0.1240  159 ARG B NH1   
3106 N NH2   . ARG B 162 ? 0.8497 1.2339 1.0663 -0.0044 0.2061  0.1243  159 ARG B NH2   
3107 N N     . LEU B 163 ? 0.2923 0.4989 0.4268 -0.0798 0.0901  0.1810  160 LEU B N     
3108 C CA    . LEU B 163 ? 0.3436 0.5080 0.4721 -0.0644 0.0804  0.1702  160 LEU B CA    
3109 C C     . LEU B 163 ? 0.3740 0.4984 0.4845 -0.0767 0.0576  0.1772  160 LEU B C     
3110 O O     . LEU B 163 ? 0.5519 0.6434 0.6482 -0.0706 0.0494  0.1716  160 LEU B O     
3111 C CB    . LEU B 163 ? 0.3894 0.5606 0.5447 -0.0457 0.0829  0.1634  160 LEU B CB    
3112 C CG    . LEU B 163 ? 0.3420 0.4791 0.4928 -0.0305 0.0756  0.1523  160 LEU B CG    
3113 C CD1   . LEU B 163 ? 0.2514 0.3747 0.3856 -0.0233 0.0825  0.1427  160 LEU B CD1   
3114 C CD2   . LEU B 163 ? 0.3210 0.4697 0.4967 -0.0158 0.0783  0.1484  160 LEU B CD2   
3115 N N     . GLN B 164 ? 0.3327 0.4598 0.4451 -0.0939 0.0467  0.1895  161 GLN B N     
3116 C CA    . GLN B 164 ? 0.4933 0.5775 0.5883 -0.1058 0.0240  0.1953  161 GLN B CA    
3117 C C     . GLN B 164 ? 0.4880 0.5508 0.5580 -0.1173 0.0161  0.2026  161 GLN B C     
3118 O O     . GLN B 164 ? 0.5399 0.5617 0.5992 -0.1119 0.0012  0.1996  161 GLN B O     
3119 C CB    . GLN B 164 ? 0.5043 0.5949 0.6013 -0.1275 0.0131  0.2089  161 GLN B CB    
3120 C CG    . GLN B 164 ? 0.5135 0.6169 0.6307 -0.1202 0.0139  0.2040  161 GLN B CG    
3121 C CD    . GLN B 164 ? 0.5766 0.6720 0.6881 -0.1443 -0.0029 0.2160  161 GLN B CD    
3122 O OE1   . GLN B 164 ? 0.5390 0.6672 0.6677 -0.1508 -0.0002 0.2221  161 GLN B OE1   
3123 N NE2   . GLN B 164 ? 0.4801 0.5299 0.5677 -0.1584 -0.0223 0.2206  161 GLN B NE2   
3124 N N     . ARG B 165 ? 0.4208 0.5147 0.4829 -0.1336 0.0261  0.2125  162 ARG B N     
3125 C CA    . ARG B 165 ? 0.4762 0.5549 0.5112 -0.1501 0.0178  0.2229  162 ARG B CA    
3126 C C     . ARG B 165 ? 0.4618 0.5287 0.4886 -0.1332 0.0240  0.2104  162 ARG B C     
3127 O O     . ARG B 165 ? 0.6411 0.6753 0.6502 -0.1380 0.0079  0.2160  162 ARG B O     
3128 C CB    . ARG B 165 ? 0.6426 0.7657 0.6690 -0.1752 0.0290  0.2366  162 ARG B CB    
3129 C CG    . ARG B 165 ? 0.9144 1.0231 0.9087 -0.2001 0.0168  0.2524  162 ARG B CG    
3130 C CD    . ARG B 165 ? 1.1827 1.3436 1.1675 -0.2273 0.0301  0.2657  162 ARG B CD    
3131 N NE    . ARG B 165 ? 1.3600 1.5417 1.3581 -0.2451 0.0249  0.2799  162 ARG B NE    
3132 C CZ    . ARG B 165 ? 1.5106 1.7402 1.5035 -0.2737 0.0322  0.2963  162 ARG B CZ    
3133 N NH1   . ARG B 165 ? 1.5986 1.8604 1.5713 -0.2873 0.0466  0.2988  162 ARG B NH1   
3134 N NH2   . ARG B 165 ? 1.5079 1.7561 1.5143 -0.2910 0.0251  0.3104  162 ARG B NH2   
3135 N N     . ALA B 166 ? 0.3649 0.4572 0.4050 -0.1142 0.0454  0.1946  163 ALA B N     
3136 C CA    . ALA B 166 ? 0.4436 0.5249 0.4748 -0.1000 0.0514  0.1820  163 ALA B CA    
3137 C C     . ALA B 166 ? 0.4149 0.4578 0.4513 -0.0844 0.0353  0.1764  163 ALA B C     
3138 O O     . ALA B 166 ? 0.4383 0.4648 0.4633 -0.0794 0.0311  0.1727  163 ALA B O     
3139 C CB    . ALA B 166 ? 0.3403 0.4515 0.3861 -0.0827 0.0757  0.1659  163 ALA B CB    
3140 N N     . SER B 167 ? 0.3530 0.3849 0.4060 -0.0778 0.0268  0.1756  164 SER B N     
3141 C CA    . SER B 167 ? 0.4319 0.4348 0.4926 -0.0615 0.0149  0.1675  164 SER B CA    
3142 C C     . SER B 167 ? 0.5194 0.4857 0.5710 -0.0694 -0.0085 0.1768  164 SER B C     
3143 O O     . SER B 167 ? 0.5345 0.4774 0.5946 -0.0551 -0.0188 0.1692  164 SER B O     
3144 C CB    . SER B 167 ? 0.3430 0.3555 0.4251 -0.0488 0.0203  0.1580  164 SER B CB    
3145 O OG    . SER B 167 ? 0.5742 0.6146 0.6677 -0.0386 0.0386  0.1502  164 SER B OG    
3146 N N     . ARG B 168 ? 0.5788 0.5409 0.6137 -0.0921 -0.0171 0.1933  165 ARG B N     
3147 C CA    . ARG B 168 ? 0.6223 0.5440 0.6479 -0.1017 -0.0426 0.2050  165 ARG B CA    
3148 C C     . ARG B 168 ? 0.5462 0.4465 0.5823 -0.0974 -0.0522 0.1996  165 ARG B C     
3149 O O     . ARG B 168 ? 0.6967 0.5553 0.7302 -0.0955 -0.0731 0.2014  165 ARG B O     
3150 C CB    . ARG B 168 ? 0.6958 0.5920 0.7205 -0.0885 -0.0551 0.2033  165 ARG B CB    
3151 C CG    . ARG B 168 ? 0.8567 0.7506 0.8598 -0.1067 -0.0637 0.2203  165 ARG B CG    
3152 C CD    . ARG B 168 ? 1.1685 1.0358 1.1567 -0.1311 -0.0861 0.2419  165 ARG B CD    
3153 N NE    . ARG B 168 ? 1.2162 1.0620 1.1888 -0.1426 -0.1067 0.2597  165 ARG B NE    
3154 C CZ    . ARG B 168 ? 1.2644 1.1284 1.2241 -0.1470 -0.1010 0.2627  165 ARG B CZ    
3155 N NH1   . ARG B 168 ? 1.1834 1.0841 1.1428 -0.1398 -0.0743 0.2472  165 ARG B NH1   
3156 N NH2   . ARG B 168 ? 1.3981 1.2408 1.3437 -0.1600 -0.1238 0.2821  165 ARG B NH2   
3157 N N     . GLY B 169 ? 0.5710 0.4988 0.6186 -0.0956 -0.0376 0.1925  166 GLY B N     
3158 C CA    . GLY B 169 ? 0.5038 0.4158 0.5575 -0.0952 -0.0454 0.1868  166 GLY B CA    
3159 C C     . GLY B 169 ? 0.5064 0.4067 0.5727 -0.0696 -0.0436 0.1664  166 GLY B C     
3160 O O     . GLY B 169 ? 0.5366 0.4109 0.6024 -0.0670 -0.0541 0.1583  166 GLY B O     
3161 N N     . TYR B 170 ? 0.3959 0.3161 0.4716 -0.0524 -0.0302 0.1576  167 TYR B N     
3162 C CA    . TYR B 170 ? 0.3454 0.2621 0.4331 -0.0302 -0.0275 0.1400  167 TYR B CA    
3163 C C     . TYR B 170 ? 0.3905 0.3413 0.4906 -0.0244 -0.0109 0.1323  167 TYR B C     
3164 O O     . TYR B 170 ? 0.5088 0.4651 0.6178 -0.0093 -0.0066 0.1196  167 TYR B O     
3165 C CB    . TYR B 170 ? 0.3596 0.2727 0.4498 -0.0167 -0.0284 0.1376  167 TYR B CB    
3166 C CG    . TYR B 170 ? 0.4436 0.3200 0.5283 -0.0158 -0.0486 0.1433  167 TYR B CG    
3167 C CD1   . TYR B 170 ? 0.5282 0.3757 0.6196 -0.0030 -0.0605 0.1325  167 TYR B CD1   
3168 C CD2   . TYR B 170 ? 0.4322 0.3028 0.5052 -0.0274 -0.0562 0.1592  167 TYR B CD2   
3169 C CE1   . TYR B 170 ? 0.6231 0.4341 0.7139 0.0010  -0.0808 0.1380  167 TYR B CE1   
3170 C CE2   . TYR B 170 ? 0.4262 0.2621 0.4963 -0.0270 -0.0779 0.1677  167 TYR B CE2   
3171 C CZ    . TYR B 170 ? 0.5850 0.3900 0.6662 -0.0114 -0.0907 0.1574  167 TYR B CZ    
3172 O OH    . TYR B 170 ? 0.7862 0.5538 0.8687 -0.0079 -0.1140 0.1662  167 TYR B OH    
3173 N N     . VAL B 171 ? 0.3031 0.2793 0.4052 -0.0369 -0.0025 0.1413  168 VAL B N     
3174 C CA    . VAL B 171 ? 0.2742 0.2831 0.3914 -0.0310 0.0114  0.1376  168 VAL B CA    
3175 C C     . VAL B 171 ? 0.3207 0.3282 0.4427 -0.0289 0.0074  0.1294  168 VAL B C     
3176 O O     . VAL B 171 ? 0.2512 0.2817 0.3852 -0.0227 0.0156  0.1263  168 VAL B O     
3177 C CB    . VAL B 171 ? 0.4227 0.4629 0.5463 -0.0429 0.0209  0.1495  168 VAL B CB    
3178 C CG1   . VAL B 171 ? 0.3199 0.3618 0.4424 -0.0609 0.0120  0.1584  168 VAL B CG1   
3179 C CG2   . VAL B 171 ? 0.4397 0.5104 0.5819 -0.0309 0.0355  0.1458  168 VAL B CG2   
3180 N N     . PHE B 172 ? 0.2989 0.2772 0.4096 -0.0351 -0.0061 0.1260  169 PHE B N     
3181 C CA    . PHE B 172 ? 0.3051 0.2789 0.4140 -0.0353 -0.0099 0.1154  169 PHE B CA    
3182 C C     . PHE B 172 ? 0.4090 0.3602 0.5143 -0.0188 -0.0134 0.0973  169 PHE B C     
3183 O O     . PHE B 172 ? 0.3847 0.3327 0.4857 -0.0170 -0.0146 0.0841  169 PHE B O     
3184 C CB    . PHE B 172 ? 0.5164 0.4730 0.6130 -0.0558 -0.0225 0.1216  169 PHE B CB    
3185 C CG    . PHE B 172 ? 0.4691 0.4542 0.5721 -0.0737 -0.0196 0.1409  169 PHE B CG    
3186 C CD1   . PHE B 172 ? 0.3029 0.3289 0.4225 -0.0753 -0.0100 0.1465  169 PHE B CD1   
3187 C CD2   . PHE B 172 ? 0.4842 0.4580 0.5783 -0.0892 -0.0271 0.1547  169 PHE B CD2   
3188 C CE1   . PHE B 172 ? 0.4085 0.4670 0.5396 -0.0889 -0.0062 0.1637  169 PHE B CE1   
3189 C CE2   . PHE B 172 ? 0.5101 0.5185 0.6120 -0.1061 -0.0225 0.1721  169 PHE B CE2   
3190 C CZ    . PHE B 172 ? 0.4256 0.4780 0.5480 -0.1043 -0.0111 0.1757  169 PHE B CZ    
3191 N N     . SER B 173 ? 0.3166 0.2555 0.4238 -0.0072 -0.0148 0.0965  170 SER B N     
3192 C CA    . SER B 173 ? 0.3287 0.2501 0.4380 0.0106  -0.0187 0.0807  170 SER B CA    
3193 C C     . SER B 173 ? 0.3143 0.2670 0.4349 0.0235  -0.0063 0.0706  170 SER B C     
3194 O O     . SER B 173 ? 0.3983 0.3485 0.5231 0.0377  -0.0063 0.0555  170 SER B O     
3195 C CB    . SER B 173 ? 0.3799 0.2793 0.4898 0.0168  -0.0279 0.0871  170 SER B CB    
3196 O OG    . SER B 173 ? 0.4362 0.3023 0.5336 0.0030  -0.0427 0.0971  170 SER B OG    
3197 N N     . LEU B 174 ? 0.2708 0.2536 0.3972 0.0183  0.0038  0.0793  171 LEU B N     
3198 C CA    . LEU B 174 ? 0.4107 0.4218 0.5456 0.0254  0.0131  0.0735  171 LEU B CA    
3199 C C     . LEU B 174 ? 0.3589 0.3943 0.4986 0.0157  0.0196  0.0841  171 LEU B C     
3200 O O     . LEU B 174 ? 0.3669 0.4035 0.5083 0.0091  0.0208  0.0959  171 LEU B O     
3201 C CB    . LEU B 174 ? 0.2817 0.2990 0.4241 0.0368  0.0156  0.0738  171 LEU B CB    
3202 C CG    . LEU B 174 ? 0.2859 0.3112 0.4298 0.0329  0.0205  0.0865  171 LEU B CG    
3203 C CD1   . LEU B 174 ? 0.2767 0.3100 0.4254 0.0413  0.0217  0.0852  171 LEU B CD1   
3204 C CD2   . LEU B 174 ? 0.2964 0.3033 0.4322 0.0251  0.0160  0.0961  171 LEU B CD2   
3205 N N     . PRO B 175 ? 0.3268 0.3838 0.4696 0.0147  0.0234  0.0804  172 PRO B N     
3206 C CA    . PRO B 175 ? 0.2367 0.3158 0.3873 0.0065  0.0265  0.0921  172 PRO B CA    
3207 C C     . PRO B 175 ? 0.1869 0.2710 0.3478 0.0108  0.0318  0.1025  172 PRO B C     
3208 O O     . PRO B 175 ? 0.2701 0.3552 0.4329 0.0184  0.0349  0.1005  172 PRO B O     
3209 C CB    . PRO B 175 ? 0.2838 0.3833 0.4346 0.0061  0.0284  0.0869  172 PRO B CB    
3210 C CG    . PRO B 175 ? 0.3385 0.4287 0.4783 0.0104  0.0271  0.0692  172 PRO B CG    
3211 C CD    . PRO B 175 ? 0.2939 0.3584 0.4339 0.0209  0.0247  0.0655  172 PRO B CD    
3212 N N     . VAL B 176 ? 0.1864 0.2745 0.3532 0.0054  0.0332  0.1127  173 VAL B N     
3213 C CA    . VAL B 176 ? 0.2024 0.2982 0.3796 0.0107  0.0405  0.1197  173 VAL B CA    
3214 C C     . VAL B 176 ? 0.2193 0.3376 0.4141 0.0084  0.0415  0.1297  173 VAL B C     
3215 O O     . VAL B 176 ? 0.2036 0.3343 0.4063 0.0012  0.0405  0.1378  173 VAL B O     
3216 C CB    . VAL B 176 ? 0.2709 0.3594 0.4436 0.0080  0.0435  0.1231  173 VAL B CB    
3217 C CG1   . VAL B 176 ? 0.2021 0.3003 0.3836 0.0146  0.0538  0.1260  173 VAL B CG1   
3218 C CG2   . VAL B 176 ? 0.2081 0.2725 0.3646 0.0091  0.0387  0.1167  173 VAL B CG2   
3219 N N     . VAL B 177 ? 0.2768 0.4011 0.4789 0.0134  0.0415  0.1312  174 VAL B N     
3220 C CA    . VAL B 177 ? 0.2235 0.3670 0.4435 0.0111  0.0382  0.1428  174 VAL B CA    
3221 C C     . VAL B 177 ? 0.2014 0.3495 0.4411 0.0222  0.0445  0.1487  174 VAL B C     
3222 O O     . VAL B 177 ? 0.3172 0.4506 0.5537 0.0315  0.0493  0.1429  174 VAL B O     
3223 C CB    . VAL B 177 ? 0.1561 0.3035 0.3727 0.0075  0.0319  0.1438  174 VAL B CB    
3224 C CG1   . VAL B 177 ? 0.1904 0.3564 0.4252 0.0029  0.0249  0.1594  174 VAL B CG1   
3225 C CG2   . VAL B 177 ? 0.1607 0.3075 0.3582 -0.0010 0.0287  0.1340  174 VAL B CG2   
3226 N N     . LEU B 178 ? 0.2861 0.4555 0.5466 0.0211  0.0442  0.1594  175 LEU B N     
3227 C CA    . LEU B 178 ? 0.1848 0.3636 0.4706 0.0349  0.0505  0.1643  175 LEU B CA    
3228 C C     . LEU B 178 ? 0.2150 0.3980 0.5184 0.0378  0.0406  0.1753  175 LEU B C     
3229 O O     . LEU B 178 ? 0.3733 0.5742 0.6847 0.0269  0.0300  0.1878  175 LEU B O     
3230 C CB    . LEU B 178 ? 0.1772 0.3842 0.4822 0.0333  0.0555  0.1719  175 LEU B CB    
3231 C CG    . LEU B 178 ? 0.2722 0.4774 0.5598 0.0262  0.0630  0.1653  175 LEU B CG    
3232 C CD1   . LEU B 178 ? 0.1824 0.4226 0.4903 0.0199  0.0660  0.1766  175 LEU B CD1   
3233 C CD2   . LEU B 178 ? 0.1974 0.3845 0.4725 0.0371  0.0751  0.1522  175 LEU B CD2   
3234 N N     . SER B 179 ? 0.1731 0.3374 0.4805 0.0504  0.0423  0.1717  176 SER B N     
3235 C CA    . SER B 179 ? 0.2590 0.4191 0.5786 0.0509  0.0297  0.1834  176 SER B CA    
3236 C C     . SER B 179 ? 0.2394 0.3826 0.5783 0.0704  0.0322  0.1822  176 SER B C     
3237 O O     . SER B 179 ? 0.2372 0.3645 0.5690 0.0820  0.0450  0.1671  176 SER B O     
3238 C CB    . SER B 179 ? 0.1759 0.3215 0.4686 0.0382  0.0223  0.1807  176 SER B CB    
3239 O OG    . SER B 179 ? 0.2786 0.4157 0.5791 0.0367  0.0098  0.1925  176 SER B OG    
3240 N N     . GLY B 180 ? 0.2400 0.3845 0.6019 0.0732  0.0188  0.1980  177 GLY B N     
3241 C CA    . GLY B 180 ? 0.2311 0.3501 0.6100 0.0917  0.0169  0.1970  177 GLY B CA    
3242 C C     . GLY B 180 ? 0.2440 0.3261 0.5943 0.0848  0.0108  0.1911  177 GLY B C     
3243 O O     . GLY B 180 ? 0.2471 0.3325 0.5724 0.0654  0.0054  0.1932  177 GLY B O     
3244 N N     . ARG B 181 ? 0.4409 0.4889 0.7946 0.1002  0.0120  0.1829  178 ARG B N     
3245 C CA    . ARG B 181 ? 0.2897 0.3007 0.6150 0.0917  0.0052  0.1777  178 ARG B CA    
3246 C C     . ARG B 181 ? 0.2932 0.3032 0.6144 0.0718  -0.0167 0.1989  178 ARG B C     
3247 O O     . ARG B 181 ? 0.4042 0.4139 0.6979 0.0530  -0.0203 0.1986  178 ARG B O     
3248 C CB    . ARG B 181 ? 0.3492 0.3188 0.6788 0.1116  0.0083  0.1648  178 ARG B CB    
3249 C CG    . ARG B 181 ? 0.4358 0.3639 0.7333 0.1006  0.0005  0.1588  178 ARG B CG    
3250 C CD    . ARG B 181 ? 0.6955 0.5794 0.9904 0.1202  0.0069  0.1400  178 ARG B CD    
3251 N NE    . ARG B 181 ? 0.8657 0.7579 1.1483 0.1302  0.0307  0.1164  178 ARG B NE    
3252 C CZ    . ARG B 181 ? 0.7840 0.6967 1.0907 0.1512  0.0473  0.1070  178 ARG B CZ    
3253 N NH1   . ARG B 181 ? 0.9093 0.8366 1.2576 0.1669  0.0424  0.1189  178 ARG B NH1   
3254 N NH2   . ARG B 181 ? 0.5213 0.4433 0.8113 0.1551  0.0681  0.0871  178 ARG B NH2   
3255 N N     . GLU B 182 ? 0.3969 0.4104 0.7469 0.0753  -0.0315 0.2184  179 GLU B N     
3256 C CA    . GLU B 182 ? 0.4999 0.5135 0.8461 0.0541  -0.0544 0.2419  179 GLU B CA    
3257 C C     . GLU B 182 ? 0.4364 0.4898 0.7638 0.0294  -0.0544 0.2479  179 GLU B C     
3258 O O     . GLU B 182 ? 0.4714 0.5264 0.7761 0.0074  -0.0638 0.2553  179 GLU B O     
3259 C CB    . GLU B 182 ? 0.4956 0.5087 0.8798 0.0631  -0.0718 0.2642  179 GLU B CB    
3260 C CG    . GLU B 182 ? 0.7917 0.7581 1.1957 0.0874  -0.0769 0.2602  179 GLU B CG    
3261 C CD    . GLU B 182 ? 1.0003 0.9715 1.4306 0.1196  -0.0563 0.2408  179 GLU B CD    
3262 O OE1   . GLU B 182 ? 0.9138 0.9204 1.3403 0.1201  -0.0370 0.2292  179 GLU B OE1   
3263 O OE2   . GLU B 182 ? 1.0416 0.9810 1.4965 0.1442  -0.0595 0.2370  179 GLU B OE2   
3264 N N     . GLU B 183 ? 0.3207 0.4065 0.6569 0.0325  -0.0437 0.2440  180 GLU B N     
3265 C CA    . GLU B 183 ? 0.2384 0.3577 0.5561 0.0115  -0.0429 0.2459  180 GLU B CA    
3266 C C     . GLU B 183 ? 0.3600 0.4757 0.6449 0.0036  -0.0319 0.2276  180 GLU B C     
3267 O O     . GLU B 183 ? 0.4229 0.5552 0.6879 -0.0161 -0.0363 0.2307  180 GLU B O     
3268 C CB    . GLU B 183 ? 0.3730 0.5205 0.7054 0.0166  -0.0343 0.2438  180 GLU B CB    
3269 C CG    . GLU B 183 ? 0.5391 0.7014 0.9081 0.0223  -0.0465 0.2648  180 GLU B CG    
3270 C CD    . GLU B 183 ? 0.7214 0.9146 1.1060 0.0258  -0.0380 0.2637  180 GLU B CD    
3271 O OE1   . GLU B 183 ? 0.7204 0.9164 1.0879 0.0266  -0.0220 0.2453  180 GLU B OE1   
3272 O OE2   . GLU B 183 ? 0.7524 0.9675 1.1672 0.0263  -0.0492 0.2832  180 GLU B OE2   
3273 N N     . ALA B 184 ? 0.2231 0.3200 0.5031 0.0191  -0.0175 0.2089  181 ALA B N     
3274 C CA    . ALA B 184 ? 0.3265 0.4193 0.5797 0.0139  -0.0087 0.1932  181 ALA B CA    
3275 C C     . ALA B 184 ? 0.2452 0.3269 0.4833 0.0000  -0.0195 0.1995  181 ALA B C     
3276 O O     . ALA B 184 ? 0.3989 0.4990 0.6195 -0.0140 -0.0188 0.1968  181 ALA B O     
3277 C CB    . ALA B 184 ? 0.2220 0.2947 0.4725 0.0308  0.0055  0.1756  181 ALA B CB    
3278 N N     . ILE B 185 ? 0.3556 0.4078 0.6015 0.0040  -0.0298 0.2079  182 ILE B N     
3279 C CA    . ILE B 185 ? 0.5206 0.5583 0.7518 -0.0122 -0.0432 0.2171  182 ILE B CA    
3280 C C     . ILE B 185 ? 0.4129 0.4826 0.6393 -0.0363 -0.0553 0.2354  182 ILE B C     
3281 O O     . ILE B 185 ? 0.4849 0.5690 0.6926 -0.0546 -0.0579 0.2371  182 ILE B O     
3282 C CB    . ILE B 185 ? 0.4567 0.4500 0.6982 -0.0036 -0.0555 0.2242  182 ILE B CB    
3283 C CG1   . ILE B 185 ? 0.4361 0.3963 0.6720 0.0156  -0.0425 0.2023  182 ILE B CG1   
3284 C CG2   . ILE B 185 ? 0.4504 0.4306 0.6777 -0.0267 -0.0750 0.2409  182 ILE B CG2   
3285 C CD1   . ILE B 185 ? 0.5369 0.4478 0.7814 0.0278  -0.0523 0.2034  182 ILE B CD1   
3286 N N     . ALA B 186 ? 0.3493 0.4340 0.5926 -0.0375 -0.0627 0.2494  183 ALA B N     
3287 C CA    . ALA B 186 ? 0.3585 0.4752 0.5948 -0.0628 -0.0748 0.2677  183 ALA B CA    
3288 C C     . ALA B 186 ? 0.3541 0.5088 0.5697 -0.0738 -0.0613 0.2537  183 ALA B C     
3289 O O     . ALA B 186 ? 0.3845 0.5636 0.5829 -0.0961 -0.0658 0.2598  183 ALA B O     
3290 C CB    . ALA B 186 ? 0.3039 0.4305 0.5627 -0.0611 -0.0850 0.2847  183 ALA B CB    
3291 N N     . PHE B 187 ? 0.2410 0.4009 0.4589 -0.0583 -0.0450 0.2346  184 PHE B N     
3292 C CA    . PHE B 187 ? 0.2537 0.4418 0.4544 -0.0639 -0.0324 0.2183  184 PHE B CA    
3293 C C     . PHE B 187 ? 0.2400 0.4309 0.4260 -0.0672 -0.0267 0.2080  184 PHE B C     
3294 O O     . PHE B 187 ? 0.4216 0.6441 0.5939 -0.0821 -0.0246 0.2056  184 PHE B O     
3295 C CB    . PHE B 187 ? 0.2841 0.4678 0.4904 -0.0464 -0.0191 0.2017  184 PHE B CB    
3296 C CG    . PHE B 187 ? 0.3137 0.5138 0.5037 -0.0469 -0.0069 0.1820  184 PHE B CG    
3297 C CD1   . PHE B 187 ? 0.2665 0.4961 0.4431 -0.0621 -0.0069 0.1797  184 PHE B CD1   
3298 C CD2   . PHE B 187 ? 0.2572 0.4422 0.4448 -0.0320 0.0038  0.1655  184 PHE B CD2   
3299 C CE1   . PHE B 187 ? 0.2792 0.5204 0.4428 -0.0590 0.0045  0.1589  184 PHE B CE1   
3300 C CE2   . PHE B 187 ? 0.2238 0.4209 0.4004 -0.0300 0.0127  0.1484  184 PHE B CE2   
3301 C CZ    . PHE B 187 ? 0.2363 0.4602 0.4021 -0.0417 0.0135  0.1439  184 PHE B CZ    
3302 N N     . ILE B 188 ? 0.2762 0.4371 0.4652 -0.0536 -0.0237 0.2015  185 ILE B N     
3303 C CA    . ILE B 188 ? 0.3438 0.5071 0.5209 -0.0571 -0.0202 0.1937  185 ILE B CA    
3304 C C     . ILE B 188 ? 0.4039 0.5836 0.5725 -0.0811 -0.0327 0.2102  185 ILE B C     
3305 O O     . ILE B 188 ? 0.3258 0.5369 0.4851 -0.0919 -0.0286 0.2061  185 ILE B O     
3306 C CB    . ILE B 188 ? 0.2640 0.3883 0.4422 -0.0428 -0.0183 0.1868  185 ILE B CB    
3307 C CG1   . ILE B 188 ? 0.3413 0.4558 0.5248 -0.0227 -0.0050 0.1709  185 ILE B CG1   
3308 C CG2   . ILE B 188 ? 0.3012 0.4297 0.4671 -0.0509 -0.0187 0.1832  185 ILE B CG2   
3309 C CD1   . ILE B 188 ? 0.3034 0.3821 0.4852 -0.0099 -0.0016 0.1632  185 ILE B CD1   
3310 N N     . ARG B 189 ? 0.4057 0.5656 0.5793 -0.0894 -0.0487 0.2300  186 ARG B N     
3311 C CA    . ARG B 189 ? 0.3254 0.4963 0.4900 -0.1160 -0.0646 0.2507  186 ARG B CA    
3312 C C     . ARG B 189 ? 0.3799 0.6046 0.5345 -0.1369 -0.0626 0.2552  186 ARG B C     
3313 O O     . ARG B 189 ? 0.3655 0.6225 0.5081 -0.1549 -0.0615 0.2569  186 ARG B O     
3314 C CB    . ARG B 189 ? 0.4346 0.5694 0.6094 -0.1188 -0.0846 0.2724  186 ARG B CB    
3315 C CG    . ARG B 189 ? 0.6378 0.7786 0.8021 -0.1497 -0.1055 0.2984  186 ARG B CG    
3316 C CD    . ARG B 189 ? 0.7339 0.8374 0.9117 -0.1509 -0.1281 0.3219  186 ARG B CD    
3317 N NE    . ARG B 189 ? 0.8770 1.0028 1.0668 -0.1513 -0.1311 0.3319  186 ARG B NE    
3318 C CZ    . ARG B 189 ? 0.8882 0.9953 1.1013 -0.1267 -0.1289 0.3283  186 ARG B CZ    
3319 N NH1   . ARG B 189 ? 1.0953 1.1617 1.3214 -0.0988 -0.1217 0.3132  186 ARG B NH1   
3320 N NH2   . ARG B 189 ? 0.5323 0.6648 0.7552 -0.1317 -0.1339 0.3402  186 ARG B NH2   
3321 N N     . ASP B 190 ? 0.3538 0.5906 0.5126 -0.1356 -0.0616 0.2567  187 ASP B N     
3322 C CA    . ASP B 190 ? 0.4627 0.7471 0.6079 -0.1581 -0.0613 0.2615  187 ASP B CA    
3323 C C     . ASP B 190 ? 0.4006 0.7198 0.5363 -0.1516 -0.0400 0.2346  187 ASP B C     
3324 O O     . ASP B 190 ? 0.4385 0.8000 0.5596 -0.1688 -0.0357 0.2322  187 ASP B O     
3325 C CB    . ASP B 190 ? 0.3149 0.5977 0.4666 -0.1619 -0.0712 0.2750  187 ASP B CB    
3326 C CG    . ASP B 190 ? 0.5404 0.7908 0.7058 -0.1670 -0.0945 0.3034  187 ASP B CG    
3327 O OD1   . ASP B 190 ? 0.5338 0.7707 0.6950 -0.1787 -0.1061 0.3165  187 ASP B OD1   
3328 O OD2   . ASP B 190 ? 0.4497 0.6880 0.6315 -0.1592 -0.1024 0.3132  187 ASP B OD2   
3329 N N     . SER B 191 ? 0.3439 0.6444 0.4870 -0.1271 -0.0272 0.2142  188 SER B N     
3330 C CA    . SER B 191 ? 0.4115 0.7366 0.5498 -0.1163 -0.0091 0.1885  188 SER B CA    
3331 C C     . SER B 191 ? 0.4709 0.8250 0.6064 -0.1211 -0.0030 0.1825  188 SER B C     
3332 O O     . SER B 191 ? 0.3888 0.7711 0.5228 -0.1131 0.0113  0.1622  188 SER B O     
3333 C CB    . SER B 191 ? 0.4829 0.7744 0.6314 -0.0890 -0.0007 0.1720  188 SER B CB    
3334 O OG    . SER B 191 ? 0.7018 1.0106 0.8457 -0.0790 0.0133  0.1489  188 SER B OG    
3335 N N     . GLY B 192 ? 0.2213 0.5680 0.3573 -0.1340 -0.0149 0.2005  189 GLY B N     
3336 C CA    . GLY B 192 ? 0.2224 0.6001 0.3572 -0.1426 -0.0118 0.1996  189 GLY B CA    
3337 C C     . GLY B 192 ? 0.4251 0.7799 0.5697 -0.1220 -0.0068 0.1875  189 GLY B C     
3338 O O     . GLY B 192 ? 0.5329 0.9156 0.6803 -0.1263 -0.0040 0.1856  189 GLY B O     
3339 N N     . MET B 193 ? 0.2450 0.5527 0.3948 -0.1013 -0.0062 0.1806  190 MET B N     
3340 C CA    . MET B 193 ? 0.3059 0.5894 0.4612 -0.0840 -0.0025 0.1703  190 MET B CA    
3341 C C     . MET B 193 ? 0.3150 0.5674 0.4656 -0.0937 -0.0158 0.1845  190 MET B C     
3342 O O     . MET B 193 ? 0.3625 0.5930 0.5088 -0.1058 -0.0283 0.2005  190 MET B O     
3343 C CB    . MET B 193 ? 0.1974 0.4470 0.3571 -0.0611 0.0042  0.1574  190 MET B CB    
3344 C CG    . MET B 193 ? 0.3829 0.6542 0.5450 -0.0504 0.0161  0.1406  190 MET B CG    
3345 S SD    . MET B 193 ? 0.4432 0.6750 0.6091 -0.0281 0.0215  0.1286  190 MET B SD    
3346 C CE    . MET B 193 ? 0.3168 0.5241 0.4839 -0.0341 0.0132  0.1443  190 MET B CE    
3347 N N     . GLN B 194 ? 0.3215 0.5698 0.4727 -0.0888 -0.0147 0.1789  191 GLN B N     
3348 C CA    . GLN B 194 ? 0.2998 0.5147 0.4421 -0.0990 -0.0274 0.1892  191 GLN B CA    
3349 C C     . GLN B 194 ? 0.4237 0.5862 0.5625 -0.0805 -0.0253 0.1792  191 GLN B C     
3350 O O     . GLN B 194 ? 0.4200 0.5824 0.5608 -0.0668 -0.0174 0.1666  191 GLN B O     
3351 C CB    . GLN B 194 ? 0.2321 0.4800 0.3746 -0.1111 -0.0300 0.1923  191 GLN B CB    
3352 C CG    . GLN B 194 ? 0.2586 0.4704 0.3877 -0.1249 -0.0446 0.2022  191 GLN B CG    
3353 C CD    . GLN B 194 ? 0.3180 0.5689 0.4492 -0.1397 -0.0487 0.2080  191 GLN B CD    
3354 O OE1   . GLN B 194 ? 0.4825 0.7888 0.6295 -0.1347 -0.0386 0.2025  191 GLN B OE1   
3355 N NE2   . GLN B 194 ? 0.3817 0.6042 0.4980 -0.1579 -0.0639 0.2187  191 GLN B NE2   
3356 N N     . LEU B 195 ? 0.2534 0.3731 0.3878 -0.0800 -0.0327 0.1850  192 LEU B N     
3357 C CA    . LEU B 195 ? 0.3718 0.4453 0.5025 -0.0627 -0.0287 0.1741  192 LEU B CA    
3358 C C     . LEU B 195 ? 0.3198 0.3697 0.4349 -0.0687 -0.0338 0.1710  192 LEU B C     
3359 O O     . LEU B 195 ? 0.3909 0.4273 0.4953 -0.0871 -0.0476 0.1820  192 LEU B O     
3360 C CB    . LEU B 195 ? 0.3962 0.4336 0.5306 -0.0585 -0.0351 0.1805  192 LEU B CB    
3361 C CG    . LEU B 195 ? 0.4804 0.4748 0.6139 -0.0388 -0.0285 0.1676  192 LEU B CG    
3362 C CD1   . LEU B 195 ? 0.3931 0.4040 0.5338 -0.0215 -0.0120 0.1539  192 LEU B CD1   
3363 C CD2   . LEU B 195 ? 0.5081 0.4737 0.6524 -0.0327 -0.0360 0.1753  192 LEU B CD2   
3364 N N     . MET B 196 ? 0.4216 0.4662 0.5334 -0.0558 -0.0244 0.1574  193 MET B N     
3365 C CA    . MET B 196 ? 0.3690 0.3920 0.4630 -0.0625 -0.0293 0.1539  193 MET B CA    
3366 C C     . MET B 196 ? 0.4036 0.3831 0.4860 -0.0483 -0.0221 0.1401  193 MET B C     
3367 O O     . MET B 196 ? 0.3778 0.3636 0.4668 -0.0326 -0.0099 0.1308  193 MET B O     
3368 C CB    . MET B 196 ? 0.4399 0.5015 0.5389 -0.0637 -0.0267 0.1525  193 MET B CB    
3369 C CG    . MET B 196 ? 0.4826 0.5975 0.5972 -0.0736 -0.0291 0.1622  193 MET B CG    
3370 S SD    . MET B 196 ? 0.7559 0.8766 0.8600 -0.1046 -0.0468 0.1806  193 MET B SD    
3371 C CE    . MET B 196 ? 0.5735 0.6917 0.6663 -0.1128 -0.0538 0.1800  193 MET B CE    
3372 N N     . THR B 197 ? 0.4608 0.3962 0.5246 -0.0550 -0.0296 0.1382  194 THR B N     
3373 C CA    . THR B 197 ? 0.4773 0.3724 0.5277 -0.0419 -0.0211 0.1222  194 THR B CA    
3374 C C     . THR B 197 ? 0.4881 0.3736 0.5139 -0.0497 -0.0210 0.1142  194 THR B C     
3375 O O     . THR B 197 ? 0.6857 0.5528 0.6913 -0.0679 -0.0336 0.1176  194 THR B O     
3376 C CB    . THR B 197 ? 0.5351 0.3808 0.5777 -0.0415 -0.0284 0.1203  194 THR B CB    
3377 O OG1   . THR B 197 ? 0.6077 0.4623 0.6744 -0.0354 -0.0314 0.1312  194 THR B OG1   
3378 C CG2   . THR B 197 ? 0.6652 0.4750 0.6957 -0.0248 -0.0158 0.0998  194 THR B CG2   
3379 N N     . LEU B 198 ? 0.4754 0.3729 0.5011 -0.0387 -0.0087 0.1053  195 LEU B N     
3380 C CA    . LEU B 198 ? 0.5634 0.4532 0.5644 -0.0475 -0.0097 0.0997  195 LEU B CA    
3381 C C     . LEU B 198 ? 0.5186 0.3612 0.4906 -0.0465 -0.0044 0.0831  195 LEU B C     
3382 O O     . LEU B 198 ? 0.5402 0.3716 0.5166 -0.0296 0.0097  0.0713  195 LEU B O     
3383 C CB    . LEU B 198 ? 0.4664 0.3869 0.4774 -0.0391 -0.0017 0.0996  195 LEU B CB    
3384 C CG    . LEU B 198 ? 0.5849 0.5491 0.6183 -0.0415 -0.0084 0.1123  195 LEU B CG    
3385 C CD1   . LEU B 198 ? 0.5389 0.5266 0.6004 -0.0284 -0.0019 0.1147  195 LEU B CD1   
3386 C CD2   . LEU B 198 ? 0.5607 0.5396 0.5912 -0.0411 -0.0091 0.1134  195 LEU B CD2   
3387 N N     . LYS B 199 ? 0.6786 0.4958 0.6207 -0.0652 -0.0155 0.0814  196 LYS B N     
3388 C CA    . LYS B 199 ? 0.7108 0.4796 0.6189 -0.0665 -0.0108 0.0623  196 LYS B CA    
3389 C C     . LYS B 199 ? 0.7440 0.5015 0.6156 -0.0909 -0.0220 0.0622  196 LYS B C     
3390 O O     . LYS B 199 ? 0.7698 0.5436 0.6428 -0.1097 -0.0389 0.0786  196 LYS B O     
3391 C CB    . LYS B 199 ? 0.7370 0.4624 0.6436 -0.0634 -0.0165 0.0575  196 LYS B CB    
3392 C CG    . LYS B 199 ? 1.0726 0.7576 0.9681 -0.0446 -0.0014 0.0332  196 LYS B CG    
3393 C CD    . LYS B 199 ? 1.1287 0.8027 0.9882 -0.0486 0.0104  0.0141  196 LYS B CD    
3394 C CE    . LYS B 199 ? 0.9622 0.6774 0.8376 -0.0340 0.0296  0.0116  196 LYS B CE    
3395 N NZ    . LYS B 199 ? 0.6368 0.3513 0.4755 -0.0451 0.0376  -0.0004 196 LYS B NZ    
3396 N N     . ALA B 200 ? 0.9504 0.6836 0.7893 -0.0920 -0.0125 0.0442  197 ALA B N     
3397 C CA    . ALA B 200 ? 0.8903 0.6091 0.6882 -0.1175 -0.0231 0.0425  197 ALA B CA    
3398 C C     . ALA B 200 ? 0.8055 0.4932 0.5846 -0.1397 -0.0438 0.0479  197 ALA B C     
3399 O O     . ALA B 200 ? 0.9284 0.6253 0.6899 -0.1651 -0.0602 0.0597  197 ALA B O     
3400 C CB    . ALA B 200 ? 0.8468 0.5366 0.6072 -0.1153 -0.0075 0.0176  197 ALA B CB    
3401 N N     . ASP B 201 ? 0.7933 0.4442 0.5770 -0.1315 -0.0448 0.0410  198 ASP B N     
3402 C CA    . ASP B 201 ? 0.8931 0.5082 0.6580 -0.1542 -0.0665 0.0475  198 ASP B CA    
3403 C C     . ASP B 201 ? 0.8659 0.5087 0.6687 -0.1559 -0.0786 0.0716  198 ASP B C     
3404 O O     . ASP B 201 ? 0.9680 0.5745 0.7672 -0.1631 -0.0915 0.0750  198 ASP B O     
3405 C CB    . ASP B 201 ? 1.0643 0.6062 0.7991 -0.1485 -0.0638 0.0222  198 ASP B CB    
3406 C CG    . ASP B 201 ? 1.0792 0.6104 0.8467 -0.1156 -0.0498 0.0136  198 ASP B CG    
3407 O OD1   . ASP B 201 ? 0.8696 0.4503 0.6772 -0.0979 -0.0392 0.0242  198 ASP B OD1   
3408 O OD2   . ASP B 201 ? 1.2744 0.7461 1.0277 -0.1072 -0.0505 -0.0039 198 ASP B OD2   
3409 N N     . GLY B 202 ? 0.7794 0.4857 0.6167 -0.1502 -0.0749 0.0879  199 GLY B N     
3410 C CA    . GLY B 202 ? 0.8481 0.5907 0.7198 -0.1527 -0.0834 0.1094  199 GLY B CA    
3411 C C     . GLY B 202 ? 0.7788 0.5343 0.6414 -0.1852 -0.1060 0.1288  199 GLY B C     
3412 O O     . GLY B 202 ? 0.8766 0.6296 0.7137 -0.2047 -0.1148 0.1294  199 GLY B O     
3413 N N     . ASP B 203 ? 0.7202 0.4935 0.6035 -0.1934 -0.1161 0.1464  200 ASP B N     
3414 C CA    . ASP B 203 ? 0.8593 0.6518 0.7371 -0.2267 -0.1377 0.1676  200 ASP B CA    
3415 C C     . ASP B 203 ? 0.8895 0.7572 0.7904 -0.2318 -0.1371 0.1813  200 ASP B C     
3416 O O     . ASP B 203 ? 0.8540 0.7373 0.7427 -0.2579 -0.1525 0.1930  200 ASP B O     
3417 C CB    . ASP B 203 ? 0.6187 0.4128 0.5120 -0.2352 -0.1479 0.1838  200 ASP B CB    
3418 C CG    . ASP B 203 ? 0.9960 0.7148 0.8733 -0.2266 -0.1508 0.1723  200 ASP B CG    
3419 O OD1   . ASP B 203 ? 1.1057 0.7643 0.9505 -0.2245 -0.1506 0.1527  200 ASP B OD1   
3420 O OD2   . ASP B 203 ? 0.8968 0.6174 0.7942 -0.2217 -0.1535 0.1826  200 ASP B OD2   
3421 N N     . ILE B 204 ? 0.7484 0.6618 0.6838 -0.2065 -0.1203 0.1798  201 ILE B N     
3422 C CA    . ILE B 204 ? 0.5604 0.5460 0.5252 -0.2057 -0.1188 0.1916  201 ILE B CA    
3423 C C     . ILE B 204 ? 0.6168 0.6091 0.5818 -0.1891 -0.1093 0.1812  201 ILE B C     
3424 O O     . ILE B 204 ? 0.6956 0.6592 0.6550 -0.1680 -0.0950 0.1650  201 ILE B O     
3425 C CB    . ILE B 204 ? 0.6849 0.7198 0.6877 -0.1907 -0.1084 0.1973  201 ILE B CB    
3426 C CG1   . ILE B 204 ? 0.6755 0.7016 0.6755 -0.2088 -0.1187 0.2095  201 ILE B CG1   
3427 C CG2   . ILE B 204 ? 0.7406 0.8505 0.7751 -0.1891 -0.1070 0.2074  201 ILE B CG2   
3428 C CD1   . ILE B 204 ? 0.7040 0.7406 0.6907 -0.2453 -0.1401 0.2281  201 ILE B CD1   
3429 N N     . SER B 205 ? 0.5181 0.5511 0.4913 -0.2001 -0.1186 0.1928  202 SER B N     
3430 C CA    . SER B 205 ? 0.4373 0.4821 0.4148 -0.1865 -0.1135 0.1882  202 SER B CA    
3431 C C     . SER B 205 ? 0.5006 0.5816 0.5163 -0.1562 -0.0976 0.1843  202 SER B C     
3432 O O     . SER B 205 ? 0.3792 0.5041 0.4260 -0.1509 -0.0947 0.1910  202 SER B O     
3433 C CB    . SER B 205 ? 0.4455 0.5277 0.4268 -0.2064 -0.1310 0.2051  202 SER B CB    
3434 O OG    . SER B 205 ? 0.7944 0.8935 0.7868 -0.1920 -0.1286 0.2047  202 SER B OG    
3435 N N     . VAL B 206 ? 0.4485 0.5106 0.4592 -0.1384 -0.0875 0.1730  203 VAL B N     
3436 C CA    . VAL B 206 ? 0.4337 0.5209 0.4756 -0.1113 -0.0743 0.1684  203 VAL B CA    
3437 C C     . VAL B 206 ? 0.3839 0.5296 0.4620 -0.1058 -0.0806 0.1803  203 VAL B C     
3438 O O     . VAL B 206 ? 0.3763 0.5504 0.4851 -0.0849 -0.0712 0.1768  203 VAL B O     
3439 C CB    . VAL B 206 ? 0.4064 0.4625 0.4329 -0.0988 -0.0658 0.1574  203 VAL B CB    
3440 C CG1   . VAL B 206 ? 0.3663 0.4262 0.3811 -0.1096 -0.0784 0.1656  203 VAL B CG1   
3441 C CG2   . VAL B 206 ? 0.3791 0.4520 0.4339 -0.0733 -0.0530 0.1519  203 VAL B CG2   
3442 N N     . LYS B 207 ? 0.4560 0.6197 0.5309 -0.1245 -0.0969 0.1937  204 LYS B N     
3443 C CA    . LYS B 207 ? 0.4933 0.7160 0.6066 -0.1184 -0.1044 0.2062  204 LYS B CA    
3444 C C     . LYS B 207 ? 0.4981 0.7732 0.6431 -0.1170 -0.1002 0.2107  204 LYS B C     
3445 O O     . LYS B 207 ? 0.4916 0.8226 0.6760 -0.1045 -0.1005 0.2161  204 LYS B O     
3446 C CB    . LYS B 207 ? 0.6122 0.8429 0.7133 -0.1423 -0.1250 0.2220  204 LYS B CB    
3447 C CG    . LYS B 207 ? 0.6959 0.9695 0.8320 -0.1299 -0.1343 0.2336  204 LYS B CG    
3448 C CD    . LYS B 207 ? 0.6614 0.9008 0.7886 -0.1132 -0.1308 0.2264  204 LYS B CD    
3449 C CE    . LYS B 207 ? 0.6825 0.9574 0.8446 -0.1008 -0.1440 0.2402  204 LYS B CE    
3450 N NZ    . LYS B 207 ? 0.5462 0.7846 0.6969 -0.0883 -0.1433 0.2361  204 LYS B NZ    
3451 N N     . GLU B 208 ? 0.4879 0.7454 0.6158 -0.1297 -0.0965 0.2083  205 GLU B N     
3452 C CA    . GLU B 208 ? 0.4445 0.7514 0.5954 -0.1352 -0.0937 0.2147  205 GLU B CA    
3453 C C     . GLU B 208 ? 0.3438 0.6585 0.5114 -0.1120 -0.0752 0.2015  205 GLU B C     
3454 O O     . GLU B 208 ? 0.2890 0.6473 0.4745 -0.1149 -0.0700 0.2046  205 GLU B O     
3455 C CB    . GLU B 208 ? 0.3610 0.6460 0.4837 -0.1670 -0.1045 0.2240  205 GLU B CB    
3456 C CG    . GLU B 208 ? 0.6071 0.8824 0.7084 -0.1951 -0.1247 0.2371  205 GLU B CG    
3457 C CD    . GLU B 208 ? 0.7300 0.9682 0.7976 -0.2266 -0.1370 0.2440  205 GLU B CD    
3458 O OE1   . GLU B 208 ? 0.6769 0.9114 0.7456 -0.2282 -0.1318 0.2437  205 GLU B OE1   
3459 O OE2   . GLU B 208 ? 0.7921 1.0023 0.8305 -0.2510 -0.1535 0.2504  205 GLU B OE2   
3460 N N     . LEU B 209 ? 0.3783 0.6531 0.5380 -0.0915 -0.0657 0.1875  206 LEU B N     
3461 C CA    . LEU B 209 ? 0.3504 0.6269 0.5217 -0.0717 -0.0498 0.1751  206 LEU B CA    
3462 C C     . LEU B 209 ? 0.3006 0.6353 0.5099 -0.0533 -0.0423 0.1713  206 LEU B C     
3463 O O     . LEU B 209 ? 0.2243 0.5810 0.4443 -0.0463 -0.0310 0.1643  206 LEU B O     
3464 C CB    . LEU B 209 ? 0.3251 0.5500 0.4808 -0.0561 -0.0428 0.1628  206 LEU B CB    
3465 C CG    . LEU B 209 ? 0.4388 0.6068 0.5606 -0.0666 -0.0433 0.1598  206 LEU B CG    
3466 C CD1   . LEU B 209 ? 0.2954 0.4274 0.4079 -0.0501 -0.0342 0.1481  206 LEU B CD1   
3467 C CD2   . LEU B 209 ? 0.3648 0.5306 0.4841 -0.0744 -0.0405 0.1614  206 LEU B CD2   
3468 N N     . GLY B 210 ? 0.2092 0.5685 0.4385 -0.0451 -0.0490 0.1755  207 GLY B N     
3469 C CA    . GLY B 210 ? 0.2870 0.6987 0.5559 -0.0229 -0.0423 0.1696  207 GLY B CA    
3470 C C     . GLY B 210 ? 0.3253 0.8028 0.6148 -0.0315 -0.0370 0.1733  207 GLY B C     
3471 O O     . GLY B 210 ? 0.4701 0.9916 0.7886 -0.0122 -0.0253 0.1625  207 GLY B O     
3472 N N     . ASP B 211 ? 0.3206 0.8044 0.5933 -0.0617 -0.0457 0.1880  208 ASP B N     
3473 C CA    . ASP B 211 ? 0.3387 0.8880 0.6273 -0.0771 -0.0428 0.1960  208 ASP B CA    
3474 C C     . ASP B 211 ? 0.2442 0.7920 0.5207 -0.0809 -0.0302 0.1883  208 ASP B C     
3475 O O     . ASP B 211 ? 0.2026 0.8114 0.4949 -0.0873 -0.0224 0.1896  208 ASP B O     
3476 C CB    . ASP B 211 ? 0.5387 1.0932 0.8120 -0.1125 -0.0608 0.2179  208 ASP B CB    
3477 C CG    . ASP B 211 ? 0.7631 1.3238 1.0466 -0.1136 -0.0756 0.2282  208 ASP B CG    
3478 O OD1   . ASP B 211 ? 0.8085 1.4027 1.1267 -0.0879 -0.0719 0.2230  208 ASP B OD1   
3479 O OD2   . ASP B 211 ? 0.8117 1.3420 1.0678 -0.1406 -0.0923 0.2417  208 ASP B OD2   
3480 N N     . ASN B 212 ? 0.2407 0.7228 0.4897 -0.0779 -0.0285 0.1813  209 ASN B N     
3481 C CA    . ASN B 212 ? 0.1885 0.6628 0.4239 -0.0841 -0.0205 0.1777  209 ASN B CA    
3482 C C     . ASN B 212 ? 0.1726 0.6790 0.4267 -0.0613 -0.0027 0.1597  209 ASN B C     
3483 O O     . ASN B 212 ? 0.4103 0.8919 0.6703 -0.0357 0.0035  0.1448  209 ASN B O     
3484 C CB    . ASN B 212 ? 0.2523 0.6497 0.4577 -0.0858 -0.0247 0.1763  209 ASN B CB    
3485 C CG    . ASN B 212 ? 0.3521 0.7386 0.5416 -0.1023 -0.0252 0.1826  209 ASN B CG    
3486 O OD1   . ASN B 212 ? 0.3895 0.8183 0.5881 -0.1045 -0.0168 0.1810  209 ASN B OD1   
3487 N ND2   . ASN B 212 ? 0.2880 0.6172 0.4533 -0.1141 -0.0355 0.1894  209 ASN B ND2   
3488 N N     . PRO B 213 ? 0.2435 0.8046 0.5042 -0.0726 0.0049  0.1610  210 PRO B N     
3489 C CA    . PRO B 213 ? 0.1939 0.7912 0.4687 -0.0540 0.0229  0.1415  210 PRO B CA    
3490 C C     . PRO B 213 ? 0.2334 0.7913 0.4857 -0.0534 0.0283  0.1337  210 PRO B C     
3491 O O     . PRO B 213 ? 0.2494 0.8238 0.5071 -0.0378 0.0421  0.1153  210 PRO B O     
3492 C CB    . PRO B 213 ? 0.1672 0.8447 0.4537 -0.0734 0.0279  0.1490  210 PRO B CB    
3493 C CG    . PRO B 213 ? 0.1793 0.8426 0.4447 -0.1093 0.0109  0.1751  210 PRO B CG    
3494 C CD    . PRO B 213 ? 0.2603 0.8536 0.5130 -0.1069 -0.0040 0.1816  210 PRO B CD    
3495 N N     . ASP B 214 ? 0.1863 0.6929 0.4145 -0.0697 0.0170  0.1471  211 ASP B N     
3496 C CA    . ASP B 214 ? 0.1935 0.6672 0.4040 -0.0712 0.0196  0.1440  211 ASP B CA    
3497 C C     . ASP B 214 ? 0.2480 0.6674 0.4557 -0.0473 0.0225  0.1307  211 ASP B C     
3498 O O     . ASP B 214 ? 0.2238 0.6171 0.4360 -0.0349 0.0187  0.1286  211 ASP B O     
3499 C CB    . ASP B 214 ? 0.1859 0.6307 0.3762 -0.0979 0.0052  0.1653  211 ASP B CB    
3500 C CG    . ASP B 214 ? 0.3648 0.8618 0.5536 -0.1273 0.0004  0.1817  211 ASP B CG    
3501 O OD1   . ASP B 214 ? 0.4424 0.9966 0.6380 -0.1300 0.0120  0.1753  211 ASP B OD1   
3502 O OD2   . ASP B 214 ? 0.4397 0.9205 0.6186 -0.1492 -0.0152 0.2007  211 ASP B OD2   
3503 N N     . ARG B 215 ? 0.1644 0.5697 0.3634 -0.0436 0.0283  0.1234  212 ARG B N     
3504 C CA    . ARG B 215 ? 0.3230 0.6780 0.5173 -0.0265 0.0295  0.1146  212 ARG B CA    
3505 C C     . ARG B 215 ? 0.2546 0.5608 0.4363 -0.0346 0.0189  0.1282  212 ARG B C     
3506 O O     . ARG B 215 ? 0.3621 0.6622 0.5346 -0.0515 0.0124  0.1412  212 ARG B O     
3507 C CB    . ARG B 215 ? 0.1613 0.5191 0.3495 -0.0239 0.0371  0.1046  212 ARG B CB    
3508 C CG    . ARG B 215 ? 0.2234 0.5354 0.4081 -0.0083 0.0381  0.0963  212 ARG B CG    
3509 C CD    . ARG B 215 ? 0.1633 0.4804 0.3407 -0.0088 0.0440  0.0869  212 ARG B CD    
3510 N NE    . ARG B 215 ? 0.2481 0.5256 0.4232 0.0042  0.0442  0.0797  212 ARG B NE    
3511 C CZ    . ARG B 215 ? 0.3726 0.6445 0.5397 0.0034  0.0468  0.0723  212 ARG B CZ    
3512 N NH1   . ARG B 215 ? 0.3364 0.6390 0.4950 -0.0094 0.0501  0.0699  212 ARG B NH1   
3513 N NH2   . ARG B 215 ? 0.4128 0.6500 0.5782 0.0126  0.0455  0.0683  212 ARG B NH2   
3514 N N     . LEU B 216 ? 0.2362 0.5073 0.4174 -0.0225 0.0169  0.1248  213 LEU B N     
3515 C CA    . LEU B 216 ? 0.1748 0.4019 0.3433 -0.0285 0.0089  0.1337  213 LEU B CA    
3516 C C     . LEU B 216 ? 0.3409 0.5295 0.5043 -0.0180 0.0124  0.1291  213 LEU B C     
3517 O O     . LEU B 216 ? 0.4025 0.5884 0.5705 -0.0042 0.0192  0.1187  213 LEU B O     
3518 C CB    . LEU B 216 ? 0.2873 0.5037 0.4539 -0.0271 0.0038  0.1345  213 LEU B CB    
3519 C CG    . LEU B 216 ? 0.3353 0.5688 0.4988 -0.0466 -0.0064 0.1471  213 LEU B CG    
3520 C CD1   . LEU B 216 ? 0.2621 0.5488 0.4358 -0.0584 -0.0050 0.1526  213 LEU B CD1   
3521 C CD2   . LEU B 216 ? 0.3237 0.5620 0.4906 -0.0437 -0.0109 0.1469  213 LEU B CD2   
3522 N N     . ALA B 217 ? 0.2178 0.3774 0.3732 -0.0248 0.0070  0.1374  214 ALA B N     
3523 C CA    . ALA B 217 ? 0.1903 0.3157 0.3438 -0.0141 0.0105  0.1338  214 ALA B CA    
3524 C C     . ALA B 217 ? 0.2051 0.2955 0.3469 -0.0128 0.0081  0.1322  214 ALA B C     
3525 O O     . ALA B 217 ? 0.3512 0.4209 0.4852 -0.0216 0.0006  0.1386  214 ALA B O     
3526 C CB    . ALA B 217 ? 0.1931 0.3131 0.3501 -0.0192 0.0068  0.1429  214 ALA B CB    
3527 N N     . LEU B 218 ? 0.2129 0.2950 0.3512 -0.0034 0.0133  0.1235  215 LEU B N     
3528 C CA    . LEU B 218 ? 0.3133 0.3660 0.4358 -0.0045 0.0119  0.1205  215 LEU B CA    
3529 C C     . LEU B 218 ? 0.2671 0.2899 0.3850 0.0037  0.0185  0.1152  215 LEU B C     
3530 O O     . LEU B 218 ? 0.2455 0.2711 0.3697 0.0135  0.0267  0.1108  215 LEU B O     
3531 C CB    . LEU B 218 ? 0.3618 0.4215 0.4816 -0.0007 0.0127  0.1163  215 LEU B CB    
3532 C CG    . LEU B 218 ? 0.3044 0.3994 0.4363 -0.0033 0.0077  0.1198  215 LEU B CG    
3533 C CD1   . LEU B 218 ? 0.2728 0.3714 0.4074 0.0046  0.0068  0.1166  215 LEU B CD1   
3534 C CD2   . LEU B 218 ? 0.2163 0.3188 0.3424 -0.0192 -0.0019 0.1282  215 LEU B CD2   
3535 N N     . LEU B 219 ? 0.3087 0.3033 0.4162 -0.0005 0.0147  0.1154  216 LEU B N     
3536 C CA    . LEU B 219 ? 0.4075 0.3762 0.5153 0.0101  0.0217  0.1090  216 LEU B CA    
3537 C C     . LEU B 219 ? 0.4501 0.3930 0.5363 0.0120  0.0279  0.0969  216 LEU B C     
3538 O O     . LEU B 219 ? 0.3997 0.3242 0.4655 0.0011  0.0210  0.0951  216 LEU B O     
3539 C CB    . LEU B 219 ? 0.4032 0.3527 0.5156 0.0074  0.0130  0.1157  216 LEU B CB    
3540 C CG    . LEU B 219 ? 0.5098 0.4320 0.6288 0.0220  0.0188  0.1091  216 LEU B CG    
3541 C CD1   . LEU B 219 ? 0.4144 0.3607 0.5557 0.0353  0.0291  0.1093  216 LEU B CD1   
3542 C CD2   . LEU B 219 ? 0.5477 0.4461 0.6719 0.0180  0.0052  0.1184  216 LEU B CD2   
3543 N N     . PHE B 220 ? 0.3623 0.3063 0.4514 0.0232  0.0406  0.0890  217 PHE B N     
3544 C CA    . PHE B 220 ? 0.4619 0.3867 0.5287 0.0241  0.0493  0.0764  217 PHE B CA    
3545 C C     . PHE B 220 ? 0.4363 0.3490 0.5106 0.0390  0.0619  0.0661  217 PHE B C     
3546 O O     . PHE B 220 ? 0.3809 0.3092 0.4817 0.0495  0.0652  0.0712  217 PHE B O     
3547 C CB    . PHE B 220 ? 0.3979 0.3419 0.4585 0.0210  0.0536  0.0770  217 PHE B CB    
3548 C CG    . PHE B 220 ? 0.3990 0.3564 0.4571 0.0106  0.0416  0.0860  217 PHE B CG    
3549 C CD1   . PHE B 220 ? 0.3125 0.2600 0.3470 -0.0014 0.0351  0.0853  217 PHE B CD1   
3550 C CD2   . PHE B 220 ? 0.2630 0.2452 0.3429 0.0131  0.0368  0.0944  217 PHE B CD2   
3551 C CE1   . PHE B 220 ? 0.3576 0.3225 0.3960 -0.0087 0.0235  0.0948  217 PHE B CE1   
3552 C CE2   . PHE B 220 ? 0.2526 0.2509 0.3347 0.0072  0.0274  0.1005  217 PHE B CE2   
3553 C CZ    . PHE B 220 ? 0.3758 0.3669 0.4399 -0.0026 0.0205  0.1016  217 PHE B CZ    
3554 N N     . GLY B 221 ? 0.4091 0.2959 0.4604 0.0398  0.0690  0.0512  218 GLY B N     
3555 C CA    . GLY B 221 ? 0.4543 0.3327 0.5130 0.0566  0.0839  0.0376  218 GLY B CA    
3556 C C     . GLY B 221 ? 0.6289 0.5210 0.6713 0.0562  0.1005  0.0264  218 GLY B C     
3557 O O     . GLY B 221 ? 0.5381 0.4472 0.5681 0.0432  0.0981  0.0333  218 GLY B O     
3558 N N     . SER B 222 ? 0.8214 0.7075 0.8645 0.0703  0.1169  0.0096  219 SER B N     
3559 C CA    . SER B 222 ? 0.8222 0.7261 0.8478 0.0680  0.1348  -0.0018 219 SER B CA    
3560 C C     . SER B 222 ? 0.9127 0.7840 0.8996 0.0649  0.1429  -0.0248 219 SER B C     
3561 O O     . SER B 222 ? 0.9420 0.8229 0.8994 0.0535  0.1533  -0.0332 219 SER B O     
3562 C CB    . SER B 222 ? 0.8277 0.7651 0.8866 0.0858  0.1515  -0.0038 219 SER B CB    
3563 O OG    . SER B 222 ? 0.8538 0.7744 0.9350 0.1081  0.1563  -0.0146 219 SER B OG    
3564 N N     . GLU B 223 ? 0.9871 0.8180 0.9719 0.0732  0.1368  -0.0346 220 GLU B N     
3565 C CA    . GLU B 223 ? 1.1206 0.9107 1.0653 0.0693  0.1416  -0.0584 220 GLU B CA    
3566 C C     . GLU B 223 ? 1.2319 0.9878 1.1499 0.0481  0.1184  -0.0501 220 GLU B C     
3567 O O     . GLU B 223 ? 1.2879 1.0490 1.2266 0.0433  0.1007  -0.0289 220 GLU B O     
3568 C CB    . GLU B 223 ? 1.1046 0.8674 1.0658 0.0960  0.1516  -0.0786 220 GLU B CB    
3569 C CG    . GLU B 223 ? 1.1703 0.9739 1.1754 0.1208  0.1699  -0.0799 220 GLU B CG    
3570 C CD    . GLU B 223 ? 1.2307 1.0757 1.2220 0.1169  0.1933  -0.0902 220 GLU B CD    
3571 O OE1   . GLU B 223 ? 1.2210 1.0525 1.1652 0.1008  0.1995  -0.1052 220 GLU B OE1   
3572 O OE2   . GLU B 223 ? 1.2085 1.1009 1.2347 0.1273  0.2044  -0.0818 220 GLU B OE2   
3573 N N     . LYS B 224 ? 1.2555 0.9797 1.1270 0.0336  0.1186  -0.0667 221 LYS B N     
3574 C CA    . LYS B 224 ? 1.3616 1.0553 1.2059 0.0104  0.0958  -0.0584 221 LYS B CA    
3575 C C     . LYS B 224 ? 1.4099 1.0652 1.2700 0.0179  0.0808  -0.0556 221 LYS B C     
3576 O O     . LYS B 224 ? 1.3012 0.9373 1.1484 -0.0015 0.0594  -0.0432 221 LYS B O     
3577 C CB    . LYS B 224 ? 1.5488 1.2137 1.3364 -0.0081 0.0989  -0.0783 221 LYS B CB    
3578 C CG    . LYS B 224 ? 1.6230 1.2651 1.3812 -0.0371 0.0739  -0.0664 221 LYS B CG    
3579 C CD    . LYS B 224 ? 1.6989 1.3155 1.3977 -0.0586 0.0763  -0.0852 221 LYS B CD    
3580 C CE    . LYS B 224 ? 1.7880 1.3576 1.4629 -0.0441 0.0926  -0.1211 221 LYS B CE    
3581 N NZ    . LYS B 224 ? 1.8366 1.3572 1.5250 -0.0337 0.0793  -0.1240 221 LYS B NZ    
3582 N N     . GLY B 225 ? 1.5648 1.2110 1.4542 0.0450  0.0911  -0.0655 222 GLY B N     
3583 C CA    . GLY B 225 ? 1.6648 1.2762 1.5749 0.0536  0.0753  -0.0590 222 GLY B CA    
3584 C C     . GLY B 225 ? 1.6093 1.2592 1.5678 0.0614  0.0683  -0.0327 222 GLY B C     
3585 O O     . GLY B 225 ? 1.6059 1.2384 1.5797 0.0585  0.0494  -0.0172 222 GLY B O     
3586 N N     . GLY B 226 ? 1.4508 1.1530 1.4304 0.0684  0.0824  -0.0269 223 GLY B N     
3587 C CA    . GLY B 226 ? 1.1715 0.9129 1.1920 0.0732  0.0769  -0.0036 223 GLY B CA    
3588 C C     . GLY B 226 ? 0.9512 0.7055 0.9681 0.0507  0.0575  0.0187  223 GLY B C     
3589 O O     . GLY B 226 ? 0.9355 0.6785 0.9208 0.0311  0.0499  0.0180  223 GLY B O     
3590 N N     . PRO B 227 ? 0.7688 0.5498 0.8184 0.0531  0.0496  0.0384  224 PRO B N     
3591 C CA    . PRO B 227 ? 0.6970 0.4936 0.7845 0.0738  0.0560  0.0420  224 PRO B CA    
3592 C C     . PRO B 227 ? 0.7714 0.5288 0.8721 0.0846  0.0455  0.0422  224 PRO B C     
3593 O O     . PRO B 227 ? 0.8593 0.5728 0.9366 0.0749  0.0333  0.0383  224 PRO B O     
3594 C CB    . PRO B 227 ? 0.6798 0.5173 0.7873 0.0648  0.0478  0.0638  224 PRO B CB    
3595 C CG    . PRO B 227 ? 0.6925 0.5185 0.7812 0.0434  0.0304  0.0738  224 PRO B CG    
3596 C CD    . PRO B 227 ? 0.6756 0.4738 0.7269 0.0342  0.0326  0.0587  224 PRO B CD    
3597 N N     . SER B 228 ? 0.7015 0.4738 0.8401 0.1034  0.0482  0.0484  225 SER B N     
3598 C CA    . SER B 228 ? 0.7211 0.4578 0.8798 0.1170  0.0365  0.0515  225 SER B CA    
3599 C C     . SER B 228 ? 0.7674 0.4685 0.9089 0.0959  0.0111  0.0656  225 SER B C     
3600 O O     . SER B 228 ? 0.8536 0.5805 0.9915 0.0744  -0.0002 0.0849  225 SER B O     
3601 C CB    . SER B 228 ? 0.7138 0.4855 0.9188 0.1312  0.0354  0.0680  225 SER B CB    
3602 O OG    . SER B 228 ? 0.6159 0.3531 0.8434 0.1436  0.0202  0.0753  225 SER B OG    
3603 N N     . ASP B 229 ? 0.8220 0.4642 0.9519 0.1016  0.0025  0.0550  226 ASP B N     
3604 C CA    . ASP B 229 ? 0.9332 0.5360 1.0455 0.0795  -0.0239 0.0695  226 ASP B CA    
3605 C C     . ASP B 229 ? 0.7872 0.4081 0.9300 0.0733  -0.0431 0.1002  226 ASP B C     
3606 O O     . ASP B 229 ? 0.9416 0.5496 1.0721 0.0483  -0.0653 0.1195  226 ASP B O     
3607 C CB    . ASP B 229 ? 1.1371 0.6656 1.2331 0.0896  -0.0305 0.0509  226 ASP B CB    
3608 C CG    . ASP B 229 ? 1.2794 0.7872 1.3368 0.0905  -0.0130 0.0196  226 ASP B CG    
3609 O OD1   . ASP B 229 ? 1.3737 0.8502 1.4323 0.1161  0.0007  -0.0068 226 ASP B OD1   
3610 O OD2   . ASP B 229 ? 1.2561 0.7814 1.2825 0.0657  -0.0128 0.0213  226 ASP B OD2   
3611 N N     . LEU B 230 ? 0.6069 0.2608 0.7884 0.0936  -0.0351 0.1059  227 LEU B N     
3612 C CA    . LEU B 230 ? 0.7551 0.4317 0.9652 0.0869  -0.0526 0.1356  227 LEU B CA    
3613 C C     . LEU B 230 ? 0.8002 0.5260 0.9982 0.0584  -0.0560 0.1526  227 LEU B C     
3614 O O     . LEU B 230 ? 0.8775 0.6194 1.0852 0.0422  -0.0734 0.1778  227 LEU B O     
3615 C CB    . LEU B 230 ? 0.8682 0.5745 1.1221 0.1141  -0.0422 0.1370  227 LEU B CB    
3616 C CG    . LEU B 230 ? 0.9338 0.6019 1.2082 0.1481  -0.0350 0.1179  227 LEU B CG    
3617 C CD1   . LEU B 230 ? 0.8682 0.5755 1.1930 0.1720  -0.0289 0.1264  227 LEU B CD1   
3618 C CD2   . LEU B 230 ? 0.9440 0.5421 1.2127 0.1474  -0.0597 0.1226  227 LEU B CD2   
3619 N N     . PHE B 231 ? 0.7378 0.4880 0.9147 0.0526  -0.0393 0.1386  228 PHE B N     
3620 C CA    . PHE B 231 ? 0.6943 0.4885 0.8599 0.0293  -0.0408 0.1501  228 PHE B CA    
3621 C C     . PHE B 231 ? 0.8817 0.6577 1.0219 0.0019  -0.0592 0.1608  228 PHE B C     
3622 O O     . PHE B 231 ? 0.7361 0.5490 0.8736 -0.0189 -0.0658 0.1762  228 PHE B O     
3623 C CB    . PHE B 231 ? 0.5324 0.3543 0.6861 0.0334  -0.0199 0.1330  228 PHE B CB    
3624 C CG    . PHE B 231 ? 0.4663 0.3327 0.6431 0.0446  -0.0066 0.1341  228 PHE B CG    
3625 C CD1   . PHE B 231 ? 0.4758 0.3438 0.6650 0.0664  0.0101  0.1199  228 PHE B CD1   
3626 C CD2   . PHE B 231 ? 0.4310 0.3389 0.6149 0.0318  -0.0107 0.1486  228 PHE B CD2   
3627 C CE1   . PHE B 231 ? 0.4857 0.3946 0.6947 0.0730  0.0202  0.1230  228 PHE B CE1   
3628 C CE2   . PHE B 231 ? 0.4561 0.3998 0.6573 0.0396  -0.0005 0.1491  228 PHE B CE2   
3629 C CZ    . PHE B 231 ? 0.4301 0.3736 0.6439 0.0591  0.0139  0.1376  228 PHE B CZ    
3630 N N     . GLU B 232 ? 1.0254 0.7458 1.1464 0.0011  -0.0670 0.1516  229 GLU B N     
3631 C CA    . GLU B 232 ? 0.9877 0.6865 1.0819 -0.0275 -0.0860 0.1618  229 GLU B CA    
3632 C C     . GLU B 232 ? 0.9583 0.6751 1.0618 -0.0501 -0.1072 0.1919  229 GLU B C     
3633 O O     . GLU B 232 ? 1.0273 0.7656 1.1149 -0.0782 -0.1168 0.2046  229 GLU B O     
3634 C CB    . GLU B 232 ? 1.0877 0.7128 1.1612 -0.0239 -0.0948 0.1482  229 GLU B CB    
3635 C CG    . GLU B 232 ? 1.2600 0.8698 1.3025 -0.0234 -0.0812 0.1232  229 GLU B CG    
3636 C CD    . GLU B 232 ? 1.3493 0.9800 1.3661 -0.0554 -0.0900 0.1327  229 GLU B CD    
3637 O OE1   . GLU B 232 ? 1.2473 0.8653 1.2554 -0.0807 -0.1127 0.1522  229 GLU B OE1   
3638 O OE2   . GLU B 232 ? 1.3816 1.0433 1.3882 -0.0560 -0.0756 0.1224  229 GLU B OE2   
3639 N N     . GLU B 233 ? 0.9772 0.6893 1.1072 -0.0390 -0.1146 0.2043  230 GLU B N     
3640 C CA    . GLU B 233 ? 1.0701 0.8023 1.2082 -0.0619 -0.1352 0.2347  230 GLU B CA    
3641 C C     . GLU B 233 ? 0.9659 0.7695 1.1012 -0.0807 -0.1271 0.2429  230 GLU B C     
3642 O O     . GLU B 233 ? 0.9057 0.7281 1.0264 -0.1107 -0.1398 0.2593  230 GLU B O     
3643 C CB    . GLU B 233 ? 1.2056 0.9319 1.3765 -0.0444 -0.1420 0.2466  230 GLU B CB    
3644 C CG    . GLU B 233 ? 1.3958 1.0591 1.5705 -0.0468 -0.1694 0.2615  230 GLU B CG    
3645 C CD    . GLU B 233 ? 1.5097 1.1780 1.6691 -0.0866 -0.1963 0.2928  230 GLU B CD    
3646 O OE1   . GLU B 233 ? 1.5258 1.2536 1.6749 -0.1100 -0.1909 0.3015  230 GLU B OE1   
3647 O OE2   . GLU B 233 ? 1.5088 1.1218 1.6666 -0.0948 -0.2230 0.3086  230 GLU B OE2   
3648 N N     . ALA B 234 ? 0.7899 0.6336 0.9393 -0.0631 -0.1059 0.2309  231 ALA B N     
3649 C CA    . ALA B 234 ? 0.6110 0.5184 0.7593 -0.0757 -0.0964 0.2341  231 ALA B CA    
3650 C C     . ALA B 234 ? 0.5966 0.5187 0.7249 -0.0841 -0.0876 0.2218  231 ALA B C     
3651 O O     . ALA B 234 ? 0.5555 0.5261 0.6804 -0.0998 -0.0851 0.2271  231 ALA B O     
3652 C CB    . ALA B 234 ? 0.5530 0.4905 0.7209 -0.0550 -0.0792 0.2251  231 ALA B CB    
3653 N N     . SER B 235 ? 0.5338 0.4158 0.6496 -0.0734 -0.0832 0.2051  232 SER B N     
3654 C CA    . SER B 235 ? 0.6347 0.5286 0.7326 -0.0804 -0.0762 0.1942  232 SER B CA    
3655 C C     . SER B 235 ? 0.6649 0.5749 0.7490 -0.1117 -0.0919 0.2106  232 SER B C     
3656 O O     . SER B 235 ? 0.7076 0.5827 0.7814 -0.1284 -0.1113 0.2238  232 SER B O     
3657 C CB    . SER B 235 ? 0.7347 0.5781 0.8165 -0.0675 -0.0711 0.1747  232 SER B CB    
3658 O OG    . SER B 235 ? 0.6082 0.4644 0.6720 -0.0768 -0.0670 0.1670  232 SER B OG    
3659 N N     . SER B 236 ? 0.6354 0.5988 0.7208 -0.1194 -0.0841 0.2102  233 SER B N     
3660 C CA    . SER B 236 ? 0.5388 0.5331 0.6160 -0.1487 -0.0959 0.2256  233 SER B CA    
3661 C C     . SER B 236 ? 0.6093 0.5818 0.6665 -0.1585 -0.1015 0.2203  233 SER B C     
3662 O O     . SER B 236 ? 0.7025 0.6714 0.7464 -0.1861 -0.1187 0.2352  233 SER B O     
3663 C CB    . SER B 236 ? 0.5118 0.5797 0.6040 -0.1501 -0.0839 0.2266  233 SER B CB    
3664 O OG    . SER B 236 ? 0.5661 0.6733 0.6538 -0.1764 -0.0923 0.2396  233 SER B OG    
3665 N N     . ALA B 237 ? 0.5464 0.5056 0.6000 -0.1389 -0.0884 0.2008  234 ALA B N     
3666 C CA    . ALA B 237 ? 0.6141 0.5529 0.6462 -0.1488 -0.0936 0.1951  234 ALA B CA    
3667 C C     . ALA B 237 ? 0.4582 0.3679 0.4822 -0.1259 -0.0795 0.1730  234 ALA B C     
3668 O O     . ALA B 237 ? 0.4492 0.3721 0.4890 -0.1029 -0.0637 0.1633  234 ALA B O     
3669 C CB    . ALA B 237 ? 0.5818 0.5814 0.6207 -0.1643 -0.0951 0.2042  234 ALA B CB    
3670 N N     . SER B 238 ? 0.5587 0.4296 0.5554 -0.1351 -0.0861 0.1657  235 SER B N     
3671 C CA    . SER B 238 ? 0.5181 0.3651 0.5010 -0.1190 -0.0733 0.1454  235 SER B CA    
3672 C C     . SER B 238 ? 0.5834 0.4636 0.5604 -0.1281 -0.0735 0.1467  235 SER B C     
3673 O O     . SER B 238 ? 0.6012 0.4887 0.5662 -0.1524 -0.0885 0.1577  235 SER B O     
3674 C CB    . SER B 238 ? 0.5969 0.3731 0.5494 -0.1213 -0.0788 0.1324  235 SER B CB    
3675 O OG    . SER B 238 ? 0.7952 0.5507 0.7233 -0.1508 -0.0991 0.1419  235 SER B OG    
3676 N N     . VAL B 239 ? 0.6331 0.5339 0.6200 -0.1096 -0.0586 0.1375  236 VAL B N     
3677 C CA    . VAL B 239 ? 0.4673 0.4006 0.4541 -0.1147 -0.0600 0.1406  236 VAL B CA    
3678 C C     . VAL B 239 ? 0.5412 0.4420 0.4998 -0.1126 -0.0551 0.1265  236 VAL B C     
3679 O O     . VAL B 239 ? 0.5861 0.4650 0.5409 -0.0954 -0.0410 0.1123  236 VAL B O     
3680 C CB    . VAL B 239 ? 0.4706 0.4556 0.4911 -0.0976 -0.0500 0.1437  236 VAL B CB    
3681 C CG1   . VAL B 239 ? 0.3524 0.3672 0.3769 -0.0998 -0.0535 0.1478  236 VAL B CG1   
3682 C CG2   . VAL B 239 ? 0.3944 0.4164 0.4387 -0.1020 -0.0532 0.1558  236 VAL B CG2   
3683 N N     . SER B 240 ? 0.4607 0.3630 0.3995 -0.1321 -0.0669 0.1315  237 SER B N     
3684 C CA    . SER B 240 ? 0.5137 0.3856 0.4186 -0.1365 -0.0645 0.1194  237 SER B CA    
3685 C C     . SER B 240 ? 0.6039 0.5116 0.5145 -0.1390 -0.0679 0.1278  237 SER B C     
3686 O O     . SER B 240 ? 0.6299 0.5782 0.5602 -0.1477 -0.0799 0.1445  237 SER B O     
3687 C CB    . SER B 240 ? 0.6730 0.5008 0.5381 -0.1616 -0.0784 0.1161  237 SER B CB    
3688 O OG    . SER B 240 ? 0.8463 0.6520 0.6750 -0.1707 -0.0776 0.1055  237 SER B OG    
3689 N N     . ILE B 241 ? 0.6312 0.5253 0.5256 -0.1315 -0.0579 0.1171  238 ILE B N     
3690 C CA    . ILE B 241 ? 0.4771 0.3961 0.3713 -0.1365 -0.0642 0.1265  238 ILE B CA    
3691 C C     . ILE B 241 ? 0.6470 0.5401 0.4957 -0.1627 -0.0753 0.1247  238 ILE B C     
3692 O O     . ILE B 241 ? 0.7528 0.6065 0.5648 -0.1657 -0.0658 0.1069  238 ILE B O     
3693 C CB    . ILE B 241 ? 0.4866 0.4094 0.3882 -0.1175 -0.0492 0.1198  238 ILE B CB    
3694 C CG1   . ILE B 241 ? 0.4125 0.3571 0.3547 -0.0937 -0.0388 0.1201  238 ILE B CG1   
3695 C CG2   . ILE B 241 ? 0.4572 0.4019 0.3588 -0.1242 -0.0597 0.1328  238 ILE B CG2   
3696 C CD1   . ILE B 241 ? 0.3971 0.3428 0.3459 -0.0774 -0.0251 0.1140  238 ILE B CD1   
3697 N N     . PRO B 242 ? 0.6795 0.5972 0.5303 -0.1822 -0.0952 0.1427  239 PRO B N     
3698 C CA    . PRO B 242 ? 0.6757 0.5720 0.4820 -0.2121 -0.1098 0.1442  239 PRO B CA    
3699 C C     . PRO B 242 ? 0.7492 0.6280 0.5222 -0.2154 -0.1032 0.1352  239 PRO B C     
3700 O O     . PRO B 242 ? 0.7092 0.6140 0.5027 -0.2032 -0.1006 0.1433  239 PRO B O     
3701 C CB    . PRO B 242 ? 0.6976 0.6430 0.5298 -0.2252 -0.1314 0.1704  239 PRO B CB    
3702 C CG    . PRO B 242 ? 0.6429 0.6251 0.5252 -0.2070 -0.1274 0.1776  239 PRO B CG    
3703 C CD    . PRO B 242 ? 0.6983 0.6696 0.5953 -0.1772 -0.1050 0.1624  239 PRO B CD    
3704 N N     . MET B 243 ? 0.8827 0.7162 0.6028 -0.2329 -0.1009 0.1180  240 MET B N     
3705 C CA    . MET B 243 ? 0.8761 0.6945 0.5556 -0.2425 -0.0947 0.1085  240 MET B CA    
3706 C C     . MET B 243 ? 0.8185 0.6123 0.4445 -0.2789 -0.1116 0.1079  240 MET B C     
3707 O O     . MET B 243 ? 0.8629 0.6492 0.4857 -0.2950 -0.1275 0.1144  240 MET B O     
3708 C CB    . MET B 243 ? 0.8307 0.6177 0.4945 -0.2237 -0.0675 0.0802  240 MET B CB    
3709 C CG    . MET B 243 ? 0.8339 0.6431 0.5475 -0.1904 -0.0514 0.0806  240 MET B CG    
3710 S SD    . MET B 243 ? 0.9440 0.7218 0.6463 -0.1680 -0.0210 0.0492  240 MET B SD    
3711 C CE    . MET B 243 ? 1.0325 0.7614 0.7179 -0.1717 -0.0250 0.0336  240 MET B CE    
3712 N N     . MET B 244 ? 0.9944 0.7767 0.5760 -0.2948 -0.1091 0.1009  241 MET B N     
3713 C CA    . MET B 244 ? 1.1802 0.9356 0.7027 -0.3321 -0.1241 0.0973  241 MET B CA    
3714 C C     . MET B 244 ? 1.3054 1.0088 0.8002 -0.3370 -0.1208 0.0741  241 MET B C     
3715 O O     . MET B 244 ? 1.4609 1.1511 0.9364 -0.3638 -0.1423 0.0822  241 MET B O     
3716 C CB    . MET B 244 ? 1.2332 0.9775 0.7051 -0.3457 -0.1141 0.0847  241 MET B CB    
3717 C CG    . MET B 244 ? 1.2787 1.0683 0.7730 -0.3455 -0.1216 0.1105  241 MET B CG    
3718 S SD    . MET B 244 ? 1.5450 1.3806 1.0799 -0.3594 -0.1585 0.1533  241 MET B SD    
3719 C CE    . MET B 244 ? 1.9766 1.7853 1.4440 -0.4084 -0.1810 0.1530  241 MET B CE    
3720 N N     . SER B 245 ? 1.2074 0.8811 0.7018 -0.3112 -0.0952 0.0465  242 SER B N     
3721 C CA    . SER B 245 ? 1.2651 0.8875 0.7463 -0.3070 -0.0917 0.0255  242 SER B CA    
3722 C C     . SER B 245 ? 1.1602 0.7899 0.6929 -0.2675 -0.0727 0.0198  242 SER B C     
3723 O O     . SER B 245 ? 1.0234 0.6858 0.5844 -0.2457 -0.0567 0.0219  242 SER B O     
3724 C CB    . SER B 245 ? 1.3771 0.9428 0.7912 -0.3185 -0.0797 -0.0098 242 SER B CB    
3725 O OG    . SER B 245 ? 1.4785 1.0508 0.8895 -0.2965 -0.0509 -0.0300 242 SER B OG    
3726 N N     . GLN B 246 ? 1.2570 0.8560 0.8009 -0.2608 -0.0766 0.0148  243 GLN B N     
3727 C CA    . GLN B 246 ? 1.2942 0.9011 0.8871 -0.2266 -0.0623 0.0129  243 GLN B CA    
3728 C C     . GLN B 246 ? 1.3922 0.9577 0.9702 -0.2032 -0.0377 -0.0206 243 GLN B C     
3729 O O     . GLN B 246 ? 1.3937 0.9529 1.0061 -0.1767 -0.0281 -0.0252 243 GLN B O     
3730 C CB    . GLN B 246 ? 1.3329 0.9349 0.9513 -0.2312 -0.0804 0.0292  243 GLN B CB    
3731 C CG    . GLN B 246 ? 1.3293 0.9842 0.9724 -0.2499 -0.1015 0.0623  243 GLN B CG    
3732 C CD    . GLN B 246 ? 1.2022 0.9185 0.8862 -0.2322 -0.0929 0.0768  243 GLN B CD    
3733 O OE1   . GLN B 246 ? 1.1640 0.8909 0.8763 -0.2034 -0.0740 0.0698  243 GLN B OE1   
3734 N NE2   . GLN B 246 ? 0.9656 0.7212 0.6538 -0.2499 -0.1085 0.0979  243 GLN B NE2   
3735 N N     . THR B 247 ? 1.4403 0.9810 0.9674 -0.2135 -0.0275 -0.0439 244 THR B N     
3736 C CA    . THR B 247 ? 1.5217 1.0306 1.0342 -0.1903 -0.0009 -0.0788 244 THR B CA    
3737 C C     . THR B 247 ? 1.4942 1.0514 1.0268 -0.1722 0.0223  -0.0796 244 THR B C     
3738 O O     . THR B 247 ? 1.4861 1.0378 1.0273 -0.1461 0.0470  -0.1022 244 THR B O     
3739 C CB    . THR B 247 ? 1.7970 1.2524 1.2390 -0.2111 0.0010  -0.1089 244 THR B CB    
3740 O OG1   . THR B 247 ? 1.9402 1.3611 1.3751 -0.1832 0.0270  -0.1456 244 THR B OG1   
3741 C CG2   . THR B 247 ? 1.8001 1.2851 1.2036 -0.2366 0.0024  -0.1054 244 THR B CG2   
3742 N N     . GLU B 248 ? 1.5178 1.1229 1.0594 -0.1865 0.0131  -0.0537 245 GLU B N     
3743 C CA    . GLU B 248 ? 1.5057 1.1560 1.0663 -0.1740 0.0300  -0.0490 245 GLU B CA    
3744 C C     . GLU B 248 ? 1.4047 1.0808 1.0282 -0.1427 0.0374  -0.0385 245 GLU B C     
3745 O O     . GLU B 248 ? 1.3739 1.0265 1.0187 -0.1251 0.0392  -0.0461 245 GLU B O     
3746 C CB    . GLU B 248 ? 1.5243 1.2126 1.0801 -0.1979 0.0129  -0.0211 245 GLU B CB    
3747 C CG    . GLU B 248 ? 1.6473 1.3196 1.1675 -0.2321 -0.0132 -0.0105 245 GLU B CG    
3748 C CD    . GLU B 248 ? 1.8083 1.4592 1.2605 -0.2593 -0.0099 -0.0280 245 GLU B CD    
3749 O OE1   . GLU B 248 ? 1.9027 1.5313 1.3280 -0.2493 0.0148  -0.0595 245 GLU B OE1   
3750 O OE2   . GLU B 248 ? 1.8234 1.4825 1.2493 -0.2909 -0.0320 -0.0103 245 GLU B OE2   
3751 N N     . SER B 249 ? 1.3215 1.0440 0.9727 -0.1379 0.0395  -0.0198 246 SER B N     
3752 C CA    . SER B 249 ? 1.1615 0.9122 0.8694 -0.1128 0.0439  -0.0073 246 SER B CA    
3753 C C     . SER B 249 ? 0.9796 0.7734 0.7035 -0.1139 0.0448  0.0105  246 SER B C     
3754 O O     . SER B 249 ? 1.0803 0.8814 0.7718 -0.1309 0.0466  0.0102  246 SER B O     
3755 C CB    . SER B 249 ? 1.1958 0.9337 0.9199 -0.0856 0.0662  -0.0289 246 SER B CB    
3756 O OG    . SER B 249 ? 1.3930 1.1433 1.0994 -0.0821 0.0883  -0.0446 246 SER B OG    
3757 N N     . LEU B 250 ? 0.7837 0.6039 0.5553 -0.0975 0.0422  0.0262  247 LEU B N     
3758 C CA    . LEU B 250 ? 0.7851 0.6396 0.5749 -0.0968 0.0408  0.0432  247 LEU B CA    
3759 C C     . LEU B 250 ? 0.7373 0.6081 0.5565 -0.0748 0.0594  0.0380  247 LEU B C     
3760 O O     . LEU B 250 ? 0.6004 0.4623 0.4396 -0.0568 0.0686  0.0276  247 LEU B O     
3761 C CB    . LEU B 250 ? 0.7653 0.6390 0.5850 -0.0981 0.0196  0.0668  247 LEU B CB    
3762 C CG    . LEU B 250 ? 0.8066 0.6865 0.6076 -0.1210 -0.0014 0.0830  247 LEU B CG    
3763 C CD1   . LEU B 250 ? 0.9587 0.8119 0.7075 -0.1438 -0.0028 0.0711  247 LEU B CD1   
3764 C CD2   . LEU B 250 ? 0.7224 0.6181 0.5552 -0.1191 -0.0198 0.0995  247 LEU B CD2   
3765 N N     . ASN B 251 ? 0.6639 0.5582 0.4853 -0.0781 0.0627  0.0472  248 ASN B N     
3766 C CA    . ASN B 251 ? 0.5893 0.5042 0.4409 -0.0613 0.0764  0.0475  248 ASN B CA    
3767 C C     . ASN B 251 ? 0.6588 0.5807 0.5536 -0.0453 0.0677  0.0579  248 ASN B C     
3768 O O     . ASN B 251 ? 0.6075 0.5322 0.5120 -0.0498 0.0499  0.0719  248 ASN B O     
3769 C CB    . ASN B 251 ? 0.6187 0.5549 0.4627 -0.0736 0.0751  0.0608  248 ASN B CB    
3770 C CG    . ASN B 251 ? 0.9836 0.9422 0.8544 -0.0609 0.0888  0.0617  248 ASN B CG    
3771 O OD1   . ASN B 251 ? 1.0503 1.0152 0.9575 -0.0454 0.0858  0.0674  248 ASN B OD1   
3772 N ND2   . ASN B 251 ? 1.1042 1.0783 0.9555 -0.0699 0.1036  0.0569  248 ASN B ND2   
3773 N N     . VAL B 252 ? 0.5538 0.4817 0.4749 -0.0270 0.0803  0.0511  249 VAL B N     
3774 C CA    . VAL B 252 ? 0.4574 0.3921 0.4151 -0.0140 0.0731  0.0594  249 VAL B CA    
3775 C C     . VAL B 252 ? 0.4116 0.3643 0.3864 -0.0166 0.0602  0.0766  249 VAL B C     
3776 O O     . VAL B 252 ? 0.4442 0.4004 0.4364 -0.0136 0.0485  0.0840  249 VAL B O     
3777 C CB    . VAL B 252 ? 0.3841 0.3272 0.3679 0.0040  0.0875  0.0527  249 VAL B CB    
3778 C CG1   . VAL B 252 ? 0.4136 0.3796 0.4003 0.0041  0.0998  0.0537  249 VAL B CG1   
3779 C CG2   . VAL B 252 ? 0.3407 0.2924 0.3576 0.0132  0.0786  0.0627  249 VAL B CG2   
3780 N N     . SER B 253 ? 0.3617 0.3257 0.3309 -0.0226 0.0622  0.0826  250 SER B N     
3781 C CA    . SER B 253 ? 0.4822 0.4558 0.4659 -0.0242 0.0487  0.0977  250 SER B CA    
3782 C C     . SER B 253 ? 0.4084 0.3763 0.3832 -0.0334 0.0306  0.1069  250 SER B C     
3783 O O     . SER B 253 ? 0.5078 0.4824 0.5043 -0.0275 0.0182  0.1156  250 SER B O     
3784 C CB    . SER B 253 ? 0.3521 0.3342 0.3278 -0.0323 0.0523  0.1040  250 SER B CB    
3785 O OG    . SER B 253 ? 1.0404 1.0180 0.9814 -0.0497 0.0531  0.1041  250 SER B OG    
3786 N N     . VAL B 254 ? 0.4191 0.3765 0.3623 -0.0480 0.0291  0.1042  251 VAL B N     
3787 C CA    . VAL B 254 ? 0.3934 0.3482 0.3275 -0.0593 0.0106  0.1145  251 VAL B CA    
3788 C C     . VAL B 254 ? 0.3779 0.3340 0.3287 -0.0527 0.0049  0.1127  251 VAL B C     
3789 O O     . VAL B 254 ? 0.5612 0.5295 0.5297 -0.0518 -0.0101 0.1240  251 VAL B O     
3790 C CB    . VAL B 254 ? 0.5961 0.5390 0.4865 -0.0805 0.0100  0.1118  251 VAL B CB    
3791 C CG1   . VAL B 254 ? 0.4487 0.3906 0.3316 -0.0933 -0.0105 0.1230  251 VAL B CG1   
3792 C CG2   . VAL B 254 ? 0.4550 0.4027 0.3272 -0.0923 0.0119  0.1188  251 VAL B CG2   
3793 N N     . SER B 255 ? 0.3813 0.3263 0.3282 -0.0481 0.0163  0.0992  252 SER B N     
3794 C CA    . SER B 255 ? 0.3707 0.3158 0.3312 -0.0452 0.0104  0.0991  252 SER B CA    
3795 C C     . SER B 255 ? 0.3709 0.3389 0.3697 -0.0311 0.0075  0.1063  252 SER B C     
3796 O O     . SER B 255 ? 0.3371 0.3196 0.3507 -0.0321 -0.0029 0.1133  252 SER B O     
3797 C CB    . SER B 255 ? 0.4550 0.3785 0.4057 -0.0414 0.0220  0.0843  252 SER B CB    
3798 O OG    . SER B 255 ? 0.6090 0.5082 0.5211 -0.0544 0.0249  0.0739  252 SER B OG    
3799 N N     . LEU B 256 ? 0.3790 0.3528 0.3926 -0.0193 0.0170  0.1041  253 LEU B N     
3800 C CA    . LEU B 256 ? 0.2828 0.2755 0.3276 -0.0070 0.0153  0.1081  253 LEU B CA    
3801 C C     . LEU B 256 ? 0.2773 0.2837 0.3341 -0.0064 0.0018  0.1178  253 LEU B C     
3802 O O     . LEU B 256 ? 0.3253 0.3507 0.4045 0.0004  -0.0032 0.1200  253 LEU B O     
3803 C CB    . LEU B 256 ? 0.4823 0.4760 0.5356 0.0014  0.0260  0.1048  253 LEU B CB    
3804 C CG    . LEU B 256 ? 0.3627 0.3720 0.4425 0.0119  0.0235  0.1073  253 LEU B CG    
3805 C CD1   . LEU B 256 ? 0.2495 0.2686 0.3438 0.0168  0.0268  0.1042  253 LEU B CD1   
3806 C CD2   . LEU B 256 ? 0.5939 0.6016 0.6767 0.0147  0.0289  0.1075  253 LEU B CD2   
3807 N N     . GLY B 257 ? 0.2950 0.2936 0.3377 -0.0135 -0.0044 0.1239  254 GLY B N     
3808 C CA    . GLY B 257 ? 0.2959 0.3033 0.3522 -0.0112 -0.0197 0.1347  254 GLY B CA    
3809 C C     . GLY B 257 ? 0.2949 0.3192 0.3609 -0.0138 -0.0310 0.1405  254 GLY B C     
3810 O O     . GLY B 257 ? 0.3212 0.3656 0.4158 -0.0024 -0.0380 0.1440  254 GLY B O     
3811 N N     . ILE B 258 ? 0.3126 0.3297 0.3548 -0.0293 -0.0326 0.1406  255 ILE B N     
3812 C CA    . ILE B 258 ? 0.3921 0.4267 0.4406 -0.0370 -0.0447 0.1481  255 ILE B CA    
3813 C C     . ILE B 258 ? 0.4623 0.5197 0.5364 -0.0280 -0.0403 0.1445  255 ILE B C     
3814 O O     . ILE B 258 ? 0.3034 0.3915 0.4030 -0.0239 -0.0489 0.1516  255 ILE B O     
3815 C CB    . ILE B 258 ? 0.3467 0.3625 0.3579 -0.0588 -0.0477 0.1474  255 ILE B CB    
3816 C CG1   . ILE B 258 ? 0.3962 0.3954 0.3786 -0.0713 -0.0528 0.1521  255 ILE B CG1   
3817 C CG2   . ILE B 258 ? 0.3605 0.3961 0.3782 -0.0701 -0.0620 0.1571  255 ILE B CG2   
3818 C CD1   . ILE B 258 ? 0.4142 0.3931 0.3539 -0.0944 -0.0552 0.1486  255 ILE B CD1   
3819 N N     . ALA B 259 ? 0.4017 0.4473 0.4704 -0.0254 -0.0272 0.1343  256 ALA B N     
3820 C CA    . ALA B 259 ? 0.3997 0.4658 0.4881 -0.0209 -0.0237 0.1326  256 ALA B CA    
3821 C C     . ALA B 259 ? 0.2836 0.3789 0.4044 -0.0041 -0.0222 0.1321  256 ALA B C     
3822 O O     . ALA B 259 ? 0.4404 0.5691 0.5820 -0.0026 -0.0257 0.1355  256 ALA B O     
3823 C CB    . ALA B 259 ? 0.2636 0.3086 0.3418 -0.0200 -0.0120 0.1239  256 ALA B CB    
3824 N N     . LEU B 260 ? 0.3158 0.3990 0.4399 0.0077  -0.0166 0.1270  257 LEU B N     
3825 C CA    . LEU B 260 ? 0.2953 0.3971 0.4457 0.0242  -0.0154 0.1233  257 LEU B CA    
3826 C C     . LEU B 260 ? 0.2809 0.4018 0.4504 0.0304  -0.0279 0.1301  257 LEU B C     
3827 O O     . LEU B 260 ? 0.2694 0.4178 0.4659 0.0441  -0.0274 0.1260  257 LEU B O     
3828 C CB    . LEU B 260 ? 0.2779 0.3565 0.4236 0.0316  -0.0097 0.1179  257 LEU B CB    
3829 C CG    . LEU B 260 ? 0.3353 0.4055 0.4739 0.0304  0.0027  0.1112  257 LEU B CG    
3830 C CD1   . LEU B 260 ? 0.4307 0.4832 0.5662 0.0351  0.0063  0.1084  257 LEU B CD1   
3831 C CD2   . LEU B 260 ? 0.2810 0.3769 0.4354 0.0342  0.0074  0.1067  257 LEU B CD2   
3832 N N     . HIS B 261 ? 0.2446 0.3525 0.4004 0.0206  -0.0391 0.1402  258 HIS B N     
3833 C CA    . HIS B 261 ? 0.2531 0.3793 0.4284 0.0250  -0.0544 0.1507  258 HIS B CA    
3834 C C     . HIS B 261 ? 0.2431 0.4127 0.4404 0.0242  -0.0571 0.1541  258 HIS B C     
3835 O O     . HIS B 261 ? 0.3402 0.5408 0.5708 0.0388  -0.0628 0.1561  258 HIS B O     
3836 C CB    . HIS B 261 ? 0.2782 0.3833 0.4283 0.0083  -0.0671 0.1632  258 HIS B CB    
3837 C CG    . HIS B 261 ? 0.2899 0.4164 0.4595 0.0088  -0.0862 0.1783  258 HIS B CG    
3838 N ND1   . HIS B 261 ? 0.2956 0.4253 0.4929 0.0267  -0.0967 0.1832  258 HIS B ND1   
3839 C CD2   . HIS B 261 ? 0.3003 0.4456 0.4670 -0.0067 -0.0984 0.1906  258 HIS B CD2   
3840 C CE1   . HIS B 261 ? 0.3070 0.4596 0.5214 0.0243  -0.1144 0.1986  258 HIS B CE1   
3841 N NE2   . HIS B 261 ? 0.3089 0.4735 0.5046 0.0027  -0.1158 0.2040  258 HIS B NE2   
3842 N N     . GLU B 262 ? 0.2953 0.4675 0.4751 0.0069  -0.0534 0.1548  259 GLU B N     
3843 C CA    . GLU B 262 ? 0.3440 0.5583 0.5405 0.0000  -0.0567 0.1606  259 GLU B CA    
3844 C C     . GLU B 262 ? 0.3840 0.6315 0.6060 0.0139  -0.0443 0.1506  259 GLU B C     
3845 O O     . GLU B 262 ? 0.3807 0.6759 0.6262 0.0133  -0.0456 0.1545  259 GLU B O     
3846 C CB    . GLU B 262 ? 0.3833 0.5818 0.5490 -0.0254 -0.0588 0.1649  259 GLU B CB    
3847 C CG    . GLU B 262 ? 0.3480 0.5200 0.4854 -0.0428 -0.0715 0.1735  259 GLU B CG    
3848 C CD    . GLU B 262 ? 0.4082 0.6149 0.5650 -0.0477 -0.0887 0.1893  259 GLU B CD    
3849 O OE1   . GLU B 262 ? 0.4031 0.6583 0.5934 -0.0420 -0.0901 0.1937  259 GLU B OE1   
3850 O OE2   . GLU B 262 ? 0.5480 0.7371 0.6872 -0.0579 -0.1011 0.1979  259 GLU B OE2   
3851 N N     . ARG B 263 ? 0.2714 0.4969 0.4876 0.0244  -0.0324 0.1381  260 ARG B N     
3852 C CA    . ARG B 263 ? 0.2101 0.4626 0.4431 0.0347  -0.0202 0.1273  260 ARG B CA    
3853 C C     . ARG B 263 ? 0.1922 0.4521 0.4494 0.0597  -0.0173 0.1163  260 ARG B C     
3854 O O     . ARG B 263 ? 0.2729 0.5531 0.5417 0.0698  -0.0064 0.1038  260 ARG B O     
3855 C CB    . ARG B 263 ? 0.1935 0.4186 0.4042 0.0279  -0.0103 0.1213  260 ARG B CB    
3856 C CG    . ARG B 263 ? 0.1901 0.4086 0.3812 0.0061  -0.0127 0.1296  260 ARG B CG    
3857 C CD    . ARG B 263 ? 0.2831 0.5482 0.4878 -0.0029 -0.0118 0.1339  260 ARG B CD    
3858 N NE    . ARG B 263 ? 0.2102 0.4936 0.4234 0.0046  -0.0003 0.1245  260 ARG B NE    
3859 C CZ    . ARG B 263 ? 0.3166 0.6448 0.5400 -0.0031 0.0035  0.1261  260 ARG B CZ    
3860 N NH1   . ARG B 263 ? 0.2096 0.5706 0.4386 -0.0187 -0.0037 0.1381  260 ARG B NH1   
3861 N NH2   . ARG B 263 ? 0.2340 0.5763 0.4602 0.0019  0.0139  0.1166  260 ARG B NH2   
3862 N N     . ILE B 264 ? 0.2027 0.4441 0.4656 0.0685  -0.0282 0.1210  261 ILE B N     
3863 C CA    . ILE B 264 ? 0.2111 0.4446 0.4934 0.0923  -0.0288 0.1111  261 ILE B CA    
3864 C C     . ILE B 264 ? 0.3780 0.6591 0.6946 0.1112  -0.0214 0.0989  261 ILE B C     
3865 O O     . ILE B 264 ? 0.4113 0.6858 0.7349 0.1279  -0.0134 0.0821  261 ILE B O     
3866 C CB    . ILE B 264 ? 0.2811 0.4919 0.5682 0.0970  -0.0464 0.1230  261 ILE B CB    
3867 C CG1   . ILE B 264 ? 0.3108 0.4955 0.6099 0.1186  -0.0490 0.1133  261 ILE B CG1   
3868 C CG2   . ILE B 264 ? 0.2338 0.4852 0.5479 0.0988  -0.0582 0.1353  261 ILE B CG2   
3869 C CD1   . ILE B 264 ? 0.3550 0.4983 0.6262 0.1128  -0.0414 0.1057  261 ILE B CD1   
3870 N N     . ASP B 265 ? 0.2523 0.5830 0.5892 0.1075  -0.0238 0.1066  262 ASP B N     
3871 C CA    . ASP B 265 ? 0.2047 0.5915 0.5766 0.1250  -0.0148 0.0948  262 ASP B CA    
3872 C C     . ASP B 265 ? 0.3283 0.7357 0.6890 0.1185  0.0035  0.0811  262 ASP B C     
3873 O O     . ASP B 265 ? 0.3247 0.7535 0.7012 0.1368  0.0153  0.0618  262 ASP B O     
3874 C CB    . ASP B 265 ? 0.3226 0.7643 0.7207 0.1195  -0.0229 0.1100  262 ASP B CB    
3875 C CG    . ASP B 265 ? 0.5617 0.9968 0.9833 0.1329  -0.0414 0.1216  262 ASP B CG    
3876 O OD1   . ASP B 265 ? 0.5506 0.9698 0.9927 0.1604  -0.0433 0.1107  262 ASP B OD1   
3877 O OD2   . ASP B 265 ? 0.6321 1.0758 1.0507 0.1149  -0.0558 0.1424  262 ASP B OD2   
3878 N N     . ARG B 266 ? 0.2770 0.6764 0.6094 0.0920  0.0048  0.0909  263 ARG B N     
3879 C CA    . ARG B 266 ? 0.1740 0.5900 0.4932 0.0815  0.0185  0.0828  263 ARG B CA    
3880 C C     . ARG B 266 ? 0.3188 0.6966 0.6233 0.0917  0.0263  0.0666  263 ARG B C     
3881 O O     . ARG B 266 ? 0.4057 0.8052 0.7089 0.0932  0.0386  0.0530  263 ARG B O     
3882 C CB    . ARG B 266 ? 0.1661 0.5721 0.4591 0.0518  0.0141  0.0992  263 ARG B CB    
3883 C CG    . ARG B 266 ? 0.1724 0.6227 0.4757 0.0349  0.0071  0.1150  263 ARG B CG    
3884 C CD    . ARG B 266 ? 0.1579 0.6784 0.4818 0.0339  0.0180  0.1098  263 ARG B CD    
3885 N NE    . ARG B 266 ? 0.2944 0.8591 0.6259 0.0122  0.0101  0.1282  263 ARG B NE    
3886 C CZ    . ARG B 266 ? 0.4224 1.0568 0.7708 0.0037  0.0175  0.1296  263 ARG B CZ    
3887 N NH1   . ARG B 266 ? 0.4329 1.1009 0.7907 0.0162  0.0347  0.1113  263 ARG B NH1   
3888 N NH2   . ARG B 266 ? 0.4258 1.0979 0.7796 -0.0197 0.0077  0.1493  263 ARG B NH2   
3889 N N     . ASN B 267 ? 0.1796 0.5026 0.4710 0.0957  0.0186  0.0690  264 ASN B N     
3890 C CA    . ASN B 267 ? 0.3091 0.5940 0.5859 0.1023  0.0233  0.0567  264 ASN B CA    
3891 C C     . ASN B 267 ? 0.3888 0.6701 0.6844 0.1281  0.0245  0.0390  264 ASN B C     
3892 O O     . ASN B 267 ? 0.4542 0.7124 0.7392 0.1334  0.0296  0.0250  264 ASN B O     
3893 C CB    . ASN B 267 ? 0.2216 0.4538 0.4755 0.0928  0.0155  0.0675  264 ASN B CB    
3894 C CG    . ASN B 267 ? 0.2634 0.4902 0.4961 0.0711  0.0176  0.0781  264 ASN B CG    
3895 O OD1   . ASN B 267 ? 0.2844 0.4837 0.5026 0.0617  0.0116  0.0887  264 ASN B OD1   
3896 N ND2   . ASN B 267 ? 0.1676 0.4203 0.3981 0.0630  0.0258  0.0748  264 ASN B ND2   
3897 N N     . LEU B 268 ? 0.3831 0.6858 0.7073 0.1440  0.0182  0.0401  265 LEU B N     
3898 C CA    . LEU B 268 ? 0.5883 0.8912 0.9366 0.1726  0.0190  0.0217  265 LEU B CA    
3899 C C     . LEU B 268 ? 0.6231 0.9828 0.9872 0.1815  0.0362  0.0024  265 LEU B C     
3900 O O     . LEU B 268 ? 0.5723 0.9264 0.9396 0.1989  0.0447  -0.0214 265 LEU B O     
3901 C CB    . LEU B 268 ? 0.7049 1.0094 1.0823 0.1880  0.0035  0.0325  265 LEU B CB    
3902 C CG    . LEU B 268 ? 0.7908 1.0346 1.1555 0.1863  -0.0145 0.0460  265 LEU B CG    
3903 C CD1   . LEU B 268 ? 0.7550 1.0094 1.1487 0.1970  -0.0319 0.0613  265 LEU B CD1   
3904 C CD2   . LEU B 268 ? 0.7553 0.9513 1.1123 0.2004  -0.0153 0.0296  265 LEU B CD2   
3905 N N     . ALA B 269 ? 0.4994 0.9140 0.8710 0.1673  0.0412  0.0125  266 ALA B N     
3906 C CA    . ALA B 269 ? 0.4160 0.8941 0.7997 0.1694  0.0584  -0.0025 266 ALA B CA    
3907 C C     . ALA B 269 ? 0.5625 1.0292 0.9140 0.1559  0.0704  -0.0150 266 ALA B C     
3908 O O     . ALA B 269 ? 0.5939 1.0911 0.9486 0.1651  0.0855  -0.0378 266 ALA B O     
3909 C CB    . ALA B 269 ? 0.3379 0.8738 0.7316 0.1497  0.0579  0.0166  266 ALA B CB    
3910 N N     . ALA B 270 ? 0.5248 0.9492 0.8456 0.1340  0.0637  -0.0002 267 ALA B N     
3911 C CA    . ALA B 270 ? 0.5203 0.9310 0.8116 0.1191  0.0712  -0.0069 267 ALA B CA    
3912 C C     . ALA B 270 ? 0.7213 1.0988 1.0065 0.1371  0.0752  -0.0311 267 ALA B C     
3913 O O     . ALA B 270 ? 0.8682 1.2520 1.1350 0.1299  0.0850  -0.0451 267 ALA B O     
3914 C CB    . ALA B 270 ? 0.3377 0.7077 0.6046 0.0973  0.0615  0.0143  267 ALA B CB    
3915 N N     . ASN B 271 ? 0.7167 1.0568 1.0155 0.1583  0.0658  -0.0348 268 ASN B N     
3916 C CA    . ASN B 271 ? 0.7636 1.0620 1.0568 0.1755  0.0655  -0.0564 268 ASN B CA    
3917 C C     . ASN B 271 ? 0.8337 1.1539 1.1574 0.2072  0.0711  -0.0801 268 ASN B C     
3918 O O     . ASN B 271 ? 0.7833 1.1549 1.1366 0.2168  0.0747  -0.0774 268 ASN B O     
3919 C CB    . ASN B 271 ? 0.7230 0.9562 1.0075 0.1754  0.0483  -0.0429 268 ASN B CB    
3920 C CG    . ASN B 271 ? 0.7462 0.9559 1.0018 0.1483  0.0452  -0.0250 268 ASN B CG    
3921 O OD1   . ASN B 271 ? 0.9257 1.1035 1.1761 0.1417  0.0338  -0.0069 268 ASN B OD1   
3922 N ND2   . ASN B 271 ? 0.6171 0.8449 0.8543 0.1325  0.0552  -0.0298 268 ASN B ND2   
3923 N N     . SAM C .   ? 1.4154 1.7247 1.7350 -0.0752 0.2875  -0.1156 270 SAM A N     
3924 C CA    . SAM C .   ? 1.3907 1.7100 1.7213 -0.0419 0.2974  -0.1245 270 SAM A CA    
3925 C C     . SAM C .   ? 1.4667 1.8607 1.8184 -0.0391 0.3056  -0.1294 270 SAM A C     
3926 O O     . SAM C .   ? 1.4597 1.8759 1.8149 -0.0440 0.3129  -0.1259 270 SAM A O     
3927 O OXT   . SAM C .   ? 1.5334 1.9674 1.8994 -0.0317 0.3050  -0.1372 270 SAM A OXT   
3928 C CB    . SAM C .   ? 1.3021 1.5775 1.6210 -0.0352 0.3025  -0.1196 270 SAM A CB    
3929 C CG    . SAM C .   ? 1.2581 1.5381 1.5692 -0.0650 0.3030  -0.1079 270 SAM A CG    
3930 S SD    . SAM C .   ? 1.3357 1.5478 1.6282 -0.0603 0.3059  -0.1008 270 SAM A SD    
3931 C CE    . SAM C .   ? 1.0809 1.2187 1.3544 -0.0616 0.2940  -0.0989 270 SAM A CE    
3932 C "C5'" . SAM C .   ? 1.0395 1.2462 1.3422 -0.0147 0.3158  -0.1129 270 SAM A "C5'" 
3933 C "C4'" . SAM C .   ? 0.9049 1.0821 1.2003 -0.0065 0.3232  -0.1089 270 SAM A "C4'" 
3934 O "O4'" . SAM C .   ? 0.7861 0.9299 1.0815 0.0276  0.3268  -0.1167 270 SAM A "O4'" 
3935 C "C3'" . SAM C .   ? 0.8526 0.9762 1.1267 -0.0312 0.3168  -0.0969 270 SAM A "C3'" 
3936 O "O3'" . SAM C .   ? 0.9259 1.0706 1.1993 -0.0511 0.3213  -0.0888 270 SAM A "O3'" 
3937 C "C2'" . SAM C .   ? 0.7996 0.8568 1.0614 -0.0088 0.3178  -0.0981 270 SAM A "C2'" 
3938 O "O2'" . SAM C .   ? 0.7478 0.7916 1.0044 -0.0096 0.3247  -0.0926 270 SAM A "O2'" 
3939 C "C1'" . SAM C .   ? 0.8415 0.9130 1.1171 0.0277  0.3231  -0.1111 270 SAM A "C1'" 
3940 N N9    . SAM C .   ? 0.8939 0.9258 1.1626 0.0372  0.3147  -0.1154 270 SAM A N9    
3941 C C8    . SAM C .   ? 0.6491 0.7016 0.9224 0.0283  0.3072  -0.1182 270 SAM A C8    
3942 N N7    . SAM C .   ? 0.6525 0.6550 0.9168 0.0415  0.3010  -0.1217 270 SAM A N7    
3943 C C5    . SAM C .   ? 0.7488 0.6989 1.0027 0.0585  0.3044  -0.1211 270 SAM A C5    
3944 C C6    . SAM C .   ? 0.6872 0.5741 0.9294 0.0764  0.3008  -0.1237 270 SAM A C6    
3945 N N6    . SAM C .   ? 0.6544 0.5238 0.8941 0.0789  0.2926  -0.1275 270 SAM A N6    
3946 N N1    . SAM C .   ? 0.6417 0.4839 0.8749 0.0916  0.3060  -0.1222 270 SAM A N1    
3947 C C2    . SAM C .   ? 0.6746 0.5350 0.9105 0.0890  0.3146  -0.1181 270 SAM A C2    
3948 N N3    . SAM C .   ? 0.6344 0.5581 0.8821 0.0711  0.3181  -0.1156 270 SAM A N3    
3949 C C4    . SAM C .   ? 0.8094 0.7772 1.0660 0.0561  0.3130  -0.1171 270 SAM A C4    
3950 N N     . SAM D .   ? 2.0211 1.9139 2.3279 0.1742  0.5918  -0.0510 270 SAM B N     
3951 C CA    . SAM D .   ? 2.0186 1.8297 2.3164 0.1674  0.5721  -0.0296 270 SAM B CA    
3952 C C     . SAM D .   ? 2.0615 1.8260 2.3132 0.1763  0.5626  -0.0185 270 SAM B C     
3953 O O     . SAM D .   ? 2.0597 1.7822 2.2804 0.2039  0.5390  -0.0193 270 SAM B O     
3954 O OXT   . SAM D .   ? 2.0955 1.8623 2.3390 0.1560  0.5783  -0.0087 270 SAM B OXT   
3955 C CB    . SAM D .   ? 1.9775 1.7744 2.3105 0.1271  0.5844  -0.0114 270 SAM B CB    
3956 C CG    . SAM D .   ? 1.9228 1.7767 2.3024 0.1121  0.6012  -0.0214 270 SAM B CG    
3957 S SD    . SAM D .   ? 1.3758 1.1959 1.7821 0.1218  0.5784  -0.0220 270 SAM B SD    
3958 C CE    . SAM D .   ? 0.9844 0.7045 1.3634 0.1187  0.5539  0.0037  270 SAM B CE    
3959 C "C5'" . SAM D .   ? 0.9251 0.7645 1.3853 0.0781  0.5995  -0.0102 270 SAM B "C5'" 
3960 C "C4'" . SAM D .   ? 0.8935 0.6900 1.3800 0.0736  0.5827  -0.0017 270 SAM B "C4'" 
3961 O "O4'" . SAM D .   ? 0.8957 0.6263 1.3775 0.0527  0.5751  0.0235  270 SAM B "O4'" 
3962 C "C3'" . SAM D .   ? 0.8961 0.6686 1.3676 0.1108  0.5554  -0.0145 270 SAM B "C3'" 
3963 O "O3'" . SAM D .   ? 0.8685 0.6882 1.3693 0.1211  0.5585  -0.0335 270 SAM B "O3'" 
3964 C "C2'" . SAM D .   ? 0.9008 0.5949 1.3725 0.1042  0.5335  0.0048  270 SAM B "C2'" 
3965 O "O2'" . SAM D .   ? 0.8518 0.5450 1.3573 0.1051  0.5254  -0.0003 270 SAM B "O2'" 
3966 C "C1'" . SAM D .   ? 0.8850 0.5584 1.3667 0.0659  0.5480  0.0286  270 SAM B "C1'" 
3967 N N9    . SAM D .   ? 0.9118 0.5156 1.3587 0.0676  0.5313  0.0463  270 SAM B N9    
3968 C C8    . SAM D .   ? 1.0029 0.5992 1.4127 0.0712  0.5352  0.0503  270 SAM B C8    
3969 N N7    . SAM D .   ? 0.9643 0.4891 1.3499 0.0718  0.5162  0.0678  270 SAM B N7    
3970 C C5    . SAM D .   ? 0.9378 0.4247 1.3441 0.0685  0.5001  0.0748  270 SAM B C5    
3971 C C6    . SAM D .   ? 1.1140 0.5280 1.5093 0.0674  0.4779  0.0917  270 SAM B C6    
3972 N N6    . SAM D .   ? 0.9706 0.3391 1.3287 0.0698  0.4694  0.1045  270 SAM B N6    
3973 N N1    . SAM D .   ? 1.0078 0.3974 1.4309 0.0636  0.4648  0.0949  270 SAM B N1    
3974 C C2    . SAM D .   ? 0.9483 0.3850 1.4103 0.0610  0.4740  0.0817  270 SAM B C2    
3975 N N3    . SAM D .   ? 0.8729 0.3825 1.3456 0.0623  0.4964  0.0650  270 SAM B N3    
3976 C C4    . SAM D .   ? 0.9045 0.4394 1.3497 0.0658  0.5093  0.0615  270 SAM B C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   SER 2   -1  ?   ?   ?   A . n 
A 1 3   HIS 3   0   ?   ?   ?   A . n 
A 1 4   MET 4   1   ?   ?   ?   A . n 
A 1 5   THR 5   2   ?   ?   ?   A . n 
A 1 6   GLU 6   3   ?   ?   ?   A . n 
A 1 7   LEU 7   4   ?   ?   ?   A . n 
A 1 8   ASP 8   5   ?   ?   ?   A . n 
A 1 9   THR 9   6   ?   ?   ?   A . n 
A 1 10  ILE 10  7   ?   ?   ?   A . n 
A 1 11  ALA 11  8   8   ALA ALA A . n 
A 1 12  ASN 12  9   9   ASN ASN A . n 
A 1 13  PRO 13  10  10  PRO PRO A . n 
A 1 14  SER 14  11  11  SER SER A . n 
A 1 15  ASP 15  12  12  ASP ASP A . n 
A 1 16  PRO 16  13  13  PRO PRO A . n 
A 1 17  ALA 17  14  14  ALA ALA A . n 
A 1 18  VAL 18  15  15  VAL VAL A . n 
A 1 19  GLN 19  16  16  GLN GLN A . n 
A 1 20  ARG 20  17  17  ARG ARG A . n 
A 1 21  ILE 21  18  18  ILE ILE A . n 
A 1 22  ILE 22  19  19  ILE ILE A . n 
A 1 23  ASP 23  20  20  ASP ASP A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  THR 25  22  22  THR THR A . n 
A 1 26  LYS 26  23  23  LYS LYS A . n 
A 1 27  PRO 27  24  24  PRO PRO A . n 
A 1 28  SER 28  25  25  SER SER A . n 
A 1 29  ARG 29  26  26  ARG ARG A . n 
A 1 30  SER 30  27  27  SER SER A . n 
A 1 31  ASN 31  28  28  ASN ASN A . n 
A 1 32  ILE 32  29  29  ILE ILE A . n 
A 1 33  LYS 33  30  30  LYS LYS A . n 
A 1 34  THR 34  31  31  THR THR A . n 
A 1 35  THR 35  32  32  THR THR A . n 
A 1 36  LEU 36  33  33  LEU LEU A . n 
A 1 37  ILE 37  34  34  ILE ILE A . n 
A 1 38  GLU 38  35  35  GLU GLU A . n 
A 1 39  ASP 39  36  36  ASP ASP A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLU 41  38  38  GLU GLU A . n 
A 1 42  PRO 42  39  39  PRO PRO A . n 
A 1 43  LEU 43  40  40  LEU LEU A . n 
A 1 44  MET 44  41  41  MET MET A . n 
A 1 45  HIS 45  42  42  HIS HIS A . n 
A 1 46  SER 46  43  43  SER SER A . n 
A 1 47  ILE 47  44  44  ILE ILE A . n 
A 1 48  ALA 48  45  45  ALA ALA A . n 
A 1 49  ALA 49  46  46  ALA ALA A . n 
A 1 50  GLY 50  47  47  GLY GLY A . n 
A 1 51  VAL 51  48  48  VAL VAL A . n 
A 1 52  GLU 52  49  49  GLU GLU A . n 
A 1 53  PHE 53  50  50  PHE PHE A . n 
A 1 54  ILE 54  51  51  ILE ILE A . n 
A 1 55  GLU 55  52  52  GLU GLU A . n 
A 1 56  VAL 56  53  53  VAL VAL A . n 
A 1 57  TYR 57  54  54  TYR TYR A . n 
A 1 58  GLY 58  55  55  GLY GLY A . n 
A 1 59  SER 59  56  56  SER SER A . n 
A 1 60  ASP 60  57  57  ASP ASP A . n 
A 1 61  SER 61  58  58  SER SER A . n 
A 1 62  SER 62  59  59  SER SER A . n 
A 1 63  PRO 63  60  60  PRO PRO A . n 
A 1 64  PHE 64  61  61  PHE PHE A . n 
A 1 65  PRO 65  62  62  PRO PRO A . n 
A 1 66  SER 66  63  63  SER SER A . n 
A 1 67  GLU 67  64  64  GLU GLU A . n 
A 1 68  LEU 68  65  65  LEU LEU A . n 
A 1 69  LEU 69  66  66  LEU LEU A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  LEU 71  68  68  LEU LEU A . n 
A 1 72  CYS 72  69  69  CYS CYS A . n 
A 1 73  GLY 73  70  70  GLY GLY A . n 
A 1 74  ARG 74  71  71  ARG ARG A . n 
A 1 75  GLN 75  72  72  GLN GLN A . n 
A 1 76  ASN 76  73  73  ASN ASN A . n 
A 1 77  ILE 77  74  74  ILE ILE A . n 
A 1 78  PRO 78  75  75  PRO PRO A . n 
A 1 79  VAL 79  76  76  VAL VAL A . n 
A 1 80  ARG 80  77  77  ARG ARG A . n 
A 1 81  LEU 81  78  78  LEU LEU A . n 
A 1 82  ILE 82  79  79  ILE ILE A . n 
A 1 83  ASP 83  80  80  ASP ASP A . n 
A 1 84  SER 84  81  81  SER SER A . n 
A 1 85  SER 85  82  82  SER SER A . n 
A 1 86  ILE 86  83  83  ILE ILE A . n 
A 1 87  VAL 87  84  84  VAL VAL A . n 
A 1 88  ASN 88  85  85  ASN ASN A . n 
A 1 89  GLN 89  86  86  GLN GLN A . n 
A 1 90  LEU 90  87  87  LEU LEU A . n 
A 1 91  PHE 91  88  88  PHE PHE A . n 
A 1 92  LYS 92  89  89  LYS LYS A . n 
A 1 93  GLY 93  90  90  GLY GLY A . n 
A 1 94  GLU 94  91  91  GLU GLU A . n 
A 1 95  ARG 95  92  92  ARG ARG A . n 
A 1 96  LYS 96  93  93  LYS LYS A . n 
A 1 97  ALA 97  94  94  ALA ALA A . n 
A 1 98  LYS 98  95  95  LYS LYS A . n 
A 1 99  THR 99  96  96  THR THR A . n 
A 1 100 PHE 100 97  97  PHE PHE A . n 
A 1 101 GLY 101 98  98  GLY GLY A . n 
A 1 102 ILE 102 99  99  ILE ILE A . n 
A 1 103 ALA 103 100 100 ALA ALA A . n 
A 1 104 ARG 104 101 101 ARG ARG A . n 
A 1 105 VAL 105 102 102 VAL VAL A . n 
A 1 106 PRO 106 103 103 PRO PRO A . n 
A 1 107 ARG 107 104 104 ARG ARG A . n 
A 1 108 PRO 108 105 105 PRO PRO A . n 
A 1 109 ALA 109 106 106 ALA ALA A . n 
A 1 110 ARG 110 107 107 ARG ARG A . n 
A 1 111 PHE 111 108 108 PHE PHE A . n 
A 1 112 GLY 112 109 109 GLY GLY A . n 
A 1 113 ASP 113 110 110 ASP ASP A . n 
A 1 114 ILE 114 111 111 ILE ILE A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 ARG 118 115 115 ARG ARG A . n 
A 1 119 GLY 119 116 116 GLY GLY A . n 
A 1 120 ASP 120 117 117 ASP ASP A . n 
A 1 121 VAL 121 118 118 VAL VAL A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 VAL 123 120 120 VAL VAL A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 ASP 125 122 122 ASP ASP A . n 
A 1 126 GLY 126 123 123 GLY GLY A . n 
A 1 127 VAL 127 124 124 VAL VAL A . n 
A 1 128 LYS 128 125 125 LYS LYS A . n 
A 1 129 ILE 129 126 126 ILE ILE A . n 
A 1 130 VAL 130 127 127 VAL VAL A . n 
A 1 131 GLY 131 128 128 GLY GLY A . n 
A 1 132 ASN 132 129 129 ASN ASN A . n 
A 1 133 ILE 133 130 130 ILE ILE A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 ALA 135 132 132 ALA ALA A . n 
A 1 136 ILE 136 133 133 ILE ILE A . n 
A 1 137 VAL 137 134 134 VAL VAL A . n 
A 1 138 ARG 138 135 135 ARG ARG A . n 
A 1 139 THR 139 136 136 THR THR A . n 
A 1 140 SER 140 137 137 SER SER A . n 
A 1 141 LEU 141 138 138 LEU LEU A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 LEU 143 140 140 LEU LEU A . n 
A 1 144 GLY 144 141 141 GLY GLY A . n 
A 1 145 ALA 145 142 142 ALA ALA A . n 
A 1 146 SER 146 143 143 SER SER A . n 
A 1 147 GLY 147 144 144 GLY GLY A . n 
A 1 148 ILE 148 145 145 ILE ILE A . n 
A 1 149 ILE 149 146 146 ILE ILE A . n 
A 1 150 LEU 150 147 147 LEU LEU A . n 
A 1 151 VAL 151 148 148 VAL VAL A . n 
A 1 152 ASP 152 149 149 ASP ASP A . n 
A 1 153 SER 153 150 150 SER SER A . n 
A 1 154 ASP 154 151 151 ASP ASP A . n 
A 1 155 ILE 155 152 152 ILE ILE A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 SER 157 154 154 SER SER A . n 
A 1 158 ILE 158 155 155 ILE ILE A . n 
A 1 159 ALA 159 156 156 ALA ALA A . n 
A 1 160 ASP 160 157 157 ASP ASP A . n 
A 1 161 ARG 161 158 158 ARG ARG A . n 
A 1 162 ARG 162 159 159 ARG ARG A . n 
A 1 163 LEU 163 160 160 LEU LEU A . n 
A 1 164 GLN 164 161 161 GLN GLN A . n 
A 1 165 ARG 165 162 162 ARG ARG A . n 
A 1 166 ALA 166 163 163 ALA ALA A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ARG 168 165 165 ARG ARG A . n 
A 1 169 GLY 169 166 166 GLY GLY A . n 
A 1 170 TYR 170 167 167 TYR TYR A . n 
A 1 171 VAL 171 168 168 VAL VAL A . n 
A 1 172 PHE 172 169 169 PHE PHE A . n 
A 1 173 SER 173 170 170 SER SER A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PRO 175 172 172 PRO PRO A . n 
A 1 176 VAL 176 173 173 VAL VAL A . n 
A 1 177 VAL 177 174 174 VAL VAL A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 SER 179 176 176 SER SER A . n 
A 1 180 GLY 180 177 177 GLY GLY A . n 
A 1 181 ARG 181 178 178 ARG ARG A . n 
A 1 182 GLU 182 179 179 GLU GLU A . n 
A 1 183 GLU 183 180 180 GLU GLU A . n 
A 1 184 ALA 184 181 181 ALA ALA A . n 
A 1 185 ILE 185 182 182 ILE ILE A . n 
A 1 186 ALA 186 183 183 ALA ALA A . n 
A 1 187 PHE 187 184 184 PHE PHE A . n 
A 1 188 ILE 188 185 185 ILE ILE A . n 
A 1 189 ARG 189 186 186 ARG ARG A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 SER 191 188 188 SER SER A . n 
A 1 192 GLY 192 189 189 GLY GLY A . n 
A 1 193 MET 193 190 190 MET MET A . n 
A 1 194 GLN 194 191 191 GLN GLN A . n 
A 1 195 LEU 195 192 192 LEU LEU A . n 
A 1 196 MET 196 193 193 MET MET A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 LEU 198 195 195 LEU LEU A . n 
A 1 199 LYS 199 196 196 LYS LYS A . n 
A 1 200 ALA 200 197 197 ALA ALA A . n 
A 1 201 ASP 201 198 198 ASP ASP A . n 
A 1 202 GLY 202 199 199 GLY GLY A . n 
A 1 203 ASP 203 200 200 ASP ASP A . n 
A 1 204 ILE 204 201 201 ILE ILE A . n 
A 1 205 SER 205 202 202 SER SER A . n 
A 1 206 VAL 206 203 203 VAL VAL A . n 
A 1 207 LYS 207 204 204 LYS LYS A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 LEU 209 206 206 LEU LEU A . n 
A 1 210 GLY 210 207 207 GLY GLY A . n 
A 1 211 ASP 211 208 208 ASP ASP A . n 
A 1 212 ASN 212 209 209 ASN ASN A . n 
A 1 213 PRO 213 210 210 PRO PRO A . n 
A 1 214 ASP 214 211 211 ASP ASP A . n 
A 1 215 ARG 215 212 212 ARG ARG A . n 
A 1 216 LEU 216 213 213 LEU LEU A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 LEU 218 215 215 LEU LEU A . n 
A 1 219 LEU 219 216 216 LEU LEU A . n 
A 1 220 PHE 220 217 217 PHE PHE A . n 
A 1 221 GLY 221 218 218 GLY GLY A . n 
A 1 222 SER 222 219 219 SER SER A . n 
A 1 223 GLU 223 220 220 GLU GLU A . n 
A 1 224 LYS 224 221 221 LYS LYS A . n 
A 1 225 GLY 225 222 222 GLY GLY A . n 
A 1 226 GLY 226 223 223 GLY GLY A . n 
A 1 227 PRO 227 224 224 PRO PRO A . n 
A 1 228 SER 228 225 225 SER SER A . n 
A 1 229 ASP 229 226 226 ASP ASP A . n 
A 1 230 LEU 230 227 227 LEU LEU A . n 
A 1 231 PHE 231 228 228 PHE PHE A . n 
A 1 232 GLU 232 229 229 GLU GLU A . n 
A 1 233 GLU 233 230 230 GLU GLU A . n 
A 1 234 ALA 234 231 231 ALA ALA A . n 
A 1 235 SER 235 232 232 SER SER A . n 
A 1 236 SER 236 233 233 SER SER A . n 
A 1 237 ALA 237 234 234 ALA ALA A . n 
A 1 238 SER 238 235 235 SER SER A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 SER 240 237 237 SER SER A . n 
A 1 241 ILE 241 238 238 ILE ILE A . n 
A 1 242 PRO 242 239 239 PRO PRO A . n 
A 1 243 MET 243 240 240 MET MET A . n 
A 1 244 MET 244 241 241 MET MET A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 GLN 246 243 243 GLN GLN A . n 
A 1 247 THR 247 244 244 THR THR A . n 
A 1 248 GLU 248 245 245 GLU GLU A . n 
A 1 249 SER 249 246 246 SER SER A . n 
A 1 250 LEU 250 247 247 LEU LEU A . n 
A 1 251 ASN 251 248 248 ASN ASN A . n 
A 1 252 VAL 252 249 249 VAL VAL A . n 
A 1 253 SER 253 250 250 SER SER A . n 
A 1 254 VAL 254 251 251 VAL VAL A . n 
A 1 255 SER 255 252 252 SER SER A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 GLY 257 254 254 GLY GLY A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ALA 259 256 256 ALA ALA A . n 
A 1 260 LEU 260 257 257 LEU LEU A . n 
A 1 261 HIS 261 258 258 HIS HIS A . n 
A 1 262 GLU 262 259 259 GLU GLU A . n 
A 1 263 ARG 263 260 260 ARG ARG A . n 
A 1 264 ILE 264 261 261 ILE ILE A . n 
A 1 265 ASP 265 262 262 ASP ASP A . n 
A 1 266 ARG 266 263 263 ARG ARG A . n 
A 1 267 ASN 267 264 264 ASN ASN A . n 
A 1 268 LEU 268 265 265 LEU LEU A . n 
A 1 269 ALA 269 266 266 ALA ALA A . n 
A 1 270 ALA 270 267 267 ALA ALA A . n 
A 1 271 ASN 271 268 268 ASN ASN A . n 
A 1 272 ARG 272 269 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   SER 2   -1  ?   ?   ?   B . n 
B 1 3   HIS 3   0   ?   ?   ?   B . n 
B 1 4   MET 4   1   ?   ?   ?   B . n 
B 1 5   THR 5   2   ?   ?   ?   B . n 
B 1 6   GLU 6   3   ?   ?   ?   B . n 
B 1 7   LEU 7   4   ?   ?   ?   B . n 
B 1 8   ASP 8   5   ?   ?   ?   B . n 
B 1 9   THR 9   6   ?   ?   ?   B . n 
B 1 10  ILE 10  7   ?   ?   ?   B . n 
B 1 11  ALA 11  8   8   ALA ALA B . n 
B 1 12  ASN 12  9   9   ASN ASN B . n 
B 1 13  PRO 13  10  10  PRO PRO B . n 
B 1 14  SER 14  11  11  SER SER B . n 
B 1 15  ASP 15  12  12  ASP ASP B . n 
B 1 16  PRO 16  13  13  PRO PRO B . n 
B 1 17  ALA 17  14  14  ALA ALA B . n 
B 1 18  VAL 18  15  15  VAL VAL B . n 
B 1 19  GLN 19  16  16  GLN GLN B . n 
B 1 20  ARG 20  17  17  ARG ARG B . n 
B 1 21  ILE 21  18  18  ILE ILE B . n 
B 1 22  ILE 22  19  19  ILE ILE B . n 
B 1 23  ASP 23  20  20  ASP ASP B . n 
B 1 24  VAL 24  21  21  VAL VAL B . n 
B 1 25  THR 25  22  22  THR THR B . n 
B 1 26  LYS 26  23  23  LYS LYS B . n 
B 1 27  PRO 27  24  24  PRO PRO B . n 
B 1 28  SER 28  25  25  SER SER B . n 
B 1 29  ARG 29  26  26  ARG ARG B . n 
B 1 30  SER 30  27  27  SER SER B . n 
B 1 31  ASN 31  28  28  ASN ASN B . n 
B 1 32  ILE 32  29  29  ILE ILE B . n 
B 1 33  LYS 33  30  30  LYS LYS B . n 
B 1 34  THR 34  31  31  THR THR B . n 
B 1 35  THR 35  32  32  THR THR B . n 
B 1 36  LEU 36  33  33  LEU LEU B . n 
B 1 37  ILE 37  34  34  ILE ILE B . n 
B 1 38  GLU 38  35  35  GLU GLU B . n 
B 1 39  ASP 39  36  36  ASP ASP B . n 
B 1 40  VAL 40  37  37  VAL VAL B . n 
B 1 41  GLU 41  38  38  GLU GLU B . n 
B 1 42  PRO 42  39  39  PRO PRO B . n 
B 1 43  LEU 43  40  40  LEU LEU B . n 
B 1 44  MET 44  41  41  MET MET B . n 
B 1 45  HIS 45  42  42  HIS HIS B . n 
B 1 46  SER 46  43  43  SER SER B . n 
B 1 47  ILE 47  44  44  ILE ILE B . n 
B 1 48  ALA 48  45  45  ALA ALA B . n 
B 1 49  ALA 49  46  46  ALA ALA B . n 
B 1 50  GLY 50  47  47  GLY GLY B . n 
B 1 51  VAL 51  48  48  VAL VAL B . n 
B 1 52  GLU 52  49  49  GLU GLU B . n 
B 1 53  PHE 53  50  50  PHE PHE B . n 
B 1 54  ILE 54  51  51  ILE ILE B . n 
B 1 55  GLU 55  52  52  GLU GLU B . n 
B 1 56  VAL 56  53  53  VAL VAL B . n 
B 1 57  TYR 57  54  54  TYR TYR B . n 
B 1 58  GLY 58  55  55  GLY GLY B . n 
B 1 59  SER 59  56  56  SER SER B . n 
B 1 60  ASP 60  57  57  ASP ASP B . n 
B 1 61  SER 61  58  58  SER SER B . n 
B 1 62  SER 62  59  59  SER SER B . n 
B 1 63  PRO 63  60  60  PRO PRO B . n 
B 1 64  PHE 64  61  61  PHE PHE B . n 
B 1 65  PRO 65  62  62  PRO PRO B . n 
B 1 66  SER 66  63  63  SER SER B . n 
B 1 67  GLU 67  64  64  GLU GLU B . n 
B 1 68  LEU 68  65  65  LEU LEU B . n 
B 1 69  LEU 69  66  66  LEU LEU B . n 
B 1 70  ASP 70  67  67  ASP ASP B . n 
B 1 71  LEU 71  68  68  LEU LEU B . n 
B 1 72  CYS 72  69  69  CYS CYS B . n 
B 1 73  GLY 73  70  70  GLY GLY B . n 
B 1 74  ARG 74  71  71  ARG ARG B . n 
B 1 75  GLN 75  72  72  GLN GLN B . n 
B 1 76  ASN 76  73  73  ASN ASN B . n 
B 1 77  ILE 77  74  74  ILE ILE B . n 
B 1 78  PRO 78  75  75  PRO PRO B . n 
B 1 79  VAL 79  76  76  VAL VAL B . n 
B 1 80  ARG 80  77  77  ARG ARG B . n 
B 1 81  LEU 81  78  78  LEU LEU B . n 
B 1 82  ILE 82  79  79  ILE ILE B . n 
B 1 83  ASP 83  80  80  ASP ASP B . n 
B 1 84  SER 84  81  81  SER SER B . n 
B 1 85  SER 85  82  82  SER SER B . n 
B 1 86  ILE 86  83  83  ILE ILE B . n 
B 1 87  VAL 87  84  84  VAL VAL B . n 
B 1 88  ASN 88  85  85  ASN ASN B . n 
B 1 89  GLN 89  86  86  GLN GLN B . n 
B 1 90  LEU 90  87  87  LEU LEU B . n 
B 1 91  PHE 91  88  88  PHE PHE B . n 
B 1 92  LYS 92  89  89  LYS LYS B . n 
B 1 93  GLY 93  90  90  GLY GLY B . n 
B 1 94  GLU 94  91  91  GLU GLU B . n 
B 1 95  ARG 95  92  92  ARG ARG B . n 
B 1 96  LYS 96  93  93  LYS LYS B . n 
B 1 97  ALA 97  94  94  ALA ALA B . n 
B 1 98  LYS 98  95  95  LYS LYS B . n 
B 1 99  THR 99  96  96  THR THR B . n 
B 1 100 PHE 100 97  97  PHE PHE B . n 
B 1 101 GLY 101 98  98  GLY GLY B . n 
B 1 102 ILE 102 99  99  ILE ILE B . n 
B 1 103 ALA 103 100 100 ALA ALA B . n 
B 1 104 ARG 104 101 101 ARG ARG B . n 
B 1 105 VAL 105 102 102 VAL VAL B . n 
B 1 106 PRO 106 103 103 PRO PRO B . n 
B 1 107 ARG 107 104 104 ARG ARG B . n 
B 1 108 PRO 108 105 105 PRO PRO B . n 
B 1 109 ALA 109 106 106 ALA ALA B . n 
B 1 110 ARG 110 107 107 ARG ARG B . n 
B 1 111 PHE 111 108 108 PHE PHE B . n 
B 1 112 GLY 112 109 109 GLY GLY B . n 
B 1 113 ASP 113 110 110 ASP ASP B . n 
B 1 114 ILE 114 111 111 ILE ILE B . n 
B 1 115 ALA 115 112 112 ALA ALA B . n 
B 1 116 SER 116 113 113 SER SER B . n 
B 1 117 ARG 117 114 114 ARG ARG B . n 
B 1 118 ARG 118 115 115 ARG ARG B . n 
B 1 119 GLY 119 116 116 GLY GLY B . n 
B 1 120 ASP 120 117 117 ASP ASP B . n 
B 1 121 VAL 121 118 118 VAL VAL B . n 
B 1 122 VAL 122 119 119 VAL VAL B . n 
B 1 123 VAL 123 120 120 VAL VAL B . n 
B 1 124 LEU 124 121 121 LEU LEU B . n 
B 1 125 ASP 125 122 122 ASP ASP B . n 
B 1 126 GLY 126 123 123 GLY GLY B . n 
B 1 127 VAL 127 124 124 VAL VAL B . n 
B 1 128 LYS 128 125 125 LYS LYS B . n 
B 1 129 ILE 129 126 126 ILE ILE B . n 
B 1 130 VAL 130 127 127 VAL VAL B . n 
B 1 131 GLY 131 128 128 GLY GLY B . n 
B 1 132 ASN 132 129 129 ASN ASN B . n 
B 1 133 ILE 133 130 130 ILE ILE B . n 
B 1 134 GLY 134 131 131 GLY GLY B . n 
B 1 135 ALA 135 132 132 ALA ALA B . n 
B 1 136 ILE 136 133 133 ILE ILE B . n 
B 1 137 VAL 137 134 134 VAL VAL B . n 
B 1 138 ARG 138 135 135 ARG ARG B . n 
B 1 139 THR 139 136 136 THR THR B . n 
B 1 140 SER 140 137 137 SER SER B . n 
B 1 141 LEU 141 138 138 LEU LEU B . n 
B 1 142 ALA 142 139 139 ALA ALA B . n 
B 1 143 LEU 143 140 140 LEU LEU B . n 
B 1 144 GLY 144 141 141 GLY GLY B . n 
B 1 145 ALA 145 142 142 ALA ALA B . n 
B 1 146 SER 146 143 143 SER SER B . n 
B 1 147 GLY 147 144 144 GLY GLY B . n 
B 1 148 ILE 148 145 145 ILE ILE B . n 
B 1 149 ILE 149 146 146 ILE ILE B . n 
B 1 150 LEU 150 147 147 LEU LEU B . n 
B 1 151 VAL 151 148 148 VAL VAL B . n 
B 1 152 ASP 152 149 149 ASP ASP B . n 
B 1 153 SER 153 150 150 SER SER B . n 
B 1 154 ASP 154 151 151 ASP ASP B . n 
B 1 155 ILE 155 152 152 ILE ILE B . n 
B 1 156 THR 156 153 153 THR THR B . n 
B 1 157 SER 157 154 154 SER SER B . n 
B 1 158 ILE 158 155 155 ILE ILE B . n 
B 1 159 ALA 159 156 156 ALA ALA B . n 
B 1 160 ASP 160 157 157 ASP ASP B . n 
B 1 161 ARG 161 158 158 ARG ARG B . n 
B 1 162 ARG 162 159 159 ARG ARG B . n 
B 1 163 LEU 163 160 160 LEU LEU B . n 
B 1 164 GLN 164 161 161 GLN GLN B . n 
B 1 165 ARG 165 162 162 ARG ARG B . n 
B 1 166 ALA 166 163 163 ALA ALA B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ARG 168 165 165 ARG ARG B . n 
B 1 169 GLY 169 166 166 GLY GLY B . n 
B 1 170 TYR 170 167 167 TYR TYR B . n 
B 1 171 VAL 171 168 168 VAL VAL B . n 
B 1 172 PHE 172 169 169 PHE PHE B . n 
B 1 173 SER 173 170 170 SER SER B . n 
B 1 174 LEU 174 171 171 LEU LEU B . n 
B 1 175 PRO 175 172 172 PRO PRO B . n 
B 1 176 VAL 176 173 173 VAL VAL B . n 
B 1 177 VAL 177 174 174 VAL VAL B . n 
B 1 178 LEU 178 175 175 LEU LEU B . n 
B 1 179 SER 179 176 176 SER SER B . n 
B 1 180 GLY 180 177 177 GLY GLY B . n 
B 1 181 ARG 181 178 178 ARG ARG B . n 
B 1 182 GLU 182 179 179 GLU GLU B . n 
B 1 183 GLU 183 180 180 GLU GLU B . n 
B 1 184 ALA 184 181 181 ALA ALA B . n 
B 1 185 ILE 185 182 182 ILE ILE B . n 
B 1 186 ALA 186 183 183 ALA ALA B . n 
B 1 187 PHE 187 184 184 PHE PHE B . n 
B 1 188 ILE 188 185 185 ILE ILE B . n 
B 1 189 ARG 189 186 186 ARG ARG B . n 
B 1 190 ASP 190 187 187 ASP ASP B . n 
B 1 191 SER 191 188 188 SER SER B . n 
B 1 192 GLY 192 189 189 GLY GLY B . n 
B 1 193 MET 193 190 190 MET MET B . n 
B 1 194 GLN 194 191 191 GLN GLN B . n 
B 1 195 LEU 195 192 192 LEU LEU B . n 
B 1 196 MET 196 193 193 MET MET B . n 
B 1 197 THR 197 194 194 THR THR B . n 
B 1 198 LEU 198 195 195 LEU LEU B . n 
B 1 199 LYS 199 196 196 LYS LYS B . n 
B 1 200 ALA 200 197 197 ALA ALA B . n 
B 1 201 ASP 201 198 198 ASP ASP B . n 
B 1 202 GLY 202 199 199 GLY GLY B . n 
B 1 203 ASP 203 200 200 ASP ASP B . n 
B 1 204 ILE 204 201 201 ILE ILE B . n 
B 1 205 SER 205 202 202 SER SER B . n 
B 1 206 VAL 206 203 203 VAL VAL B . n 
B 1 207 LYS 207 204 204 LYS LYS B . n 
B 1 208 GLU 208 205 205 GLU GLU B . n 
B 1 209 LEU 209 206 206 LEU LEU B . n 
B 1 210 GLY 210 207 207 GLY GLY B . n 
B 1 211 ASP 211 208 208 ASP ASP B . n 
B 1 212 ASN 212 209 209 ASN ASN B . n 
B 1 213 PRO 213 210 210 PRO PRO B . n 
B 1 214 ASP 214 211 211 ASP ASP B . n 
B 1 215 ARG 215 212 212 ARG ARG B . n 
B 1 216 LEU 216 213 213 LEU LEU B . n 
B 1 217 ALA 217 214 214 ALA ALA B . n 
B 1 218 LEU 218 215 215 LEU LEU B . n 
B 1 219 LEU 219 216 216 LEU LEU B . n 
B 1 220 PHE 220 217 217 PHE PHE B . n 
B 1 221 GLY 221 218 218 GLY GLY B . n 
B 1 222 SER 222 219 219 SER SER B . n 
B 1 223 GLU 223 220 220 GLU GLU B . n 
B 1 224 LYS 224 221 221 LYS LYS B . n 
B 1 225 GLY 225 222 222 GLY GLY B . n 
B 1 226 GLY 226 223 223 GLY GLY B . n 
B 1 227 PRO 227 224 224 PRO PRO B . n 
B 1 228 SER 228 225 225 SER SER B . n 
B 1 229 ASP 229 226 226 ASP ASP B . n 
B 1 230 LEU 230 227 227 LEU LEU B . n 
B 1 231 PHE 231 228 228 PHE PHE B . n 
B 1 232 GLU 232 229 229 GLU GLU B . n 
B 1 233 GLU 233 230 230 GLU GLU B . n 
B 1 234 ALA 234 231 231 ALA ALA B . n 
B 1 235 SER 235 232 232 SER SER B . n 
B 1 236 SER 236 233 233 SER SER B . n 
B 1 237 ALA 237 234 234 ALA ALA B . n 
B 1 238 SER 238 235 235 SER SER B . n 
B 1 239 VAL 239 236 236 VAL VAL B . n 
B 1 240 SER 240 237 237 SER SER B . n 
B 1 241 ILE 241 238 238 ILE ILE B . n 
B 1 242 PRO 242 239 239 PRO PRO B . n 
B 1 243 MET 243 240 240 MET MET B . n 
B 1 244 MET 244 241 241 MET MET B . n 
B 1 245 SER 245 242 242 SER SER B . n 
B 1 246 GLN 246 243 243 GLN GLN B . n 
B 1 247 THR 247 244 244 THR THR B . n 
B 1 248 GLU 248 245 245 GLU GLU B . n 
B 1 249 SER 249 246 246 SER SER B . n 
B 1 250 LEU 250 247 247 LEU LEU B . n 
B 1 251 ASN 251 248 248 ASN ASN B . n 
B 1 252 VAL 252 249 249 VAL VAL B . n 
B 1 253 SER 253 250 250 SER SER B . n 
B 1 254 VAL 254 251 251 VAL VAL B . n 
B 1 255 SER 255 252 252 SER SER B . n 
B 1 256 LEU 256 253 253 LEU LEU B . n 
B 1 257 GLY 257 254 254 GLY GLY B . n 
B 1 258 ILE 258 255 255 ILE ILE B . n 
B 1 259 ALA 259 256 256 ALA ALA B . n 
B 1 260 LEU 260 257 257 LEU LEU B . n 
B 1 261 HIS 261 258 258 HIS HIS B . n 
B 1 262 GLU 262 259 259 GLU GLU B . n 
B 1 263 ARG 263 260 260 ARG ARG B . n 
B 1 264 ILE 264 261 261 ILE ILE B . n 
B 1 265 ASP 265 262 262 ASP ASP B . n 
B 1 266 ARG 266 263 263 ARG ARG B . n 
B 1 267 ASN 267 264 264 ASN ASN B . n 
B 1 268 LEU 268 265 265 LEU LEU B . n 
B 1 269 ALA 269 266 266 ALA ALA B . n 
B 1 270 ALA 270 267 267 ALA ALA B . n 
B 1 271 ASN 271 268 268 ASN ASN B . n 
B 1 272 ARG 272 269 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SAM 1  270 1  SAM SAM A . 
D 2 SAM 1  270 1  SAM SAM B . 
E 3 HOH 1  271 10 HOH HOH A . 
E 3 HOH 2  272 18 HOH HOH A . 
E 3 HOH 3  273 22 HOH HOH A . 
E 3 HOH 4  274 24 HOH HOH A . 
E 3 HOH 5  275 27 HOH HOH A . 
E 3 HOH 6  276 36 HOH HOH A . 
E 3 HOH 7  277 41 HOH HOH A . 
E 3 HOH 8  278 45 HOH HOH A . 
E 3 HOH 9  279 48 HOH HOH A . 
E 3 HOH 10 280 49 HOH HOH A . 
E 3 HOH 11 281 50 HOH HOH A . 
E 3 HOH 12 282 52 HOH HOH A . 
E 3 HOH 13 283 54 HOH HOH A . 
E 3 HOH 14 284 62 HOH HOH A . 
E 3 HOH 15 285 64 HOH HOH A . 
E 3 HOH 16 286 69 HOH HOH A . 
F 3 HOH 1  271 1  HOH HOH B . 
F 3 HOH 2  272 2  HOH HOH B . 
F 3 HOH 3  273 3  HOH HOH B . 
F 3 HOH 4  274 4  HOH HOH B . 
F 3 HOH 5  275 5  HOH HOH B . 
F 3 HOH 6  276 6  HOH HOH B . 
F 3 HOH 7  277 7  HOH HOH B . 
F 3 HOH 8  278 8  HOH HOH B . 
F 3 HOH 9  279 9  HOH HOH B . 
F 3 HOH 10 280 11 HOH HOH B . 
F 3 HOH 11 281 12 HOH HOH B . 
F 3 HOH 12 282 13 HOH HOH B . 
F 3 HOH 13 283 14 HOH HOH B . 
F 3 HOH 14 284 15 HOH HOH B . 
F 3 HOH 15 285 16 HOH HOH B . 
F 3 HOH 16 286 17 HOH HOH B . 
F 3 HOH 17 287 19 HOH HOH B . 
F 3 HOH 18 288 20 HOH HOH B . 
F 3 HOH 19 289 21 HOH HOH B . 
F 3 HOH 20 290 23 HOH HOH B . 
F 3 HOH 21 291 25 HOH HOH B . 
F 3 HOH 22 292 26 HOH HOH B . 
F 3 HOH 23 293 28 HOH HOH B . 
F 3 HOH 24 294 29 HOH HOH B . 
F 3 HOH 25 295 30 HOH HOH B . 
F 3 HOH 26 296 31 HOH HOH B . 
F 3 HOH 27 297 32 HOH HOH B . 
F 3 HOH 28 298 33 HOH HOH B . 
F 3 HOH 29 299 34 HOH HOH B . 
F 3 HOH 30 300 35 HOH HOH B . 
F 3 HOH 31 301 37 HOH HOH B . 
F 3 HOH 32 302 38 HOH HOH B . 
F 3 HOH 33 303 39 HOH HOH B . 
F 3 HOH 34 304 40 HOH HOH B . 
F 3 HOH 35 305 42 HOH HOH B . 
F 3 HOH 36 306 43 HOH HOH B . 
F 3 HOH 37 307 44 HOH HOH B . 
F 3 HOH 38 308 46 HOH HOH B . 
F 3 HOH 39 309 47 HOH HOH B . 
F 3 HOH 40 310 51 HOH HOH B . 
F 3 HOH 41 311 53 HOH HOH B . 
F 3 HOH 42 312 55 HOH HOH B . 
F 3 HOH 43 313 56 HOH HOH B . 
F 3 HOH 44 314 57 HOH HOH B . 
F 3 HOH 45 315 58 HOH HOH B . 
F 3 HOH 46 316 59 HOH HOH B . 
F 3 HOH 47 317 60 HOH HOH B . 
F 3 HOH 48 318 61 HOH HOH B . 
F 3 HOH 49 319 63 HOH HOH B . 
F 3 HOH 50 320 65 HOH HOH B . 
F 3 HOH 51 321 66 HOH HOH B . 
F 3 HOH 52 322 67 HOH HOH B . 
F 3 HOH 53 323 68 HOH HOH B . 
F 3 HOH 54 324 70 HOH HOH B . 
F 3 HOH 55 325 71 HOH HOH B . 
F 3 HOH 56 326 72 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2650  ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  23330 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-04-14 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 28.1896 -0.0345 64.4283 1.7739 0.7616 0.7904 0.0421  0.0703  -0.2075 0.5663  0.3860  1.0286  0.0586  0.6244  -1.0343 
-0.0617 -0.3454 -0.0053 0.3013  -0.4276 -0.0235 0.6590  1.1144  0.4599  'X-RAY DIFFRACTION' 
2 ? refined 9.8589  23.4559 71.1636 0.4834 0.5097 0.2178 -0.0765 -0.0761 0.1876  1.7652  3.5553  4.9980  -0.9854 -1.2067 0.9938  
0.1311  0.2899  0.0004  0.5321  0.2061  0.0955  -0.7963 -0.2156 -0.3861 'X-RAY DIFFRACTION' 
3 ? refined 17.8919 15.1330 94.6801 0.1998 0.2375 0.3322 0.0284  0.0408  0.1032  3.4135  2.2941  3.8353  1.6565  1.3048  -0.7295 
-0.0055 0.0220  0.0002  -0.0397 -0.1462 -0.1033 -0.3087 0.2001  -0.0845 'X-RAY DIFFRACTION' 
4 ? refined 30.0510 42.8326 93.4814 0.5258 0.3841 0.4720 -0.0489 0.0372  0.0291  1.7818  2.6878  1.1328  0.1657  -0.7571 -0.3559 
0.2235  -0.0782 0.0003  -0.1464 0.3729  0.0250  0.0804  -0.7391 0.1673  'X-RAY DIFFRACTION' 
5 ? refined 13.3335 29.9520 80.7479 0.6536 0.7786 0.9387 0.0004  0.3096  -0.1135 -0.0016 -0.0117 -0.3188 0.0612  -0.0064 0.0194  
-0.2706 0.1747  0.0007  0.4285  0.2380  -0.2901 0.0387  -0.5540 1.2984  'X-RAY DIFFRACTION' 
6 ? refined 16.8123 8.2746  83.6418 0.9577 0.6336 1.3607 0.1033  0.5433  0.0178  -0.7920 -0.1952 0.7486  0.0226  -0.1021 0.1252  
0.3345  0.2513  -0.0067 0.5408  0.2353  -0.1521 -0.7615 0.3135  1.5416  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.pdbx_refine_id 
1 1 ? ? ? ? ? ? ? ? ? 'chain A and (resid 7:100)'   'X-RAY DIFFRACTION' 
2 2 ? ? ? ? ? ? ? ? ? 'chain A and (resid 101:268)' 'X-RAY DIFFRACTION' 
3 3 ? ? ? ? ? ? ? ? ? 'chain B and (resid 101:268)' 'X-RAY DIFFRACTION' 
4 4 ? ? ? ? ? ? ? ? ? 'chain B and (resid 7:100)'   'X-RAY DIFFRACTION' 
5 5 ? ? ? ? ? ? ? ? ? 'chain X and (resid 1:1)'     'X-RAY DIFFRACTION' 
6 6 ? ? ? ? ? ? ? ? ? 'chain Z and (resid 1:1)'     'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX      ?     ?               package 'Paul D. Adams' PDAdams@lbl.gov       refinement        http://www.phenix-online.org/ 
C++ ? 1 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB             help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 2 
DNA         .     ?               ?       ?               ?                     'data collection' ? ?   ? 3 
XDS         .     ?               ?       ?               ?                     'data reduction'  ? ?   ? 4 
XSCALE      .     ?               ?       ?               ?                     'data scaling'    ? ?   ? 5 
MOLREP      .     ?               ?       ?               ?                     phasing           ? ?   ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 14  ? ? 53.40   9.42    
2  1 VAL A 15  ? ? 68.63   -20.73  
3  1 ARG A 17  ? ? -62.08  11.58   
4  1 ARG A 26  ? ? -113.68 -124.51 
5  1 SER A 27  ? ? -104.64 -61.26  
6  1 LYS A 30  ? ? -57.32  -95.91  
7  1 ASP A 36  ? ? 70.74   148.36  
8  1 ALA A 46  ? ? -125.45 -50.81  
9  1 GLU A 52  ? ? -171.62 143.82  
10 1 SER A 59  ? ? -175.78 107.49  
11 1 PRO A 60  ? ? -37.75  139.23  
12 1 GLU A 64  ? ? 126.14  -46.34  
13 1 LYS A 89  ? ? -171.96 119.00  
14 1 GLU A 91  ? ? 24.83   78.02   
15 1 ARG A 92  ? ? 77.49   -51.96  
16 1 LYS A 95  ? ? 62.59   -71.36  
17 1 ASP A 157 ? ? -25.68  119.24  
18 1 ARG A 165 ? ? 65.08   -4.75   
19 1 PRO A 172 ? ? -58.07  107.08  
20 1 SER A 242 ? ? -172.37 131.38  
21 1 GLN A 243 ? ? -68.49  5.51    
22 1 GLU A 245 ? ? -109.61 -158.16 
23 1 SER B 11  ? ? -85.34  -159.69 
24 1 PRO B 13  ? ? -98.97  -79.43  
25 1 ALA B 14  ? ? 145.42  -45.60  
26 1 VAL B 15  ? ? 155.22  -12.69  
27 1 SER B 25  ? ? -72.58  43.85   
28 1 ARG B 26  ? ? -66.54  -148.34 
29 1 ASN B 28  ? ? -33.86  120.38  
30 1 ASP B 36  ? ? 74.30   151.00  
31 1 GLU B 64  ? ? 142.09  -32.83  
32 1 PHE B 88  ? ? 60.27   -144.93 
33 1 LYS B 89  ? ? 70.78   140.09  
34 1 GLU B 91  ? ? -79.07  27.03   
35 1 ARG B 92  ? ? 67.79   -81.00  
36 1 LYS B 95  ? ? 68.22   -26.76  
37 1 GLU B 245 ? ? -73.16  -149.16 
38 1 SER B 246 ? ? 176.99  163.23  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2  ? A GLY 1   
2  1 Y 1 A SER -1  ? A SER 2   
3  1 Y 1 A HIS 0   ? A HIS 3   
4  1 Y 1 A MET 1   ? A MET 4   
5  1 Y 1 A THR 2   ? A THR 5   
6  1 Y 1 A GLU 3   ? A GLU 6   
7  1 Y 1 A LEU 4   ? A LEU 7   
8  1 Y 1 A ASP 5   ? A ASP 8   
9  1 Y 1 A THR 6   ? A THR 9   
10 1 Y 1 A ILE 7   ? A ILE 10  
11 1 Y 1 A ARG 269 ? A ARG 272 
12 1 Y 1 B GLY -2  ? B GLY 1   
13 1 Y 1 B SER -1  ? B SER 2   
14 1 Y 1 B HIS 0   ? B HIS 3   
15 1 Y 1 B MET 1   ? B MET 4   
16 1 Y 1 B THR 2   ? B THR 5   
17 1 Y 1 B GLU 3   ? B GLU 6   
18 1 Y 1 B LEU 4   ? B LEU 7   
19 1 Y 1 B ASP 5   ? B ASP 8   
20 1 Y 1 B THR 6   ? B THR 9   
21 1 Y 1 B ILE 7   ? B ILE 10  
22 1 Y 1 B ARG 269 ? B ARG 272 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 S-ADENOSYLMETHIONINE SAM 
3 water                HOH 
#