data_3H2V
# 
_entry.id   3H2V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H2V         
RCSB  RCSB052622   
WWPDB D_1000052622 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RKE . unspecified 
PDB 1tr2 . unspecified 
PDB 3H2U . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H2V 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, J.H.'        1 
'Rangarajan, E.S.' 2 
'Yogesha, S.D.'    3 
'Izard, T.'        4 
# 
_citation.id                        primary 
_citation.title                     
'Raver1 interactions with vinculin and RNA suggest a feed-forward pathway in directing mRNA to focal adhesions' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            17 
_citation.page_first                833 
_citation.page_last                 842 
_citation.year                      2009 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19523901 
_citation.pdbx_database_id_DOI      10.1016/j.str.2009.04.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, J.H.'        1 
primary 'Rangarajan, E.S.' 2 
primary 'Yogesha, S.D.'    3 
primary 'Izard, T.'        4 
# 
_cell.entry_id           3H2V 
_cell.length_a           41.818 
_cell.length_b           70.921 
_cell.length_c           99.342 
_cell.angle_alpha        89.77 
_cell.angle_beta         90.04 
_cell.angle_gamma        104.04 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H2V 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Vinculin 21222.484 4 ? ? 'C-TERMINAL DOMAIN' ? 
2 polymer man Raver-1  8528.689  4 ? ? 'RRM 1 domain'      ? 
3 water   nat water    18.015    4 ? ? ?                   ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Ribonucleoprotein PTB-binding 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKAS
DEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETV
REAEAASIKIRTDAGFTLRWVRKTPWYQ
;
;EEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKAS
DEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETV
REAEAASIKIRTDAGFTLRWVRKTPWYQ
;
A,B,C,D ? 
2 'polypeptide(L)' no no HMRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQPT 
HMRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQPT E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLU n 
1 3   LYS n 
1 4   ASP n 
1 5   GLU n 
1 6   GLU n 
1 7   PHE n 
1 8   PRO n 
1 9   GLU n 
1 10  GLN n 
1 11  LYS n 
1 12  ALA n 
1 13  GLY n 
1 14  GLU n 
1 15  VAL n 
1 16  ILE n 
1 17  ASN n 
1 18  GLN n 
1 19  PRO n 
1 20  MET n 
1 21  MET n 
1 22  MET n 
1 23  ALA n 
1 24  ALA n 
1 25  ARG n 
1 26  GLN n 
1 27  LEU n 
1 28  HIS n 
1 29  ASP n 
1 30  GLU n 
1 31  ALA n 
1 32  ARG n 
1 33  LYS n 
1 34  TRP n 
1 35  SER n 
1 36  SER n 
1 37  LYS n 
1 38  GLY n 
1 39  ASN n 
1 40  ASP n 
1 41  ILE n 
1 42  ILE n 
1 43  ALA n 
1 44  ALA n 
1 45  ALA n 
1 46  LYS n 
1 47  ARG n 
1 48  MET n 
1 49  ALA n 
1 50  LEU n 
1 51  LEU n 
1 52  MET n 
1 53  ALA n 
1 54  GLU n 
1 55  MET n 
1 56  SER n 
1 57  ARG n 
1 58  LEU n 
1 59  VAL n 
1 60  ARG n 
1 61  GLY n 
1 62  GLY n 
1 63  SER n 
1 64  GLY n 
1 65  THR n 
1 66  LYS n 
1 67  ARG n 
1 68  ALA n 
1 69  LEU n 
1 70  ILE n 
1 71  GLN n 
1 72  CYS n 
1 73  ALA n 
1 74  LYS n 
1 75  ASP n 
1 76  ILE n 
1 77  ALA n 
1 78  LYS n 
1 79  ALA n 
1 80  SER n 
1 81  ASP n 
1 82  GLU n 
1 83  VAL n 
1 84  THR n 
1 85  ARG n 
1 86  LEU n 
1 87  ALA n 
1 88  LYS n 
1 89  GLU n 
1 90  VAL n 
1 91  ALA n 
1 92  LYS n 
1 93  GLN n 
1 94  CYS n 
1 95  THR n 
1 96  ASP n 
1 97  LYS n 
1 98  ARG n 
1 99  ILE n 
1 100 ARG n 
1 101 THR n 
1 102 ASN n 
1 103 LEU n 
1 104 LEU n 
1 105 GLN n 
1 106 VAL n 
1 107 CYS n 
1 108 GLU n 
1 109 ARG n 
1 110 ILE n 
1 111 PRO n 
1 112 THR n 
1 113 ILE n 
1 114 SER n 
1 115 THR n 
1 116 GLN n 
1 117 LEU n 
1 118 LYS n 
1 119 ILE n 
1 120 LEU n 
1 121 SER n 
1 122 THR n 
1 123 VAL n 
1 124 LYS n 
1 125 ALA n 
1 126 THR n 
1 127 MET n 
1 128 LEU n 
1 129 GLY n 
1 130 ARG n 
1 131 THR n 
1 132 ASN n 
1 133 ILE n 
1 134 SER n 
1 135 ASP n 
1 136 GLU n 
1 137 GLU n 
1 138 SER n 
1 139 GLU n 
1 140 GLN n 
1 141 ALA n 
1 142 THR n 
1 143 GLU n 
1 144 MET n 
1 145 LEU n 
1 146 VAL n 
1 147 HIS n 
1 148 ASN n 
1 149 ALA n 
1 150 GLN n 
1 151 ASN n 
1 152 LEU n 
1 153 MET n 
1 154 GLN n 
1 155 SER n 
1 156 VAL n 
1 157 LYS n 
1 158 GLU n 
1 159 THR n 
1 160 VAL n 
1 161 ARG n 
1 162 GLU n 
1 163 ALA n 
1 164 GLU n 
1 165 ALA n 
1 166 ALA n 
1 167 SER n 
1 168 ILE n 
1 169 LYS n 
1 170 ILE n 
1 171 ARG n 
1 172 THR n 
1 173 ASP n 
1 174 ALA n 
1 175 GLY n 
1 176 PHE n 
1 177 THR n 
1 178 LEU n 
1 179 ARG n 
1 180 TRP n 
1 181 VAL n 
1 182 ARG n 
1 183 LYS n 
1 184 THR n 
1 185 PRO n 
1 186 TRP n 
1 187 TYR n 
1 188 GLN n 
2 1   HIS n 
2 2   MET n 
2 3   ARG n 
2 4   LYS n 
2 5   ILE n 
2 6   LEU n 
2 7   ILE n 
2 8   ARG n 
2 9   GLY n 
2 10  LEU n 
2 11  PRO n 
2 12  GLY n 
2 13  ASP n 
2 14  VAL n 
2 15  THR n 
2 16  ASN n 
2 17  GLN n 
2 18  GLU n 
2 19  VAL n 
2 20  HIS n 
2 21  ASP n 
2 22  LEU n 
2 23  LEU n 
2 24  SER n 
2 25  ASP n 
2 26  TYR n 
2 27  GLU n 
2 28  LEU n 
2 29  LYS n 
2 30  TYR n 
2 31  CYS n 
2 32  PHE n 
2 33  VAL n 
2 34  ASP n 
2 35  LYS n 
2 36  TYR n 
2 37  LYS n 
2 38  GLY n 
2 39  THR n 
2 40  ALA n 
2 41  PHE n 
2 42  VAL n 
2 43  THR n 
2 44  LEU n 
2 45  LEU n 
2 46  ASN n 
2 47  GLY n 
2 48  GLU n 
2 49  GLN n 
2 50  ALA n 
2 51  GLU n 
2 52  ALA n 
2 53  ALA n 
2 54  ILE n 
2 55  ASN n 
2 56  ALA n 
2 57  PHE n 
2 58  HIS n 
2 59  GLN n 
2 60  SER n 
2 61  ARG n 
2 62  LEU n 
2 63  ARG n 
2 64  GLU n 
2 65  ARG n 
2 66  GLU n 
2 67  LEU n 
2 68  SER n 
2 69  VAL n 
2 70  GLN n 
2 71  LEU n 
2 72  GLN n 
2 73  PRO n 
2 74  THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? ?                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'RAVER1, KIAA1978' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP B4DTM7_HUMAN B4DTM7 1 
;EEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKAS
DEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETV
REAEAASIKIRTDAGFTLRWVRKTPWYQ
;
140 ? 
2 UNP RAVR1_HUMAN  Q8IY67 2 RKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQPT 59  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3H2V A 1 ? 188 ? B4DTM7 140 ? 327 ? 879 1066 
2 1 3H2V B 1 ? 188 ? B4DTM7 140 ? 327 ? 879 1066 
3 1 3H2V C 1 ? 188 ? B4DTM7 140 ? 327 ? 879 1066 
4 1 3H2V D 1 ? 188 ? B4DTM7 140 ? 327 ? 879 1066 
5 2 3H2V E 3 ? 74  ? Q8IY67 59  ? 130 ? 59  130  
6 2 3H2V F 3 ? 74  ? Q8IY67 59  ? 130 ? 59  130  
7 2 3H2V G 3 ? 74  ? Q8IY67 59  ? 130 ? 59  130  
8 2 3H2V H 3 ? 74  ? Q8IY67 59  ? 130 ? 59  130  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
5 3H2V HIS E 1 ? UNP Q8IY67 ? ? 'CLONING ARTIFACT' 57 1 
5 3H2V MET E 2 ? UNP Q8IY67 ? ? 'CLONING ARTIFACT' 58 2 
6 3H2V HIS F 1 ? UNP Q8IY67 ? ? 'CLONING ARTIFACT' 57 3 
6 3H2V MET F 2 ? UNP Q8IY67 ? ? 'CLONING ARTIFACT' 58 4 
7 3H2V HIS G 1 ? UNP Q8IY67 ? ? 'CLONING ARTIFACT' 57 5 
7 3H2V MET G 2 ? UNP Q8IY67 ? ? 'CLONING ARTIFACT' 58 6 
8 3H2V HIS H 1 ? UNP Q8IY67 ? ? 'CLONING ARTIFACT' 57 7 
8 3H2V MET H 2 ? UNP Q8IY67 ? ? 'CLONING ARTIFACT' 58 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3H2V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   48.79 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Tris (pH 7.5), 200 mM sodium nitrate, and 16% PEG-3,350, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-02-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3H2V 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   23190 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        71.477 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3H2V 
_refine.ls_number_reflns_obs                     23051 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    93.96 
_refine.ls_R_factor_obs                          0.2131 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2096 
_refine.ls_R_factor_R_free                       0.2769 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.13 
_refine.ls_number_reflns_R_free                  1182 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               55.74 
_refine.aniso_B[1][1]                            5.33060903 
_refine.aniso_B[2][2]                            6.17485622 
_refine.aniso_B[3][3]                            -11.50546525 
_refine.aniso_B[1][2]                            -1.62685549 
_refine.aniso_B[1][3]                            2.47506340 
_refine.aniso_B[2][3]                            -2.35675701 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1RKE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3H2V 
_refine_analyze.Luzzati_coordinate_error_obs    0.4034 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7689 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             4 
_refine_hist.number_atoms_total               7693 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.011  ? 2.00  7762  'X-RAY DIFFRACTION' ? 
t_angle_deg        1.203  ? 2.00  10395 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 27.796 ? 0.00  1738  'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?      ? ?     ?     'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?      ? ?     ?     'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.010  ? 2.00  219   'X-RAY DIFFRACTION' ? 
t_gen_planes       0.013  ? 5.00  1097  'X-RAY DIFFRACTION' ? 
t_it               2.806  ? 20.00 7762  'X-RAY DIFFRACTION' ? 
t_nbd              0.045  ? 5.00  222   'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.07 
_refine_ls_shell.number_reflns_R_work             3141 
_refine_ls_shell.R_factor_R_work                  0.2595 
_refine_ls_shell.percent_reflns_obs               93.96 
_refine_ls_shell.R_factor_R_free                  0.3483 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.05 
_refine_ls_shell.number_reflns_R_free             167 
_refine_ls_shell.number_reflns_all                3308 
_refine_ls_shell.R_factor_all                     0.2639 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3H2V 
_struct.title                     'Human raver1 RRM1 domain in complex with human vinculin tail domain Vt' 
_struct.pdbx_descriptor           'Vinculin, Raver-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H2V 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;focal adhesion, actin cytoskeleton, RNP motif, RNA binding, Alternative splicing, Cytoplasm, Nucleus, Phosphoprotein, RNA-binding, CELL ADHESION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 17  ? ARG A 32  ? ASN A 895  ARG A 910  1 ? 16 
HELX_P HELX_P2  2  ASN A 39  ? VAL A 59  ? ASN A 917  VAL A 937  1 ? 21 
HELX_P HELX_P3  3  GLY A 64  ? CYS A 94  ? GLY A 942  CYS A 972  1 ? 31 
HELX_P HELX_P4  4  ASP A 96  ? LEU A 128 ? ASP A 974  LEU A 1006 1 ? 33 
HELX_P HELX_P5  5  SER A 134 ? ALA A 166 ? SER A 1012 ALA A 1044 1 ? 33 
HELX_P HELX_P6  6  ASN B 17  ? ARG B 32  ? ASN B 895  ARG B 910  1 ? 16 
HELX_P HELX_P7  7  ASN B 39  ? VAL B 59  ? ASN B 917  VAL B 937  1 ? 21 
HELX_P HELX_P8  8  GLY B 64  ? CYS B 94  ? GLY B 942  CYS B 972  1 ? 31 
HELX_P HELX_P9  9  ASP B 96  ? LEU B 128 ? ASP B 974  LEU B 1006 1 ? 33 
HELX_P HELX_P10 10 SER B 134 ? ALA B 166 ? SER B 1012 ALA B 1044 1 ? 33 
HELX_P HELX_P11 11 ASN C 17  ? LYS C 33  ? ASN C 895  LYS C 911  1 ? 17 
HELX_P HELX_P12 12 ASN C 39  ? VAL C 59  ? ASN C 917  VAL C 937  1 ? 21 
HELX_P HELX_P13 13 GLY C 64  ? CYS C 94  ? GLY C 942  CYS C 972  1 ? 31 
HELX_P HELX_P14 14 ASP C 96  ? CYS C 107 ? ASP C 974  CYS C 985  1 ? 12 
HELX_P HELX_P15 15 GLU C 108 ? LEU C 128 ? GLU C 986  LEU C 1006 1 ? 21 
HELX_P HELX_P16 16 SER C 134 ? ALA C 166 ? SER C 1012 ALA C 1044 1 ? 33 
HELX_P HELX_P17 17 ASN D 17  ? ARG D 32  ? ASN D 895  ARG D 910  1 ? 16 
HELX_P HELX_P18 18 ASN D 39  ? VAL D 59  ? ASN D 917  VAL D 937  1 ? 21 
HELX_P HELX_P19 19 GLY D 64  ? CYS D 94  ? GLY D 942  CYS D 972  1 ? 31 
HELX_P HELX_P20 20 ASP D 96  ? LEU D 128 ? ASP D 974  LEU D 1006 1 ? 33 
HELX_P HELX_P21 21 SER D 134 ? ALA D 166 ? SER D 1012 ALA D 1044 1 ? 33 
HELX_P HELX_P22 22 THR E 15  ? LEU E 23  ? THR E 71   LEU E 79   1 ? 9  
HELX_P HELX_P23 23 ASN E 46  ? HIS E 58  ? ASN E 102  HIS E 114  1 ? 13 
HELX_P HELX_P24 24 THR F 15  ? LEU F 23  ? THR F 71   LEU F 79   1 ? 9  
HELX_P HELX_P25 25 ASN F 46  ? HIS F 58  ? ASN F 102  HIS F 114  1 ? 13 
HELX_P HELX_P26 26 THR G 15  ? LEU G 23  ? THR G 71   LEU G 79   1 ? 9  
HELX_P HELX_P27 27 ASN G 46  ? HIS G 58  ? ASN G 102  HIS G 114  1 ? 13 
HELX_P HELX_P28 28 THR H 15  ? LEU H 23  ? THR H 71   LEU H 79   1 ? 9  
HELX_P HELX_P29 29 ASN H 46  ? HIS H 58  ? ASN H 102  HIS H 114  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 63  D . ? SER 941  D GLY 64  D ? GLY 942  D 1 -7.77 
2 ALA 174 D . ? ALA 1052 D GLY 175 D ? GLY 1053 D 1 2.25  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 4 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR E 30 ? ASP E 34 ? TYR E 86  ASP E 90  
A 2 THR E 39 ? THR E 43 ? THR E 95  THR E 99  
A 3 LYS E 4  ? ARG E 8  ? LYS E 60  ARG E 64  
A 4 SER E 68 ? LEU E 71 ? SER E 124 LEU E 127 
B 1 ARG E 61 ? LEU E 62 ? ARG E 117 LEU E 118 
B 2 ARG E 65 ? GLU E 66 ? ARG E 121 GLU E 122 
C 1 LEU F 28 ? ASP F 34 ? LEU F 84  ASP F 90  
C 2 THR F 39 ? LEU F 44 ? THR F 95  LEU F 100 
C 3 LYS F 4  ? ARG F 8  ? LYS F 60  ARG F 64  
C 4 SER F 68 ? LEU F 71 ? SER F 124 LEU F 127 
D 1 ARG F 61 ? LEU F 62 ? ARG F 117 LEU F 118 
D 2 ARG F 65 ? GLU F 66 ? ARG F 121 GLU F 122 
E 1 LEU G 28 ? ASP G 34 ? LEU G 84  ASP G 90  
E 2 THR G 39 ? LEU G 44 ? THR G 95  LEU G 100 
E 3 LYS G 4  ? ARG G 8  ? LYS G 60  ARG G 64  
E 4 SER G 68 ? LEU G 71 ? SER G 124 LEU G 127 
F 1 ARG G 61 ? LEU G 62 ? ARG G 117 LEU G 118 
F 2 ARG G 65 ? GLU G 66 ? ARG G 121 GLU G 122 
G 1 LEU H 28 ? ASP H 34 ? LEU H 84  ASP H 90  
G 2 THR H 39 ? LEU H 44 ? THR H 95  LEU H 100 
G 3 LYS H 4  ? ARG H 8  ? LYS H 60  ARG H 64  
G 4 SER H 68 ? LEU H 71 ? SER H 124 LEU H 127 
H 1 ARG H 61 ? LEU H 62 ? ARG H 117 LEU H 118 
H 2 ARG H 65 ? GLU H 66 ? ARG H 121 GLU H 122 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP E 34 ? N ASP E 90  O THR E 39 ? O THR E 95  
A 2 3 O ALA E 40 ? O ALA E 96  N ILE E 7  ? N ILE E 63  
A 3 4 N LEU E 6  ? N LEU E 62  O GLN E 70 ? O GLN E 126 
B 1 2 N LEU E 62 ? N LEU E 118 O ARG E 65 ? O ARG E 121 
C 1 2 N ASP F 34 ? N ASP F 90  O THR F 39 ? O THR F 95  
C 2 3 O ALA F 40 ? O ALA F 96  N ILE F 7  ? N ILE F 63  
C 3 4 N LEU F 6  ? N LEU F 62  O GLN F 70 ? O GLN F 126 
D 1 2 N LEU F 62 ? N LEU F 118 O ARG F 65 ? O ARG F 121 
E 1 2 N LYS G 29 ? N LYS G 85  O THR G 43 ? O THR G 99  
E 2 3 O ALA G 40 ? O ALA G 96  N ILE G 7  ? N ILE G 63  
E 3 4 N LEU G 6  ? N LEU G 62  O GLN G 70 ? O GLN G 126 
F 1 2 N LEU G 62 ? N LEU G 118 O ARG G 65 ? O ARG G 121 
G 1 2 N ASP H 34 ? N ASP H 90  O THR H 39 ? O THR H 95  
G 2 3 O ALA H 40 ? O ALA H 96  N ILE H 7  ? N ILE H 63  
G 3 4 N LEU H 6  ? N LEU H 62  O GLN H 70 ? O GLN H 126 
H 1 2 N LEU H 62 ? N LEU H 118 O ARG H 65 ? O ARG H 121 
# 
_database_PDB_matrix.entry_id          3H2V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H2V 
_atom_sites.fract_transf_matrix[1][1]   0.023913 
_atom_sites.fract_transf_matrix[1][2]   0.005980 
_atom_sites.fract_transf_matrix[1][3]   -0.000007 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014534 
_atom_sites.fract_transf_matrix[2][3]   -0.000058 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010066 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 6   ? -14.596 4.563   4.947   1.00 77.43  ? 884  GLU A N   1 
ATOM   2    C CA  . GLU A 1 6   ? -15.358 4.722   3.712   1.00 77.82  ? 884  GLU A CA  1 
ATOM   3    C C   . GLU A 1 6   ? -15.162 3.553   2.730   1.00 77.95  ? 884  GLU A C   1 
ATOM   4    O O   . GLU A 1 6   ? -15.389 3.664   1.509   1.00 78.01  ? 884  GLU A O   1 
ATOM   5    C CB  . GLU A 1 6   ? -15.130 6.092   3.069   1.00 78.64  ? 884  GLU A CB  1 
ATOM   6    C CG  . GLU A 1 6   ? -13.731 6.628   3.205   1.00 79.12  ? 884  GLU A CG  1 
ATOM   7    C CD  . GLU A 1 6   ? -13.115 6.915   1.856   1.00 79.40  ? 884  GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 6   ? -13.000 5.963   1.045   1.00 78.13  ? 884  GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 6   ? -12.803 8.103   1.594   1.00 78.50  ? 884  GLU A OE2 1 
ATOM   10   N N   . PHE A 1 7   ? -14.524 2.523   3.188   1.00 76.52  ? 885  PHE A N   1 
ATOM   11   C CA  . PHE A 1 7   ? -14.470 1.314   2.533   1.00 76.09  ? 885  PHE A CA  1 
ATOM   12   C C   . PHE A 1 7   ? -15.631 0.738   3.175   1.00 76.59  ? 885  PHE A C   1 
ATOM   13   O O   . PHE A 1 7   ? -16.078 1.130   4.115   1.00 76.42  ? 885  PHE A O   1 
ATOM   14   C CB  . PHE A 1 7   ? -13.394 0.511   3.038   1.00 76.68  ? 885  PHE A CB  1 
ATOM   15   C CG  . PHE A 1 7   ? -12.227 0.431   2.211   1.00 75.51  ? 885  PHE A CG  1 
ATOM   16   C CD1 . PHE A 1 7   ? -11.801 1.417   1.563   1.00 75.23  ? 885  PHE A CD1 1 
ATOM   17   C CD2 . PHE A 1 7   ? -11.469 -0.703  2.195   1.00 73.84  ? 885  PHE A CD2 1 
ATOM   18   C CE1 . PHE A 1 7   ? -10.706 1.246   0.911   1.00 73.28  ? 885  PHE A CE1 1 
ATOM   19   C CE2 . PHE A 1 7   ? -10.401 -0.799  1.590   1.00 71.76  ? 885  PHE A CE2 1 
ATOM   20   C CZ  . PHE A 1 7   ? -10.040 0.127   0.956   1.00 72.97  ? 885  PHE A CZ  1 
ATOM   21   N N   . PRO A 1 8   ? -16.182 -0.228  2.571   1.00 74.58  ? 886  PRO A N   1 
ATOM   22   C CA  . PRO A 1 8   ? -17.392 -0.705  3.073   1.00 74.91  ? 886  PRO A CA  1 
ATOM   23   C C   . PRO A 1 8   ? -17.405 -1.956  3.893   1.00 75.02  ? 886  PRO A C   1 
ATOM   24   O O   . PRO A 1 8   ? -16.414 -2.551  3.853   1.00 74.89  ? 886  PRO A O   1 
ATOM   25   C CB  . PRO A 1 8   ? -18.056 -0.961  1.812   1.00 76.33  ? 886  PRO A CB  1 
ATOM   26   C CG  . PRO A 1 8   ? -17.185 -0.926  0.940   1.00 76.38  ? 886  PRO A CG  1 
ATOM   27   C CD  . PRO A 1 8   ? -16.388 0.024   1.169   1.00 76.27  ? 886  PRO A CD  1 
ATOM   28   N N   . GLU A 1 9   ? -18.454 -2.303  4.626   1.00 72.50  ? 887  GLU A N   1 
ATOM   29   C CA  . GLU A 1 9   ? -18.535 -3.508  5.385   1.00 72.90  ? 887  GLU A CA  1 
ATOM   30   C C   . GLU A 1 9   ? -18.144 -4.724  4.645   1.00 72.56  ? 887  GLU A C   1 
ATOM   31   O O   . GLU A 1 9   ? -17.392 -4.615  3.813   1.00 72.57  ? 887  GLU A O   1 
ATOM   32   N N   . GLN A 1 10  ? -18.673 -5.899  4.914   1.00 72.47  ? 888  GLN A N   1 
ATOM   33   C CA  . GLN A 1 10  ? -18.334 -7.139  4.150   1.00 71.98  ? 888  GLN A CA  1 
ATOM   34   C C   . GLN A 1 10  ? -19.475 -8.046  3.606   1.00 71.83  ? 888  GLN A C   1 
ATOM   35   O O   . GLN A 1 10  ? -19.299 -8.897  2.755   1.00 71.96  ? 888  GLN A O   1 
ATOM   36   C CB  . GLN A 1 10  ? -17.386 -8.002  4.930   1.00 74.69  ? 888  GLN A CB  1 
ATOM   37   C CG  . GLN A 1 10  ? -18.138 -8.896  5.779   1.00 74.25  ? 888  GLN A CG  1 
ATOM   38   C CD  . GLN A 1 10  ? -17.360 -9.976  6.289   1.00 73.76  ? 888  GLN A CD  1 
ATOM   39   O OE1 . GLN A 1 10  ? -17.792 -10.743 7.030   1.00 73.77  ? 888  GLN A OE1 1 
ATOM   40   N NE2 . GLN A 1 10  ? -16.210 -10.064 5.847   1.00 72.03  ? 888  GLN A NE2 1 
ATOM   41   N N   . VAL A 1 15  ? -16.408 -11.926 -3.765  1.00 73.70  ? 893  VAL A N   1 
ATOM   42   C CA  . VAL A 1 15  ? -15.479 -12.606 -4.683  1.00 72.17  ? 893  VAL A CA  1 
ATOM   43   C C   . VAL A 1 15  ? -14.067 -12.041 -4.662  1.00 70.60  ? 893  VAL A C   1 
ATOM   44   O O   . VAL A 1 15  ? -13.494 -11.723 -5.710  1.00 70.32  ? 893  VAL A O   1 
ATOM   45   C CB  . VAL A 1 15  ? -15.973 -12.626 -6.136  1.00 75.08  ? 893  VAL A CB  1 
ATOM   46   C CG1 . VAL A 1 15  ? -15.425 -13.862 -6.858  1.00 75.12  ? 893  VAL A CG1 1 
ATOM   47   C CG2 . VAL A 1 15  ? -17.500 -12.505 -6.207  1.00 75.27  ? 893  VAL A CG2 1 
ATOM   48   N N   . ILE A 1 16  ? -13.510 -11.945 -3.467  1.00 69.22  ? 894  ILE A N   1 
ATOM   49   C CA  . ILE A 1 16  ? -12.188 -11.402 -3.261  1.00 67.71  ? 894  ILE A CA  1 
ATOM   50   C C   . ILE A 1 16  ? -11.364 -12.394 -2.456  1.00 66.99  ? 894  ILE A C   1 
ATOM   51   O O   . ILE A 1 16  ? -11.463 -13.597 -2.626  1.00 66.83  ? 894  ILE A O   1 
ATOM   52   C CB  . ILE A 1 16  ? -12.276 -10.097 -2.465  1.00 68.56  ? 894  ILE A CB  1 
ATOM   53   C CG1 . ILE A 1 16  ? -12.881 -10.369 -1.091  1.00 68.36  ? 894  ILE A CG1 1 
ATOM   54   C CG2 . ILE A 1 16  ? -12.989 -9.012  -3.238  1.00 68.54  ? 894  ILE A CG2 1 
ATOM   55   C CD1 . ILE A 1 16  ? -13.770 -9.275  -0.603  1.00 68.33  ? 894  ILE A CD1 1 
ATOM   56   N N   . ASN A 1 17  ? -10.568 -11.863 -1.544  1.00 67.66  ? 895  ASN A N   1 
ATOM   57   C CA  . ASN A 1 17  ? -9.753  -12.669 -0.657  1.00 66.37  ? 895  ASN A CA  1 
ATOM   58   C C   . ASN A 1 17  ? -9.866  -12.021 0.717   1.00 65.69  ? 895  ASN A C   1 
ATOM   59   O O   . ASN A 1 17  ? -9.128  -11.097 1.016   1.00 65.34  ? 895  ASN A O   1 
ATOM   60   C CB  . ASN A 1 17  ? -8.308  -12.635 -1.131  1.00 62.35  ? 895  ASN A CB  1 
ATOM   61   C CG  . ASN A 1 17  ? -7.390  -13.379 -0.210  1.00 60.65  ? 895  ASN A CG  1 
ATOM   62   O OD1 . ASN A 1 17  ? -6.865  -14.418 -0.564  1.00 58.92  ? 895  ASN A OD1 1 
ATOM   63   N ND2 . ASN A 1 17  ? -7.245  -12.886 1.001   1.00 58.62  ? 895  ASN A ND2 1 
ATOM   64   N N   . GLN A 1 18  ? -10.840 -12.468 1.503   1.00 63.42  ? 896  GLN A N   1 
ATOM   65   C CA  . GLN A 1 18  ? -11.136 -11.901 2.808   1.00 63.49  ? 896  GLN A CA  1 
ATOM   66   C C   . GLN A 1 18  ? -9.955  -11.307 3.569   1.00 63.01  ? 896  GLN A C   1 
ATOM   67   O O   . GLN A 1 18  ? -10.000 -10.146 3.972   1.00 62.82  ? 896  GLN A O   1 
ATOM   68   C CB  . GLN A 1 18  ? -11.906 -12.887 3.695   1.00 68.16  ? 896  GLN A CB  1 
ATOM   69   C CG  . GLN A 1 18  ? -11.744 -12.586 5.210   1.00 69.92  ? 896  GLN A CG  1 
ATOM   70   C CD  . GLN A 1 18  ? -12.460 -13.584 6.156   1.00 73.06  ? 896  GLN A CD  1 
ATOM   71   O OE1 . GLN A 1 18  ? -13.057 -13.178 7.175   1.00 73.71  ? 896  GLN A OE1 1 
ATOM   72   N NE2 . GLN A 1 18  ? -12.333 -14.887 5.863   1.00 70.66  ? 896  GLN A NE2 1 
ATOM   73   N N   . PRO A 1 19  ? -8.881  -12.094 3.773   1.00 56.19  ? 897  PRO A N   1 
ATOM   74   C CA  . PRO A 1 19  ? -7.713  -11.613 4.531   1.00 55.70  ? 897  PRO A CA  1 
ATOM   75   C C   . PRO A 1 19  ? -6.871  -10.497 3.875   1.00 55.50  ? 897  PRO A C   1 
ATOM   76   O O   . PRO A 1 19  ? -6.181  -9.754  4.572   1.00 55.52  ? 897  PRO A O   1 
ATOM   77   C CB  . PRO A 1 19  ? -6.888  -12.884 4.781   1.00 56.24  ? 897  PRO A CB  1 
ATOM   78   C CG  . PRO A 1 19  ? -7.790  -13.998 4.500   1.00 56.39  ? 897  PRO A CG  1 
ATOM   79   C CD  . PRO A 1 19  ? -8.804  -13.539 3.518   1.00 57.45  ? 897  PRO A CD  1 
ATOM   80   N N   . MET A 1 20  ? -6.941  -10.372 2.554   1.00 53.14  ? 898  MET A N   1 
ATOM   81   C CA  . MET A 1 20  ? -6.247  -9.287  1.865   1.00 52.63  ? 898  MET A CA  1 
ATOM   82   C C   . MET A 1 20  ? -7.106  -8.018  2.019   1.00 52.18  ? 898  MET A C   1 
ATOM   83   O O   . MET A 1 20  ? -6.628  -6.905  2.297   1.00 52.17  ? 898  MET A O   1 
ATOM   84   C CB  . MET A 1 20  ? -6.075  -9.595  0.366   1.00 55.73  ? 898  MET A CB  1 
ATOM   85   C CG  . MET A 1 20  ? -5.281  -10.873 0.038   1.00 56.39  ? 898  MET A CG  1 
ATOM   86   S SD  . MET A 1 20  ? -4.123  -10.619 -1.314  1.00 57.05  ? 898  MET A SD  1 
ATOM   87   C CE  . MET A 1 20  ? -4.124  -8.875  -1.272  1.00 57.71  ? 898  MET A CE  1 
ATOM   88   N N   . MET A 1 21  ? -8.400  -8.204  1.875   1.00 49.74  ? 899  MET A N   1 
ATOM   89   C CA  . MET A 1 21  ? -9.283  -7.097  2.041   1.00 49.51  ? 899  MET A CA  1 
ATOM   90   C C   . MET A 1 21  ? -9.268  -6.617  3.459   1.00 49.33  ? 899  MET A C   1 
ATOM   91   O O   . MET A 1 21  ? -9.393  -5.446  3.713   1.00 49.38  ? 899  MET A O   1 
ATOM   92   C CB  . MET A 1 21  ? -10.661 -7.485  1.617   1.00 51.53  ? 899  MET A CB  1 
ATOM   93   C CG  . MET A 1 21  ? -10.852 -7.177  0.182   1.00 53.07  ? 899  MET A CG  1 
ATOM   94   S SD  . MET A 1 21  ? -11.005 -5.404  -0.053  1.00 55.42  ? 899  MET A SD  1 
ATOM   95   C CE  . MET A 1 21  ? -11.630 -5.452  -1.887  1.00 56.81  ? 899  MET A CE  1 
ATOM   96   N N   . MET A 1 22  ? -9.101  -7.531  4.393   1.00 50.87  ? 900  MET A N   1 
ATOM   97   C CA  . MET A 1 22  ? -9.042  -7.159  5.783   1.00 50.14  ? 900  MET A CA  1 
ATOM   98   C C   . MET A 1 22  ? -7.832  -6.300  6.006   1.00 49.27  ? 900  MET A C   1 
ATOM   99   O O   . MET A 1 22  ? -7.897  -5.296  6.678   1.00 48.86  ? 900  MET A O   1 
ATOM   100  C CB  . MET A 1 22  ? -8.900  -8.400  6.636   1.00 54.45  ? 900  MET A CB  1 
ATOM   101  C CG  . MET A 1 22  ? -9.502  -8.221  8.005   1.00 57.79  ? 900  MET A CG  1 
ATOM   102  S SD  . MET A 1 22  ? -11.188 -7.533  7.891   1.00 64.20  ? 900  MET A SD  1 
ATOM   103  C CE  . MET A 1 22  ? -12.135 -9.122  7.302   1.00 61.55  ? 900  MET A CE  1 
ATOM   104  N N   . ALA A 1 23  ? -6.700  -6.734  5.478   1.00 48.91  ? 901  ALA A N   1 
ATOM   105  C CA  . ALA A 1 23  ? -5.463  -5.991  5.620   1.00 48.38  ? 901  ALA A CA  1 
ATOM   106  C C   . ALA A 1 23  ? -5.595  -4.686  4.867   1.00 47.96  ? 901  ALA A C   1 
ATOM   107  O O   . ALA A 1 23  ? -5.166  -3.660  5.345   1.00 48.50  ? 901  ALA A O   1 
ATOM   108  C CB  . ALA A 1 23  ? -4.315  -6.784  5.082   1.00 48.60  ? 901  ALA A CB  1 
ATOM   109  N N   . ALA A 1 24  ? -6.191  -4.717  3.681   1.00 49.15  ? 902  ALA A N   1 
ATOM   110  C CA  . ALA A 1 24  ? -6.379  -3.489  2.923   1.00 48.54  ? 902  ALA A CA  1 
ATOM   111  C C   . ALA A 1 24  ? -7.148  -2.472  3.777   1.00 48.36  ? 902  ALA A C   1 
ATOM   112  O O   . ALA A 1 24  ? -6.794  -1.306  3.846   1.00 47.90  ? 902  ALA A O   1 
ATOM   113  C CB  . ALA A 1 24  ? -7.147  -3.782  1.647   1.00 48.77  ? 902  ALA A CB  1 
ATOM   114  N N   . ARG A 1 25  ? -8.236  -2.927  4.391   1.00 52.09  ? 903  ARG A N   1 
ATOM   115  C CA  . ARG A 1 25  ? -9.120  -2.082  5.182   1.00 51.98  ? 903  ARG A CA  1 
ATOM   116  C C   . ARG A 1 25  ? -8.464  -1.560  6.433   1.00 51.67  ? 903  ARG A C   1 
ATOM   117  O O   . ARG A 1 25  ? -8.648  -0.407  6.768   1.00 52.20  ? 903  ARG A O   1 
ATOM   118  C CB  . ARG A 1 25  ? -10.435 -2.800  5.501   1.00 54.42  ? 903  ARG A CB  1 
ATOM   119  C CG  . ARG A 1 25  ? -11.363 -2.066  6.468   1.00 57.80  ? 903  ARG A CG  1 
ATOM   120  C CD  . ARG A 1 25  ? -12.831 -2.476  6.260   1.00 61.55  ? 903  ARG A CD  1 
ATOM   121  N NE  . ARG A 1 25  ? -12.936 -3.926  6.184   1.00 64.77  ? 903  ARG A NE  1 
ATOM   122  C CZ  . ARG A 1 25  ? -13.410 -4.605  5.140   1.00 67.01  ? 903  ARG A CZ  1 
ATOM   123  N NH1 . ARG A 1 25  ? -13.913 -3.964  4.085   1.00 65.66  ? 903  ARG A NH1 1 
ATOM   124  N NH2 . ARG A 1 25  ? -13.403 -5.942  5.165   1.00 68.82  ? 903  ARG A NH2 1 
ATOM   125  N N   . GLN A 1 26  ? -7.673  -2.381  7.107   1.00 52.05  ? 904  GLN A N   1 
ATOM   126  C CA  . GLN A 1 26  ? -6.984  -1.938  8.312   1.00 51.26  ? 904  GLN A CA  1 
ATOM   127  C C   . GLN A 1 26  ? -6.029  -0.781  8.091   1.00 50.24  ? 904  GLN A C   1 
ATOM   128  O O   . GLN A 1 26  ? -5.809  0.018   9.006   1.00 50.48  ? 904  GLN A O   1 
ATOM   129  C CB  . GLN A 1 26  ? -6.205  -3.081  8.908   1.00 55.20  ? 904  GLN A CB  1 
ATOM   130  C CG  . GLN A 1 26  ? -7.048  -4.048  9.660   1.00 56.37  ? 904  GLN A CG  1 
ATOM   131  C CD  . GLN A 1 26  ? -6.195  -5.033  10.417  1.00 59.89  ? 904  GLN A CD  1 
ATOM   132  O OE1 . GLN A 1 26  ? -5.369  -4.633  11.246  1.00 60.35  ? 904  GLN A OE1 1 
ATOM   133  N NE2 . GLN A 1 26  ? -6.350  -6.331  10.105  1.00 62.15  ? 904  GLN A NE2 1 
ATOM   134  N N   . LEU A 1 27  ? -5.411  -0.742  6.911   1.00 46.83  ? 905  LEU A N   1 
ATOM   135  C CA  . LEU A 1 27  ? -4.513  0.338   6.550   1.00 46.13  ? 905  LEU A CA  1 
ATOM   136  C C   . LEU A 1 27  ? -5.401  1.510   6.237   1.00 46.61  ? 905  LEU A C   1 
ATOM   137  O O   . LEU A 1 27  ? -5.259  2.568   6.824   1.00 47.38  ? 905  LEU A O   1 
ATOM   138  C CB  . LEU A 1 27  ? -3.631  0.023   5.331   1.00 46.11  ? 905  LEU A CB  1 
ATOM   139  C CG  . LEU A 1 27  ? -2.692  1.158   4.845   1.00 44.40  ? 905  LEU A CG  1 
ATOM   140  C CD1 . LEU A 1 27  ? -1.474  1.290   5.734   1.00 41.48  ? 905  LEU A CD1 1 
ATOM   141  C CD2 . LEU A 1 27  ? -2.264  1.003   3.378   1.00 42.93  ? 905  LEU A CD2 1 
ATOM   142  N N   . HIS A 1 28  ? -6.361  1.313   5.356   1.00 47.23  ? 906  HIS A N   1 
ATOM   143  C CA  . HIS A 1 28  ? -7.259  2.382   5.023   1.00 48.07  ? 906  HIS A CA  1 
ATOM   144  C C   . HIS A 1 28  ? -7.786  3.204   6.195   1.00 48.86  ? 906  HIS A C   1 
ATOM   145  O O   . HIS A 1 28  ? -7.772  4.418   6.158   1.00 48.95  ? 906  HIS A O   1 
ATOM   146  C CB  . HIS A 1 28  ? -8.420  1.890   4.192   1.00 50.15  ? 906  HIS A CB  1 
ATOM   147  C CG  . HIS A 1 28  ? -9.074  2.995   3.444   1.00 50.29  ? 906  HIS A CG  1 
ATOM   148  N ND1 . HIS A 1 28  ? -10.259 3.555   3.859   1.00 50.99  ? 906  HIS A ND1 1 
ATOM   149  C CD2 . HIS A 1 28  ? -8.606  3.779   2.440   1.00 49.36  ? 906  HIS A CD2 1 
ATOM   150  C CE1 . HIS A 1 28  ? -10.528 4.598   3.092   1.00 51.90  ? 906  HIS A CE1 1 
ATOM   151  N NE2 . HIS A 1 28  ? -9.538  4.761   2.230   1.00 50.32  ? 906  HIS A NE2 1 
ATOM   152  N N   . ASP A 1 29  ? -8.239  2.529   7.238   1.00 50.62  ? 907  ASP A N   1 
ATOM   153  C CA  . ASP A 1 29  ? -8.760  3.185   8.418   1.00 51.61  ? 907  ASP A CA  1 
ATOM   154  C C   . ASP A 1 29  ? -7.733  4.002   9.168   1.00 51.31  ? 907  ASP A C   1 
ATOM   155  O O   . ASP A 1 29  ? -8.073  5.053   9.724   1.00 51.43  ? 907  ASP A O   1 
ATOM   156  C CB  . ASP A 1 29  ? -9.334  2.152   9.362   1.00 55.52  ? 907  ASP A CB  1 
ATOM   157  C CG  . ASP A 1 29  ? -10.514 1.418   8.763   1.00 58.81  ? 907  ASP A CG  1 
ATOM   158  O OD1 . ASP A 1 29  ? -11.064 1.855   7.710   1.00 61.71  ? 907  ASP A OD1 1 
ATOM   159  O OD2 . ASP A 1 29  ? -10.880 0.376   9.347   1.00 63.14  ? 907  ASP A OD2 1 
ATOM   160  N N   . GLU A 1 30  ? -6.492  3.521   9.235   1.00 50.11  ? 908  GLU A N   1 
ATOM   161  C CA  . GLU A 1 30  ? -5.484  4.296   9.932   1.00 50.56  ? 908  GLU A CA  1 
ATOM   162  C C   . GLU A 1 30  ? -5.164  5.624   9.219   1.00 50.77  ? 908  GLU A C   1 
ATOM   163  O O   . GLU A 1 30  ? -4.947  6.645   9.874   1.00 51.08  ? 908  GLU A O   1 
ATOM   164  C CB  . GLU A 1 30  ? -4.226  3.478   10.236  1.00 53.91  ? 908  GLU A CB  1 
ATOM   165  C CG  . GLU A 1 30  ? -3.236  4.201   11.211  1.00 56.53  ? 908  GLU A CG  1 
ATOM   166  C CD  . GLU A 1 30  ? -3.721  4.274   12.692  1.00 61.01  ? 908  GLU A CD  1 
ATOM   167  O OE1 . GLU A 1 30  ? -4.597  3.462   13.076  1.00 61.02  ? 908  GLU A OE1 1 
ATOM   168  O OE2 . GLU A 1 30  ? -3.212  5.126   13.476  1.00 61.63  ? 908  GLU A OE2 1 
ATOM   169  N N   . ALA A 1 31  ? -5.183  5.607   7.880   1.00 45.04  ? 909  ALA A N   1 
ATOM   170  C CA  . ALA A 1 31  ? -4.869  6.769   7.051   1.00 44.65  ? 909  ALA A CA  1 
ATOM   171  C C   . ALA A 1 31  ? -6.046  7.710   6.775   1.00 44.83  ? 909  ALA A C   1 
ATOM   172  O O   . ALA A 1 31  ? -5.854  8.857   6.370   1.00 44.79  ? 909  ALA A O   1 
ATOM   173  C CB  . ALA A 1 31  ? -4.237  6.324   5.757   1.00 44.47  ? 909  ALA A CB  1 
ATOM   174  N N   . ARG A 1 32  ? -7.261  7.205   6.926   1.00 45.73  ? 910  ARG A N   1 
ATOM   175  C CA  . ARG A 1 32  ? -8.446  8.011   6.676   1.00 46.57  ? 910  ARG A CA  1 
ATOM   176  C C   . ARG A 1 32  ? -8.657  8.831   7.945   1.00 46.54  ? 910  ARG A C   1 
ATOM   177  O O   . ARG A 1 32  ? -9.562  9.668   8.015   1.00 47.11  ? 910  ARG A O   1 
ATOM   178  C CB  . ARG A 1 32  ? -9.671  7.113   6.434   1.00 54.38  ? 910  ARG A CB  1 
ATOM   179  C CG  . ARG A 1 32  ? -10.190 6.492   7.732   1.00 56.72  ? 910  ARG A CG  1 
ATOM   180  C CD  . ARG A 1 32  ? -11.121 5.275   7.553   1.00 61.41  ? 910  ARG A CD  1 
ATOM   181  N NE  . ARG A 1 32  ? -12.502 5.664   7.815   1.00 65.36  ? 910  ARG A NE  1 
ATOM   182  C CZ  . ARG A 1 32  ? -13.146 6.546   7.060   1.00 66.44  ? 910  ARG A CZ  1 
ATOM   183  N NH1 . ARG A 1 32  ? -12.545 7.048   5.969   1.00 66.13  ? 910  ARG A NH1 1 
ATOM   184  N NH2 . ARG A 1 32  ? -14.383 6.912   7.374   1.00 66.40  ? 910  ARG A NH2 1 
ATOM   185  N N   . LYS A 1 33  ? -7.829  8.569   8.955   1.00 45.10  ? 911  LYS A N   1 
ATOM   186  C CA  . LYS A 1 33  ? -7.892  9.303   10.210  1.00 43.93  ? 911  LYS A CA  1 
ATOM   187  C C   . LYS A 1 33  ? -7.410  10.721  9.974   1.00 42.38  ? 911  LYS A C   1 
ATOM   188  O O   . LYS A 1 33  ? -7.721  11.615  10.748  1.00 42.45  ? 911  LYS A O   1 
ATOM   189  C CB  . LYS A 1 33  ? -6.967  8.653   11.234  1.00 45.52  ? 911  LYS A CB  1 
ATOM   190  C CG  . LYS A 1 33  ? -7.658  7.678   12.173  1.00 46.89  ? 911  LYS A CG  1 
ATOM   191  C CD  . LYS A 1 33  ? -6.767  7.327   13.347  1.00 50.53  ? 911  LYS A CD  1 
ATOM   192  C CE  . LYS A 1 33  ? -7.538  6.485   14.402  1.00 55.10  ? 911  LYS A CE  1 
ATOM   193  N NZ  . LYS A 1 33  ? -7.622  7.016   15.848  1.00 56.95  ? 911  LYS A NZ  1 
ATOM   194  N N   . TRP A 1 34  ? -6.657  10.906  8.888   1.00 44.69  ? 912  TRP A N   1 
ATOM   195  C CA  . TRP A 1 34  ? -6.021  12.175  8.527   1.00 42.66  ? 912  TRP A CA  1 
ATOM   196  C C   . TRP A 1 34  ? -6.360  12.707  7.146   1.00 41.75  ? 912  TRP A C   1 
ATOM   197  O O   . TRP A 1 34  ? -6.583  11.964  6.196   1.00 42.25  ? 912  TRP A O   1 
ATOM   198  C CB  . TRP A 1 34  ? -4.487  12.013  8.536   1.00 42.74  ? 912  TRP A CB  1 
ATOM   199  C CG  . TRP A 1 34  ? -3.943  11.325  9.689   1.00 41.62  ? 912  TRP A CG  1 
ATOM   200  C CD1 . TRP A 1 34  ? -3.720  9.994   9.816   1.00 41.86  ? 912  TRP A CD1 1 
ATOM   201  C CD2 . TRP A 1 34  ? -3.579  11.919  10.920  1.00 41.19  ? 912  TRP A CD2 1 
ATOM   202  N NE1 . TRP A 1 34  ? -3.216  9.717   11.058  1.00 41.18  ? 912  TRP A NE1 1 
ATOM   203  C CE2 . TRP A 1 34  ? -3.129  10.888  11.762  1.00 41.84  ? 912  TRP A CE2 1 
ATOM   204  C CE3 . TRP A 1 34  ? -3.610  13.226  11.408  1.00 40.87  ? 912  TRP A CE3 1 
ATOM   205  C CZ2 . TRP A 1 34  ? -2.724  11.119  13.062  1.00 41.94  ? 912  TRP A CZ2 1 
ATOM   206  C CZ3 . TRP A 1 34  ? -3.172  13.464  12.675  1.00 41.07  ? 912  TRP A CZ3 1 
ATOM   207  C CH2 . TRP A 1 34  ? -2.760  12.414  13.508  1.00 41.43  ? 912  TRP A CH2 1 
ATOM   208  N N   . SER A 1 35  ? -6.203  14.012  7.005   1.00 41.96  ? 913  SER A N   1 
ATOM   209  C CA  . SER A 1 35  ? -6.344  14.661  5.728   1.00 41.50  ? 913  SER A CA  1 
ATOM   210  C C   . SER A 1 35  ? -5.073  14.397  4.852   1.00 41.03  ? 913  SER A C   1 
ATOM   211  O O   . SER A 1 35  ? -3.943  14.374  5.337   1.00 39.75  ? 913  SER A O   1 
ATOM   212  C CB  . SER A 1 35  ? -6.598  16.144  5.948   1.00 44.28  ? 913  SER A CB  1 
ATOM   213  O OG  . SER A 1 35  ? -6.162  16.871  4.825   1.00 46.59  ? 913  SER A OG  1 
ATOM   214  N N   . SER A 1 36  ? -5.294  14.159  3.561   1.00 39.60  ? 914  SER A N   1 
ATOM   215  C CA  . SER A 1 36  ? -4.236  13.878  2.605   1.00 39.98  ? 914  SER A CA  1 
ATOM   216  C C   . SER A 1 36  ? -3.500  15.139  2.237   1.00 40.30  ? 914  SER A C   1 
ATOM   217  O O   . SER A 1 36  ? -2.317  15.080  1.893   1.00 40.33  ? 914  SER A O   1 
ATOM   218  C CB  . SER A 1 36  ? -4.842  13.285  1.334   1.00 42.16  ? 914  SER A CB  1 
ATOM   219  O OG  . SER A 1 36  ? -5.619  12.132  1.615   1.00 44.25  ? 914  SER A OG  1 
ATOM   220  N N   . LYS A 1 37  ? -4.229  16.265  2.254   1.00 38.53  ? 915  LYS A N   1 
ATOM   221  C CA  . LYS A 1 37  ? -3.689  17.597  1.924   1.00 38.96  ? 915  LYS A CA  1 
ATOM   222  C C   . LYS A 1 37  ? -2.349  17.879  2.654   1.00 39.44  ? 915  LYS A C   1 
ATOM   223  O O   . LYS A 1 37  ? -2.294  17.955  3.904   1.00 39.86  ? 915  LYS A O   1 
ATOM   224  C CB  . LYS A 1 37  ? -4.742  18.664  2.289   1.00 39.63  ? 915  LYS A CB  1 
ATOM   225  C CG  . LYS A 1 37  ? -4.591  20.066  1.617   1.00 42.18  ? 915  LYS A CG  1 
ATOM   226  C CD  . LYS A 1 37  ? -3.369  20.889  2.112   1.00 45.75  ? 915  LYS A CD  1 
ATOM   227  C CE  . LYS A 1 37  ? -3.688  22.406  2.254   1.00 48.47  ? 915  LYS A CE  1 
ATOM   228  N NZ  . LYS A 1 37  ? -2.508  23.268  2.737   1.00 50.03  ? 915  LYS A NZ  1 
ATOM   229  N N   . GLY A 1 38  ? -1.272  17.996  1.885   1.00 38.51  ? 916  GLY A N   1 
ATOM   230  C CA  . GLY A 1 38  ? 0.039   18.311  2.436   1.00 38.07  ? 916  GLY A CA  1 
ATOM   231  C C   . GLY A 1 38  ? 0.748   17.204  3.182   1.00 38.76  ? 916  GLY A C   1 
ATOM   232  O O   . GLY A 1 38  ? 1.740   17.432  3.881   1.00 39.06  ? 916  GLY A O   1 
ATOM   233  N N   . ASN A 1 39  ? 0.216   15.995  3.011   1.00 41.02  ? 917  ASN A N   1 
ATOM   234  C CA  . ASN A 1 39  ? 0.761   14.751  3.575   1.00 41.25  ? 917  ASN A CA  1 
ATOM   235  C C   . ASN A 1 39  ? 0.716   13.620  2.533   1.00 42.15  ? 917  ASN A C   1 
ATOM   236  O O   . ASN A 1 39  ? -0.272  12.920  2.411   1.00 42.31  ? 917  ASN A O   1 
ATOM   237  C CB  . ASN A 1 39  ? -0.012  14.322  4.804   1.00 37.43  ? 917  ASN A CB  1 
ATOM   238  C CG  . ASN A 1 39  ? 0.768   13.376  5.644   1.00 38.11  ? 917  ASN A CG  1 
ATOM   239  O OD1 . ASN A 1 39  ? 1.589   12.595  5.131   1.00 39.77  ? 917  ASN A OD1 1 
ATOM   240  N ND2 . ASN A 1 39  ? 0.535   13.421  6.951   1.00 38.46  ? 917  ASN A ND2 1 
ATOM   241  N N   . ASP A 1 40  ? 1.794   13.491  1.768   1.00 44.40  ? 918  ASP A N   1 
ATOM   242  C CA  . ASP A 1 40  ? 1.916   12.482  0.732   1.00 44.42  ? 918  ASP A CA  1 
ATOM   243  C C   . ASP A 1 40  ? 2.059   11.082  1.308   1.00 43.60  ? 918  ASP A C   1 
ATOM   244  O O   . ASP A 1 40  ? 1.797   10.087  0.619   1.00 44.12  ? 918  ASP A O   1 
ATOM   245  C CB  . ASP A 1 40  ? 3.095   12.820  -0.195  1.00 48.82  ? 918  ASP A CB  1 
ATOM   246  C CG  . ASP A 1 40  ? 2.744   13.921  -1.214  1.00 52.93  ? 918  ASP A CG  1 
ATOM   247  O OD1 . ASP A 1 40  ? 1.550   14.376  -1.240  1.00 54.53  ? 918  ASP A OD1 1 
ATOM   248  O OD2 . ASP A 1 40  ? 3.663   14.300  -2.001  1.00 56.75  ? 918  ASP A OD2 1 
ATOM   249  N N   . ILE A 1 41  ? 2.482   10.999  2.565   1.00 39.58  ? 919  ILE A N   1 
ATOM   250  C CA  . ILE A 1 41  ? 2.574   9.706   3.200   1.00 37.97  ? 919  ILE A CA  1 
ATOM   251  C C   . ILE A 1 41  ? 1.149   9.152   3.249   1.00 37.08  ? 919  ILE A C   1 
ATOM   252  O O   . ILE A 1 41  ? 0.929   7.988   2.872   1.00 36.74  ? 919  ILE A O   1 
ATOM   253  C CB  . ILE A 1 41  ? 3.228   9.802   4.579   1.00 40.17  ? 919  ILE A CB  1 
ATOM   254  C CG1 . ILE A 1 41  ? 4.738   9.782   4.406   1.00 40.99  ? 919  ILE A CG1 1 
ATOM   255  C CG2 . ILE A 1 41  ? 2.844   8.631   5.473   1.00 40.14  ? 919  ILE A CG2 1 
ATOM   256  C CD1 . ILE A 1 41  ? 5.460   9.225   5.585   1.00 42.66  ? 919  ILE A CD1 1 
ATOM   257  N N   . ILE A 1 42  ? 0.191   10.000  3.657   1.00 33.21  ? 920  ILE A N   1 
ATOM   258  C CA  . ILE A 1 42  ? -1.201  9.605   3.763   1.00 32.47  ? 920  ILE A CA  1 
ATOM   259  C C   . ILE A 1 42  ? -1.810  9.357   2.430   1.00 32.65  ? 920  ILE A C   1 
ATOM   260  O O   . ILE A 1 42  ? -2.631  8.444   2.290   1.00 33.65  ? 920  ILE A O   1 
ATOM   261  C CB  . ILE A 1 42  ? -2.034  10.586  4.518   1.00 34.82  ? 920  ILE A CB  1 
ATOM   262  C CG1 . ILE A 1 42  ? -1.403  10.852  5.875   1.00 34.68  ? 920  ILE A CG1 1 
ATOM   263  C CG2 . ILE A 1 42  ? -3.437  10.022  4.721   1.00 35.15  ? 920  ILE A CG2 1 
ATOM   264  C CD1 . ILE A 1 42  ? -1.529  9.702   6.852   1.00 31.43  ? 920  ILE A CD1 1 
ATOM   265  N N   . ALA A 1 43  ? -1.404  10.137  1.432   1.00 32.75  ? 921  ALA A N   1 
ATOM   266  C CA  . ALA A 1 43  ? -1.958  9.939   0.101   1.00 31.88  ? 921  ALA A CA  1 
ATOM   267  C C   . ALA A 1 43  ? -1.531  8.591   -0.474  1.00 31.50  ? 921  ALA A C   1 
ATOM   268  O O   . ALA A 1 43  ? -2.313  7.900   -1.123  1.00 32.33  ? 921  ALA A O   1 
ATOM   269  C CB  . ALA A 1 43  ? -1.539  11.016  -0.784  1.00 32.43  ? 921  ALA A CB  1 
ATOM   270  N N   . ALA A 1 44  ? -0.270  8.251   -0.258  1.00 31.38  ? 922  ALA A N   1 
ATOM   271  C CA  . ALA A 1 44  ? 0.308   7.024   -0.769  1.00 31.35  ? 922  ALA A CA  1 
ATOM   272  C C   . ALA A 1 44  ? -0.323  5.829   -0.030  1.00 31.73  ? 922  ALA A C   1 
ATOM   273  O O   . ALA A 1 44  ? -0.754  4.830   -0.657  1.00 31.74  ? 922  ALA A O   1 
ATOM   274  C CB  . ALA A 1 44  ? 1.843   7.057   -0.563  1.00 31.69  ? 922  ALA A CB  1 
ATOM   275  N N   . ALA A 1 45  ? -0.388  5.945   1.302   1.00 32.18  ? 923  ALA A N   1 
ATOM   276  C CA  . ALA A 1 45  ? -0.989  4.906   2.116   1.00 31.42  ? 923  ALA A CA  1 
ATOM   277  C C   . ALA A 1 45  ? -2.384  4.608   1.610   1.00 30.95  ? 923  ALA A C   1 
ATOM   278  O O   . ALA A 1 45  ? -2.703  3.456   1.385   1.00 30.86  ? 923  ALA A O   1 
ATOM   279  C CB  . ALA A 1 45  ? -0.981  5.265   3.614   1.00 31.23  ? 923  ALA A CB  1 
ATOM   280  N N   . LYS A 1 46  ? -3.192  5.643   1.391   1.00 31.56  ? 924  LYS A N   1 
ATOM   281  C CA  . LYS A 1 46  ? -4.550  5.467   0.888   1.00 31.32  ? 924  LYS A CA  1 
ATOM   282  C C   . LYS A 1 46  ? -4.527  4.739   -0.454  1.00 31.53  ? 924  LYS A C   1 
ATOM   283  O O   . LYS A 1 46  ? -5.309  3.821   -0.686  1.00 32.13  ? 924  LYS A O   1 
ATOM   284  C CB  . LYS A 1 46  ? -5.249  6.821   0.784   1.00 33.32  ? 924  LYS A CB  1 
ATOM   285  C CG  . LYS A 1 46  ? -5.763  7.333   2.118   1.00 33.05  ? 924  LYS A CG  1 
ATOM   286  C CD  . LYS A 1 46  ? -6.094  8.833   2.118   1.00 34.55  ? 924  LYS A CD  1 
ATOM   287  C CE  . LYS A 1 46  ? -6.779  9.316   3.458   1.00 37.42  ? 924  LYS A CE  1 
ATOM   288  N NZ  . LYS A 1 46  ? -6.990  10.808  3.614   1.00 36.63  ? 924  LYS A NZ  1 
ATOM   289  N N   . ARG A 1 47  ? -3.575  5.090   -1.307  1.00 32.63  ? 925  ARG A N   1 
ATOM   290  C CA  . ARG A 1 47  ? -3.444  4.433   -2.600  1.00 33.57  ? 925  ARG A CA  1 
ATOM   291  C C   . ARG A 1 47  ? -3.127  2.954   -2.451  1.00 33.70  ? 925  ARG A C   1 
ATOM   292  O O   . ARG A 1 47  ? -3.784  2.112   -3.054  1.00 34.40  ? 925  ARG A O   1 
ATOM   293  C CB  . ARG A 1 47  ? -2.343  5.075   -3.418  1.00 28.04  ? 925  ARG A CB  1 
ATOM   294  C CG  . ARG A 1 47  ? -2.791  6.191   -4.292  1.00 28.90  ? 925  ARG A CG  1 
ATOM   295  C CD  . ARG A 1 47  ? -1.636  6.601   -5.163  1.00 29.93  ? 925  ARG A CD  1 
ATOM   296  N NE  . ARG A 1 47  ? -1.046  7.797   -4.614  1.00 30.09  ? 925  ARG A NE  1 
ATOM   297  C CZ  . ARG A 1 47  ? 0.251   7.953   -4.380  1.00 31.63  ? 925  ARG A CZ  1 
ATOM   298  N NH1 . ARG A 1 47  ? 1.141   6.992   -4.705  1.00 31.34  ? 925  ARG A NH1 1 
ATOM   299  N NH2 . ARG A 1 47  ? 0.657   9.099   -3.844  1.00 33.23  ? 925  ARG A NH2 1 
ATOM   300  N N   . MET A 1 48  ? -2.069  2.633   -1.719  1.00 34.22  ? 926  MET A N   1 
ATOM   301  C CA  . MET A 1 48  ? -1.732  1.230   -1.483  1.00 34.56  ? 926  MET A CA  1 
ATOM   302  C C   . MET A 1 48  ? -2.981  0.474   -1.051  1.00 34.31  ? 926  MET A C   1 
ATOM   303  O O   . MET A 1 48  ? -3.342  -0.473  -1.703  1.00 34.44  ? 926  MET A O   1 
ATOM   304  C CB  . MET A 1 48  ? -0.651  1.098   -0.406  1.00 38.52  ? 926  MET A CB  1 
ATOM   305  C CG  . MET A 1 48  ? 0.725   1.406   -0.957  1.00 39.78  ? 926  MET A CG  1 
ATOM   306  S SD  . MET A 1 48  ? 2.024   1.391   0.290   1.00 41.31  ? 926  MET A SD  1 
ATOM   307  C CE  . MET A 1 48  ? 1.908   -0.350  0.756   1.00 40.23  ? 926  MET A CE  1 
ATOM   308  N N   . ALA A 1 49  ? -3.658  0.926   0.006   1.00 31.95  ? 927  ALA A N   1 
ATOM   309  C CA  . ALA A 1 49  ? -4.852  0.250   0.498   1.00 32.60  ? 927  ALA A CA  1 
ATOM   310  C C   . ALA A 1 49  ? -5.862  -0.033  -0.646  1.00 33.14  ? 927  ALA A C   1 
ATOM   311  O O   . ALA A 1 49  ? -6.388  -1.146  -0.773  1.00 32.77  ? 927  ALA A O   1 
ATOM   312  C CB  . ALA A 1 49  ? -5.500  1.011   1.695   1.00 32.33  ? 927  ALA A CB  1 
ATOM   313  N N   . LEU A 1 50  ? -6.046  0.943   -1.531  1.00 35.26  ? 928  LEU A N   1 
ATOM   314  C CA  . LEU A 1 50  ? -6.928  0.795   -2.701  1.00 35.77  ? 928  LEU A CA  1 
ATOM   315  C C   . LEU A 1 50  ? -6.411  -0.220  -3.734  1.00 36.83  ? 928  LEU A C   1 
ATOM   316  O O   . LEU A 1 50  ? -7.213  -0.870  -4.425  1.00 37.71  ? 928  LEU A O   1 
ATOM   317  C CB  . LEU A 1 50  ? -7.082  2.128   -3.400  1.00 35.32  ? 928  LEU A CB  1 
ATOM   318  C CG  . LEU A 1 50  ? -8.383  2.885   -3.205  1.00 34.24  ? 928  LEU A CG  1 
ATOM   319  C CD1 . LEU A 1 50  ? -9.476  2.162   -2.377  1.00 33.00  ? 928  LEU A CD1 1 
ATOM   320  C CD2 . LEU A 1 50  ? -8.062  4.297   -2.713  1.00 32.13  ? 928  LEU A CD2 1 
ATOM   321  N N   . LEU A 1 51  ? -5.088  -0.330  -3.861  1.00 35.36  ? 929  LEU A N   1 
ATOM   322  C CA  . LEU A 1 51  ? -4.498  -1.322  -4.740  1.00 35.86  ? 929  LEU A CA  1 
ATOM   323  C C   . LEU A 1 51  ? -4.444  -2.708  -4.064  1.00 36.12  ? 929  LEU A C   1 
ATOM   324  O O   . LEU A 1 51  ? -4.402  -3.727  -4.739  1.00 36.63  ? 929  LEU A O   1 
ATOM   325  C CB  . LEU A 1 51  ? -3.104  -0.912  -5.167  1.00 34.51  ? 929  LEU A CB  1 
ATOM   326  C CG  . LEU A 1 51  ? -2.929  0.369   -5.940  1.00 34.45  ? 929  LEU A CG  1 
ATOM   327  C CD1 . LEU A 1 51  ? -1.633  0.997   -5.507  1.00 36.37  ? 929  LEU A CD1 1 
ATOM   328  C CD2 . LEU A 1 51  ? -2.866  0.002   -7.389  1.00 34.53  ? 929  LEU A CD2 1 
ATOM   329  N N   . MET A 1 52  ? -4.435  -2.748  -2.737  1.00 38.82  ? 930  MET A N   1 
ATOM   330  C CA  . MET A 1 52  ? -4.472  -4.017  -2.012  1.00 39.33  ? 930  MET A CA  1 
ATOM   331  C C   . MET A 1 52  ? -5.832  -4.650  -2.180  1.00 39.62  ? 930  MET A C   1 
ATOM   332  O O   . MET A 1 52  ? -5.966  -5.863  -2.331  1.00 39.28  ? 930  MET A O   1 
ATOM   333  C CB  . MET A 1 52  ? -4.270  -3.812  -0.522  1.00 43.32  ? 930  MET A CB  1 
ATOM   334  C CG  . MET A 1 52  ? -3.925  -5.122  0.134   1.00 44.65  ? 930  MET A CG  1 
ATOM   335  S SD  . MET A 1 52  ? -2.433  -5.806  -0.720  1.00 50.32  ? 930  MET A SD  1 
ATOM   336  C CE  . MET A 1 52  ? -1.629  -4.154  -1.231  1.00 50.46  ? 930  MET A CE  1 
ATOM   337  N N   . ALA A 1 53  ? -6.842  -3.804  -2.084  1.00 38.62  ? 931  ALA A N   1 
ATOM   338  C CA  . ALA A 1 53  ? -8.194  -4.220  -2.310  1.00 39.69  ? 931  ALA A CA  1 
ATOM   339  C C   . ALA A 1 53  ? -8.262  -4.797  -3.752  1.00 40.28  ? 931  ALA A C   1 
ATOM   340  O O   . ALA A 1 53  ? -8.760  -5.898  -3.954  1.00 40.57  ? 931  ALA A O   1 
ATOM   341  C CB  . ALA A 1 53  ? -9.127  -3.012  -2.159  1.00 40.03  ? 931  ALA A CB  1 
ATOM   342  N N   . GLU A 1 54  ? -7.727  -4.086  -4.748  1.00 40.82  ? 932  GLU A N   1 
ATOM   343  C CA  . GLU A 1 54  ? -7.762  -4.614  -6.115  1.00 41.71  ? 932  GLU A CA  1 
ATOM   344  C C   . GLU A 1 54  ? -7.081  -5.985  -6.185  1.00 41.79  ? 932  GLU A C   1 
ATOM   345  O O   . GLU A 1 54  ? -7.457  -6.865  -6.952  1.00 41.68  ? 932  GLU A O   1 
ATOM   346  C CB  . GLU A 1 54  ? -7.068  -3.678  -7.081  1.00 43.37  ? 932  GLU A CB  1 
ATOM   347  C CG  . GLU A 1 54  ? -6.473  -4.407  -8.261  1.00 44.27  ? 932  GLU A CG  1 
ATOM   348  C CD  . GLU A 1 54  ? -6.057  -3.473  -9.393  1.00 45.64  ? 932  GLU A CD  1 
ATOM   349  O OE1 . GLU A 1 54  ? -6.134  -3.890  -10.572 1.00 47.18  ? 932  GLU A OE1 1 
ATOM   350  O OE2 . GLU A 1 54  ? -5.637  -2.328  -9.107  1.00 45.80  ? 932  GLU A OE2 1 
ATOM   351  N N   . MET A 1 55  ? -6.073  -6.168  -5.354  1.00 42.92  ? 933  MET A N   1 
ATOM   352  C CA  . MET A 1 55  ? -5.357  -7.421  -5.349  1.00 43.13  ? 933  MET A CA  1 
ATOM   353  C C   . MET A 1 55  ? -6.182  -8.597  -4.828  1.00 42.74  ? 933  MET A C   1 
ATOM   354  O O   . MET A 1 55  ? -6.155  -9.656  -5.420  1.00 42.97  ? 933  MET A O   1 
ATOM   355  C CB  . MET A 1 55  ? -4.046  -7.277  -4.596  1.00 46.22  ? 933  MET A CB  1 
ATOM   356  C CG  . MET A 1 55  ? -3.072  -8.388  -4.903  1.00 47.40  ? 933  MET A CG  1 
ATOM   357  S SD  . MET A 1 55  ? -1.327  -7.855  -4.746  1.00 51.61  ? 933  MET A SD  1 
ATOM   358  C CE  . MET A 1 55  ? -0.841  -7.687  -6.572  1.00 50.08  ? 933  MET A CE  1 
ATOM   359  N N   . SER A 1 56  ? -6.924  -8.426  -3.745  1.00 39.74  ? 934  SER A N   1 
ATOM   360  C CA  . SER A 1 56  ? -7.703  -9.547  -3.270  1.00 40.32  ? 934  SER A CA  1 
ATOM   361  C C   . SER A 1 56  ? -8.669  -9.986  -4.363  1.00 40.98  ? 934  SER A C   1 
ATOM   362  O O   . SER A 1 56  ? -8.896  -11.183 -4.564  1.00 40.92  ? 934  SER A O   1 
ATOM   363  C CB  . SER A 1 56  ? -8.428  -9.238  -1.957  1.00 42.84  ? 934  SER A CB  1 
ATOM   364  O OG  . SER A 1 56  ? -9.117  -8.008  -2.009  1.00 43.88  ? 934  SER A OG  1 
ATOM   365  N N   . ARG A 1 57  ? -9.186  -9.013  -5.112  1.00 44.05  ? 935  ARG A N   1 
ATOM   366  C CA  . ARG A 1 57  ? -10.040 -9.290  -6.260  1.00 44.57  ? 935  ARG A CA  1 
ATOM   367  C C   . ARG A 1 57  ? -9.236  -10.073 -7.331  1.00 45.27  ? 935  ARG A C   1 
ATOM   368  O O   . ARG A 1 57  ? -9.617  -11.181 -7.697  1.00 45.78  ? 935  ARG A O   1 
ATOM   369  C CB  . ARG A 1 57  ? -10.568 -7.974  -6.849  1.00 49.41  ? 935  ARG A CB  1 
ATOM   370  C CG  . ARG A 1 57  ? -11.648 -7.274  -6.013  1.00 50.40  ? 935  ARG A CG  1 
ATOM   371  C CD  . ARG A 1 57  ? -12.167 -5.991  -6.707  1.00 54.44  ? 935  ARG A CD  1 
ATOM   372  N NE  . ARG A 1 57  ? -11.538 -4.745  -6.241  1.00 58.86  ? 935  ARG A NE  1 
ATOM   373  C CZ  . ARG A 1 57  ? -10.980 -3.841  -7.054  1.00 60.66  ? 935  ARG A CZ  1 
ATOM   374  N NH1 . ARG A 1 57  ? -10.963 -4.043  -8.372  1.00 61.70  ? 935  ARG A NH1 1 
ATOM   375  N NH2 . ARG A 1 57  ? -10.433 -2.728  -6.567  1.00 60.44  ? 935  ARG A NH2 1 
ATOM   376  N N   . LEU A 1 58  ? -8.116  -9.509  -7.798  1.00 44.84  ? 936  LEU A N   1 
ATOM   377  C CA  . LEU A 1 58  ? -7.231  -10.160 -8.789  1.00 45.65  ? 936  LEU A CA  1 
ATOM   378  C C   . LEU A 1 58  ? -6.774  -11.560 -8.402  1.00 46.24  ? 936  LEU A C   1 
ATOM   379  O O   . LEU A 1 58  ? -6.472  -12.380 -9.259  1.00 46.58  ? 936  LEU A O   1 
ATOM   380  C CB  . LEU A 1 58  ? -5.967  -9.329  -9.047  1.00 43.56  ? 936  LEU A CB  1 
ATOM   381  C CG  . LEU A 1 58  ? -6.193  -8.067  -9.871  1.00 42.68  ? 936  LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 58  ? -4.902  -7.392  -10.217 1.00 40.06  ? 936  LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 58  ? -7.018  -8.369  -11.099 1.00 40.82  ? 936  LEU A CD2 1 
ATOM   384  N N   . VAL A 1 59  ? -6.658  -11.802 -7.104  1.00 51.94  ? 937  VAL A N   1 
ATOM   385  C CA  . VAL A 1 59  ? -6.241  -13.098 -6.571  1.00 53.10  ? 937  VAL A CA  1 
ATOM   386  C C   . VAL A 1 59  ? -7.251  -14.264 -6.842  1.00 54.34  ? 937  VAL A C   1 
ATOM   387  O O   . VAL A 1 59  ? -6.934  -15.443 -6.688  1.00 53.93  ? 937  VAL A O   1 
ATOM   388  C CB  . VAL A 1 59  ? -5.763  -12.953 -5.112  1.00 53.91  ? 937  VAL A CB  1 
ATOM   389  C CG1 . VAL A 1 59  ? -6.587  -13.784 -4.150  1.00 53.62  ? 937  VAL A CG1 1 
ATOM   390  C CG2 . VAL A 1 59  ? -4.296  -13.227 -5.017  1.00 52.97  ? 937  VAL A CG2 1 
ATOM   391  N N   . ARG A 1 60  ? -8.437  -13.933 -7.331  1.00 63.52  ? 938  ARG A N   1 
ATOM   392  C CA  . ARG A 1 60  ? -9.399  -14.957 -7.723  1.00 65.27  ? 938  ARG A CA  1 
ATOM   393  C C   . ARG A 1 60  ? -9.364  -15.042 -9.257  1.00 66.31  ? 938  ARG A C   1 
ATOM   394  O O   . ARG A 1 60  ? -9.314  -16.134 -9.831  1.00 66.11  ? 938  ARG A O   1 
ATOM   395  C CB  . ARG A 1 60  ? -10.779 -14.547 -7.255  1.00 72.94  ? 938  ARG A CB  1 
ATOM   396  C CG  . ARG A 1 60  ? -10.718 -13.746 -5.986  1.00 74.54  ? 938  ARG A CG  1 
ATOM   397  C CD  . ARG A 1 60  ? -10.168 -14.627 -4.910  1.00 77.21  ? 938  ARG A CD  1 
ATOM   398  N NE  . ARG A 1 60  ? -10.515 -16.013 -5.191  1.00 81.64  ? 938  ARG A NE  1 
ATOM   399  C CZ  . ARG A 1 60  ? -11.581 -16.640 -4.690  1.00 82.69  ? 938  ARG A CZ  1 
ATOM   400  N NH1 . ARG A 1 60  ? -12.411 -16.002 -3.860  1.00 81.99  ? 938  ARG A NH1 1 
ATOM   401  N NH2 . ARG A 1 60  ? -11.807 -17.917 -4.997  1.00 83.55  ? 938  ARG A NH2 1 
ATOM   402  N N   . GLY A 1 61  ? -9.328  -13.861 -9.886  1.00 70.75  ? 939  GLY A N   1 
ATOM   403  C CA  . GLY A 1 61  ? -9.264  -13.578 -11.319 1.00 71.42  ? 939  GLY A CA  1 
ATOM   404  C C   . GLY A 1 61  ? -9.226  -14.683 -12.354 1.00 71.82  ? 939  GLY A C   1 
ATOM   405  O O   . GLY A 1 61  ? -9.744  -14.527 -13.466 1.00 71.71  ? 939  GLY A O   1 
ATOM   406  N N   . GLY A 1 62  ? -8.601  -15.798 -12.013 1.00 74.92  ? 940  GLY A N   1 
ATOM   407  C CA  . GLY A 1 62  ? -8.515  -16.904 -12.953 1.00 75.95  ? 940  GLY A CA  1 
ATOM   408  C C   . GLY A 1 62  ? -7.532  -16.509 -14.035 1.00 76.51  ? 940  GLY A C   1 
ATOM   409  O O   . GLY A 1 62  ? -6.360  -16.886 -14.008 1.00 76.98  ? 940  GLY A O   1 
ATOM   410  N N   . SER A 1 63  ? -8.002  -15.724 -14.991 1.00 76.30  ? 941  SER A N   1 
ATOM   411  C CA  . SER A 1 63  ? -7.107  -15.200 -16.001 1.00 76.19  ? 941  SER A CA  1 
ATOM   412  C C   . SER A 1 63  ? -7.543  -13.875 -16.580 1.00 75.72  ? 941  SER A C   1 
ATOM   413  O O   . SER A 1 63  ? -8.715  -13.455 -16.429 1.00 75.73  ? 941  SER A O   1 
ATOM   414  C CB  . SER A 1 63  ? -6.662  -16.203 -17.057 1.00 80.01  ? 941  SER A CB  1 
ATOM   415  O OG  . SER A 1 63  ? -5.550  -15.659 -17.763 1.00 81.72  ? 941  SER A OG  1 
ATOM   416  N N   . GLY A 1 64  ? -6.568  -13.229 -17.221 1.00 70.24  ? 942  GLY A N   1 
ATOM   417  C CA  . GLY A 1 64  ? -6.643  -11.876 -17.714 1.00 68.90  ? 942  GLY A CA  1 
ATOM   418  C C   . GLY A 1 64  ? -6.090  -11.125 -16.513 1.00 68.09  ? 942  GLY A C   1 
ATOM   419  O O   . GLY A 1 64  ? -5.685  -9.947  -16.592 1.00 68.34  ? 942  GLY A O   1 
ATOM   420  N N   . THR A 1 65  ? -6.045  -11.850 -15.391 1.00 59.75  ? 943  THR A N   1 
ATOM   421  C CA  . THR A 1 65  ? -5.544  -11.317 -14.131 1.00 58.56  ? 943  THR A CA  1 
ATOM   422  C C   . THR A 1 65  ? -4.016  -11.414 -14.056 1.00 58.09  ? 943  THR A C   1 
ATOM   423  O O   . THR A 1 65  ? -3.393  -10.741 -13.238 1.00 58.19  ? 943  THR A O   1 
ATOM   424  C CB  . THR A 1 65  ? -6.269  -11.931 -12.888 1.00 54.38  ? 943  THR A CB  1 
ATOM   425  O OG1 . THR A 1 65  ? -6.293  -13.364 -12.974 1.00 54.27  ? 943  THR A OG1 1 
ATOM   426  C CG2 . THR A 1 65  ? -7.677  -11.451 -12.811 1.00 54.32  ? 943  THR A CG2 1 
ATOM   427  N N   . LYS A 1 66  ? -3.423  -12.238 -14.925 1.00 54.72  ? 944  LYS A N   1 
ATOM   428  C CA  . LYS A 1 66  ? -1.964  -12.401 -14.982 1.00 53.31  ? 944  LYS A CA  1 
ATOM   429  C C   . LYS A 1 66  ? -1.277  -11.032 -15.137 1.00 52.80  ? 944  LYS A C   1 
ATOM   430  O O   . LYS A 1 66  ? -0.561  -10.556 -14.242 1.00 53.03  ? 944  LYS A O   1 
ATOM   431  C CB  . LYS A 1 66  ? -1.580  -13.311 -16.163 1.00 60.41  ? 944  LYS A CB  1 
ATOM   432  C CG  . LYS A 1 66  ? -2.775  -13.663 -17.100 1.00 60.61  ? 944  LYS A CG  1 
ATOM   433  C CD  . LYS A 1 66  ? -2.486  -13.354 -18.584 1.00 56.02  ? 944  LYS A CD  1 
ATOM   434  C CE  . LYS A 1 66  ? -3.481  -12.364 -19.188 1.00 53.23  ? 944  LYS A CE  1 
ATOM   435  N NZ  . LYS A 1 66  ? -3.520  -11.118 -18.400 1.00 53.01  ? 944  LYS A NZ  1 
ATOM   436  N N   . ARG A 1 67  ? -1.519  -10.384 -16.267 1.00 46.56  ? 945  ARG A N   1 
ATOM   437  C CA  . ARG A 1 67  ? -0.910  -9.103  -16.496 1.00 45.14  ? 945  ARG A CA  1 
ATOM   438  C C   . ARG A 1 67  ? -1.253  -8.122  -15.408 1.00 44.16  ? 945  ARG A C   1 
ATOM   439  O O   . ARG A 1 67  ? -0.374  -7.449  -14.875 1.00 44.24  ? 945  ARG A O   1 
ATOM   440  C CB  . ARG A 1 67  ? -1.313  -8.574  -17.850 1.00 42.34  ? 945  ARG A CB  1 
ATOM   441  C CG  . ARG A 1 67  ? -0.485  -9.141  -18.934 1.00 43.00  ? 945  ARG A CG  1 
ATOM   442  C CD  . ARG A 1 67  ? -0.310  -8.126  -20.010 1.00 47.00  ? 945  ARG A CD  1 
ATOM   443  N NE  . ARG A 1 67  ? -1.321  -8.289  -21.053 1.00 50.56  ? 945  ARG A NE  1 
ATOM   444  C CZ  . ARG A 1 67  ? -1.643  -7.355  -21.948 1.00 53.26  ? 945  ARG A CZ  1 
ATOM   445  N NH1 . ARG A 1 67  ? -1.035  -6.167  -21.959 1.00 53.31  ? 945  ARG A NH1 1 
ATOM   446  N NH2 . ARG A 1 67  ? -2.585  -7.613  -22.847 1.00 55.95  ? 945  ARG A NH2 1 
ATOM   447  N N   . ALA A 1 68  ? -2.537  -8.013  -15.092 1.00 41.61  ? 946  ALA A N   1 
ATOM   448  C CA  . ALA A 1 68  ? -2.968  -7.076  -14.063 1.00 40.62  ? 946  ALA A CA  1 
ATOM   449  C C   . ALA A 1 68  ? -2.278  -7.350  -12.737 1.00 40.04  ? 946  ALA A C   1 
ATOM   450  O O   . ALA A 1 68  ? -1.677  -6.453  -12.168 1.00 40.51  ? 946  ALA A O   1 
ATOM   451  C CB  . ALA A 1 68  ? -4.448  -7.111  -13.889 1.00 40.94  ? 946  ALA A CB  1 
ATOM   452  N N   . LEU A 1 69  ? -2.364  -8.586  -12.252 1.00 37.95  ? 947  LEU A N   1 
ATOM   453  C CA  . LEU A 1 69  ? -1.743  -8.995  -10.977 1.00 36.47  ? 947  LEU A CA  1 
ATOM   454  C C   . LEU A 1 69  ? -0.311  -8.526  -10.884 1.00 36.27  ? 947  LEU A C   1 
ATOM   455  O O   . LEU A 1 69  ? 0.126   -8.037  -9.830  1.00 36.51  ? 947  LEU A O   1 
ATOM   456  C CB  . LEU A 1 69  ? -1.778  -10.506 -10.807 1.00 36.43  ? 947  LEU A CB  1 
ATOM   457  C CG  . LEU A 1 69  ? -1.397  -10.936 -9.416  1.00 32.80  ? 947  LEU A CG  1 
ATOM   458  C CD1 . LEU A 1 69  ? -1.891  -9.950  -8.399  1.00 30.44  ? 947  LEU A CD1 1 
ATOM   459  C CD2 . LEU A 1 69  ? -1.870  -12.334 -9.158  1.00 29.43  ? 947  LEU A CD2 1 
ATOM   460  N N   . ILE A 1 70  ? 0.397   -8.637  -12.008 1.00 36.21  ? 948  ILE A N   1 
ATOM   461  C CA  . ILE A 1 70  ? 1.773   -8.176  -12.080 1.00 35.86  ? 948  ILE A CA  1 
ATOM   462  C C   . ILE A 1 70  ? 1.867   -6.642  -11.968 1.00 35.93  ? 948  ILE A C   1 
ATOM   463  O O   . ILE A 1 70  ? 2.529   -6.089  -11.055 1.00 35.75  ? 948  ILE A O   1 
ATOM   464  C CB  . ILE A 1 70  ? 2.456   -8.676  -13.323 1.00 36.55  ? 948  ILE A CB  1 
ATOM   465  C CG1 . ILE A 1 70  ? 3.058   -10.060 -13.071 1.00 36.19  ? 948  ILE A CG1 1 
ATOM   466  C CG2 . ILE A 1 70  ? 3.506   -7.704  -13.732 1.00 35.72  ? 948  ILE A CG2 1 
ATOM   467  C CD1 . ILE A 1 70  ? 2.768   -11.060 -14.166 1.00 35.68  ? 948  ILE A CD1 1 
ATOM   468  N N   . GLN A 1 71  ? 1.168   -5.953  -12.862 1.00 37.59  ? 949  GLN A N   1 
ATOM   469  C CA  . GLN A 1 71  ? 1.155   -4.496  -12.808 1.00 38.25  ? 949  GLN A CA  1 
ATOM   470  C C   . GLN A 1 71  ? 0.806   -3.943  -11.407 1.00 38.21  ? 949  GLN A C   1 
ATOM   471  O O   . GLN A 1 71  ? 1.439   -3.032  -10.879 1.00 37.42  ? 949  GLN A O   1 
ATOM   472  C CB  . GLN A 1 71  ? 0.150   -3.961  -13.811 1.00 39.12  ? 949  GLN A CB  1 
ATOM   473  C CG  . GLN A 1 71  ? 0.546   -2.613  -14.336 1.00 40.81  ? 949  GLN A CG  1 
ATOM   474  C CD  . GLN A 1 71  ? 2.064   -2.420  -14.325 1.00 42.90  ? 949  GLN A CD  1 
ATOM   475  O OE1 . GLN A 1 71  ? 2.595   -1.634  -13.525 1.00 44.59  ? 949  GLN A OE1 1 
ATOM   476  N NE2 . GLN A 1 71  ? 2.777   -3.196  -15.167 1.00 43.50  ? 949  GLN A NE2 1 
ATOM   477  N N   . CYS A 1 72  ? -0.240  -4.516  -10.833 1.00 39.65  ? 950  CYS A N   1 
ATOM   478  C CA  . CYS A 1 72  ? -0.744  -4.122  -9.554  1.00 39.76  ? 950  CYS A CA  1 
ATOM   479  C C   . CYS A 1 72  ? 0.324   -4.179  -8.469  1.00 39.60  ? 950  CYS A C   1 
ATOM   480  O O   . CYS A 1 72  ? 0.417   -3.286  -7.622  1.00 38.88  ? 950  CYS A O   1 
ATOM   481  C CB  . CYS A 1 72  ? -1.871  -5.056  -9.187  1.00 40.52  ? 950  CYS A CB  1 
ATOM   482  S SG  . CYS A 1 72  ? -2.473  -4.645  -7.573  1.00 42.79  ? 950  CYS A SG  1 
ATOM   483  N N   . ALA A 1 73  ? 1.078   -5.278  -8.460  1.00 42.21  ? 951  ALA A N   1 
ATOM   484  C CA  . ALA A 1 73  ? 2.098   -5.496  -7.445  1.00 41.33  ? 951  ALA A CA  1 
ATOM   485  C C   . ALA A 1 73  ? 3.196   -4.465  -7.644  1.00 41.13  ? 951  ALA A C   1 
ATOM   486  O O   . ALA A 1 73  ? 3.707   -3.897  -6.659  1.00 41.26  ? 951  ALA A O   1 
ATOM   487  C CB  . ALA A 1 73  ? 2.629   -6.912  -7.517  1.00 41.51  ? 951  ALA A CB  1 
ATOM   488  N N   . LYS A 1 74  ? 3.485   -4.169  -8.914  1.00 42.04  ? 952  LYS A N   1 
ATOM   489  C CA  . LYS A 1 74  ? 4.444   -3.126  -9.271  1.00 42.37  ? 952  LYS A CA  1 
ATOM   490  C C   . LYS A 1 74  ? 3.954   -1.772  -8.756  1.00 42.60  ? 952  LYS A C   1 
ATOM   491  O O   . LYS A 1 74  ? 4.700   -1.026  -8.128  1.00 43.49  ? 952  LYS A O   1 
ATOM   492  C CB  . LYS A 1 74  ? 4.606   -3.049  -10.782 1.00 47.45  ? 952  LYS A CB  1 
ATOM   493  C CG  . LYS A 1 74  ? 5.431   -4.185  -11.311 1.00 46.30  ? 952  LYS A CG  1 
ATOM   494  C CD  . LYS A 1 74  ? 6.062   -3.807  -12.606 1.00 46.37  ? 952  LYS A CD  1 
ATOM   495  C CE  . LYS A 1 74  ? 5.574   -4.724  -13.709 1.00 44.96  ? 952  LYS A CE  1 
ATOM   496  N NZ  . LYS A 1 74  ? 6.195   -4.362  -15.005 1.00 43.89  ? 952  LYS A NZ  1 
ATOM   497  N N   . ASP A 1 75  ? 2.682   -1.489  -8.981  1.00 43.41  ? 953  ASP A N   1 
ATOM   498  C CA  . ASP A 1 75  ? 2.087   -0.251  -8.521  1.00 43.84  ? 953  ASP A CA  1 
ATOM   499  C C   . ASP A 1 75  ? 2.328   -0.066  -7.054  1.00 43.85  ? 953  ASP A C   1 
ATOM   500  O O   . ASP A 1 75  ? 2.792   1.007   -6.627  1.00 43.93  ? 953  ASP A O   1 
ATOM   501  C CB  . ASP A 1 75  ? 0.586   -0.263  -8.767  1.00 48.76  ? 953  ASP A CB  1 
ATOM   502  C CG  . ASP A 1 75  ? 0.236   0.141   -10.184 1.00 49.46  ? 953  ASP A CG  1 
ATOM   503  O OD1 . ASP A 1 75  ? 1.185   0.337   -10.991 1.00 48.43  ? 953  ASP A OD1 1 
ATOM   504  O OD2 . ASP A 1 75  ? -0.977  0.298   -10.481 1.00 53.50  ? 953  ASP A OD2 1 
ATOM   505  N N   . ILE A 1 76  ? 1.991   -1.114  -6.297  1.00 39.46  ? 954  ILE A N   1 
ATOM   506  C CA  . ILE A 1 76  ? 2.120   -1.130  -4.830  1.00 39.80  ? 954  ILE A CA  1 
ATOM   507  C C   . ILE A 1 76  ? 3.547   -0.761  -4.414  1.00 39.80  ? 954  ILE A C   1 
ATOM   508  O O   . ILE A 1 76  ? 3.765   0.170   -3.633  1.00 39.17  ? 954  ILE A O   1 
ATOM   509  C CB  . ILE A 1 76  ? 1.691   -2.491  -4.216  1.00 42.02  ? 954  ILE A CB  1 
ATOM   510  C CG1 . ILE A 1 76  ? 0.178   -2.557  -4.031  1.00 41.64  ? 954  ILE A CG1 1 
ATOM   511  C CG2 . ILE A 1 76  ? 2.366   -2.693  -2.881  1.00 42.29  ? 954  ILE A CG2 1 
ATOM   512  C CD1 . ILE A 1 76  ? -0.394  -3.968  -4.157  1.00 42.17  ? 954  ILE A CD1 1 
ATOM   513  N N   . ALA A 1 77  ? 4.515   -1.453  -5.001  1.00 37.82  ? 955  ALA A N   1 
ATOM   514  C CA  . ALA A 1 77  ? 5.911   -1.193  -4.688  1.00 38.41  ? 955  ALA A CA  1 
ATOM   515  C C   . ALA A 1 77  ? 6.260   0.265   -4.983  1.00 38.99  ? 955  ALA A C   1 
ATOM   516  O O   . ALA A 1 77  ? 7.022   0.900   -4.250  1.00 38.79  ? 955  ALA A O   1 
ATOM   517  C CB  . ALA A 1 77  ? 6.818   -2.148  -5.427  1.00 38.35  ? 955  ALA A CB  1 
ATOM   518  N N   . LYS A 1 78  ? 5.640   0.833   -6.009  1.00 39.11  ? 956  LYS A N   1 
ATOM   519  C CA  . LYS A 1 78  ? 5.889   2.237   -6.291  1.00 39.58  ? 956  LYS A CA  1 
ATOM   520  C C   . LYS A 1 78  ? 5.471   3.095   -5.087  1.00 39.24  ? 956  LYS A C   1 
ATOM   521  O O   . LYS A 1 78  ? 6.262   3.905   -4.586  1.00 39.12  ? 956  LYS A O   1 
ATOM   522  C CB  . LYS A 1 78  ? 5.172   2.658   -7.555  1.00 41.30  ? 956  LYS A CB  1 
ATOM   523  C CG  . LYS A 1 78  ? 5.935   3.700   -8.338  1.00 43.40  ? 956  LYS A CG  1 
ATOM   524  C CD  . LYS A 1 78  ? 5.040   4.268   -9.449  1.00 49.73  ? 956  LYS A CD  1 
ATOM   525  C CE  . LYS A 1 78  ? 3.645   3.499   -9.543  1.00 54.13  ? 956  LYS A CE  1 
ATOM   526  N NZ  . LYS A 1 78  ? 3.100   3.279   -10.939 1.00 54.47  ? 956  LYS A NZ  1 
ATOM   527  N N   . ALA A 1 79  ? 4.258   2.836   -4.601  1.00 38.16  ? 957  ALA A N   1 
ATOM   528  C CA  . ALA A 1 79  ? 3.678   3.512   -3.446  1.00 38.02  ? 957  ALA A CA  1 
ATOM   529  C C   . ALA A 1 79  ? 4.517   3.351   -2.152  1.00 38.62  ? 957  ALA A C   1 
ATOM   530  O O   . ALA A 1 79  ? 4.657   4.292   -1.375  1.00 38.46  ? 957  ALA A O   1 
ATOM   531  C CB  . ALA A 1 79  ? 2.245   3.002   -3.217  1.00 38.08  ? 957  ALA A CB  1 
ATOM   532  N N   . SER A 1 80  ? 5.052   2.161   -1.900  1.00 39.52  ? 958  SER A N   1 
ATOM   533  C CA  . SER A 1 80  ? 5.862   1.961   -0.720  1.00 40.69  ? 958  SER A CA  1 
ATOM   534  C C   . SER A 1 80  ? 7.163   2.750   -0.853  1.00 41.42  ? 958  SER A C   1 
ATOM   535  O O   . SER A 1 80  ? 7.595   3.430   0.090   1.00 41.46  ? 958  SER A O   1 
ATOM   536  C CB  . SER A 1 80  ? 6.203   0.502   -0.582  1.00 41.14  ? 958  SER A CB  1 
ATOM   537  O OG  . SER A 1 80  ? 5.418   -0.240  -1.472  1.00 43.42  ? 958  SER A OG  1 
ATOM   538  N N   . ASP A 1 81  ? 7.799   2.659   -2.021  1.00 47.63  ? 959  ASP A N   1 
ATOM   539  C CA  . ASP A 1 81  ? 9.039   3.409   -2.272  1.00 47.69  ? 959  ASP A CA  1 
ATOM   540  C C   . ASP A 1 81  ? 8.877   4.891   -1.874  1.00 47.61  ? 959  ASP A C   1 
ATOM   541  O O   . ASP A 1 81  ? 9.801   5.512   -1.344  1.00 48.03  ? 959  ASP A O   1 
ATOM   542  C CB  . ASP A 1 81  ? 9.509   3.253   -3.736  1.00 52.47  ? 959  ASP A CB  1 
ATOM   543  C CG  . ASP A 1 81  ? 10.063  1.827   -4.044  1.00 54.27  ? 959  ASP A CG  1 
ATOM   544  O OD1 . ASP A 1 81  ? 10.802  1.272   -3.187  1.00 54.50  ? 959  ASP A OD1 1 
ATOM   545  O OD2 . ASP A 1 81  ? 9.752   1.248   -5.138  1.00 58.86  ? 959  ASP A OD2 1 
ATOM   546  N N   . GLU A 1 82  ? 7.684   5.437   -2.074  1.00 47.31  ? 960  GLU A N   1 
ATOM   547  C CA  . GLU A 1 82  ? 7.426   6.823   -1.708  1.00 48.10  ? 960  GLU A CA  1 
ATOM   548  C C   . GLU A 1 82  ? 7.128   7.021   -0.202  1.00 48.04  ? 960  GLU A C   1 
ATOM   549  O O   . GLU A 1 82  ? 7.441   8.058   0.373   1.00 48.28  ? 960  GLU A O   1 
ATOM   550  C CB  . GLU A 1 82  ? 6.311   7.394   -2.583  1.00 51.88  ? 960  GLU A CB  1 
ATOM   551  C CG  . GLU A 1 82  ? 6.752   7.794   -4.020  1.00 55.15  ? 960  GLU A CG  1 
ATOM   552  C CD  . GLU A 1 82  ? 8.150   7.233   -4.479  1.00 60.46  ? 960  GLU A CD  1 
ATOM   553  O OE1 . GLU A 1 82  ? 8.161   6.123   -5.119  1.00 61.05  ? 960  GLU A OE1 1 
ATOM   554  O OE2 . GLU A 1 82  ? 9.188   7.978   -4.334  1.00 58.88  ? 960  GLU A OE2 1 
ATOM   555  N N   . VAL A 1 83  ? 6.538   6.013   0.434   1.00 42.16  ? 961  VAL A N   1 
ATOM   556  C CA  . VAL A 1 83  ? 6.285   6.064   1.866   1.00 41.69  ? 961  VAL A CA  1 
ATOM   557  C C   . VAL A 1 83  ? 7.651   6.066   2.543   1.00 41.87  ? 961  VAL A C   1 
ATOM   558  O O   . VAL A 1 83  ? 7.926   6.863   3.441   1.00 41.63  ? 961  VAL A O   1 
ATOM   559  C CB  . VAL A 1 83  ? 5.409   4.862   2.344   1.00 41.93  ? 961  VAL A CB  1 
ATOM   560  C CG1 . VAL A 1 83  ? 5.268   4.862   3.839   1.00 41.29  ? 961  VAL A CG1 1 
ATOM   561  C CG2 . VAL A 1 83  ? 4.041   4.928   1.718   1.00 41.15  ? 961  VAL A CG2 1 
ATOM   562  N N   . THR A 1 84  ? 8.515   5.174   2.072   1.00 43.04  ? 962  THR A N   1 
ATOM   563  C CA  . THR A 1 84  ? 9.868   5.072   2.600   1.00 43.51  ? 962  THR A CA  1 
ATOM   564  C C   . THR A 1 84  ? 10.646  6.391   2.391   1.00 43.71  ? 962  THR A C   1 
ATOM   565  O O   . THR A 1 84  ? 11.159  6.990   3.337   1.00 43.55  ? 962  THR A O   1 
ATOM   566  C CB  . THR A 1 84  ? 10.639  3.893   1.972   1.00 42.08  ? 962  THR A CB  1 
ATOM   567  O OG1 . THR A 1 84  ? 9.762   2.784   1.755   1.00 43.39  ? 962  THR A OG1 1 
ATOM   568  C CG2 . THR A 1 84  ? 11.760  3.479   2.886   1.00 41.87  ? 962  THR A CG2 1 
ATOM   569  N N   . ARG A 1 85  ? 10.749  6.816   1.137   1.00 46.77  ? 963  ARG A N   1 
ATOM   570  C CA  . ARG A 1 85  ? 11.458  8.024   0.808   1.00 47.15  ? 963  ARG A CA  1 
ATOM   571  C C   . ARG A 1 85  ? 11.075  9.219   1.717   1.00 47.20  ? 963  ARG A C   1 
ATOM   572  O O   . ARG A 1 85  ? 11.942  9.946   2.227   1.00 46.97  ? 963  ARG A O   1 
ATOM   573  C CB  . ARG A 1 85  ? 11.199  8.359   -0.652  1.00 52.87  ? 963  ARG A CB  1 
ATOM   574  C CG  . ARG A 1 85  ? 11.807  9.693   -1.046  1.00 54.51  ? 963  ARG A CG  1 
ATOM   575  C CD  . ARG A 1 85  ? 11.566  10.044  -2.502  1.00 55.76  ? 963  ARG A CD  1 
ATOM   576  N NE  . ARG A 1 85  ? 10.198  10.511  -2.734  1.00 57.50  ? 963  ARG A NE  1 
ATOM   577  C CZ  . ARG A 1 85  ? 9.714   11.685  -2.318  1.00 58.98  ? 963  ARG A CZ  1 
ATOM   578  N NH1 . ARG A 1 85  ? 10.483  12.538  -1.625  1.00 58.40  ? 963  ARG A NH1 1 
ATOM   579  N NH2 . ARG A 1 85  ? 8.451   12.001  -2.611  1.00 59.57  ? 963  ARG A NH2 1 
ATOM   580  N N   . LEU A 1 86  ? 9.775   9.410   1.919   1.00 46.68  ? 964  LEU A N   1 
ATOM   581  C CA  . LEU A 1 86  ? 9.275   10.503  2.732   1.00 46.94  ? 964  LEU A CA  1 
ATOM   582  C C   . LEU A 1 86  ? 9.464   10.234  4.224   1.00 47.50  ? 964  LEU A C   1 
ATOM   583  O O   . LEU A 1 86  ? 9.796   11.147  4.995   1.00 47.35  ? 964  LEU A O   1 
ATOM   584  C CB  . LEU A 1 86  ? 7.804   10.770  2.405   1.00 46.96  ? 964  LEU A CB  1 
ATOM   585  C CG  . LEU A 1 86  ? 7.523   11.325  1.002   1.00 46.37  ? 964  LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 86  ? 6.040   11.356  0.656   1.00 44.11  ? 964  LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 86  ? 8.093   12.703  0.897   1.00 45.92  ? 964  LEU A CD2 1 
ATOM   588  N N   . ALA A 1 87  ? 9.264   8.983   4.635   1.00 49.05  ? 965  ALA A N   1 
ATOM   589  C CA  . ALA A 1 87  ? 9.472   8.621   6.029   1.00 49.29  ? 965  ALA A CA  1 
ATOM   590  C C   . ALA A 1 87  ? 10.910  8.975   6.399   1.00 49.52  ? 965  ALA A C   1 
ATOM   591  O O   . ALA A 1 87  ? 11.194  9.398   7.498   1.00 49.63  ? 965  ALA A O   1 
ATOM   592  C CB  . ALA A 1 87  ? 9.224   7.143   6.237   1.00 49.39  ? 965  ALA A CB  1 
ATOM   593  N N   . LYS A 1 88  ? 11.819  8.837   5.451   1.00 52.64  ? 966  LYS A N   1 
ATOM   594  C CA  . LYS A 1 88  ? 13.214  9.135   5.718   1.00 53.04  ? 966  LYS A CA  1 
ATOM   595  C C   . LYS A 1 88  ? 13.510  10.612  5.846   1.00 53.29  ? 966  LYS A C   1 
ATOM   596  O O   . LYS A 1 88  ? 14.323  11.037  6.680   1.00 53.06  ? 966  LYS A O   1 
ATOM   597  C CB  . LYS A 1 88  ? 14.107  8.490   4.674   1.00 57.34  ? 966  LYS A CB  1 
ATOM   598  C CG  . LYS A 1 88  ? 14.574  7.129   5.114   1.00 58.13  ? 966  LYS A CG  1 
ATOM   599  C CD  . LYS A 1 88  ? 15.513  6.474   4.129   1.00 61.06  ? 966  LYS A CD  1 
ATOM   600  C CE  . LYS A 1 88  ? 15.455  4.955   4.326   1.00 61.53  ? 966  LYS A CE  1 
ATOM   601  N NZ  . LYS A 1 88  ? 14.232  4.567   5.171   1.00 60.51  ? 966  LYS A NZ  1 
ATOM   602  N N   . GLU A 1 89  ? 12.847  11.410  5.022   1.00 55.83  ? 967  GLU A N   1 
ATOM   603  C CA  . GLU A 1 89  ? 13.063  12.831  5.125   1.00 56.28  ? 967  GLU A CA  1 
ATOM   604  C C   . GLU A 1 89  ? 12.555  13.326  6.480   1.00 56.16  ? 967  GLU A C   1 
ATOM   605  O O   . GLU A 1 89  ? 13.135  14.239  7.066   1.00 56.53  ? 967  GLU A O   1 
ATOM   606  C CB  . GLU A 1 89  ? 12.437  13.583  3.953   1.00 60.21  ? 967  GLU A CB  1 
ATOM   607  C CG  . GLU A 1 89  ? 13.460  14.390  3.069   1.00 63.28  ? 967  GLU A CG  1 
ATOM   608  C CD  . GLU A 1 89  ? 14.672  15.035  3.843   1.00 64.42  ? 967  GLU A CD  1 
ATOM   609  O OE1 . GLU A 1 89  ? 15.804  14.501  3.730   1.00 64.78  ? 967  GLU A OE1 1 
ATOM   610  O OE2 . GLU A 1 89  ? 14.523  16.127  4.450   1.00 61.84  ? 967  GLU A OE2 1 
ATOM   611  N N   . VAL A 1 90  ? 11.508  12.680  6.995   1.00 52.28  ? 968  VAL A N   1 
ATOM   612  C CA  . VAL A 1 90  ? 10.926  13.030  8.288   1.00 51.90  ? 968  VAL A CA  1 
ATOM   613  C C   . VAL A 1 90  ? 11.907  12.672  9.384   1.00 52.29  ? 968  VAL A C   1 
ATOM   614  O O   . VAL A 1 90  ? 12.100  13.412  10.336  1.00 52.31  ? 968  VAL A O   1 
ATOM   615  C CB  . VAL A 1 90  ? 9.635   12.255  8.533   1.00 53.34  ? 968  VAL A CB  1 
ATOM   616  C CG1 . VAL A 1 90  ? 9.193   12.429  9.972   1.00 53.10  ? 968  VAL A CG1 1 
ATOM   617  C CG2 . VAL A 1 90  ? 8.565   12.663  7.566   1.00 52.78  ? 968  VAL A CG2 1 
ATOM   618  N N   . ALA A 1 91  ? 12.473  11.486  9.269   1.00 54.73  ? 969  ALA A N   1 
ATOM   619  C CA  . ALA A 1 91  ? 13.418  10.994  10.239  1.00 56.06  ? 969  ALA A CA  1 
ATOM   620  C C   . ALA A 1 91  ? 14.679  11.869  10.234  1.00 57.11  ? 969  ALA A C   1 
ATOM   621  O O   . ALA A 1 91  ? 15.314  12.072  11.277  1.00 56.90  ? 969  ALA A O   1 
ATOM   622  C CB  . ALA A 1 91  ? 13.765  9.534   9.922   1.00 56.87  ? 969  ALA A CB  1 
ATOM   623  N N   . LYS A 1 92  ? 15.045  12.363  9.048   1.00 60.59  ? 970  LYS A N   1 
ATOM   624  C CA  . LYS A 1 92  ? 16.223  13.216  8.887   1.00 61.91  ? 970  LYS A CA  1 
ATOM   625  C C   . LYS A 1 92  ? 15.994  14.578  9.567   1.00 62.22  ? 970  LYS A C   1 
ATOM   626  O O   . LYS A 1 92  ? 16.942  15.275  9.913   1.00 62.73  ? 970  LYS A O   1 
ATOM   627  C CB  . LYS A 1 92  ? 16.534  13.392  7.396   1.00 65.02  ? 970  LYS A CB  1 
ATOM   628  C CG  . LYS A 1 92  ? 17.867  14.072  7.074   1.00 66.94  ? 970  LYS A CG  1 
ATOM   629  C CD  . LYS A 1 92  ? 18.035  14.353  5.564   1.00 68.84  ? 970  LYS A CD  1 
ATOM   630  C CE  . LYS A 1 92  ? 18.801  15.676  5.289   1.00 71.40  ? 970  LYS A CE  1 
ATOM   631  N NZ  . LYS A 1 92  ? 18.600  16.236  3.905   1.00 72.80  ? 970  LYS A NZ  1 
ATOM   632  N N   . GLN A 1 93  ? 14.726  14.923  9.787   1.00 63.40  ? 971  GLN A N   1 
ATOM   633  C CA  . GLN A 1 93  ? 14.332  16.177  10.435  1.00 63.47  ? 971  GLN A CA  1 
ATOM   634  C C   . GLN A 1 93  ? 14.057  15.991  11.926  1.00 62.94  ? 971  GLN A C   1 
ATOM   635  O O   . GLN A 1 93  ? 14.049  16.952  12.693  1.00 63.09  ? 971  GLN A O   1 
ATOM   636  C CB  . GLN A 1 93  ? 13.078  16.758  9.766   1.00 65.45  ? 971  GLN A CB  1 
ATOM   637  C CG  . GLN A 1 93  ? 13.271  18.156  9.154   1.00 67.72  ? 971  GLN A CG  1 
ATOM   638  C CD  . GLN A 1 93  ? 14.613  18.291  8.437   1.00 70.45  ? 971  GLN A CD  1 
ATOM   639  O OE1 . GLN A 1 93  ? 15.338  19.286  8.630   1.00 70.43  ? 971  GLN A OE1 1 
ATOM   640  N NE2 . GLN A 1 93  ? 14.982  17.257  7.649   1.00 70.68  ? 971  GLN A NE2 1 
ATOM   641  N N   . CYS A 1 94  ? 13.807  14.754  12.336  1.00 64.51  ? 972  CYS A N   1 
ATOM   642  C CA  . CYS A 1 94  ? 13.525  14.479  13.739  1.00 63.56  ? 972  CYS A CA  1 
ATOM   643  C C   . CYS A 1 94  ? 14.715  14.741  14.638  1.00 62.60  ? 972  CYS A C   1 
ATOM   644  O O   . CYS A 1 94  ? 15.850  14.413  14.281  1.00 63.06  ? 972  CYS A O   1 
ATOM   645  C CB  . CYS A 1 94  ? 13.064  13.045  13.936  1.00 63.10  ? 972  CYS A CB  1 
ATOM   646  S SG  . CYS A 1 94  ? 12.317  12.790  15.564  1.00 63.45  ? 972  CYS A SG  1 
ATOM   647  N N   . THR A 1 95  ? 14.453  15.316  15.812  1.00 62.61  ? 973  THR A N   1 
ATOM   648  C CA  . THR A 1 95  ? 15.510  15.601  16.786  1.00 61.22  ? 973  THR A CA  1 
ATOM   649  C C   . THR A 1 95  ? 15.437  14.676  18.019  1.00 61.65  ? 973  THR A C   1 
ATOM   650  O O   . THR A 1 95  ? 16.140  14.861  19.022  1.00 62.02  ? 973  THR A O   1 
ATOM   651  C CB  . THR A 1 95  ? 15.583  17.096  17.158  1.00 61.68  ? 973  THR A CB  1 
ATOM   652  O OG1 . THR A 1 95  ? 14.443  17.447  17.932  1.00 60.11  ? 973  THR A OG1 1 
ATOM   653  C CG2 . THR A 1 95  ? 15.650  17.986  15.913  1.00 60.37  ? 973  THR A CG2 1 
ATOM   654  N N   . ASP A 1 96  ? 14.635  13.629  17.902  1.00 61.49  ? 974  ASP A N   1 
ATOM   655  C CA  . ASP A 1 96  ? 14.486  12.679  18.975  1.00 61.84  ? 974  ASP A CA  1 
ATOM   656  C C   . ASP A 1 96  ? 15.031  11.295  18.610  1.00 62.48  ? 974  ASP A C   1 
ATOM   657  O O   . ASP A 1 96  ? 14.380  10.515  17.916  1.00 62.62  ? 974  ASP A O   1 
ATOM   658  C CB  . ASP A 1 96  ? 13.021  12.587  19.351  1.00 64.29  ? 974  ASP A CB  1 
ATOM   659  C CG  . ASP A 1 96  ? 12.799  11.759  20.578  1.00 64.88  ? 974  ASP A CG  1 
ATOM   660  O OD1 . ASP A 1 96  ? 13.802  11.223  21.088  1.00 67.05  ? 974  ASP A OD1 1 
ATOM   661  O OD2 . ASP A 1 96  ? 11.641  11.644  21.040  1.00 65.11  ? 974  ASP A OD2 1 
ATOM   662  N N   . LYS A 1 97  ? 16.220  10.985  19.109  1.00 63.26  ? 975  LYS A N   1 
ATOM   663  C CA  . LYS A 1 97  ? 16.868  9.694   18.859  1.00 63.35  ? 975  LYS A CA  1 
ATOM   664  C C   . LYS A 1 97  ? 15.908  8.495   19.080  1.00 62.75  ? 975  LYS A C   1 
ATOM   665  O O   . LYS A 1 97  ? 15.899  7.520   18.317  1.00 62.76  ? 975  LYS A O   1 
ATOM   666  C CB  . LYS A 1 97  ? 18.111  9.575   19.763  1.00 65.37  ? 975  LYS A CB  1 
ATOM   667  C CG  . LYS A 1 97  ? 19.273  8.799   19.158  1.00 66.76  ? 975  LYS A CG  1 
ATOM   668  C CD  . LYS A 1 97  ? 19.955  7.951   20.220  1.00 68.49  ? 975  LYS A CD  1 
ATOM   669  C CE  . LYS A 1 97  ? 21.261  7.334   19.726  1.00 70.10  ? 975  LYS A CE  1 
ATOM   670  N NZ  . LYS A 1 97  ? 21.290  7.110   18.256  1.00 68.59  ? 975  LYS A NZ  1 
ATOM   671  N N   . ARG A 1 98  ? 15.117  8.568   20.140  1.00 63.83  ? 976  ARG A N   1 
ATOM   672  C CA  . ARG A 1 98  ? 14.182  7.502   20.435  1.00 63.15  ? 976  ARG A CA  1 
ATOM   673  C C   . ARG A 1 98  ? 13.296  7.270   19.229  1.00 62.38  ? 976  ARG A C   1 
ATOM   674  O O   . ARG A 1 98  ? 13.250  6.163   18.679  1.00 62.06  ? 976  ARG A O   1 
ATOM   675  C CB  . ARG A 1 98  ? 13.324  7.845   21.655  1.00 68.80  ? 976  ARG A CB  1 
ATOM   676  C CG  . ARG A 1 98  ? 12.821  6.616   22.346  1.00 68.62  ? 976  ARG A CG  1 
ATOM   677  C CD  . ARG A 1 98  ? 13.643  5.451   21.849  1.00 68.61  ? 976  ARG A CD  1 
ATOM   678  N NE  . ARG A 1 98  ? 13.020  4.163   22.109  1.00 71.17  ? 976  ARG A NE  1 
ATOM   679  C CZ  . ARG A 1 98  ? 13.474  3.010   21.628  1.00 73.65  ? 976  ARG A CZ  1 
ATOM   680  N NH1 . ARG A 1 98  ? 14.554  3.004   20.846  1.00 72.37  ? 976  ARG A NH1 1 
ATOM   681  N NH2 . ARG A 1 98  ? 12.848  1.868   21.939  1.00 74.68  ? 976  ARG A NH2 1 
ATOM   682  N N   . ILE A 1 99  ? 12.619  8.338   18.807  1.00 59.38  ? 977  ILE A N   1 
ATOM   683  C CA  . ILE A 1 99  ? 11.696  8.291   17.674  1.00 58.87  ? 977  ILE A CA  1 
ATOM   684  C C   . ILE A 1 99  ? 12.368  8.152   16.327  1.00 58.69  ? 977  ILE A C   1 
ATOM   685  O O   . ILE A 1 99  ? 11.994  7.289   15.556  1.00 58.41  ? 977  ILE A O   1 
ATOM   686  C CB  . ILE A 1 99  ? 10.679  9.448   17.674  1.00 62.72  ? 977  ILE A CB  1 
ATOM   687  C CG1 . ILE A 1 99  ? 9.967   9.575   19.026  1.00 61.57  ? 977  ILE A CG1 1 
ATOM   688  C CG2 . ILE A 1 99  ? 9.644   9.200   16.620  1.00 63.20  ? 977  ILE A CG2 1 
ATOM   689  C CD1 . ILE A 1 99  ? 9.540   8.237   19.632  1.00 60.42  ? 977  ILE A CD1 1 
ATOM   690  N N   . ARG A 1 100 ? 13.357  8.989   16.043  1.00 56.34  ? 978  ARG A N   1 
ATOM   691  C CA  . ARG A 1 100 ? 14.068  8.894   14.774  1.00 56.96  ? 978  ARG A CA  1 
ATOM   692  C C   . ARG A 1 100 ? 14.505  7.468   14.496  1.00 57.09  ? 978  ARG A C   1 
ATOM   693  O O   . ARG A 1 100 ? 14.672  7.065   13.340  1.00 57.20  ? 978  ARG A O   1 
ATOM   694  C CB  . ARG A 1 100 ? 15.317  9.765   14.768  1.00 54.13  ? 978  ARG A CB  1 
ATOM   695  C CG  . ARG A 1 100 ? 15.860  10.021  13.355  1.00 56.02  ? 978  ARG A CG  1 
ATOM   696  C CD  . ARG A 1 100 ? 17.380  10.148  13.314  1.00 60.02  ? 978  ARG A CD  1 
ATOM   697  N NE  . ARG A 1 100 ? 17.963  10.104  14.648  1.00 62.51  ? 978  ARG A NE  1 
ATOM   698  C CZ  . ARG A 1 100 ? 18.053  11.154  15.463  1.00 62.22  ? 978  ARG A CZ  1 
ATOM   699  N NH1 . ARG A 1 100 ? 17.604  12.343  15.068  1.00 61.82  ? 978  ARG A NH1 1 
ATOM   700  N NH2 . ARG A 1 100 ? 18.570  11.009  16.682  1.00 60.96  ? 978  ARG A NH2 1 
ATOM   701  N N   . THR A 1 101 ? 14.710  6.720   15.572  1.00 57.63  ? 979  THR A N   1 
ATOM   702  C CA  . THR A 1 101 ? 15.197  5.361   15.496  1.00 57.24  ? 979  THR A CA  1 
ATOM   703  C C   . THR A 1 101 ? 14.089  4.408   15.125  1.00 57.81  ? 979  THR A C   1 
ATOM   704  O O   . THR A 1 101 ? 14.230  3.579   14.213  1.00 58.49  ? 979  THR A O   1 
ATOM   705  C CB  . THR A 1 101 ? 15.877  4.965   16.819  1.00 60.67  ? 979  THR A CB  1 
ATOM   706  O OG1 . THR A 1 101 ? 17.179  5.556   16.869  1.00 59.90  ? 979  THR A OG1 1 
ATOM   707  C CG2 . THR A 1 101 ? 15.990  3.461   16.943  1.00 59.66  ? 979  THR A CG2 1 
ATOM   708  N N   . ASN A 1 102 ? 12.994  4.507   15.860  1.00 56.53  ? 980  ASN A N   1 
ATOM   709  C CA  . ASN A 1 102 ? 11.875  3.633   15.620  1.00 57.16  ? 980  ASN A CA  1 
ATOM   710  C C   . ASN A 1 102 ? 11.399  3.839   14.206  1.00 57.30  ? 980  ASN A C   1 
ATOM   711  O O   . ASN A 1 102 ? 11.119  2.883   13.505  1.00 57.43  ? 980  ASN A O   1 
ATOM   712  C CB  . ASN A 1 102 ? 10.744  3.911   16.608  1.00 63.67  ? 980  ASN A CB  1 
ATOM   713  C CG  . ASN A 1 102 ? 11.172  3.733   18.064  1.00 65.11  ? 980  ASN A CG  1 
ATOM   714  O OD1 . ASN A 1 102 ? 10.459  4.142   18.978  1.00 65.18  ? 980  ASN A OD1 1 
ATOM   715  N ND2 . ASN A 1 102 ? 12.339  3.131   18.278  1.00 67.66  ? 980  ASN A ND2 1 
ATOM   716  N N   . LEU A 1 103 ? 11.343  5.089   13.779  1.00 55.59  ? 981  LEU A N   1 
ATOM   717  C CA  . LEU A 1 103 ? 10.955  5.395   12.417  1.00 55.49  ? 981  LEU A CA  1 
ATOM   718  C C   . LEU A 1 103 ? 11.831  4.672   11.368  1.00 56.28  ? 981  LEU A C   1 
ATOM   719  O O   . LEU A 1 103 ? 11.322  4.012   10.458  1.00 56.80  ? 981  LEU A O   1 
ATOM   720  C CB  . LEU A 1 103 ? 10.964  6.910   12.182  1.00 55.12  ? 981  LEU A CB  1 
ATOM   721  C CG  . LEU A 1 103 ? 10.346  7.344   10.849  1.00 54.30  ? 981  LEU A CG  1 
ATOM   722  C CD1 . LEU A 1 103 ? 8.996   6.653   10.660  1.00 54.00  ? 981  LEU A CD1 1 
ATOM   723  C CD2 . LEU A 1 103 ? 10.216  8.862   10.715  1.00 52.17  ? 981  LEU A CD2 1 
ATOM   724  N N   . LEU A 1 104 ? 13.142  4.801   11.471  1.00 57.73  ? 982  LEU A N   1 
ATOM   725  C CA  . LEU A 1 104 ? 13.983  4.169   10.480  1.00 58.53  ? 982  LEU A CA  1 
ATOM   726  C C   . LEU A 1 104 ? 13.819  2.673   10.508  1.00 59.58  ? 982  LEU A C   1 
ATOM   727  O O   . LEU A 1 104 ? 13.748  2.032   9.464   1.00 60.34  ? 982  LEU A O   1 
ATOM   728  C CB  . LEU A 1 104 ? 15.430  4.574   10.660  1.00 57.94  ? 982  LEU A CB  1 
ATOM   729  C CG  . LEU A 1 104 ? 15.532  6.047   10.275  1.00 57.47  ? 982  LEU A CG  1 
ATOM   730  C CD1 . LEU A 1 104 ? 16.889  6.630   10.611  1.00 55.31  ? 982  LEU A CD1 1 
ATOM   731  C CD2 . LEU A 1 104 ? 15.149  6.253   8.822   1.00 56.31  ? 982  LEU A CD2 1 
ATOM   732  N N   . GLN A 1 105 ? 13.705  2.126   11.713  1.00 64.27  ? 983  GLN A N   1 
ATOM   733  C CA  . GLN A 1 105 ? 13.546  0.694   11.901  1.00 65.17  ? 983  GLN A CA  1 
ATOM   734  C C   . GLN A 1 105 ? 12.400  0.120   11.101  1.00 64.90  ? 983  GLN A C   1 
ATOM   735  O O   . GLN A 1 105 ? 12.591  -0.769  10.279  1.00 64.86  ? 983  GLN A O   1 
ATOM   736  C CB  . GLN A 1 105 ? 13.353  0.392   13.380  1.00 68.85  ? 983  GLN A CB  1 
ATOM   737  C CG  . GLN A 1 105 ? 12.958  -1.040  13.651  1.00 71.22  ? 983  GLN A CG  1 
ATOM   738  C CD  . GLN A 1 105 ? 11.956  -1.146  14.782  1.00 73.87  ? 983  GLN A CD  1 
ATOM   739  O OE1 . GLN A 1 105 ? 11.797  -2.206  15.388  1.00 75.33  ? 983  GLN A OE1 1 
ATOM   740  N NE2 . GLN A 1 105 ? 11.275  -0.039  15.076  1.00 73.52  ? 983  GLN A NE2 1 
ATOM   741  N N   . VAL A 1 106 ? 11.207  0.646   11.341  1.00 64.30  ? 984  VAL A N   1 
ATOM   742  C CA  . VAL A 1 106 ? 9.976   0.171   10.693  1.00 64.78  ? 984  VAL A CA  1 
ATOM   743  C C   . VAL A 1 106 ? 9.869   0.420   9.183   1.00 65.27  ? 984  VAL A C   1 
ATOM   744  O O   . VAL A 1 106 ? 9.180   -0.314  8.476   1.00 65.33  ? 984  VAL A O   1 
ATOM   745  C CB  . VAL A 1 106 ? 8.704   0.711   11.413  1.00 69.00  ? 984  VAL A CB  1 
ATOM   746  C CG1 . VAL A 1 106 ? 8.552   0.115   12.808  1.00 68.10  ? 984  VAL A CG1 1 
ATOM   747  C CG2 . VAL A 1 106 ? 8.729   2.232   11.465  1.00 68.15  ? 984  VAL A CG2 1 
ATOM   748  N N   . CYS A 1 107 ? 10.489  1.489   8.701   1.00 64.46  ? 985  CYS A N   1 
ATOM   749  C CA  . CYS A 1 107 ? 10.409  1.807   7.286   1.00 65.10  ? 985  CYS A CA  1 
ATOM   750  C C   . CYS A 1 107 ? 11.526  1.184   6.461   1.00 65.33  ? 985  CYS A C   1 
ATOM   751  O O   . CYS A 1 107 ? 11.587  1.367   5.250   1.00 66.05  ? 985  CYS A O   1 
ATOM   752  C CB  . CYS A 1 107 ? 10.345  3.317   7.065   1.00 64.05  ? 985  CYS A CB  1 
ATOM   753  S SG  . CYS A 1 107 ? 11.913  4.147   7.295   1.00 66.16  ? 985  CYS A SG  1 
ATOM   754  N N   . GLU A 1 108 ? 12.404  0.430   7.100   1.00 67.87  ? 986  GLU A N   1 
ATOM   755  C CA  . GLU A 1 108 ? 13.489  -0.184  6.351   1.00 67.84  ? 986  GLU A CA  1 
ATOM   756  C C   . GLU A 1 108 ? 12.938  -1.403  5.656   1.00 66.93  ? 986  GLU A C   1 
ATOM   757  O O   . GLU A 1 108 ? 13.243  -1.659  4.494   1.00 67.43  ? 986  GLU A O   1 
ATOM   758  C CB  . GLU A 1 108 ? 14.658  -0.599  7.272   1.00 71.90  ? 986  GLU A CB  1 
ATOM   759  C CG  . GLU A 1 108 ? 15.475  0.547   7.904   1.00 73.52  ? 986  GLU A CG  1 
ATOM   760  C CD  . GLU A 1 108 ? 15.796  1.701   6.937   1.00 77.06  ? 986  GLU A CD  1 
ATOM   761  O OE1 . GLU A 1 108 ? 16.357  2.734   7.406   1.00 77.64  ? 986  GLU A OE1 1 
ATOM   762  O OE2 . GLU A 1 108 ? 15.500  1.569   5.715   1.00 76.89  ? 986  GLU A OE2 1 
ATOM   763  N N   . ARG A 1 109 ? 12.145  -2.164  6.397   1.00 61.74  ? 987  ARG A N   1 
ATOM   764  C CA  . ARG A 1 109 ? 11.574  -3.402  5.894   1.00 60.79  ? 987  ARG A CA  1 
ATOM   765  C C   . ARG A 1 109 ? 10.638  -3.203  4.708   1.00 58.92  ? 987  ARG A C   1 
ATOM   766  O O   . ARG A 1 109 ? 10.482  -4.095  3.883   1.00 59.08  ? 987  ARG A O   1 
ATOM   767  C CB  . ARG A 1 109 ? 10.854  -4.137  7.024   1.00 68.90  ? 987  ARG A CB  1 
ATOM   768  C CG  . ARG A 1 109 ? 11.206  -3.589  8.400   1.00 70.07  ? 987  ARG A CG  1 
ATOM   769  C CD  . ARG A 1 109 ? 10.896  -4.589  9.510   1.00 72.10  ? 987  ARG A CD  1 
ATOM   770  N NE  . ARG A 1 109 ? 10.338  -3.924  10.685  1.00 74.76  ? 987  ARG A NE  1 
ATOM   771  C CZ  . ARG A 1 109 ? 9.043   -3.667  10.844  1.00 75.87  ? 987  ARG A CZ  1 
ATOM   772  N NH1 . ARG A 1 109 ? 8.183   -4.041  9.897   1.00 76.96  ? 987  ARG A NH1 1 
ATOM   773  N NH2 . ARG A 1 109 ? 8.610   -3.041  11.942  1.00 75.27  ? 987  ARG A NH2 1 
ATOM   774  N N   . ILE A 1 110 ? 10.008  -2.040  4.633   1.00 50.65  ? 988  ILE A N   1 
ATOM   775  C CA  . ILE A 1 110 ? 9.027   -1.768  3.593   1.00 49.33  ? 988  ILE A CA  1 
ATOM   776  C C   . ILE A 1 110 ? 9.401   -2.218  2.195   1.00 48.86  ? 988  ILE A C   1 
ATOM   777  O O   . ILE A 1 110 ? 8.674   -2.967  1.565   1.00 48.97  ? 988  ILE A O   1 
ATOM   778  C CB  . ILE A 1 110 ? 8.558   -0.326  3.631   1.00 52.15  ? 988  ILE A CB  1 
ATOM   779  C CG1 . ILE A 1 110 ? 7.874   -0.039  4.971   1.00 51.65  ? 988  ILE A CG1 1 
ATOM   780  C CG2 . ILE A 1 110 ? 7.676   -0.011  2.418   1.00 51.35  ? 988  ILE A CG2 1 
ATOM   781  C CD1 . ILE A 1 110 ? 6.929   1.109   4.911   1.00 50.30  ? 988  ILE A CD1 1 
ATOM   782  N N   . PRO A 1 111 ? 10.557  -1.767  1.694   1.00 46.93  ? 989  PRO A N   1 
ATOM   783  C CA  . PRO A 1 111 ? 11.117  -2.066  0.374   1.00 46.03  ? 989  PRO A CA  1 
ATOM   784  C C   . PRO A 1 111 ? 11.258  -3.560  0.201   1.00 45.32  ? 989  PRO A C   1 
ATOM   785  O O   . PRO A 1 111 ? 10.956  -4.117  -0.846  1.00 45.33  ? 989  PRO A O   1 
ATOM   786  C CB  . PRO A 1 111 ? 12.505  -1.437  0.452   1.00 47.65  ? 989  PRO A CB  1 
ATOM   787  C CG  . PRO A 1 111 ? 12.384  -0.365  1.516   1.00 48.05  ? 989  PRO A CG  1 
ATOM   788  C CD  . PRO A 1 111 ? 11.486  -0.970  2.518   1.00 48.66  ? 989  PRO A CD  1 
ATOM   789  N N   . THR A 1 112 ? 11.746  -4.208  1.245   1.00 44.26  ? 990  THR A N   1 
ATOM   790  C CA  . THR A 1 112 ? 11.962  -5.653  1.218   1.00 42.86  ? 990  THR A CA  1 
ATOM   791  C C   . THR A 1 112 ? 10.646  -6.385  1.049   1.00 41.68  ? 990  THR A C   1 
ATOM   792  O O   . THR A 1 112 ? 10.488  -7.209  0.151   1.00 41.54  ? 990  THR A O   1 
ATOM   793  C CB  . THR A 1 112 ? 12.651  -6.114  2.510   1.00 51.76  ? 990  THR A CB  1 
ATOM   794  O OG1 . THR A 1 112 ? 13.772  -5.267  2.795   1.00 53.04  ? 990  THR A OG1 1 
ATOM   795  C CG2 . THR A 1 112 ? 13.100  -7.535  2.374   1.00 51.81  ? 990  THR A CG2 1 
ATOM   796  N N   . ILE A 1 113 ? 9.715   -6.079  1.948   1.00 37.79  ? 991  ILE A N   1 
ATOM   797  C CA  . ILE A 1 113 ? 8.411   -6.678  1.924   1.00 36.75  ? 991  ILE A CA  1 
ATOM   798  C C   . ILE A 1 113 ? 7.791   -6.421  0.576   1.00 36.95  ? 991  ILE A C   1 
ATOM   799  O O   . ILE A 1 113 ? 7.240   -7.324  -0.029  1.00 37.20  ? 991  ILE A O   1 
ATOM   800  C CB  . ILE A 1 113 ? 7.525   -6.190  3.093   1.00 36.16  ? 991  ILE A CB  1 
ATOM   801  C CG1 . ILE A 1 113 ? 8.224   -6.494  4.412   1.00 35.13  ? 991  ILE A CG1 1 
ATOM   802  C CG2 . ILE A 1 113 ? 6.181   -6.897  3.058   1.00 33.19  ? 991  ILE A CG2 1 
ATOM   803  C CD1 . ILE A 1 113 ? 8.125   -5.412  5.425   1.00 35.48  ? 991  ILE A CD1 1 
ATOM   804  N N   . SER A 1 114 ? 7.876   -5.196  0.085   1.00 39.26  ? 992  SER A N   1 
ATOM   805  C CA  . SER A 1 114 ? 7.275   -4.881  -1.213  1.00 40.07  ? 992  SER A CA  1 
ATOM   806  C C   . SER A 1 114 ? 7.916   -5.661  -2.378  1.00 40.38  ? 992  SER A C   1 
ATOM   807  O O   . SER A 1 114 ? 7.249   -5.964  -3.376  1.00 40.81  ? 992  SER A O   1 
ATOM   808  C CB  . SER A 1 114 ? 7.220   -3.363  -1.473  1.00 44.06  ? 992  SER A CB  1 
ATOM   809  O OG  . SER A 1 114 ? 8.504   -2.778  -1.626  1.00 45.58  ? 992  SER A OG  1 
ATOM   810  N N   . THR A 1 115 ? 9.189   -6.036  -2.219  1.00 41.05  ? 993  THR A N   1 
ATOM   811  C CA  . THR A 1 115 ? 9.892   -6.804  -3.233  1.00 41.12  ? 993  THR A CA  1 
ATOM   812  C C   . THR A 1 115 ? 9.470   -8.263  -3.188  1.00 41.23  ? 993  THR A C   1 
ATOM   813  O O   . THR A 1 115 ? 9.225   -8.869  -4.230  1.00 41.83  ? 993  THR A O   1 
ATOM   814  C CB  . THR A 1 115 ? 11.405  -6.614  -3.149  1.00 38.70  ? 993  THR A CB  1 
ATOM   815  O OG1 . THR A 1 115 ? 11.742  -5.345  -3.727  1.00 39.91  ? 993  THR A OG1 1 
ATOM   816  C CG2 . THR A 1 115 ? 12.110  -7.680  -3.946  1.00 37.65  ? 993  THR A CG2 1 
ATOM   817  N N   . GLN A 1 116 ? 9.342   -8.820  -1.986  1.00 41.14  ? 994  GLN A N   1 
ATOM   818  C CA  . GLN A 1 116 ? 8.831   -10.171 -1.823  1.00 41.35  ? 994  GLN A CA  1 
ATOM   819  C C   . GLN A 1 116 ? 7.462   -10.242 -2.489  1.00 40.98  ? 994  GLN A C   1 
ATOM   820  O O   . GLN A 1 116 ? 7.069   -11.246 -3.118  1.00 40.46  ? 994  GLN A O   1 
ATOM   821  C CB  . GLN A 1 116 ? 8.628   -10.429 -0.354  1.00 43.98  ? 994  GLN A CB  1 
ATOM   822  C CG  . GLN A 1 116 ? 9.895   -10.322 0.431   1.00 48.78  ? 994  GLN A CG  1 
ATOM   823  C CD  . GLN A 1 116 ? 9.820   -11.078 1.758   1.00 53.11  ? 994  GLN A CD  1 
ATOM   824  O OE1 . GLN A 1 116 ? 8.767   -11.668 2.107   1.00 56.49  ? 994  GLN A OE1 1 
ATOM   825  N NE2 . GLN A 1 116 ? 10.908  -11.022 2.531   1.00 49.60  ? 994  GLN A NE2 1 
ATOM   826  N N   . LEU A 1 117 ? 6.727   -9.154  -2.333  1.00 38.32  ? 995  LEU A N   1 
ATOM   827  C CA  . LEU A 1 117 ? 5.419   -9.084  -2.897  1.00 38.78  ? 995  LEU A CA  1 
ATOM   828  C C   . LEU A 1 117 ? 5.361   -9.164  -4.431  1.00 38.69  ? 995  LEU A C   1 
ATOM   829  O O   . LEU A 1 117 ? 4.426   -9.753  -4.984  1.00 38.19  ? 995  LEU A O   1 
ATOM   830  C CB  . LEU A 1 117 ? 4.701   -7.858  -2.388  1.00 39.12  ? 995  LEU A CB  1 
ATOM   831  C CG  . LEU A 1 117 ? 3.177   -7.926  -2.599  1.00 39.30  ? 995  LEU A CG  1 
ATOM   832  C CD1 . LEU A 1 117 ? 2.537   -8.805  -1.499  1.00 39.93  ? 995  LEU A CD1 1 
ATOM   833  C CD2 . LEU A 1 117 ? 2.576   -6.521  -2.598  1.00 35.97  ? 995  LEU A CD2 1 
ATOM   834  N N   . LYS A 1 118 ? 6.349   -8.576  -5.111  1.00 35.88  ? 996  LYS A N   1 
ATOM   835  C CA  . LYS A 1 118 ? 6.415   -8.594  -6.578  1.00 35.48  ? 996  LYS A CA  1 
ATOM   836  C C   . LYS A 1 118 ? 6.779   -9.988  -7.035  1.00 35.17  ? 996  LYS A C   1 
ATOM   837  O O   . LYS A 1 118 ? 6.274   -10.499 -8.048  1.00 34.94  ? 996  LYS A O   1 
ATOM   838  C CB  . LYS A 1 118 ? 7.506   -7.652  -7.071  1.00 41.15  ? 996  LYS A CB  1 
ATOM   839  C CG  . LYS A 1 118 ? 7.293   -6.186  -6.732  1.00 42.11  ? 996  LYS A CG  1 
ATOM   840  C CD  . LYS A 1 118 ? 8.038   -5.296  -7.700  1.00 44.19  ? 996  LYS A CD  1 
ATOM   841  C CE  . LYS A 1 118 ? 9.532   -5.333  -7.424  1.00 46.06  ? 996  LYS A CE  1 
ATOM   842  N NZ  . LYS A 1 118 ? 9.869   -4.554  -6.177  1.00 46.72  ? 996  LYS A NZ  1 
ATOM   843  N N   . ILE A 1 119 ? 7.658   -10.611 -6.268  1.00 32.95  ? 997  ILE A N   1 
ATOM   844  C CA  . ILE A 1 119 ? 8.121   -11.956 -6.569  1.00 33.43  ? 997  ILE A CA  1 
ATOM   845  C C   . ILE A 1 119 ? 7.015   -12.993 -6.376  1.00 33.89  ? 997  ILE A C   1 
ATOM   846  O O   . ILE A 1 119 ? 6.793   -13.853 -7.230  1.00 33.52  ? 997  ILE A O   1 
ATOM   847  C CB  . ILE A 1 119 ? 9.336   -12.267 -5.696  1.00 36.26  ? 997  ILE A CB  1 
ATOM   848  C CG1 . ILE A 1 119 ? 10.522  -11.402 -6.136  1.00 36.48  ? 997  ILE A CG1 1 
ATOM   849  C CG2 . ILE A 1 119 ? 9.662   -13.743 -5.722  1.00 35.84  ? 997  ILE A CG2 1 
ATOM   850  C CD1 . ILE A 1 119 ? 11.821  -11.724 -5.428  1.00 38.15  ? 997  ILE A CD1 1 
ATOM   851  N N   . LEU A 1 120 ? 6.330   -12.895 -5.233  1.00 37.60  ? 998  LEU A N   1 
ATOM   852  C CA  . LEU A 1 120 ? 5.271   -13.829 -4.898  1.00 37.84  ? 998  LEU A CA  1 
ATOM   853  C C   . LEU A 1 120 ? 4.148   -13.690 -5.875  1.00 38.14  ? 998  LEU A C   1 
ATOM   854  O O   . LEU A 1 120 ? 3.440   -14.662 -6.166  1.00 37.82  ? 998  LEU A O   1 
ATOM   855  C CB  . LEU A 1 120 ? 4.740   -13.573 -3.485  1.00 37.38  ? 998  LEU A CB  1 
ATOM   856  C CG  . LEU A 1 120 ? 5.696   -13.943 -2.338  1.00 37.22  ? 998  LEU A CG  1 
ATOM   857  C CD1 . LEU A 1 120 ? 5.163   -13.391 -1.005  1.00 35.30  ? 998  LEU A CD1 1 
ATOM   858  C CD2 . LEU A 1 120 ? 5.863   -15.476 -2.265  1.00 37.21  ? 998  LEU A CD2 1 
ATOM   859  N N   . SER A 1 121 ? 3.941   -12.468 -6.357  1.00 39.84  ? 999  SER A N   1 
ATOM   860  C CA  . SER A 1 121 ? 2.815   -12.241 -7.250  1.00 40.87  ? 999  SER A CA  1 
ATOM   861  C C   . SER A 1 121 ? 3.120   -12.778 -8.600  1.00 41.25  ? 999  SER A C   1 
ATOM   862  O O   . SER A 1 121 ? 2.228   -13.189 -9.332  1.00 42.02  ? 999  SER A O   1 
ATOM   863  C CB  . SER A 1 121 ? 2.445   -10.782 -7.345  1.00 42.60  ? 999  SER A CB  1 
ATOM   864  O OG  . SER A 1 121 ? 3.586   -10.043 -7.646  1.00 43.94  ? 999  SER A OG  1 
ATOM   865  N N   . THR A 1 122 ? 4.397   -12.821 -8.931  1.00 44.94  ? 1000 THR A N   1 
ATOM   866  C CA  . THR A 1 122 ? 4.758   -13.393 -10.220 1.00 45.67  ? 1000 THR A CA  1 
ATOM   867  C C   . THR A 1 122 ? 4.455   -14.897 -10.305 1.00 45.92  ? 1000 THR A C   1 
ATOM   868  O O   . THR A 1 122 ? 3.756   -15.344 -11.238 1.00 46.20  ? 1000 THR A O   1 
ATOM   869  C CB  . THR A 1 122 ? 6.148   -13.022 -10.631 1.00 48.62  ? 1000 THR A CB  1 
ATOM   870  O OG1 . THR A 1 122 ? 6.182   -11.596 -10.788 1.00 48.21  ? 1000 THR A OG1 1 
ATOM   871  C CG2 . THR A 1 122 ? 6.461   -13.684 -11.945 1.00 49.41  ? 1000 THR A CG2 1 
ATOM   872  N N   . VAL A 1 123 ? 4.901   -15.646 -9.295  1.00 43.63  ? 1001 VAL A N   1 
ATOM   873  C CA  . VAL A 1 123 ? 4.613   -17.071 -9.196  1.00 43.44  ? 1001 VAL A CA  1 
ATOM   874  C C   . VAL A 1 123 ? 3.118   -17.280 -9.281  1.00 43.96  ? 1001 VAL A C   1 
ATOM   875  O O   . VAL A 1 123 ? 2.646   -18.219 -9.907  1.00 43.79  ? 1001 VAL A O   1 
ATOM   876  C CB  . VAL A 1 123 ? 5.094   -17.674 -7.840  1.00 47.18  ? 1001 VAL A CB  1 
ATOM   877  C CG1 . VAL A 1 123 ? 5.950   -16.704 -7.063  1.00 47.45  ? 1001 VAL A CG1 1 
ATOM   878  C CG2 . VAL A 1 123 ? 3.927   -18.116 -6.987  1.00 45.24  ? 1001 VAL A CG2 1 
ATOM   879  N N   . LYS A 1 124 ? 2.376   -16.444 -8.575  1.00 45.07  ? 1002 LYS A N   1 
ATOM   880  C CA  . LYS A 1 124 ? 0.939   -16.603 -8.522  1.00 46.15  ? 1002 LYS A CA  1 
ATOM   881  C C   . LYS A 1 124 ? 0.318   -16.392 -9.876  1.00 47.96  ? 1002 LYS A C   1 
ATOM   882  O O   . LYS A 1 124 ? -0.626  -17.071 -10.241 1.00 47.85  ? 1002 LYS A O   1 
ATOM   883  C CB  . LYS A 1 124 ? 0.322   -15.653 -7.498  1.00 51.46  ? 1002 LYS A CB  1 
ATOM   884  C CG  . LYS A 1 124 ? -1.196  -15.805 -7.397  1.00 50.05  ? 1002 LYS A CG  1 
ATOM   885  C CD  . LYS A 1 124 ? -1.565  -16.822 -6.343  1.00 47.43  ? 1002 LYS A CD  1 
ATOM   886  C CE  . LYS A 1 124 ? -2.584  -17.843 -6.846  1.00 48.71  ? 1002 LYS A CE  1 
ATOM   887  N NZ  . LYS A 1 124 ? -2.161  -19.282 -6.564  1.00 47.95  ? 1002 LYS A NZ  1 
ATOM   888  N N   . ALA A 1 125 ? 0.871   -15.446 -10.622 1.00 50.93  ? 1003 ALA A N   1 
ATOM   889  C CA  . ALA A 1 125 ? 0.352   -15.094 -11.935 1.00 53.02  ? 1003 ALA A CA  1 
ATOM   890  C C   . ALA A 1 125 ? 0.483   -16.228 -12.926 1.00 54.62  ? 1003 ALA A C   1 
ATOM   891  O O   . ALA A 1 125 ? -0.444  -16.517 -13.682 1.00 54.75  ? 1003 ALA A O   1 
ATOM   892  C CB  . ALA A 1 125 ? 1.030   -13.829 -12.468 1.00 53.15  ? 1003 ALA A CB  1 
ATOM   893  N N   . THR A 1 126 ? 1.660   -16.841 -12.951 1.00 59.51  ? 1004 THR A N   1 
ATOM   894  C CA  . THR A 1 126 ? 1.933   -17.938 -13.880 1.00 61.74  ? 1004 THR A CA  1 
ATOM   895  C C   . THR A 1 126 ? 1.147   -19.176 -13.482 1.00 63.10  ? 1004 THR A C   1 
ATOM   896  O O   . THR A 1 126 ? 0.799   -20.006 -14.324 1.00 63.01  ? 1004 THR A O   1 
ATOM   897  C CB  . THR A 1 126 ? 3.419   -18.276 -13.922 1.00 64.52  ? 1004 THR A CB  1 
ATOM   898  O OG1 . THR A 1 126 ? 3.642   -19.440 -13.115 1.00 64.54  ? 1004 THR A OG1 1 
ATOM   899  C CG2 . THR A 1 126 ? 4.258   -17.093 -13.414 1.00 64.22  ? 1004 THR A CG2 1 
ATOM   900  N N   . MET A 1 127 ? 0.892   -19.303 -12.185 1.00 66.32  ? 1005 MET A N   1 
ATOM   901  C CA  . MET A 1 127 ? 0.140   -20.432 -11.673 1.00 68.50  ? 1005 MET A CA  1 
ATOM   902  C C   . MET A 1 127 ? -1.300  -20.320 -12.131 1.00 70.32  ? 1005 MET A C   1 
ATOM   903  O O   . MET A 1 127 ? -1.965  -21.321 -12.380 1.00 70.61  ? 1005 MET A O   1 
ATOM   904  C CB  . MET A 1 127 ? 0.210   -20.459 -10.157 1.00 70.91  ? 1005 MET A CB  1 
ATOM   905  C CG  . MET A 1 127 ? 1.145   -21.499 -9.675  1.00 70.66  ? 1005 MET A CG  1 
ATOM   906  S SD  . MET A 1 127 ? 0.950   -21.767 -7.947  1.00 72.39  ? 1005 MET A SD  1 
ATOM   907  C CE  . MET A 1 127 ? 2.706   -22.250 -7.499  1.00 71.21  ? 1005 MET A CE  1 
ATOM   908  N N   . LEU A 1 128 ? -1.772  -19.087 -12.259 1.00 75.07  ? 1006 LEU A N   1 
ATOM   909  C CA  . LEU A 1 128 ? -3.119  -18.852 -12.740 1.00 76.95  ? 1006 LEU A CA  1 
ATOM   910  C C   . LEU A 1 128 ? -3.296  -19.464 -14.127 1.00 78.50  ? 1006 LEU A C   1 
ATOM   911  O O   . LEU A 1 128 ? -2.488  -19.247 -15.045 1.00 78.43  ? 1006 LEU A O   1 
ATOM   912  C CB  . LEU A 1 128 ? -3.432  -17.360 -12.795 1.00 77.06  ? 1006 LEU A CB  1 
ATOM   913  C CG  . LEU A 1 128 ? -3.485  -16.620 -11.459 1.00 77.36  ? 1006 LEU A CG  1 
ATOM   914  C CD1 . LEU A 1 128 ? -4.491  -15.460 -11.482 1.00 76.63  ? 1006 LEU A CD1 1 
ATOM   915  C CD2 . LEU A 1 128 ? -3.735  -17.583 -10.291 1.00 76.28  ? 1006 LEU A CD2 1 
ATOM   916  N N   . GLY A 1 129 ? -4.367  -20.240 -14.261 1.00 84.15  ? 1007 GLY A N   1 
ATOM   917  C CA  . GLY A 1 129 ? -4.714  -20.903 -15.496 1.00 85.79  ? 1007 GLY A CA  1 
ATOM   918  C C   . GLY A 1 129 ? -4.331  -22.355 -15.419 1.00 87.03  ? 1007 GLY A C   1 
ATOM   919  O O   . GLY A 1 129 ? -5.090  -23.235 -15.848 1.00 87.18  ? 1007 GLY A O   1 
ATOM   920  N N   . ARG A 1 130 ? -3.144  -22.600 -14.871 1.00 89.38  ? 1008 ARG A N   1 
ATOM   921  C CA  . ARG A 1 130 ? -2.618  -23.952 -14.752 1.00 90.02  ? 1008 ARG A CA  1 
ATOM   922  C C   . ARG A 1 130 ? -3.599  -24.970 -14.146 1.00 89.96  ? 1008 ARG A C   1 
ATOM   923  O O   . ARG A 1 130 ? -4.409  -24.639 -13.265 1.00 89.49  ? 1008 ARG A O   1 
ATOM   924  C CB  . ARG A 1 130 ? -1.277  -23.955 -14.025 1.00 92.40  ? 1008 ARG A CB  1 
ATOM   925  C CG  . ARG A 1 130 ? -0.130  -24.281 -14.931 1.00 94.19  ? 1008 ARG A CG  1 
ATOM   926  C CD  . ARG A 1 130 ? -0.084  -23.336 -16.112 1.00 97.30  ? 1008 ARG A CD  1 
ATOM   927  N NE  . ARG A 1 130 ? 1.165   -22.576 -16.164 1.00 99.75  ? 1008 ARG A NE  1 
ATOM   928  C CZ  . ARG A 1 130 ? 2.374   -23.065 -15.875 1.00 101.26 ? 1008 ARG A CZ  1 
ATOM   929  N NH1 . ARG A 1 130 ? 2.537   -24.333 -15.507 1.00 100.90 ? 1008 ARG A NH1 1 
ATOM   930  N NH2 . ARG A 1 130 ? 3.436   -22.275 -15.956 1.00 102.70 ? 1008 ARG A NH2 1 
ATOM   931  N N   . THR A 1 131 ? -3.531  -26.198 -14.666 1.00 88.92  ? 1009 THR A N   1 
ATOM   932  C CA  . THR A 1 131 ? -4.395  -27.301 -14.242 1.00 88.60  ? 1009 THR A CA  1 
ATOM   933  C C   . THR A 1 131 ? -3.511  -28.411 -13.673 1.00 88.63  ? 1009 THR A C   1 
ATOM   934  O O   . THR A 1 131 ? -3.924  -29.202 -12.816 1.00 88.21  ? 1009 THR A O   1 
ATOM   935  C CB  . THR A 1 131 ? -5.227  -27.807 -15.441 1.00 94.22  ? 1009 THR A CB  1 
ATOM   936  O OG1 . THR A 1 131 ? -4.359  -28.083 -16.555 1.00 92.97  ? 1009 THR A OG1 1 
ATOM   937  C CG2 . THR A 1 131 ? -6.247  -26.749 -15.845 1.00 93.78  ? 1009 THR A CG2 1 
ATOM   938  N N   . ASN A 1 132 ? -2.277  -28.430 -14.161 1.00 85.68  ? 1010 ASN A N   1 
ATOM   939  C CA  . ASN A 1 132 ? -1.287  -29.407 -13.763 1.00 85.94  ? 1010 ASN A CA  1 
ATOM   940  C C   . ASN A 1 132 ? -0.753  -29.119 -12.362 1.00 85.90  ? 1010 ASN A C   1 
ATOM   941  O O   . ASN A 1 132 ? -0.463  -30.038 -11.608 1.00 86.19  ? 1010 ASN A O   1 
ATOM   942  C CB  . ASN A 1 132 ? -0.150  -29.431 -14.794 1.00 90.08  ? 1010 ASN A CB  1 
ATOM   943  C CG  . ASN A 1 132 ? 0.081   -28.068 -15.446 1.00 90.44  ? 1010 ASN A CG  1 
ATOM   944  O OD1 . ASN A 1 132 ? 0.896   -27.269 -14.967 1.00 90.50  ? 1010 ASN A OD1 1 
ATOM   945  N ND2 . ASN A 1 132 ? -0.640  -27.792 -16.533 1.00 90.56  ? 1010 ASN A ND2 1 
ATOM   946  N N   . ILE A 1 133 ? -0.629  -27.844 -12.006 1.00 84.37  ? 1011 ILE A N   1 
ATOM   947  C CA  . ILE A 1 133 ? -0.133  -27.496 -10.677 1.00 84.04  ? 1011 ILE A CA  1 
ATOM   948  C C   . ILE A 1 133 ? -0.991  -28.128 -9.576  1.00 83.57  ? 1011 ILE A C   1 
ATOM   949  O O   . ILE A 1 133 ? -2.218  -28.222 -9.684  1.00 83.47  ? 1011 ILE A O   1 
ATOM   950  C CB  . ILE A 1 133 ? 0.125   -25.966 -10.484 1.00 86.46  ? 1011 ILE A CB  1 
ATOM   951  C CG1 . ILE A 1 133 ? 1.472   -25.577 -11.105 1.00 86.82  ? 1011 ILE A CG1 1 
ATOM   952  C CG2 . ILE A 1 133 ? 0.164   -25.609 -8.990  1.00 86.48  ? 1011 ILE A CG2 1 
ATOM   953  C CD1 . ILE A 1 133 ? 1.379   -24.851 -12.447 1.00 86.98  ? 1011 ILE A CD1 1 
ATOM   954  N N   . SER A 1 134 ? -0.311  -28.575 -8.524  1.00 82.94  ? 1012 SER A N   1 
ATOM   955  C CA  . SER A 1 134 ? -0.942  -29.252 -7.400  1.00 82.30  ? 1012 SER A CA  1 
ATOM   956  C C   . SER A 1 134 ? -1.876  -28.374 -6.589  1.00 81.45  ? 1012 SER A C   1 
ATOM   957  O O   . SER A 1 134 ? -1.756  -27.145 -6.592  1.00 81.07  ? 1012 SER A O   1 
ATOM   958  C CB  . SER A 1 134 ? 0.130   -29.849 -6.480  1.00 84.84  ? 1012 SER A CB  1 
ATOM   959  O OG  . SER A 1 134 ? -0.097  -29.500 -5.120  1.00 85.00  ? 1012 SER A OG  1 
ATOM   960  N N   . ASP A 1 135 ? -2.779  -29.028 -5.864  1.00 80.20  ? 1013 ASP A N   1 
ATOM   961  C CA  . ASP A 1 135 ? -3.705  -28.336 -4.982  1.00 79.81  ? 1013 ASP A CA  1 
ATOM   962  C C   . ASP A 1 135 ? -2.905  -27.617 -3.889  1.00 79.15  ? 1013 ASP A C   1 
ATOM   963  O O   . ASP A 1 135 ? -3.004  -26.396 -3.696  1.00 78.91  ? 1013 ASP A O   1 
ATOM   964  C CB  . ASP A 1 135 ? -4.617  -29.357 -4.302  1.00 83.00  ? 1013 ASP A CB  1 
ATOM   965  C CG  . ASP A 1 135 ? -5.634  -29.954 -5.244  1.00 83.12  ? 1013 ASP A CG  1 
ATOM   966  O OD1 . ASP A 1 135 ? -5.728  -31.199 -5.277  1.00 82.54  ? 1013 ASP A OD1 1 
ATOM   967  O OD2 . ASP A 1 135 ? -6.354  -29.175 -5.914  1.00 81.28  ? 1013 ASP A OD2 1 
ATOM   968  N N   . GLU A 1 136 ? -2.108  -28.395 -3.169  1.00 77.17  ? 1014 GLU A N   1 
ATOM   969  C CA  . GLU A 1 136 ? -1.303  -27.841 -2.102  1.00 76.47  ? 1014 GLU A CA  1 
ATOM   970  C C   . GLU A 1 136 ? -0.421  -26.701 -2.571  1.00 75.87  ? 1014 GLU A C   1 
ATOM   971  O O   . GLU A 1 136 ? -0.288  -25.706 -1.871  1.00 76.16  ? 1014 GLU A O   1 
ATOM   972  C CB  . GLU A 1 136 ? -0.488  -28.923 -1.405  1.00 78.88  ? 1014 GLU A CB  1 
ATOM   973  C CG  . GLU A 1 136 ? -1.179  -29.523 -0.179  1.00 79.42  ? 1014 GLU A CG  1 
ATOM   974  C CD  . GLU A 1 136 ? -2.681  -29.191 -0.097  1.00 81.71  ? 1014 GLU A CD  1 
ATOM   975  O OE1 . GLU A 1 136 ? -3.028  -27.986 0.038   1.00 81.40  ? 1014 GLU A OE1 1 
ATOM   976  O OE2 . GLU A 1 136 ? -3.507  -30.146 -0.115  1.00 82.83  ? 1014 GLU A OE2 1 
ATOM   977  N N   . GLU A 1 137 ? 0.166   -26.826 -3.755  1.00 70.89  ? 1015 GLU A N   1 
ATOM   978  C CA  . GLU A 1 137 ? 1.026   -25.769 -4.282  1.00 69.71  ? 1015 GLU A CA  1 
ATOM   979  C C   . GLU A 1 137 ? 0.276   -24.448 -4.478  1.00 68.19  ? 1015 GLU A C   1 
ATOM   980  O O   . GLU A 1 137 ? 0.751   -23.396 -4.070  1.00 68.16  ? 1015 GLU A O   1 
ATOM   981  C CB  . GLU A 1 137 ? 1.671   -26.195 -5.605  1.00 71.66  ? 1015 GLU A CB  1 
ATOM   982  C CG  . GLU A 1 137 ? 3.203   -26.240 -5.596  1.00 73.83  ? 1015 GLU A CG  1 
ATOM   983  C CD  . GLU A 1 137 ? 3.813   -26.289 -7.003  1.00 78.25  ? 1015 GLU A CD  1 
ATOM   984  O OE1 . GLU A 1 137 ? 3.108   -26.716 -7.955  1.00 79.22  ? 1015 GLU A OE1 1 
ATOM   985  O OE2 . GLU A 1 137 ? 4.997   -25.894 -7.155  1.00 79.09  ? 1015 GLU A OE2 1 
ATOM   986  N N   . SER A 1 138 ? -0.895  -24.496 -5.099  1.00 64.98  ? 1016 SER A N   1 
ATOM   987  C CA  . SER A 1 138 ? -1.626  -23.273 -5.368  1.00 63.25  ? 1016 SER A CA  1 
ATOM   988  C C   . SER A 1 138 ? -2.185  -22.568 -4.146  1.00 62.09  ? 1016 SER A C   1 
ATOM   989  O O   . SER A 1 138 ? -2.146  -21.338 -4.082  1.00 62.01  ? 1016 SER A O   1 
ATOM   990  C CB  . SER A 1 138 ? -2.699  -23.493 -6.407  1.00 65.13  ? 1016 SER A CB  1 
ATOM   991  O OG  . SER A 1 138 ? -2.938  -24.872 -6.520  1.00 65.18  ? 1016 SER A OG  1 
ATOM   992  N N   . GLU A 1 139 ? -2.712  -23.305 -3.173  1.00 60.34  ? 1017 GLU A N   1 
ATOM   993  C CA  . GLU A 1 139 ? -3.228  -22.609 -2.001  1.00 59.29  ? 1017 GLU A CA  1 
ATOM   994  C C   . GLU A 1 139 ? -2.098  -22.066 -1.140  1.00 57.80  ? 1017 GLU A C   1 
ATOM   995  O O   . GLU A 1 139 ? -2.262  -21.115 -0.392  1.00 57.73  ? 1017 GLU A O   1 
ATOM   996  C CB  . GLU A 1 139 ? -4.208  -23.447 -1.188  1.00 61.71  ? 1017 GLU A CB  1 
ATOM   997  C CG  . GLU A 1 139 ? -4.854  -22.683 0.025   1.00 64.90  ? 1017 GLU A CG  1 
ATOM   998  C CD  . GLU A 1 139 ? -5.610  -21.318 -0.299  1.00 68.70  ? 1017 GLU A CD  1 
ATOM   999  O OE1 . GLU A 1 139 ? -5.664  -20.451 0.614   1.00 69.06  ? 1017 GLU A OE1 1 
ATOM   1000 O OE2 . GLU A 1 139 ? -6.241  -21.151 -1.384  1.00 68.59  ? 1017 GLU A OE2 1 
ATOM   1001 N N   . GLN A 1 140 ? -0.919  -22.627 -1.316  1.00 55.12  ? 1018 GLN A N   1 
ATOM   1002 C CA  . GLN A 1 140 ? 0.243   -22.151 -0.602  1.00 53.88  ? 1018 GLN A CA  1 
ATOM   1003 C C   . GLN A 1 140 ? 0.797   -20.887 -1.275  1.00 53.43  ? 1018 GLN A C   1 
ATOM   1004 O O   . GLN A 1 140 ? 1.335   -19.988 -0.607  1.00 53.42  ? 1018 GLN A O   1 
ATOM   1005 C CB  . GLN A 1 140 ? 1.301   -23.240 -0.543  1.00 54.03  ? 1018 GLN A CB  1 
ATOM   1006 C CG  . GLN A 1 140 ? 2.296   -23.012 0.542   1.00 52.60  ? 1018 GLN A CG  1 
ATOM   1007 C CD  . GLN A 1 140 ? 1.641   -22.824 1.889   1.00 50.57  ? 1018 GLN A CD  1 
ATOM   1008 O OE1 . GLN A 1 140 ? 2.199   -22.148 2.783   1.00 49.71  ? 1018 GLN A OE1 1 
ATOM   1009 N NE2 . GLN A 1 140 ? 0.479   -23.472 2.077   1.00 51.31  ? 1018 GLN A NE2 1 
ATOM   1010 N N   . ALA A 1 141 ? 0.680   -20.811 -2.595  1.00 52.63  ? 1019 ALA A N   1 
ATOM   1011 C CA  . ALA A 1 141 ? 1.214   -19.645 -3.272  1.00 51.92  ? 1019 ALA A CA  1 
ATOM   1012 C C   . ALA A 1 141 ? 0.407   -18.458 -2.748  1.00 51.43  ? 1019 ALA A C   1 
ATOM   1013 O O   . ALA A 1 141 ? 0.949   -17.439 -2.307  1.00 51.63  ? 1019 ALA A O   1 
ATOM   1014 C CB  . ALA A 1 141 ? 1.067   -19.793 -4.775  1.00 52.20  ? 1019 ALA A CB  1 
ATOM   1015 N N   . THR A 1 142 ? -0.903  -18.664 -2.717  1.00 50.17  ? 1020 THR A N   1 
ATOM   1016 C CA  . THR A 1 142 ? -1.861  -17.662 -2.293  1.00 49.16  ? 1020 THR A CA  1 
ATOM   1017 C C   . THR A 1 142 ? -1.741  -17.264 -0.837  1.00 49.05  ? 1020 THR A C   1 
ATOM   1018 O O   . THR A 1 142 ? -2.086  -16.153 -0.467  1.00 49.11  ? 1020 THR A O   1 
ATOM   1019 C CB  . THR A 1 142 ? -3.243  -18.177 -2.543  1.00 46.81  ? 1020 THR A CB  1 
ATOM   1020 O OG1 . THR A 1 142 ? -3.631  -17.884 -3.890  1.00 45.76  ? 1020 THR A OG1 1 
ATOM   1021 C CG2 . THR A 1 142 ? -4.192  -17.569 -1.564  1.00 46.57  ? 1020 THR A CG2 1 
ATOM   1022 N N   . GLU A 1 143 ? -1.304  -18.178 0.006   1.00 49.35  ? 1021 GLU A N   1 
ATOM   1023 C CA  . GLU A 1 143 ? -1.167  -17.855 1.400   1.00 49.01  ? 1021 GLU A CA  1 
ATOM   1024 C C   . GLU A 1 143 ? 0.102   -17.119 1.742   1.00 47.95  ? 1021 GLU A C   1 
ATOM   1025 O O   . GLU A 1 143 ? 0.157   -16.489 2.793   1.00 48.34  ? 1021 GLU A O   1 
ATOM   1026 C CB  . GLU A 1 143 ? -1.380  -19.067 2.288   1.00 51.74  ? 1021 GLU A CB  1 
ATOM   1027 C CG  . GLU A 1 143 ? -2.799  -19.614 2.134   1.00 55.40  ? 1021 GLU A CG  1 
ATOM   1028 C CD  . GLU A 1 143 ? -3.308  -20.411 3.347   1.00 61.35  ? 1021 GLU A CD  1 
ATOM   1029 O OE1 . GLU A 1 143 ? -3.732  -21.591 3.160   1.00 64.39  ? 1021 GLU A OE1 1 
ATOM   1030 O OE2 . GLU A 1 143 ? -3.364  -19.823 4.467   1.00 61.95  ? 1021 GLU A OE2 1 
ATOM   1031 N N   . MET A 1 144 ? 1.104   -17.151 0.859   1.00 45.61  ? 1022 MET A N   1 
ATOM   1032 C CA  . MET A 1 144 ? 2.357   -16.402 1.096   1.00 44.35  ? 1022 MET A CA  1 
ATOM   1033 C C   . MET A 1 144 ? 2.119   -14.980 0.665   1.00 42.71  ? 1022 MET A C   1 
ATOM   1034 O O   . MET A 1 144 ? 2.791   -14.053 1.093   1.00 42.96  ? 1022 MET A O   1 
ATOM   1035 C CB  . MET A 1 144 ? 3.521   -16.911 0.250   1.00 46.28  ? 1022 MET A CB  1 
ATOM   1036 C CG  . MET A 1 144 ? 3.522   -18.371 -0.065  1.00 49.22  ? 1022 MET A CG  1 
ATOM   1037 S SD  . MET A 1 144 ? 5.229   -18.947 -0.188  1.00 53.57  ? 1022 MET A SD  1 
ATOM   1038 C CE  . MET A 1 144 ? 5.098   -19.948 -1.708  1.00 52.44  ? 1022 MET A CE  1 
ATOM   1039 N N   . LEU A 1 145 ? 1.228   -14.849 -0.293  1.00 41.96  ? 1023 LEU A N   1 
ATOM   1040 C CA  . LEU A 1 145 ? 0.849   -13.570 -0.818  1.00 40.69  ? 1023 LEU A CA  1 
ATOM   1041 C C   . LEU A 1 145 ? 0.134   -12.860 0.332   1.00 40.52  ? 1023 LEU A C   1 
ATOM   1042 O O   . LEU A 1 145 ? 0.607   -11.830 0.823   1.00 39.48  ? 1023 LEU A O   1 
ATOM   1043 C CB  . LEU A 1 145 ? -0.103  -13.791 -1.990  1.00 40.34  ? 1023 LEU A CB  1 
ATOM   1044 C CG  . LEU A 1 145 ? -0.009  -12.812 -3.146  1.00 38.07  ? 1023 LEU A CG  1 
ATOM   1045 C CD1 . LEU A 1 145 ? 1.204   -11.877 -3.021  1.00 36.18  ? 1023 LEU A CD1 1 
ATOM   1046 C CD2 . LEU A 1 145 ? -0.010  -13.590 -4.467  1.00 37.53  ? 1023 LEU A CD2 1 
ATOM   1047 N N   . VAL A 1 146 ? -0.974  -13.447 0.788   1.00 40.19  ? 1024 VAL A N   1 
ATOM   1048 C CA  . VAL A 1 146 ? -1.734  -12.898 1.913   1.00 39.83  ? 1024 VAL A CA  1 
ATOM   1049 C C   . VAL A 1 146 ? -0.817  -12.577 3.089   1.00 40.34  ? 1024 VAL A C   1 
ATOM   1050 O O   . VAL A 1 146 ? -1.024  -11.620 3.810   1.00 40.33  ? 1024 VAL A O   1 
ATOM   1051 C CB  . VAL A 1 146 ? -2.832  -13.885 2.416   1.00 42.66  ? 1024 VAL A CB  1 
ATOM   1052 C CG1 . VAL A 1 146 ? -3.534  -13.319 3.629   1.00 41.33  ? 1024 VAL A CG1 1 
ATOM   1053 C CG2 . VAL A 1 146 ? -3.824  -14.216 1.334   1.00 41.24  ? 1024 VAL A CG2 1 
ATOM   1054 N N   . HIS A 1 147 ? 0.152   -13.432 3.346   1.00 43.73  ? 1025 HIS A N   1 
ATOM   1055 C CA  . HIS A 1 147 ? 1.013   -13.192 4.485   1.00 44.97  ? 1025 HIS A CA  1 
ATOM   1056 C C   . HIS A 1 147 ? 1.859   -11.938 4.282   1.00 45.61  ? 1025 HIS A C   1 
ATOM   1057 O O   . HIS A 1 147 ? 1.957   -11.092 5.168   1.00 45.92  ? 1025 HIS A O   1 
ATOM   1058 C CB  . HIS A 1 147 ? 1.891   -14.400 4.735   1.00 47.85  ? 1025 HIS A CB  1 
ATOM   1059 C CG  . HIS A 1 147 ? 2.823   -14.227 5.886   1.00 50.92  ? 1025 HIS A CG  1 
ATOM   1060 N ND1 . HIS A 1 147 ? 2.496   -14.611 7.170   1.00 53.07  ? 1025 HIS A ND1 1 
ATOM   1061 C CD2 . HIS A 1 147 ? 4.068   -13.690 5.957   1.00 53.24  ? 1025 HIS A CD2 1 
ATOM   1062 C CE1 . HIS A 1 147 ? 3.504   -14.326 7.979   1.00 54.98  ? 1025 HIS A CE1 1 
ATOM   1063 N NE2 . HIS A 1 147 ? 4.472   -13.775 7.267   1.00 55.12  ? 1025 HIS A NE2 1 
ATOM   1064 N N   . ASN A 1 148 ? 2.475   -11.841 3.105   1.00 44.48  ? 1026 ASN A N   1 
ATOM   1065 C CA  . ASN A 1 148 ? 3.299   -10.717 2.718   1.00 44.98  ? 1026 ASN A CA  1 
ATOM   1066 C C   . ASN A 1 148 ? 2.454   -9.444  2.707   1.00 44.76  ? 1026 ASN A C   1 
ATOM   1067 O O   . ASN A 1 148 ? 2.885   -8.405  3.198   1.00 45.15  ? 1026 ASN A O   1 
ATOM   1068 C CB  . ASN A 1 148 ? 3.833   -10.983 1.323   1.00 52.83  ? 1026 ASN A CB  1 
ATOM   1069 C CG  . ASN A 1 148 ? 5.241   -10.474 1.132   1.00 56.62  ? 1026 ASN A CG  1 
ATOM   1070 O OD1 . ASN A 1 148 ? 5.435   -9.276  0.898   1.00 60.20  ? 1026 ASN A OD1 1 
ATOM   1071 N ND2 . ASN A 1 148 ? 6.240   -11.384 1.192   1.00 56.13  ? 1026 ASN A ND2 1 
ATOM   1072 N N   . ALA A 1 149 ? 1.229   -9.534  2.179   1.00 41.61  ? 1027 ALA A N   1 
ATOM   1073 C CA  . ALA A 1 149 ? 0.308   -8.399  2.123   1.00 40.31  ? 1027 ALA A CA  1 
ATOM   1074 C C   . ALA A 1 149 ? -0.040  -7.950  3.524   1.00 39.73  ? 1027 ALA A C   1 
ATOM   1075 O O   . ALA A 1 149 ? 0.002   -6.793  3.846   1.00 39.96  ? 1027 ALA A O   1 
ATOM   1076 C CB  . ALA A 1 149 ? -0.931  -8.770  1.366   1.00 40.26  ? 1027 ALA A CB  1 
ATOM   1077 N N   . GLN A 1 150 ? -0.345  -8.879  4.391   1.00 40.50  ? 1028 GLN A N   1 
ATOM   1078 C CA  . GLN A 1 150 ? -0.639  -8.511  5.770   1.00 40.01  ? 1028 GLN A CA  1 
ATOM   1079 C C   . GLN A 1 150 ? 0.489   -7.694  6.405   1.00 39.58  ? 1028 GLN A C   1 
ATOM   1080 O O   . GLN A 1 150 ? 0.254   -6.665  7.049   1.00 39.47  ? 1028 GLN A O   1 
ATOM   1081 C CB  . GLN A 1 150 ? -0.879  -9.763  6.608   1.00 42.36  ? 1028 GLN A CB  1 
ATOM   1082 C CG  . GLN A 1 150 ? -2.215  -10.391 6.354   1.00 39.79  ? 1028 GLN A CG  1 
ATOM   1083 C CD  . GLN A 1 150 ? -2.248  -11.811 6.848   1.00 38.89  ? 1028 GLN A CD  1 
ATOM   1084 O OE1 . GLN A 1 150 ? -1.198  -12.447 6.997   1.00 38.41  ? 1028 GLN A OE1 1 
ATOM   1085 N NE2 . GLN A 1 150 ? -3.438  -12.296 7.188   1.00 37.53  ? 1028 GLN A NE2 1 
ATOM   1086 N N   . ASN A 1 151 ? 1.711   -8.161  6.215   1.00 40.44  ? 1029 ASN A N   1 
ATOM   1087 C CA  . ASN A 1 151 ? 2.871   -7.489  6.779   1.00 40.96  ? 1029 ASN A CA  1 
ATOM   1088 C C   . ASN A 1 151 ? 3.267   -6.174  6.117   1.00 40.20  ? 1029 ASN A C   1 
ATOM   1089 O O   . ASN A 1 151 ? 3.742   -5.262  6.802   1.00 39.70  ? 1029 ASN A O   1 
ATOM   1090 C CB  . ASN A 1 151 ? 4.024   -8.459  6.900   1.00 56.91  ? 1029 ASN A CB  1 
ATOM   1091 C CG  . ASN A 1 151 ? 3.611   -9.729  7.635   1.00 59.78  ? 1029 ASN A CG  1 
ATOM   1092 O OD1 . ASN A 1 151 ? 4.453   -10.548 8.027   1.00 62.22  ? 1029 ASN A OD1 1 
ATOM   1093 N ND2 . ASN A 1 151 ? 2.296   -9.900  7.824   1.00 60.99  ? 1029 ASN A ND2 1 
ATOM   1094 N N   . LEU A 1 152 ? 2.982   -6.051  4.817   1.00 36.83  ? 1030 LEU A N   1 
ATOM   1095 C CA  . LEU A 1 152 ? 3.238   -4.824  4.093   1.00 36.33  ? 1030 LEU A CA  1 
ATOM   1096 C C   . LEU A 1 152 ? 2.296   -3.768  4.622   1.00 37.24  ? 1030 LEU A C   1 
ATOM   1097 O O   . LEU A 1 152 ? 2.688   -2.630  4.877   1.00 37.99  ? 1030 LEU A O   1 
ATOM   1098 C CB  . LEU A 1 152 ? 2.985   -5.011  2.616   1.00 35.20  ? 1030 LEU A CB  1 
ATOM   1099 C CG  . LEU A 1 152 ? 3.285   -3.782  1.742   1.00 33.71  ? 1030 LEU A CG  1 
ATOM   1100 C CD1 . LEU A 1 152 ? 4.700   -3.250  1.916   1.00 31.59  ? 1030 LEU A CD1 1 
ATOM   1101 C CD2 . LEU A 1 152 ? 2.970   -4.021  0.269   1.00 32.68  ? 1030 LEU A CD2 1 
ATOM   1102 N N   . MET A 1 153 ? 1.039   -4.143  4.806   1.00 41.22  ? 1031 MET A N   1 
ATOM   1103 C CA  . MET A 1 153 ? 0.065   -3.204  5.310   1.00 42.57  ? 1031 MET A CA  1 
ATOM   1104 C C   . MET A 1 153 ? 0.405   -2.820  6.722   1.00 43.31  ? 1031 MET A C   1 
ATOM   1105 O O   . MET A 1 153 ? 0.390   -1.653  7.056   1.00 43.40  ? 1031 MET A O   1 
ATOM   1106 C CB  . MET A 1 153 ? -1.349  -3.772  5.222   1.00 46.34  ? 1031 MET A CB  1 
ATOM   1107 C CG  . MET A 1 153 ? -1.695  -4.369  3.851   1.00 47.60  ? 1031 MET A CG  1 
ATOM   1108 S SD  . MET A 1 153 ? -2.010  -3.166  2.543   1.00 48.82  ? 1031 MET A SD  1 
ATOM   1109 C CE  . MET A 1 153 ? -0.377  -3.091  1.685   1.00 47.33  ? 1031 MET A CE  1 
ATOM   1110 N N   . GLN A 1 154 ? 0.766   -3.795  7.541   1.00 44.28  ? 1032 GLN A N   1 
ATOM   1111 C CA  . GLN A 1 154 ? 1.118   -3.504  8.928   1.00 44.46  ? 1032 GLN A CA  1 
ATOM   1112 C C   . GLN A 1 154 ? 2.298   -2.541  9.013   1.00 43.94  ? 1032 GLN A C   1 
ATOM   1113 O O   . GLN A 1 154 ? 2.347   -1.654  9.857   1.00 43.07  ? 1032 GLN A O   1 
ATOM   1114 C CB  . GLN A 1 154 ? 1.451   -4.797  9.662   1.00 47.47  ? 1032 GLN A CB  1 
ATOM   1115 C CG  . GLN A 1 154 ? 0.499   -5.112  10.806  1.00 49.13  ? 1032 GLN A CG  1 
ATOM   1116 C CD  . GLN A 1 154 ? 0.796   -4.253  12.029  1.00 53.25  ? 1032 GLN A CD  1 
ATOM   1117 O OE1 . GLN A 1 154 ? -0.051  -3.437  12.470  1.00 54.45  ? 1032 GLN A OE1 1 
ATOM   1118 N NE2 . GLN A 1 154 ? 2.023   -4.392  12.567  1.00 54.41  ? 1032 GLN A NE2 1 
ATOM   1119 N N   . SER A 1 155 ? 3.253   -2.722  8.115   1.00 43.78  ? 1033 SER A N   1 
ATOM   1120 C CA  . SER A 1 155 ? 4.426   -1.877  8.096   1.00 43.91  ? 1033 SER A CA  1 
ATOM   1121 C C   . SER A 1 155 ? 4.098   -0.440  7.680   1.00 44.06  ? 1033 SER A C   1 
ATOM   1122 O O   . SER A 1 155 ? 4.557   0.537   8.314   1.00 44.71  ? 1033 SER A O   1 
ATOM   1123 C CB  . SER A 1 155 ? 5.480   -2.496  7.192   1.00 47.81  ? 1033 SER A CB  1 
ATOM   1124 O OG  . SER A 1 155 ? 5.926   -3.718  7.778   1.00 48.53  ? 1033 SER A OG  1 
ATOM   1125 N N   . VAL A 1 156 ? 3.293   -0.305  6.634   1.00 41.01  ? 1034 VAL A N   1 
ATOM   1126 C CA  . VAL A 1 156 ? 2.936   1.008   6.161   1.00 40.57  ? 1034 VAL A CA  1 
ATOM   1127 C C   . VAL A 1 156 ? 2.219   1.773   7.263   1.00 40.68  ? 1034 VAL A C   1 
ATOM   1128 O O   . VAL A 1 156 ? 2.487   2.950   7.484   1.00 40.33  ? 1034 VAL A O   1 
ATOM   1129 C CB  . VAL A 1 156 ? 2.159   0.918   4.821   1.00 43.15  ? 1034 VAL A CB  1 
ATOM   1130 C CG1 . VAL A 1 156 ? 1.944   2.272   4.192   1.00 41.20  ? 1034 VAL A CG1 1 
ATOM   1131 C CG2 . VAL A 1 156 ? 2.955   0.111   3.871   1.00 42.43  ? 1034 VAL A CG2 1 
ATOM   1132 N N   . LYS A 1 157 ? 1.354   1.089   8.000   1.00 45.94  ? 1035 LYS A N   1 
ATOM   1133 C CA  . LYS A 1 157 ? 0.581   1.745   9.054   1.00 46.03  ? 1035 LYS A CA  1 
ATOM   1134 C C   . LYS A 1 157 ? 1.361   2.014   10.304  1.00 45.82  ? 1035 LYS A C   1 
ATOM   1135 O O   . LYS A 1 157 ? 1.023   2.890   11.068  1.00 45.49  ? 1035 LYS A O   1 
ATOM   1136 C CB  . LYS A 1 157 ? -0.720  1.009   9.350   1.00 49.58  ? 1035 LYS A CB  1 
ATOM   1137 C CG  . LYS A 1 157 ? -0.850  0.461   10.743  1.00 50.44  ? 1035 LYS A CG  1 
ATOM   1138 C CD  . LYS A 1 157 ? -2.081  -0.473  10.821  1.00 51.34  ? 1035 LYS A CD  1 
ATOM   1139 C CE  . LYS A 1 157 ? -2.529  -0.766  12.265  1.00 51.96  ? 1035 LYS A CE  1 
ATOM   1140 N NZ  . LYS A 1 157 ? -4.023  -0.688  12.442  1.00 54.70  ? 1035 LYS A NZ  1 
ATOM   1141 N N   . GLU A 1 158 ? 2.428   1.270   10.501  1.00 49.30  ? 1036 GLU A N   1 
ATOM   1142 C CA  . GLU A 1 158 ? 3.255   1.505   11.655  1.00 49.72  ? 1036 GLU A CA  1 
ATOM   1143 C C   . GLU A 1 158 ? 4.074   2.752   11.353  1.00 49.30  ? 1036 GLU A C   1 
ATOM   1144 O O   . GLU A 1 158 ? 4.414   3.511   12.253  1.00 49.84  ? 1036 GLU A O   1 
ATOM   1145 C CB  . GLU A 1 158 ? 4.185   0.333   11.875  1.00 52.17  ? 1036 GLU A CB  1 
ATOM   1146 C CG  . GLU A 1 158 ? 4.034   -0.315  13.204  1.00 55.46  ? 1036 GLU A CG  1 
ATOM   1147 C CD  . GLU A 1 158 ? 3.716   -1.800  13.086  1.00 62.15  ? 1036 GLU A CD  1 
ATOM   1148 O OE1 . GLU A 1 158 ? 4.654   -2.591  12.758  1.00 63.94  ? 1036 GLU A OE1 1 
ATOM   1149 O OE2 . GLU A 1 158 ? 2.534   -2.167  13.356  1.00 63.24  ? 1036 GLU A OE2 1 
ATOM   1150 N N   . THR A 1 159 ? 4.399   2.957   10.082  1.00 45.38  ? 1037 THR A N   1 
ATOM   1151 C CA  . THR A 1 159 ? 5.189   4.104   9.666   1.00 44.93  ? 1037 THR A CA  1 
ATOM   1152 C C   . THR A 1 159 ? 4.356   5.315   9.919   1.00 45.36  ? 1037 THR A C   1 
ATOM   1153 O O   . THR A 1 159 ? 4.770   6.246   10.580  1.00 45.61  ? 1037 THR A O   1 
ATOM   1154 C CB  . THR A 1 159 ? 5.484   4.044   8.162   1.00 48.18  ? 1037 THR A CB  1 
ATOM   1155 O OG1 . THR A 1 159 ? 6.457   3.039   7.894   1.00 47.52  ? 1037 THR A OG1 1 
ATOM   1156 C CG2 . THR A 1 159 ? 6.000   5.365   7.675   1.00 47.04  ? 1037 THR A CG2 1 
ATOM   1157 N N   . VAL A 1 160 ? 3.230   5.328   9.495   1.00 48.57  ? 1038 VAL A N   1 
ATOM   1158 C CA  . VAL A 1 160 ? 2.490   6.441   9.530   1.00 49.11  ? 1038 VAL A CA  1 
ATOM   1159 C C   . VAL A 1 160 ? 2.274   6.825   10.807  1.00 49.68  ? 1038 VAL A C   1 
ATOM   1160 O O   . VAL A 1 160 ? 1.784   7.718   10.990  1.00 50.14  ? 1038 VAL A O   1 
ATOM   1161 C CB  . VAL A 1 160 ? 1.354   6.007   9.141   1.00 52.17  ? 1038 VAL A CB  1 
ATOM   1162 C CG1 . VAL A 1 160 ? 0.479   6.753   9.396   1.00 52.23  ? 1038 VAL A CG1 1 
ATOM   1163 C CG2 . VAL A 1 160 ? 1.409   5.744   7.821   1.00 51.79  ? 1038 VAL A CG2 1 
ATOM   1164 N N   . ARG A 1 161 ? 2.663   6.143   11.790  1.00 53.95  ? 1039 ARG A N   1 
ATOM   1165 C CA  . ARG A 1 161 ? 2.281   6.513   13.090  1.00 54.49  ? 1039 ARG A CA  1 
ATOM   1166 C C   . ARG A 1 161 ? 3.458   6.809   13.688  1.00 54.75  ? 1039 ARG A C   1 
ATOM   1167 O O   . ARG A 1 161 ? 3.442   7.385   14.566  1.00 55.17  ? 1039 ARG A O   1 
ATOM   1168 C CB  . ARG A 1 161 ? 1.860   5.396   13.881  1.00 62.13  ? 1039 ARG A CB  1 
ATOM   1169 C CG  . ARG A 1 161 ? 0.732   4.820   13.486  1.00 63.60  ? 1039 ARG A CG  1 
ATOM   1170 C CD  . ARG A 1 161 ? 0.487   3.809   14.389  1.00 63.85  ? 1039 ARG A CD  1 
ATOM   1171 N NE  . ARG A 1 161 ? -0.886  3.399   14.421  1.00 65.61  ? 1039 ARG A NE  1 
ATOM   1172 C CZ  . ARG A 1 161 ? -1.342  2.248   14.847  1.00 67.42  ? 1039 ARG A CZ  1 
ATOM   1173 N NH1 . ARG A 1 161 ? -0.611  1.300   15.284  1.00 69.08  ? 1039 ARG A NH1 1 
ATOM   1174 N NH2 . ARG A 1 161 ? -2.567  2.056   14.778  1.00 66.50  ? 1039 ARG A NH2 1 
ATOM   1175 N N   . GLU A 1 162 ? 4.557   6.423   13.225  1.00 54.56  ? 1040 GLU A N   1 
ATOM   1176 C CA  . GLU A 1 162 ? 5.628   6.898   13.860  1.00 55.17  ? 1040 GLU A CA  1 
ATOM   1177 C C   . GLU A 1 162 ? 6.072   7.972   13.130  1.00 55.16  ? 1040 GLU A C   1 
ATOM   1178 O O   . GLU A 1 162 ? 6.783   8.581   13.581  1.00 56.03  ? 1040 GLU A O   1 
ATOM   1179 C CB  . GLU A 1 162 ? 6.753   5.985   13.915  1.00 58.66  ? 1040 GLU A CB  1 
ATOM   1180 C CG  . GLU A 1 162 ? 6.635   4.881   14.780  1.00 61.18  ? 1040 GLU A CG  1 
ATOM   1181 C CD  . GLU A 1 162 ? 6.975   5.159   16.237  1.00 66.01  ? 1040 GLU A CD  1 
ATOM   1182 O OE1 . GLU A 1 162 ? 6.438   4.620   17.175  1.00 67.12  ? 1040 GLU A OE1 1 
ATOM   1183 O OE2 . GLU A 1 162 ? 7.755   5.963   16.553  1.00 68.66  ? 1040 GLU A OE2 1 
ATOM   1184 N N   . ALA A 1 163 ? 5.662   8.241   11.940  1.00 51.06  ? 1041 ALA A N   1 
ATOM   1185 C CA  . ALA A 1 163 ? 5.962   9.448   11.146  1.00 50.37  ? 1041 ALA A CA  1 
ATOM   1186 C C   . ALA A 1 163 ? 5.269   10.639  11.783  1.00 50.46  ? 1041 ALA A C   1 
ATOM   1187 O O   . ALA A 1 163 ? 5.803   11.754  11.815  1.00 50.02  ? 1041 ALA A O   1 
ATOM   1188 C CB  . ALA A 1 163 ? 5.453   9.293   9.722   1.00 50.66  ? 1041 ALA A CB  1 
ATOM   1189 N N   . GLU A 1 164 ? 4.058   10.391  12.269  1.00 48.77  ? 1042 GLU A N   1 
ATOM   1190 C CA  . GLU A 1 164 ? 3.297   11.416  12.916  1.00 49.01  ? 1042 GLU A CA  1 
ATOM   1191 C C   . GLU A 1 164 ? 3.951   11.782  14.245  1.00 49.20  ? 1042 GLU A C   1 
ATOM   1192 O O   . GLU A 1 164 ? 4.057   12.959  14.602  1.00 48.53  ? 1042 GLU A O   1 
ATOM   1193 C CB  . GLU A 1 164 ? 1.873   10.954  13.120  1.00 51.23  ? 1042 GLU A CB  1 
ATOM   1194 C CG  . GLU A 1 164 ? 0.970   12.062  13.584  1.00 53.40  ? 1042 GLU A CG  1 
ATOM   1195 C CD  . GLU A 1 164 ? 0.734   12.056  15.088  1.00 55.63  ? 1042 GLU A CD  1 
ATOM   1196 O OE1 . GLU A 1 164 ? -0.406  12.368  15.502  1.00 56.85  ? 1042 GLU A OE1 1 
ATOM   1197 O OE2 . GLU A 1 164 ? 1.676   11.752  15.864  1.00 55.38  ? 1042 GLU A OE2 1 
ATOM   1198 N N   . ALA A 1 165 ? 4.408   10.780  14.980  1.00 50.92  ? 1043 ALA A N   1 
ATOM   1199 C CA  . ALA A 1 165 ? 5.057   11.058  16.261  1.00 51.74  ? 1043 ALA A CA  1 
ATOM   1200 C C   . ALA A 1 165 ? 6.323   11.915  16.081  1.00 52.15  ? 1043 ALA A C   1 
ATOM   1201 O O   . ALA A 1 165 ? 6.604   12.829  16.860  1.00 52.52  ? 1043 ALA A O   1 
ATOM   1202 C CB  . ALA A 1 165 ? 5.402   9.757   16.983  1.00 52.13  ? 1043 ALA A CB  1 
ATOM   1203 N N   . ALA A 1 166 ? 7.086   11.585  15.049  1.00 54.89  ? 1044 ALA A N   1 
ATOM   1204 C CA  . ALA A 1 166 ? 8.317   12.274  14.731  1.00 55.63  ? 1044 ALA A CA  1 
ATOM   1205 C C   . ALA A 1 166 ? 8.101   13.629  14.028  1.00 56.06  ? 1044 ALA A C   1 
ATOM   1206 O O   . ALA A 1 166 ? 9.077   14.274  13.570  1.00 56.56  ? 1044 ALA A O   1 
ATOM   1207 C CB  . ALA A 1 166 ? 9.219   11.359  13.883  1.00 56.27  ? 1044 ALA A CB  1 
ATOM   1208 N N   . SER A 1 167 ? 6.840   14.048  13.915  1.00 56.75  ? 1045 SER A N   1 
ATOM   1209 C CA  . SER A 1 167 ? 6.533   15.328  13.293  1.00 57.31  ? 1045 SER A CA  1 
ATOM   1210 C C   . SER A 1 167 ? 6.514   16.400  14.390  1.00 58.16  ? 1045 SER A C   1 
ATOM   1211 O O   . SER A 1 167 ? 6.599   17.605  14.105  1.00 57.96  ? 1045 SER A O   1 
ATOM   1212 C CB  . SER A 1 167 ? 5.210   15.270  12.518  1.00 60.89  ? 1045 SER A CB  1 
ATOM   1213 O OG  . SER A 1 167 ? 5.391   14.726  11.209  1.00 60.83  ? 1045 SER A OG  1 
ATOM   1214 N N   . ILE A 1 168 ? 6.513   15.930  15.645  1.00 53.53  ? 1046 ILE A N   1 
ATOM   1215 C CA  . ILE A 1 168 ? 6.464   16.758  16.859  1.00 54.19  ? 1046 ILE A CA  1 
ATOM   1216 C C   . ILE A 1 168 ? 7.718   17.600  17.185  1.00 55.50  ? 1046 ILE A C   1 
ATOM   1217 O O   . ILE A 1 168 ? 7.634   18.806  17.408  1.00 55.60  ? 1046 ILE A O   1 
ATOM   1218 C CB  . ILE A 1 168 ? 6.044   15.903  18.044  1.00 55.33  ? 1046 ILE A CB  1 
ATOM   1219 C CG1 . ILE A 1 168 ? 4.777   15.108  17.726  1.00 54.59  ? 1046 ILE A CG1 1 
ATOM   1220 C CG2 . ILE A 1 168 ? 5.917   16.722  19.283  1.00 55.08  ? 1046 ILE A CG2 1 
ATOM   1221 C CD1 . ILE A 1 168 ? 3.477   15.761  18.189  1.00 53.71  ? 1046 ILE A CD1 1 
ATOM   1222 N N   . LYS A 1 169 ? 8.883   16.970  17.243  1.00 60.08  ? 1047 LYS A N   1 
ATOM   1223 C CA  . LYS A 1 169 ? 10.121  17.712  17.519  1.00 61.91  ? 1047 LYS A CA  1 
ATOM   1224 C C   . LYS A 1 169 ? 10.875  17.904  16.208  1.00 62.55  ? 1047 LYS A C   1 
ATOM   1225 O O   . LYS A 1 169 ? 11.492  16.973  15.701  1.00 62.97  ? 1047 LYS A O   1 
ATOM   1226 C CB  . LYS A 1 169 ? 11.006  16.968  18.531  1.00 64.05  ? 1047 LYS A CB  1 
ATOM   1227 C CG  . LYS A 1 169 ? 10.958  15.446  18.392  1.00 65.81  ? 1047 LYS A CG  1 
ATOM   1228 C CD  . LYS A 1 169 ? 9.805   14.826  19.222  1.00 68.57  ? 1047 LYS A CD  1 
ATOM   1229 C CE  . LYS A 1 169 ? 8.986   13.804  18.426  1.00 68.55  ? 1047 LYS A CE  1 
ATOM   1230 N NZ  . LYS A 1 169 ? 8.879   14.156  16.979  1.00 67.82  ? 1047 LYS A NZ  1 
ATOM   1231 N N   . ILE A 1 170 ? 10.819  19.109  15.662  1.00 64.78  ? 1048 ILE A N   1 
ATOM   1232 C CA  . ILE A 1 170 ? 11.469  19.385  14.395  1.00 65.48  ? 1048 ILE A CA  1 
ATOM   1233 C C   . ILE A 1 170 ? 12.722  20.237  14.528  1.00 65.95  ? 1048 ILE A C   1 
ATOM   1234 O O   . ILE A 1 170 ? 12.683  21.288  15.155  1.00 65.64  ? 1048 ILE A O   1 
ATOM   1235 C CB  . ILE A 1 170 ? 10.451  19.992  13.403  1.00 68.52  ? 1048 ILE A CB  1 
ATOM   1236 C CG1 . ILE A 1 170 ? 9.457   18.919  12.970  1.00 68.68  ? 1048 ILE A CG1 1 
ATOM   1237 C CG2 . ILE A 1 170 ? 11.138  20.562  12.172  1.00 68.13  ? 1048 ILE A CG2 1 
ATOM   1238 C CD1 . ILE A 1 170 ? 9.796   18.317  11.626  1.00 70.75  ? 1048 ILE A CD1 1 
ATOM   1239 N N   . ARG A 1 171 ? 13.820  19.780  13.921  1.00 72.37  ? 1049 ARG A N   1 
ATOM   1240 C CA  . ARG A 1 171 ? 15.106  20.497  13.908  1.00 73.25  ? 1049 ARG A CA  1 
ATOM   1241 C C   . ARG A 1 171 ? 14.966  21.949  13.416  1.00 73.70  ? 1049 ARG A C   1 
ATOM   1242 O O   . ARG A 1 171 ? 15.477  22.881  14.038  1.00 73.91  ? 1049 ARG A O   1 
ATOM   1243 C CB  . ARG A 1 171 ? 16.080  19.777  12.982  1.00 75.56  ? 1049 ARG A CB  1 
ATOM   1244 C CG  . ARG A 1 171 ? 17.278  19.174  13.665  1.00 76.72  ? 1049 ARG A CG  1 
ATOM   1245 C CD  . ARG A 1 171 ? 18.209  18.538  12.636  1.00 78.96  ? 1049 ARG A CD  1 
ATOM   1246 N NE  . ARG A 1 171 ? 19.504  19.220  12.567  1.00 80.97  ? 1049 ARG A NE  1 
ATOM   1247 C CZ  . ARG A 1 171 ? 19.682  20.496  12.211  1.00 81.65  ? 1049 ARG A CZ  1 
ATOM   1248 N NH1 . ARG A 1 171 ? 18.642  21.258  11.881  1.00 81.67  ? 1049 ARG A NH1 1 
ATOM   1249 N NH2 . ARG A 1 171 ? 20.908  21.011  12.190  1.00 80.02  ? 1049 ARG A NH2 1 
ATOM   1250 N N   . THR A 1 172 ? 14.310  22.122  12.269  1.00 79.10  ? 1050 THR A N   1 
ATOM   1251 C CA  . THR A 1 172 ? 14.063  23.440  11.680  1.00 79.56  ? 1050 THR A CA  1 
ATOM   1252 C C   . THR A 1 172 ? 12.680  23.384  11.036  1.00 79.91  ? 1050 THR A C   1 
ATOM   1253 O O   . THR A 1 172 ? 12.350  22.377  10.394  1.00 80.16  ? 1050 THR A O   1 
ATOM   1254 C CB  . THR A 1 172 ? 15.119  23.770  10.598  1.00 81.68  ? 1050 THR A CB  1 
ATOM   1255 O OG1 . THR A 1 172 ? 14.927  25.112  10.132  1.00 82.33  ? 1050 THR A OG1 1 
ATOM   1256 C CG2 . THR A 1 172 ? 14.994  22.810  9.421   1.00 81.30  ? 1050 THR A CG2 1 
ATOM   1257 N N   . ASP A 1 173 ? 11.868  24.430  11.201  1.00 83.16  ? 1051 ASP A N   1 
ATOM   1258 C CA  . ASP A 1 173 ? 10.539  24.445  10.561  1.00 83.52  ? 1051 ASP A CA  1 
ATOM   1259 C C   . ASP A 1 173 ? 10.753  24.733  9.059   1.00 83.55  ? 1051 ASP A C   1 
ATOM   1260 O O   . ASP A 1 173 ? 9.805   24.682  8.249   1.00 83.11  ? 1051 ASP A O   1 
ATOM   1261 C CB  . ASP A 1 173 ? 9.591   25.499  11.201  1.00 86.05  ? 1051 ASP A CB  1 
ATOM   1262 C CG  . ASP A 1 173 ? 8.136   24.973  11.423  1.00 87.02  ? 1051 ASP A CG  1 
ATOM   1263 O OD1 . ASP A 1 173 ? 7.776   23.864  10.943  1.00 87.57  ? 1051 ASP A OD1 1 
ATOM   1264 O OD2 . ASP A 1 173 ? 7.349   25.681  12.096  1.00 87.05  ? 1051 ASP A OD2 1 
ATOM   1265 N N   . ALA A 1 174 ? 12.014  25.017  8.713   1.00 83.53  ? 1052 ALA A N   1 
ATOM   1266 C CA  . ALA A 1 174 ? 12.420  25.324  7.344   1.00 83.28  ? 1052 ALA A CA  1 
ATOM   1267 C C   . ALA A 1 174 ? 12.504  24.059  6.495   1.00 83.15  ? 1052 ALA A C   1 
ATOM   1268 O O   . ALA A 1 174 ? 12.057  24.061  5.330   1.00 83.67  ? 1052 ALA A O   1 
ATOM   1269 C CB  . ALA A 1 174 ? 13.762  26.072  7.329   1.00 83.94  ? 1052 ALA A CB  1 
ATOM   1270 N N   . GLY A 1 175 ? 13.075  22.993  7.075   1.00 78.66  ? 1053 GLY A N   1 
ATOM   1271 C CA  . GLY A 1 175 ? 13.245  21.707  6.408   1.00 76.98  ? 1053 GLY A CA  1 
ATOM   1272 C C   . GLY A 1 175 ? 11.918  21.090  6.013   1.00 75.89  ? 1053 GLY A C   1 
ATOM   1273 O O   . GLY A 1 175 ? 10.924  21.800  5.841   1.00 75.43  ? 1053 GLY A O   1 
ATOM   1274 N N   . PHE A 1 176 ? 11.877  19.766  5.889   1.00 70.58  ? 1054 PHE A N   1 
ATOM   1275 C CA  . PHE A 1 176 ? 10.616  19.111  5.525   1.00 69.53  ? 1054 PHE A CA  1 
ATOM   1276 C C   . PHE A 1 176 ? 9.544   19.021  6.640   1.00 68.15  ? 1054 PHE A C   1 
ATOM   1277 O O   . PHE A 1 176 ? 9.855   19.076  7.837   1.00 68.33  ? 1054 PHE A O   1 
ATOM   1278 C CB  . PHE A 1 176 ? 10.842  17.772  4.833   1.00 71.84  ? 1054 PHE A CB  1 
ATOM   1279 C CG  . PHE A 1 176 ? 9.764   17.429  3.850   1.00 73.88  ? 1054 PHE A CG  1 
ATOM   1280 C CD1 . PHE A 1 176 ? 9.408   18.337  2.854   1.00 75.27  ? 1054 PHE A CD1 1 
ATOM   1281 C CD2 . PHE A 1 176 ? 9.037   16.238  3.972   1.00 74.90  ? 1054 PHE A CD2 1 
ATOM   1282 C CE1 . PHE A 1 176 ? 8.373   18.047  1.969   1.00 76.46  ? 1054 PHE A CE1 1 
ATOM   1283 C CE2 . PHE A 1 176 ? 7.998   15.950  3.104   1.00 76.01  ? 1054 PHE A CE2 1 
ATOM   1284 C CZ  . PHE A 1 176 ? 7.663   16.855  2.104   1.00 77.02  ? 1054 PHE A CZ  1 
ATOM   1285 N N   . THR A 1 177 ? 8.280   18.945  6.221   1.00 60.66  ? 1055 THR A N   1 
ATOM   1286 C CA  . THR A 1 177 ? 7.126   18.854  7.121   1.00 58.48  ? 1055 THR A CA  1 
ATOM   1287 C C   . THR A 1 177 ? 5.941   18.190  6.411   1.00 57.11  ? 1055 THR A C   1 
ATOM   1288 O O   . THR A 1 177 ? 5.615   18.526  5.261   1.00 57.28  ? 1055 THR A O   1 
ATOM   1289 C CB  . THR A 1 177 ? 6.658   20.248  7.614   1.00 70.28  ? 1055 THR A CB  1 
ATOM   1290 O OG1 . THR A 1 177 ? 7.691   20.880  8.376   1.00 71.61  ? 1055 THR A OG1 1 
ATOM   1291 C CG2 . THR A 1 177 ? 5.413   20.120  8.485   1.00 69.26  ? 1055 THR A CG2 1 
ATOM   1292 N N   . LEU A 1 178 ? 5.258   17.286  7.103   1.00 45.33  ? 1056 LEU A N   1 
ATOM   1293 C CA  . LEU A 1 178 ? 4.051   16.723  6.548   1.00 43.04  ? 1056 LEU A CA  1 
ATOM   1294 C C   . LEU A 1 178 ? 3.011   17.378  7.378   1.00 42.20  ? 1056 LEU A C   1 
ATOM   1295 O O   . LEU A 1 178 ? 3.253   17.718  8.535   1.00 41.99  ? 1056 LEU A O   1 
ATOM   1296 C CB  . LEU A 1 178 ? 3.961   15.224  6.773   1.00 41.77  ? 1056 LEU A CB  1 
ATOM   1297 C CG  . LEU A 1 178 ? 4.749   14.382  5.796   1.00 40.82  ? 1056 LEU A CG  1 
ATOM   1298 C CD1 . LEU A 1 178 ? 4.531   12.915  6.082   1.00 39.37  ? 1056 LEU A CD1 1 
ATOM   1299 C CD2 . LEU A 1 178 ? 4.379   14.762  4.389   1.00 39.26  ? 1056 LEU A CD2 1 
ATOM   1300 N N   . ARG A 1 179 ? 1.837   17.518  6.793   1.00 41.09  ? 1057 ARG A N   1 
ATOM   1301 C CA  . ARG A 1 179 ? 0.685   18.083  7.481   1.00 40.24  ? 1057 ARG A CA  1 
ATOM   1302 C C   . ARG A 1 179 ? -0.108  16.969  8.180   1.00 39.87  ? 1057 ARG A C   1 
ATOM   1303 O O   . ARG A 1 179 ? -0.620  16.036  7.526   1.00 39.26  ? 1057 ARG A O   1 
ATOM   1304 C CB  . ARG A 1 179 ? -0.200  18.832  6.480   1.00 37.70  ? 1057 ARG A CB  1 
ATOM   1305 C CG  . ARG A 1 179 ? -1.407  19.466  7.082   1.00 36.97  ? 1057 ARG A CG  1 
ATOM   1306 C CD  . ARG A 1 179 ? -2.047  20.500  6.157   1.00 37.93  ? 1057 ARG A CD  1 
ATOM   1307 N NE  . ARG A 1 179 ? -3.471  20.640  6.462   1.00 39.25  ? 1057 ARG A NE  1 
ATOM   1308 C CZ  . ARG A 1 179 ? -4.384  19.729  6.123   1.00 39.08  ? 1057 ARG A CZ  1 
ATOM   1309 N NH1 . ARG A 1 179 ? -4.009  18.629  5.449   1.00 36.22  ? 1057 ARG A NH1 1 
ATOM   1310 N NH2 . ARG A 1 179 ? -5.662  19.907  6.464   1.00 36.47  ? 1057 ARG A NH2 1 
ATOM   1311 N N   . TRP A 1 180 ? -0.182  17.077  9.512   1.00 40.47  ? 1058 TRP A N   1 
ATOM   1312 C CA  . TRP A 1 180 ? -0.958  16.160  10.359  1.00 41.14  ? 1058 TRP A CA  1 
ATOM   1313 C C   . TRP A 1 180 ? -2.253  16.806  10.872  1.00 42.24  ? 1058 TRP A C   1 
ATOM   1314 O O   . TRP A 1 180 ? -2.324  17.307  11.997  1.00 42.38  ? 1058 TRP A O   1 
ATOM   1315 C CB  . TRP A 1 180 ? -0.120  15.560  11.505  1.00 39.97  ? 1058 TRP A CB  1 
ATOM   1316 C CG  . TRP A 1 180 ? 1.049   14.748  11.012  1.00 37.47  ? 1058 TRP A CG  1 
ATOM   1317 C CD1 . TRP A 1 180 ? 2.344   15.174  10.871  1.00 36.48  ? 1058 TRP A CD1 1 
ATOM   1318 C CD2 . TRP A 1 180 ? 1.004   13.413  10.455  1.00 35.67  ? 1058 TRP A CD2 1 
ATOM   1319 N NE1 . TRP A 1 180 ? 3.110   14.190  10.263  1.00 36.86  ? 1058 TRP A NE1 1 
ATOM   1320 C CE2 . TRP A 1 180 ? 2.309   13.108  9.984   1.00 35.99  ? 1058 TRP A CE2 1 
ATOM   1321 C CE3 . TRP A 1 180 ? -0.022  12.466  10.266  1.00 32.61  ? 1058 TRP A CE3 1 
ATOM   1322 C CZ2 . TRP A 1 180 ? 2.632   11.863  9.411   1.00 34.56  ? 1058 TRP A CZ2 1 
ATOM   1323 C CZ3 . TRP A 1 180 ? 0.295   11.253  9.643   1.00 32.01  ? 1058 TRP A CZ3 1 
ATOM   1324 C CH2 . TRP A 1 180 ? 1.609   10.982  9.191   1.00 33.41  ? 1058 TRP A CH2 1 
ATOM   1325 N N   . VAL A 1 181 ? -3.278  16.797  10.031  1.00 42.55  ? 1059 VAL A N   1 
ATOM   1326 C CA  . VAL A 1 181 ? -4.545  17.357  10.462  1.00 44.30  ? 1059 VAL A CA  1 
ATOM   1327 C C   . VAL A 1 181 ? -5.630  16.287  10.447  1.00 45.69  ? 1059 VAL A C   1 
ATOM   1328 O O   . VAL A 1 181 ? -5.982  15.755  9.382   1.00 45.45  ? 1059 VAL A O   1 
ATOM   1329 C CB  . VAL A 1 181 ? -4.963  18.580  9.643   1.00 47.98  ? 1059 VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 181 ? -6.471  18.722  9.697   1.00 47.40  ? 1059 VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 181 ? -4.263  19.854  10.166  1.00 48.28  ? 1059 VAL A CG2 1 
ATOM   1332 N N   . ARG A 1 182 ? -6.155  15.976  11.635  1.00 44.21  ? 1060 ARG A N   1 
ATOM   1333 C CA  . ARG A 1 182 ? -7.188  14.946  11.750  1.00 45.07  ? 1060 ARG A CA  1 
ATOM   1334 C C   . ARG A 1 182 ? -8.442  15.340  11.010  1.00 45.64  ? 1060 ARG A C   1 
ATOM   1335 O O   . ARG A 1 182 ? -8.836  16.481  11.034  1.00 45.30  ? 1060 ARG A O   1 
ATOM   1336 C CB  . ARG A 1 182 ? -7.528  14.634  13.218  1.00 47.08  ? 1060 ARG A CB  1 
ATOM   1337 C CG  . ARG A 1 182 ? -6.426  13.948  14.033  1.00 46.53  ? 1060 ARG A CG  1 
ATOM   1338 C CD  . ARG A 1 182 ? -6.254  12.475  13.683  1.00 45.46  ? 1060 ARG A CD  1 
ATOM   1339 N NE  . ARG A 1 182 ? -6.841  11.646  14.717  1.00 45.44  ? 1060 ARG A NE  1 
ATOM   1340 C CZ  . ARG A 1 182 ? -8.052  11.099  14.635  1.00 45.52  ? 1060 ARG A CZ  1 
ATOM   1341 N NH1 . ARG A 1 182 ? -8.794  11.229  13.525  1.00 44.48  ? 1060 ARG A NH1 1 
ATOM   1342 N NH2 . ARG A 1 182 ? -8.523  10.387  15.656  1.00 44.56  ? 1060 ARG A NH2 1 
ATOM   1343 N N   . LYS A 1 183 ? -9.060  14.371  10.351  1.00 45.92  ? 1061 LYS A N   1 
ATOM   1344 C CA  . LYS A 1 183 ? -10.317 14.571  9.644   1.00 47.92  ? 1061 LYS A CA  1 
ATOM   1345 C C   . LYS A 1 183 ? -11.455 14.325  10.651  1.00 49.91  ? 1061 LYS A C   1 
ATOM   1346 O O   . LYS A 1 183 ? -11.429 13.345  11.430  1.00 50.19  ? 1061 LYS A O   1 
ATOM   1347 C CB  . LYS A 1 183 ? -10.426 13.582  8.485   1.00 50.44  ? 1061 LYS A CB  1 
ATOM   1348 C CG  . LYS A 1 183 ? -10.302 14.197  7.086   1.00 50.49  ? 1061 LYS A CG  1 
ATOM   1349 C CD  . LYS A 1 183 ? -10.183 13.092  6.010   1.00 50.60  ? 1061 LYS A CD  1 
ATOM   1350 C CE  . LYS A 1 183 ? -11.119 13.326  4.800   1.00 52.03  ? 1061 LYS A CE  1 
ATOM   1351 N NZ  . LYS A 1 183 ? -12.152 12.240  4.577   1.00 51.47  ? 1061 LYS A NZ  1 
ATOM   1352 N N   . GLU B 1 6   ? 12.304  32.279  11.348  1.00 102.24 ? 884  GLU B N   1 
ATOM   1353 C CA  . GLU B 1 6   ? 13.490  33.112  11.171  1.00 102.57 ? 884  GLU B CA  1 
ATOM   1354 C C   . GLU B 1 6   ? 13.343  34.083  10.002  1.00 102.75 ? 884  GLU B C   1 
ATOM   1355 O O   . GLU B 1 6   ? 13.543  33.724  8.830   1.00 102.95 ? 884  GLU B O   1 
ATOM   1356 C CB  . GLU B 1 6   ? 14.753  32.259  10.991  1.00 104.21 ? 884  GLU B CB  1 
ATOM   1357 C CG  . GLU B 1 6   ? 14.640  31.188  9.905   1.00 104.91 ? 884  GLU B CG  1 
ATOM   1358 C CD  . GLU B 1 6   ? 15.489  29.962  10.203  1.00 105.42 ? 884  GLU B CD  1 
ATOM   1359 O OE1 . GLU B 1 6   ? 16.589  30.141  10.774  1.00 105.22 ? 884  GLU B OE1 1 
ATOM   1360 O OE2 . GLU B 1 6   ? 15.067  28.830  9.855   1.00 105.51 ? 884  GLU B OE2 1 
ATOM   1361 N N   . PHE B 1 7   ? 12.997  35.321  10.335  1.00 97.60  ? 885  PHE B N   1 
ATOM   1362 C CA  . PHE B 1 7   ? 12.871  36.375  9.344   1.00 97.25  ? 885  PHE B CA  1 
ATOM   1363 C C   . PHE B 1 7   ? 14.100  37.278  9.460   1.00 97.22  ? 885  PHE B C   1 
ATOM   1364 O O   . PHE B 1 7   ? 14.668  37.443  10.549  1.00 97.09  ? 885  PHE B O   1 
ATOM   1365 C CB  . PHE B 1 7   ? 11.612  37.187  9.620   1.00 97.63  ? 885  PHE B CB  1 
ATOM   1366 C CG  . PHE B 1 7   ? 10.673  37.255  8.460   1.00 97.11  ? 885  PHE B CG  1 
ATOM   1367 C CD1 . PHE B 1 7   ? 9.951   36.140  8.072   1.00 95.95  ? 885  PHE B CD1 1 
ATOM   1368 C CD2 . PHE B 1 7   ? 10.499  38.436  7.765   1.00 96.63  ? 885  PHE B CD2 1 
ATOM   1369 C CE1 . PHE B 1 7   ? 9.079   36.201  7.007   1.00 94.95  ? 885  PHE B CE1 1 
ATOM   1370 C CE2 . PHE B 1 7   ? 9.617   38.507  6.716   1.00 95.26  ? 885  PHE B CE2 1 
ATOM   1371 C CZ  . PHE B 1 7   ? 8.905   37.387  6.334   1.00 95.12  ? 885  PHE B CZ  1 
ATOM   1372 N N   . PRO B 1 8   ? 14.530  37.869  8.337   1.00 95.31  ? 886  PRO B N   1 
ATOM   1373 C CA  . PRO B 1 8   ? 15.677  38.785  8.293   1.00 95.48  ? 886  PRO B CA  1 
ATOM   1374 C C   . PRO B 1 8   ? 15.249  40.144  8.834   1.00 95.59  ? 886  PRO B C   1 
ATOM   1375 O O   . PRO B 1 8   ? 14.165  40.273  9.403   1.00 96.05  ? 886  PRO B O   1 
ATOM   1376 C CB  . PRO B 1 8   ? 15.990  38.891  6.797   1.00 97.10  ? 886  PRO B CB  1 
ATOM   1377 C CG  . PRO B 1 8   ? 15.107  37.879  6.124   1.00 97.04  ? 886  PRO B CG  1 
ATOM   1378 C CD  . PRO B 1 8   ? 13.936  37.674  7.011   1.00 96.79  ? 886  PRO B CD  1 
ATOM   1379 N N   . GLU B 1 9   ? 16.072  41.166  8.647   1.00 92.52  ? 887  GLU B N   1 
ATOM   1380 C CA  . GLU B 1 9   ? 15.736  42.477  9.189   1.00 92.28  ? 887  GLU B CA  1 
ATOM   1381 C C   . GLU B 1 9   ? 15.691  43.603  8.155   1.00 92.22  ? 887  GLU B C   1 
ATOM   1382 O O   . GLU B 1 9   ? 16.579  43.723  7.311   1.00 91.95  ? 887  GLU B O   1 
ATOM   1383 C CB  . GLU B 1 9   ? 16.700  42.820  10.327  1.00 94.28  ? 887  GLU B CB  1 
ATOM   1384 C CG  . GLU B 1 9   ? 18.192  42.642  9.950   1.00 94.38  ? 887  GLU B CG  1 
ATOM   1385 C CD  . GLU B 1 9   ? 18.886  41.475  10.666  1.00 95.01  ? 887  GLU B CD  1 
ATOM   1386 O OE1 . GLU B 1 9   ? 19.507  41.724  11.733  1.00 94.26  ? 887  GLU B OE1 1 
ATOM   1387 O OE2 . GLU B 1 9   ? 18.868  40.339  10.118  1.00 95.52  ? 887  GLU B OE2 1 
ATOM   1388 N N   . GLU B 1 14  ? 16.401  46.707  1.871   1.00 80.56  ? 892  GLU B N   1 
ATOM   1389 C CA  . GLU B 1 14  ? 16.050  46.014  0.634   1.00 80.88  ? 892  GLU B CA  1 
ATOM   1390 C C   . GLU B 1 14  ? 15.343  46.919  -0.386  1.00 80.72  ? 892  GLU B C   1 
ATOM   1391 O O   . GLU B 1 14  ? 15.227  48.138  -0.190  1.00 80.54  ? 892  GLU B O   1 
ATOM   1392 C CB  . GLU B 1 14  ? 15.173  44.790  0.947   1.00 82.74  ? 892  GLU B CB  1 
ATOM   1393 C CG  . GLU B 1 14  ? 15.680  43.450  0.383   1.00 84.49  ? 892  GLU B CG  1 
ATOM   1394 C CD  . GLU B 1 14  ? 14.993  42.237  1.021   1.00 87.06  ? 892  GLU B CD  1 
ATOM   1395 O OE1 . GLU B 1 14  ? 14.690  42.300  2.238   1.00 87.12  ? 892  GLU B OE1 1 
ATOM   1396 O OE2 . GLU B 1 14  ? 14.768  41.223  0.308   1.00 87.62  ? 892  GLU B OE2 1 
ATOM   1397 N N   . VAL B 1 15  ? 14.880  46.284  -1.471  1.00 76.41  ? 893  VAL B N   1 
ATOM   1398 C CA  . VAL B 1 15  ? 14.104  46.898  -2.565  1.00 75.68  ? 893  VAL B CA  1 
ATOM   1399 C C   . VAL B 1 15  ? 12.635  46.471  -2.403  1.00 75.25  ? 893  VAL B C   1 
ATOM   1400 O O   . VAL B 1 15  ? 12.012  45.925  -3.330  1.00 74.91  ? 893  VAL B O   1 
ATOM   1401 C CB  . VAL B 1 15  ? 14.617  46.427  -3.931  1.00 78.50  ? 893  VAL B CB  1 
ATOM   1402 C CG1 . VAL B 1 15  ? 14.186  47.370  -5.019  1.00 78.76  ? 893  VAL B CG1 1 
ATOM   1403 C CG2 . VAL B 1 15  ? 16.116  46.237  -3.905  1.00 77.38  ? 893  VAL B CG2 1 
ATOM   1404 N N   . ILE B 1 16  ? 12.103  46.710  -1.207  1.00 72.75  ? 894  ILE B N   1 
ATOM   1405 C CA  . ILE B 1 16  ? 10.743  46.313  -0.858  1.00 72.12  ? 894  ILE B CA  1 
ATOM   1406 C C   . ILE B 1 16  ? 9.948   47.526  -0.427  1.00 71.67  ? 894  ILE B C   1 
ATOM   1407 O O   . ILE B 1 16  ? 10.131  48.635  -0.941  1.00 71.85  ? 894  ILE B O   1 
ATOM   1408 C CB  . ILE B 1 16  ? 10.745  45.299  0.308   1.00 72.96  ? 894  ILE B CB  1 
ATOM   1409 C CG1 . ILE B 1 16  ? 11.273  45.980  1.589   1.00 72.22  ? 894  ILE B CG1 1 
ATOM   1410 C CG2 . ILE B 1 16  ? 11.503  44.024  -0.084  1.00 72.63  ? 894  ILE B CG2 1 
ATOM   1411 C CD1 . ILE B 1 16  ? 12.085  45.084  2.498   1.00 71.31  ? 894  ILE B CD1 1 
ATOM   1412 N N   . ASN B 1 17  ? 9.063   47.287  0.536   1.00 71.26  ? 895  ASN B N   1 
ATOM   1413 C CA  . ASN B 1 17  ? 8.239   48.326  1.115   1.00 70.31  ? 895  ASN B CA  1 
ATOM   1414 C C   . ASN B 1 17  ? 8.286   48.142  2.626   1.00 69.58  ? 895  ASN B C   1 
ATOM   1415 O O   . ASN B 1 17  ? 7.429   47.440  3.172   1.00 69.70  ? 895  ASN B O   1 
ATOM   1416 C CB  . ASN B 1 17  ? 6.796   48.210  0.641   1.00 64.41  ? 895  ASN B CB  1 
ATOM   1417 C CG  . ASN B 1 17  ? 5.902   49.253  1.288   1.00 64.68  ? 895  ASN B CG  1 
ATOM   1418 O OD1 . ASN B 1 17  ? 5.530   50.233  0.651   1.00 64.83  ? 895  ASN B OD1 1 
ATOM   1419 N ND2 . ASN B 1 17  ? 5.658   49.109  2.592   1.00 64.65  ? 895  ASN B ND2 1 
ATOM   1420 N N   . GLN B 1 18  ? 9.291   48.757  3.272   1.00 69.00  ? 896  GLN B N   1 
ATOM   1421 C CA  . GLN B 1 18  ? 9.500   48.699  4.731   1.00 67.70  ? 896  GLN B CA  1 
ATOM   1422 C C   . GLN B 1 18  ? 8.256   48.440  5.605   1.00 65.82  ? 896  GLN B C   1 
ATOM   1423 O O   . GLN B 1 18  ? 8.238   47.502  6.406   1.00 65.60  ? 896  GLN B O   1 
ATOM   1424 C CB  . GLN B 1 18  ? 10.250  49.949  5.260   1.00 70.78  ? 896  GLN B CB  1 
ATOM   1425 C CG  . GLN B 1 18  ? 10.049  50.182  6.798   1.00 73.04  ? 896  GLN B CG  1 
ATOM   1426 C CD  . GLN B 1 18  ? 10.788  51.420  7.361   1.00 76.74  ? 896  GLN B CD  1 
ATOM   1427 O OE1 . GLN B 1 18  ? 11.447  51.341  8.419   1.00 78.72  ? 896  GLN B OE1 1 
ATOM   1428 N NE2 . GLN B 1 18  ? 10.635  52.572  6.690   1.00 76.23  ? 896  GLN B NE2 1 
ATOM   1429 N N   . PRO B 1 19  ? 7.215   49.289  5.481   1.00 60.20  ? 897  PRO B N   1 
ATOM   1430 C CA  . PRO B 1 19  ? 6.028   49.110  6.330   1.00 58.85  ? 897  PRO B CA  1 
ATOM   1431 C C   . PRO B 1 19  ? 5.217   47.823  6.084   1.00 57.76  ? 897  PRO B C   1 
ATOM   1432 O O   . PRO B 1 19  ? 4.569   47.309  6.995   1.00 57.26  ? 897  PRO B O   1 
ATOM   1433 C CB  . PRO B 1 19  ? 5.205   50.368  6.062   1.00 59.45  ? 897  PRO B CB  1 
ATOM   1434 C CG  . PRO B 1 19  ? 6.168   51.347  5.546   1.00 59.72  ? 897  PRO B CG  1 
ATOM   1435 C CD  . PRO B 1 19  ? 7.227   50.604  4.818   1.00 60.74  ? 897  PRO B CD  1 
ATOM   1436 N N   . MET B 1 20  ? 5.261   47.301  4.868   1.00 56.71  ? 898  MET B N   1 
ATOM   1437 C CA  . MET B 1 20  ? 4.580   46.052  4.573   1.00 55.85  ? 898  MET B CA  1 
ATOM   1438 C C   . MET B 1 20  ? 5.390   44.908  5.134   1.00 55.46  ? 898  MET B C   1 
ATOM   1439 O O   . MET B 1 20  ? 4.840   43.974  5.710   1.00 55.20  ? 898  MET B O   1 
ATOM   1440 C CB  . MET B 1 20  ? 4.477   45.844  3.078   1.00 59.71  ? 898  MET B CB  1 
ATOM   1441 C CG  . MET B 1 20  ? 3.854   46.998  2.360   1.00 60.09  ? 898  MET B CG  1 
ATOM   1442 S SD  . MET B 1 20  ? 2.719   46.293  1.211   1.00 62.72  ? 898  MET B SD  1 
ATOM   1443 C CE  . MET B 1 20  ? 2.639   44.605  1.929   1.00 58.04  ? 898  MET B CE  1 
ATOM   1444 N N   . MET B 1 21  ? 6.697   44.971  4.906   1.00 53.36  ? 899  MET B N   1 
ATOM   1445 C CA  . MET B 1 21  ? 7.618   43.961  5.384   1.00 53.30  ? 899  MET B CA  1 
ATOM   1446 C C   . MET B 1 21  ? 7.548   43.965  6.882   1.00 53.23  ? 899  MET B C   1 
ATOM   1447 O O   . MET B 1 21  ? 7.594   42.912  7.513   1.00 53.34  ? 899  MET B O   1 
ATOM   1448 C CB  . MET B 1 21  ? 9.037   44.267  4.934   1.00 56.46  ? 899  MET B CB  1 
ATOM   1449 C CG  . MET B 1 21  ? 9.401   43.617  3.621   1.00 57.08  ? 899  MET B CG  1 
ATOM   1450 S SD  . MET B 1 21  ? 9.594   41.835  3.823   1.00 61.64  ? 899  MET B SD  1 
ATOM   1451 C CE  . MET B 1 21  ? 9.900   41.263  2.139   1.00 56.68  ? 899  MET B CE  1 
ATOM   1452 N N   . MET B 1 22  ? 7.401   45.156  7.449   1.00 53.01  ? 900  MET B N   1 
ATOM   1453 C CA  . MET B 1 22  ? 7.333   45.304  8.891   1.00 53.44  ? 900  MET B CA  1 
ATOM   1454 C C   . MET B 1 22  ? 6.136   44.584  9.449   1.00 52.85  ? 900  MET B C   1 
ATOM   1455 O O   . MET B 1 22  ? 6.201   44.006  10.520  1.00 52.33  ? 900  MET B O   1 
ATOM   1456 C CB  . MET B 1 22  ? 7.215   46.772  9.271   1.00 57.08  ? 900  MET B CB  1 
ATOM   1457 C CG  . MET B 1 22  ? 7.658   47.025  10.689  1.00 60.62  ? 900  MET B CG  1 
ATOM   1458 S SD  . MET B 1 22  ? 9.367   46.446  10.845  1.00 69.32  ? 900  MET B SD  1 
ATOM   1459 C CE  . MET B 1 22  ? 10.250  47.668  9.558   1.00 66.79  ? 900  MET B CE  1 
ATOM   1460 N N   . ALA B 1 23  ? 5.019   44.700  8.740   1.00 52.43  ? 901  ALA B N   1 
ATOM   1461 C CA  . ALA B 1 23  ? 3.757   44.101  9.157   1.00 51.63  ? 901  ALA B CA  1 
ATOM   1462 C C   . ALA B 1 23  ? 3.796   42.615  8.866   1.00 51.46  ? 901  ALA B C   1 
ATOM   1463 O O   . ALA B 1 23  ? 3.193   41.823  9.587   1.00 51.28  ? 901  ALA B O   1 
ATOM   1464 C CB  . ALA B 1 23  ? 2.596   44.749  8.426   1.00 51.91  ? 901  ALA B CB  1 
ATOM   1465 N N   . ALA B 1 24  ? 4.495   42.232  7.797   1.00 52.33  ? 902  ALA B N   1 
ATOM   1466 C CA  . ALA B 1 24  ? 4.609   40.822  7.462   1.00 52.26  ? 902  ALA B CA  1 
ATOM   1467 C C   . ALA B 1 24  ? 5.341   40.202  8.648   1.00 52.41  ? 902  ALA B C   1 
ATOM   1468 O O   . ALA B 1 24  ? 4.830   39.277  9.302   1.00 52.22  ? 902  ALA B O   1 
ATOM   1469 C CB  . ALA B 1 24  ? 5.394   40.629  6.167   1.00 52.38  ? 902  ALA B CB  1 
ATOM   1470 N N   . ARG B 1 25  ? 6.494   40.789  8.982   1.00 55.55  ? 903  ARG B N   1 
ATOM   1471 C CA  . ARG B 1 25  ? 7.309   40.315  10.099  1.00 55.76  ? 903  ARG B CA  1 
ATOM   1472 C C   . ARG B 1 25  ? 6.518   40.154  11.376  1.00 55.25  ? 903  ARG B C   1 
ATOM   1473 O O   . ARG B 1 25  ? 6.530   39.093  11.988  1.00 55.21  ? 903  ARG B O   1 
ATOM   1474 C CB  . ARG B 1 25  ? 8.504   41.227  10.359  1.00 64.26  ? 903  ARG B CB  1 
ATOM   1475 C CG  . ARG B 1 25  ? 9.456   40.700  11.451  1.00 66.06  ? 903  ARG B CG  1 
ATOM   1476 C CD  . ARG B 1 25  ? 10.936  41.047  11.149  1.00 68.86  ? 903  ARG B CD  1 
ATOM   1477 N NE  . ARG B 1 25  ? 11.089  42.402  10.603  1.00 68.57  ? 903  ARG B NE  1 
ATOM   1478 C CZ  . ARG B 1 25  ? 11.679  42.685  9.443   1.00 65.51  ? 903  ARG B CZ  1 
ATOM   1479 N NH1 . ARG B 1 25  ? 12.199  41.700  8.714   1.00 63.90  ? 903  ARG B NH1 1 
ATOM   1480 N NH2 . ARG B 1 25  ? 11.739  43.948  9.007   1.00 64.41  ? 903  ARG B NH2 1 
ATOM   1481 N N   . GLN B 1 26  ? 5.849   41.215  11.790  1.00 55.46  ? 904  GLN B N   1 
ATOM   1482 C CA  . GLN B 1 26  ? 5.070   41.161  13.015  1.00 55.64  ? 904  GLN B CA  1 
ATOM   1483 C C   . GLN B 1 26  ? 4.140   39.937  13.119  1.00 55.20  ? 904  GLN B C   1 
ATOM   1484 O O   . GLN B 1 26  ? 4.008   39.351  14.209  1.00 55.54  ? 904  GLN B O   1 
ATOM   1485 C CB  . GLN B 1 26  ? 4.277   42.455  13.240  1.00 59.91  ? 904  GLN B CB  1 
ATOM   1486 C CG  . GLN B 1 26  ? 5.115   43.632  13.682  1.00 61.17  ? 904  GLN B CG  1 
ATOM   1487 C CD  . GLN B 1 26  ? 4.273   44.875  13.934  1.00 63.20  ? 904  GLN B CD  1 
ATOM   1488 O OE1 . GLN B 1 26  ? 3.396   44.878  14.812  1.00 62.63  ? 904  GLN B OE1 1 
ATOM   1489 N NE2 . GLN B 1 26  ? 4.547   45.945  13.180  1.00 65.06  ? 904  GLN B NE2 1 
ATOM   1490 N N   . LEU B 1 27  ? 3.471   39.578  12.017  1.00 50.59  ? 905  LEU B N   1 
ATOM   1491 C CA  . LEU B 1 27  ? 2.558   38.427  12.017  1.00 49.85  ? 905  LEU B CA  1 
ATOM   1492 C C   . LEU B 1 27  ? 3.391   37.166  12.153  1.00 49.66  ? 905  LEU B C   1 
ATOM   1493 O O   . LEU B 1 27  ? 3.140   36.316  13.006  1.00 49.39  ? 905  LEU B O   1 
ATOM   1494 C CB  . LEU B 1 27  ? 1.777   38.354  10.712  1.00 48.39  ? 905  LEU B CB  1 
ATOM   1495 C CG  . LEU B 1 27  ? 0.835   37.159  10.623  1.00 47.27  ? 905  LEU B CG  1 
ATOM   1496 C CD1 . LEU B 1 27  ? -0.306  37.318  11.609  1.00 46.35  ? 905  LEU B CD1 1 
ATOM   1497 C CD2 . LEU B 1 27  ? 0.309   37.040  9.216   1.00 45.37  ? 905  LEU B CD2 1 
ATOM   1498 N N   . HIS B 1 28  ? 4.431   37.091  11.326  1.00 52.63  ? 906  HIS B N   1 
ATOM   1499 C CA  . HIS B 1 28  ? 5.363   35.987  11.370  1.00 52.49  ? 906  HIS B CA  1 
ATOM   1500 C C   . HIS B 1 28  ? 5.879   35.590  12.763  1.00 52.32  ? 906  HIS B C   1 
ATOM   1501 O O   . HIS B 1 28  ? 5.914   34.408  13.095  1.00 52.09  ? 906  HIS B O   1 
ATOM   1502 C CB  . HIS B 1 28  ? 6.545   36.243  10.460  1.00 53.13  ? 906  HIS B CB  1 
ATOM   1503 C CG  . HIS B 1 28  ? 7.268   34.986  10.111  1.00 54.87  ? 906  HIS B CG  1 
ATOM   1504 N ND1 . HIS B 1 28  ? 8.502   34.667  10.645  1.00 54.74  ? 906  HIS B ND1 1 
ATOM   1505 C CD2 . HIS B 1 28  ? 6.843   33.884  9.435   1.00 55.86  ? 906  HIS B CD2 1 
ATOM   1506 C CE1 . HIS B 1 28  ? 8.836   33.448  10.247  1.00 55.40  ? 906  HIS B CE1 1 
ATOM   1507 N NE2 . HIS B 1 28  ? 7.842   32.947  9.525   1.00 55.29  ? 906  HIS B NE2 1 
ATOM   1508 N N   . ASP B 1 29  ? 6.325   36.573  13.544  1.00 54.91  ? 907  ASP B N   1 
ATOM   1509 C CA  . ASP B 1 29  ? 6.835   36.341  14.889  1.00 54.69  ? 907  ASP B CA  1 
ATOM   1510 C C   . ASP B 1 29  ? 5.781   35.825  15.826  1.00 53.89  ? 907  ASP B C   1 
ATOM   1511 O O   . ASP B 1 29  ? 6.082   35.018  16.693  1.00 53.89  ? 907  ASP B O   1 
ATOM   1512 C CB  . ASP B 1 29  ? 7.404   37.616  15.490  1.00 59.24  ? 907  ASP B CB  1 
ATOM   1513 C CG  . ASP B 1 29  ? 8.635   38.106  14.758  1.00 62.31  ? 907  ASP B CG  1 
ATOM   1514 O OD1 . ASP B 1 29  ? 9.265   37.268  14.054  1.00 64.40  ? 907  ASP B OD1 1 
ATOM   1515 O OD2 . ASP B 1 29  ? 8.940   39.334  14.861  1.00 66.13  ? 907  ASP B OD2 1 
ATOM   1516 N N   . GLU B 1 30  ? 4.559   36.326  15.726  1.00 54.27  ? 908  GLU B N   1 
ATOM   1517 C CA  . GLU B 1 30  ? 3.540   35.815  16.632  1.00 53.62  ? 908  GLU B CA  1 
ATOM   1518 C C   . GLU B 1 30  ? 3.188   34.348  16.337  1.00 52.93  ? 908  GLU B C   1 
ATOM   1519 O O   . GLU B 1 30  ? 2.866   33.587  17.258  1.00 52.86  ? 908  GLU B O   1 
ATOM   1520 C CB  . GLU B 1 30  ? 2.283   36.688  16.660  1.00 57.12  ? 908  GLU B CB  1 
ATOM   1521 C CG  . GLU B 1 30  ? 1.258   36.281  17.764  1.00 60.01  ? 908  GLU B CG  1 
ATOM   1522 C CD  . GLU B 1 30  ? 1.567   36.868  19.172  1.00 63.42  ? 908  GLU B CD  1 
ATOM   1523 O OE1 . GLU B 1 30  ? 2.333   37.869  19.270  1.00 65.70  ? 908  GLU B OE1 1 
ATOM   1524 O OE2 . GLU B 1 30  ? 1.029   36.329  20.175  1.00 62.98  ? 908  GLU B OE2 1 
ATOM   1525 N N   . ALA B 1 31  ? 3.256   33.968  15.053  1.00 49.03  ? 909  ALA B N   1 
ATOM   1526 C CA  . ALA B 1 31  ? 2.949   32.629  14.597  1.00 47.92  ? 909  ALA B CA  1 
ATOM   1527 C C   . ALA B 1 31  ? 4.145   31.672  14.689  1.00 47.84  ? 909  ALA B C   1 
ATOM   1528 O O   . ALA B 1 31  ? 3.972   30.447  14.757  1.00 48.11  ? 909  ALA B O   1 
ATOM   1529 C CB  . ALA B 1 31  ? 2.393   32.666  13.190  1.00 47.56  ? 909  ALA B CB  1 
ATOM   1530 N N   . ARG B 1 32  ? 5.359   32.198  14.675  1.00 48.23  ? 910  ARG B N   1 
ATOM   1531 C CA  . ARG B 1 32  ? 6.508   31.323  14.795  1.00 48.82  ? 910  ARG B CA  1 
ATOM   1532 C C   . ARG B 1 32  ? 6.625   30.876  16.255  1.00 48.45  ? 910  ARG B C   1 
ATOM   1533 O O   . ARG B 1 32  ? 7.417   29.996  16.589  1.00 48.39  ? 910  ARG B O   1 
ATOM   1534 C CB  . ARG B 1 32  ? 7.785   32.038  14.371  1.00 57.56  ? 910  ARG B CB  1 
ATOM   1535 C CG  . ARG B 1 32  ? 8.384   32.888  15.492  1.00 60.61  ? 910  ARG B CG  1 
ATOM   1536 C CD  . ARG B 1 32  ? 9.119   34.162  14.993  1.00 64.47  ? 910  ARG B CD  1 
ATOM   1537 N NE  . ARG B 1 32  ? 10.555  34.013  15.166  1.00 68.54  ? 910  ARG B NE  1 
ATOM   1538 C CZ  . ARG B 1 32  ? 11.222  32.959  14.705  1.00 69.89  ? 910  ARG B CZ  1 
ATOM   1539 N NH1 . ARG B 1 32  ? 10.569  31.996  14.025  1.00 68.57  ? 910  ARG B NH1 1 
ATOM   1540 N NH2 . ARG B 1 32  ? 12.533  32.860  14.915  1.00 69.98  ? 910  ARG B NH2 1 
ATOM   1541 N N   . LYS B 1 33  ? 5.818   31.478  17.126  1.00 47.84  ? 911  LYS B N   1 
ATOM   1542 C CA  . LYS B 1 33  ? 5.800   31.126  18.540  1.00 46.87  ? 911  LYS B CA  1 
ATOM   1543 C C   . LYS B 1 33  ? 5.218   29.703  18.684  1.00 46.48  ? 911  LYS B C   1 
ATOM   1544 O O   . LYS B 1 33  ? 5.475   28.994  19.655  1.00 46.03  ? 911  LYS B O   1 
ATOM   1545 C CB  . LYS B 1 33  ? 4.906   32.110  19.290  1.00 50.03  ? 911  LYS B CB  1 
ATOM   1546 C CG  . LYS B 1 33  ? 5.573   33.400  19.728  1.00 50.91  ? 911  LYS B CG  1 
ATOM   1547 C CD  . LYS B 1 33  ? 4.619   34.188  20.644  1.00 54.04  ? 911  LYS B CD  1 
ATOM   1548 C CE  . LYS B 1 33  ? 5.315   35.316  21.414  1.00 56.01  ? 911  LYS B CE  1 
ATOM   1549 N NZ  . LYS B 1 33  ? 5.331   35.149  22.945  1.00 60.83  ? 911  LYS B NZ  1 
ATOM   1550 N N   . TRP B 1 34  ? 4.408   29.299  17.721  1.00 45.83  ? 912  TRP B N   1 
ATOM   1551 C CA  . TRP B 1 34  ? 3.776   27.996  17.786  1.00 45.72  ? 912  TRP B CA  1 
ATOM   1552 C C   . TRP B 1 34  ? 4.173   26.989  16.705  1.00 45.71  ? 912  TRP B C   1 
ATOM   1553 O O   . TRP B 1 34  ? 4.628   27.344  15.594  1.00 46.20  ? 912  TRP B O   1 
ATOM   1554 C CB  . TRP B 1 34  ? 2.263   28.160  17.726  1.00 44.37  ? 912  TRP B CB  1 
ATOM   1555 C CG  . TRP B 1 34  ? 1.745   29.208  18.596  1.00 44.81  ? 912  TRP B CG  1 
ATOM   1556 C CD1 . TRP B 1 34  ? 1.566   30.507  18.279  1.00 46.62  ? 912  TRP B CD1 1 
ATOM   1557 C CD2 . TRP B 1 34  ? 1.369   29.063  19.967  1.00 46.18  ? 912  TRP B CD2 1 
ATOM   1558 N NE1 . TRP B 1 34  ? 1.093   31.200  19.377  1.00 47.48  ? 912  TRP B NE1 1 
ATOM   1559 C CE2 . TRP B 1 34  ? 1.009   30.333  20.435  1.00 47.82  ? 912  TRP B CE2 1 
ATOM   1560 C CE3 . TRP B 1 34  ? 1.379   27.992  20.866  1.00 44.98  ? 912  TRP B CE3 1 
ATOM   1561 C CZ2 . TRP B 1 34  ? 0.624   30.551  21.746  1.00 47.66  ? 912  TRP B CZ2 1 
ATOM   1562 C CZ3 . TRP B 1 34  ? 0.948   28.198  22.142  1.00 44.61  ? 912  TRP B CZ3 1 
ATOM   1563 C CH2 . TRP B 1 34  ? 0.581   29.464  22.578  1.00 46.66  ? 912  TRP B CH2 1 
ATOM   1564 N N   . SER B 1 35  ? 3.909   25.722  17.003  1.00 45.87  ? 913  SER B N   1 
ATOM   1565 C CA  . SER B 1 35  ? 4.170   24.676  16.035  1.00 45.43  ? 913  SER B CA  1 
ATOM   1566 C C   . SER B 1 35  ? 2.986   24.607  15.071  1.00 44.48  ? 913  SER B C   1 
ATOM   1567 O O   . SER B 1 35  ? 1.825   24.658  15.505  1.00 44.63  ? 913  SER B O   1 
ATOM   1568 C CB  . SER B 1 35  ? 4.334   23.328  16.757  1.00 49.75  ? 913  SER B CB  1 
ATOM   1569 O OG  . SER B 1 35  ? 3.942   22.215  15.950  1.00 50.21  ? 913  SER B OG  1 
ATOM   1570 N N   . SER B 1 36  ? 3.280   24.468  13.778  1.00 43.76  ? 914  SER B N   1 
ATOM   1571 C CA  . SER B 1 36  ? 2.230   24.288  12.744  1.00 43.14  ? 914  SER B CA  1 
ATOM   1572 C C   . SER B 1 36  ? 1.426   22.966  12.867  1.00 42.35  ? 914  SER B C   1 
ATOM   1573 O O   . SER B 1 36  ? 0.295   22.864  12.388  1.00 42.13  ? 914  SER B O   1 
ATOM   1574 C CB  . SER B 1 36  ? 2.834   24.382  11.327  1.00 45.85  ? 914  SER B CB  1 
ATOM   1575 O OG  . SER B 1 36  ? 3.600   25.568  11.165  1.00 46.91  ? 914  SER B OG  1 
ATOM   1576 N N   . LYS B 1 37  ? 2.046   21.966  13.495  1.00 42.41  ? 915  LYS B N   1 
ATOM   1577 C CA  . LYS B 1 37  ? 1.515   20.615  13.661  1.00 41.99  ? 915  LYS B CA  1 
ATOM   1578 C C   . LYS B 1 37  ? 0.099   20.517  14.242  1.00 42.02  ? 915  LYS B C   1 
ATOM   1579 O O   . LYS B 1 37  ? -0.101  20.594  15.460  1.00 42.12  ? 915  LYS B O   1 
ATOM   1580 C CB  . LYS B 1 37  ? 2.477   19.816  14.538  1.00 46.12  ? 915  LYS B CB  1 
ATOM   1581 C CG  . LYS B 1 37  ? 2.537   18.299  14.281  1.00 45.94  ? 915  LYS B CG  1 
ATOM   1582 C CD  . LYS B 1 37  ? 1.264   17.590  14.719  1.00 46.45  ? 915  LYS B CD  1 
ATOM   1583 C CE  . LYS B 1 37  ? 1.511   16.128  15.011  1.00 45.34  ? 915  LYS B CE  1 
ATOM   1584 N NZ  . LYS B 1 37  ? 0.317   15.635  15.723  1.00 46.18  ? 915  LYS B NZ  1 
ATOM   1585 N N   . GLY B 1 38  ? -0.893  20.307  13.392  1.00 41.94  ? 916  GLY B N   1 
ATOM   1586 C CA  . GLY B 1 38  ? -2.238  20.181  13.913  1.00 41.58  ? 916  GLY B CA  1 
ATOM   1587 C C   . GLY B 1 38  ? -3.007  21.469  14.156  1.00 41.55  ? 916  GLY B C   1 
ATOM   1588 O O   . GLY B 1 38  ? -4.104  21.428  14.728  1.00 41.34  ? 916  GLY B O   1 
ATOM   1589 N N   . ASN B 1 39  ? -2.462  22.587  13.674  1.00 43.00  ? 917  ASN B N   1 
ATOM   1590 C CA  . ASN B 1 39  ? -3.057  23.912  13.810  1.00 43.01  ? 917  ASN B CA  1 
ATOM   1591 C C   . ASN B 1 39  ? -2.929  24.682  12.472  1.00 43.84  ? 917  ASN B C   1 
ATOM   1592 O O   . ASN B 1 39  ? -1.903  25.300  12.191  1.00 43.88  ? 917  ASN B O   1 
ATOM   1593 C CB  . ASN B 1 39  ? -2.311  24.643  14.910  1.00 40.88  ? 917  ASN B CB  1 
ATOM   1594 C CG  . ASN B 1 39  ? -2.900  25.971  15.221  1.00 40.33  ? 917  ASN B CG  1 
ATOM   1595 O OD1 . ASN B 1 39  ? -3.700  26.509  14.468  1.00 40.71  ? 917  ASN B OD1 1 
ATOM   1596 N ND2 . ASN B 1 39  ? -2.450  26.556  16.315  1.00 41.22  ? 917  ASN B ND2 1 
ATOM   1597 N N   . ASP B 1 40  ? -3.963  24.622  11.633  1.00 45.60  ? 918  ASP B N   1 
ATOM   1598 C CA  . ASP B 1 40  ? -3.937  25.279  10.326  1.00 46.22  ? 918  ASP B CA  1 
ATOM   1599 C C   . ASP B 1 40  ? -4.017  26.795  10.437  1.00 46.29  ? 918  ASP B C   1 
ATOM   1600 O O   . ASP B 1 40  ? -3.735  27.527  9.496   1.00 46.70  ? 918  ASP B O   1 
ATOM   1601 C CB  . ASP B 1 40  ? -5.086  24.767  9.468   1.00 51.59  ? 918  ASP B CB  1 
ATOM   1602 C CG  . ASP B 1 40  ? -4.722  23.505  8.718   1.00 55.53  ? 918  ASP B CG  1 
ATOM   1603 O OD1 . ASP B 1 40  ? -3.523  23.106  8.804   1.00 59.18  ? 918  ASP B OD1 1 
ATOM   1604 O OD2 . ASP B 1 40  ? -5.621  22.916  8.054   1.00 54.74  ? 918  ASP B OD2 1 
ATOM   1605 N N   . ILE B 1 41  ? -4.405  27.270  11.603  1.00 41.77  ? 919  ILE B N   1 
ATOM   1606 C CA  . ILE B 1 41  ? -4.475  28.697  11.835  1.00 41.38  ? 919  ILE B CA  1 
ATOM   1607 C C   . ILE B 1 41  ? -3.048  29.253  11.762  1.00 40.86  ? 919  ILE B C   1 
ATOM   1608 O O   . ILE B 1 41  ? -2.814  30.313  11.160  1.00 40.44  ? 919  ILE B O   1 
ATOM   1609 C CB  . ILE B 1 41  ? -5.143  28.999  13.191  1.00 43.31  ? 919  ILE B CB  1 
ATOM   1610 C CG1 . ILE B 1 41  ? -6.664  28.838  13.083  1.00 43.79  ? 919  ILE B CG1 1 
ATOM   1611 C CG2 . ILE B 1 41  ? -4.721  30.358  13.689  1.00 42.47  ? 919  ILE B CG2 1 
ATOM   1612 C CD1 . ILE B 1 41  ? -7.456  29.921  13.772  1.00 46.96  ? 919  ILE B CD1 1 
ATOM   1613 N N   . ILE B 1 42  ? -2.102  28.507  12.345  1.00 37.18  ? 920  ILE B N   1 
ATOM   1614 C CA  . ILE B 1 42  ? -0.691  28.893  12.345  1.00 36.49  ? 920  ILE B CA  1 
ATOM   1615 C C   . ILE B 1 42  ? -0.063  28.710  10.970  1.00 36.04  ? 920  ILE B C   1 
ATOM   1616 O O   . ILE B 1 42  ? 0.707   29.541  10.475  1.00 35.54  ? 920  ILE B O   1 
ATOM   1617 C CB  . ILE B 1 42  ? 0.120   28.131  13.406  1.00 39.44  ? 920  ILE B CB  1 
ATOM   1618 C CG1 . ILE B 1 42  ? -0.545  28.241  14.790  1.00 37.36  ? 920  ILE B CG1 1 
ATOM   1619 C CG2 . ILE B 1 42  ? 1.538   28.699  13.437  1.00 39.46  ? 920  ILE B CG2 1 
ATOM   1620 C CD1 . ILE B 1 42  ? -0.491  29.647  15.348  1.00 32.87  ? 920  ILE B CD1 1 
ATOM   1621 N N   . ALA B 1 43  ? -0.400  27.598  10.352  1.00 35.71  ? 921  ALA B N   1 
ATOM   1622 C CA  . ALA B 1 43  ? 0.063   27.320  9.012   1.00 35.46  ? 921  ALA B CA  1 
ATOM   1623 C C   . ALA B 1 43  ? -0.386  28.439  8.060   1.00 35.40  ? 921  ALA B C   1 
ATOM   1624 O O   . ALA B 1 43  ? 0.407   28.931  7.243   1.00 35.40  ? 921  ALA B O   1 
ATOM   1625 C CB  . ALA B 1 43  ? -0.500  26.039  8.578   1.00 36.19  ? 921  ALA B CB  1 
ATOM   1626 N N   . ALA B 1 44  ? -1.662  28.823  8.165   1.00 34.67  ? 922  ALA B N   1 
ATOM   1627 C CA  . ALA B 1 44  ? -2.215  29.911  7.351   1.00 33.92  ? 922  ALA B CA  1 
ATOM   1628 C C   . ALA B 1 44  ? -1.474  31.222  7.602   1.00 33.53  ? 922  ALA B C   1 
ATOM   1629 O O   . ALA B 1 44  ? -0.978  31.856  6.670   1.00 33.77  ? 922  ALA B O   1 
ATOM   1630 C CB  . ALA B 1 44  ? -3.686  30.083  7.629   1.00 33.81  ? 922  ALA B CB  1 
ATOM   1631 N N   . ALA B 1 45  ? -1.407  31.623  8.870   1.00 34.36  ? 923  ALA B N   1 
ATOM   1632 C CA  . ALA B 1 45  ? -0.718  32.846  9.261   1.00 34.18  ? 923  ALA B CA  1 
ATOM   1633 C C   . ALA B 1 45  ? 0.736   32.893  8.713   1.00 34.57  ? 923  ALA B C   1 
ATOM   1634 O O   . ALA B 1 45  ? 1.190   33.911  8.163   1.00 35.14  ? 923  ALA B O   1 
ATOM   1635 C CB  . ALA B 1 45  ? -0.739  33.012  10.785  1.00 33.89  ? 923  ALA B CB  1 
ATOM   1636 N N   . LYS B 1 46  ? 1.483   31.805  8.844   1.00 34.41  ? 924  LYS B N   1 
ATOM   1637 C CA  . LYS B 1 46  ? 2.838   31.814  8.323   1.00 34.32  ? 924  LYS B CA  1 
ATOM   1638 C C   . LYS B 1 46  ? 2.830   32.092  6.813   1.00 34.55  ? 924  LYS B C   1 
ATOM   1639 O O   . LYS B 1 46  ? 3.627   32.894  6.309   1.00 34.71  ? 924  LYS B O   1 
ATOM   1640 C CB  . LYS B 1 46  ? 3.526   30.497  8.660   1.00 35.85  ? 924  LYS B CB  1 
ATOM   1641 C CG  . LYS B 1 46  ? 3.984   30.440  10.116  1.00 37.05  ? 924  LYS B CG  1 
ATOM   1642 C CD  . LYS B 1 46  ? 4.185   29.020  10.597  1.00 38.86  ? 924  LYS B CD  1 
ATOM   1643 C CE  . LYS B 1 46  ? 4.545   28.985  12.093  1.00 42.03  ? 924  LYS B CE  1 
ATOM   1644 N NZ  . LYS B 1 46  ? 4.966   27.594  12.610  1.00 41.71  ? 924  LYS B NZ  1 
ATOM   1645 N N   . ARG B 1 47  ? 1.892   31.461  6.103   1.00 36.42  ? 925  ARG B N   1 
ATOM   1646 C CA  . ARG B 1 47  ? 1.745   31.633  4.652   1.00 35.88  ? 925  ARG B CA  1 
ATOM   1647 C C   . ARG B 1 47  ? 1.424   33.081  4.281   1.00 36.59  ? 925  ARG B C   1 
ATOM   1648 O O   . ARG B 1 47  ? 2.080   33.657  3.392   1.00 35.94  ? 925  ARG B O   1 
ATOM   1649 C CB  . ARG B 1 47  ? 0.638   30.753  4.151   1.00 37.20  ? 925  ARG B CB  1 
ATOM   1650 C CG  . ARG B 1 47  ? 1.075   29.419  3.659   1.00 35.25  ? 925  ARG B CG  1 
ATOM   1651 C CD  . ARG B 1 47  ? -0.154  28.775  2.979   1.00 32.71  ? 925  ARG B CD  1 
ATOM   1652 N NE  . ARG B 1 47  ? -0.845  27.843  3.861   1.00 31.47  ? 925  ARG B NE  1 
ATOM   1653 C CZ  . ARG B 1 47  ? -2.148  27.874  4.130   1.00 29.46  ? 925  ARG B CZ  1 
ATOM   1654 N NH1 . ARG B 1 47  ? -2.951  28.795  3.604   1.00 27.30  ? 925  ARG B NH1 1 
ATOM   1655 N NH2 . ARG B 1 47  ? -2.651  26.972  4.963   1.00 32.52  ? 925  ARG B NH2 1 
ATOM   1656 N N   . MET B 1 48  ? 0.426   33.659  4.974   1.00 36.41  ? 926  MET B N   1 
ATOM   1657 C CA  . MET B 1 48  ? 0.038   35.067  4.792   1.00 37.37  ? 926  MET B CA  1 
ATOM   1658 C C   . MET B 1 48  ? 1.246   35.954  5.024   1.00 37.49  ? 926  MET B C   1 
ATOM   1659 O O   . MET B 1 48  ? 1.552   36.769  4.181   1.00 37.99  ? 926  MET B O   1 
ATOM   1660 C CB  . MET B 1 48  ? -1.065  35.496  5.758   1.00 40.03  ? 926  MET B CB  1 
ATOM   1661 C CG  . MET B 1 48  ? -2.439  35.040  5.378   1.00 42.57  ? 926  MET B CG  1 
ATOM   1662 S SD  . MET B 1 48  ? -3.789  35.615  6.485   1.00 47.87  ? 926  MET B SD  1 
ATOM   1663 C CE  . MET B 1 48  ? -3.563  37.425  6.380   1.00 44.45  ? 926  MET B CE  1 
ATOM   1664 N N   . ALA B 1 49  ? 1.943   35.781  6.152   1.00 35.75  ? 927  ALA B N   1 
ATOM   1665 C CA  . ALA B 1 49  ? 3.104   36.611  6.458   1.00 36.24  ? 927  ALA B CA  1 
ATOM   1666 C C   . ALA B 1 49  ? 4.094   36.577  5.321   1.00 36.77  ? 927  ALA B C   1 
ATOM   1667 O O   . ALA B 1 49  ? 4.643   37.633  4.948   1.00 36.03  ? 927  ALA B O   1 
ATOM   1668 C CB  . ALA B 1 49  ? 3.768   36.194  7.726   1.00 36.13  ? 927  ALA B CB  1 
ATOM   1669 N N   . LEU B 1 50  ? 4.301   35.372  4.758   1.00 39.03  ? 928  LEU B N   1 
ATOM   1670 C CA  . LEU B 1 50  ? 5.232   35.144  3.631   1.00 39.33  ? 928  LEU B CA  1 
ATOM   1671 C C   . LEU B 1 50  ? 4.792   35.818  2.326   1.00 39.87  ? 928  LEU B C   1 
ATOM   1672 O O   . LEU B 1 50  ? 5.621   36.305  1.563   1.00 40.67  ? 928  LEU B O   1 
ATOM   1673 C CB  . LEU B 1 50  ? 5.385   33.638  3.392   1.00 38.79  ? 928  LEU B CB  1 
ATOM   1674 C CG  . LEU B 1 50  ? 6.682   32.917  3.819   1.00 38.67  ? 928  LEU B CG  1 
ATOM   1675 C CD1 . LEU B 1 50  ? 7.541   33.772  4.750   1.00 37.10  ? 928  LEU B CD1 1 
ATOM   1676 C CD2 . LEU B 1 50  ? 6.378   31.558  4.452   1.00 37.46  ? 928  LEU B CD2 1 
ATOM   1677 N N   . LEU B 1 51  ? 3.488   35.812  2.061   1.00 39.43  ? 929  LEU B N   1 
ATOM   1678 C CA  . LEU B 1 51  ? 2.928   36.409  0.841   1.00 39.42  ? 929  LEU B CA  1 
ATOM   1679 C C   . LEU B 1 51  ? 2.894   37.930  0.913   1.00 39.88  ? 929  LEU B C   1 
ATOM   1680 O O   . LEU B 1 51  ? 2.732   38.611  -0.116  1.00 39.33  ? 929  LEU B O   1 
ATOM   1681 C CB  . LEU B 1 51  ? 1.494   35.935  0.642   1.00 39.39  ? 929  LEU B CB  1 
ATOM   1682 C CG  . LEU B 1 51  ? 1.354   34.494  0.244   1.00 37.11  ? 929  LEU B CG  1 
ATOM   1683 C CD1 . LEU B 1 51  ? 0.063   34.051  0.835   1.00 36.05  ? 929  LEU B CD1 1 
ATOM   1684 C CD2 . LEU B 1 51  ? 1.326   34.452  -1.260  1.00 34.87  ? 929  LEU B CD2 1 
ATOM   1685 N N   . MET B 1 52  ? 2.970   38.433  2.155   1.00 41.70  ? 930  MET B N   1 
ATOM   1686 C CA  . MET B 1 52  ? 2.932   39.872  2.473   1.00 41.80  ? 930  MET B CA  1 
ATOM   1687 C C   . MET B 1 52  ? 4.301   40.423  2.193   1.00 41.62  ? 930  MET B C   1 
ATOM   1688 O O   . MET B 1 52  ? 4.468   41.556  1.780   1.00 40.83  ? 930  MET B O   1 
ATOM   1689 C CB  . MET B 1 52  ? 2.653   40.068  3.951   1.00 45.08  ? 930  MET B CB  1 
ATOM   1690 C CG  . MET B 1 52  ? 2.322   41.482  4.300   1.00 48.21  ? 930  MET B CG  1 
ATOM   1691 S SD  . MET B 1 52  ? 0.957   41.911  3.248   1.00 54.81  ? 930  MET B SD  1 
ATOM   1692 C CE  . MET B 1 52  ? 0.027   40.307  3.347   1.00 53.17  ? 930  MET B CE  1 
ATOM   1693 N N   . ALA B 1 53  ? 5.285   39.587  2.467   1.00 41.61  ? 931  ALA B N   1 
ATOM   1694 C CA  . ALA B 1 53  ? 6.656   39.930  2.202   1.00 42.90  ? 931  ALA B CA  1 
ATOM   1695 C C   . ALA B 1 53  ? 6.800   39.925  0.676   1.00 43.86  ? 931  ALA B C   1 
ATOM   1696 O O   . ALA B 1 53  ? 7.488   40.791  0.116   1.00 44.79  ? 931  ALA B O   1 
ATOM   1697 C CB  . ALA B 1 53  ? 7.580   38.927  2.837   1.00 43.18  ? 931  ALA B CB  1 
ATOM   1698 N N   . GLU B 1 54  ? 6.129   38.995  -0.008  1.00 43.94  ? 932  GLU B N   1 
ATOM   1699 C CA  . GLU B 1 54  ? 6.217   39.005  -1.462  1.00 44.26  ? 932  GLU B CA  1 
ATOM   1700 C C   . GLU B 1 54  ? 5.570   40.296  -1.994  1.00 44.38  ? 932  GLU B C   1 
ATOM   1701 O O   . GLU B 1 54  ? 5.996   40.872  -3.006  1.00 43.80  ? 932  GLU B O   1 
ATOM   1702 C CB  . GLU B 1 54  ? 5.537   37.792  -2.094  1.00 44.73  ? 932  GLU B CB  1 
ATOM   1703 C CG  . GLU B 1 54  ? 4.974   38.109  -3.500  1.00 47.46  ? 932  GLU B CG  1 
ATOM   1704 C CD  . GLU B 1 54  ? 4.475   36.879  -4.307  1.00 51.64  ? 932  GLU B CD  1 
ATOM   1705 O OE1 . GLU B 1 54  ? 4.660   36.891  -5.566  1.00 51.08  ? 932  GLU B OE1 1 
ATOM   1706 O OE2 . GLU B 1 54  ? 3.855   35.944  -3.700  1.00 51.20  ? 932  GLU B OE2 1 
ATOM   1707 N N   . MET B 1 55  ? 4.529   40.758  -1.308  1.00 45.45  ? 933  MET B N   1 
ATOM   1708 C CA  . MET B 1 55  ? 3.828   41.947  -1.750  1.00 45.49  ? 933  MET B CA  1 
ATOM   1709 C C   . MET B 1 55  ? 4.677   43.227  -1.624  1.00 45.70  ? 933  MET B C   1 
ATOM   1710 O O   . MET B 1 55  ? 4.618   44.102  -2.494  1.00 45.83  ? 933  MET B O   1 
ATOM   1711 C CB  . MET B 1 55  ? 2.504   42.057  -1.025  1.00 48.37  ? 933  MET B CB  1 
ATOM   1712 C CG  . MET B 1 55  ? 1.569   43.082  -1.583  1.00 50.25  ? 933  MET B CG  1 
ATOM   1713 S SD  . MET B 1 55  ? -0.191  42.588  -1.409  1.00 55.13  ? 933  MET B SD  1 
ATOM   1714 C CE  . MET B 1 55  ? -0.440  41.821  -3.103  1.00 50.18  ? 933  MET B CE  1 
ATOM   1715 N N   . SER B 1 56  ? 5.494   43.331  -0.574  1.00 43.50  ? 934  SER B N   1 
ATOM   1716 C CA  . SER B 1 56  ? 6.330   44.512  -0.410  1.00 43.54  ? 934  SER B CA  1 
ATOM   1717 C C   . SER B 1 56  ? 7.365   44.532  -1.541  1.00 44.15  ? 934  SER B C   1 
ATOM   1718 O O   . SER B 1 56  ? 7.707   45.577  -2.092  1.00 44.25  ? 934  SER B O   1 
ATOM   1719 C CB  . SER B 1 56  ? 6.960   44.596  0.992   1.00 46.14  ? 934  SER B CB  1 
ATOM   1720 O OG  . SER B 1 56  ? 7.815   43.502  1.262   1.00 45.12  ? 934  SER B OG  1 
ATOM   1721 N N   . ARG B 1 57  ? 7.785   43.359  -1.966  1.00 46.96  ? 935  ARG B N   1 
ATOM   1722 C CA  . ARG B 1 57  ? 8.647   43.306  -3.115  1.00 47.76  ? 935  ARG B CA  1 
ATOM   1723 C C   . ARG B 1 57  ? 7.812   43.707  -4.367  1.00 48.27  ? 935  ARG B C   1 
ATOM   1724 O O   . ARG B 1 57  ? 8.158   44.641  -5.097  1.00 47.47  ? 935  ARG B O   1 
ATOM   1725 C CB  . ARG B 1 57  ? 9.231   41.900  -3.263  1.00 54.33  ? 935  ARG B CB  1 
ATOM   1726 C CG  . ARG B 1 57  ? 10.189  41.489  -2.145  1.00 54.85  ? 935  ARG B CG  1 
ATOM   1727 C CD  . ARG B 1 57  ? 10.826  40.113  -2.405  1.00 55.60  ? 935  ARG B CD  1 
ATOM   1728 N NE  . ARG B 1 57  ? 10.234  39.055  -1.579  1.00 60.96  ? 935  ARG B NE  1 
ATOM   1729 C CZ  . ARG B 1 57  ? 9.576   38.004  -2.076  1.00 63.15  ? 935  ARG B CZ  1 
ATOM   1730 N NH1 . ARG B 1 57  ? 9.443   37.881  -3.396  1.00 64.73  ? 935  ARG B NH1 1 
ATOM   1731 N NH2 . ARG B 1 57  ? 9.048   37.079  -1.267  1.00 62.83  ? 935  ARG B NH2 1 
ATOM   1732 N N   . LEU B 1 58  ? 6.703   43.012  -4.608  1.00 48.34  ? 936  LEU B N   1 
ATOM   1733 C CA  . LEU B 1 58  ? 5.870   43.327  -5.774  1.00 49.42  ? 936  LEU B CA  1 
ATOM   1734 C C   . LEU B 1 58  ? 5.556   44.808  -5.896  1.00 50.35  ? 936  LEU B C   1 
ATOM   1735 O O   . LEU B 1 58  ? 5.561   45.367  -7.015  1.00 49.82  ? 936  LEU B O   1 
ATOM   1736 C CB  . LEU B 1 58  ? 4.556   42.542  -5.771  1.00 48.10  ? 936  LEU B CB  1 
ATOM   1737 C CG  . LEU B 1 58  ? 4.729   41.060  -6.031  1.00 46.89  ? 936  LEU B CG  1 
ATOM   1738 C CD1 . LEU B 1 58  ? 3.379   40.340  -6.062  1.00 43.46  ? 936  LEU B CD1 1 
ATOM   1739 C CD2 . LEU B 1 58  ? 5.531   40.870  -7.292  1.00 41.81  ? 936  LEU B CD2 1 
ATOM   1740 N N   . VAL B 1 59  ? 5.251   45.412  -4.743  1.00 54.56  ? 937  VAL B N   1 
ATOM   1741 C CA  . VAL B 1 59  ? 4.882   46.826  -4.643  1.00 56.36  ? 937  VAL B CA  1 
ATOM   1742 C C   . VAL B 1 59  ? 5.905   47.832  -5.231  1.00 57.89  ? 937  VAL B C   1 
ATOM   1743 O O   . VAL B 1 59  ? 5.610   49.015  -5.401  1.00 57.88  ? 937  VAL B O   1 
ATOM   1744 C CB  . VAL B 1 59  ? 4.362   47.166  -3.235  1.00 57.55  ? 937  VAL B CB  1 
ATOM   1745 C CG1 . VAL B 1 59  ? 5.220   48.231  -2.540  1.00 56.83  ? 937  VAL B CG1 1 
ATOM   1746 C CG2 . VAL B 1 59  ? 2.915   47.560  -3.304  1.00 58.22  ? 937  VAL B CG2 1 
ATOM   1747 N N   . ARG B 1 60  ? 7.080   47.329  -5.602  1.00 66.79  ? 938  ARG B N   1 
ATOM   1748 C CA  . ARG B 1 60  ? 8.096   48.126  -6.280  1.00 68.43  ? 938  ARG B CA  1 
ATOM   1749 C C   . ARG B 1 60  ? 8.149   47.657  -7.755  1.00 69.44  ? 938  ARG B C   1 
ATOM   1750 O O   . ARG B 1 60  ? 8.294   48.456  -8.679  1.00 69.67  ? 938  ARG B O   1 
ATOM   1751 C CB  . ARG B 1 60  ? 9.457   47.929  -5.607  1.00 72.50  ? 938  ARG B CB  1 
ATOM   1752 C CG  . ARG B 1 60  ? 9.378   47.668  -4.107  1.00 74.76  ? 938  ARG B CG  1 
ATOM   1753 C CD  . ARG B 1 60  ? 8.732   48.831  -3.399  1.00 80.13  ? 938  ARG B CD  1 
ATOM   1754 N NE  . ARG B 1 60  ? 9.041   50.063  -4.119  1.00 84.68  ? 938  ARG B NE  1 
ATOM   1755 C CZ  . ARG B 1 60  ? 10.086  50.870  -3.878  1.00 88.11  ? 938  ARG B CZ  1 
ATOM   1756 N NH1 . ARG B 1 60  ? 10.939  50.622  -2.875  1.00 89.69  ? 938  ARG B NH1 1 
ATOM   1757 N NH2 . ARG B 1 60  ? 10.263  51.954  -4.642  1.00 88.98  ? 938  ARG B NH2 1 
ATOM   1758 N N   . GLY B 1 61  ? 7.970   46.353  -7.953  1.00 74.02  ? 939  GLY B N   1 
ATOM   1759 C CA  . GLY B 1 61  ? 8.003   45.656  -9.232  1.00 74.75  ? 939  GLY B CA  1 
ATOM   1760 C C   . GLY B 1 61  ? 8.012   46.358  -10.588 1.00 75.29  ? 939  GLY B C   1 
ATOM   1761 O O   . GLY B 1 61  ? 8.401   45.719  -11.589 1.00 75.41  ? 939  GLY B O   1 
ATOM   1762 N N   . GLY B 1 62  ? 7.536   47.609  -10.659 1.00 78.19  ? 940  GLY B N   1 
ATOM   1763 C CA  . GLY B 1 62  ? 7.455   48.361  -11.914 1.00 78.44  ? 940  GLY B CA  1 
ATOM   1764 C C   . GLY B 1 62  ? 6.456   47.726  -12.882 1.00 78.94  ? 940  GLY B C   1 
ATOM   1765 O O   . GLY B 1 62  ? 5.365   48.260  -13.161 1.00 79.15  ? 940  GLY B O   1 
ATOM   1766 N N   . SER B 1 63  ? 6.824   46.553  -13.383 1.00 79.49  ? 941  SER B N   1 
ATOM   1767 C CA  . SER B 1 63  ? 5.922   45.779  -14.232 1.00 79.27  ? 941  SER B CA  1 
ATOM   1768 C C   . SER B 1 63  ? 6.238   44.289  -14.318 1.00 78.86  ? 941  SER B C   1 
ATOM   1769 O O   . SER B 1 63  ? 7.335   43.832  -13.936 1.00 78.78  ? 941  SER B O   1 
ATOM   1770 C CB  . SER B 1 63  ? 5.582   46.442  -15.585 1.00 85.16  ? 941  SER B CB  1 
ATOM   1771 O OG  . SER B 1 63  ? 4.306   46.012  -16.059 1.00 83.07  ? 941  SER B OG  1 
ATOM   1772 N N   . GLY B 1 64  ? 5.220   43.558  -14.765 1.00 73.16  ? 942  GLY B N   1 
ATOM   1773 C CA  . GLY B 1 64  ? 5.200   42.120  -14.827 1.00 72.11  ? 942  GLY B CA  1 
ATOM   1774 C C   . GLY B 1 64  ? 4.649   41.790  -13.461 1.00 71.21  ? 942  GLY B C   1 
ATOM   1775 O O   . GLY B 1 64  ? 4.245   40.650  -13.160 1.00 72.00  ? 942  GLY B O   1 
ATOM   1776 N N   . THR B 1 65  ? 4.639   42.830  -12.627 1.00 63.63  ? 943  THR B N   1 
ATOM   1777 C CA  . THR B 1 65  ? 4.158   42.707  -11.271 1.00 61.61  ? 943  THR B CA  1 
ATOM   1778 C C   . THR B 1 65  ? 2.654   42.852  -11.276 1.00 60.73  ? 943  THR B C   1 
ATOM   1779 O O   . THR B 1 65  ? 2.004   42.457  -10.327 1.00 60.20  ? 943  THR B O   1 
ATOM   1780 C CB  . THR B 1 65  ? 4.855   43.684  -10.311 1.00 57.15  ? 943  THR B CB  1 
ATOM   1781 O OG1 . THR B 1 65  ? 4.670   45.018  -10.769 1.00 56.71  ? 943  THR B OG1 1 
ATOM   1782 C CG2 . THR B 1 65  ? 6.332   43.386  -10.235 1.00 55.90  ? 943  THR B CG2 1 
ATOM   1783 N N   . LYS B 1 66  ? 2.104   43.385  -12.364 1.00 55.68  ? 944  LYS B N   1 
ATOM   1784 C CA  . LYS B 1 66  ? 0.653   43.537  -12.486 1.00 55.06  ? 944  LYS B CA  1 
ATOM   1785 C C   . LYS B 1 66  ? -0.021  42.215  -12.175 1.00 54.19  ? 944  LYS B C   1 
ATOM   1786 O O   . LYS B 1 66  ? -0.669  42.066  -11.147 1.00 54.26  ? 944  LYS B O   1 
ATOM   1787 C CB  . LYS B 1 66  ? 0.226   44.026  -13.882 1.00 57.32  ? 944  LYS B CB  1 
ATOM   1788 C CG  . LYS B 1 66  ? 1.354   44.069  -14.934 1.00 59.83  ? 944  LYS B CG  1 
ATOM   1789 C CD  . LYS B 1 66  ? 1.114   43.122  -16.162 1.00 62.74  ? 944  LYS B CD  1 
ATOM   1790 C CE  . LYS B 1 66  ? 2.299   42.195  -16.394 1.00 62.81  ? 944  LYS B CE  1 
ATOM   1791 N NZ  . LYS B 1 66  ? 2.296   41.124  -15.360 1.00 62.54  ? 944  LYS B NZ  1 
ATOM   1792 N N   . ARG B 1 67  ? 0.187   41.236  -13.038 1.00 48.95  ? 945  ARG B N   1 
ATOM   1793 C CA  . ARG B 1 67  ? -0.383  39.921  -12.839 1.00 48.08  ? 945  ARG B CA  1 
ATOM   1794 C C   . ARG B 1 67  ? -0.039  39.292  -11.493 1.00 46.81  ? 945  ARG B C   1 
ATOM   1795 O O   . ARG B 1 67  ? -0.914  38.718  -10.832 1.00 46.62  ? 945  ARG B O   1 
ATOM   1796 C CB  . ARG B 1 67  ? 0.041   39.014  -13.975 1.00 47.89  ? 945  ARG B CB  1 
ATOM   1797 C CG  . ARG B 1 67  ? -0.835  39.166  -15.189 1.00 49.51  ? 945  ARG B CG  1 
ATOM   1798 C CD  . ARG B 1 67  ? -0.985  37.840  -15.874 1.00 52.44  ? 945  ARG B CD  1 
ATOM   1799 N NE  . ARG B 1 67  ? 0.088   37.678  -16.838 1.00 54.51  ? 945  ARG B NE  1 
ATOM   1800 C CZ  . ARG B 1 67  ? 0.456   36.517  -17.365 1.00 56.08  ? 945  ARG B CZ  1 
ATOM   1801 N NH1 . ARG B 1 67  ? -0.187  35.386  -17.030 1.00 54.77  ? 945  ARG B NH1 1 
ATOM   1802 N NH2 . ARG B 1 67  ? 1.475   36.503  -18.233 1.00 56.38  ? 945  ARG B NH2 1 
ATOM   1803 N N   . ALA B 1 68  ? 1.226   39.398  -11.084 1.00 45.10  ? 946  ALA B N   1 
ATOM   1804 C CA  . ALA B 1 68  ? 1.637   38.855  -9.777  1.00 43.39  ? 946  ALA B CA  1 
ATOM   1805 C C   . ALA B 1 68  ? 0.909   39.508  -8.614  1.00 42.41  ? 946  ALA B C   1 
ATOM   1806 O O   . ALA B 1 68  ? 0.358   38.802  -7.767  1.00 43.03  ? 946  ALA B O   1 
ATOM   1807 C CB  . ALA B 1 68  ? 3.122   38.924  -9.564  1.00 42.89  ? 946  ALA B CB  1 
ATOM   1808 N N   . LEU B 1 69  ? 0.896   40.845  -8.584  1.00 39.79  ? 947  LEU B N   1 
ATOM   1809 C CA  . LEU B 1 69  ? 0.270   41.622  -7.506  1.00 38.53  ? 947  LEU B CA  1 
ATOM   1810 C C   . LEU B 1 69  ? -1.130  41.171  -7.232  1.00 38.53  ? 947  LEU B C   1 
ATOM   1811 O O   . LEU B 1 69  ? -1.487  40.859  -6.079  1.00 38.71  ? 947  LEU B O   1 
ATOM   1812 C CB  . LEU B 1 69  ? 0.203   43.083  -7.868  1.00 37.69  ? 947  LEU B CB  1 
ATOM   1813 C CG  . LEU B 1 69  ? 0.056   43.999  -6.668  1.00 37.29  ? 947  LEU B CG  1 
ATOM   1814 C CD1 . LEU B 1 69  ? 0.806   43.440  -5.442  1.00 38.84  ? 947  LEU B CD1 1 
ATOM   1815 C CD2 . LEU B 1 69  ? 0.595   45.360  -7.034  1.00 34.92  ? 947  LEU B CD2 1 
ATOM   1816 N N   . ILE B 1 70  ? -1.918  41.130  -8.308  1.00 39.25  ? 948  ILE B N   1 
ATOM   1817 C CA  . ILE B 1 70  ? -3.293  40.656  -8.268  1.00 38.51  ? 948  ILE B CA  1 
ATOM   1818 C C   . ILE B 1 70  ? -3.381  39.242  -7.666  1.00 38.76  ? 948  ILE B C   1 
ATOM   1819 O O   . ILE B 1 70  ? -4.052  39.050  -6.645  1.00 39.22  ? 948  ILE B O   1 
ATOM   1820 C CB  . ILE B 1 70  ? -3.906  40.689  -9.661  1.00 39.91  ? 948  ILE B CB  1 
ATOM   1821 C CG1 . ILE B 1 70  ? -4.550  42.037  -9.898  1.00 38.62  ? 948  ILE B CG1 1 
ATOM   1822 C CG2 . ILE B 1 70  ? -4.937  39.565  -9.834  1.00 40.64  ? 948  ILE B CG2 1 
ATOM   1823 C CD1 . ILE B 1 70  ? -4.008  42.744  -11.054 1.00 37.36  ? 948  ILE B CD1 1 
ATOM   1824 N N   . GLN B 1 71  ? -2.726  38.263  -8.309  1.00 41.53  ? 949  GLN B N   1 
ATOM   1825 C CA  . GLN B 1 71  ? -2.723  36.864  -7.853  1.00 41.38  ? 949  GLN B CA  1 
ATOM   1826 C C   . GLN B 1 71  ? -2.265  36.811  -6.414  1.00 41.26  ? 949  GLN B C   1 
ATOM   1827 O O   . GLN B 1 71  ? -2.804  36.070  -5.610  1.00 41.40  ? 949  GLN B O   1 
ATOM   1828 C CB  . GLN B 1 71  ? -1.755  36.038  -8.699  1.00 42.49  ? 949  GLN B CB  1 
ATOM   1829 C CG  . GLN B 1 71  ? -2.104  34.567  -8.809  1.00 42.41  ? 949  GLN B CG  1 
ATOM   1830 C CD  . GLN B 1 71  ? -3.567  34.321  -8.649  1.00 45.14  ? 949  GLN B CD  1 
ATOM   1831 O OE1 . GLN B 1 71  ? -4.017  33.988  -7.558  1.00 46.51  ? 949  GLN B OE1 1 
ATOM   1832 N NE2 . GLN B 1 71  ? -4.340  34.518  -9.725  1.00 46.74  ? 949  GLN B NE2 1 
ATOM   1833 N N   . CYS B 1 72  ? -1.289  37.638  -6.080  1.00 42.27  ? 950  CYS B N   1 
ATOM   1834 C CA  . CYS B 1 72  ? -0.779  37.668  -4.731  1.00 42.26  ? 950  CYS B CA  1 
ATOM   1835 C C   . CYS B 1 72  ? -1.793  38.053  -3.644  1.00 41.91  ? 950  CYS B C   1 
ATOM   1836 O O   . CYS B 1 72  ? -1.774  37.536  -2.512  1.00 40.98  ? 950  CYS B O   1 
ATOM   1837 C CB  . CYS B 1 72  ? 0.404   38.602  -4.654  1.00 43.72  ? 950  CYS B CB  1 
ATOM   1838 S SG  . CYS B 1 72  ? 0.983   38.616  -2.995  1.00 45.86  ? 950  CYS B SG  1 
ATOM   1839 N N   . ALA B 1 73  ? -2.616  39.042  -3.963  1.00 44.15  ? 951  ALA B N   1 
ATOM   1840 C CA  . ALA B 1 73  ? -3.641  39.457  -3.031  1.00 43.62  ? 951  ALA B CA  1 
ATOM   1841 C C   . ALA B 1 73  ? -4.706  38.364  -3.025  1.00 43.64  ? 951  ALA B C   1 
ATOM   1842 O O   . ALA B 1 73  ? -5.284  38.064  -1.994  1.00 43.52  ? 951  ALA B O   1 
ATOM   1843 C CB  . ALA B 1 73  ? -4.223  40.779  -3.434  1.00 44.24  ? 951  ALA B CB  1 
ATOM   1844 N N   . LYS B 1 74  ? -4.944  37.737  -4.172  1.00 44.28  ? 952  LYS B N   1 
ATOM   1845 C CA  . LYS B 1 74  ? -5.936  36.669  -4.227  1.00 44.90  ? 952  LYS B CA  1 
ATOM   1846 C C   . LYS B 1 74  ? -5.473  35.540  -3.328  1.00 44.97  ? 952  LYS B C   1 
ATOM   1847 O O   . LYS B 1 74  ? -6.284  34.842  -2.706  1.00 44.27  ? 952  LYS B O   1 
ATOM   1848 C CB  . LYS B 1 74  ? -6.122  36.163  -5.652  1.00 46.91  ? 952  LYS B CB  1 
ATOM   1849 C CG  . LYS B 1 74  ? -6.856  37.130  -6.532  1.00 48.44  ? 952  LYS B CG  1 
ATOM   1850 C CD  . LYS B 1 74  ? -7.623  36.432  -7.626  1.00 48.90  ? 952  LYS B CD  1 
ATOM   1851 C CE  . LYS B 1 74  ? -7.069  36.837  -8.963  1.00 50.52  ? 952  LYS B CE  1 
ATOM   1852 N NZ  . LYS B 1 74  ? -7.805  36.113  -10.045 1.00 53.25  ? 952  LYS B NZ  1 
ATOM   1853 N N   . ASP B 1 75  ? -4.158  35.361  -3.271  1.00 45.59  ? 953  ASP B N   1 
ATOM   1854 C CA  . ASP B 1 75  ? -3.588  34.307  -2.445  1.00 46.01  ? 953  ASP B CA  1 
ATOM   1855 C C   . ASP B 1 75  ? -3.842  34.624  -0.970  1.00 45.43  ? 953  ASP B C   1 
ATOM   1856 O O   . ASP B 1 75  ? -4.427  33.830  -0.255  1.00 44.91  ? 953  ASP B O   1 
ATOM   1857 C CB  . ASP B 1 75  ? -2.087  34.153  -2.710  1.00 48.90  ? 953  ASP B CB  1 
ATOM   1858 C CG  . ASP B 1 75  ? -1.779  33.292  -3.944  1.00 52.95  ? 953  ASP B CG  1 
ATOM   1859 O OD1 . ASP B 1 75  ? -2.736  32.888  -4.664  1.00 52.40  ? 953  ASP B OD1 1 
ATOM   1860 O OD2 . ASP B 1 75  ? -0.560  33.031  -4.192  1.00 58.17  ? 953  ASP B OD2 1 
ATOM   1861 N N   . ILE B 1 76  ? -3.425  35.813  -0.555  1.00 41.85  ? 954  ILE B N   1 
ATOM   1862 C CA  . ILE B 1 76  ? -3.602  36.303  0.810   1.00 41.90  ? 954  ILE B CA  1 
ATOM   1863 C C   . ILE B 1 76  ? -5.025  36.126  1.289   1.00 41.79  ? 954  ILE B C   1 
ATOM   1864 O O   . ILE B 1 76  ? -5.254  35.716  2.420   1.00 41.36  ? 954  ILE B O   1 
ATOM   1865 C CB  . ILE B 1 76  ? -3.183  37.797  0.933   1.00 44.32  ? 954  ILE B CB  1 
ATOM   1866 C CG1 . ILE B 1 76  ? -1.666  37.924  1.100   1.00 45.21  ? 954  ILE B CG1 1 
ATOM   1867 C CG2 . ILE B 1 76  ? -3.906  38.446  2.093   1.00 43.61  ? 954  ILE B CG2 1 
ATOM   1868 C CD1 . ILE B 1 76  ? -1.086  39.171  0.541   1.00 45.78  ? 954  ILE B CD1 1 
ATOM   1869 N N   . ALA B 1 77  ? -5.973  36.470  0.425   1.00 40.65  ? 955  ALA B N   1 
ATOM   1870 C CA  . ALA B 1 77  ? -7.387  36.347  0.726   1.00 41.25  ? 955  ALA B CA  1 
ATOM   1871 C C   . ALA B 1 77  ? -7.783  34.883  0.974   1.00 42.09  ? 955  ALA B C   1 
ATOM   1872 O O   . ALA B 1 77  ? -8.470  34.579  1.946   1.00 42.96  ? 955  ALA B O   1 
ATOM   1873 C CB  . ALA B 1 77  ? -8.231  36.991  -0.366  1.00 41.24  ? 955  ALA B CB  1 
ATOM   1874 N N   . LYS B 1 78  ? -7.295  33.960  0.160   1.00 41.82  ? 956  LYS B N   1 
ATOM   1875 C CA  . LYS B 1 78  ? -7.604  32.559  0.398   1.00 42.00  ? 956  LYS B CA  1 
ATOM   1876 C C   . LYS B 1 78  ? -7.100  32.147  1.784   1.00 41.61  ? 956  LYS B C   1 
ATOM   1877 O O   . LYS B 1 78  ? -7.732  31.357  2.477   1.00 41.42  ? 956  LYS B O   1 
ATOM   1878 C CB  . LYS B 1 78  ? -6.935  31.705  -0.660  1.00 47.19  ? 956  LYS B CB  1 
ATOM   1879 C CG  . LYS B 1 78  ? -7.679  30.441  -1.068  1.00 48.37  ? 956  LYS B CG  1 
ATOM   1880 C CD  . LYS B 1 78  ? -6.789  29.617  -2.027  1.00 51.35  ? 956  LYS B CD  1 
ATOM   1881 C CE  . LYS B 1 78  ? -5.436  30.400  -2.389  1.00 53.29  ? 956  LYS B CE  1 
ATOM   1882 N NZ  . LYS B 1 78  ? -4.646  29.991  -3.605  1.00 53.35  ? 956  LYS B NZ  1 
ATOM   1883 N N   . ALA B 1 79  ? -5.959  32.696  2.180   1.00 41.14  ? 957  ALA B N   1 
ATOM   1884 C CA  . ALA B 1 79  ? -5.344  32.383  3.465   1.00 41.22  ? 957  ALA B CA  1 
ATOM   1885 C C   . ALA B 1 79  ? -6.155  32.951  4.605   1.00 41.29  ? 957  ALA B C   1 
ATOM   1886 O O   . ALA B 1 79  ? -6.242  32.328  5.659   1.00 41.49  ? 957  ALA B O   1 
ATOM   1887 C CB  . ALA B 1 79  ? -3.889  32.872  3.532   1.00 40.88  ? 957  ALA B CB  1 
ATOM   1888 N N   . SER B 1 80  ? -6.742  34.132  4.399   1.00 42.80  ? 958  SER B N   1 
ATOM   1889 C CA  . SER B 1 80  ? -7.567  34.756  5.433   1.00 43.23  ? 958  SER B CA  1 
ATOM   1890 C C   . SER B 1 80  ? -8.866  34.009  5.543   1.00 43.98  ? 958  SER B C   1 
ATOM   1891 O O   . SER B 1 80  ? -9.306  33.688  6.628   1.00 43.92  ? 958  SER B O   1 
ATOM   1892 C CB  . SER B 1 80  ? -7.855  36.202  5.103   1.00 44.68  ? 958  SER B CB  1 
ATOM   1893 O OG  . SER B 1 80  ? -6.755  36.746  4.428   1.00 44.14  ? 958  SER B OG  1 
ATOM   1894 N N   . ASP B 1 81  ? -9.454  33.693  4.407   1.00 48.90  ? 959  ASP B N   1 
ATOM   1895 C CA  . ASP B 1 81  ? -10.690 32.932  4.400   1.00 50.41  ? 959  ASP B CA  1 
ATOM   1896 C C   . ASP B 1 81  ? -10.571 31.671  5.268   1.00 50.40  ? 959  ASP B C   1 
ATOM   1897 O O   . ASP B 1 81  ? -11.539 31.225  5.876   1.00 51.47  ? 959  ASP B O   1 
ATOM   1898 C CB  . ASP B 1 81  ? -11.099 32.565  2.959   1.00 54.87  ? 959  ASP B CB  1 
ATOM   1899 C CG  . ASP B 1 81  ? -11.721 33.749  2.196   1.00 57.95  ? 959  ASP B CG  1 
ATOM   1900 O OD1 . ASP B 1 81  ? -12.566 34.485  2.786   1.00 55.54  ? 959  ASP B OD1 1 
ATOM   1901 O OD2 . ASP B 1 81  ? -11.389 33.915  0.984   1.00 61.59  ? 959  ASP B OD2 1 
ATOM   1902 N N   . GLU B 1 82  ? -9.381  31.104  5.341   1.00 51.06  ? 960  GLU B N   1 
ATOM   1903 C CA  . GLU B 1 82  ? -9.211  29.889  6.119   1.00 51.47  ? 960  GLU B CA  1 
ATOM   1904 C C   . GLU B 1 82  ? -8.892  30.173  7.611   1.00 51.27  ? 960  GLU B C   1 
ATOM   1905 O O   . GLU B 1 82  ? -9.161  29.336  8.489   1.00 51.90  ? 960  GLU B O   1 
ATOM   1906 C CB  . GLU B 1 82  ? -8.181  28.972  5.452   1.00 54.86  ? 960  GLU B CB  1 
ATOM   1907 C CG  . GLU B 1 82  ? -8.685  28.057  4.225   1.00 59.66  ? 960  GLU B CG  1 
ATOM   1908 C CD  . GLU B 1 82  ? -10.023 28.473  3.483   1.00 62.60  ? 960  GLU B CD  1 
ATOM   1909 O OE1 . GLU B 1 82  ? -9.928  29.127  2.406   1.00 62.51  ? 960  GLU B OE1 1 
ATOM   1910 O OE2 . GLU B 1 82  ? -11.134 27.984  3.869   1.00 59.19  ? 960  GLU B OE2 1 
ATOM   1911 N N   . VAL B 1 83  ? -8.371  31.372  7.901   1.00 45.73  ? 961  VAL B N   1 
ATOM   1912 C CA  . VAL B 1 83  ? -8.117  31.764  9.258   1.00 44.12  ? 961  VAL B CA  1 
ATOM   1913 C C   . VAL B 1 83  ? -9.468  32.071  9.891   1.00 44.68  ? 961  VAL B C   1 
ATOM   1914 O O   . VAL B 1 83  ? -9.731  31.718  11.033  1.00 45.66  ? 961  VAL B O   1 
ATOM   1915 C CB  . VAL B 1 83  ? -7.211  32.956  9.345   1.00 44.91  ? 961  VAL B CB  1 
ATOM   1916 C CG1 . VAL B 1 83  ? -7.079  33.373  10.796  1.00 42.89  ? 961  VAL B CG1 1 
ATOM   1917 C CG2 . VAL B 1 83  ? -5.852  32.643  8.759   1.00 43.53  ? 961  VAL B CG2 1 
ATOM   1918 N N   . THR B 1 84  ? -10.339 32.732  9.157   1.00 44.60  ? 962  THR B N   1 
ATOM   1919 C CA  . THR B 1 84  ? -11.667 32.992  9.654   1.00 44.58  ? 962  THR B CA  1 
ATOM   1920 C C   . THR B 1 84  ? -12.424 31.677  9.823   1.00 45.28  ? 962  THR B C   1 
ATOM   1921 O O   . THR B 1 84  ? -12.980 31.412  10.888  1.00 45.61  ? 962  THR B O   1 
ATOM   1922 C CB  . THR B 1 84  ? -12.405 33.863  8.676   1.00 43.56  ? 962  THR B CB  1 
ATOM   1923 O OG1 . THR B 1 84  ? -11.611 35.006  8.405   1.00 43.26  ? 962  THR B OG1 1 
ATOM   1924 C CG2 . THR B 1 84  ? -13.752 34.281  9.209   1.00 44.60  ? 962  THR B CG2 1 
ATOM   1925 N N   . ARG B 1 85  ? -12.493 30.879  8.752   1.00 49.01  ? 963  ARG B N   1 
ATOM   1926 C CA  . ARG B 1 85  ? -13.230 29.612  8.758   1.00 49.99  ? 963  ARG B CA  1 
ATOM   1927 C C   . ARG B 1 85  ? -12.931 28.753  9.999   1.00 50.25  ? 963  ARG B C   1 
ATOM   1928 O O   . ARG B 1 85  ? -13.831 28.199  10.638  1.00 50.08  ? 963  ARG B O   1 
ATOM   1929 C CB  . ARG B 1 85  ? -12.944 28.824  7.483   1.00 56.89  ? 963  ARG B CB  1 
ATOM   1930 C CG  . ARG B 1 85  ? -13.617 27.460  7.472   1.00 57.53  ? 963  ARG B CG  1 
ATOM   1931 C CD  . ARG B 1 85  ? -13.339 26.693  6.184   1.00 57.87  ? 963  ARG B CD  1 
ATOM   1932 N NE  . ARG B 1 85  ? -11.987 26.148  6.179   1.00 60.04  ? 963  ARG B NE  1 
ATOM   1933 C CZ  . ARG B 1 85  ? -11.580 25.123  6.935   1.00 61.46  ? 963  ARG B CZ  1 
ATOM   1934 N NH1 . ARG B 1 85  ? -12.432 24.492  7.749   1.00 61.32  ? 963  ARG B NH1 1 
ATOM   1935 N NH2 . ARG B 1 85  ? -10.306 24.733  6.887   1.00 62.08  ? 963  ARG B NH2 1 
ATOM   1936 N N   . LEU B 1 86  ? -11.650 28.681  10.325  1.00 48.78  ? 964  LEU B N   1 
ATOM   1937 C CA  . LEU B 1 86  ? -11.156 27.907  11.443  1.00 49.50  ? 964  LEU B CA  1 
ATOM   1938 C C   . LEU B 1 86  ? -11.452 28.529  12.805  1.00 50.62  ? 964  LEU B C   1 
ATOM   1939 O O   . LEU B 1 86  ? -11.898 27.846  13.732  1.00 50.32  ? 964  LEU B O   1 
ATOM   1940 C CB  . LEU B 1 86  ? -9.655  27.649  11.247  1.00 49.89  ? 964  LEU B CB  1 
ATOM   1941 C CG  . LEU B 1 86  ? -9.417  26.645  10.091  1.00 49.54  ? 964  LEU B CG  1 
ATOM   1942 C CD1 . LEU B 1 86  ? -7.971  26.495  9.632   1.00 48.04  ? 964  LEU B CD1 1 
ATOM   1943 C CD2 . LEU B 1 86  ? -10.012 25.297  10.433  1.00 46.58  ? 964  LEU B CD2 1 
ATOM   1944 N N   . ALA B 1 87  ? -11.211 29.831  12.906  1.00 51.53  ? 965  ALA B N   1 
ATOM   1945 C CA  . ALA B 1 87  ? -11.449 30.619  14.118  1.00 52.48  ? 965  ALA B CA  1 
ATOM   1946 C C   . ALA B 1 87  ? -12.889 30.514  14.580  1.00 53.70  ? 965  ALA B C   1 
ATOM   1947 O O   . ALA B 1 87  ? -13.176 30.574  15.772  1.00 54.21  ? 965  ALA B O   1 
ATOM   1948 C CB  . ALA B 1 87  ? -11.129 32.063  13.847  1.00 53.44  ? 965  ALA B CB  1 
ATOM   1949 N N   . LYS B 1 88  ? -13.795 30.385  13.619  1.00 55.39  ? 966  LYS B N   1 
ATOM   1950 C CA  . LYS B 1 88  ? -15.207 30.263  13.911  1.00 56.47  ? 966  LYS B CA  1 
ATOM   1951 C C   . LYS B 1 88  ? -15.510 28.877  14.483  1.00 57.03  ? 966  LYS B C   1 
ATOM   1952 O O   . LYS B 1 88  ? -16.288 28.737  15.426  1.00 57.04  ? 966  LYS B O   1 
ATOM   1953 C CB  . LYS B 1 88  ? -16.022 30.518  12.638  1.00 59.80  ? 966  LYS B CB  1 
ATOM   1954 C CG  . LYS B 1 88  ? -16.532 31.944  12.521  1.00 61.31  ? 966  LYS B CG  1 
ATOM   1955 C CD  . LYS B 1 88  ? -17.387 32.145  11.286  1.00 62.86  ? 966  LYS B CD  1 
ATOM   1956 C CE  . LYS B 1 88  ? -17.326 33.604  10.866  1.00 65.24  ? 966  LYS B CE  1 
ATOM   1957 N NZ  . LYS B 1 88  ? -16.141 34.242  11.481  1.00 64.97  ? 966  LYS B NZ  1 
ATOM   1958 N N   . GLU B 1 89  ? -14.905 27.840  13.913  1.00 58.95  ? 967  GLU B N   1 
ATOM   1959 C CA  . GLU B 1 89  ? -15.140 26.501  14.441  1.00 59.30  ? 967  GLU B CA  1 
ATOM   1960 C C   . GLU B 1 89  ? -14.596 26.457  15.874  1.00 59.06  ? 967  GLU B C   1 
ATOM   1961 O O   . GLU B 1 89  ? -15.182 25.804  16.739  1.00 59.27  ? 967  GLU B O   1 
ATOM   1962 C CB  . GLU B 1 89  ? -14.553 25.404  13.543  1.00 61.56  ? 967  GLU B CB  1 
ATOM   1963 C CG  . GLU B 1 89  ? -15.552 24.293  13.135  1.00 63.86  ? 967  GLU B CG  1 
ATOM   1964 C CD  . GLU B 1 89  ? -16.832 24.164  14.037  1.00 68.33  ? 967  GLU B CD  1 
ATOM   1965 O OE1 . GLU B 1 89  ? -17.901 24.708  13.639  1.00 69.87  ? 967  GLU B OE1 1 
ATOM   1966 O OE2 . GLU B 1 89  ? -16.817 23.415  15.058  1.00 68.59  ? 967  GLU B OE2 1 
ATOM   1967 N N   . VAL B 1 90  ? -13.534 27.225  16.138  1.00 55.66  ? 968  VAL B N   1 
ATOM   1968 C CA  . VAL B 1 90  ? -12.987 27.345  17.494  1.00 55.14  ? 968  VAL B CA  1 
ATOM   1969 C C   . VAL B 1 90  ? -14.030 28.013  18.379  1.00 55.15  ? 968  VAL B C   1 
ATOM   1970 O O   . VAL B 1 90  ? -14.225 27.626  19.525  1.00 54.80  ? 968  VAL B O   1 
ATOM   1971 C CB  . VAL B 1 90  ? -11.712 28.226  17.549  1.00 56.84  ? 968  VAL B CB  1 
ATOM   1972 C CG1 . VAL B 1 90  ? -11.375 28.556  19.003  1.00 55.98  ? 968  VAL B CG1 1 
ATOM   1973 C CG2 . VAL B 1 90  ? -10.530 27.588  16.816  1.00 56.56  ? 968  VAL B CG2 1 
ATOM   1974 N N   . ALA B 1 91  ? -14.634 29.072  17.849  1.00 58.51  ? 969  ALA B N   1 
ATOM   1975 C CA  . ALA B 1 91  ? -15.617 29.861  18.573  1.00 59.42  ? 969  ALA B CA  1 
ATOM   1976 C C   . ALA B 1 91  ? -16.892 29.074  18.829  1.00 60.29  ? 969  ALA B C   1 
ATOM   1977 O O   . ALA B 1 91  ? -17.540 29.230  19.862  1.00 60.35  ? 969  ALA B O   1 
ATOM   1978 C CB  . ALA B 1 91  ? -15.932 31.147  17.810  1.00 60.08  ? 969  ALA B CB  1 
ATOM   1979 N N   . LYS B 1 92  ? -17.263 28.238  17.872  1.00 64.25  ? 970  LYS B N   1 
ATOM   1980 C CA  . LYS B 1 92  ? -18.461 27.436  18.005  1.00 64.83  ? 970  LYS B CA  1 
ATOM   1981 C C   . LYS B 1 92  ? -18.265 26.407  19.110  1.00 65.05  ? 970  LYS B C   1 
ATOM   1982 O O   . LYS B 1 92  ? -19.230 25.858  19.638  1.00 65.32  ? 970  LYS B O   1 
ATOM   1983 C CB  . LYS B 1 92  ? -18.754 26.738  16.672  1.00 68.66  ? 970  LYS B CB  1 
ATOM   1984 C CG  . LYS B 1 92  ? -19.944 25.792  16.677  1.00 70.21  ? 970  LYS B CG  1 
ATOM   1985 C CD  . LYS B 1 92  ? -20.103 25.077  15.330  1.00 72.45  ? 970  LYS B CD  1 
ATOM   1986 C CE  . LYS B 1 92  ? -21.022 23.836  15.435  1.00 74.09  ? 970  LYS B CE  1 
ATOM   1987 N NZ  . LYS B 1 92  ? -20.739 22.794  14.380  1.00 74.81  ? 970  LYS B NZ  1 
ATOM   1988 N N   . GLN B 1 93  ? -17.012 26.123  19.445  1.00 65.45  ? 971  GLN B N   1 
ATOM   1989 C CA  . GLN B 1 93  ? -16.722 25.105  20.448  1.00 65.79  ? 971  GLN B CA  1 
ATOM   1990 C C   . GLN B 1 93  ? -16.543 25.724  21.835  1.00 65.76  ? 971  GLN B C   1 
ATOM   1991 O O   . GLN B 1 93  ? -16.786 25.087  22.866  1.00 65.30  ? 971  GLN B O   1 
ATOM   1992 C CB  . GLN B 1 93  ? -15.494 24.286  20.022  1.00 67.29  ? 971  GLN B CB  1 
ATOM   1993 C CG  . GLN B 1 93  ? -15.761 22.807  19.840  1.00 68.31  ? 971  GLN B CG  1 
ATOM   1994 C CD  . GLN B 1 93  ? -17.106 22.507  19.163  1.00 72.52  ? 971  GLN B CD  1 
ATOM   1995 O OE1 . GLN B 1 93  ? -17.929 21.748  19.687  1.00 72.96  ? 971  GLN B OE1 1 
ATOM   1996 N NE2 . GLN B 1 93  ? -17.299 23.048  17.962  1.00 73.36  ? 971  GLN B NE2 1 
ATOM   1997 N N   . CYS B 1 94  ? -16.122 26.983  21.826  1.00 66.89  ? 972  CYS B N   1 
ATOM   1998 C CA  . CYS B 1 94  ? -15.880 27.770  23.037  1.00 66.85  ? 972  CYS B CA  1 
ATOM   1999 C C   . CYS B 1 94  ? -17.096 27.827  23.946  1.00 66.53  ? 972  CYS B C   1 
ATOM   2000 O O   . CYS B 1 94  ? -18.224 27.940  23.465  1.00 66.85  ? 972  CYS B O   1 
ATOM   2001 C CB  . CYS B 1 94  ? -15.511 29.195  22.645  1.00 66.65  ? 972  CYS B CB  1 
ATOM   2002 S SG  . CYS B 1 94  ? -14.839 30.114  23.987  1.00 65.90  ? 972  CYS B SG  1 
ATOM   2003 N N   . THR B 1 95  ? -16.871 27.762  25.256  1.00 65.63  ? 973  THR B N   1 
ATOM   2004 C CA  . THR B 1 95  ? -17.986 27.825  26.210  1.00 65.19  ? 973  THR B CA  1 
ATOM   2005 C C   . THR B 1 95  ? -17.902 29.097  27.048  1.00 64.99  ? 973  THR B C   1 
ATOM   2006 O O   . THR B 1 95  ? -18.663 29.298  27.991  1.00 65.18  ? 973  THR B O   1 
ATOM   2007 C CB  . THR B 1 95  ? -18.140 26.536  27.066  1.00 65.51  ? 973  THR B CB  1 
ATOM   2008 O OG1 . THR B 1 95  ? -17.030 26.416  27.970  1.00 65.93  ? 973  THR B OG1 1 
ATOM   2009 C CG2 . THR B 1 95  ? -18.201 25.294  26.171  1.00 65.10  ? 973  THR B CG2 1 
ATOM   2010 N N   . ASP B 1 96  ? -16.990 29.978  26.657  1.00 65.71  ? 974  ASP B N   1 
ATOM   2011 C CA  . ASP B 1 96  ? -16.828 31.258  27.324  1.00 65.27  ? 974  ASP B CA  1 
ATOM   2012 C C   . ASP B 1 96  ? -17.392 32.416  26.483  1.00 65.26  ? 974  ASP B C   1 
ATOM   2013 O O   . ASP B 1 96  ? -16.807 32.825  25.489  1.00 65.09  ? 974  ASP B O   1 
ATOM   2014 C CB  . ASP B 1 96  ? -15.358 31.505  27.659  1.00 67.88  ? 974  ASP B CB  1 
ATOM   2015 C CG  . ASP B 1 96  ? -15.162 32.727  28.525  1.00 67.87  ? 974  ASP B CG  1 
ATOM   2016 O OD1 . ASP B 1 96  ? -16.176 33.352  28.902  1.00 66.54  ? 974  ASP B OD1 1 
ATOM   2017 O OD2 . ASP B 1 96  ? -14.002 33.058  28.846  1.00 69.44  ? 974  ASP B OD2 1 
ATOM   2018 N N   . LYS B 1 97  ? -18.532 32.943  26.903  1.00 64.88  ? 975  LYS B N   1 
ATOM   2019 C CA  . LYS B 1 97  ? -19.171 34.054  26.230  1.00 65.65  ? 975  LYS B CA  1 
ATOM   2020 C C   . LYS B 1 97  ? -18.227 35.246  26.094  1.00 66.34  ? 975  LYS B C   1 
ATOM   2021 O O   . LYS B 1 97  ? -18.208 35.922  25.070  1.00 66.49  ? 975  LYS B O   1 
ATOM   2022 C CB  . LYS B 1 97  ? -20.400 34.468  27.021  1.00 71.03  ? 975  LYS B CB  1 
ATOM   2023 C CG  . LYS B 1 97  ? -21.436 35.188  26.201  1.00 70.60  ? 975  LYS B CG  1 
ATOM   2024 C CD  . LYS B 1 97  ? -22.132 36.316  26.995  1.00 71.38  ? 975  LYS B CD  1 
ATOM   2025 C CE  . LYS B 1 97  ? -23.462 36.712  26.329  1.00 70.18  ? 975  LYS B CE  1 
ATOM   2026 N NZ  . LYS B 1 97  ? -23.558 36.281  24.855  1.00 68.29  ? 975  LYS B NZ  1 
ATOM   2027 N N   . ARG B 1 98  ? -17.464 35.526  27.143  1.00 65.25  ? 976  ARG B N   1 
ATOM   2028 C CA  . ARG B 1 98  ? -16.500 36.622  27.108  1.00 66.10  ? 976  ARG B CA  1 
ATOM   2029 C C   . ARG B 1 98  ? -15.589 36.424  25.889  1.00 66.62  ? 976  ARG B C   1 
ATOM   2030 O O   . ARG B 1 98  ? -15.538 37.268  24.997  1.00 66.72  ? 976  ARG B O   1 
ATOM   2031 C CB  . ARG B 1 98  ? -15.657 36.636  28.396  1.00 70.03  ? 976  ARG B CB  1 
ATOM   2032 C CG  . ARG B 1 98  ? -14.844 37.897  28.548  1.00 71.73  ? 976  ARG B CG  1 
ATOM   2033 C CD  . ARG B 1 98  ? -15.535 38.897  27.689  1.00 74.67  ? 976  ARG B CD  1 
ATOM   2034 N NE  . ARG B 1 98  ? -14.836 40.172  27.573  1.00 78.70  ? 976  ARG B NE  1 
ATOM   2035 C CZ  . ARG B 1 98  ? -15.192 41.123  26.699  1.00 78.76  ? 976  ARG B CZ  1 
ATOM   2036 N NH1 . ARG B 1 98  ? -16.225 40.908  25.860  1.00 78.19  ? 976  ARG B NH1 1 
ATOM   2037 N NH2 . ARG B 1 98  ? -14.522 42.281  26.651  1.00 76.62  ? 976  ARG B NH2 1 
ATOM   2038 N N   . ILE B 1 99  ? -14.903 35.282  25.846  1.00 62.62  ? 977  ILE B N   1 
ATOM   2039 C CA  . ILE B 1 99  ? -13.989 34.952  24.753  1.00 62.73  ? 977  ILE B CA  1 
ATOM   2040 C C   . ILE B 1 99  ? -14.673 34.607  23.419  1.00 62.52  ? 977  ILE B C   1 
ATOM   2041 O O   . ILE B 1 99  ? -14.235 35.064  22.368  1.00 62.35  ? 977  ILE B O   1 
ATOM   2042 C CB  . ILE B 1 99  ? -12.979 33.831  25.145  1.00 65.44  ? 977  ILE B CB  1 
ATOM   2043 C CG1 . ILE B 1 99  ? -12.356 34.083  26.530  1.00 66.30  ? 977  ILE B CG1 1 
ATOM   2044 C CG2 . ILE B 1 99  ? -11.875 33.747  24.087  1.00 66.28  ? 977  ILE B CG2 1 
ATOM   2045 C CD1 . ILE B 1 99  ? -11.905 35.530  26.754  1.00 68.22  ? 977  ILE B CD1 1 
ATOM   2046 N N   . ARG B 1 100 ? -15.712 33.776  23.449  1.00 59.68  ? 978  ARG B N   1 
ATOM   2047 C CA  . ARG B 1 100 ? -16.397 33.394  22.220  1.00 60.09  ? 978  ARG B CA  1 
ATOM   2048 C C   . ARG B 1 100 ? -16.834 34.621  21.482  1.00 60.28  ? 978  ARG B C   1 
ATOM   2049 O O   . ARG B 1 100 ? -17.128 34.582  20.278  1.00 59.73  ? 978  ARG B O   1 
ATOM   2050 C CB  . ARG B 1 100 ? -17.639 32.576  22.505  1.00 57.35  ? 978  ARG B CB  1 
ATOM   2051 C CG  . ARG B 1 100 ? -18.105 31.854  21.263  1.00 59.12  ? 978  ARG B CG  1 
ATOM   2052 C CD  . ARG B 1 100 ? -19.611 31.847  21.106  1.00 62.32  ? 978  ARG B CD  1 
ATOM   2053 N NE  . ARG B 1 100 ? -20.281 32.298  22.320  1.00 65.13  ? 978  ARG B NE  1 
ATOM   2054 C CZ  . ARG B 1 100 ? -20.450 31.547  23.399  1.00 65.97  ? 978  ARG B CZ  1 
ATOM   2055 N NH1 . ARG B 1 100 ? -19.995 30.302  23.412  1.00 64.61  ? 978  ARG B NH1 1 
ATOM   2056 N NH2 . ARG B 1 100 ? -21.082 32.038  24.457  1.00 66.79  ? 978  ARG B NH2 1 
ATOM   2057 N N   . THR B 1 101 ? -16.922 35.712  22.240  1.00 61.08  ? 979  THR B N   1 
ATOM   2058 C CA  . THR B 1 101 ? -17.365 37.001  21.721  1.00 60.97  ? 979  THR B CA  1 
ATOM   2059 C C   . THR B 1 101 ? -16.243 37.759  21.061  1.00 61.11  ? 979  THR B C   1 
ATOM   2060 O O   . THR B 1 101 ? -16.360 38.133  19.904  1.00 61.08  ? 979  THR B O   1 
ATOM   2061 C CB  . THR B 1 101 ? -18.022 37.830  22.806  1.00 64.95  ? 979  THR B CB  1 
ATOM   2062 O OG1 . THR B 1 101 ? -19.378 37.401  22.976  1.00 64.25  ? 979  THR B OG1 1 
ATOM   2063 C CG2 . THR B 1 101 ? -17.992 39.297  22.426  1.00 65.09  ? 979  THR B CG2 1 
ATOM   2064 N N   . ASN B 1 102 ? -15.167 37.997  21.799  1.00 59.18  ? 980  ASN B N   1 
ATOM   2065 C CA  . ASN B 1 102 ? -14.017 38.664  21.228  1.00 60.20  ? 980  ASN B CA  1 
ATOM   2066 C C   . ASN B 1 102 ? -13.578 37.912  19.982  1.00 60.70  ? 980  ASN B C   1 
ATOM   2067 O O   . ASN B 1 102 ? -13.260 38.535  18.975  1.00 61.52  ? 980  ASN B O   1 
ATOM   2068 C CB  . ASN B 1 102 ? -12.871 38.726  22.227  1.00 66.90  ? 980  ASN B CB  1 
ATOM   2069 C CG  . ASN B 1 102 ? -13.310 39.307  23.538  1.00 68.56  ? 980  ASN B CG  1 
ATOM   2070 O OD1 . ASN B 1 102 ? -12.579 39.270  24.548  1.00 69.32  ? 980  ASN B OD1 1 
ATOM   2071 N ND2 . ASN B 1 102 ? -14.549 39.828  23.551  1.00 69.50  ? 980  ASN B ND2 1 
ATOM   2072 N N   . LEU B 1 103 ? -13.566 36.581  20.036  1.00 59.36  ? 981  LEU B N   1 
ATOM   2073 C CA  . LEU B 1 103 ? -13.117 35.806  18.888  1.00 59.60  ? 981  LEU B CA  1 
ATOM   2074 C C   . LEU B 1 103 ? -13.920 36.124  17.651  1.00 60.09  ? 981  LEU B C   1 
ATOM   2075 O O   . LEU B 1 103 ? -13.363 36.366  16.580  1.00 60.49  ? 981  LEU B O   1 
ATOM   2076 C CB  . LEU B 1 103 ? -13.126 34.297  19.139  1.00 59.01  ? 981  LEU B CB  1 
ATOM   2077 C CG  . LEU B 1 103 ? -12.418 33.436  18.079  1.00 57.93  ? 981  LEU B CG  1 
ATOM   2078 C CD1 . LEU B 1 103 ? -10.993 33.934  17.768  1.00 55.91  ? 981  LEU B CD1 1 
ATOM   2079 C CD2 . LEU B 1 103 ? -12.388 31.995  18.504  1.00 57.25  ? 981  LEU B CD2 1 
ATOM   2080 N N   . LEU B 1 104 ? -15.233 36.120  17.773  1.00 62.16  ? 982  LEU B N   1 
ATOM   2081 C CA  . LEU B 1 104 ? -16.043 36.454  16.620  1.00 62.31  ? 982  LEU B CA  1 
ATOM   2082 C C   . LEU B 1 104 ? -15.799 37.887  16.132  1.00 62.51  ? 982  LEU B C   1 
ATOM   2083 O O   . LEU B 1 104 ? -15.568 38.125  14.950  1.00 62.72  ? 982  LEU B O   1 
ATOM   2084 C CB  . LEU B 1 104 ? -17.503 36.169  16.915  1.00 61.37  ? 982  LEU B CB  1 
ATOM   2085 C CG  . LEU B 1 104 ? -17.543 34.651  16.977  1.00 60.87  ? 982  LEU B CG  1 
ATOM   2086 C CD1 . LEU B 1 104 ? -18.955 34.148  17.226  1.00 60.40  ? 982  LEU B CD1 1 
ATOM   2087 C CD2 . LEU B 1 104 ? -16.985 34.133  15.654  1.00 59.09  ? 982  LEU B CD2 1 
ATOM   2088 N N   . GLN B 1 105 ? -15.792 38.831  17.056  1.00 68.22  ? 983  GLN B N   1 
ATOM   2089 C CA  . GLN B 1 105 ? -15.568 40.228  16.714  1.00 68.85  ? 983  GLN B CA  1 
ATOM   2090 C C   . GLN B 1 105 ? -14.356 40.428  15.775  1.00 68.62  ? 983  GLN B C   1 
ATOM   2091 O O   . GLN B 1 105 ? -14.514 40.776  14.595  1.00 68.82  ? 983  GLN B O   1 
ATOM   2092 C CB  . GLN B 1 105 ? -15.428 41.051  18.002  1.00 72.30  ? 983  GLN B CB  1 
ATOM   2093 C CG  . GLN B 1 105 ? -14.925 42.472  17.802  1.00 74.31  ? 983  GLN B CG  1 
ATOM   2094 C CD  . GLN B 1 105 ? -13.869 42.874  18.838  1.00 77.65  ? 983  GLN B CD  1 
ATOM   2095 O OE1 . GLN B 1 105 ? -13.630 44.074  19.068  1.00 78.73  ? 983  GLN B OE1 1 
ATOM   2096 N NE2 . GLN B 1 105 ? -13.204 41.876  19.441  1.00 78.38  ? 983  GLN B NE2 1 
ATOM   2097 N N   . VAL B 1 106 ? -13.163 40.150  16.296  1.00 68.99  ? 984  VAL B N   1 
ATOM   2098 C CA  . VAL B 1 106 ? -11.904 40.288  15.566  1.00 68.66  ? 984  VAL B CA  1 
ATOM   2099 C C   . VAL B 1 106 ? -11.820 39.530  14.243  1.00 68.30  ? 984  VAL B C   1 
ATOM   2100 O O   . VAL B 1 106 ? -11.145 39.968  13.310  1.00 68.09  ? 984  VAL B O   1 
ATOM   2101 C CB  . VAL B 1 106 ? -10.717 39.927  16.461  1.00 71.65  ? 984  VAL B CB  1 
ATOM   2102 C CG1 . VAL B 1 106 ? -10.706 40.804  17.691  1.00 71.27  ? 984  VAL B CG1 1 
ATOM   2103 C CG2 . VAL B 1 106 ? -10.810 38.481  16.863  1.00 71.58  ? 984  VAL B CG2 1 
ATOM   2104 N N   . CYS B 1 107 ? -12.465 38.377  14.165  1.00 68.23  ? 985  CYS B N   1 
ATOM   2105 C CA  . CYS B 1 107 ? -12.382 37.605  12.937  1.00 68.63  ? 985  CYS B CA  1 
ATOM   2106 C C   . CYS B 1 107 ? -13.466 37.937  11.944  1.00 68.28  ? 985  CYS B C   1 
ATOM   2107 O O   . CYS B 1 107 ? -13.503 37.381  10.856  1.00 68.91  ? 985  CYS B O   1 
ATOM   2108 C CB  . CYS B 1 107 ? -12.237 36.086  13.185  1.00 67.76  ? 985  CYS B CB  1 
ATOM   2109 S SG  . CYS B 1 107 ? -13.741 35.077  13.462  1.00 68.59  ? 985  CYS B SG  1 
ATOM   2110 N N   . GLU B 1 108 ? -14.320 38.892  12.274  1.00 71.13  ? 986  GLU B N   1 
ATOM   2111 C CA  . GLU B 1 108 ? -15.372 39.262  11.337  1.00 70.79  ? 986  GLU B CA  1 
ATOM   2112 C C   . GLU B 1 108 ? -14.841 40.202  10.281  1.00 69.79  ? 986  GLU B C   1 
ATOM   2113 O O   . GLU B 1 108 ? -15.278 40.198  9.127   1.00 70.13  ? 986  GLU B O   1 
ATOM   2114 C CB  . GLU B 1 108 ? -16.516 39.943  12.074  1.00 74.40  ? 986  GLU B CB  1 
ATOM   2115 C CG  . GLU B 1 108 ? -17.303 39.001  12.981  1.00 77.21  ? 986  GLU B CG  1 
ATOM   2116 C CD  . GLU B 1 108 ? -17.659 37.671  12.321  1.00 80.36  ? 986  GLU B CD  1 
ATOM   2117 O OE1 . GLU B 1 108 ? -18.230 36.813  13.034  1.00 80.99  ? 986  GLU B OE1 1 
ATOM   2118 O OE2 . GLU B 1 108 ? -17.417 37.499  11.094  1.00 79.49  ? 986  GLU B OE2 1 
ATOM   2119 N N   . ARG B 1 109 ? -13.895 41.021  10.710  1.00 65.01  ? 987  ARG B N   1 
ATOM   2120 C CA  . ARG B 1 109 ? -13.305 42.043  9.867   1.00 64.06  ? 987  ARG B CA  1 
ATOM   2121 C C   . ARG B 1 109 ? -12.335 41.470  8.837   1.00 62.29  ? 987  ARG B C   1 
ATOM   2122 O O   . ARG B 1 109 ? -12.105 42.059  7.767   1.00 62.35  ? 987  ARG B O   1 
ATOM   2123 C CB  . ARG B 1 109 ? -12.615 43.066  10.767  1.00 69.48  ? 987  ARG B CB  1 
ATOM   2124 C CG  . ARG B 1 109 ? -12.976 42.880  12.244  1.00 72.80  ? 987  ARG B CG  1 
ATOM   2125 C CD  . ARG B 1 109 ? -12.882 44.183  13.035  1.00 76.64  ? 987  ARG B CD  1 
ATOM   2126 N NE  . ARG B 1 109 ? -12.305 43.971  14.364  1.00 78.54  ? 987  ARG B NE  1 
ATOM   2127 C CZ  . ARG B 1 109 ? -11.001 43.840  14.591  1.00 79.39  ? 987  ARG B CZ  1 
ATOM   2128 N NH1 . ARG B 1 109 ? -10.147 43.911  13.568  1.00 79.86  ? 987  ARG B NH1 1 
ATOM   2129 N NH2 . ARG B 1 109 ? -10.548 43.631  15.831  1.00 79.45  ? 987  ARG B NH2 1 
ATOM   2130 N N   . ILE B 1 110 ? -11.777 40.311  9.159   1.00 55.59  ? 988  ILE B N   1 
ATOM   2131 C CA  . ILE B 1 110 ? -10.837 39.672  8.266   1.00 53.39  ? 988  ILE B CA  1 
ATOM   2132 C C   . ILE B 1 110 ? -11.229 39.690  6.784   1.00 51.71  ? 988  ILE B C   1 
ATOM   2133 O O   . ILE B 1 110 ? -10.604 40.394  6.000   1.00 51.00  ? 988  ILE B O   1 
ATOM   2134 C CB  . ILE B 1 110 ? -10.409 38.326  8.779   1.00 55.53  ? 988  ILE B CB  1 
ATOM   2135 C CG1 . ILE B 1 110 ? -9.817  38.489  10.183  1.00 55.33  ? 988  ILE B CG1 1 
ATOM   2136 C CG2 . ILE B 1 110 ? -9.384  37.753  7.834   1.00 55.91  ? 988  ILE B CG2 1 
ATOM   2137 C CD1 . ILE B 1 110 ? -8.798  37.417  10.578  1.00 53.93  ? 988  ILE B CD1 1 
ATOM   2138 N N   . PRO B 1 111 ? -12.330 39.001  6.413   1.00 49.40  ? 989  PRO B N   1 
ATOM   2139 C CA  . PRO B 1 111 ? -12.966 38.888  5.098   1.00 48.22  ? 989  PRO B CA  1 
ATOM   2140 C C   . PRO B 1 111 ? -12.974 40.222  4.392   1.00 47.72  ? 989  PRO B C   1 
ATOM   2141 O O   . PRO B 1 111 ? -12.557 40.358  3.233   1.00 47.80  ? 989  PRO B O   1 
ATOM   2142 C CB  . PRO B 1 111 ? -14.423 38.595  5.448   1.00 49.33  ? 989  PRO B CB  1 
ATOM   2143 C CG  . PRO B 1 111 ? -14.414 38.036  6.743   1.00 49.31  ? 989  PRO B CG  1 
ATOM   2144 C CD  . PRO B 1 111 ? -13.268 38.640  7.488   1.00 50.94  ? 989  PRO B CD  1 
ATOM   2145 N N   . THR B 1 112 ? -13.548 41.187  5.098   1.00 46.71  ? 990  THR B N   1 
ATOM   2146 C CA  . THR B 1 112 ? -13.689 42.563  4.639   1.00 45.64  ? 990  THR B CA  1 
ATOM   2147 C C   . THR B 1 112 ? -12.327 43.178  4.308   1.00 44.63  ? 990  THR B C   1 
ATOM   2148 O O   . THR B 1 112 ? -12.091 43.588  3.170   1.00 44.78  ? 990  THR B O   1 
ATOM   2149 C CB  . THR B 1 112 ? -14.425 43.393  5.710   1.00 55.13  ? 990  THR B CB  1 
ATOM   2150 O OG1 . THR B 1 112 ? -15.595 42.690  6.163   1.00 56.77  ? 990  THR B OG1 1 
ATOM   2151 C CG2 . THR B 1 112 ? -14.822 44.740  5.166   1.00 55.75  ? 990  THR B CG2 1 
ATOM   2152 N N   . ILE B 1 113 ? -11.436 43.237  5.297   1.00 40.87  ? 991  ILE B N   1 
ATOM   2153 C CA  . ILE B 1 113 ? -10.105 43.804  5.080   1.00 39.30  ? 991  ILE B CA  1 
ATOM   2154 C C   . ILE B 1 113 ? -9.402  43.124  3.896   1.00 38.99  ? 991  ILE B C   1 
ATOM   2155 O O   . ILE B 1 113 ? -8.785  43.768  3.055   1.00 38.97  ? 991  ILE B O   1 
ATOM   2156 C CB  . ILE B 1 113 ? -9.250  43.760  6.377   1.00 39.37  ? 991  ILE B CB  1 
ATOM   2157 C CG1 . ILE B 1 113 ? -9.942  44.550  7.489   1.00 38.68  ? 991  ILE B CG1 1 
ATOM   2158 C CG2 . ILE B 1 113 ? -7.811  44.254  6.137   1.00 37.54  ? 991  ILE B CG2 1 
ATOM   2159 C CD1 . ILE B 1 113 ? -9.933  43.840  8.847   1.00 38.37  ? 991  ILE B CD1 1 
ATOM   2160 N N   . SER B 1 114 ? -9.502  41.812  3.837   1.00 41.78  ? 992  SER B N   1 
ATOM   2161 C CA  . SER B 1 114 ? -8.877  41.081  2.773   1.00 42.41  ? 992  SER B CA  1 
ATOM   2162 C C   . SER B 1 114 ? -9.513  41.376  1.405   1.00 42.97  ? 992  SER B C   1 
ATOM   2163 O O   . SER B 1 114 ? -8.843  41.258  0.366   1.00 43.06  ? 992  SER B O   1 
ATOM   2164 C CB  . SER B 1 114 ? -8.920  39.593  3.090   1.00 48.63  ? 992  SER B CB  1 
ATOM   2165 O OG  . SER B 1 114 ? -10.235 39.073  2.933   1.00 50.02  ? 992  SER B OG  1 
ATOM   2166 N N   . THR B 1 115 ? -10.783 41.791  1.397   1.00 44.00  ? 993  THR B N   1 
ATOM   2167 C CA  . THR B 1 115 ? -11.457 42.133  0.151   1.00 43.64  ? 993  THR B CA  1 
ATOM   2168 C C   . THR B 1 115 ? -11.094 43.525  -0.327  1.00 43.62  ? 993  THR B C   1 
ATOM   2169 O O   . THR B 1 115 ? -11.038 43.781  -1.524  1.00 44.34  ? 993  THR B O   1 
ATOM   2170 C CB  . THR B 1 115 ? -12.947 41.937  0.252   1.00 41.25  ? 993  THR B CB  1 
ATOM   2171 O OG1 . THR B 1 115 ? -13.225 40.536  0.165   1.00 42.06  ? 993  THR B OG1 1 
ATOM   2172 C CG2 . THR B 1 115 ? -13.648 42.635  -0.883  1.00 40.74  ? 993  THR B CG2 1 
ATOM   2173 N N   . GLN B 1 116 ? -10.871 44.440  0.606   1.00 45.57  ? 994  GLN B N   1 
ATOM   2174 C CA  . GLN B 1 116 ? -10.446 45.787  0.254   1.00 45.38  ? 994  GLN B CA  1 
ATOM   2175 C C   . GLN B 1 116 ? -9.044  45.638  -0.360  1.00 44.78  ? 994  GLN B C   1 
ATOM   2176 O O   . GLN B 1 116 ? -8.622  46.408  -1.246  1.00 44.51  ? 994  GLN B O   1 
ATOM   2177 C CB  . GLN B 1 116 ? -10.286 46.610  1.535   1.00 49.33  ? 994  GLN B CB  1 
ATOM   2178 C CG  . GLN B 1 116 ? -11.576 47.011  2.210   1.00 51.59  ? 994  GLN B CG  1 
ATOM   2179 C CD  . GLN B 1 116 ? -11.316 47.821  3.472   1.00 55.19  ? 994  GLN B CD  1 
ATOM   2180 O OE1 . GLN B 1 116 ? -10.244 48.424  3.620   1.00 55.07  ? 994  GLN B OE1 1 
ATOM   2181 N NE2 . GLN B 1 116 ? -12.263 47.781  4.418   1.00 54.64  ? 994  GLN B NE2 1 
ATOM   2182 N N   . LEU B 1 117 ? -8.305  44.673  0.176   1.00 43.70  ? 995  LEU B N   1 
ATOM   2183 C CA  . LEU B 1 117 ? -6.950  44.468  -0.242  1.00 42.28  ? 995  LEU B CA  1 
ATOM   2184 C C   . LEU B 1 117 ? -6.826  44.115  -1.724  1.00 41.62  ? 995  LEU B C   1 
ATOM   2185 O O   . LEU B 1 117 ? -5.920  44.619  -2.415  1.00 40.52  ? 995  LEU B O   1 
ATOM   2186 C CB  . LEU B 1 117 ? -6.289  43.422  0.627   1.00 43.25  ? 995  LEU B CB  1 
ATOM   2187 C CG  . LEU B 1 117 ? -4.776  43.391  0.392   1.00 41.80  ? 995  LEU B CG  1 
ATOM   2188 C CD1 . LEU B 1 117 ? -4.098  44.639  0.992   1.00 40.19  ? 995  LEU B CD1 1 
ATOM   2189 C CD2 . LEU B 1 117 ? -4.190  42.103  0.925   1.00 40.19  ? 995  LEU B CD2 1 
ATOM   2190 N N   . LYS B 1 118 ? -7.726  43.237  -2.191  1.00 39.94  ? 996  LYS B N   1 
ATOM   2191 C CA  . LYS B 1 118 ? -7.808  42.786  -3.592  1.00 38.37  ? 996  LYS B CA  1 
ATOM   2192 C C   . LYS B 1 118 ? -8.153  43.992  -4.452  1.00 37.65  ? 996  LYS B C   1 
ATOM   2193 O O   . LYS B 1 118 ? -7.587  44.219  -5.523  1.00 36.90  ? 996  LYS B O   1 
ATOM   2194 C CB  . LYS B 1 118 ? -8.924  41.744  -3.751  1.00 42.00  ? 996  LYS B CB  1 
ATOM   2195 C CG  . LYS B 1 118 ? -8.759  40.456  -2.945  1.00 42.88  ? 996  LYS B CG  1 
ATOM   2196 C CD  . LYS B 1 118 ? -9.554  39.302  -3.558  1.00 44.49  ? 996  LYS B CD  1 
ATOM   2197 C CE  . LYS B 1 118 ? -11.088 39.363  -3.276  1.00 48.04  ? 996  LYS B CE  1 
ATOM   2198 N NZ  . LYS B 1 118 ? -11.583 38.777  -1.959  1.00 49.36  ? 996  LYS B NZ  1 
ATOM   2199 N N   . ILE B 1 119 ? -9.054  44.806  -3.942  1.00 35.70  ? 997  ILE B N   1 
ATOM   2200 C CA  . ILE B 1 119 ? -9.459  46.007  -4.628  1.00 36.06  ? 997  ILE B CA  1 
ATOM   2201 C C   . ILE B 1 119 ? -8.332  47.025  -4.690  1.00 36.61  ? 997  ILE B C   1 
ATOM   2202 O O   . ILE B 1 119 ? -7.970  47.494  -5.757  1.00 36.67  ? 997  ILE B O   1 
ATOM   2203 C CB  . ILE B 1 119 ? -10.701 46.561  -3.972  1.00 38.84  ? 997  ILE B CB  1 
ATOM   2204 C CG1 . ILE B 1 119 ? -11.833 45.528  -4.025  1.00 39.11  ? 997  ILE B CG1 1 
ATOM   2205 C CG2 . ILE B 1 119 ? -11.060 47.888  -4.559  1.00 37.59  ? 997  ILE B CG2 1 
ATOM   2206 C CD1 . ILE B 1 119 ? -13.092 46.012  -3.388  1.00 38.45  ? 997  ILE B CD1 1 
ATOM   2207 N N   . LEU B 1 120 ? -7.744  47.338  -3.549  1.00 39.20  ? 998  LEU B N   1 
ATOM   2208 C CA  . LEU B 1 120 ? -6.644  48.299  -3.528  1.00 39.98  ? 998  LEU B CA  1 
ATOM   2209 C C   . LEU B 1 120 ? -5.540  47.848  -4.439  1.00 40.48  ? 998  LEU B C   1 
ATOM   2210 O O   . LEU B 1 120 ? -4.911  48.661  -5.103  1.00 40.33  ? 998  LEU B O   1 
ATOM   2211 C CB  . LEU B 1 120 ? -6.076  48.457  -2.115  1.00 40.17  ? 998  LEU B CB  1 
ATOM   2212 C CG  . LEU B 1 120 ? -7.058  49.196  -1.217  1.00 38.33  ? 998  LEU B CG  1 
ATOM   2213 C CD1 . LEU B 1 120 ? -6.738  48.990  0.239   1.00 36.80  ? 998  LEU B CD1 1 
ATOM   2214 C CD2 . LEU B 1 120 ? -6.998  50.652  -1.597  1.00 37.99  ? 998  LEU B CD2 1 
ATOM   2215 N N   . SER B 1 121 ? -5.282  46.545  -4.443  1.00 42.24  ? 999  SER B N   1 
ATOM   2216 C CA  . SER B 1 121 ? -4.206  45.984  -5.269  1.00 43.74  ? 999  SER B CA  1 
ATOM   2217 C C   . SER B 1 121 ? -4.478  45.979  -6.781  1.00 44.66  ? 999  SER B C   1 
ATOM   2218 O O   . SER B 1 121 ? -3.544  46.083  -7.584  1.00 44.24  ? 999  SER B O   1 
ATOM   2219 C CB  . SER B 1 121 ? -3.802  44.599  -4.789  1.00 46.51  ? 999  SER B CB  1 
ATOM   2220 O OG  . SER B 1 121 ? -4.953  43.839  -4.523  1.00 46.58  ? 999  SER B OG  1 
ATOM   2221 N N   . THR B 1 122 ? -5.741  45.873  -7.177  1.00 45.54  ? 1000 THR B N   1 
ATOM   2222 C CA  . THR B 1 122 ? -6.054  45.942  -8.596  1.00 46.96  ? 1000 THR B CA  1 
ATOM   2223 C C   . THR B 1 122 ? -5.803  47.362  -9.117  1.00 48.20  ? 1000 THR B C   1 
ATOM   2224 O O   . THR B 1 122 ? -5.342  47.542  -10.246 1.00 48.01  ? 1000 THR B O   1 
ATOM   2225 C CB  . THR B 1 122 ? -7.489  45.534  -8.876  1.00 51.85  ? 1000 THR B CB  1 
ATOM   2226 O OG1 . THR B 1 122 ? -7.673  44.169  -8.494  1.00 52.52  ? 1000 THR B OG1 1 
ATOM   2227 C CG2 . THR B 1 122 ? -7.799  45.714  -10.347 1.00 50.67  ? 1000 THR B CG2 1 
ATOM   2228 N N   . VAL B 1 123 ? -6.121  48.379  -8.318  1.00 45.84  ? 1001 VAL B N   1 
ATOM   2229 C CA  . VAL B 1 123 ? -5.874  49.750  -8.775  1.00 47.61  ? 1001 VAL B CA  1 
ATOM   2230 C C   . VAL B 1 123 ? -4.388  49.986  -8.886  1.00 48.41  ? 1001 VAL B C   1 
ATOM   2231 O O   . VAL B 1 123 ? -3.922  50.626  -9.823  1.00 49.06  ? 1001 VAL B O   1 
ATOM   2232 C CB  . VAL B 1 123 ? -6.480  50.813  -7.846  1.00 50.66  ? 1001 VAL B CB  1 
ATOM   2233 C CG1 . VAL B 1 123 ? -7.459  50.179  -6.886  1.00 50.16  ? 1001 VAL B CG1 1 
ATOM   2234 C CG2 . VAL B 1 123 ? -5.363  51.552  -7.113  1.00 51.95  ? 1001 VAL B CG2 1 
ATOM   2235 N N   . LYS B 1 124 ? -3.667  49.507  -7.879  1.00 48.78  ? 1002 LYS B N   1 
ATOM   2236 C CA  . LYS B 1 124 ? -2.233  49.683  -7.797  1.00 49.94  ? 1002 LYS B CA  1 
ATOM   2237 C C   . LYS B 1 124 ? -1.597  49.070  -9.029  1.00 50.72  ? 1002 LYS B C   1 
ATOM   2238 O O   . LYS B 1 124 ? -0.806  49.716  -9.713  1.00 50.64  ? 1002 LYS B O   1 
ATOM   2239 C CB  . LYS B 1 124 ? -1.700  49.051  -6.510  1.00 50.24  ? 1002 LYS B CB  1 
ATOM   2240 C CG  . LYS B 1 124 ? -0.224  49.244  -6.316  1.00 50.93  ? 1002 LYS B CG  1 
ATOM   2241 C CD  . LYS B 1 124 ? 0.055   50.649  -5.850  1.00 53.18  ? 1002 LYS B CD  1 
ATOM   2242 C CE  . LYS B 1 124 ? 1.231   51.237  -6.600  1.00 53.99  ? 1002 LYS B CE  1 
ATOM   2243 N NZ  . LYS B 1 124 ? 0.976   52.650  -6.972  1.00 54.96  ? 1002 LYS B NZ  1 
ATOM   2244 N N   . ALA B 1 125 ? -2.016  47.852  -9.339  1.00 54.20  ? 1003 ALA B N   1 
ATOM   2245 C CA  . ALA B 1 125 ? -1.546  47.111  -10.502 1.00 55.74  ? 1003 ALA B CA  1 
ATOM   2246 C C   . ALA B 1 125 ? -1.688  47.879  -11.819 1.00 56.94  ? 1003 ALA B C   1 
ATOM   2247 O O   . ALA B 1 125 ? -0.722  48.007  -12.553 1.00 57.51  ? 1003 ALA B O   1 
ATOM   2248 C CB  . ALA B 1 125 ? -2.258  45.743  -10.595 1.00 56.36  ? 1003 ALA B CB  1 
ATOM   2249 N N   . THR B 1 126 ? -2.888  48.354  -12.141 1.00 61.96  ? 1004 THR B N   1 
ATOM   2250 C CA  . THR B 1 126 ? -3.096  49.102  -13.380 1.00 63.70  ? 1004 THR B CA  1 
ATOM   2251 C C   . THR B 1 126 ? -2.302  50.414  -13.390 1.00 64.54  ? 1004 THR B C   1 
ATOM   2252 O O   . THR B 1 126 ? -1.916  50.933  -14.444 1.00 64.41  ? 1004 THR B O   1 
ATOM   2253 C CB  . THR B 1 126 ? -4.586  49.377  -13.615 1.00 67.41  ? 1004 THR B CB  1 
ATOM   2254 O OG1 . THR B 1 126 ? -4.882  50.725  -13.229 1.00 66.78  ? 1004 THR B OG1 1 
ATOM   2255 C CG2 . THR B 1 126 ? -5.430  48.428  -12.806 1.00 68.12  ? 1004 THR B CG2 1 
ATOM   2256 N N   . MET B 1 127 ? -2.096  50.965  -12.206 1.00 69.22  ? 1005 MET B N   1 
ATOM   2257 C CA  . MET B 1 127 ? -1.362  52.196  -12.092 1.00 71.21  ? 1005 MET B CA  1 
ATOM   2258 C C   . MET B 1 127 ? 0.082   51.970  -12.463 1.00 72.49  ? 1005 MET B C   1 
ATOM   2259 O O   . MET B 1 127 ? 0.708   52.835  -13.074 1.00 71.93  ? 1005 MET B O   1 
ATOM   2260 C CB  . MET B 1 127 ? -1.458  52.717  -10.687 1.00 73.84  ? 1005 MET B CB  1 
ATOM   2261 C CG  . MET B 1 127 ? -2.469  53.788  -10.604 1.00 74.41  ? 1005 MET B CG  1 
ATOM   2262 S SD  . MET B 1 127 ? -2.430  54.511  -9.006  1.00 75.46  ? 1005 MET B SD  1 
ATOM   2263 C CE  . MET B 1 127 ? -3.980  55.342  -9.027  1.00 74.23  ? 1005 MET B CE  1 
ATOM   2264 N N   . LEU B 1 128 ? 0.599   50.797  -12.094 1.00 78.20  ? 1006 LEU B N   1 
ATOM   2265 C CA  . LEU B 1 128 ? 1.970   50.410  -12.425 1.00 79.83  ? 1006 LEU B CA  1 
ATOM   2266 C C   . LEU B 1 128 ? 2.182   50.549  -13.926 1.00 81.12  ? 1006 LEU B C   1 
ATOM   2267 O O   . LEU B 1 128 ? 1.333   50.126  -14.744 1.00 81.13  ? 1006 LEU B O   1 
ATOM   2268 C CB  . LEU B 1 128 ? 2.272   48.965  -12.000 1.00 79.49  ? 1006 LEU B CB  1 
ATOM   2269 C CG  . LEU B 1 128 ? 2.208   48.600  -10.513 1.00 80.46  ? 1006 LEU B CG  1 
ATOM   2270 C CD1 . LEU B 1 128 ? 3.251   47.552  -10.165 1.00 78.69  ? 1006 LEU B CD1 1 
ATOM   2271 C CD2 . LEU B 1 128 ? 2.343   49.836  -9.623  1.00 80.81  ? 1006 LEU B CD2 1 
ATOM   2272 N N   . GLY B 1 129 ? 3.317   51.155  -14.276 1.00 87.73  ? 1007 GLY B N   1 
ATOM   2273 C CA  . GLY B 1 129 ? 3.715   51.397  -15.656 1.00 89.05  ? 1007 GLY B CA  1 
ATOM   2274 C C   . GLY B 1 129 ? 3.307   52.775  -16.144 1.00 89.94  ? 1007 GLY B C   1 
ATOM   2275 O O   . GLY B 1 129 ? 4.064   53.456  -16.837 1.00 90.09  ? 1007 GLY B O   1 
ATOM   2276 N N   . ARG B 1 130 ? 2.094   53.179  -15.779 1.00 93.54  ? 1008 ARG B N   1 
ATOM   2277 C CA  . ARG B 1 130 ? 1.569   54.472  -16.174 1.00 93.21  ? 1008 ARG B CA  1 
ATOM   2278 C C   . ARG B 1 130 ? 2.564   55.601  -15.910 1.00 92.75  ? 1008 ARG B C   1 
ATOM   2279 O O   . ARG B 1 130 ? 3.328   55.572  -14.935 1.00 92.46  ? 1008 ARG B O   1 
ATOM   2280 C CB  . ARG B 1 130 ? 0.237   54.744  -15.473 1.00 97.61  ? 1008 ARG B CB  1 
ATOM   2281 C CG  . ARG B 1 130 ? -0.949  54.703  -16.401 1.00 98.49  ? 1008 ARG B CG  1 
ATOM   2282 C CD  . ARG B 1 130 ? -0.952  53.425  -17.215 1.00 100.21 ? 1008 ARG B CD  1 
ATOM   2283 N NE  . ARG B 1 130 ? -2.205  52.674  -17.100 1.00 102.40 ? 1008 ARG B NE  1 
ATOM   2284 C CZ  . ARG B 1 130 ? -3.427  53.216  -17.042 1.00 103.61 ? 1008 ARG B CZ  1 
ATOM   2285 N NH1 . ARG B 1 130 ? -3.598  54.541  -17.069 1.00 103.87 ? 1008 ARG B NH1 1 
ATOM   2286 N NH2 . ARG B 1 130 ? -4.494  52.422  -16.951 1.00 103.96 ? 1008 ARG B NH2 1 
ATOM   2287 N N   . THR B 1 131 ? 2.551   56.583  -16.810 1.00 92.52  ? 1009 THR B N   1 
ATOM   2288 C CA  . THR B 1 131 ? 3.411   57.758  -16.717 1.00 92.07  ? 1009 THR B CA  1 
ATOM   2289 C C   . THR B 1 131 ? 2.525   58.992  -16.596 1.00 91.55  ? 1009 THR B C   1 
ATOM   2290 O O   . THR B 1 131 ? 2.979   60.046  -16.149 1.00 91.47  ? 1009 THR B O   1 
ATOM   2291 C CB  . THR B 1 131 ? 4.351   57.869  -17.939 1.00 97.26  ? 1009 THR B CB  1 
ATOM   2292 O OG1 . THR B 1 131 ? 3.572   57.892  -19.140 1.00 96.69  ? 1009 THR B OG1 1 
ATOM   2293 C CG2 . THR B 1 131 ? 5.300   56.682  -17.987 1.00 96.78  ? 1009 THR B CG2 1 
ATOM   2294 N N   . ASN B 1 132 ? 1.261   58.839  -16.989 1.00 89.42  ? 1010 ASN B N   1 
ATOM   2295 C CA  . ASN B 1 132 ? 0.296   59.925  -16.945 1.00 88.81  ? 1010 ASN B CA  1 
ATOM   2296 C C   . ASN B 1 132 ? -0.321  60.086  -15.572 1.00 88.35  ? 1010 ASN B C   1 
ATOM   2297 O O   . ASN B 1 132 ? -0.774  61.166  -15.222 1.00 88.33  ? 1010 ASN B O   1 
ATOM   2298 C CB  . ASN B 1 132 ? -0.800  59.722  -17.983 1.00 93.65  ? 1010 ASN B CB  1 
ATOM   2299 C CG  . ASN B 1 132 ? -1.106  58.262  -18.218 1.00 93.36  ? 1010 ASN B CG  1 
ATOM   2300 O OD1 . ASN B 1 132 ? -1.920  57.660  -17.513 1.00 93.34  ? 1010 ASN B OD1 1 
ATOM   2301 N ND2 . ASN B 1 132 ? -0.434  57.674  -19.197 1.00 92.08  ? 1010 ASN B ND2 1 
ATOM   2302 N N   . ILE B 1 133 ? -0.339  59.025  -14.779 1.00 87.22  ? 1011 ILE B N   1 
ATOM   2303 C CA  . ILE B 1 133 ? -0.914  59.148  -13.446 1.00 86.91  ? 1011 ILE B CA  1 
ATOM   2304 C C   . ILE B 1 133 ? -0.069  60.055  -12.565 1.00 86.64  ? 1011 ILE B C   1 
ATOM   2305 O O   . ILE B 1 133 ? 1.162   59.977  -12.556 1.00 86.40  ? 1011 ILE B O   1 
ATOM   2306 C CB  . ILE B 1 133 ? -1.186  57.792  -12.769 1.00 90.20  ? 1011 ILE B CB  1 
ATOM   2307 C CG1 . ILE B 1 133 ? -2.540  57.237  -13.222 1.00 89.69  ? 1011 ILE B CG1 1 
ATOM   2308 C CG2 . ILE B 1 133 ? -1.169  57.959  -11.246 1.00 88.85  ? 1011 ILE B CG2 1 
ATOM   2309 C CD1 . ILE B 1 133 ? -2.443  56.126  -14.242 1.00 88.37  ? 1011 ILE B CD1 1 
ATOM   2310 N N   . SER B 1 134 ? -0.758  60.909  -11.820 1.00 85.06  ? 1012 SER B N   1 
ATOM   2311 C CA  . SER B 1 134 ? -0.126  61.877  -10.939 1.00 84.72  ? 1012 SER B CA  1 
ATOM   2312 C C   . SER B 1 134 ? 0.764   61.283  -9.837  1.00 84.47  ? 1012 SER B C   1 
ATOM   2313 O O   . SER B 1 134 ? 0.608   60.133  -9.438  1.00 84.31  ? 1012 SER B O   1 
ATOM   2314 C CB  . SER B 1 134 ? -1.192  62.793  -10.334 1.00 87.62  ? 1012 SER B CB  1 
ATOM   2315 O OG  . SER B 1 134 ? -1.294  62.629  -8.931  1.00 87.32  ? 1012 SER B OG  1 
ATOM   2316 N N   . ASP B 1 135 ? 1.690   62.097  -9.345  1.00 82.78  ? 1013 ASP B N   1 
ATOM   2317 C CA  . ASP B 1 135 ? 2.598   61.703  -8.279  1.00 82.36  ? 1013 ASP B CA  1 
ATOM   2318 C C   . ASP B 1 135 ? 1.781   61.385  -7.040  1.00 81.28  ? 1013 ASP B C   1 
ATOM   2319 O O   . ASP B 1 135 ? 1.938   60.334  -6.411  1.00 81.31  ? 1013 ASP B O   1 
ATOM   2320 C CB  . ASP B 1 135 ? 3.521   62.885  -7.924  1.00 84.76  ? 1013 ASP B CB  1 
ATOM   2321 C CG  . ASP B 1 135 ? 4.516   63.223  -9.033  1.00 86.63  ? 1013 ASP B CG  1 
ATOM   2322 O OD1 . ASP B 1 135 ? 4.650   64.435  -9.377  1.00 85.36  ? 1013 ASP B OD1 1 
ATOM   2323 O OD2 . ASP B 1 135 ? 5.165   62.265  -9.526  1.00 86.77  ? 1013 ASP B OD2 1 
ATOM   2324 N N   . GLU B 1 136 ? 0.960   62.353  -6.653  1.00 78.90  ? 1014 GLU B N   1 
ATOM   2325 C CA  . GLU B 1 136 ? 0.158   62.234  -5.457  1.00 78.04  ? 1014 GLU B CA  1 
ATOM   2326 C C   . GLU B 1 136 ? -0.769  61.042  -5.509  1.00 77.37  ? 1014 GLU B C   1 
ATOM   2327 O O   . GLU B 1 136 ? -0.973  60.377  -4.504  1.00 77.31  ? 1014 GLU B O   1 
ATOM   2328 C CB  . GLU B 1 136 ? -0.601  63.530  -5.199  1.00 80.57  ? 1014 GLU B CB  1 
ATOM   2329 C CG  . GLU B 1 136 ? 0.114   64.516  -4.242  1.00 82.86  ? 1014 GLU B CG  1 
ATOM   2330 C CD  . GLU B 1 136 ? 1.624   64.229  -4.017  1.00 85.24  ? 1014 GLU B CD  1 
ATOM   2331 O OE1 . GLU B 1 136 ? 1.971   63.136  -3.492  1.00 84.66  ? 1014 GLU B OE1 1 
ATOM   2332 O OE2 . GLU B 1 136 ? 2.453   65.135  -4.302  1.00 84.34  ? 1014 GLU B OE2 1 
ATOM   2333 N N   . GLU B 1 137 ? -1.299  60.752  -6.692  1.00 72.78  ? 1015 GLU B N   1 
ATOM   2334 C CA  . GLU B 1 137 ? -2.209  59.623  -6.877  1.00 72.35  ? 1015 GLU B CA  1 
ATOM   2335 C C   . GLU B 1 137 ? -1.510  58.293  -6.630  1.00 71.33  ? 1015 GLU B C   1 
ATOM   2336 O O   . GLU B 1 137 ? -2.001  57.435  -5.916  1.00 71.07  ? 1015 GLU B O   1 
ATOM   2337 C CB  . GLU B 1 137 ? -2.800  59.629  -8.291  1.00 74.88  ? 1015 GLU B CB  1 
ATOM   2338 C CG  . GLU B 1 137 ? -4.346  59.711  -8.384  1.00 77.23  ? 1015 GLU B CG  1 
ATOM   2339 C CD  . GLU B 1 137 ? -4.907  59.374  -9.798  1.00 80.75  ? 1015 GLU B CD  1 
ATOM   2340 O OE1 . GLU B 1 137 ? -4.137  59.366  -10.791 1.00 81.88  ? 1015 GLU B OE1 1 
ATOM   2341 O OE2 . GLU B 1 137 ? -6.129  59.109  -9.919  1.00 82.04  ? 1015 GLU B OE2 1 
ATOM   2342 N N   . SER B 1 138 ? -0.363  58.107  -7.245  1.00 65.86  ? 1016 SER B N   1 
ATOM   2343 C CA  . SER B 1 138 ? 0.350   56.866  -7.067  1.00 65.48  ? 1016 SER B CA  1 
ATOM   2344 C C   . SER B 1 138 ? 0.822   56.654  -5.648  1.00 64.96  ? 1016 SER B C   1 
ATOM   2345 O O   . SER B 1 138 ? 0.751   55.550  -5.162  1.00 65.33  ? 1016 SER B O   1 
ATOM   2346 C CB  . SER B 1 138 ? 1.523   56.765  -8.033  1.00 67.87  ? 1016 SER B CB  1 
ATOM   2347 O OG  . SER B 1 138 ? 1.764   58.003  -8.675  1.00 70.02  ? 1016 SER B OG  1 
ATOM   2348 N N   . GLU B 1 139 ? 1.357   57.669  -4.980  1.00 63.64  ? 1017 GLU B N   1 
ATOM   2349 C CA  . GLU B 1 139 ? 1.807   57.407  -3.621  1.00 63.08  ? 1017 GLU B CA  1 
ATOM   2350 C C   . GLU B 1 139 ? 0.632   57.201  -2.680  1.00 62.26  ? 1017 GLU B C   1 
ATOM   2351 O O   . GLU B 1 139 ? 0.756   56.573  -1.628  1.00 62.49  ? 1017 GLU B O   1 
ATOM   2352 C CB  . GLU B 1 139 ? 2.865   58.397  -3.079  1.00 65.92  ? 1017 GLU B CB  1 
ATOM   2353 C CG  . GLU B 1 139 ? 3.448   58.043  -1.602  1.00 67.53  ? 1017 GLU B CG  1 
ATOM   2354 C CD  . GLU B 1 139 ? 4.215   56.665  -1.432  1.00 70.33  ? 1017 GLU B CD  1 
ATOM   2355 O OE1 . GLU B 1 139 ? 4.211   56.113  -0.294  1.00 70.04  ? 1017 GLU B OE1 1 
ATOM   2356 O OE2 . GLU B 1 139 ? 4.887   56.196  -2.389  1.00 70.10  ? 1017 GLU B OE2 1 
ATOM   2357 N N   . GLN B 1 140 ? -0.533  57.673  -3.076  1.00 56.94  ? 1018 GLN B N   1 
ATOM   2358 C CA  . GLN B 1 140 ? -1.694  57.441  -2.235  1.00 56.21  ? 1018 GLN B CA  1 
ATOM   2359 C C   . GLN B 1 140 ? -2.238  56.017  -2.432  1.00 55.48  ? 1018 GLN B C   1 
ATOM   2360 O O   . GLN B 1 140 ? -2.708  55.378  -1.478  1.00 55.19  ? 1018 GLN B O   1 
ATOM   2361 C CB  . GLN B 1 140 ? -2.782  58.474  -2.489  1.00 54.08  ? 1018 GLN B CB  1 
ATOM   2362 C CG  . GLN B 1 140 ? -3.788  58.587  -1.352  1.00 54.68  ? 1018 GLN B CG  1 
ATOM   2363 C CD  . GLN B 1 140 ? -3.132  58.861  -0.013  1.00 56.37  ? 1018 GLN B CD  1 
ATOM   2364 O OE1 . GLN B 1 140 ? -3.602  58.389  1.026   1.00 57.93  ? 1018 GLN B OE1 1 
ATOM   2365 N NE2 . GLN B 1 140 ? -2.058  59.648  -0.024  1.00 55.31  ? 1018 GLN B NE2 1 
ATOM   2366 N N   . ALA B 1 141 ? -2.182  55.523  -3.667  1.00 55.02  ? 1019 ALA B N   1 
ATOM   2367 C CA  . ALA B 1 141 ? -2.635  54.177  -3.940  1.00 54.45  ? 1019 ALA B CA  1 
ATOM   2368 C C   . ALA B 1 141 ? -1.801  53.245  -3.035  1.00 54.40  ? 1019 ALA B C   1 
ATOM   2369 O O   . ALA B 1 141 ? -2.332  52.408  -2.283  1.00 54.58  ? 1019 ALA B O   1 
ATOM   2370 C CB  . ALA B 1 141 ? -2.434  53.853  -5.408  1.00 54.44  ? 1019 ALA B CB  1 
ATOM   2371 N N   . THR B 1 142 ? -0.489  53.456  -3.066  1.00 53.01  ? 1020 THR B N   1 
ATOM   2372 C CA  . THR B 1 142 ? 0.466   52.689  -2.284  1.00 52.31  ? 1020 THR B CA  1 
ATOM   2373 C C   . THR B 1 142 ? 0.189   52.760  -0.777  1.00 51.75  ? 1020 THR B C   1 
ATOM   2374 O O   . THR B 1 142 ? 0.288   51.769  -0.056  1.00 51.04  ? 1020 THR B O   1 
ATOM   2375 C CB  . THR B 1 142 ? 1.894   53.172  -2.606  1.00 48.61  ? 1020 THR B CB  1 
ATOM   2376 O OG1 . THR B 1 142 ? 2.281   52.710  -3.902  1.00 48.03  ? 1020 THR B OG1 1 
ATOM   2377 C CG2 . THR B 1 142 ? 2.871   52.706  -1.548  1.00 48.29  ? 1020 THR B CG2 1 
ATOM   2378 N N   . GLU B 1 143 ? -0.132  53.941  -0.288  1.00 51.79  ? 1021 GLU B N   1 
ATOM   2379 C CA  . GLU B 1 143 ? -0.343  54.071  1.133   1.00 52.15  ? 1021 GLU B CA  1 
ATOM   2380 C C   . GLU B 1 143 ? -1.608  53.478  1.683   1.00 51.51  ? 1021 GLU B C   1 
ATOM   2381 O O   . GLU B 1 143 ? -1.691  53.247  2.878   1.00 51.42  ? 1021 GLU B O   1 
ATOM   2382 C CB  . GLU B 1 143 ? -0.106  55.488  1.621   1.00 56.13  ? 1021 GLU B CB  1 
ATOM   2383 C CG  . GLU B 1 143 ? 1.367   55.890  1.522   1.00 58.99  ? 1021 GLU B CG  1 
ATOM   2384 C CD  . GLU B 1 143 ? 1.690   57.237  2.198   1.00 64.02  ? 1021 GLU B CD  1 
ATOM   2385 O OE1 . GLU B 1 143 ? 1.801   58.255  1.461   1.00 64.11  ? 1021 GLU B OE1 1 
ATOM   2386 O OE2 . GLU B 1 143 ? 1.905   57.273  3.448   1.00 65.71  ? 1021 GLU B OE2 1 
ATOM   2387 N N   . MET B 1 144 ? -2.582  53.211  0.818   1.00 48.30  ? 1022 MET B N   1 
ATOM   2388 C CA  . MET B 1 144 ? -3.862  52.626  1.233   1.00 47.26  ? 1022 MET B CA  1 
ATOM   2389 C C   . MET B 1 144 ? -3.705  51.123  1.289   1.00 46.16  ? 1022 MET B C   1 
ATOM   2390 O O   . MET B 1 144 ? -4.487  50.403  1.921   1.00 45.57  ? 1022 MET B O   1 
ATOM   2391 C CB  . MET B 1 144 ? -4.952  52.925  0.214   1.00 49.19  ? 1022 MET B CB  1 
ATOM   2392 C CG  . MET B 1 144 ? -5.072  54.353  -0.269  1.00 51.07  ? 1022 MET B CG  1 
ATOM   2393 S SD  . MET B 1 144 ? -6.763  54.565  -0.959  1.00 55.95  ? 1022 MET B SD  1 
ATOM   2394 C CE  . MET B 1 144 ? -6.384  54.946  -2.661  1.00 55.71  ? 1022 MET B CE  1 
ATOM   2395 N N   . LEU B 1 145 ? -2.739  50.667  0.511   1.00 44.47  ? 1023 LEU B N   1 
ATOM   2396 C CA  . LEU B 1 145 ? -2.386  49.260  0.420   1.00 43.98  ? 1023 LEU B CA  1 
ATOM   2397 C C   . LEU B 1 145 ? -1.685  48.934  1.731   1.00 43.79  ? 1023 LEU B C   1 
ATOM   2398 O O   . LEU B 1 145 ? -2.134  48.100  2.494   1.00 43.53  ? 1023 LEU B O   1 
ATOM   2399 C CB  . LEU B 1 145 ? -1.421  49.052  -0.761  1.00 43.32  ? 1023 LEU B CB  1 
ATOM   2400 C CG  . LEU B 1 145 ? -1.536  47.749  -1.540  1.00 41.54  ? 1023 LEU B CG  1 
ATOM   2401 C CD1 . LEU B 1 145 ? -2.784  46.959  -1.150  1.00 37.24  ? 1023 LEU B CD1 1 
ATOM   2402 C CD2 . LEU B 1 145 ? -1.517  48.053  -2.998  1.00 40.13  ? 1023 LEU B CD2 1 
ATOM   2403 N N   . VAL B 1 146 ? -0.598  49.639  1.996   1.00 43.27  ? 1024 VAL B N   1 
ATOM   2404 C CA  . VAL B 1 146 ? 0.139   49.452  3.232   1.00 43.28  ? 1024 VAL B CA  1 
ATOM   2405 C C   . VAL B 1 146 ? -0.756  49.512  4.465   1.00 43.80  ? 1024 VAL B C   1 
ATOM   2406 O O   . VAL B 1 146 ? -0.509  48.864  5.469   1.00 43.84  ? 1024 VAL B O   1 
ATOM   2407 C CB  . VAL B 1 146 ? 1.189   50.525  3.366   1.00 45.34  ? 1024 VAL B CB  1 
ATOM   2408 C CG1 . VAL B 1 146 ? 1.768   50.473  4.745   1.00 44.52  ? 1024 VAL B CG1 1 
ATOM   2409 C CG2 . VAL B 1 146 ? 2.233   50.380  2.268   1.00 45.49  ? 1024 VAL B CG2 1 
ATOM   2410 N N   . HIS B 1 147 ? -1.757  50.371  4.418   1.00 48.25  ? 1025 HIS B N   1 
ATOM   2411 C CA  . HIS B 1 147 ? -2.603  50.550  5.566   1.00 48.75  ? 1025 HIS B CA  1 
ATOM   2412 C C   . HIS B 1 147 ? -3.491  49.355  5.759   1.00 48.19  ? 1025 HIS B C   1 
ATOM   2413 O O   . HIS B 1 147 ? -3.730  48.922  6.871   1.00 48.60  ? 1025 HIS B O   1 
ATOM   2414 C CB  . HIS B 1 147 ? -3.458  51.785  5.384   1.00 51.60  ? 1025 HIS B CB  1 
ATOM   2415 C CG  . HIS B 1 147 ? -4.394  52.033  6.522   1.00 55.41  ? 1025 HIS B CG  1 
ATOM   2416 N ND1 . HIS B 1 147 ? -4.018  52.724  7.653   1.00 56.82  ? 1025 HIS B ND1 1 
ATOM   2417 C CD2 . HIS B 1 147 ? -5.691  51.680  6.706   1.00 57.54  ? 1025 HIS B CD2 1 
ATOM   2418 C CE1 . HIS B 1 147 ? -5.051  52.808  8.477   1.00 57.21  ? 1025 HIS B CE1 1 
ATOM   2419 N NE2 . HIS B 1 147 ? -6.075  52.173  7.931   1.00 57.98  ? 1025 HIS B NE2 1 
ATOM   2420 N N   . ASN B 1 148 ? -4.026  48.858  4.658   1.00 48.26  ? 1026 ASN B N   1 
ATOM   2421 C CA  . ASN B 1 148 ? -4.940  47.714  4.651   1.00 47.54  ? 1026 ASN B CA  1 
ATOM   2422 C C   . ASN B 1 148 ? -4.190  46.452  5.033   1.00 46.78  ? 1026 ASN B C   1 
ATOM   2423 O O   . ASN B 1 148 ? -4.730  45.577  5.689   1.00 47.02  ? 1026 ASN B O   1 
ATOM   2424 C CB  . ASN B 1 148 ? -5.481  47.559  3.247   1.00 56.83  ? 1026 ASN B CB  1 
ATOM   2425 C CG  . ASN B 1 148 ? -6.833  46.971  3.234   1.00 59.10  ? 1026 ASN B CG  1 
ATOM   2426 O OD1 . ASN B 1 148 ? -6.979  45.756  3.372   1.00 60.66  ? 1026 ASN B OD1 1 
ATOM   2427 N ND2 . ASN B 1 148 ? -7.857  47.815  3.061   1.00 59.87  ? 1026 ASN B ND2 1 
ATOM   2428 N N   . ALA B 1 149 ? -2.931  46.391  4.610   1.00 43.51  ? 1027 ALA B N   1 
ATOM   2429 C CA  . ALA B 1 149 ? -2.011  45.305  4.901   1.00 42.85  ? 1027 ALA B CA  1 
ATOM   2430 C C   . ALA B 1 149 ? -1.647  45.328  6.385   1.00 42.80  ? 1027 ALA B C   1 
ATOM   2431 O O   . ALA B 1 149 ? -1.666  44.300  7.048   1.00 42.94  ? 1027 ALA B O   1 
ATOM   2432 C CB  . ALA B 1 149 ? -0.753  45.445  4.040   1.00 43.05  ? 1027 ALA B CB  1 
ATOM   2433 N N   . GLN B 1 150 ? -1.319  46.502  6.918   1.00 42.11  ? 1028 GLN B N   1 
ATOM   2434 C CA  . GLN B 1 150 ? -1.001  46.616  8.345   1.00 42.26  ? 1028 GLN B CA  1 
ATOM   2435 C C   . GLN B 1 150 ? -2.142  46.038  9.190   1.00 41.91  ? 1028 GLN B C   1 
ATOM   2436 O O   . GLN B 1 150 ? -1.908  45.353  10.193  1.00 40.97  ? 1028 GLN B O   1 
ATOM   2437 C CB  . GLN B 1 150 ? -0.821  48.095  8.735   1.00 42.47  ? 1028 GLN B CB  1 
ATOM   2438 C CG  . GLN B 1 150 ? 0.557   48.641  8.528   1.00 43.52  ? 1028 GLN B CG  1 
ATOM   2439 C CD  . GLN B 1 150 ? 0.577   50.144  8.339   1.00 44.38  ? 1028 GLN B CD  1 
ATOM   2440 O OE1 . GLN B 1 150 ? -0.475  50.815  8.320   1.00 45.25  ? 1028 GLN B OE1 1 
ATOM   2441 N NE2 . GLN B 1 150 ? 1.780   50.686  8.148   1.00 43.45  ? 1028 GLN B NE2 1 
ATOM   2442 N N   . ASN B 1 151 ? -3.367  46.408  8.815   1.00 43.44  ? 1029 ASN B N   1 
ATOM   2443 C CA  . ASN B 1 151 ? -4.564  46.029  9.556   1.00 44.50  ? 1029 ASN B CA  1 
ATOM   2444 C C   . ASN B 1 151 ? -4.918  44.564  9.325   1.00 44.56  ? 1029 ASN B C   1 
ATOM   2445 O O   . ASN B 1 151 ? -5.369  43.850  10.233  1.00 45.11  ? 1029 ASN B O   1 
ATOM   2446 C CB  . ASN B 1 151 ? -5.732  46.995  9.268   1.00 59.38  ? 1029 ASN B CB  1 
ATOM   2447 C CG  . ASN B 1 151 ? -5.369  48.481  9.580   1.00 62.46  ? 1029 ASN B CG  1 
ATOM   2448 O OD1 . ASN B 1 151 ? -6.247  49.338  9.757   1.00 63.96  ? 1029 ASN B OD1 1 
ATOM   2449 N ND2 . ASN B 1 151 ? -4.067  48.766  9.691   1.00 65.86  ? 1029 ASN B ND2 1 
ATOM   2450 N N   . LEU B 1 152 ? -4.626  44.079  8.131   1.00 41.98  ? 1030 LEU B N   1 
ATOM   2451 C CA  . LEU B 1 152 ? -4.900  42.692  7.853   1.00 40.90  ? 1030 LEU B CA  1 
ATOM   2452 C C   . LEU B 1 152 ? -4.037  41.887  8.789   1.00 40.97  ? 1030 LEU B C   1 
ATOM   2453 O O   . LEU B 1 152 ? -4.536  41.053  9.528   1.00 41.53  ? 1030 LEU B O   1 
ATOM   2454 C CB  . LEU B 1 152 ? -4.597  42.352  6.400   1.00 39.23  ? 1030 LEU B CB  1 
ATOM   2455 C CG  . LEU B 1 152 ? -4.941  40.913  6.078   1.00 37.03  ? 1030 LEU B CG  1 
ATOM   2456 C CD1 . LEU B 1 152 ? -6.351  40.575  6.541   1.00 34.37  ? 1030 LEU B CD1 1 
ATOM   2457 C CD2 . LEU B 1 152 ? -4.764  40.719  4.608   1.00 34.98  ? 1030 LEU B CD2 1 
ATOM   2458 N N   . MET B 1 153 ? -2.739  42.156  8.787   1.00 45.57  ? 1031 MET B N   1 
ATOM   2459 C CA  . MET B 1 153 ? -1.811  41.421  9.660   1.00 46.04  ? 1031 MET B CA  1 
ATOM   2460 C C   . MET B 1 153 ? -2.242  41.562  11.112  1.00 46.33  ? 1031 MET B C   1 
ATOM   2461 O O   . MET B 1 153 ? -2.315  40.578  11.825  1.00 46.48  ? 1031 MET B O   1 
ATOM   2462 C CB  . MET B 1 153 ? -0.359  41.891  9.495   1.00 50.23  ? 1031 MET B CB  1 
ATOM   2463 C CG  . MET B 1 153 ? 0.151   41.965  8.045   1.00 50.50  ? 1031 MET B CG  1 
ATOM   2464 S SD  . MET B 1 153 ? 0.511   40.313  7.390   1.00 52.40  ? 1031 MET B SD  1 
ATOM   2465 C CE  . MET B 1 153 ? -0.952  40.075  6.161   1.00 49.30  ? 1031 MET B CE  1 
ATOM   2466 N N   . GLN B 1 154 ? -2.583  42.778  11.529  1.00 48.03  ? 1032 GLN B N   1 
ATOM   2467 C CA  . GLN B 1 154 ? -3.006  43.011  12.897  1.00 48.03  ? 1032 GLN B CA  1 
ATOM   2468 C C   . GLN B 1 154 ? -4.189  42.154  13.311  1.00 47.45  ? 1032 GLN B C   1 
ATOM   2469 O O   . GLN B 1 154 ? -4.254  41.646  14.447  1.00 47.33  ? 1032 GLN B O   1 
ATOM   2470 C CB  . GLN B 1 154 ? -3.310  44.484  13.124  1.00 51.16  ? 1032 GLN B CB  1 
ATOM   2471 C CG  . GLN B 1 154 ? -2.383  45.103  14.145  1.00 53.59  ? 1032 GLN B CG  1 
ATOM   2472 C CD  . GLN B 1 154 ? -2.687  44.632  15.541  1.00 55.57  ? 1032 GLN B CD  1 
ATOM   2473 O OE1 . GLN B 1 154 ? -1.792  44.198  16.292  1.00 55.86  ? 1032 GLN B OE1 1 
ATOM   2474 N NE2 . GLN B 1 154 ? -3.955  44.753  15.924  1.00 53.87  ? 1032 GLN B NE2 1 
ATOM   2475 N N   . SER B 1 155 ? -5.133  42.000  12.392  1.00 46.57  ? 1033 SER B N   1 
ATOM   2476 C CA  . SER B 1 155 ? -6.313  41.220  12.681  1.00 46.20  ? 1033 SER B CA  1 
ATOM   2477 C C   . SER B 1 155 ? -5.981  39.735  12.724  1.00 45.94  ? 1033 SER B C   1 
ATOM   2478 O O   . SER B 1 155 ? -6.505  38.985  13.562  1.00 45.50  ? 1033 SER B O   1 
ATOM   2479 C CB  . SER B 1 155 ? -7.397  41.525  11.657  1.00 50.29  ? 1033 SER B CB  1 
ATOM   2480 O OG  . SER B 1 155 ? -7.761  42.887  11.763  1.00 50.53  ? 1033 SER B OG  1 
ATOM   2481 N N   . VAL B 1 156 ? -5.099  39.307  11.828  1.00 43.11  ? 1034 VAL B N   1 
ATOM   2482 C CA  . VAL B 1 156 ? -4.757  37.906  11.798  1.00 43.32  ? 1034 VAL B CA  1 
ATOM   2483 C C   . VAL B 1 156 ? -4.100  37.527  13.116  1.00 43.74  ? 1034 VAL B C   1 
ATOM   2484 O O   . VAL B 1 156 ? -4.550  36.617  13.814  1.00 42.55  ? 1034 VAL B O   1 
ATOM   2485 C CB  . VAL B 1 156 ? -3.971  37.533  10.545  1.00 45.50  ? 1034 VAL B CB  1 
ATOM   2486 C CG1 . VAL B 1 156 ? -3.851  36.039  10.419  1.00 44.74  ? 1034 VAL B CG1 1 
ATOM   2487 C CG2 . VAL B 1 156 ? -4.688  38.071  9.344   1.00 45.45  ? 1034 VAL B CG2 1 
ATOM   2488 N N   . LYS B 1 157 ? -3.088  38.288  13.498  1.00 47.48  ? 1035 LYS B N   1 
ATOM   2489 C CA  . LYS B 1 157 ? -2.424  38.039  14.760  1.00 48.85  ? 1035 LYS B CA  1 
ATOM   2490 C C   . LYS B 1 157 ? -3.321  38.234  16.001  1.00 50.16  ? 1035 LYS B C   1 
ATOM   2491 O O   . LYS B 1 157 ? -3.095  37.630  17.044  1.00 51.34  ? 1035 LYS B O   1 
ATOM   2492 C CB  . LYS B 1 157 ? -1.105  38.788  14.848  1.00 51.99  ? 1035 LYS B CB  1 
ATOM   2493 C CG  . LYS B 1 157 ? -1.079  39.861  15.850  1.00 52.49  ? 1035 LYS B CG  1 
ATOM   2494 C CD  . LYS B 1 157 ? 0.132   40.753  15.636  1.00 55.42  ? 1035 LYS B CD  1 
ATOM   2495 C CE  . LYS B 1 157 ? 0.563   41.412  16.976  1.00 56.59  ? 1035 LYS B CE  1 
ATOM   2496 N NZ  . LYS B 1 157 ? 2.050   41.335  17.202  1.00 56.18  ? 1035 LYS B NZ  1 
ATOM   2497 N N   . GLU B 1 158 ? -4.373  39.027  15.891  1.00 52.73  ? 1036 GLU B N   1 
ATOM   2498 C CA  . GLU B 1 158 ? -5.258  39.165  17.029  1.00 53.43  ? 1036 GLU B CA  1 
ATOM   2499 C C   . GLU B 1 158 ? -6.113  37.909  17.176  1.00 53.39  ? 1036 GLU B C   1 
ATOM   2500 O O   . GLU B 1 158 ? -6.467  37.523  18.277  1.00 53.65  ? 1036 GLU B O   1 
ATOM   2501 C CB  . GLU B 1 158 ? -6.146  40.384  16.861  1.00 57.08  ? 1036 GLU B CB  1 
ATOM   2502 C CG  . GLU B 1 158 ? -5.920  41.439  17.931  1.00 60.34  ? 1036 GLU B CG  1 
ATOM   2503 C CD  . GLU B 1 158 ? -5.538  42.806  17.351  1.00 64.22  ? 1036 GLU B CD  1 
ATOM   2504 O OE1 . GLU B 1 158 ? -6.420  43.431  16.686  1.00 67.34  ? 1036 GLU B OE1 1 
ATOM   2505 O OE2 . GLU B 1 158 ? -4.387  43.265  17.616  1.00 63.21  ? 1036 GLU B OE2 1 
ATOM   2506 N N   . THR B 1 159 ? -6.454  37.287  16.048  1.00 49.79  ? 1037 THR B N   1 
ATOM   2507 C CA  . THR B 1 159 ? -7.279  36.075  16.012  1.00 48.59  ? 1037 THR B CA  1 
ATOM   2508 C C   . THR B 1 159 ? -6.466  34.930  16.584  1.00 48.87  ? 1037 THR B C   1 
ATOM   2509 O O   . THR B 1 159 ? -6.929  34.192  17.433  1.00 48.36  ? 1037 THR B O   1 
ATOM   2510 C CB  . THR B 1 159 ? -7.682  35.762  14.564  1.00 50.67  ? 1037 THR B CB  1 
ATOM   2511 O OG1 . THR B 1 159 ? -8.570  36.767  14.077  1.00 48.66  ? 1037 THR B OG1 1 
ATOM   2512 C CG2 . THR B 1 159 ? -8.330  34.405  14.435  1.00 50.01  ? 1037 THR B CG2 1 
ATOM   2513 N N   . VAL B 1 160 ? -5.239  34.805  16.104  1.00 51.27  ? 1038 VAL B N   1 
ATOM   2514 C CA  . VAL B 1 160 ? -4.317  33.795  16.587  1.00 52.59  ? 1038 VAL B CA  1 
ATOM   2515 C C   . VAL B 1 160 ? -4.278  33.756  18.112  1.00 53.66  ? 1038 VAL B C   1 
ATOM   2516 O O   . VAL B 1 160 ? -4.321  32.690  18.712  1.00 53.93  ? 1038 VAL B O   1 
ATOM   2517 C CB  . VAL B 1 160 ? -2.896  34.050  16.065  1.00 55.60  ? 1038 VAL B CB  1 
ATOM   2518 C CG1 . VAL B 1 160 ? -1.917  33.253  16.865  1.00 55.02  ? 1038 VAL B CG1 1 
ATOM   2519 C CG2 . VAL B 1 160 ? -2.793  33.686  14.606  1.00 55.14  ? 1038 VAL B CG2 1 
ATOM   2520 N N   . ARG B 1 161 ? -4.161  34.922  18.729  1.00 56.53  ? 1039 ARG B N   1 
ATOM   2521 C CA  . ARG B 1 161 ? -4.090  35.033  20.178  1.00 57.27  ? 1039 ARG B CA  1 
ATOM   2522 C C   . ARG B 1 161 ? -5.393  34.666  20.871  1.00 57.17  ? 1039 ARG B C   1 
ATOM   2523 O O   . ARG B 1 161 ? -5.401  33.923  21.855  1.00 57.43  ? 1039 ARG B O   1 
ATOM   2524 C CB  . ARG B 1 161 ? -3.670  36.454  20.556  1.00 61.26  ? 1039 ARG B CB  1 
ATOM   2525 C CG  . ARG B 1 161 ? -2.381  36.872  19.866  1.00 63.21  ? 1039 ARG B CG  1 
ATOM   2526 C CD  . ARG B 1 161 ? -1.685  37.949  20.629  1.00 67.76  ? 1039 ARG B CD  1 
ATOM   2527 N NE  . ARG B 1 161 ? -2.279  39.242  20.319  1.00 71.75  ? 1039 ARG B NE  1 
ATOM   2528 C CZ  . ARG B 1 161 ? -1.587  40.358  20.091  1.00 73.15  ? 1039 ARG B CZ  1 
ATOM   2529 N NH1 . ARG B 1 161 ? -0.245  40.354  20.148  1.00 73.91  ? 1039 ARG B NH1 1 
ATOM   2530 N NH2 . ARG B 1 161 ? -2.247  41.482  19.816  1.00 71.84  ? 1039 ARG B NH2 1 
ATOM   2531 N N   . GLU B 1 162 ? -6.496  35.209  20.379  1.00 57.02  ? 1040 GLU B N   1 
ATOM   2532 C CA  . GLU B 1 162 ? -7.795  34.938  20.973  1.00 57.86  ? 1040 GLU B CA  1 
ATOM   2533 C C   . GLU B 1 162 ? -8.276  33.501  20.687  1.00 57.49  ? 1040 GLU B C   1 
ATOM   2534 O O   . GLU B 1 162 ? -9.144  32.981  21.396  1.00 57.36  ? 1040 GLU B O   1 
ATOM   2535 C CB  . GLU B 1 162 ? -8.829  35.971  20.488  1.00 59.25  ? 1040 GLU B CB  1 
ATOM   2536 C CG  . GLU B 1 162 ? -8.871  37.289  21.288  1.00 64.18  ? 1040 GLU B CG  1 
ATOM   2537 C CD  . GLU B 1 162 ? -9.521  37.157  22.715  1.00 72.57  ? 1040 GLU B CD  1 
ATOM   2538 O OE1 . GLU B 1 162 ? -9.088  37.906  23.648  1.00 74.31  ? 1040 GLU B OE1 1 
ATOM   2539 O OE2 . GLU B 1 162 ? -10.486 36.343  22.894  1.00 76.84  ? 1040 GLU B OE2 1 
ATOM   2540 N N   . ALA B 1 163 ? -7.743  32.874  19.633  1.00 53.46  ? 1041 ALA B N   1 
ATOM   2541 C CA  . ALA B 1 163 ? -8.153  31.522  19.251  1.00 53.31  ? 1041 ALA B CA  1 
ATOM   2542 C C   . ALA B 1 163 ? -7.492  30.581  20.208  1.00 53.47  ? 1041 ALA B C   1 
ATOM   2543 O O   . ALA B 1 163 ? -8.043  29.553  20.578  1.00 53.00  ? 1041 ALA B O   1 
ATOM   2544 C CB  . ALA B 1 163 ? -7.707  31.211  17.841  1.00 53.75  ? 1041 ALA B CB  1 
ATOM   2545 N N   . GLU B 1 164 ? -6.287  30.945  20.604  1.00 50.19  ? 1042 GLU B N   1 
ATOM   2546 C CA  . GLU B 1 164 ? -5.539  30.132  21.526  1.00 51.29  ? 1042 GLU B CA  1 
ATOM   2547 C C   . GLU B 1 164 ? -6.221  30.231  22.872  1.00 51.13  ? 1042 GLU B C   1 
ATOM   2548 O O   . GLU B 1 164 ? -6.478  29.240  23.512  1.00 50.23  ? 1042 GLU B O   1 
ATOM   2549 C CB  . GLU B 1 164 ? -4.098  30.620  21.591  1.00 52.47  ? 1042 GLU B CB  1 
ATOM   2550 C CG  . GLU B 1 164 ? -3.190  29.721  22.366  1.00 56.36  ? 1042 GLU B CG  1 
ATOM   2551 C CD  . GLU B 1 164 ? -3.009  30.185  23.800  1.00 61.18  ? 1042 GLU B CD  1 
ATOM   2552 O OE1 . GLU B 1 164 ? -1.896  30.053  24.352  1.00 62.24  ? 1042 GLU B OE1 1 
ATOM   2553 O OE2 . GLU B 1 164 ? -3.979  30.711  24.380  1.00 63.32  ? 1042 GLU B OE2 1 
ATOM   2554 N N   . ALA B 1 165 ? -6.542  31.444  23.288  1.00 52.67  ? 1043 ALA B N   1 
ATOM   2555 C CA  . ALA B 1 165 ? -7.220  31.644  24.563  1.00 54.29  ? 1043 ALA B CA  1 
ATOM   2556 C C   . ALA B 1 165 ? -8.511  30.810  24.643  1.00 55.40  ? 1043 ALA B C   1 
ATOM   2557 O O   . ALA B 1 165 ? -8.822  30.222  25.675  1.00 55.71  ? 1043 ALA B O   1 
ATOM   2558 C CB  . ALA B 1 165 ? -7.521  33.132  24.762  1.00 54.75  ? 1043 ALA B CB  1 
ATOM   2559 N N   . ALA B 1 166 ? -9.238  30.775  23.529  1.00 57.19  ? 1044 ALA B N   1 
ATOM   2560 C CA  . ALA B 1 166 ? -10.517 30.086  23.390  1.00 58.94  ? 1044 ALA B CA  1 
ATOM   2561 C C   . ALA B 1 166 ? -10.414 28.575  23.329  1.00 60.04  ? 1044 ALA B C   1 
ATOM   2562 O O   . ALA B 1 166 ? -11.435 27.872  23.417  1.00 59.91  ? 1044 ALA B O   1 
ATOM   2563 C CB  . ALA B 1 166 ? -11.237 30.581  22.133  1.00 59.73  ? 1044 ALA B CB  1 
ATOM   2564 N N   . SER B 1 167 ? -9.193  28.081  23.126  1.00 60.15  ? 1045 SER B N   1 
ATOM   2565 C CA  . SER B 1 167 ? -8.949  26.642  23.000  1.00 61.39  ? 1045 SER B CA  1 
ATOM   2566 C C   . SER B 1 167 ? -8.887  25.897  24.341  1.00 62.39  ? 1045 SER B C   1 
ATOM   2567 O O   . SER B 1 167 ? -9.318  24.735  24.434  1.00 62.10  ? 1045 SER B O   1 
ATOM   2568 C CB  . SER B 1 167 ? -7.670  26.396  22.199  1.00 65.00  ? 1045 SER B CB  1 
ATOM   2569 O OG  . SER B 1 167 ? -7.818  26.750  20.828  1.00 65.40  ? 1045 SER B OG  1 
ATOM   2570 N N   . THR B 1 177 ? -10.726 21.361  17.425  1.00 56.42  ? 1055 THR B N   1 
ATOM   2571 C CA  . THR B 1 177 ? -9.608  21.177  18.348  1.00 56.31  ? 1055 THR B CA  1 
ATOM   2572 C C   . THR B 1 177 ? -8.276  21.454  17.626  1.00 55.43  ? 1055 THR B C   1 
ATOM   2573 O O   . THR B 1 177 ? -7.690  20.566  17.021  1.00 55.50  ? 1055 THR B O   1 
ATOM   2574 C CB  . THR B 1 177 ? -9.636  19.729  19.029  1.00 63.71  ? 1055 THR B CB  1 
ATOM   2575 O OG1 . THR B 1 177 ? -10.962 19.417  19.492  1.00 64.69  ? 1055 THR B OG1 1 
ATOM   2576 C CG2 . THR B 1 177 ? -8.626  19.606  20.213  1.00 63.59  ? 1055 THR B CG2 1 
ATOM   2577 N N   . LEU B 1 178 ? -7.766  22.670  17.715  1.00 48.99  ? 1056 LEU B N   1 
ATOM   2578 C CA  . LEU B 1 178 ? -6.470  22.954  17.097  1.00 47.82  ? 1056 LEU B CA  1 
ATOM   2579 C C   . LEU B 1 178 ? -5.379  22.676  18.146  1.00 47.47  ? 1056 LEU B C   1 
ATOM   2580 O O   . LEU B 1 178 ? -5.604  22.852  19.346  1.00 48.06  ? 1056 LEU B O   1 
ATOM   2581 C CB  . LEU B 1 178 ? -6.396  24.421  16.673  1.00 47.34  ? 1056 LEU B CB  1 
ATOM   2582 C CG  . LEU B 1 178 ? -7.009  24.905  15.369  1.00 45.88  ? 1056 LEU B CG  1 
ATOM   2583 C CD1 . LEU B 1 178 ? -6.938  26.433  15.358  1.00 44.79  ? 1056 LEU B CD1 1 
ATOM   2584 C CD2 . LEU B 1 178 ? -6.235  24.325  14.190  1.00 46.51  ? 1056 LEU B CD2 1 
ATOM   2585 N N   . ARG B 1 179 ? -4.207  22.255  17.707  1.00 40.11  ? 1057 ARG B N   1 
ATOM   2586 C CA  . ARG B 1 179 ? -3.128  21.969  18.632  1.00 40.23  ? 1057 ARG B CA  1 
ATOM   2587 C C   . ARG B 1 179 ? -2.304  23.224  18.873  1.00 40.30  ? 1057 ARG B C   1 
ATOM   2588 O O   . ARG B 1 179 ? -1.752  23.849  17.945  1.00 40.12  ? 1057 ARG B O   1 
ATOM   2589 C CB  . ARG B 1 179 ? -2.262  20.781  18.140  1.00 41.09  ? 1057 ARG B CB  1 
ATOM   2590 C CG  . ARG B 1 179 ? -1.016  20.414  19.014  1.00 41.63  ? 1057 ARG B CG  1 
ATOM   2591 C CD  . ARG B 1 179 ? -0.208  19.307  18.298  1.00 42.43  ? 1057 ARG B CD  1 
ATOM   2592 N NE  . ARG B 1 179 ? 1.232   19.200  18.601  1.00 39.35  ? 1057 ARG B NE  1 
ATOM   2593 C CZ  . ARG B 1 179 ? 2.154   20.082  18.241  1.00 38.36  ? 1057 ARG B CZ  1 
ATOM   2594 N NH1 . ARG B 1 179 ? 1.790   21.211  17.635  1.00 37.78  ? 1057 ARG B NH1 1 
ATOM   2595 N NH2 . ARG B 1 179 ? 3.436   19.847  18.520  1.00 39.43  ? 1057 ARG B NH2 1 
ATOM   2596 N N   . TRP B 1 180 ? -2.194  23.569  20.150  1.00 40.88  ? 1058 TRP B N   1 
ATOM   2597 C CA  . TRP B 1 180 ? -1.479  24.773  20.577  1.00 41.41  ? 1058 TRP B CA  1 
ATOM   2598 C C   . TRP B 1 180 ? -0.328  24.374  21.440  1.00 41.95  ? 1058 TRP B C   1 
ATOM   2599 O O   . TRP B 1 180 ? -0.526  24.077  22.607  1.00 42.71  ? 1058 TRP B O   1 
ATOM   2600 C CB  . TRP B 1 180 ? -2.410  25.696  21.377  1.00 38.59  ? 1058 TRP B CB  1 
ATOM   2601 C CG  . TRP B 1 180 ? -3.360  26.448  20.489  1.00 39.67  ? 1058 TRP B CG  1 
ATOM   2602 C CD1 . TRP B 1 180 ? -4.685  26.181  20.267  1.00 39.54  ? 1058 TRP B CD1 1 
ATOM   2603 C CD2 . TRP B 1 180 ? -3.011  27.498  19.594  1.00 40.69  ? 1058 TRP B CD2 1 
ATOM   2604 N NE1 . TRP B 1 180 ? -5.193  27.036  19.328  1.00 39.44  ? 1058 TRP B NE1 1 
ATOM   2605 C CE2 . TRP B 1 180 ? -4.192  27.872  18.911  1.00 38.93  ? 1058 TRP B CE2 1 
ATOM   2606 C CE3 . TRP B 1 180 ? -1.823  28.215  19.355  1.00 41.32  ? 1058 TRP B CE3 1 
ATOM   2607 C CZ2 . TRP B 1 180 ? -4.232  28.951  18.031  1.00 38.17  ? 1058 TRP B CZ2 1 
ATOM   2608 C CZ3 . TRP B 1 180 ? -1.853  29.243  18.438  1.00 41.65  ? 1058 TRP B CZ3 1 
ATOM   2609 C CH2 . TRP B 1 180 ? -3.061  29.629  17.809  1.00 40.44  ? 1058 TRP B CH2 1 
ATOM   2610 N N   . VAL B 1 181 ? 0.875   24.377  20.881  1.00 42.64  ? 1059 VAL B N   1 
ATOM   2611 C CA  . VAL B 1 181 ? 2.030   23.988  21.666  1.00 43.56  ? 1059 VAL B CA  1 
ATOM   2612 C C   . VAL B 1 181 ? 3.177   24.926  21.366  1.00 45.46  ? 1059 VAL B C   1 
ATOM   2613 O O   . VAL B 1 181 ? 3.622   25.023  20.223  1.00 45.73  ? 1059 VAL B O   1 
ATOM   2614 C CB  . VAL B 1 181 ? 2.376   22.509  21.434  1.00 42.04  ? 1059 VAL B CB  1 
ATOM   2615 C CG1 . VAL B 1 181 ? 3.780   22.227  21.817  1.00 40.89  ? 1059 VAL B CG1 1 
ATOM   2616 C CG2 . VAL B 1 181 ? 1.393   21.618  22.183  1.00 40.78  ? 1059 VAL B CG2 1 
ATOM   2617 N N   . ARG B 1 182 ? 3.638   25.657  22.374  1.00 56.18  ? 1060 ARG B N   1 
ATOM   2618 C CA  . ARG B 1 182 ? 4.707   26.612  22.106  1.00 58.22  ? 1060 ARG B CA  1 
ATOM   2619 C C   . ARG B 1 182 ? 5.932   25.980  21.450  1.00 60.09  ? 1060 ARG B C   1 
ATOM   2620 O O   . ARG B 1 182 ? 6.327   24.882  21.794  1.00 60.97  ? 1060 ARG B O   1 
ATOM   2621 C CB  . ARG B 1 182 ? 5.060   27.468  23.332  1.00 62.71  ? 1060 ARG B CB  1 
ATOM   2622 C CG  . ARG B 1 182 ? 3.882   28.285  23.903  1.00 62.01  ? 1060 ARG B CG  1 
ATOM   2623 C CD  . ARG B 1 182 ? 3.675   29.637  23.177  1.00 61.52  ? 1060 ARG B CD  1 
ATOM   2624 N NE  . ARG B 1 182 ? 4.439   30.741  23.775  1.00 59.88  ? 1060 ARG B NE  1 
ATOM   2625 C CZ  . ARG B 1 182 ? 5.685   31.083  23.424  1.00 57.98  ? 1060 ARG B CZ  1 
ATOM   2626 N NH1 . ARG B 1 182 ? 6.339   30.410  22.474  1.00 57.95  ? 1060 ARG B NH1 1 
ATOM   2627 N NH2 . ARG B 1 182 ? 6.294   32.096  24.033  1.00 57.59  ? 1060 ARG B NH2 1 
ATOM   2628 N N   . LYS B 1 183 ? 6.485   26.664  20.455  1.00 66.37  ? 1061 LYS B N   1 
ATOM   2629 C CA  . LYS B 1 183 ? 7.693   26.215  19.769  1.00 67.51  ? 1061 LYS B CA  1 
ATOM   2630 C C   . LYS B 1 183 ? 8.883   26.650  20.615  1.00 68.57  ? 1061 LYS B C   1 
ATOM   2631 O O   . LYS B 1 183 ? 9.070   27.850  20.892  1.00 68.70  ? 1061 LYS B O   1 
ATOM   2632 C CB  . LYS B 1 183 ? 7.794   26.888  18.397  1.00 71.63  ? 1061 LYS B CB  1 
ATOM   2633 C CG  . LYS B 1 183 ? 8.829   26.273  17.480  1.00 72.14  ? 1061 LYS B CG  1 
ATOM   2634 C CD  . LYS B 1 183 ? 8.414   24.861  17.037  1.00 73.05  ? 1061 LYS B CD  1 
ATOM   2635 C CE  . LYS B 1 183 ? 9.008   24.473  15.672  1.00 71.15  ? 1061 LYS B CE  1 
ATOM   2636 N NZ  . LYS B 1 183 ? 7.974   24.254  14.616  1.00 69.30  ? 1061 LYS B NZ  1 
ATOM   2637 N N   . THR B 1 184 ? 9.695   25.684  21.026  1.00 71.41  ? 1062 THR B N   1 
ATOM   2638 C CA  . THR B 1 184 ? 10.865  26.015  21.834  1.00 73.20  ? 1062 THR B CA  1 
ATOM   2639 C C   . THR B 1 184 ? 12.197  25.527  21.247  1.00 73.84  ? 1062 THR B C   1 
ATOM   2640 O O   . THR B 1 184 ? 12.240  24.501  20.544  1.00 73.60  ? 1062 THR B O   1 
ATOM   2641 C CB  . THR B 1 184 ? 10.671  25.623  23.336  1.00 83.18  ? 1062 THR B CB  1 
ATOM   2642 O OG1 . THR B 1 184 ? 9.569   26.369  23.897  1.00 84.16  ? 1062 THR B OG1 1 
ATOM   2643 C CG2 . THR B 1 184 ? 11.980  25.861  24.160  1.00 82.07  ? 1062 THR B CG2 1 
ATOM   2644 N N   . PRO B 1 185 ? 13.297  26.285  21.512  1.00 75.52  ? 1063 PRO B N   1 
ATOM   2645 C CA  . PRO B 1 185 ? 14.702  26.043  21.150  1.00 75.94  ? 1063 PRO B CA  1 
ATOM   2646 C C   . PRO B 1 185 ? 15.568  25.876  22.411  1.00 76.21  ? 1063 PRO B C   1 
ATOM   2647 O O   . PRO B 1 185 ? 15.769  24.757  22.895  1.00 76.19  ? 1063 PRO B O   1 
ATOM   2648 C CB  . PRO B 1 185 ? 15.090  27.325  20.392  1.00 77.80  ? 1063 PRO B CB  1 
ATOM   2649 C CG  . PRO B 1 185 ? 14.206  28.407  20.988  1.00 77.46  ? 1063 PRO B CG  1 
ATOM   2650 C CD  . PRO B 1 185 ? 13.049  27.729  21.717  1.00 77.17  ? 1063 PRO B CD  1 
ATOM   2651 N N   . GLU C 1 6   ? 12.538  35.964  59.336  1.00 101.81 ? 884  GLU C N   1 
ATOM   2652 C CA  . GLU C 1 6   ? 13.966  35.659  59.313  1.00 101.09 ? 884  GLU C CA  1 
ATOM   2653 C C   . GLU C 1 6   ? 14.338  34.390  58.516  1.00 100.64 ? 884  GLU C C   1 
ATOM   2654 O O   . GLU C 1 6   ? 14.434  34.415  57.274  1.00 100.72 ? 884  GLU C O   1 
ATOM   2655 C CB  . GLU C 1 6   ? 14.527  35.597  60.739  1.00 102.87 ? 884  GLU C CB  1 
ATOM   2656 C CG  . GLU C 1 6   ? 16.012  35.973  60.857  1.00 103.06 ? 884  GLU C CG  1 
ATOM   2657 C CD  . GLU C 1 6   ? 16.296  37.481  60.719  1.00 103.90 ? 884  GLU C CD  1 
ATOM   2658 O OE1 . GLU C 1 6   ? 15.526  38.187  60.018  1.00 103.61 ? 884  GLU C OE1 1 
ATOM   2659 O OE2 . GLU C 1 6   ? 17.323  37.946  61.285  1.00 103.10 ? 884  GLU C OE2 1 
ATOM   2660 N N   . PHE C 1 7   ? 14.580  33.292  59.230  1.00 95.23  ? 885  PHE C N   1 
ATOM   2661 C CA  . PHE C 1 7   ? 14.963  32.043  58.580  1.00 94.33  ? 885  PHE C CA  1 
ATOM   2662 C C   . PHE C 1 7   ? 13.896  30.941  58.608  1.00 94.47  ? 885  PHE C C   1 
ATOM   2663 O O   . PHE C 1 7   ? 13.582  30.376  59.663  1.00 94.56  ? 885  PHE C O   1 
ATOM   2664 C CB  . PHE C 1 7   ? 16.290  31.532  59.136  1.00 94.54  ? 885  PHE C CB  1 
ATOM   2665 C CG  . PHE C 1 7   ? 17.262  31.126  58.074  1.00 92.53  ? 885  PHE C CG  1 
ATOM   2666 C CD1 . PHE C 1 7   ? 18.136  32.051  57.529  1.00 90.70  ? 885  PHE C CD1 1 
ATOM   2667 C CD2 . PHE C 1 7   ? 17.259  29.841  57.572  1.00 90.81  ? 885  PHE C CD2 1 
ATOM   2668 C CE1 . PHE C 1 7   ? 19.017  31.694  56.535  1.00 88.80  ? 885  PHE C CE1 1 
ATOM   2669 C CE2 . PHE C 1 7   ? 18.142  29.479  56.582  1.00 89.20  ? 885  PHE C CE2 1 
ATOM   2670 C CZ  . PHE C 1 7   ? 19.034  30.409  56.075  1.00 88.16  ? 885  PHE C CZ  1 
ATOM   2671 N N   . PRO C 1 8   ? 13.336  30.606  57.435  1.00 92.96  ? 886  PRO C N   1 
ATOM   2672 C CA  . PRO C 1 8   ? 12.312  29.560  57.404  1.00 93.06  ? 886  PRO C CA  1 
ATOM   2673 C C   . PRO C 1 8   ? 12.849  28.225  57.881  1.00 93.15  ? 886  PRO C C   1 
ATOM   2674 O O   . PRO C 1 8   ? 13.991  28.126  58.329  1.00 93.12  ? 886  PRO C O   1 
ATOM   2675 C CB  . PRO C 1 8   ? 11.947  29.481  55.924  1.00 94.95  ? 886  PRO C CB  1 
ATOM   2676 C CG  . PRO C 1 8   ? 12.092  30.881  55.456  1.00 94.97  ? 886  PRO C CG  1 
ATOM   2677 C CD  . PRO C 1 8   ? 13.265  31.467  56.242  1.00 94.89  ? 886  PRO C CD  1 
ATOM   2678 N N   . GLU C 1 9   ? 12.006  27.202  57.775  1.00 91.08  ? 887  GLU C N   1 
ATOM   2679 C CA  . GLU C 1 9   ? 12.358  25.856  58.209  1.00 90.87  ? 887  GLU C CA  1 
ATOM   2680 C C   . GLU C 1 9   ? 11.316  24.822  57.761  1.00 90.55  ? 887  GLU C C   1 
ATOM   2681 O O   . GLU C 1 9   ? 10.686  24.962  56.703  1.00 89.95  ? 887  GLU C O   1 
ATOM   2682 C CB  . GLU C 1 9   ? 12.552  25.827  59.730  1.00 92.20  ? 887  GLU C CB  1 
ATOM   2683 C CG  . GLU C 1 9   ? 11.259  25.855  60.571  1.00 92.38  ? 887  GLU C CG  1 
ATOM   2684 C CD  . GLU C 1 9   ? 10.235  26.941  60.175  1.00 92.68  ? 887  GLU C CD  1 
ATOM   2685 O OE1 . GLU C 1 9   ? 9.085   26.882  60.684  1.00 92.07  ? 887  GLU C OE1 1 
ATOM   2686 O OE2 . GLU C 1 9   ? 10.567  27.852  59.381  1.00 92.42  ? 887  GLU C OE2 1 
ATOM   2687 N N   . VAL C 1 15  ? 13.009  21.557  48.178  1.00 76.00  ? 893  VAL C N   1 
ATOM   2688 C CA  . VAL C 1 15  ? 13.891  21.299  47.034  1.00 75.87  ? 893  VAL C CA  1 
ATOM   2689 C C   . VAL C 1 15  ? 15.317  21.833  47.263  1.00 75.83  ? 893  VAL C C   1 
ATOM   2690 O O   . VAL C 1 15  ? 15.922  22.475  46.374  1.00 75.81  ? 893  VAL C O   1 
ATOM   2691 C CB  . VAL C 1 15  ? 13.314  21.848  45.698  1.00 79.06  ? 893  VAL C CB  1 
ATOM   2692 C CG1 . VAL C 1 15  ? 13.764  20.994  44.525  1.00 79.10  ? 893  VAL C CG1 1 
ATOM   2693 C CG2 . VAL C 1 15  ? 11.806  21.962  45.752  1.00 77.98  ? 893  VAL C CG2 1 
ATOM   2694 N N   . ILE C 1 16  ? 15.850  21.553  48.451  1.00 73.30  ? 894  ILE C N   1 
ATOM   2695 C CA  . ILE C 1 16  ? 17.193  21.992  48.823  1.00 72.23  ? 894  ILE C CA  1 
ATOM   2696 C C   . ILE C 1 16  ? 18.024  20.791  49.244  1.00 71.93  ? 894  ILE C C   1 
ATOM   2697 O O   . ILE C 1 16  ? 17.888  19.680  48.714  1.00 71.82  ? 894  ILE C O   1 
ATOM   2698 C CB  . ILE C 1 16  ? 17.156  22.968  50.009  1.00 73.18  ? 894  ILE C CB  1 
ATOM   2699 C CG1 . ILE C 1 16  ? 16.578  22.248  51.247  1.00 72.34  ? 894  ILE C CG1 1 
ATOM   2700 C CG2 . ILE C 1 16  ? 16.512  24.292  49.614  1.00 72.70  ? 894  ILE C CG2 1 
ATOM   2701 C CD1 . ILE C 1 16  ? 15.866  23.122  52.223  1.00 70.84  ? 894  ILE C CD1 1 
ATOM   2702 N N   . ASN C 1 17  ? 18.883  21.041  50.228  1.00 71.62  ? 895  ASN C N   1 
ATOM   2703 C CA  . ASN C 1 17  ? 19.708  20.008  50.813  1.00 70.77  ? 895  ASN C CA  1 
ATOM   2704 C C   . ASN C 1 17  ? 19.611  20.175  52.312  1.00 70.34  ? 895  ASN C C   1 
ATOM   2705 O O   . ASN C 1 17  ? 20.364  20.973  52.865  1.00 70.97  ? 895  ASN C O   1 
ATOM   2706 C CB  . ASN C 1 17  ? 21.157  20.169  50.396  1.00 64.92  ? 895  ASN C CB  1 
ATOM   2707 C CG  . ASN C 1 17  ? 22.019  19.071  50.953  1.00 65.20  ? 895  ASN C CG  1 
ATOM   2708 O OD1 . ASN C 1 17  ? 22.341  18.115  50.244  1.00 66.74  ? 895  ASN C OD1 1 
ATOM   2709 N ND2 . ASN C 1 17  ? 22.248  19.105  52.267  1.00 64.61  ? 895  ASN C ND2 1 
ATOM   2710 N N   . GLN C 1 18  ? 18.681  19.450  52.950  1.00 69.26  ? 896  GLN C N   1 
ATOM   2711 C CA  . GLN C 1 18  ? 18.454  19.524  54.404  1.00 68.12  ? 896  GLN C CA  1 
ATOM   2712 C C   . GLN C 1 18  ? 19.665  19.798  55.328  1.00 66.69  ? 896  GLN C C   1 
ATOM   2713 O O   . GLN C 1 18  ? 19.600  20.643  56.221  1.00 66.39  ? 896  GLN C O   1 
ATOM   2714 C CB  . GLN C 1 18  ? 17.720  18.284  54.929  1.00 72.88  ? 896  GLN C CB  1 
ATOM   2715 C CG  . GLN C 1 18  ? 17.973  18.086  56.442  1.00 74.29  ? 896  GLN C CG  1 
ATOM   2716 C CD  . GLN C 1 18  ? 17.167  16.954  57.059  1.00 76.22  ? 896  GLN C CD  1 
ATOM   2717 O OE1 . GLN C 1 18  ? 16.528  17.137  58.113  1.00 75.49  ? 896  GLN C OE1 1 
ATOM   2718 N NE2 . GLN C 1 18  ? 17.240  15.758  56.447  1.00 76.39  ? 896  GLN C NE2 1 
ATOM   2719 N N   . PRO C 1 19  ? 20.750  19.022  55.172  1.00 60.55  ? 897  PRO C N   1 
ATOM   2720 C CA  . PRO C 1 19  ? 21.926  19.204  56.030  1.00 59.68  ? 897  PRO C CA  1 
ATOM   2721 C C   . PRO C 1 19  ? 22.731  20.476  55.753  1.00 58.82  ? 897  PRO C C   1 
ATOM   2722 O O   . PRO C 1 19  ? 23.392  20.996  56.667  1.00 58.81  ? 897  PRO C O   1 
ATOM   2723 C CB  . PRO C 1 19  ? 22.755  17.950  55.767  1.00 60.41  ? 897  PRO C CB  1 
ATOM   2724 C CG  . PRO C 1 19  ? 21.775  16.951  55.329  1.00 60.87  ? 897  PRO C CG  1 
ATOM   2725 C CD  . PRO C 1 19  ? 20.726  17.686  54.555  1.00 61.38  ? 897  PRO C CD  1 
ATOM   2726 N N   . MET C 1 20  ? 22.670  20.982  54.521  1.00 57.34  ? 898  MET C N   1 
ATOM   2727 C CA  . MET C 1 20  ? 23.348  22.235  54.191  1.00 56.54  ? 898  MET C CA  1 
ATOM   2728 C C   . MET C 1 20  ? 22.512  23.373  54.738  1.00 55.65  ? 898  MET C C   1 
ATOM   2729 O O   . MET C 1 20  ? 23.030  24.334  55.283  1.00 55.59  ? 898  MET C O   1 
ATOM   2730 C CB  . MET C 1 20  ? 23.480  22.437  52.689  1.00 59.35  ? 898  MET C CB  1 
ATOM   2731 C CG  . MET C 1 20  ? 24.149  21.286  51.934  1.00 60.44  ? 898  MET C CG  1 
ATOM   2732 S SD  . MET C 1 20  ? 25.222  21.935  50.581  1.00 62.06  ? 898  MET C SD  1 
ATOM   2733 C CE  . MET C 1 20  ? 25.381  23.690  51.222  1.00 63.21  ? 898  MET C CE  1 
ATOM   2734 N N   . MET C 1 21  ? 21.206  23.252  54.599  1.00 54.13  ? 899  MET C N   1 
ATOM   2735 C CA  . MET C 1 21  ? 20.326  24.284  55.074  1.00 53.35  ? 899  MET C CA  1 
ATOM   2736 C C   . MET C 1 21  ? 20.350  24.290  56.557  1.00 52.56  ? 899  MET C C   1 
ATOM   2737 O O   . MET C 1 21  ? 20.212  25.332  57.174  1.00 52.68  ? 899  MET C O   1 
ATOM   2738 C CB  . MET C 1 21  ? 18.920  24.044  54.583  1.00 55.77  ? 899  MET C CB  1 
ATOM   2739 C CG  . MET C 1 21  ? 18.647  24.717  53.275  1.00 57.28  ? 899  MET C CG  1 
ATOM   2740 S SD  . MET C 1 21  ? 18.416  26.478  53.529  1.00 62.43  ? 899  MET C SD  1 
ATOM   2741 C CE  . MET C 1 21  ? 18.005  27.055  51.815  1.00 61.93  ? 899  MET C CE  1 
ATOM   2742 N N   . MET C 1 22  ? 20.542  23.121  57.134  1.00 54.00  ? 900  MET C N   1 
ATOM   2743 C CA  . MET C 1 22  ? 20.576  22.994  58.571  1.00 53.55  ? 900  MET C CA  1 
ATOM   2744 C C   . MET C 1 22  ? 21.771  23.693  59.110  1.00 52.56  ? 900  MET C C   1 
ATOM   2745 O O   . MET C 1 22  ? 21.755  24.185  60.228  1.00 52.66  ? 900  MET C O   1 
ATOM   2746 C CB  . MET C 1 22  ? 20.677  21.528  58.981  1.00 57.94  ? 900  MET C CB  1 
ATOM   2747 C CG  . MET C 1 22  ? 20.130  21.283  60.368  1.00 60.65  ? 900  MET C CG  1 
ATOM   2748 S SD  . MET C 1 22  ? 18.408  21.967  60.504  1.00 68.17  ? 900  MET C SD  1 
ATOM   2749 C CE  . MET C 1 22  ? 17.472  20.721  59.348  1.00 66.52  ? 900  MET C CE  1 
ATOM   2750 N N   . ALA C 1 23  ? 22.847  23.638  58.341  1.00 52.18  ? 901  ALA C N   1 
ATOM   2751 C CA  . ALA C 1 23  ? 24.106  24.218  58.760  1.00 51.29  ? 901  ALA C CA  1 
ATOM   2752 C C   . ALA C 1 23  ? 24.064  25.700  58.514  1.00 51.00  ? 901  ALA C C   1 
ATOM   2753 O O   . ALA C 1 23  ? 24.649  26.480  59.254  1.00 51.06  ? 901  ALA C O   1 
ATOM   2754 C CB  . ALA C 1 23  ? 25.240  23.594  57.986  1.00 52.17  ? 901  ALA C CB  1 
ATOM   2755 N N   . ALA C 1 24  ? 23.383  26.078  57.439  1.00 52.60  ? 902  ALA C N   1 
ATOM   2756 C CA  . ALA C 1 24  ? 23.249  27.480  57.082  1.00 52.09  ? 902  ALA C CA  1 
ATOM   2757 C C   . ALA C 1 24  ? 22.552  28.113  58.267  1.00 52.11  ? 902  ALA C C   1 
ATOM   2758 O O   . ALA C 1 24  ? 23.116  29.009  58.906  1.00 51.97  ? 902  ALA C O   1 
ATOM   2759 C CB  . ALA C 1 24  ? 22.426  27.649  55.787  1.00 52.03  ? 902  ALA C CB  1 
ATOM   2760 N N   . ARG C 1 25  ? 21.380  27.564  58.617  1.00 55.51  ? 903  ARG C N   1 
ATOM   2761 C CA  . ARG C 1 25  ? 20.577  28.042  59.744  1.00 55.85  ? 903  ARG C CA  1 
ATOM   2762 C C   . ARG C 1 25  ? 21.325  28.132  61.073  1.00 55.81  ? 903  ARG C C   1 
ATOM   2763 O O   . ARG C 1 25  ? 21.234  29.133  61.766  1.00 55.51  ? 903  ARG C O   1 
ATOM   2764 C CB  . ARG C 1 25  ? 19.315  27.209  59.926  1.00 64.96  ? 903  ARG C CB  1 
ATOM   2765 C CG  . ARG C 1 25  ? 18.404  27.680  61.084  1.00 65.73  ? 903  ARG C CG  1 
ATOM   2766 C CD  . ARG C 1 25  ? 16.926  27.308  60.835  1.00 65.74  ? 903  ARG C CD  1 
ATOM   2767 N NE  . ARG C 1 25  ? 16.784  25.944  60.306  1.00 66.04  ? 903  ARG C NE  1 
ATOM   2768 C CZ  . ARG C 1 25  ? 16.301  25.636  59.099  1.00 66.98  ? 903  ARG C CZ  1 
ATOM   2769 N NH1 . ARG C 1 25  ? 15.870  26.593  58.267  1.00 66.93  ? 903  ARG C NH1 1 
ATOM   2770 N NH2 . ARG C 1 25  ? 16.249  24.361  58.716  1.00 67.06  ? 903  ARG C NH2 1 
ATOM   2771 N N   . GLN C 1 26  ? 22.053  27.095  61.442  1.00 54.87  ? 904  GLN C N   1 
ATOM   2772 C CA  . GLN C 1 26  ? 22.783  27.161  62.684  1.00 55.63  ? 904  GLN C CA  1 
ATOM   2773 C C   . GLN C 1 26  ? 23.721  28.384  62.759  1.00 55.51  ? 904  GLN C C   1 
ATOM   2774 O O   . GLN C 1 26  ? 23.906  28.977  63.841  1.00 56.06  ? 904  GLN C O   1 
ATOM   2775 C CB  . GLN C 1 26  ? 23.575  25.882  62.919  1.00 59.69  ? 904  GLN C CB  1 
ATOM   2776 C CG  . GLN C 1 26  ? 22.761  24.722  63.422  1.00 61.44  ? 904  GLN C CG  1 
ATOM   2777 C CD  . GLN C 1 26  ? 23.625  23.478  63.666  1.00 64.32  ? 904  GLN C CD  1 
ATOM   2778 O OE1 . GLN C 1 26  ? 24.448  23.445  64.602  1.00 64.34  ? 904  GLN C OE1 1 
ATOM   2779 N NE2 . GLN C 1 26  ? 23.445  22.450  62.822  1.00 64.31  ? 904  GLN C NE2 1 
ATOM   2780 N N   . LEU C 1 27  ? 24.339  28.752  61.637  1.00 51.37  ? 905  LEU C N   1 
ATOM   2781 C CA  . LEU C 1 27  ? 25.275  29.886  61.657  1.00 50.58  ? 905  LEU C CA  1 
ATOM   2782 C C   . LEU C 1 27  ? 24.447  31.135  61.819  1.00 50.67  ? 905  LEU C C   1 
ATOM   2783 O O   . LEU C 1 27  ? 24.658  31.933  62.722  1.00 50.84  ? 905  LEU C O   1 
ATOM   2784 C CB  . LEU C 1 27  ? 26.092  29.971  60.364  1.00 49.94  ? 905  LEU C CB  1 
ATOM   2785 C CG  . LEU C 1 27  ? 27.046  31.155  60.295  1.00 47.29  ? 905  LEU C CG  1 
ATOM   2786 C CD1 . LEU C 1 27  ? 28.221  30.973  61.217  1.00 45.10  ? 905  LEU C CD1 1 
ATOM   2787 C CD2 . LEU C 1 27  ? 27.500  31.374  58.890  1.00 44.93  ? 905  LEU C CD2 1 
ATOM   2788 N N   . HIS C 1 28  ? 23.436  31.237  60.972  1.00 52.76  ? 906  HIS C N   1 
ATOM   2789 C CA  . HIS C 1 28  ? 22.506  32.332  61.022  1.00 52.56  ? 906  HIS C CA  1 
ATOM   2790 C C   . HIS C 1 28  ? 22.022  32.738  62.420  1.00 52.51  ? 906  HIS C C   1 
ATOM   2791 O O   . HIS C 1 28  ? 22.065  33.905  62.763  1.00 51.97  ? 906  HIS C O   1 
ATOM   2792 C CB  . HIS C 1 28  ? 21.325  32.105  60.076  1.00 54.93  ? 906  HIS C CB  1 
ATOM   2793 C CG  . HIS C 1 28  ? 20.645  33.384  59.716  1.00 54.24  ? 906  HIS C CG  1 
ATOM   2794 N ND1 . HIS C 1 28  ? 19.419  33.743  60.243  1.00 53.25  ? 906  HIS C ND1 1 
ATOM   2795 C CD2 . HIS C 1 28  ? 21.125  34.487  59.081  1.00 53.08  ? 906  HIS C CD2 1 
ATOM   2796 C CE1 . HIS C 1 28  ? 19.145  34.984  59.876  1.00 54.70  ? 906  HIS C CE1 1 
ATOM   2797 N NE2 . HIS C 1 28  ? 20.170  35.464  59.187  1.00 52.50  ? 906  HIS C NE2 1 
ATOM   2798 N N   . ASP C 1 29  ? 21.531  31.781  63.200  1.00 54.08  ? 907  ASP C N   1 
ATOM   2799 C CA  . ASP C 1 29  ? 21.067  32.035  64.564  1.00 55.04  ? 907  ASP C CA  1 
ATOM   2800 C C   . ASP C 1 29  ? 22.154  32.556  65.508  1.00 54.61  ? 907  ASP C C   1 
ATOM   2801 O O   . ASP C 1 29  ? 21.882  33.382  66.391  1.00 54.30  ? 907  ASP C O   1 
ATOM   2802 C CB  . ASP C 1 29  ? 20.477  30.766  65.176  1.00 59.46  ? 907  ASP C CB  1 
ATOM   2803 C CG  . ASP C 1 29  ? 19.303  30.235  64.385  1.00 63.01  ? 907  ASP C CG  1 
ATOM   2804 O OD1 . ASP C 1 29  ? 18.736  31.040  63.603  1.00 64.16  ? 907  ASP C OD1 1 
ATOM   2805 O OD2 . ASP C 1 29  ? 18.965  29.020  64.526  1.00 66.50  ? 907  ASP C OD2 1 
ATOM   2806 N N   . GLU C 1 30  ? 23.375  32.045  65.380  1.00 54.61  ? 908  GLU C N   1 
ATOM   2807 C CA  . GLU C 1 30  ? 24.404  32.521  66.283  1.00 54.64  ? 908  GLU C CA  1 
ATOM   2808 C C   . GLU C 1 30  ? 24.804  33.969  66.029  1.00 54.15  ? 908  GLU C C   1 
ATOM   2809 O O   . GLU C 1 30  ? 25.200  34.674  66.979  1.00 55.05  ? 908  GLU C O   1 
ATOM   2810 C CB  . GLU C 1 30  ? 25.628  31.621  66.336  1.00 57.14  ? 908  GLU C CB  1 
ATOM   2811 C CG  . GLU C 1 30  ? 26.621  32.017  67.461  1.00 60.62  ? 908  GLU C CG  1 
ATOM   2812 C CD  . GLU C 1 30  ? 26.227  31.485  68.875  1.00 65.13  ? 908  GLU C CD  1 
ATOM   2813 O OE1 . GLU C 1 30  ? 25.368  30.567  68.975  1.00 67.90  ? 908  GLU C OE1 1 
ATOM   2814 O OE2 . GLU C 1 30  ? 26.792  31.979  69.885  1.00 63.77  ? 908  GLU C OE2 1 
ATOM   2815 N N   . ALA C 1 31  ? 24.703  34.402  64.765  1.00 48.54  ? 909  ALA C N   1 
ATOM   2816 C CA  . ALA C 1 31  ? 25.038  35.752  64.349  1.00 47.63  ? 909  ALA C CA  1 
ATOM   2817 C C   . ALA C 1 31  ? 23.855  36.723  64.433  1.00 47.99  ? 909  ALA C C   1 
ATOM   2818 O O   . ALA C 1 31  ? 24.054  37.935  64.532  1.00 48.72  ? 909  ALA C O   1 
ATOM   2819 C CB  . ALA C 1 31  ? 25.603  35.740  62.948  1.00 48.09  ? 909  ALA C CB  1 
ATOM   2820 N N   . ARG C 1 32  ? 22.627  36.219  64.351  1.00 48.64  ? 910  ARG C N   1 
ATOM   2821 C CA  . ARG C 1 32  ? 21.470  37.093  64.448  1.00 49.08  ? 910  ARG C CA  1 
ATOM   2822 C C   . ARG C 1 32  ? 21.373  37.518  65.907  1.00 48.86  ? 910  ARG C C   1 
ATOM   2823 O O   . ARG C 1 32  ? 20.641  38.420  66.248  1.00 49.13  ? 910  ARG C O   1 
ATOM   2824 C CB  . ARG C 1 32  ? 20.191  36.378  64.005  1.00 58.68  ? 910  ARG C CB  1 
ATOM   2825 C CG  . ARG C 1 32  ? 19.526  35.569  65.130  1.00 62.92  ? 910  ARG C CG  1 
ATOM   2826 C CD  . ARG C 1 32  ? 18.817  34.269  64.670  1.00 66.59  ? 910  ARG C CD  1 
ATOM   2827 N NE  . ARG C 1 32  ? 17.374  34.382  64.826  1.00 67.21  ? 910  ARG C NE  1 
ATOM   2828 C CZ  . ARG C 1 32  ? 16.677  35.396  64.318  1.00 68.10  ? 910  ARG C CZ  1 
ATOM   2829 N NH1 . ARG C 1 32  ? 17.307  36.361  63.626  1.00 68.54  ? 910  ARG C NH1 1 
ATOM   2830 N NH2 . ARG C 1 32  ? 15.358  35.457  64.498  1.00 70.57  ? 910  ARG C NH2 1 
ATOM   2831 N N   . LYS C 1 33  ? 22.133  36.872  66.776  1.00 47.85  ? 911  LYS C N   1 
ATOM   2832 C CA  . LYS C 1 33  ? 22.124  37.221  68.195  1.00 47.72  ? 911  LYS C CA  1 
ATOM   2833 C C   . LYS C 1 33  ? 22.680  38.641  68.404  1.00 47.59  ? 911  LYS C C   1 
ATOM   2834 O O   . LYS C 1 33  ? 22.479  39.268  69.454  1.00 47.46  ? 911  LYS C O   1 
ATOM   2835 C CB  . LYS C 1 33  ? 23.005  36.241  68.961  1.00 51.09  ? 911  LYS C CB  1 
ATOM   2836 C CG  . LYS C 1 33  ? 22.291  35.003  69.471  1.00 52.50  ? 911  LYS C CG  1 
ATOM   2837 C CD  . LYS C 1 33  ? 23.128  34.335  70.565  1.00 54.60  ? 911  LYS C CD  1 
ATOM   2838 C CE  . LYS C 1 33  ? 22.511  33.043  71.081  1.00 56.46  ? 911  LYS C CE  1 
ATOM   2839 N NZ  . LYS C 1 33  ? 22.537  32.976  72.581  1.00 57.00  ? 911  LYS C NZ  1 
ATOM   2840 N N   . TRP C 1 34  ? 23.419  39.129  67.413  1.00 46.29  ? 912  TRP C N   1 
ATOM   2841 C CA  . TRP C 1 34  ? 24.058  40.434  67.512  1.00 45.88  ? 912  TRP C CA  1 
ATOM   2842 C C   . TRP C 1 34  ? 23.682  41.419  66.416  1.00 45.58  ? 912  TRP C C   1 
ATOM   2843 O O   . TRP C 1 34  ? 23.267  41.038  65.310  1.00 45.86  ? 912  TRP C O   1 
ATOM   2844 C CB  . TRP C 1 34  ? 25.559  40.251  67.438  1.00 42.46  ? 912  TRP C CB  1 
ATOM   2845 C CG  . TRP C 1 34  ? 26.063  39.189  68.287  1.00 43.76  ? 912  TRP C CG  1 
ATOM   2846 C CD1 . TRP C 1 34  ? 26.199  37.880  67.967  1.00 46.23  ? 912  TRP C CD1 1 
ATOM   2847 C CD2 . TRP C 1 34  ? 26.499  39.330  69.633  1.00 46.08  ? 912  TRP C CD2 1 
ATOM   2848 N NE1 . TRP C 1 34  ? 26.709  37.185  69.043  1.00 47.31  ? 912  TRP C NE1 1 
ATOM   2849 C CE2 . TRP C 1 34  ? 26.862  38.055  70.089  1.00 48.19  ? 912  TRP C CE2 1 
ATOM   2850 C CE3 . TRP C 1 34  ? 26.539  40.403  70.527  1.00 45.99  ? 912  TRP C CE3 1 
ATOM   2851 C CZ2 . TRP C 1 34  ? 27.305  37.832  71.379  1.00 49.75  ? 912  TRP C CZ2 1 
ATOM   2852 C CZ3 . TRP C 1 34  ? 26.968  40.187  71.808  1.00 46.14  ? 912  TRP C CZ3 1 
ATOM   2853 C CH2 . TRP C 1 34  ? 27.346  38.914  72.228  1.00 48.55  ? 912  TRP C CH2 1 
ATOM   2854 N N   . SER C 1 35  ? 23.967  42.686  66.679  1.00 46.33  ? 913  SER C N   1 
ATOM   2855 C CA  . SER C 1 35  ? 23.738  43.719  65.676  1.00 45.60  ? 913  SER C CA  1 
ATOM   2856 C C   . SER C 1 35  ? 24.933  43.766  64.706  1.00 44.31  ? 913  SER C C   1 
ATOM   2857 O O   . SER C 1 35  ? 26.090  43.665  65.133  1.00 44.31  ? 913  SER C O   1 
ATOM   2858 C CB  . SER C 1 35  ? 23.511  45.088  66.355  1.00 49.24  ? 913  SER C CB  1 
ATOM   2859 O OG  . SER C 1 35  ? 23.964  46.193  65.568  1.00 50.39  ? 913  SER C OG  1 
ATOM   2860 N N   . SER C 1 36  ? 24.640  43.903  63.407  1.00 45.02  ? 914  SER C N   1 
ATOM   2861 C CA  . SER C 1 36  ? 25.684  44.042  62.365  1.00 44.31  ? 914  SER C CA  1 
ATOM   2862 C C   . SER C 1 36  ? 26.477  45.377  62.468  1.00 43.87  ? 914  SER C C   1 
ATOM   2863 O O   . SER C 1 36  ? 27.583  45.502  61.899  1.00 43.69  ? 914  SER C O   1 
ATOM   2864 C CB  . SER C 1 36  ? 25.073  43.935  60.960  1.00 45.70  ? 914  SER C CB  1 
ATOM   2865 O OG  . SER C 1 36  ? 24.351  42.729  60.789  1.00 46.07  ? 914  SER C OG  1 
ATOM   2866 N N   . LYS C 1 37  ? 25.884  46.368  63.154  1.00 42.14  ? 915  LYS C N   1 
ATOM   2867 C CA  . LYS C 1 37  ? 26.423  47.712  63.294  1.00 41.89  ? 915  LYS C CA  1 
ATOM   2868 C C   . LYS C 1 37  ? 27.826  47.777  63.922  1.00 42.39  ? 915  LYS C C   1 
ATOM   2869 O O   . LYS C 1 37  ? 28.001  47.556  65.120  1.00 42.13  ? 915  LYS C O   1 
ATOM   2870 C CB  . LYS C 1 37  ? 25.452  48.544  64.116  1.00 45.64  ? 915  LYS C CB  1 
ATOM   2871 C CG  . LYS C 1 37  ? 25.426  50.039  63.796  1.00 45.64  ? 915  LYS C CG  1 
ATOM   2872 C CD  . LYS C 1 37  ? 26.689  50.763  64.190  1.00 46.23  ? 915  LYS C CD  1 
ATOM   2873 C CE  . LYS C 1 37  ? 26.403  52.217  64.537  1.00 46.83  ? 915  LYS C CE  1 
ATOM   2874 N NZ  . LYS C 1 37  ? 27.468  52.774  65.414  1.00 46.05  ? 915  LYS C NZ  1 
ATOM   2875 N N   . GLY C 1 38  ? 28.837  48.100  63.127  1.00 42.21  ? 916  GLY C N   1 
ATOM   2876 C CA  . GLY C 1 38  ? 30.190  48.184  63.650  1.00 42.29  ? 916  GLY C CA  1 
ATOM   2877 C C   . GLY C 1 38  ? 30.913  46.849  63.831  1.00 42.73  ? 916  GLY C C   1 
ATOM   2878 O O   . GLY C 1 38  ? 32.022  46.806  64.389  1.00 43.16  ? 916  GLY C O   1 
ATOM   2879 N N   . ASN C 1 39  ? 30.305  45.768  63.337  1.00 44.07  ? 917  ASN C N   1 
ATOM   2880 C CA  . ASN C 1 39  ? 30.863  44.425  63.427  1.00 44.40  ? 917  ASN C CA  1 
ATOM   2881 C C   . ASN C 1 39  ? 30.726  43.673  62.089  1.00 44.66  ? 917  ASN C C   1 
ATOM   2882 O O   . ASN C 1 39  ? 29.708  43.029  61.820  1.00 44.95  ? 917  ASN C O   1 
ATOM   2883 C CB  . ASN C 1 39  ? 30.128  43.661  64.507  1.00 40.89  ? 917  ASN C CB  1 
ATOM   2884 C CG  . ASN C 1 39  ? 30.805  42.387  64.854  1.00 40.85  ? 917  ASN C CG  1 
ATOM   2885 O OD1 . ASN C 1 39  ? 31.671  41.897  64.115  1.00 40.40  ? 917  ASN C OD1 1 
ATOM   2886 N ND2 . ASN C 1 39  ? 30.453  41.847  66.013  1.00 42.10  ? 917  ASN C ND2 1 
ATOM   2887 N N   . ASP C 1 40  ? 31.759  43.757  61.250  1.00 46.76  ? 918  ASP C N   1 
ATOM   2888 C CA  . ASP C 1 40  ? 31.759  43.102  59.943  1.00 46.72  ? 918  ASP C CA  1 
ATOM   2889 C C   . ASP C 1 40  ? 31.884  41.579  60.061  1.00 46.21  ? 918  ASP C C   1 
ATOM   2890 O O   . ASP C 1 40  ? 31.630  40.851  59.107  1.00 46.10  ? 918  ASP C O   1 
ATOM   2891 C CB  . ASP C 1 40  ? 32.904  43.645  59.092  1.00 51.75  ? 918  ASP C CB  1 
ATOM   2892 C CG  . ASP C 1 40  ? 32.571  44.975  58.429  1.00 54.60  ? 918  ASP C CG  1 
ATOM   2893 O OD1 . ASP C 1 40  ? 31.377  45.381  58.460  1.00 59.25  ? 918  ASP C OD1 1 
ATOM   2894 O OD2 . ASP C 1 40  ? 33.512  45.604  57.860  1.00 56.52  ? 918  ASP C OD2 1 
ATOM   2895 N N   . ILE C 1 41  ? 32.298  41.093  61.225  1.00 42.28  ? 919  ILE C N   1 
ATOM   2896 C CA  . ILE C 1 41  ? 32.377  39.647  61.432  1.00 41.73  ? 919  ILE C CA  1 
ATOM   2897 C C   . ILE C 1 41  ? 30.946  39.106  61.342  1.00 41.78  ? 919  ILE C C   1 
ATOM   2898 O O   . ILE C 1 41  ? 30.699  38.092  60.689  1.00 41.56  ? 919  ILE C O   1 
ATOM   2899 C CB  . ILE C 1 41  ? 33.038  39.265  62.785  1.00 44.99  ? 919  ILE C CB  1 
ATOM   2900 C CG1 . ILE C 1 41  ? 34.570  39.313  62.685  1.00 45.02  ? 919  ILE C CG1 1 
ATOM   2901 C CG2 . ILE C 1 41  ? 32.600  37.896  63.203  1.00 43.38  ? 919  ILE C CG2 1 
ATOM   2902 C CD1 . ILE C 1 41  ? 35.271  38.421  63.697  1.00 41.75  ? 919  ILE C CD1 1 
ATOM   2903 N N   . ILE C 1 42  ? 30.009  39.831  61.960  1.00 37.84  ? 920  ILE C N   1 
ATOM   2904 C CA  . ILE C 1 42  ? 28.619  39.431  61.956  1.00 37.34  ? 920  ILE C CA  1 
ATOM   2905 C C   . ILE C 1 42  ? 28.003  39.664  60.603  1.00 36.92  ? 920  ILE C C   1 
ATOM   2906 O O   . ILE C 1 42  ? 27.202  38.872  60.115  1.00 37.00  ? 920  ILE C O   1 
ATOM   2907 C CB  . ILE C 1 42  ? 27.817  40.140  63.019  1.00 39.68  ? 920  ILE C CB  1 
ATOM   2908 C CG1 . ILE C 1 42  ? 28.527  40.058  64.381  1.00 38.68  ? 920  ILE C CG1 1 
ATOM   2909 C CG2 . ILE C 1 42  ? 26.401  39.550  63.048  1.00 40.68  ? 920  ILE C CG2 1 
ATOM   2910 C CD1 . ILE C 1 42  ? 28.494  38.727  64.976  1.00 34.41  ? 920  ILE C CD1 1 
ATOM   2911 N N   . ALA C 1 43  ? 28.377  40.745  59.963  1.00 35.83  ? 921  ALA C N   1 
ATOM   2912 C CA  . ALA C 1 43  ? 27.838  40.977  58.634  1.00 35.44  ? 921  ALA C CA  1 
ATOM   2913 C C   . ALA C 1 43  ? 28.280  39.860  57.651  1.00 34.98  ? 921  ALA C C   1 
ATOM   2914 O O   . ALA C 1 43  ? 27.492  39.381  56.832  1.00 33.99  ? 921  ALA C O   1 
ATOM   2915 C CB  . ALA C 1 43  ? 28.261  42.333  58.154  1.00 35.89  ? 921  ALA C CB  1 
ATOM   2916 N N   . ALA C 1 44  ? 29.550  39.458  57.749  1.00 34.90  ? 922  ALA C N   1 
ATOM   2917 C CA  . ALA C 1 44  ? 30.127  38.373  56.934  1.00 34.78  ? 922  ALA C CA  1 
ATOM   2918 C C   . ALA C 1 44  ? 29.386  37.066  57.235  1.00 34.99  ? 922  ALA C C   1 
ATOM   2919 O O   . ALA C 1 44  ? 28.900  36.370  56.332  1.00 34.94  ? 922  ALA C O   1 
ATOM   2920 C CB  . ALA C 1 44  ? 31.610  38.197  57.261  1.00 33.92  ? 922  ALA C CB  1 
ATOM   2921 N N   . ALA C 1 45  ? 29.307  36.735  58.521  1.00 35.36  ? 923  ALA C N   1 
ATOM   2922 C CA  . ALA C 1 45  ? 28.653  35.517  58.935  1.00 35.22  ? 923  ALA C CA  1 
ATOM   2923 C C   . ALA C 1 45  ? 27.228  35.410  58.346  1.00 35.29  ? 923  ALA C C   1 
ATOM   2924 O O   . ALA C 1 45  ? 26.840  34.356  57.783  1.00 35.14  ? 923  ALA C O   1 
ATOM   2925 C CB  . ALA C 1 45  ? 28.641  35.409  60.435  1.00 34.69  ? 923  ALA C CB  1 
ATOM   2926 N N   . LYS C 1 46  ? 26.448  36.484  58.475  1.00 34.70  ? 924  LYS C N   1 
ATOM   2927 C CA  . LYS C 1 46  ? 25.085  36.483  57.979  1.00 34.44  ? 924  LYS C CA  1 
ATOM   2928 C C   . LYS C 1 46  ? 25.030  36.250  56.471  1.00 34.90  ? 924  LYS C C   1 
ATOM   2929 O O   . LYS C 1 46  ? 24.129  35.560  55.964  1.00 35.98  ? 924  LYS C O   1 
ATOM   2930 C CB  . LYS C 1 46  ? 24.432  37.791  58.354  1.00 37.72  ? 924  LYS C CB  1 
ATOM   2931 C CG  . LYS C 1 46  ? 24.127  37.876  59.862  1.00 38.35  ? 924  LYS C CG  1 
ATOM   2932 C CD  . LYS C 1 46  ? 23.897  39.315  60.321  1.00 38.85  ? 924  LYS C CD  1 
ATOM   2933 C CE  . LYS C 1 46  ? 23.231  39.375  61.694  1.00 40.46  ? 924  LYS C CE  1 
ATOM   2934 N NZ  . LYS C 1 46  ? 22.889  40.806  62.165  1.00 38.32  ? 924  LYS C NZ  1 
ATOM   2935 N N   . ARG C 1 47  ? 26.021  36.795  55.761  1.00 36.43  ? 925  ARG C N   1 
ATOM   2936 C CA  . ARG C 1 47  ? 26.128  36.668  54.320  1.00 35.86  ? 925  ARG C CA  1 
ATOM   2937 C C   . ARG C 1 47  ? 26.491  35.230  53.974  1.00 37.05  ? 925  ARG C C   1 
ATOM   2938 O O   . ARG C 1 47  ? 25.959  34.636  53.015  1.00 37.46  ? 925  ARG C O   1 
ATOM   2939 C CB  . ARG C 1 47  ? 27.239  37.554  53.856  1.00 38.79  ? 925  ARG C CB  1 
ATOM   2940 C CG  . ARG C 1 47  ? 26.826  38.775  53.152  1.00 38.13  ? 925  ARG C CG  1 
ATOM   2941 C CD  . ARG C 1 47  ? 28.085  39.400  52.510  1.00 33.20  ? 925  ARG C CD  1 
ATOM   2942 N NE  . ARG C 1 47  ? 28.673  40.353  53.439  1.00 30.66  ? 925  ARG C NE  1 
ATOM   2943 C CZ  . ARG C 1 47  ? 29.957  40.414  53.774  1.00 30.36  ? 925  ARG C CZ  1 
ATOM   2944 N NH1 . ARG C 1 47  ? 30.885  39.647  53.188  1.00 26.68  ? 925  ARG C NH1 1 
ATOM   2945 N NH2 . ARG C 1 47  ? 30.318  41.302  54.693  1.00 33.13  ? 925  ARG C NH2 1 
ATOM   2946 N N   . MET C 1 48  ? 27.405  34.663  54.763  1.00 37.70  ? 926  MET C N   1 
ATOM   2947 C CA  . MET C 1 48  ? 27.824  33.277  54.556  1.00 38.44  ? 926  MET C CA  1 
ATOM   2948 C C   . MET C 1 48  ? 26.632  32.351  54.716  1.00 38.01  ? 926  MET C C   1 
ATOM   2949 O O   . MET C 1 48  ? 26.414  31.466  53.895  1.00 38.10  ? 926  MET C O   1 
ATOM   2950 C CB  . MET C 1 48  ? 28.934  32.867  55.527  1.00 40.79  ? 926  MET C CB  1 
ATOM   2951 C CG  . MET C 1 48  ? 30.320  32.995  54.945  1.00 43.71  ? 926  MET C CG  1 
ATOM   2952 S SD  . MET C 1 48  ? 31.703  32.683  56.124  1.00 50.04  ? 926  MET C SD  1 
ATOM   2953 C CE  . MET C 1 48  ? 31.615  30.892  56.137  1.00 44.55  ? 926  MET C CE  1 
ATOM   2954 N N   . ALA C 1 49  ? 25.871  32.557  55.782  1.00 35.79  ? 927  ALA C N   1 
ATOM   2955 C CA  . ALA C 1 49  ? 24.726  31.716  56.078  1.00 35.80  ? 927  ALA C CA  1 
ATOM   2956 C C   . ALA C 1 49  ? 23.751  31.774  54.916  1.00 36.21  ? 927  ALA C C   1 
ATOM   2957 O O   . ALA C 1 49  ? 23.229  30.745  54.471  1.00 35.77  ? 927  ALA C O   1 
ATOM   2958 C CB  . ALA C 1 49  ? 24.064  32.162  57.377  1.00 35.91  ? 927  ALA C CB  1 
ATOM   2959 N N   . LEU C 1 50  ? 23.543  32.981  54.393  1.00 39.56  ? 928  LEU C N   1 
ATOM   2960 C CA  . LEU C 1 50  ? 22.659  33.196  53.239  1.00 39.89  ? 928  LEU C CA  1 
ATOM   2961 C C   . LEU C 1 50  ? 23.135  32.482  51.951  1.00 40.08  ? 928  LEU C C   1 
ATOM   2962 O O   . LEU C 1 50  ? 22.331  31.920  51.207  1.00 41.12  ? 928  LEU C O   1 
ATOM   2963 C CB  . LEU C 1 50  ? 22.559  34.695  52.976  1.00 40.08  ? 928  LEU C CB  1 
ATOM   2964 C CG  . LEU C 1 50  ? 21.259  35.468  53.269  1.00 39.18  ? 928  LEU C CG  1 
ATOM   2965 C CD1 . LEU C 1 50  ? 20.208  34.693  54.112  1.00 35.93  ? 928  LEU C CD1 1 
ATOM   2966 C CD2 . LEU C 1 50  ? 21.604  36.858  53.847  1.00 36.72  ? 928  LEU C CD2 1 
ATOM   2967 N N   . LEU C 1 51  ? 24.433  32.558  51.668  1.00 40.13  ? 929  LEU C N   1 
ATOM   2968 C CA  . LEU C 1 51  ? 25.004  31.924  50.488  1.00 39.98  ? 929  LEU C CA  1 
ATOM   2969 C C   . LEU C 1 51  ? 25.044  30.414  50.606  1.00 40.16  ? 929  LEU C C   1 
ATOM   2970 O O   . LEU C 1 51  ? 25.167  29.714  49.601  1.00 39.83  ? 929  LEU C O   1 
ATOM   2971 C CB  . LEU C 1 51  ? 26.427  32.412  50.280  1.00 40.19  ? 929  LEU C CB  1 
ATOM   2972 C CG  . LEU C 1 51  ? 26.613  33.874  49.920  1.00 38.03  ? 929  LEU C CG  1 
ATOM   2973 C CD1 . LEU C 1 51  ? 27.952  34.258  50.526  1.00 36.10  ? 929  LEU C CD1 1 
ATOM   2974 C CD2 . LEU C 1 51  ? 26.584  34.029  48.394  1.00 36.01  ? 929  LEU C CD2 1 
ATOM   2975 N N   . MET C 1 52  ? 25.016  29.932  51.847  1.00 41.90  ? 930  MET C N   1 
ATOM   2976 C CA  . MET C 1 52  ? 25.015  28.494  52.167  1.00 42.60  ? 930  MET C CA  1 
ATOM   2977 C C   . MET C 1 52  ? 23.635  27.943  51.869  1.00 42.18  ? 930  MET C C   1 
ATOM   2978 O O   . MET C 1 52  ? 23.473  26.808  51.483  1.00 41.74  ? 930  MET C O   1 
ATOM   2979 C CB  . MET C 1 52  ? 25.277  28.294  53.654  1.00 45.77  ? 930  MET C CB  1 
ATOM   2980 C CG  . MET C 1 52  ? 25.638  26.879  53.999  1.00 48.42  ? 930  MET C CG  1 
ATOM   2981 S SD  . MET C 1 52  ? 26.969  26.407  52.882  1.00 56.32  ? 930  MET C SD  1 
ATOM   2982 C CE  . MET C 1 52  ? 27.960  28.002  52.927  1.00 55.95  ? 930  MET C CE  1 
ATOM   2983 N N   . ALA C 1 53  ? 22.635  28.766  52.113  1.00 42.59  ? 931  ALA C N   1 
ATOM   2984 C CA  . ALA C 1 53  ? 21.269  28.389  51.835  1.00 43.02  ? 931  ALA C CA  1 
ATOM   2985 C C   . ALA C 1 53  ? 21.147  28.348  50.317  1.00 43.86  ? 931  ALA C C   1 
ATOM   2986 O O   . ALA C 1 53  ? 20.464  27.477  49.755  1.00 44.56  ? 931  ALA C O   1 
ATOM   2987 C CB  . ALA C 1 53  ? 20.309  29.419  52.398  1.00 43.26  ? 931  ALA C CB  1 
ATOM   2988 N N   . GLU C 1 54  ? 21.799  29.289  49.642  1.00 44.70  ? 932  GLU C N   1 
ATOM   2989 C CA  . GLU C 1 54  ? 21.703  29.298  48.194  1.00 45.39  ? 932  GLU C CA  1 
ATOM   2990 C C   . GLU C 1 54  ? 22.355  28.029  47.669  1.00 45.33  ? 932  GLU C C   1 
ATOM   2991 O O   . GLU C 1 54  ? 21.923  27.455  46.661  1.00 45.13  ? 932  GLU C O   1 
ATOM   2992 C CB  . GLU C 1 54  ? 22.370  30.514  47.582  1.00 47.48  ? 932  GLU C CB  1 
ATOM   2993 C CG  . GLU C 1 54  ? 22.989  30.167  46.233  1.00 48.71  ? 932  GLU C CG  1 
ATOM   2994 C CD  . GLU C 1 54  ? 23.407  31.379  45.397  1.00 50.46  ? 932  GLU C CD  1 
ATOM   2995 O OE1 . GLU C 1 54  ? 23.147  31.342  44.151  1.00 49.85  ? 932  GLU C OE1 1 
ATOM   2996 O OE2 . GLU C 1 54  ? 24.015  32.329  45.992  1.00 50.14  ? 932  GLU C OE2 1 
ATOM   2997 N N   . MET C 1 55  ? 23.392  27.583  48.365  1.00 45.45  ? 933  MET C N   1 
ATOM   2998 C CA  . MET C 1 55  ? 24.111  26.392  47.945  1.00 45.86  ? 933  MET C CA  1 
ATOM   2999 C C   . MET C 1 55  ? 23.275  25.096  48.066  1.00 46.31  ? 933  MET C C   1 
ATOM   3000 O O   . MET C 1 55  ? 23.333  24.234  47.193  1.00 46.16  ? 933  MET C O   1 
ATOM   3001 C CB  . MET C 1 55  ? 25.456  26.303  48.658  1.00 49.35  ? 933  MET C CB  1 
ATOM   3002 C CG  . MET C 1 55  ? 26.398  25.306  48.046  1.00 50.31  ? 933  MET C CG  1 
ATOM   3003 S SD  . MET C 1 55  ? 28.181  25.646  48.264  1.00 52.89  ? 933  MET C SD  1 
ATOM   3004 C CE  . MET C 1 55  ? 28.482  26.567  46.718  1.00 50.42  ? 933  MET C CE  1 
ATOM   3005 N N   . SER C 1 56  ? 22.457  24.979  49.109  1.00 43.63  ? 934  SER C N   1 
ATOM   3006 C CA  . SER C 1 56  ? 21.623  23.800  49.257  1.00 44.42  ? 934  SER C CA  1 
ATOM   3007 C C   . SER C 1 56  ? 20.620  23.765  48.114  1.00 44.86  ? 934  SER C C   1 
ATOM   3008 O O   . SER C 1 56  ? 20.357  22.726  47.513  1.00 44.54  ? 934  SER C O   1 
ATOM   3009 C CB  . SER C 1 56  ? 20.956  23.714  50.640  1.00 46.28  ? 934  SER C CB  1 
ATOM   3010 O OG  . SER C 1 56  ? 20.059  24.776  50.854  1.00 46.47  ? 934  SER C OG  1 
ATOM   3011 N N   . ARG C 1 57  ? 20.147  24.930  47.734  1.00 46.81  ? 935  ARG C N   1 
ATOM   3012 C CA  . ARG C 1 57  ? 19.280  25.003  46.587  1.00 48.06  ? 935  ARG C CA  1 
ATOM   3013 C C   . ARG C 1 57  ? 20.053  24.582  45.333  1.00 49.26  ? 935  ARG C C   1 
ATOM   3014 O O   . ARG C 1 57  ? 19.596  23.720  44.581  1.00 50.16  ? 935  ARG C O   1 
ATOM   3015 C CB  . ARG C 1 57  ? 18.749  26.416  46.437  1.00 53.65  ? 935  ARG C CB  1 
ATOM   3016 C CG  . ARG C 1 57  ? 17.681  26.777  47.465  1.00 54.75  ? 935  ARG C CG  1 
ATOM   3017 C CD  . ARG C 1 57  ? 17.101  28.185  47.231  1.00 57.17  ? 935  ARG C CD  1 
ATOM   3018 N NE  . ARG C 1 57  ? 17.740  29.196  48.083  1.00 62.05  ? 935  ARG C NE  1 
ATOM   3019 C CZ  . ARG C 1 57  ? 18.393  30.256  47.608  1.00 63.68  ? 935  ARG C CZ  1 
ATOM   3020 N NH1 . ARG C 1 57  ? 18.463  30.440  46.289  1.00 64.40  ? 935  ARG C NH1 1 
ATOM   3021 N NH2 . ARG C 1 57  ? 18.985  31.122  48.437  1.00 65.31  ? 935  ARG C NH2 1 
ATOM   3022 N N   . LEU C 1 58  ? 21.222  25.192  45.109  1.00 49.20  ? 936  LEU C N   1 
ATOM   3023 C CA  . LEU C 1 58  ? 22.059  24.897  43.937  1.00 49.53  ? 936  LEU C CA  1 
ATOM   3024 C C   . LEU C 1 58  ? 22.408  23.439  43.821  1.00 50.40  ? 936  LEU C C   1 
ATOM   3025 O O   . LEU C 1 58  ? 22.441  22.889  42.725  1.00 50.68  ? 936  LEU C O   1 
ATOM   3026 C CB  . LEU C 1 58  ? 23.357  25.700  43.963  1.00 48.07  ? 936  LEU C CB  1 
ATOM   3027 C CG  . LEU C 1 58  ? 23.198  27.183  43.683  1.00 46.52  ? 936  LEU C CG  1 
ATOM   3028 C CD1 . LEU C 1 58  ? 24.578  27.825  43.624  1.00 45.09  ? 936  LEU C CD1 1 
ATOM   3029 C CD2 . LEU C 1 58  ? 22.434  27.367  42.391  1.00 42.68  ? 936  LEU C CD2 1 
ATOM   3030 N N   . VAL C 1 59  ? 22.717  22.835  44.958  1.00 54.81  ? 937  VAL C N   1 
ATOM   3031 C CA  . VAL C 1 59  ? 23.098  21.423  45.045  1.00 56.67  ? 937  VAL C CA  1 
ATOM   3032 C C   . VAL C 1 59  ? 22.039  20.429  44.477  1.00 58.00  ? 937  VAL C C   1 
ATOM   3033 O O   . VAL C 1 59  ? 22.278  19.227  44.365  1.00 57.69  ? 937  VAL C O   1 
ATOM   3034 C CB  . VAL C 1 59  ? 23.604  21.106  46.474  1.00 57.60  ? 937  VAL C CB  1 
ATOM   3035 C CG1 . VAL C 1 59  ? 22.746  20.080  47.192  1.00 58.10  ? 937  VAL C CG1 1 
ATOM   3036 C CG2 . VAL C 1 59  ? 25.052  20.755  46.460  1.00 57.43  ? 937  VAL C CG2 1 
ATOM   3037 N N   . ARG C 1 60  ? 20.884  20.958  44.080  1.00 67.23  ? 938  ARG C N   1 
ATOM   3038 C CA  . ARG C 1 60  ? 19.845  20.170  43.424  1.00 69.34  ? 938  ARG C CA  1 
ATOM   3039 C C   . ARG C 1 60  ? 19.768  20.622  41.946  1.00 70.34  ? 938  ARG C C   1 
ATOM   3040 O O   . ARG C 1 60  ? 19.514  19.818  41.041  1.00 70.79  ? 938  ARG C O   1 
ATOM   3041 C CB  . ARG C 1 60  ? 18.492  20.386  44.104  1.00 75.64  ? 938  ARG C CB  1 
ATOM   3042 C CG  . ARG C 1 60  ? 18.585  20.593  45.601  1.00 77.40  ? 938  ARG C CG  1 
ATOM   3043 C CD  . ARG C 1 60  ? 19.215  19.397  46.277  1.00 81.90  ? 938  ARG C CD  1 
ATOM   3044 N NE  . ARG C 1 60  ? 18.891  18.159  45.566  1.00 84.73  ? 938  ARG C NE  1 
ATOM   3045 C CZ  . ARG C 1 60  ? 17.841  17.364  45.819  1.00 86.93  ? 938  ARG C CZ  1 
ATOM   3046 N NH1 . ARG C 1 60  ? 16.972  17.644  46.796  1.00 87.01  ? 938  ARG C NH1 1 
ATOM   3047 N NH2 . ARG C 1 60  ? 17.665  16.260  45.089  1.00 87.56  ? 938  ARG C NH2 1 
ATOM   3048 N N   . GLY C 1 61  ? 20.039  21.908  41.723  1.00 74.47  ? 939  GLY C N   1 
ATOM   3049 C CA  . GLY C 1 61  ? 20.024  22.588  40.434  1.00 75.06  ? 939  GLY C CA  1 
ATOM   3050 C C   . GLY C 1 61  ? 19.985  21.881  39.078  1.00 75.85  ? 939  GLY C C   1 
ATOM   3051 O O   . GLY C 1 61  ? 19.558  22.512  38.087  1.00 76.10  ? 939  GLY C O   1 
ATOM   3052 N N   . GLY C 1 62  ? 20.463  20.629  39.000  1.00 79.21  ? 940  GLY C N   1 
ATOM   3053 C CA  . GLY C 1 62  ? 20.517  19.858  37.755  1.00 79.14  ? 940  GLY C CA  1 
ATOM   3054 C C   . GLY C 1 62  ? 21.507  20.486  36.784  1.00 79.16  ? 940  GLY C C   1 
ATOM   3055 O O   . GLY C 1 62  ? 22.592  19.953  36.525  1.00 78.76  ? 940  GLY C O   1 
ATOM   3056 N N   . SER C 1 63  ? 21.102  21.640  36.244  1.00 79.65  ? 941  SER C N   1 
ATOM   3057 C CA  . SER C 1 63  ? 21.886  22.412  35.275  1.00 79.78  ? 941  SER C CA  1 
ATOM   3058 C C   . SER C 1 63  ? 21.691  23.935  35.415  1.00 79.69  ? 941  SER C C   1 
ATOM   3059 O O   . SER C 1 63  ? 20.696  24.394  35.974  1.00 79.38  ? 941  SER C O   1 
ATOM   3060 C CB  . SER C 1 63  ? 21.555  21.971  33.847  1.00 84.73  ? 941  SER C CB  1 
ATOM   3061 O OG  . SER C 1 63  ? 22.733  21.815  33.075  1.00 84.15  ? 941  SER C OG  1 
ATOM   3062 N N   . GLY C 1 64  ? 22.653  24.703  34.901  1.00 73.71  ? 942  GLY C N   1 
ATOM   3063 C CA  . GLY C 1 64  ? 22.609  26.138  34.884  1.00 72.92  ? 942  GLY C CA  1 
ATOM   3064 C C   . GLY C 1 64  ? 23.165  26.454  36.258  1.00 72.28  ? 942  GLY C C   1 
ATOM   3065 O O   . GLY C 1 64  ? 23.504  27.610  36.584  1.00 72.61  ? 942  GLY C O   1 
ATOM   3066 N N   . THR C 1 65  ? 23.260  25.399  37.071  1.00 63.64  ? 943  THR C N   1 
ATOM   3067 C CA  . THR C 1 65  ? 23.790  25.532  38.412  1.00 62.34  ? 943  THR C CA  1 
ATOM   3068 C C   . THR C 1 65  ? 25.305  25.468  38.418  1.00 61.26  ? 943  THR C C   1 
ATOM   3069 O O   . THR C 1 65  ? 25.926  26.031  39.300  1.00 61.62  ? 943  THR C O   1 
ATOM   3070 C CB  . THR C 1 65  ? 23.122  24.585  39.426  1.00 57.74  ? 943  THR C CB  1 
ATOM   3071 O OG1 . THR C 1 65  ? 23.330  23.227  39.037  1.00 58.40  ? 943  THR C OG1 1 
ATOM   3072 C CG2 . THR C 1 65  ? 21.627  24.865  39.501  1.00 57.07  ? 943  THR C CG2 1 
ATOM   3073 N N   . LYS C 1 66  ? 25.892  24.832  37.401  1.00 56.82  ? 944  LYS C N   1 
ATOM   3074 C CA  . LYS C 1 66  ? 27.352  24.725  37.261  1.00 55.50  ? 944  LYS C CA  1 
ATOM   3075 C C   . LYS C 1 66  ? 28.047  26.069  37.538  1.00 54.09  ? 944  LYS C C   1 
ATOM   3076 O O   . LYS C 1 66  ? 28.779  26.218  38.519  1.00 54.25  ? 944  LYS C O   1 
ATOM   3077 C CB  . LYS C 1 66  ? 27.731  24.218  35.861  1.00 54.98  ? 944  LYS C CB  1 
ATOM   3078 C CG  . LYS C 1 66  ? 26.550  24.181  34.849  1.00 58.25  ? 944  LYS C CG  1 
ATOM   3079 C CD  . LYS C 1 66  ? 26.756  25.087  33.588  1.00 63.79  ? 944  LYS C CD  1 
ATOM   3080 C CE  . LYS C 1 66  ? 25.569  26.003  33.355  1.00 65.59  ? 944  LYS C CE  1 
ATOM   3081 N NZ  . LYS C 1 66  ? 25.576  27.115  34.345  1.00 66.00  ? 944  LYS C NZ  1 
ATOM   3082 N N   . ARG C 1 67  ? 27.789  27.062  36.702  1.00 49.92  ? 945  ARG C N   1 
ATOM   3083 C CA  . ARG C 1 67  ? 28.391  28.362  36.904  1.00 48.63  ? 945  ARG C CA  1 
ATOM   3084 C C   . ARG C 1 67  ? 28.046  28.980  38.261  1.00 47.40  ? 945  ARG C C   1 
ATOM   3085 O O   . ARG C 1 67  ? 28.914  29.578  38.942  1.00 46.80  ? 945  ARG C O   1 
ATOM   3086 C CB  . ARG C 1 67  ? 27.981  29.289  35.788  1.00 50.40  ? 945  ARG C CB  1 
ATOM   3087 C CG  . ARG C 1 67  ? 28.854  29.171  34.592  1.00 50.82  ? 945  ARG C CG  1 
ATOM   3088 C CD  . ARG C 1 67  ? 28.931  30.489  33.888  1.00 53.19  ? 945  ARG C CD  1 
ATOM   3089 N NE  . ARG C 1 67  ? 27.832  30.613  32.938  1.00 54.85  ? 945  ARG C NE  1 
ATOM   3090 C CZ  . ARG C 1 67  ? 27.528  31.724  32.283  1.00 53.96  ? 945  ARG C CZ  1 
ATOM   3091 N NH1 . ARG C 1 67  ? 28.236  32.845  32.453  1.00 52.55  ? 945  ARG C NH1 1 
ATOM   3092 N NH2 . ARG C 1 67  ? 26.507  31.696  31.447  1.00 54.68  ? 945  ARG C NH2 1 
ATOM   3093 N N   . ALA C 1 68  ? 26.771  28.865  38.645  1.00 45.77  ? 946  ALA C N   1 
ATOM   3094 C CA  . ALA C 1 68  ? 26.327  29.413  39.928  1.00 43.88  ? 946  ALA C CA  1 
ATOM   3095 C C   . ALA C 1 68  ? 27.055  28.754  41.086  1.00 43.05  ? 946  ALA C C   1 
ATOM   3096 O O   . ALA C 1 68  ? 27.615  29.441  41.946  1.00 43.62  ? 946  ALA C O   1 
ATOM   3097 C CB  . ALA C 1 68  ? 24.852  29.269  40.104  1.00 43.79  ? 946  ALA C CB  1 
ATOM   3098 N N   . LEU C 1 69  ? 27.063  27.423  41.077  1.00 40.44  ? 947  LEU C N   1 
ATOM   3099 C CA  . LEU C 1 69  ? 27.684  26.621  42.126  1.00 39.14  ? 947  LEU C CA  1 
ATOM   3100 C C   . LEU C 1 69  ? 29.085  27.074  42.421  1.00 38.21  ? 947  LEU C C   1 
ATOM   3101 O O   . LEU C 1 69  ? 29.471  27.288  43.588  1.00 37.70  ? 947  LEU C O   1 
ATOM   3102 C CB  . LEU C 1 69  ? 27.738  25.155  41.727  1.00 37.87  ? 947  LEU C CB  1 
ATOM   3103 C CG  . LEU C 1 69  ? 27.929  24.235  42.935  1.00 38.71  ? 947  LEU C CG  1 
ATOM   3104 C CD1 . LEU C 1 69  ? 27.297  24.803  44.224  1.00 38.96  ? 947  LEU C CD1 1 
ATOM   3105 C CD2 . LEU C 1 69  ? 27.360  22.876  42.632  1.00 37.81  ? 947  LEU C CD2 1 
ATOM   3106 N N   . ILE C 1 70  ? 29.851  27.186  41.340  1.00 40.15  ? 948  ILE C N   1 
ATOM   3107 C CA  . ILE C 1 70  ? 31.231  27.648  41.403  1.00 38.89  ? 948  ILE C CA  1 
ATOM   3108 C C   . ILE C 1 70  ? 31.319  29.060  41.999  1.00 39.18  ? 948  ILE C C   1 
ATOM   3109 O O   . ILE C 1 70  ? 31.990  29.270  43.020  1.00 39.45  ? 948  ILE C O   1 
ATOM   3110 C CB  . ILE C 1 70  ? 31.852  27.599  40.025  1.00 40.33  ? 948  ILE C CB  1 
ATOM   3111 C CG1 . ILE C 1 70  ? 32.416  26.202  39.780  1.00 39.16  ? 948  ILE C CG1 1 
ATOM   3112 C CG2 . ILE C 1 70  ? 32.878  28.719  39.861  1.00 38.98  ? 948  ILE C CG2 1 
ATOM   3113 C CD1 . ILE C 1 70  ? 31.787  25.498  38.629  1.00 39.17  ? 948  ILE C CD1 1 
ATOM   3114 N N   . GLN C 1 71  ? 30.637  30.016  41.353  1.00 42.04  ? 949  GLN C N   1 
ATOM   3115 C CA  . GLN C 1 71  ? 30.621  31.409  41.799  1.00 41.96  ? 949  GLN C CA  1 
ATOM   3116 C C   . GLN C 1 71  ? 30.186  31.461  43.265  1.00 42.55  ? 949  GLN C C   1 
ATOM   3117 O O   . GLN C 1 71  ? 30.735  32.204  44.074  1.00 42.16  ? 949  GLN C O   1 
ATOM   3118 C CB  . GLN C 1 71  ? 29.631  32.202  40.954  1.00 43.03  ? 949  GLN C CB  1 
ATOM   3119 C CG  . GLN C 1 71  ? 29.996  33.635  40.824  1.00 42.68  ? 949  GLN C CG  1 
ATOM   3120 C CD  . GLN C 1 71  ? 31.464  33.854  41.048  1.00 44.49  ? 949  GLN C CD  1 
ATOM   3121 O OE1 . GLN C 1 71  ? 31.871  34.215  42.127  1.00 47.48  ? 949  GLN C OE1 1 
ATOM   3122 N NE2 . GLN C 1 71  ? 32.266  33.659  40.016  1.00 46.70  ? 949  GLN C NE2 1 
ATOM   3123 N N   . CYS C 1 72  ? 29.210  30.639  43.610  1.00 43.25  ? 950  CYS C N   1 
ATOM   3124 C CA  . CYS C 1 72  ? 28.719  30.647  44.956  1.00 43.07  ? 950  CYS C CA  1 
ATOM   3125 C C   . CYS C 1 72  ? 29.750  30.250  45.975  1.00 42.61  ? 950  CYS C C   1 
ATOM   3126 O O   . CYS C 1 72  ? 29.805  30.782  47.084  1.00 42.35  ? 950  CYS C O   1 
ATOM   3127 C CB  . CYS C 1 72  ? 27.520  29.740  45.090  1.00 45.08  ? 950  CYS C CB  1 
ATOM   3128 S SG  . CYS C 1 72  ? 26.849  29.809  46.765  1.00 46.07  ? 950  CYS C SG  1 
ATOM   3129 N N   . ALA C 1 73  ? 30.535  29.250  45.644  1.00 44.40  ? 951  ALA C N   1 
ATOM   3130 C CA  . ALA C 1 73  ? 31.550  28.853  46.595  1.00 44.52  ? 951  ALA C CA  1 
ATOM   3131 C C   . ALA C 1 73  ? 32.622  29.950  46.637  1.00 44.90  ? 951  ALA C C   1 
ATOM   3132 O O   . ALA C 1 73  ? 33.115  30.288  47.702  1.00 44.79  ? 951  ALA C O   1 
ATOM   3133 C CB  . ALA C 1 73  ? 32.135  27.502  46.234  1.00 45.43  ? 951  ALA C CB  1 
ATOM   3134 N N   . LYS C 1 74  ? 32.918  30.562  45.493  1.00 44.62  ? 952  LYS C N   1 
ATOM   3135 C CA  . LYS C 1 74  ? 33.899  31.641  45.454  1.00 45.09  ? 952  LYS C CA  1 
ATOM   3136 C C   . LYS C 1 74  ? 33.439  32.775  46.342  1.00 45.19  ? 952  LYS C C   1 
ATOM   3137 O O   . LYS C 1 74  ? 34.260  33.484  46.945  1.00 45.48  ? 952  LYS C O   1 
ATOM   3138 C CB  . LYS C 1 74  ? 34.093  32.154  44.026  1.00 45.67  ? 952  LYS C CB  1 
ATOM   3139 C CG  . LYS C 1 74  ? 34.907  31.215  43.162  1.00 47.34  ? 952  LYS C CG  1 
ATOM   3140 C CD  . LYS C 1 74  ? 35.627  31.904  42.049  1.00 49.39  ? 952  LYS C CD  1 
ATOM   3141 C CE  . LYS C 1 74  ? 35.050  31.467  40.710  1.00 52.75  ? 952  LYS C CE  1 
ATOM   3142 N NZ  . LYS C 1 74  ? 35.653  32.233  39.571  1.00 55.95  ? 952  LYS C NZ  1 
ATOM   3143 N N   . ASP C 1 75  ? 32.121  32.949  46.413  1.00 46.88  ? 953  ASP C N   1 
ATOM   3144 C CA  . ASP C 1 75  ? 31.531  34.003  47.222  1.00 46.44  ? 953  ASP C CA  1 
ATOM   3145 C C   . ASP C 1 75  ? 31.740  33.659  48.685  1.00 45.95  ? 953  ASP C C   1 
ATOM   3146 O O   . ASP C 1 75  ? 32.202  34.488  49.477  1.00 46.37  ? 953  ASP C O   1 
ATOM   3147 C CB  . ASP C 1 75  ? 30.034  34.120  46.956  1.00 50.20  ? 953  ASP C CB  1 
ATOM   3148 C CG  . ASP C 1 75  ? 29.698  34.947  45.714  1.00 53.04  ? 953  ASP C CG  1 
ATOM   3149 O OD1 . ASP C 1 75  ? 30.625  35.302  44.935  1.00 54.72  ? 953  ASP C OD1 1 
ATOM   3150 O OD2 . ASP C 1 75  ? 28.474  35.178  45.494  1.00 55.03  ? 953  ASP C OD2 1 
ATOM   3151 N N   . ILE C 1 76  ? 31.402  32.426  49.043  1.00 42.68  ? 954  ILE C N   1 
ATOM   3152 C CA  . ILE C 1 76  ? 31.552  31.963  50.424  1.00 41.69  ? 954  ILE C CA  1 
ATOM   3153 C C   . ILE C 1 76  ? 32.946  32.165  50.959  1.00 41.47  ? 954  ILE C C   1 
ATOM   3154 O O   . ILE C 1 76  ? 33.113  32.597  52.083  1.00 41.31  ? 954  ILE C O   1 
ATOM   3155 C CB  . ILE C 1 76  ? 31.149  30.498  50.572  1.00 44.73  ? 954  ILE C CB  1 
ATOM   3156 C CG1 . ILE C 1 76  ? 29.638  30.384  50.707  1.00 44.67  ? 954  ILE C CG1 1 
ATOM   3157 C CG2 . ILE C 1 76  ? 31.846  29.890  51.773  1.00 42.90  ? 954  ILE C CG2 1 
ATOM   3158 C CD1 . ILE C 1 76  ? 29.082  29.174  50.073  1.00 46.81  ? 954  ILE C CD1 1 
ATOM   3159 N N   . ALA C 1 77  ? 33.931  31.812  50.140  1.00 40.34  ? 955  ALA C N   1 
ATOM   3160 C CA  . ALA C 1 77  ? 35.337  31.965  50.472  1.00 40.84  ? 955  ALA C CA  1 
ATOM   3161 C C   . ALA C 1 77  ? 35.715  33.436  50.763  1.00 41.52  ? 955  ALA C C   1 
ATOM   3162 O O   . ALA C 1 77  ? 36.348  33.767  51.798  1.00 41.49  ? 955  ALA C O   1 
ATOM   3163 C CB  . ALA C 1 77  ? 36.201  31.374  49.382  1.00 41.21  ? 955  ALA C CB  1 
ATOM   3164 N N   . LYS C 1 78  ? 35.251  34.331  49.902  1.00 41.34  ? 956  LYS C N   1 
ATOM   3165 C CA  . LYS C 1 78  ? 35.509  35.751  50.113  1.00 42.14  ? 956  LYS C CA  1 
ATOM   3166 C C   . LYS C 1 78  ? 35.006  36.177  51.507  1.00 42.32  ? 956  LYS C C   1 
ATOM   3167 O O   . LYS C 1 78  ? 35.677  36.913  52.234  1.00 42.25  ? 956  LYS C O   1 
ATOM   3168 C CB  . LYS C 1 78  ? 34.848  36.553  49.003  1.00 45.24  ? 956  LYS C CB  1 
ATOM   3169 C CG  . LYS C 1 78  ? 35.555  37.847  48.598  1.00 46.05  ? 956  LYS C CG  1 
ATOM   3170 C CD  . LYS C 1 78  ? 34.626  38.696  47.641  1.00 52.32  ? 956  LYS C CD  1 
ATOM   3171 C CE  . LYS C 1 78  ? 33.199  38.004  47.375  1.00 55.62  ? 956  LYS C CE  1 
ATOM   3172 N NZ  . LYS C 1 78  ? 32.552  38.133  46.022  1.00 59.28  ? 956  LYS C NZ  1 
ATOM   3173 N N   . ALA C 1 79  ? 33.846  35.657  51.888  1.00 40.28  ? 957  ALA C N   1 
ATOM   3174 C CA  . ALA C 1 79  ? 33.270  35.979  53.177  1.00 41.26  ? 957  ALA C CA  1 
ATOM   3175 C C   . ALA C 1 79  ? 34.069  35.385  54.327  1.00 42.27  ? 957  ALA C C   1 
ATOM   3176 O O   . ALA C 1 79  ? 34.214  36.024  55.365  1.00 42.24  ? 957  ALA C O   1 
ATOM   3177 C CB  . ALA C 1 79  ? 31.832  35.568  53.252  1.00 41.21  ? 957  ALA C CB  1 
ATOM   3178 N N   . SER C 1 80  ? 34.633  34.193  54.145  1.00 42.43  ? 958  SER C N   1 
ATOM   3179 C CA  . SER C 1 80  ? 35.435  33.609  55.202  1.00 43.35  ? 958  SER C CA  1 
ATOM   3180 C C   . SER C 1 80  ? 36.782  34.297  55.254  1.00 44.24  ? 958  SER C C   1 
ATOM   3181 O O   . SER C 1 80  ? 37.314  34.536  56.331  1.00 44.42  ? 958  SER C O   1 
ATOM   3182 C CB  . SER C 1 80  ? 35.595  32.122  54.996  1.00 44.56  ? 958  SER C CB  1 
ATOM   3183 O OG  . SER C 1 80  ? 34.717  31.684  53.997  1.00 44.80  ? 958  SER C OG  1 
ATOM   3184 N N   . ASP C 1 81  ? 37.306  34.679  54.100  1.00 48.77  ? 959  ASP C N   1 
ATOM   3185 C CA  . ASP C 1 81  ? 38.581  35.408  54.090  1.00 50.49  ? 959  ASP C CA  1 
ATOM   3186 C C   . ASP C 1 81  ? 38.476  36.686  54.941  1.00 50.99  ? 959  ASP C C   1 
ATOM   3187 O O   . ASP C 1 81  ? 39.445  37.135  55.556  1.00 51.55  ? 959  ASP C O   1 
ATOM   3188 C CB  . ASP C 1 81  ? 39.002  35.782  52.654  1.00 54.69  ? 959  ASP C CB  1 
ATOM   3189 C CG  . ASP C 1 81  ? 39.581  34.605  51.878  1.00 57.55  ? 959  ASP C CG  1 
ATOM   3190 O OD1 . ASP C 1 81  ? 40.396  33.842  52.466  1.00 58.44  ? 959  ASP C OD1 1 
ATOM   3191 O OD2 . ASP C 1 81  ? 39.221  34.454  50.679  1.00 62.47  ? 959  ASP C OD2 1 
ATOM   3192 N N   . GLU C 1 82  ? 37.291  37.275  54.968  1.00 51.03  ? 960  GLU C N   1 
ATOM   3193 C CA  . GLU C 1 82  ? 37.095  38.480  55.755  1.00 51.42  ? 960  GLU C CA  1 
ATOM   3194 C C   . GLU C 1 82  ? 36.825  38.206  57.251  1.00 50.99  ? 960  GLU C C   1 
ATOM   3195 O O   . GLU C 1 82  ? 37.133  39.040  58.111  1.00 51.20  ? 960  GLU C O   1 
ATOM   3196 C CB  . GLU C 1 82  ? 36.023  39.370  55.120  1.00 53.77  ? 960  GLU C CB  1 
ATOM   3197 C CG  . GLU C 1 82  ? 36.510  40.245  53.871  1.00 59.36  ? 960  GLU C CG  1 
ATOM   3198 C CD  . GLU C 1 82  ? 37.896  39.827  53.212  1.00 65.46  ? 960  GLU C CD  1 
ATOM   3199 O OE1 . GLU C 1 82  ? 37.869  39.239  52.086  1.00 62.69  ? 960  GLU C OE1 1 
ATOM   3200 O OE2 . GLU C 1 82  ? 38.988  40.204  53.752  1.00 64.92  ? 960  GLU C OE2 1 
ATOM   3201 N N   . VAL C 1 83  ? 36.293  37.021  57.559  1.00 45.81  ? 961  VAL C N   1 
ATOM   3202 C CA  . VAL C 1 83  ? 36.041  36.645  58.935  1.00 44.77  ? 961  VAL C CA  1 
ATOM   3203 C C   . VAL C 1 83  ? 37.398  36.339  59.563  1.00 45.24  ? 961  VAL C C   1 
ATOM   3204 O O   . VAL C 1 83  ? 37.699  36.755  60.682  1.00 44.77  ? 961  VAL C O   1 
ATOM   3205 C CB  . VAL C 1 83  ? 35.103  35.447  59.032  1.00 45.09  ? 961  VAL C CB  1 
ATOM   3206 C CG1 . VAL C 1 83  ? 35.069  34.927  60.430  1.00 44.69  ? 961  VAL C CG1 1 
ATOM   3207 C CG2 . VAL C 1 83  ? 33.735  35.818  58.620  1.00 43.76  ? 961  VAL C CG2 1 
ATOM   3208 N N   . THR C 1 84  ? 38.232  35.628  58.825  1.00 44.84  ? 962  THR C N   1 
ATOM   3209 C CA  . THR C 1 84  ? 39.562  35.331  59.304  1.00 45.40  ? 962  THR C CA  1 
ATOM   3210 C C   . THR C 1 84  ? 40.367  36.609  59.494  1.00 46.25  ? 962  THR C C   1 
ATOM   3211 O O   . THR C 1 84  ? 41.029  36.779  60.524  1.00 46.32  ? 962  THR C O   1 
ATOM   3212 C CB  . THR C 1 84  ? 40.242  34.491  58.283  1.00 44.81  ? 962  THR C CB  1 
ATOM   3213 O OG1 . THR C 1 84  ? 39.328  33.481  57.876  1.00 46.29  ? 962  THR C OG1 1 
ATOM   3214 C CG2 . THR C 1 84  ? 41.537  33.900  58.795  1.00 43.87  ? 962  THR C CG2 1 
ATOM   3215 N N   . ARG C 1 85  ? 40.326  37.477  58.471  1.00 49.14  ? 963  ARG C N   1 
ATOM   3216 C CA  . ARG C 1 85  ? 41.085  38.730  58.437  1.00 49.86  ? 963  ARG C CA  1 
ATOM   3217 C C   . ARG C 1 85  ? 40.834  39.606  59.645  1.00 50.47  ? 963  ARG C C   1 
ATOM   3218 O O   . ARG C 1 85  ? 41.758  40.203  60.220  1.00 50.97  ? 963  ARG C O   1 
ATOM   3219 C CB  . ARG C 1 85  ? 40.766  39.512  57.164  1.00 56.46  ? 963  ARG C CB  1 
ATOM   3220 C CG  . ARG C 1 85  ? 41.470  40.852  57.119  1.00 57.91  ? 963  ARG C CG  1 
ATOM   3221 C CD  . ARG C 1 85  ? 41.244  41.612  55.817  1.00 60.54  ? 963  ARG C CD  1 
ATOM   3222 N NE  . ARG C 1 85  ? 39.918  42.226  55.755  1.00 62.49  ? 963  ARG C NE  1 
ATOM   3223 C CZ  . ARG C 1 85  ? 39.520  43.250  56.510  1.00 62.29  ? 963  ARG C CZ  1 
ATOM   3224 N NH1 . ARG C 1 85  ? 40.346  43.816  57.402  1.00 58.51  ? 963  ARG C NH1 1 
ATOM   3225 N NH2 . ARG C 1 85  ? 38.278  43.707  56.363  1.00 63.12  ? 963  ARG C NH2 1 
ATOM   3226 N N   . LEU C 1 86  ? 39.562  39.671  60.007  1.00 49.00  ? 964  LEU C N   1 
ATOM   3227 C CA  . LEU C 1 86  ? 39.110  40.490  61.103  1.00 49.63  ? 964  LEU C CA  1 
ATOM   3228 C C   . LEU C 1 86  ? 39.347  39.828  62.457  1.00 50.35  ? 964  LEU C C   1 
ATOM   3229 O O   . LEU C 1 86  ? 39.731  40.476  63.433  1.00 50.08  ? 964  LEU C O   1 
ATOM   3230 C CB  . LEU C 1 86  ? 37.635  40.833  60.875  1.00 48.99  ? 964  LEU C CB  1 
ATOM   3231 C CG  . LEU C 1 86  ? 37.444  41.784  59.670  1.00 49.62  ? 964  LEU C CG  1 
ATOM   3232 C CD1 . LEU C 1 86  ? 36.000  41.953  59.191  1.00 49.87  ? 964  LEU C CD1 1 
ATOM   3233 C CD2 . LEU C 1 86  ? 38.082  43.120  59.966  1.00 48.98  ? 964  LEU C CD2 1 
ATOM   3234 N N   . ALA C 1 87  ? 39.143  38.522  62.499  1.00 52.48  ? 965  ALA C N   1 
ATOM   3235 C CA  . ALA C 1 87  ? 39.347  37.754  63.722  1.00 53.33  ? 965  ALA C CA  1 
ATOM   3236 C C   . ALA C 1 87  ? 40.795  37.824  64.153  1.00 54.30  ? 965  ALA C C   1 
ATOM   3237 O O   . ALA C 1 87  ? 41.107  37.621  65.327  1.00 54.62  ? 965  ALA C O   1 
ATOM   3238 C CB  . ALA C 1 87  ? 38.978  36.326  63.495  1.00 54.19  ? 965  ALA C CB  1 
ATOM   3239 N N   . LYS C 1 88  ? 41.677  38.080  63.192  1.00 56.11  ? 966  LYS C N   1 
ATOM   3240 C CA  . LYS C 1 88  ? 43.089  38.162  63.479  1.00 56.74  ? 966  LYS C CA  1 
ATOM   3241 C C   . LYS C 1 88  ? 43.453  39.518  64.055  1.00 57.28  ? 966  LYS C C   1 
ATOM   3242 O O   . LYS C 1 88  ? 44.312  39.623  64.961  1.00 57.36  ? 966  LYS C O   1 
ATOM   3243 C CB  . LYS C 1 88  ? 43.899  37.855  62.236  1.00 59.00  ? 966  LYS C CB  1 
ATOM   3244 C CG  . LYS C 1 88  ? 44.298  36.395  62.151  1.00 60.53  ? 966  LYS C CG  1 
ATOM   3245 C CD  . LYS C 1 88  ? 45.343  36.151  61.092  1.00 62.94  ? 966  LYS C CD  1 
ATOM   3246 C CE  . LYS C 1 88  ? 45.250  34.720  60.657  1.00 66.03  ? 966  LYS C CE  1 
ATOM   3247 N NZ  . LYS C 1 88  ? 44.081  34.158  61.351  1.00 67.44  ? 966  LYS C NZ  1 
ATOM   3248 N N   . GLU C 1 89  ? 42.791  40.560  63.552  1.00 59.01  ? 967  GLU C N   1 
ATOM   3249 C CA  . GLU C 1 89  ? 43.026  41.894  64.100  1.00 59.11  ? 967  GLU C CA  1 
ATOM   3250 C C   . GLU C 1 89  ? 42.479  41.930  65.541  1.00 58.61  ? 967  GLU C C   1 
ATOM   3251 O O   . GLU C 1 89  ? 43.044  42.597  66.410  1.00 57.99  ? 967  GLU C O   1 
ATOM   3252 C CB  . GLU C 1 89  ? 42.428  42.993  63.218  1.00 61.12  ? 967  GLU C CB  1 
ATOM   3253 C CG  . GLU C 1 89  ? 43.419  44.090  62.789  1.00 64.39  ? 967  GLU C CG  1 
ATOM   3254 C CD  . GLU C 1 89  ? 44.671  44.267  63.726  1.00 69.65  ? 967  GLU C CD  1 
ATOM   3255 O OE1 . GLU C 1 89  ? 45.715  43.598  63.461  1.00 71.73  ? 967  GLU C OE1 1 
ATOM   3256 O OE2 . GLU C 1 89  ? 44.653  45.142  64.651  1.00 70.32  ? 967  GLU C OE2 1 
ATOM   3257 N N   . VAL C 1 90  ? 41.433  41.142  65.798  1.00 55.14  ? 968  VAL C N   1 
ATOM   3258 C CA  . VAL C 1 90  ? 40.869  41.037  67.140  1.00 55.21  ? 968  VAL C CA  1 
ATOM   3259 C C   . VAL C 1 90  ? 41.871  40.346  68.025  1.00 56.01  ? 968  VAL C C   1 
ATOM   3260 O O   . VAL C 1 90  ? 41.982  40.649  69.206  1.00 56.19  ? 968  VAL C O   1 
ATOM   3261 C CB  . VAL C 1 90  ? 39.609  40.170  67.193  1.00 57.18  ? 968  VAL C CB  1 
ATOM   3262 C CG1 . VAL C 1 90  ? 39.300  39.830  68.642  1.00 56.00  ? 968  VAL C CG1 1 
ATOM   3263 C CG2 . VAL C 1 90  ? 38.430  40.830  66.524  1.00 57.52  ? 968  VAL C CG2 1 
ATOM   3264 N N   . ALA C 1 91  ? 42.512  39.330  67.468  1.00 59.45  ? 969  ALA C N   1 
ATOM   3265 C CA  . ALA C 1 91  ? 43.459  38.531  68.217  1.00 60.07  ? 969  ALA C CA  1 
ATOM   3266 C C   . ALA C 1 91  ? 44.725  39.334  68.490  1.00 60.82  ? 969  ALA C C   1 
ATOM   3267 O O   . ALA C 1 91  ? 45.341  39.210  69.555  1.00 61.00  ? 969  ALA C O   1 
ATOM   3268 C CB  . ALA C 1 91  ? 43.780  37.244  67.453  1.00 60.61  ? 969  ALA C CB  1 
ATOM   3269 N N   . LYS C 1 92  ? 45.102  40.164  67.521  1.00 65.51  ? 970  LYS C N   1 
ATOM   3270 C CA  . LYS C 1 92  ? 46.292  40.996  67.636  1.00 65.72  ? 970  LYS C CA  1 
ATOM   3271 C C   . LYS C 1 92  ? 46.107  42.062  68.715  1.00 65.78  ? 970  LYS C C   1 
ATOM   3272 O O   . LYS C 1 92  ? 47.077  42.648  69.195  1.00 66.40  ? 970  LYS C O   1 
ATOM   3273 C CB  . LYS C 1 92  ? 46.582  41.667  66.287  1.00 72.28  ? 970  LYS C CB  1 
ATOM   3274 C CG  . LYS C 1 92  ? 47.858  42.501  66.260  1.00 72.50  ? 970  LYS C CG  1 
ATOM   3275 C CD  . LYS C 1 92  ? 48.038  43.236  64.931  1.00 71.53  ? 970  LYS C CD  1 
ATOM   3276 C CE  . LYS C 1 92  ? 48.981  44.450  65.087  1.00 72.79  ? 970  LYS C CE  1 
ATOM   3277 N NZ  . LYS C 1 92  ? 48.625  45.601  64.188  1.00 71.87  ? 970  LYS C NZ  1 
ATOM   3278 N N   . GLN C 1 93  ? 44.856  42.323  69.078  1.00 66.69  ? 971  GLN C N   1 
ATOM   3279 C CA  . GLN C 1 93  ? 44.550  43.332  70.083  1.00 66.51  ? 971  GLN C CA  1 
ATOM   3280 C C   . GLN C 1 93  ? 44.347  42.695  71.464  1.00 66.51  ? 971  GLN C C   1 
ATOM   3281 O O   . GLN C 1 93  ? 44.489  43.341  72.511  1.00 65.49  ? 971  GLN C O   1 
ATOM   3282 C CB  . GLN C 1 93  ? 43.316  44.136  69.652  1.00 70.01  ? 971  GLN C CB  1 
ATOM   3283 C CG  . GLN C 1 93  ? 43.585  45.612  69.417  1.00 70.17  ? 971  GLN C CG  1 
ATOM   3284 C CD  . GLN C 1 93  ? 44.951  45.880  68.770  1.00 72.05  ? 971  GLN C CD  1 
ATOM   3285 O OE1 . GLN C 1 93  ? 45.791  46.580  69.334  1.00 71.27  ? 971  GLN C OE1 1 
ATOM   3286 N NE2 . GLN C 1 93  ? 45.156  45.350  67.566  1.00 71.61  ? 971  GLN C NE2 1 
ATOM   3287 N N   . CYS C 1 94  ? 44.016  41.413  71.442  1.00 66.02  ? 972  CYS C N   1 
ATOM   3288 C CA  . CYS C 1 94  ? 43.778  40.644  72.654  1.00 66.92  ? 972  CYS C CA  1 
ATOM   3289 C C   . CYS C 1 94  ? 45.000  40.610  73.549  1.00 67.25  ? 972  CYS C C   1 
ATOM   3290 O O   . CYS C 1 94  ? 46.126  40.509  73.056  1.00 68.07  ? 972  CYS C O   1 
ATOM   3291 C CB  . CYS C 1 94  ? 43.413  39.214  72.299  1.00 66.71  ? 972  CYS C CB  1 
ATOM   3292 S SG  . CYS C 1 94  ? 42.686  38.379  73.676  1.00 66.66  ? 972  CYS C SG  1 
ATOM   3293 N N   . THR C 1 95  ? 44.768  40.668  74.861  1.00 65.69  ? 973  THR C N   1 
ATOM   3294 C CA  . THR C 1 95  ? 45.848  40.650  75.851  1.00 65.72  ? 973  THR C CA  1 
ATOM   3295 C C   . THR C 1 95  ? 45.727  39.413  76.739  1.00 65.93  ? 973  THR C C   1 
ATOM   3296 O O   . THR C 1 95  ? 46.406  39.294  77.763  1.00 66.27  ? 973  THR C O   1 
ATOM   3297 C CB  . THR C 1 95  ? 45.935  41.983  76.682  1.00 66.27  ? 973  THR C CB  1 
ATOM   3298 O OG1 . THR C 1 95  ? 44.816  42.082  77.578  1.00 66.90  ? 973  THR C OG1 1 
ATOM   3299 C CG2 . THR C 1 95  ? 45.961  43.229  75.762  1.00 65.90  ? 973  THR C CG2 1 
ATOM   3300 N N   . ASP C 1 96  ? 44.865  38.489  76.332  1.00 65.68  ? 974  ASP C N   1 
ATOM   3301 C CA  . ASP C 1 96  ? 44.693  37.244  77.058  1.00 65.51  ? 974  ASP C CA  1 
ATOM   3302 C C   . ASP C 1 96  ? 45.267  36.053  76.270  1.00 65.49  ? 974  ASP C C   1 
ATOM   3303 O O   . ASP C 1 96  ? 44.698  35.610  75.273  1.00 65.09  ? 974  ASP C O   1 
ATOM   3304 C CB  . ASP C 1 96  ? 43.221  37.022  77.410  1.00 66.97  ? 974  ASP C CB  1 
ATOM   3305 C CG  . ASP C 1 96  ? 43.004  35.757  78.229  1.00 69.20  ? 974  ASP C CG  1 
ATOM   3306 O OD1 . ASP C 1 96  ? 44.016  35.117  78.605  1.00 69.93  ? 974  ASP C OD1 1 
ATOM   3307 O OD2 . ASP C 1 96  ? 41.829  35.393  78.489  1.00 70.96  ? 974  ASP C OD2 1 
ATOM   3308 N N   . LYS C 1 97  ? 46.402  35.537  76.726  1.00 66.15  ? 975  LYS C N   1 
ATOM   3309 C CA  . LYS C 1 97  ? 47.043  34.421  76.049  1.00 66.65  ? 975  LYS C CA  1 
ATOM   3310 C C   . LYS C 1 97  ? 46.088  33.248  75.845  1.00 67.05  ? 975  LYS C C   1 
ATOM   3311 O O   . LYS C 1 97  ? 46.065  32.621  74.783  1.00 67.35  ? 975  LYS C O   1 
ATOM   3312 C CB  . LYS C 1 97  ? 48.276  33.971  76.823  1.00 70.65  ? 975  LYS C CB  1 
ATOM   3313 C CG  . LYS C 1 97  ? 49.271  33.227  75.969  1.00 70.52  ? 975  LYS C CG  1 
ATOM   3314 C CD  . LYS C 1 97  ? 50.065  32.174  76.770  1.00 70.52  ? 975  LYS C CD  1 
ATOM   3315 C CE  . LYS C 1 97  ? 51.378  31.772  76.035  1.00 71.76  ? 975  LYS C CE  1 
ATOM   3316 N NZ  . LYS C 1 97  ? 51.399  32.130  74.546  1.00 71.51  ? 975  LYS C NZ  1 
ATOM   3317 N N   . ARG C 1 98  ? 45.313  32.942  76.875  1.00 66.94  ? 976  ARG C N   1 
ATOM   3318 C CA  . ARG C 1 98  ? 44.361  31.849  76.789  1.00 67.04  ? 976  ARG C CA  1 
ATOM   3319 C C   . ARG C 1 98  ? 43.473  32.070  75.559  1.00 67.48  ? 976  ARG C C   1 
ATOM   3320 O O   . ARG C 1 98  ? 43.447  31.240  74.645  1.00 67.36  ? 976  ARG C O   1 
ATOM   3321 C CB  . ARG C 1 98  ? 43.497  31.785  78.055  1.00 74.41  ? 976  ARG C CB  1 
ATOM   3322 C CG  . ARG C 1 98  ? 43.260  30.378  78.534  1.00 73.37  ? 976  ARG C CG  1 
ATOM   3323 C CD  . ARG C 1 98  ? 41.837  30.063  78.229  1.00 74.53  ? 976  ARG C CD  1 
ATOM   3324 N NE  . ARG C 1 98  ? 41.366  28.815  78.836  1.00 75.50  ? 976  ARG C NE  1 
ATOM   3325 C CZ  . ARG C 1 98  ? 40.068  28.482  78.964  1.00 76.95  ? 976  ARG C CZ  1 
ATOM   3326 N NH1 . ARG C 1 98  ? 39.100  29.315  78.535  1.00 78.58  ? 976  ARG C NH1 1 
ATOM   3327 N NH2 . ARG C 1 98  ? 39.727  27.316  79.523  1.00 75.95  ? 976  ARG C NH2 1 
ATOM   3328 N N   . ILE C 1 99  ? 42.783  33.211  75.526  1.00 62.83  ? 977  ILE C N   1 
ATOM   3329 C CA  . ILE C 1 99  ? 41.859  33.520  74.443  1.00 63.15  ? 977  ILE C CA  1 
ATOM   3330 C C   . ILE C 1 99  ? 42.513  33.850  73.096  1.00 63.36  ? 977  ILE C C   1 
ATOM   3331 O O   . ILE C 1 99  ? 42.017  33.417  72.052  1.00 63.23  ? 977  ILE C O   1 
ATOM   3332 C CB  . ILE C 1 99  ? 40.798  34.581  74.856  1.00 66.28  ? 977  ILE C CB  1 
ATOM   3333 C CG1 . ILE C 1 99  ? 40.167  34.244  76.213  1.00 66.27  ? 977  ILE C CG1 1 
ATOM   3334 C CG2 . ILE C 1 99  ? 39.689  34.663  73.802  1.00 67.08  ? 977  ILE C CG2 1 
ATOM   3335 C CD1 . ILE C 1 99  ? 39.649  32.810  76.325  1.00 65.75  ? 977  ILE C CD1 1 
ATOM   3336 N N   . ARG C 1 100 ? 43.605  34.620  73.115  1.00 60.56  ? 978  ARG C N   1 
ATOM   3337 C CA  . ARG C 1 100 ? 44.298  35.010  71.885  1.00 60.51  ? 978  ARG C CA  1 
ATOM   3338 C C   . ARG C 1 100 ? 44.707  33.788  71.136  1.00 60.93  ? 978  ARG C C   1 
ATOM   3339 O O   . ARG C 1 100 ? 44.933  33.813  69.911  1.00 61.51  ? 978  ARG C O   1 
ATOM   3340 C CB  . ARG C 1 100 ? 45.561  35.792  72.179  1.00 59.65  ? 978  ARG C CB  1 
ATOM   3341 C CG  . ARG C 1 100 ? 45.988  36.586  70.974  1.00 59.95  ? 978  ARG C CG  1 
ATOM   3342 C CD  . ARG C 1 100 ? 47.482  36.624  70.815  1.00 62.08  ? 978  ARG C CD  1 
ATOM   3343 N NE  . ARG C 1 100 ? 48.147  36.170  72.026  1.00 64.21  ? 978  ARG C NE  1 
ATOM   3344 C CZ  . ARG C 1 100 ? 48.331  36.924  73.100  1.00 65.49  ? 978  ARG C CZ  1 
ATOM   3345 N NH1 . ARG C 1 100 ? 47.907  38.175  73.109  1.00 65.50  ? 978  ARG C NH1 1 
ATOM   3346 N NH2 . ARG C 1 100 ? 48.962  36.435  74.157  1.00 65.74  ? 978  ARG C NH2 1 
ATOM   3347 N N   . THR C 1 101 ? 44.841  32.714  71.908  1.00 61.71  ? 979  THR C N   1 
ATOM   3348 C CA  . THR C 1 101 ? 45.248  31.419  71.392  1.00 61.28  ? 979  THR C CA  1 
ATOM   3349 C C   . THR C 1 101 ? 44.101  30.700  70.714  1.00 61.29  ? 979  THR C C   1 
ATOM   3350 O O   . THR C 1 101 ? 44.174  30.437  69.522  1.00 61.43  ? 979  THR C O   1 
ATOM   3351 C CB  . THR C 1 101 ? 45.889  30.593  72.482  1.00 65.29  ? 979  THR C CB  1 
ATOM   3352 O OG1 . THR C 1 101 ? 47.217  31.078  72.709  1.00 65.42  ? 979  THR C OG1 1 
ATOM   3353 C CG2 . THR C 1 101 ? 45.937  29.131  72.088  1.00 65.27  ? 979  THR C CG2 1 
ATOM   3354 N N   . ASN C 1 102 ? 43.058  30.385  71.474  1.00 60.04  ? 980  ASN C N   1 
ATOM   3355 C CA  . ASN C 1 102 ? 41.887  29.738  70.923  1.00 60.97  ? 980  ASN C CA  1 
ATOM   3356 C C   . ASN C 1 102 ? 41.436  30.498  69.683  1.00 61.52  ? 980  ASN C C   1 
ATOM   3357 O O   . ASN C 1 102 ? 41.123  29.884  68.666  1.00 62.08  ? 980  ASN C O   1 
ATOM   3358 C CB  . ASN C 1 102 ? 40.750  29.683  71.939  1.00 66.69  ? 980  ASN C CB  1 
ATOM   3359 C CG  . ASN C 1 102 ? 41.192  29.096  73.261  1.00 69.07  ? 980  ASN C CG  1 
ATOM   3360 O OD1 . ASN C 1 102 ? 40.454  29.144  74.268  1.00 69.19  ? 980  ASN C OD1 1 
ATOM   3361 N ND2 . ASN C 1 102 ? 42.423  28.555  73.282  1.00 70.35  ? 980  ASN C ND2 1 
ATOM   3362 N N   . LEU C 1 103 ? 41.425  31.825  69.729  1.00 59.66  ? 981  LEU C N   1 
ATOM   3363 C CA  . LEU C 1 103 ? 40.987  32.573  68.552  1.00 59.83  ? 981  LEU C CA  1 
ATOM   3364 C C   . LEU C 1 103 ? 41.804  32.234  67.317  1.00 60.26  ? 981  LEU C C   1 
ATOM   3365 O O   . LEU C 1 103 ? 41.257  31.941  66.260  1.00 60.76  ? 981  LEU C O   1 
ATOM   3366 C CB  . LEU C 1 103 ? 41.028  34.082  68.782  1.00 59.54  ? 981  LEU C CB  1 
ATOM   3367 C CG  . LEU C 1 103 ? 40.319  34.944  67.731  1.00 58.61  ? 981  LEU C CG  1 
ATOM   3368 C CD1 . LEU C 1 103 ? 38.919  34.382  67.366  1.00 57.94  ? 981  LEU C CD1 1 
ATOM   3369 C CD2 . LEU C 1 103 ? 40.222  36.381  68.199  1.00 56.40  ? 981  LEU C CD2 1 
ATOM   3370 N N   . LEU C 1 104 ? 43.115  32.293  67.429  1.00 61.93  ? 982  LEU C N   1 
ATOM   3371 C CA  . LEU C 1 104 ? 43.922  31.962  66.281  1.00 62.59  ? 982  LEU C CA  1 
ATOM   3372 C C   . LEU C 1 104 ? 43.740  30.512  65.831  1.00 63.02  ? 982  LEU C C   1 
ATOM   3373 O O   . LEU C 1 104 ? 43.646  30.222  64.643  1.00 63.17  ? 982  LEU C O   1 
ATOM   3374 C CB  . LEU C 1 104 ? 45.367  32.281  66.565  1.00 61.57  ? 982  LEU C CB  1 
ATOM   3375 C CG  . LEU C 1 104 ? 45.429  33.797  66.561  1.00 61.70  ? 982  LEU C CG  1 
ATOM   3376 C CD1 . LEU C 1 104 ? 46.853  34.275  66.872  1.00 61.74  ? 982  LEU C CD1 1 
ATOM   3377 C CD2 . LEU C 1 104 ? 44.938  34.278  65.206  1.00 59.13  ? 982  LEU C CD2 1 
ATOM   3378 N N   . GLN C 1 105 ? 43.656  29.601  66.783  1.00 68.98  ? 983  GLN C N   1 
ATOM   3379 C CA  . GLN C 1 105 ? 43.458  28.201  66.453  1.00 69.33  ? 983  GLN C CA  1 
ATOM   3380 C C   . GLN C 1 105 ? 42.257  28.035  65.488  1.00 68.50  ? 983  GLN C C   1 
ATOM   3381 O O   . GLN C 1 105 ? 42.418  27.804  64.279  1.00 67.90  ? 983  GLN C O   1 
ATOM   3382 C CB  . GLN C 1 105 ? 43.249  27.410  67.759  1.00 72.44  ? 983  GLN C CB  1 
ATOM   3383 C CG  . GLN C 1 105 ? 42.909  25.922  67.590  1.00 75.22  ? 983  GLN C CG  1 
ATOM   3384 C CD  . GLN C 1 105 ? 41.813  25.443  68.555  1.00 78.72  ? 983  GLN C CD  1 
ATOM   3385 O OE1 . GLN C 1 105 ? 41.494  24.244  68.602  1.00 78.78  ? 983  GLN C OE1 1 
ATOM   3386 N NE2 . GLN C 1 105 ? 41.199  26.383  69.289  1.00 79.41  ? 983  GLN C NE2 1 
ATOM   3387 N N   . VAL C 1 106 ? 41.063  28.239  66.029  1.00 69.56  ? 984  VAL C N   1 
ATOM   3388 C CA  . VAL C 1 106 ? 39.816  28.108  65.288  1.00 69.16  ? 984  VAL C CA  1 
ATOM   3389 C C   . VAL C 1 106 ? 39.730  28.866  63.971  1.00 68.94  ? 984  VAL C C   1 
ATOM   3390 O O   . VAL C 1 106 ? 38.990  28.469  63.064  1.00 69.05  ? 984  VAL C O   1 
ATOM   3391 C CB  . VAL C 1 106 ? 38.626  28.469  66.166  1.00 72.60  ? 984  VAL C CB  1 
ATOM   3392 C CG1 . VAL C 1 106 ? 38.618  27.618  67.418  1.00 72.05  ? 984  VAL C CG1 1 
ATOM   3393 C CG2 . VAL C 1 106 ? 38.698  29.929  66.523  1.00 72.19  ? 984  VAL C CG2 1 
ATOM   3394 N N   . CYS C 1 107 ? 40.418  29.989  63.869  1.00 69.67  ? 985  CYS C N   1 
ATOM   3395 C CA  . CYS C 1 107 ? 40.294  30.752  62.640  1.00 69.01  ? 985  CYS C CA  1 
ATOM   3396 C C   . CYS C 1 107 ? 41.377  30.450  61.640  1.00 68.64  ? 985  CYS C C   1 
ATOM   3397 O O   . CYS C 1 107 ? 41.489  31.134  60.626  1.00 68.33  ? 985  CYS C O   1 
ATOM   3398 C CB  . CYS C 1 107 ? 40.139  32.265  62.894  1.00 68.60  ? 985  CYS C CB  1 
ATOM   3399 S SG  . CYS C 1 107 ? 41.636  33.191  63.256  1.00 66.74  ? 985  CYS C SG  1 
ATOM   3400 N N   . GLU C 1 108 ? 42.177  29.424  61.916  1.00 70.97  ? 986  GLU C N   1 
ATOM   3401 C CA  . GLU C 1 108 ? 43.254  29.085  60.992  1.00 70.87  ? 986  GLU C CA  1 
ATOM   3402 C C   . GLU C 1 108 ? 42.701  28.167  59.946  1.00 69.62  ? 986  GLU C C   1 
ATOM   3403 O O   . GLU C 1 108 ? 43.076  28.214  58.771  1.00 69.63  ? 986  GLU C O   1 
ATOM   3404 C CB  . GLU C 1 108 ? 44.393  28.373  61.713  1.00 72.93  ? 986  GLU C CB  1 
ATOM   3405 C CG  . GLU C 1 108 ? 45.241  29.277  62.596  1.00 76.42  ? 986  GLU C CG  1 
ATOM   3406 C CD  . GLU C 1 108 ? 45.613  30.608  61.951  1.00 81.08  ? 986  GLU C CD  1 
ATOM   3407 O OE1 . GLU C 1 108 ? 46.220  31.443  62.662  1.00 81.77  ? 986  GLU C OE1 1 
ATOM   3408 O OE2 . GLU C 1 108 ? 45.330  30.812  60.744  1.00 84.32  ? 986  GLU C OE2 1 
ATOM   3409 N N   . ARG C 1 109 ? 41.793  27.325  60.405  1.00 65.10  ? 987  ARG C N   1 
ATOM   3410 C CA  . ARG C 1 109 ? 41.218  26.311  59.567  1.00 63.97  ? 987  ARG C CA  1 
ATOM   3411 C C   . ARG C 1 109 ? 40.275  26.882  58.536  1.00 62.22  ? 987  ARG C C   1 
ATOM   3412 O O   . ARG C 1 109 ? 40.076  26.297  57.463  1.00 62.43  ? 987  ARG C O   1 
ATOM   3413 C CB  . ARG C 1 109 ? 40.517  25.304  60.450  1.00 71.66  ? 987  ARG C CB  1 
ATOM   3414 C CG  . ARG C 1 109 ? 40.862  25.513  61.906  1.00 74.43  ? 987  ARG C CG  1 
ATOM   3415 C CD  . ARG C 1 109 ? 40.775  24.217  62.702  1.00 77.13  ? 987  ARG C CD  1 
ATOM   3416 N NE  . ARG C 1 109 ? 40.217  24.452  64.031  1.00 78.04  ? 987  ARG C NE  1 
ATOM   3417 C CZ  . ARG C 1 109 ? 38.916  24.589  64.277  1.00 79.10  ? 987  ARG C CZ  1 
ATOM   3418 N NH1 . ARG C 1 109 ? 38.045  24.490  63.277  1.00 78.90  ? 987  ARG C NH1 1 
ATOM   3419 N NH2 . ARG C 1 109 ? 38.485  24.823  65.519  1.00 79.05  ? 987  ARG C NH2 1 
ATOM   3420 N N   . ILE C 1 110 ? 39.706  28.036  58.857  1.00 55.24  ? 988  ILE C N   1 
ATOM   3421 C CA  . ILE C 1 110 ? 38.747  28.666  57.965  1.00 53.29  ? 988  ILE C CA  1 
ATOM   3422 C C   . ILE C 1 110 ? 39.135  28.667  56.484  1.00 51.87  ? 988  ILE C C   1 
ATOM   3423 O O   . ILE C 1 110 ? 38.491  27.991  55.676  1.00 51.23  ? 988  ILE C O   1 
ATOM   3424 C CB  . ILE C 1 110 ? 38.287  30.016  58.474  1.00 54.88  ? 988  ILE C CB  1 
ATOM   3425 C CG1 . ILE C 1 110 ? 37.747  29.875  59.894  1.00 55.46  ? 988  ILE C CG1 1 
ATOM   3426 C CG2 . ILE C 1 110 ? 37.209  30.553  57.565  1.00 54.44  ? 988  ILE C CG2 1 
ATOM   3427 C CD1 . ILE C 1 110 ? 36.642  30.835  60.211  1.00 56.37  ? 988  ILE C CD1 1 
ATOM   3428 N N   . PRO C 1 111 ? 40.236  29.371  56.132  1.00 49.69  ? 989  PRO C N   1 
ATOM   3429 C CA  . PRO C 1 111 ? 40.859  29.499  54.808  1.00 48.84  ? 989  PRO C CA  1 
ATOM   3430 C C   . PRO C 1 111 ? 40.918  28.146  54.116  1.00 48.10  ? 989  PRO C C   1 
ATOM   3431 O O   . PRO C 1 111 ? 40.541  27.997  52.952  1.00 47.64  ? 989  PRO C O   1 
ATOM   3432 C CB  . PRO C 1 111 ? 42.297  29.897  55.157  1.00 49.94  ? 989  PRO C CB  1 
ATOM   3433 C CG  . PRO C 1 111 ? 42.234  30.451  56.504  1.00 49.50  ? 989  PRO C CG  1 
ATOM   3434 C CD  . PRO C 1 111 ? 41.211  29.662  57.201  1.00 50.70  ? 989  PRO C CD  1 
ATOM   3435 N N   . THR C 1 112 ? 41.429  27.171  54.864  1.00 46.92  ? 990  THR C N   1 
ATOM   3436 C CA  . THR C 1 112 ? 41.568  25.795  54.403  1.00 46.22  ? 990  THR C CA  1 
ATOM   3437 C C   . THR C 1 112 ? 40.230  25.161  54.025  1.00 45.25  ? 990  THR C C   1 
ATOM   3438 O O   . THR C 1 112 ? 40.023  24.735  52.883  1.00 45.55  ? 990  THR C O   1 
ATOM   3439 C CB  . THR C 1 112 ? 42.241  24.964  55.476  1.00 55.83  ? 990  THR C CB  1 
ATOM   3440 O OG1 . THR C 1 112 ? 43.390  25.667  55.980  1.00 57.00  ? 990  THR C OG1 1 
ATOM   3441 C CG2 . THR C 1 112 ? 42.648  23.630  54.911  1.00 57.13  ? 990  THR C CG2 1 
ATOM   3442 N N   . ILE C 1 113 ? 39.328  25.080  55.000  1.00 42.49  ? 991  ILE C N   1 
ATOM   3443 C CA  . ILE C 1 113 ? 38.022  24.491  54.763  1.00 40.56  ? 991  ILE C CA  1 
ATOM   3444 C C   . ILE C 1 113 ? 37.351  25.213  53.608  1.00 39.87  ? 991  ILE C C   1 
ATOM   3445 O O   . ILE C 1 113 ? 36.732  24.598  52.751  1.00 40.11  ? 991  ILE C O   1 
ATOM   3446 C CB  . ILE C 1 113 ? 37.180  24.511  56.041  1.00 41.26  ? 991  ILE C CB  1 
ATOM   3447 C CG1 . ILE C 1 113 ? 37.891  23.724  57.148  1.00 39.63  ? 991  ILE C CG1 1 
ATOM   3448 C CG2 . ILE C 1 113 ? 35.786  23.981  55.791  1.00 39.25  ? 991  ILE C CG2 1 
ATOM   3449 C CD1 . ILE C 1 113 ? 37.972  24.466  58.478  1.00 36.18  ? 991  ILE C CD1 1 
ATOM   3450 N N   . SER C 1 114 ? 37.496  26.522  53.556  1.00 43.35  ? 992  SER C N   1 
ATOM   3451 C CA  . SER C 1 114 ? 36.852  27.244  52.492  1.00 43.48  ? 992  SER C CA  1 
ATOM   3452 C C   . SER C 1 114 ? 37.449  26.942  51.119  1.00 43.56  ? 992  SER C C   1 
ATOM   3453 O O   . SER C 1 114 ? 36.762  27.072  50.089  1.00 44.13  ? 992  SER C O   1 
ATOM   3454 C CB  . SER C 1 114 ? 36.794  28.739  52.793  1.00 49.00  ? 992  SER C CB  1 
ATOM   3455 O OG  . SER C 1 114 ? 38.052  29.369  52.619  1.00 50.45  ? 992  SER C OG  1 
ATOM   3456 N N   . THR C 1 115 ? 38.708  26.506  51.090  1.00 45.29  ? 993  THR C N   1 
ATOM   3457 C CA  . THR C 1 115 ? 39.356  26.162  49.823  1.00 44.30  ? 993  THR C CA  1 
ATOM   3458 C C   . THR C 1 115 ? 38.978  24.757  49.365  1.00 44.71  ? 993  THR C C   1 
ATOM   3459 O O   . THR C 1 115 ? 38.818  24.495  48.163  1.00 44.19  ? 993  THR C O   1 
ATOM   3460 C CB  . THR C 1 115 ? 40.843  26.352  49.905  1.00 42.36  ? 993  THR C CB  1 
ATOM   3461 O OG1 . THR C 1 115 ? 41.101  27.742  49.761  1.00 41.38  ? 993  THR C OG1 1 
ATOM   3462 C CG2 . THR C 1 115 ? 41.541  25.614  48.799  1.00 41.34  ? 993  THR C CG2 1 
ATOM   3463 N N   . GLN C 1 116 ? 38.841  23.849  50.329  1.00 45.26  ? 994  GLN C N   1 
ATOM   3464 C CA  . GLN C 1 116 ? 38.406  22.505  50.027  1.00 45.41  ? 994  GLN C CA  1 
ATOM   3465 C C   . GLN C 1 116 ? 37.012  22.646  49.423  1.00 45.02  ? 994  GLN C C   1 
ATOM   3466 O O   . GLN C 1 116 ? 36.590  21.860  48.558  1.00 43.96  ? 994  GLN C O   1 
ATOM   3467 C CB  . GLN C 1 116 ? 38.268  21.727  51.318  1.00 48.47  ? 994  GLN C CB  1 
ATOM   3468 C CG  . GLN C 1 116 ? 39.575  21.327  51.952  1.00 51.53  ? 994  GLN C CG  1 
ATOM   3469 C CD  . GLN C 1 116 ? 39.354  20.408  53.159  1.00 55.44  ? 994  GLN C CD  1 
ATOM   3470 O OE1 . GLN C 1 116 ? 38.305  19.746  53.276  1.00 56.12  ? 994  GLN C OE1 1 
ATOM   3471 N NE2 . GLN C 1 116 ? 40.307  20.422  54.094  1.00 56.61  ? 994  GLN C NE2 1 
ATOM   3472 N N   . LEU C 1 117 ? 36.291  23.644  49.925  1.00 43.23  ? 995  LEU C N   1 
ATOM   3473 C CA  . LEU C 1 117 ? 34.935  23.858  49.494  1.00 42.74  ? 995  LEU C CA  1 
ATOM   3474 C C   . LEU C 1 117 ? 34.847  24.230  48.007  1.00 42.67  ? 995  LEU C C   1 
ATOM   3475 O O   . LEU C 1 117 ? 33.977  23.716  47.277  1.00 42.74  ? 995  LEU C O   1 
ATOM   3476 C CB  . LEU C 1 117 ? 34.256  24.899  50.368  1.00 43.27  ? 995  LEU C CB  1 
ATOM   3477 C CG  . LEU C 1 117 ? 32.733  24.897  50.168  1.00 41.87  ? 995  LEU C CG  1 
ATOM   3478 C CD1 . LEU C 1 117 ? 32.051  23.674  50.804  1.00 42.12  ? 995  LEU C CD1 1 
ATOM   3479 C CD2 . LEU C 1 117 ? 32.120  26.182  50.648  1.00 38.09  ? 995  LEU C CD2 1 
ATOM   3480 N N   . LYS C 1 118 ? 35.749  25.109  47.566  1.00 38.62  ? 996  LYS C N   1 
ATOM   3481 C CA  . LYS C 1 118 ? 35.792  25.571  46.179  1.00 38.06  ? 996  LYS C CA  1 
ATOM   3482 C C   . LYS C 1 118 ? 36.086  24.391  45.266  1.00 37.28  ? 996  LYS C C   1 
ATOM   3483 O O   . LYS C 1 118 ? 35.574  24.261  44.163  1.00 36.42  ? 996  LYS C O   1 
ATOM   3484 C CB  . LYS C 1 118 ? 36.928  26.585  46.024  1.00 40.89  ? 996  LYS C CB  1 
ATOM   3485 C CG  . LYS C 1 118 ? 36.752  27.898  46.779  1.00 43.34  ? 996  LYS C CG  1 
ATOM   3486 C CD  . LYS C 1 118 ? 37.538  29.036  46.110  1.00 46.84  ? 996  LYS C CD  1 
ATOM   3487 C CE  . LYS C 1 118 ? 39.054  28.987  46.419  1.00 50.51  ? 996  LYS C CE  1 
ATOM   3488 N NZ  . LYS C 1 118 ? 39.473  29.383  47.831  1.00 52.69  ? 996  LYS C NZ  1 
ATOM   3489 N N   . ILE C 1 119 ? 36.937  23.528  45.774  1.00 37.03  ? 997  ILE C N   1 
ATOM   3490 C CA  . ILE C 1 119 ? 37.377  22.337  45.077  1.00 37.14  ? 997  ILE C CA  1 
ATOM   3491 C C   . ILE C 1 119 ? 36.287  21.295  44.996  1.00 37.39  ? 997  ILE C C   1 
ATOM   3492 O O   . ILE C 1 119 ? 35.974  20.822  43.926  1.00 37.67  ? 997  ILE C O   1 
ATOM   3493 C CB  . ILE C 1 119 ? 38.630  21.792  45.748  1.00 39.83  ? 997  ILE C CB  1 
ATOM   3494 C CG1 . ILE C 1 119 ? 39.726  22.874  45.807  1.00 39.59  ? 997  ILE C CG1 1 
ATOM   3495 C CG2 . ILE C 1 119 ? 39.049  20.524  45.074  1.00 39.25  ? 997  ILE C CG2 1 
ATOM   3496 C CD1 . ILE C 1 119 ? 40.989  22.379  46.372  1.00 39.00  ? 997  ILE C CD1 1 
ATOM   3497 N N   . LEU C 1 120 ? 35.679  20.978  46.130  1.00 39.96  ? 998  LEU C N   1 
ATOM   3498 C CA  . LEU C 1 120 ? 34.603  19.993  46.167  1.00 40.16  ? 998  LEU C CA  1 
ATOM   3499 C C   . LEU C 1 120 ? 33.507  20.453  45.263  1.00 40.74  ? 998  LEU C C   1 
ATOM   3500 O O   . LEU C 1 120 ? 32.918  19.653  44.541  1.00 41.07  ? 998  LEU C O   1 
ATOM   3501 C CB  . LEU C 1 120 ? 34.047  19.819  47.585  1.00 40.09  ? 998  LEU C CB  1 
ATOM   3502 C CG  . LEU C 1 120 ? 35.023  19.078  48.499  1.00 39.21  ? 998  LEU C CG  1 
ATOM   3503 C CD1 . LEU C 1 120 ? 34.685  19.171  49.988  1.00 38.03  ? 998  LEU C CD1 1 
ATOM   3504 C CD2 . LEU C 1 120 ? 34.994  17.676  48.017  1.00 38.63  ? 998  LEU C CD2 1 
ATOM   3505 N N   . SER C 1 121 ? 33.231  21.750  45.290  1.00 42.18  ? 999  SER C N   1 
ATOM   3506 C CA  . SER C 1 121 ? 32.164  22.277  44.455  1.00 42.89  ? 999  SER C CA  1 
ATOM   3507 C C   . SER C 1 121 ? 32.457  22.256  42.960  1.00 43.30  ? 999  SER C C   1 
ATOM   3508 O O   . SER C 1 121 ? 31.530  22.159  42.147  1.00 42.78  ? 999  SER C O   1 
ATOM   3509 C CB  . SER C 1 121 ? 31.763  23.656  44.899  1.00 45.69  ? 999  SER C CB  1 
ATOM   3510 O OG  . SER C 1 121 ? 32.914  24.434  45.067  1.00 46.97  ? 999  SER C OG  1 
ATOM   3511 N N   . THR C 1 122 ? 33.731  22.354  42.581  1.00 46.73  ? 1000 THR C N   1 
ATOM   3512 C CA  . THR C 1 122 ? 34.050  22.293  41.162  1.00 47.45  ? 1000 THR C CA  1 
ATOM   3513 C C   . THR C 1 122 ? 33.763  20.893  40.611  1.00 48.76  ? 1000 THR C C   1 
ATOM   3514 O O   . THR C 1 122 ? 33.208  20.741  39.501  1.00 48.89  ? 1000 THR C O   1 
ATOM   3515 C CB  . THR C 1 122 ? 35.461  22.706  40.854  1.00 51.43  ? 1000 THR C CB  1 
ATOM   3516 O OG1 . THR C 1 122 ? 35.644  24.070  41.238  1.00 51.45  ? 1000 THR C OG1 1 
ATOM   3517 C CG2 . THR C 1 122 ? 35.676  22.589  39.372  1.00 50.62  ? 1000 THR C CG2 1 
ATOM   3518 N N   . VAL C 1 123 ? 34.128  19.870  41.385  1.00 46.20  ? 1001 VAL C N   1 
ATOM   3519 C CA  . VAL C 1 123 ? 33.870  18.501  40.953  1.00 47.58  ? 1001 VAL C CA  1 
ATOM   3520 C C   . VAL C 1 123 ? 32.381  18.279  40.811  1.00 48.35  ? 1001 VAL C C   1 
ATOM   3521 O O   . VAL C 1 123 ? 31.928  17.621  39.875  1.00 47.94  ? 1001 VAL C O   1 
ATOM   3522 C CB  . VAL C 1 123 ? 34.460  17.468  41.933  1.00 51.44  ? 1001 VAL C CB  1 
ATOM   3523 C CG1 . VAL C 1 123 ? 35.487  18.111  42.814  1.00 50.97  ? 1001 VAL C CG1 1 
ATOM   3524 C CG2 . VAL C 1 123 ? 33.332  16.811  42.777  1.00 51.71  ? 1001 VAL C CG2 1 
ATOM   3525 N N   . LYS C 1 124 ? 31.647  18.784  41.798  1.00 48.72  ? 1002 LYS C N   1 
ATOM   3526 C CA  . LYS C 1 124 ? 30.215  18.618  41.857  1.00 50.45  ? 1002 LYS C CA  1 
ATOM   3527 C C   . LYS C 1 124 ? 29.606  19.262  40.615  1.00 51.87  ? 1002 LYS C C   1 
ATOM   3528 O O   . LYS C 1 124 ? 28.849  18.631  39.881  1.00 52.51  ? 1002 LYS C O   1 
ATOM   3529 C CB  . LYS C 1 124 ? 29.673  19.234  43.136  1.00 51.64  ? 1002 LYS C CB  1 
ATOM   3530 C CG  . LYS C 1 124 ? 28.209  19.003  43.341  1.00 52.33  ? 1002 LYS C CG  1 
ATOM   3531 C CD  . LYS C 1 124 ? 27.968  17.628  43.897  1.00 52.30  ? 1002 LYS C CD  1 
ATOM   3532 C CE  . LYS C 1 124 ? 26.727  17.011  43.307  1.00 53.29  ? 1002 LYS C CE  1 
ATOM   3533 N NZ  . LYS C 1 124 ? 26.953  15.572  42.990  1.00 54.86  ? 1002 LYS C NZ  1 
ATOM   3534 N N   . ALA C 1 125 ? 30.032  20.481  40.318  1.00 54.94  ? 1003 ALA C N   1 
ATOM   3535 C CA  . ALA C 1 125 ? 29.554  21.203  39.152  1.00 56.20  ? 1003 ALA C CA  1 
ATOM   3536 C C   . ALA C 1 125 ? 29.667  20.402  37.882  1.00 57.21  ? 1003 ALA C C   1 
ATOM   3537 O O   . ALA C 1 125 ? 28.692  20.242  37.170  1.00 57.67  ? 1003 ALA C O   1 
ATOM   3538 C CB  . ALA C 1 125 ? 30.299  22.515  39.001  1.00 57.11  ? 1003 ALA C CB  1 
ATOM   3539 N N   . THR C 1 126 ? 30.871  19.939  37.572  1.00 62.67  ? 1004 THR C N   1 
ATOM   3540 C CA  . THR C 1 126 ? 31.093  19.149  36.360  1.00 64.41  ? 1004 THR C CA  1 
ATOM   3541 C C   . THR C 1 126 ? 30.313  17.818  36.391  1.00 65.25  ? 1004 THR C C   1 
ATOM   3542 O O   . THR C 1 126 ? 29.935  17.252  35.355  1.00 64.87  ? 1004 THR C O   1 
ATOM   3543 C CB  . THR C 1 126 ? 32.586  18.899  36.141  1.00 67.52  ? 1004 THR C CB  1 
ATOM   3544 O OG1 . THR C 1 126 ? 32.899  17.567  36.565  1.00 67.62  ? 1004 THR C OG1 1 
ATOM   3545 C CG2 . THR C 1 126 ? 33.408  19.898  36.925  1.00 68.09  ? 1004 THR C CG2 1 
ATOM   3546 N N   . MET C 1 127 ? 30.083  17.315  37.590  1.00 68.91  ? 1005 MET C N   1 
ATOM   3547 C CA  . MET C 1 127 ? 29.342  16.092  37.698  1.00 70.87  ? 1005 MET C CA  1 
ATOM   3548 C C   . MET C 1 127 ? 27.895  16.316  37.310  1.00 71.88  ? 1005 MET C C   1 
ATOM   3549 O O   . MET C 1 127 ? 27.258  15.440  36.725  1.00 71.82  ? 1005 MET C O   1 
ATOM   3550 C CB  . MET C 1 127 ? 29.445  15.548  39.093  1.00 71.18  ? 1005 MET C CB  1 
ATOM   3551 C CG  . MET C 1 127 ? 30.389  14.413  39.122  1.00 73.46  ? 1005 MET C CG  1 
ATOM   3552 S SD  . MET C 1 127 ? 30.402  13.693  40.721  1.00 80.79  ? 1005 MET C SD  1 
ATOM   3553 C CE  . MET C 1 127 ? 32.028  12.982  40.737  1.00 79.53  ? 1005 MET C CE  1 
ATOM   3554 N N   . LEU C 1 128 ? 27.388  17.505  37.623  1.00 78.53  ? 1006 LEU C N   1 
ATOM   3555 C CA  . LEU C 1 128 ? 26.022  17.874  37.280  1.00 79.86  ? 1006 LEU C CA  1 
ATOM   3556 C C   . LEU C 1 128 ? 25.827  17.749  35.779  1.00 81.10  ? 1006 LEU C C   1 
ATOM   3557 O O   . LEU C 1 128 ? 26.664  18.214  34.973  1.00 81.61  ? 1006 LEU C O   1 
ATOM   3558 C CB  . LEU C 1 128 ? 25.702  19.306  37.715  1.00 79.85  ? 1006 LEU C CB  1 
ATOM   3559 C CG  . LEU C 1 128 ? 25.715  19.663  39.206  1.00 80.55  ? 1006 LEU C CG  1 
ATOM   3560 C CD1 . LEU C 1 128 ? 24.726  20.776  39.491  1.00 80.01  ? 1006 LEU C CD1 1 
ATOM   3561 C CD2 . LEU C 1 128 ? 25.449  18.450  40.110  1.00 80.12  ? 1006 LEU C CD2 1 
ATOM   3562 N N   . GLY C 1 129 ? 24.718  17.110  35.415  1.00 87.87  ? 1007 GLY C N   1 
ATOM   3563 C CA  . GLY C 1 129 ? 24.353  16.856  34.029  1.00 89.26  ? 1007 GLY C CA  1 
ATOM   3564 C C   . GLY C 1 129 ? 24.761  15.464  33.570  1.00 90.08  ? 1007 GLY C C   1 
ATOM   3565 O O   . GLY C 1 129 ? 24.020  14.777  32.857  1.00 90.14  ? 1007 GLY C O   1 
ATOM   3566 N N   . ARG C 1 130 ? 25.950  15.045  33.988  1.00 92.80  ? 1008 ARG C N   1 
ATOM   3567 C CA  . ARG C 1 130 ? 26.445  13.737  33.625  1.00 93.04  ? 1008 ARG C CA  1 
ATOM   3568 C C   . ARG C 1 130 ? 25.449  12.609  33.888  1.00 92.99  ? 1008 ARG C C   1 
ATOM   3569 O O   . ARG C 1 130 ? 24.674  12.633  34.853  1.00 93.02  ? 1008 ARG C O   1 
ATOM   3570 C CB  . ARG C 1 130 ? 27.789  13.455  34.279  1.00 97.17  ? 1008 ARG C CB  1 
ATOM   3571 C CG  . ARG C 1 130 ? 28.918  13.460  33.289  1.00 98.53  ? 1008 ARG C CG  1 
ATOM   3572 C CD  . ARG C 1 130 ? 28.910  14.737  32.463  1.00 100.65 ? 1008 ARG C CD  1 
ATOM   3573 N NE  . ARG C 1 130 ? 30.130  15.529  32.627  1.00 103.18 ? 1008 ARG C NE  1 
ATOM   3574 C CZ  . ARG C 1 130 ? 31.362  15.024  32.741  1.00 104.25 ? 1008 ARG C CZ  1 
ATOM   3575 N NH1 . ARG C 1 130 ? 31.570  13.703  32.714  1.00 105.49 ? 1008 ARG C NH1 1 
ATOM   3576 N NH2 . ARG C 1 130 ? 32.397  15.852  32.881  1.00 103.92 ? 1008 ARG C NH2 1 
ATOM   3577 N N   . THR C 1 131 ? 25.483  11.626  32.992  1.00 92.85  ? 1009 THR C N   1 
ATOM   3578 C CA  . THR C 1 131 ? 24.616  10.452  33.052  1.00 92.53  ? 1009 THR C CA  1 
ATOM   3579 C C   . THR C 1 131 ? 25.507  9.220   33.173  1.00 91.98  ? 1009 THR C C   1 
ATOM   3580 O O   . THR C 1 131 ? 25.082  8.184   33.679  1.00 92.15  ? 1009 THR C O   1 
ATOM   3581 C CB  . THR C 1 131 ? 23.657  10.365  31.803  1.00 97.98  ? 1009 THR C CB  1 
ATOM   3582 O OG1 . THR C 1 131 ? 24.419  10.332  30.583  1.00 97.02  ? 1009 THR C OG1 1 
ATOM   3583 C CG2 . THR C 1 131 ? 22.695  11.565  31.772  1.00 97.66  ? 1009 THR C CG2 1 
ATOM   3584 N N   . ASN C 1 132 ? 26.751  9.362   32.724  1.00 89.93  ? 1010 ASN C N   1 
ATOM   3585 C CA  . ASN C 1 132 ? 27.722  8.284   32.766  1.00 89.26  ? 1010 ASN C CA  1 
ATOM   3586 C C   . ASN C 1 132 ? 28.329  8.134   34.150  1.00 88.77  ? 1010 ASN C C   1 
ATOM   3587 O O   . ASN C 1 132 ? 28.783  7.058   34.507  1.00 88.39  ? 1010 ASN C O   1 
ATOM   3588 C CB  . ASN C 1 132 ? 28.825  8.533   31.752  1.00 92.61  ? 1010 ASN C CB  1 
ATOM   3589 C CG  . ASN C 1 132 ? 29.093  10.008  31.545  1.00 93.11  ? 1010 ASN C CG  1 
ATOM   3590 O OD1 . ASN C 1 132 ? 29.866  10.623  32.286  1.00 93.39  ? 1010 ASN C OD1 1 
ATOM   3591 N ND2 . ASN C 1 132 ? 28.432  10.595  30.555  1.00 94.57  ? 1010 ASN C ND2 1 
ATOM   3592 N N   . ILE C 1 133 ? 28.343  9.204   34.935  1.00 88.15  ? 1011 ILE C N   1 
ATOM   3593 C CA  . ILE C 1 133 ? 28.902  9.101   36.273  1.00 87.44  ? 1011 ILE C CA  1 
ATOM   3594 C C   . ILE C 1 133 ? 28.045  8.201   37.146  1.00 87.14  ? 1011 ILE C C   1 
ATOM   3595 O O   . ILE C 1 133 ? 26.808  8.272   37.119  1.00 86.81  ? 1011 ILE C O   1 
ATOM   3596 C CB  . ILE C 1 133 ? 29.170  10.466  36.939  1.00 90.93  ? 1011 ILE C CB  1 
ATOM   3597 C CG1 . ILE C 1 133 ? 30.521  11.023  36.479  1.00 89.71  ? 1011 ILE C CG1 1 
ATOM   3598 C CG2 . ILE C 1 133 ? 29.179  10.303  38.470  1.00 90.31  ? 1011 ILE C CG2 1 
ATOM   3599 C CD1 . ILE C 1 133 ? 30.407  12.149  35.500  1.00 88.39  ? 1011 ILE C CD1 1 
ATOM   3600 N N   . SER C 1 134 ? 28.732  7.363   37.919  1.00 85.56  ? 1012 SER C N   1 
ATOM   3601 C CA  . SER C 1 134 ? 28.113  6.385   38.797  1.00 84.82  ? 1012 SER C CA  1 
ATOM   3602 C C   . SER C 1 134 ? 27.252  6.956   39.913  1.00 84.66  ? 1012 SER C C   1 
ATOM   3603 O O   . SER C 1 134 ? 27.476  8.061   40.397  1.00 84.51  ? 1012 SER C O   1 
ATOM   3604 C CB  . SER C 1 134 ? 29.185  5.493   39.406  1.00 88.08  ? 1012 SER C CB  1 
ATOM   3605 O OG  . SER C 1 134 ? 29.214  5.643   40.812  1.00 87.04  ? 1012 SER C OG  1 
ATOM   3606 N N   . ASP C 1 135 ? 26.292  6.158   40.351  1.00 82.75  ? 1013 ASP C N   1 
ATOM   3607 C CA  . ASP C 1 135 ? 25.408  6.545   41.429  1.00 82.48  ? 1013 ASP C CA  1 
ATOM   3608 C C   . ASP C 1 135 ? 26.246  6.846   42.647  1.00 82.15  ? 1013 ASP C C   1 
ATOM   3609 O O   . ASP C 1 135 ? 26.143  7.910   43.241  1.00 81.91  ? 1013 ASP C O   1 
ATOM   3610 C CB  . ASP C 1 135 ? 24.456  5.387   41.774  1.00 86.18  ? 1013 ASP C CB  1 
ATOM   3611 C CG  . ASP C 1 135 ? 23.465  5.063   40.642  1.00 86.58  ? 1013 ASP C CG  1 
ATOM   3612 O OD1 . ASP C 1 135 ? 23.271  3.844   40.330  1.00 85.96  ? 1013 ASP C OD1 1 
ATOM   3613 O OD2 . ASP C 1 135 ? 22.867  6.034   40.100  1.00 86.38  ? 1013 ASP C OD2 1 
ATOM   3614 N N   . GLU C 1 136 ? 27.042  5.874   43.056  1.00 78.51  ? 1014 GLU C N   1 
ATOM   3615 C CA  . GLU C 1 136 ? 27.834  6.030   44.259  1.00 79.13  ? 1014 GLU C CA  1 
ATOM   3616 C C   . GLU C 1 136 ? 28.765  7.219   44.203  1.00 78.86  ? 1014 GLU C C   1 
ATOM   3617 O O   . GLU C 1 136 ? 28.993  7.872   45.217  1.00 79.68  ? 1014 GLU C O   1 
ATOM   3618 C CB  . GLU C 1 136 ? 28.599  4.750   44.589  1.00 81.07  ? 1014 GLU C CB  1 
ATOM   3619 C CG  . GLU C 1 136 ? 27.858  3.791   45.563  1.00 83.60  ? 1014 GLU C CG  1 
ATOM   3620 C CD  . GLU C 1 136 ? 26.349  4.080   45.710  1.00 85.82  ? 1014 GLU C CD  1 
ATOM   3621 O OE1 . GLU C 1 136 ? 25.993  5.195   46.170  1.00 85.56  ? 1014 GLU C OE1 1 
ATOM   3622 O OE2 . GLU C 1 136 ? 25.527  3.182   45.391  1.00 85.80  ? 1014 GLU C OE2 1 
ATOM   3623 N N   . GLU C 1 137 ? 29.292  7.508   43.017  1.00 74.09  ? 1015 GLU C N   1 
ATOM   3624 C CA  . GLU C 1 137 ? 30.214  8.624   42.841  1.00 73.14  ? 1015 GLU C CA  1 
ATOM   3625 C C   . GLU C 1 137 ? 29.513  9.941   43.107  1.00 72.26  ? 1015 GLU C C   1 
ATOM   3626 O O   . GLU C 1 137 ? 30.026  10.813  43.801  1.00 72.53  ? 1015 GLU C O   1 
ATOM   3627 C CB  . GLU C 1 137 ? 30.795  8.641   41.420  1.00 75.28  ? 1015 GLU C CB  1 
ATOM   3628 C CG  . GLU C 1 137 ? 32.325  8.480   41.344  1.00 77.35  ? 1015 GLU C CG  1 
ATOM   3629 C CD  . GLU C 1 137 ? 32.931  8.879   39.987  1.00 81.06  ? 1015 GLU C CD  1 
ATOM   3630 O OE1 . GLU C 1 137 ? 32.200  8.914   38.961  1.00 82.89  ? 1015 GLU C OE1 1 
ATOM   3631 O OE2 . GLU C 1 137 ? 34.158  9.150   39.946  1.00 81.86  ? 1015 GLU C OE2 1 
ATOM   3632 N N   . SER C 1 138 ? 28.341  10.107  42.528  1.00 67.52  ? 1016 SER C N   1 
ATOM   3633 C CA  . SER C 1 138 ? 27.638  11.356  42.687  1.00 66.40  ? 1016 SER C CA  1 
ATOM   3634 C C   . SER C 1 138 ? 27.178  11.636  44.106  1.00 65.60  ? 1016 SER C C   1 
ATOM   3635 O O   . SER C 1 138 ? 27.343  12.745  44.579  1.00 65.48  ? 1016 SER C O   1 
ATOM   3636 C CB  . SER C 1 138 ? 26.503  11.451  41.683  1.00 69.04  ? 1016 SER C CB  1 
ATOM   3637 O OG  . SER C 1 138 ? 26.411  10.247  40.941  1.00 68.86  ? 1016 SER C OG  1 
ATOM   3638 N N   . GLU C 1 139 ? 26.589  10.659  44.789  1.00 64.75  ? 1017 GLU C N   1 
ATOM   3639 C CA  . GLU C 1 139 ? 26.133  10.946  46.143  1.00 63.76  ? 1017 GLU C CA  1 
ATOM   3640 C C   . GLU C 1 139 ? 27.299  11.170  47.065  1.00 62.67  ? 1017 GLU C C   1 
ATOM   3641 O O   . GLU C 1 139 ? 27.190  11.865  48.071  1.00 62.73  ? 1017 GLU C O   1 
ATOM   3642 C CB  . GLU C 1 139 ? 25.133  9.922   46.717  1.00 67.99  ? 1017 GLU C CB  1 
ATOM   3643 C CG  . GLU C 1 139 ? 24.573  10.276  48.184  1.00 68.85  ? 1017 GLU C CG  1 
ATOM   3644 C CD  . GLU C 1 139 ? 23.742  11.606  48.307  1.00 69.76  ? 1017 GLU C CD  1 
ATOM   3645 O OE1 . GLU C 1 139 ? 23.814  12.261  49.386  1.00 67.97  ? 1017 GLU C OE1 1 
ATOM   3646 O OE2 . GLU C 1 139 ? 22.967  11.944  47.367  1.00 69.49  ? 1017 GLU C OE2 1 
ATOM   3647 N N   . GLN C 1 140 ? 28.439  10.629  46.688  1.00 57.72  ? 1018 GLN C N   1 
ATOM   3648 C CA  . GLN C 1 140 ? 29.629  10.841  47.490  1.00 56.64  ? 1018 GLN C CA  1 
ATOM   3649 C C   . GLN C 1 140 ? 30.217  12.243  47.285  1.00 56.06  ? 1018 GLN C C   1 
ATOM   3650 O O   . GLN C 1 140 ? 30.696  12.856  48.239  1.00 55.94  ? 1018 GLN C O   1 
ATOM   3651 C CB  . GLN C 1 140 ? 30.665  9.766   47.228  1.00 55.63  ? 1018 GLN C CB  1 
ATOM   3652 C CG  . GLN C 1 140 ? 31.672  9.656   48.322  1.00 55.99  ? 1018 GLN C CG  1 
ATOM   3653 C CD  . GLN C 1 140 ? 31.040  9.338   49.648  1.00 56.56  ? 1018 GLN C CD  1 
ATOM   3654 O OE1 . GLN C 1 140 ? 31.438  9.890   50.676  1.00 55.93  ? 1018 GLN C OE1 1 
ATOM   3655 N NE2 . GLN C 1 140 ? 30.049  8.445   49.640  1.00 53.97  ? 1018 GLN C NE2 1 
ATOM   3656 N N   . ALA C 1 141 ? 30.149  12.762  46.057  1.00 55.18  ? 1019 ALA C N   1 
ATOM   3657 C CA  . ALA C 1 141 ? 30.635  14.102  45.785  1.00 54.96  ? 1019 ALA C CA  1 
ATOM   3658 C C   . ALA C 1 141 ? 29.816  15.054  46.662  1.00 54.99  ? 1019 ALA C C   1 
ATOM   3659 O O   . ALA C 1 141 ? 30.362  15.822  47.456  1.00 55.30  ? 1019 ALA C O   1 
ATOM   3660 C CB  . ALA C 1 141 ? 30.476  14.428  44.331  1.00 55.32  ? 1019 ALA C CB  1 
ATOM   3661 N N   . THR C 1 142 ? 28.497  14.926  46.578  1.00 53.48  ? 1020 THR C N   1 
ATOM   3662 C CA  . THR C 1 142 ? 27.553  15.685  47.385  1.00 52.70  ? 1020 THR C CA  1 
ATOM   3663 C C   . THR C 1 142 ? 27.829  15.571  48.898  1.00 51.87  ? 1020 THR C C   1 
ATOM   3664 O O   . THR C 1 142 ? 27.755  16.551  49.631  1.00 51.46  ? 1020 THR C O   1 
ATOM   3665 C CB  . THR C 1 142 ? 26.138  15.178  47.092  1.00 50.19  ? 1020 THR C CB  1 
ATOM   3666 O OG1 . THR C 1 142 ? 25.695  15.626  45.794  1.00 51.07  ? 1020 THR C OG1 1 
ATOM   3667 C CG2 . THR C 1 142 ? 25.175  15.605  48.195  1.00 50.21  ? 1020 THR C CG2 1 
ATOM   3668 N N   . GLU C 1 143 ? 28.118  14.375  49.386  1.00 52.40  ? 1021 GLU C N   1 
ATOM   3669 C CA  . GLU C 1 143 ? 28.324  14.242  50.814  1.00 52.18  ? 1021 GLU C CA  1 
ATOM   3670 C C   . GLU C 1 143 ? 29.583  14.852  51.366  1.00 51.19  ? 1021 GLU C C   1 
ATOM   3671 O O   . GLU C 1 143 ? 29.649  15.151  52.555  1.00 50.74  ? 1021 GLU C O   1 
ATOM   3672 C CB  . GLU C 1 143 ? 28.107  12.824  51.304  1.00 55.50  ? 1021 GLU C CB  1 
ATOM   3673 C CG  . GLU C 1 143 ? 26.646  12.414  51.251  1.00 58.47  ? 1021 GLU C CG  1 
ATOM   3674 C CD  . GLU C 1 143 ? 26.389  11.045  51.886  1.00 65.03  ? 1021 GLU C CD  1 
ATOM   3675 O OE1 . GLU C 1 143 ? 26.366  10.015  51.143  1.00 65.89  ? 1021 GLU C OE1 1 
ATOM   3676 O OE2 . GLU C 1 143 ? 26.191  11.004  53.136  1.00 68.13  ? 1021 GLU C OE2 1 
ATOM   3677 N N   . MET C 1 144 ? 30.575  15.064  50.506  1.00 48.85  ? 1022 MET C N   1 
ATOM   3678 C CA  . MET C 1 144 ? 31.822  15.689  50.945  1.00 47.54  ? 1022 MET C CA  1 
ATOM   3679 C C   . MET C 1 144 ? 31.619  17.194  50.946  1.00 46.60  ? 1022 MET C C   1 
ATOM   3680 O O   . MET C 1 144 ? 32.371  17.947  51.587  1.00 46.55  ? 1022 MET C O   1 
ATOM   3681 C CB  . MET C 1 144 ? 32.981  15.381  50.013  1.00 50.03  ? 1022 MET C CB  1 
ATOM   3682 C CG  . MET C 1 144 ? 33.036  14.022  49.368  1.00 52.32  ? 1022 MET C CG  1 
ATOM   3683 S SD  . MET C 1 144 ? 34.745  13.789  48.673  1.00 54.76  ? 1022 MET C SD  1 
ATOM   3684 C CE  . MET C 1 144 ? 34.390  13.336  46.999  1.00 56.64  ? 1022 MET C CE  1 
ATOM   3685 N N   . LEU C 1 145 ? 30.650  17.620  50.140  1.00 44.01  ? 1023 LEU C N   1 
ATOM   3686 C CA  . LEU C 1 145 ? 30.277  19.014  50.067  1.00 43.23  ? 1023 LEU C CA  1 
ATOM   3687 C C   . LEU C 1 145 ? 29.597  19.333  51.419  1.00 43.62  ? 1023 LEU C C   1 
ATOM   3688 O O   . LEU C 1 145 ? 30.102  20.109  52.233  1.00 43.99  ? 1023 LEU C O   1 
ATOM   3689 C CB  . LEU C 1 145 ? 29.281  19.189  48.935  1.00 42.49  ? 1023 LEU C CB  1 
ATOM   3690 C CG  . LEU C 1 145 ? 29.442  20.482  48.147  1.00 41.70  ? 1023 LEU C CG  1 
ATOM   3691 C CD1 . LEU C 1 145 ? 30.683  21.254  48.661  1.00 39.71  ? 1023 LEU C CD1 1 
ATOM   3692 C CD2 . LEU C 1 145 ? 29.515  20.190  46.634  1.00 42.23  ? 1023 LEU C CD2 1 
ATOM   3693 N N   . VAL C 1 146 ? 28.473  18.673  51.676  1.00 43.07  ? 1024 VAL C N   1 
ATOM   3694 C CA  . VAL C 1 146 ? 27.777  18.831  52.935  1.00 43.51  ? 1024 VAL C CA  1 
ATOM   3695 C C   . VAL C 1 146 ? 28.674  18.754  54.158  1.00 44.08  ? 1024 VAL C C   1 
ATOM   3696 O O   . VAL C 1 146 ? 28.430  19.397  55.159  1.00 44.00  ? 1024 VAL C O   1 
ATOM   3697 C CB  . VAL C 1 146 ? 26.761  17.755  53.074  1.00 45.51  ? 1024 VAL C CB  1 
ATOM   3698 C CG1 . VAL C 1 146 ? 26.117  17.864  54.441  1.00 43.84  ? 1024 VAL C CG1 1 
ATOM   3699 C CG2 . VAL C 1 146 ? 25.787  17.806  51.906  1.00 45.49  ? 1024 VAL C CG2 1 
ATOM   3700 N N   . HIS C 1 147 ? 29.663  17.885  54.116  1.00 48.03  ? 1025 HIS C N   1 
ATOM   3701 C CA  . HIS C 1 147 ? 30.515  17.719  55.263  1.00 48.98  ? 1025 HIS C CA  1 
ATOM   3702 C C   . HIS C 1 147 ? 31.381  18.932  55.446  1.00 48.56  ? 1025 HIS C C   1 
ATOM   3703 O O   . HIS C 1 147 ? 31.552  19.406  56.548  1.00 48.73  ? 1025 HIS C O   1 
ATOM   3704 C CB  . HIS C 1 147 ? 31.392  16.494  55.091  1.00 52.12  ? 1025 HIS C CB  1 
ATOM   3705 C CG  . HIS C 1 147 ? 32.309  16.255  56.246  1.00 55.07  ? 1025 HIS C CG  1 
ATOM   3706 N ND1 . HIS C 1 147 ? 31.916  15.573  57.378  1.00 57.90  ? 1025 HIS C ND1 1 
ATOM   3707 C CD2 . HIS C 1 147 ? 33.586  16.648  56.466  1.00 56.87  ? 1025 HIS C CD2 1 
ATOM   3708 C CE1 . HIS C 1 147 ? 32.918  15.545  58.241  1.00 58.49  ? 1025 HIS C CE1 1 
ATOM   3709 N NE2 . HIS C 1 147 ? 33.941  16.197  57.715  1.00 58.03  ? 1025 HIS C NE2 1 
ATOM   3710 N N   . ASN C 1 148 ? 31.966  19.402  54.352  1.00 48.27  ? 1026 ASN C N   1 
ATOM   3711 C CA  . ASN C 1 148 ? 32.850  20.566  54.350  1.00 47.86  ? 1026 ASN C CA  1 
ATOM   3712 C C   . ASN C 1 148 ? 32.047  21.813  54.739  1.00 47.19  ? 1026 ASN C C   1 
ATOM   3713 O O   . ASN C 1 148 ? 32.523  22.671  55.461  1.00 47.33  ? 1026 ASN C O   1 
ATOM   3714 C CB  . ASN C 1 148 ? 33.404  20.724  52.941  1.00 56.31  ? 1026 ASN C CB  1 
ATOM   3715 C CG  . ASN C 1 148 ? 34.779  21.316  52.917  1.00 59.46  ? 1026 ASN C CG  1 
ATOM   3716 O OD1 . ASN C 1 148 ? 34.920  22.536  52.979  1.00 62.69  ? 1026 ASN C OD1 1 
ATOM   3717 N ND2 . ASN C 1 148 ? 35.800  20.478  52.710  1.00 61.40  ? 1026 ASN C ND2 1 
ATOM   3718 N N   . ALA C 1 149 ? 30.803  21.884  54.277  1.00 43.72  ? 1027 ALA C N   1 
ATOM   3719 C CA  . ALA C 1 149 ? 29.895  22.980  54.584  1.00 43.26  ? 1027 ALA C CA  1 
ATOM   3720 C C   . ALA C 1 149 ? 29.578  22.974  56.074  1.00 43.20  ? 1027 ALA C C   1 
ATOM   3721 O O   . ALA C 1 149 ? 29.666  23.995  56.751  1.00 43.62  ? 1027 ALA C O   1 
ATOM   3722 C CB  . ALA C 1 149 ? 28.625  22.852  53.750  1.00 43.27  ? 1027 ALA C CB  1 
ATOM   3723 N N   . GLN C 1 150 ? 29.239  21.810  56.602  1.00 42.42  ? 1028 GLN C N   1 
ATOM   3724 C CA  . GLN C 1 150 ? 28.977  21.696  58.034  1.00 42.62  ? 1028 GLN C CA  1 
ATOM   3725 C C   . GLN C 1 150 ? 30.128  22.278  58.882  1.00 42.59  ? 1028 GLN C C   1 
ATOM   3726 O O   . GLN C 1 150 ? 29.923  23.036  59.828  1.00 41.75  ? 1028 GLN C O   1 
ATOM   3727 C CB  . GLN C 1 150 ? 28.796  20.222  58.404  1.00 43.36  ? 1028 GLN C CB  1 
ATOM   3728 C CG  . GLN C 1 150 ? 27.435  19.663  58.072  1.00 42.98  ? 1028 GLN C CG  1 
ATOM   3729 C CD  . GLN C 1 150 ? 27.444  18.164  57.971  1.00 43.24  ? 1028 GLN C CD  1 
ATOM   3730 O OE1 . GLN C 1 150 ? 28.506  17.545  57.942  1.00 44.92  ? 1028 GLN C OE1 1 
ATOM   3731 N NE2 . GLN C 1 150 ? 26.265  17.566  57.910  1.00 42.89  ? 1028 GLN C NE2 1 
ATOM   3732 N N   . ASN C 1 151 ? 31.340  21.866  58.548  1.00 43.97  ? 1029 ASN C N   1 
ATOM   3733 C CA  . ASN C 1 151 ? 32.536  22.274  59.266  1.00 44.93  ? 1029 ASN C CA  1 
ATOM   3734 C C   . ASN C 1 151 ? 32.898  23.742  59.022  1.00 44.97  ? 1029 ASN C C   1 
ATOM   3735 O O   . ASN C 1 151 ? 33.372  24.434  59.913  1.00 45.76  ? 1029 ASN C O   1 
ATOM   3736 C CB  . ASN C 1 151 ? 33.685  21.314  58.946  1.00 60.10  ? 1029 ASN C CB  1 
ATOM   3737 C CG  . ASN C 1 151 ? 33.314  19.840  59.232  1.00 63.44  ? 1029 ASN C CG  1 
ATOM   3738 O OD1 . ASN C 1 151 ? 34.186  18.980  59.356  1.00 67.87  ? 1029 ASN C OD1 1 
ATOM   3739 N ND2 . ASN C 1 151 ? 32.014  19.563  59.387  1.00 63.99  ? 1029 ASN C ND2 1 
ATOM   3740 N N   . LEU C 1 152 ? 32.602  24.246  57.840  1.00 42.07  ? 1030 LEU C N   1 
ATOM   3741 C CA  . LEU C 1 152 ? 32.855  25.636  57.577  1.00 41.35  ? 1030 LEU C CA  1 
ATOM   3742 C C   . LEU C 1 152 ? 31.965  26.452  58.508  1.00 41.58  ? 1030 LEU C C   1 
ATOM   3743 O O   . LEU C 1 152 ? 32.423  27.366  59.208  1.00 42.09  ? 1030 LEU C O   1 
ATOM   3744 C CB  . LEU C 1 152 ? 32.507  25.969  56.132  1.00 39.92  ? 1030 LEU C CB  1 
ATOM   3745 C CG  . LEU C 1 152 ? 32.810  27.431  55.847  1.00 37.97  ? 1030 LEU C CG  1 
ATOM   3746 C CD1 . LEU C 1 152 ? 34.217  27.789  56.379  1.00 35.48  ? 1030 LEU C CD1 1 
ATOM   3747 C CD2 . LEU C 1 152 ? 32.639  27.707  54.351  1.00 35.81  ? 1030 LEU C CD2 1 
ATOM   3748 N N   . MET C 1 153 ? 30.677  26.155  58.488  1.00 45.83  ? 1031 MET C N   1 
ATOM   3749 C CA  . MET C 1 153 ? 29.762  26.904  59.328  1.00 46.05  ? 1031 MET C CA  1 
ATOM   3750 C C   . MET C 1 153 ? 30.216  26.771  60.781  1.00 45.81  ? 1031 MET C C   1 
ATOM   3751 O O   . MET C 1 153 ? 30.350  27.767  61.474  1.00 45.88  ? 1031 MET C O   1 
ATOM   3752 C CB  . MET C 1 153 ? 28.309  26.423  59.157  1.00 49.30  ? 1031 MET C CB  1 
ATOM   3753 C CG  . MET C 1 153 ? 27.797  26.384  57.705  1.00 51.22  ? 1031 MET C CG  1 
ATOM   3754 S SD  . MET C 1 153 ? 27.464  28.044  57.031  1.00 56.25  ? 1031 MET C SD  1 
ATOM   3755 C CE  . MET C 1 153 ? 28.845  28.223  55.819  1.00 51.75  ? 1031 MET C CE  1 
ATOM   3756 N N   . GLN C 1 154 ? 30.501  25.552  61.228  1.00 47.87  ? 1032 GLN C N   1 
ATOM   3757 C CA  . GLN C 1 154 ? 30.943  25.343  62.599  1.00 48.24  ? 1032 GLN C CA  1 
ATOM   3758 C C   . GLN C 1 154 ? 32.100  26.247  62.992  1.00 47.71  ? 1032 GLN C C   1 
ATOM   3759 O O   . GLN C 1 154 ? 32.083  26.891  64.059  1.00 47.20  ? 1032 GLN C O   1 
ATOM   3760 C CB  . GLN C 1 154 ? 31.313  23.889  62.836  1.00 51.41  ? 1032 GLN C CB  1 
ATOM   3761 C CG  . GLN C 1 154 ? 30.375  23.223  63.806  1.00 53.87  ? 1032 GLN C CG  1 
ATOM   3762 C CD  . GLN C 1 154 ? 30.596  23.725  65.211  1.00 54.95  ? 1032 GLN C CD  1 
ATOM   3763 O OE1 . GLN C 1 154 ? 29.679  24.259  65.847  1.00 54.91  ? 1032 GLN C OE1 1 
ATOM   3764 N NE2 . GLN C 1 154 ? 31.823  23.555  65.711  1.00 56.22  ? 1032 GLN C NE2 1 
ATOM   3765 N N   . SER C 1 155 ? 33.090  26.328  62.110  1.00 46.87  ? 1033 SER C N   1 
ATOM   3766 C CA  . SER C 1 155 ? 34.246  27.172  62.354  1.00 46.12  ? 1033 SER C CA  1 
ATOM   3767 C C   . SER C 1 155 ? 33.880  28.662  62.410  1.00 46.69  ? 1033 SER C C   1 
ATOM   3768 O O   . SER C 1 155 ? 34.304  29.390  63.313  1.00 46.37  ? 1033 SER C O   1 
ATOM   3769 C CB  . SER C 1 155 ? 35.340  26.900  61.327  1.00 50.55  ? 1033 SER C CB  1 
ATOM   3770 O OG  . SER C 1 155 ? 35.765  25.556  61.405  1.00 48.92  ? 1033 SER C OG  1 
ATOM   3771 N N   . VAL C 1 156 ? 33.085  29.124  61.453  1.00 43.85  ? 1034 VAL C N   1 
ATOM   3772 C CA  . VAL C 1 156 ? 32.702  30.536  61.453  1.00 44.22  ? 1034 VAL C CA  1 
ATOM   3773 C C   . VAL C 1 156 ? 32.012  30.930  62.755  1.00 44.40  ? 1034 VAL C C   1 
ATOM   3774 O O   . VAL C 1 156 ? 32.329  31.959  63.342  1.00 44.16  ? 1034 VAL C O   1 
ATOM   3775 C CB  . VAL C 1 156 ? 31.891  30.894  60.215  1.00 46.29  ? 1034 VAL C CB  1 
ATOM   3776 C CG1 . VAL C 1 156 ? 31.688  32.361  60.128  1.00 47.15  ? 1034 VAL C CG1 1 
ATOM   3777 C CG2 . VAL C 1 156 ? 32.628  30.422  59.004  1.00 45.39  ? 1034 VAL C CG2 1 
ATOM   3778 N N   . LYS C 1 157 ? 31.117  30.070  63.233  1.00 48.63  ? 1035 LYS C N   1 
ATOM   3779 C CA  . LYS C 1 157 ? 30.420  30.329  64.474  1.00 49.55  ? 1035 LYS C CA  1 
ATOM   3780 C C   . LYS C 1 157 ? 31.304  30.146  65.714  1.00 50.55  ? 1035 LYS C C   1 
ATOM   3781 O O   . LYS C 1 157 ? 31.147  30.837  66.716  1.00 50.83  ? 1035 LYS C O   1 
ATOM   3782 C CB  . LYS C 1 157 ? 29.103  29.574  64.544  1.00 52.78  ? 1035 LYS C CB  1 
ATOM   3783 C CG  . LYS C 1 157 ? 29.082  28.421  65.476  1.00 53.51  ? 1035 LYS C CG  1 
ATOM   3784 C CD  . LYS C 1 157 ? 27.811  27.581  65.276  1.00 55.16  ? 1035 LYS C CD  1 
ATOM   3785 C CE  . LYS C 1 157 ? 27.327  26.983  66.609  1.00 55.67  ? 1035 LYS C CE  1 
ATOM   3786 N NZ  . LYS C 1 157 ? 25.883  27.246  66.889  1.00 56.12  ? 1035 LYS C NZ  1 
ATOM   3787 N N   . GLU C 1 158 ? 32.299  29.280  65.645  1.00 52.63  ? 1036 GLU C N   1 
ATOM   3788 C CA  . GLU C 1 158 ? 33.203  29.171  66.786  1.00 53.69  ? 1036 GLU C CA  1 
ATOM   3789 C C   . GLU C 1 158 ? 34.079  30.439  66.892  1.00 53.47  ? 1036 GLU C C   1 
ATOM   3790 O O   . GLU C 1 158 ? 34.587  30.775  67.952  1.00 53.68  ? 1036 GLU C O   1 
ATOM   3791 C CB  . GLU C 1 158 ? 34.098  27.946  66.618  1.00 56.54  ? 1036 GLU C CB  1 
ATOM   3792 C CG  . GLU C 1 158 ? 33.908  26.879  67.688  1.00 60.59  ? 1036 GLU C CG  1 
ATOM   3793 C CD  . GLU C 1 158 ? 33.524  25.491  67.113  1.00 65.93  ? 1036 GLU C CD  1 
ATOM   3794 O OE1 . GLU C 1 158 ? 34.433  24.775  66.589  1.00 68.20  ? 1036 GLU C OE1 1 
ATOM   3795 O OE2 . GLU C 1 158 ? 32.326  25.101  67.244  1.00 65.25  ? 1036 GLU C OE2 1 
ATOM   3796 N N   . THR C 1 159 ? 34.274  31.117  65.766  1.00 49.53  ? 1037 THR C N   1 
ATOM   3797 C CA  . THR C 1 159 ? 35.115  32.312  65.687  1.00 49.20  ? 1037 THR C CA  1 
ATOM   3798 C C   . THR C 1 159 ? 34.359  33.489  66.250  1.00 49.17  ? 1037 THR C C   1 
ATOM   3799 O O   . THR C 1 159 ? 34.862  34.240  67.062  1.00 48.66  ? 1037 THR C O   1 
ATOM   3800 C CB  . THR C 1 159 ? 35.483  32.614  64.214  1.00 52.37  ? 1037 THR C CB  1 
ATOM   3801 O OG1 . THR C 1 159 ? 36.602  31.810  63.803  1.00 52.43  ? 1037 THR C OG1 1 
ATOM   3802 C CG2 . THR C 1 159 ? 35.808  34.080  64.023  1.00 51.74  ? 1037 THR C CG2 1 
ATOM   3803 N N   . VAL C 1 160 ? 33.146  33.649  65.763  1.00 51.64  ? 1038 VAL C N   1 
ATOM   3804 C CA  . VAL C 1 160 ? 32.252  34.681  66.228  1.00 52.93  ? 1038 VAL C CA  1 
ATOM   3805 C C   . VAL C 1 160 ? 32.207  34.664  67.748  1.00 54.23  ? 1038 VAL C C   1 
ATOM   3806 O O   . VAL C 1 160 ? 32.264  35.715  68.374  1.00 53.93  ? 1038 VAL C O   1 
ATOM   3807 C CB  . VAL C 1 160 ? 30.832  34.439  65.689  1.00 56.47  ? 1038 VAL C CB  1 
ATOM   3808 C CG1 . VAL C 1 160 ? 29.821  35.179  66.520  1.00 56.16  ? 1038 VAL C CG1 1 
ATOM   3809 C CG2 . VAL C 1 160 ? 30.740  34.848  64.244  1.00 55.21  ? 1038 VAL C CG2 1 
ATOM   3810 N N   . ARG C 1 161 ? 32.075  33.477  68.337  1.00 56.65  ? 1039 ARG C N   1 
ATOM   3811 C CA  . ARG C 1 161 ? 32.005  33.338  69.794  1.00 57.89  ? 1039 ARG C CA  1 
ATOM   3812 C C   . ARG C 1 161 ? 33.304  33.693  70.492  1.00 58.35  ? 1039 ARG C C   1 
ATOM   3813 O O   . ARG C 1 161 ? 33.309  34.450  71.477  1.00 58.46  ? 1039 ARG C O   1 
ATOM   3814 C CB  . ARG C 1 161 ? 31.572  31.921  70.177  1.00 62.46  ? 1039 ARG C CB  1 
ATOM   3815 C CG  . ARG C 1 161 ? 30.239  31.511  69.551  1.00 64.41  ? 1039 ARG C CG  1 
ATOM   3816 C CD  . ARG C 1 161 ? 29.553  30.478  70.386  1.00 67.30  ? 1039 ARG C CD  1 
ATOM   3817 N NE  . ARG C 1 161 ? 30.152  29.181  70.124  1.00 71.65  ? 1039 ARG C NE  1 
ATOM   3818 C CZ  . ARG C 1 161 ? 29.470  28.063  69.878  1.00 73.67  ? 1039 ARG C CZ  1 
ATOM   3819 N NH1 . ARG C 1 161 ? 28.126  28.066  69.889  1.00 74.57  ? 1039 ARG C NH1 1 
ATOM   3820 N NH2 . ARG C 1 161 ? 30.142  26.938  69.624  1.00 72.82  ? 1039 ARG C NH2 1 
ATOM   3821 N N   . GLU C 1 162 ? 34.401  33.145  69.981  1.00 57.90  ? 1040 GLU C N   1 
ATOM   3822 C CA  . GLU C 1 162 ? 35.702  33.400  70.573  1.00 58.93  ? 1040 GLU C CA  1 
ATOM   3823 C C   . GLU C 1 162 ? 36.191  34.821  70.333  1.00 59.15  ? 1040 GLU C C   1 
ATOM   3824 O O   . GLU C 1 162 ? 37.009  35.343  71.093  1.00 59.67  ? 1040 GLU C O   1 
ATOM   3825 C CB  . GLU C 1 162 ? 36.731  32.369  70.117  1.00 62.16  ? 1040 GLU C CB  1 
ATOM   3826 C CG  . GLU C 1 162 ? 36.785  31.118  70.994  1.00 65.15  ? 1040 GLU C CG  1 
ATOM   3827 C CD  . GLU C 1 162 ? 37.304  31.376  72.449  1.00 70.81  ? 1040 GLU C CD  1 
ATOM   3828 O OE1 . GLU C 1 162 ? 36.827  30.678  73.395  1.00 71.11  ? 1040 GLU C OE1 1 
ATOM   3829 O OE2 . GLU C 1 162 ? 38.221  32.229  72.645  1.00 74.43  ? 1040 GLU C OE2 1 
ATOM   3830 N N   . ALA C 1 163 ? 35.688  35.445  69.278  1.00 54.11  ? 1041 ALA C N   1 
ATOM   3831 C CA  . ALA C 1 163 ? 36.087  36.806  68.935  1.00 53.87  ? 1041 ALA C CA  1 
ATOM   3832 C C   . ALA C 1 163 ? 35.405  37.761  69.884  1.00 54.07  ? 1041 ALA C C   1 
ATOM   3833 O O   . ALA C 1 163 ? 35.923  38.814  70.208  1.00 53.78  ? 1041 ALA C O   1 
ATOM   3834 C CB  . ALA C 1 163 ? 35.668  37.130  67.496  1.00 54.58  ? 1041 ALA C CB  1 
ATOM   3835 N N   . GLU C 1 164 ? 34.193  37.413  70.264  1.00 52.10  ? 1042 GLU C N   1 
ATOM   3836 C CA  . GLU C 1 164 ? 33.430  38.273  71.125  1.00 52.74  ? 1042 GLU C CA  1 
ATOM   3837 C C   . GLU C 1 164 ? 34.097  38.202  72.451  1.00 52.90  ? 1042 GLU C C   1 
ATOM   3838 O O   . GLU C 1 164 ? 34.298  39.205  73.093  1.00 52.38  ? 1042 GLU C O   1 
ATOM   3839 C CB  . GLU C 1 164 ? 31.995  37.771  71.218  1.00 55.17  ? 1042 GLU C CB  1 
ATOM   3840 C CG  . GLU C 1 164 ? 31.094  38.663  72.000  1.00 57.59  ? 1042 GLU C CG  1 
ATOM   3841 C CD  . GLU C 1 164 ? 30.920  38.187  73.438  1.00 60.66  ? 1042 GLU C CD  1 
ATOM   3842 O OE1 . GLU C 1 164 ? 29.768  38.151  73.926  1.00 61.26  ? 1042 GLU C OE1 1 
ATOM   3843 O OE2 . GLU C 1 164 ? 31.927  37.817  74.080  1.00 61.46  ? 1042 GLU C OE2 1 
ATOM   3844 N N   . ALA C 1 165 ? 34.454  36.991  72.852  1.00 54.87  ? 1043 ALA C N   1 
ATOM   3845 C CA  . ALA C 1 165 ? 35.101  36.756  74.136  1.00 55.58  ? 1043 ALA C CA  1 
ATOM   3846 C C   . ALA C 1 165 ? 36.372  37.587  74.233  1.00 56.18  ? 1043 ALA C C   1 
ATOM   3847 O O   . ALA C 1 165 ? 36.700  38.130  75.293  1.00 56.67  ? 1043 ALA C O   1 
ATOM   3848 C CB  . ALA C 1 165 ? 35.414  35.277  74.277  1.00 55.71  ? 1043 ALA C CB  1 
ATOM   3849 N N   . ALA C 1 166 ? 37.070  37.682  73.112  1.00 57.85  ? 1044 ALA C N   1 
ATOM   3850 C CA  . ALA C 1 166 ? 38.346  38.371  73.026  1.00 58.93  ? 1044 ALA C CA  1 
ATOM   3851 C C   . ALA C 1 166 ? 38.251  39.865  72.836  1.00 59.71  ? 1044 ALA C C   1 
ATOM   3852 O O   . ALA C 1 166 ? 39.273  40.537  72.668  1.00 60.27  ? 1044 ALA C O   1 
ATOM   3853 C CB  . ALA C 1 166 ? 39.169  37.785  71.894  1.00 60.05  ? 1044 ALA C CB  1 
ATOM   3854 N N   . SER C 1 167 ? 37.032  40.384  72.793  1.00 61.45  ? 1045 SER C N   1 
ATOM   3855 C CA  . SER C 1 167 ? 36.820  41.821  72.568  1.00 61.87  ? 1045 SER C CA  1 
ATOM   3856 C C   . SER C 1 167 ? 36.771  42.547  73.912  1.00 62.29  ? 1045 SER C C   1 
ATOM   3857 O O   . SER C 1 167 ? 37.240  43.697  74.045  1.00 62.25  ? 1045 SER C O   1 
ATOM   3858 C CB  . SER C 1 167 ? 35.498  42.049  71.803  1.00 65.51  ? 1045 SER C CB  1 
ATOM   3859 O OG  . SER C 1 167 ? 35.596  41.724  70.419  1.00 65.12  ? 1045 SER C OG  1 
ATOM   3860 N N   . ILE C 1 168 ? 36.156  41.851  74.878  1.00 67.22  ? 1046 ILE C N   1 
ATOM   3861 C CA  . ILE C 1 168 ? 35.987  42.292  76.270  1.00 67.73  ? 1046 ILE C CA  1 
ATOM   3862 C C   . ILE C 1 168 ? 37.310  42.748  76.926  1.00 67.74  ? 1046 ILE C C   1 
ATOM   3863 O O   . ILE C 1 168 ? 37.574  43.957  77.071  1.00 67.51  ? 1046 ILE C O   1 
ATOM   3864 C CB  . ILE C 1 168 ? 35.260  41.188  77.133  1.00 71.49  ? 1046 ILE C CB  1 
ATOM   3865 C CG1 . ILE C 1 168 ? 34.333  40.319  76.262  1.00 71.35  ? 1046 ILE C CG1 1 
ATOM   3866 C CG2 . ILE C 1 168 ? 34.495  41.831  78.326  1.00 71.59  ? 1046 ILE C CG2 1 
ATOM   3867 C CD1 . ILE C 1 168 ? 34.091  38.899  76.799  1.00 70.99  ? 1046 ILE C CD1 1 
ATOM   3868 N N   . THR C 1 177 ? 38.863  47.044  67.039  1.00 56.23  ? 1055 THR C N   1 
ATOM   3869 C CA  . THR C 1 177 ? 37.740  47.156  67.980  1.00 56.23  ? 1055 THR C CA  1 
ATOM   3870 C C   . THR C 1 177 ? 36.455  46.792  67.240  1.00 55.49  ? 1055 THR C C   1 
ATOM   3871 O O   . THR C 1 177 ? 36.180  47.321  66.177  1.00 55.90  ? 1055 THR C O   1 
ATOM   3872 C CB  . THR C 1 177 ? 37.675  48.581  68.632  1.00 62.73  ? 1055 THR C CB  1 
ATOM   3873 O OG1 . THR C 1 177 ? 38.967  48.945  69.151  1.00 64.16  ? 1055 THR C OG1 1 
ATOM   3874 C CG2 . THR C 1 177 ? 36.600  48.665  69.749  1.00 62.85  ? 1055 THR C CG2 1 
ATOM   3875 N N   . LEU C 1 178 ? 35.694  45.845  67.766  1.00 52.24  ? 1056 LEU C N   1 
ATOM   3876 C CA  . LEU C 1 178 ? 34.482  45.413  67.073  1.00 50.85  ? 1056 LEU C CA  1 
ATOM   3877 C C   . LEU C 1 178 ? 33.289  45.596  67.981  1.00 49.82  ? 1056 LEU C C   1 
ATOM   3878 O O   . LEU C 1 178 ? 33.387  45.376  69.177  1.00 50.07  ? 1056 LEU C O   1 
ATOM   3879 C CB  . LEU C 1 178 ? 34.612  43.951  66.657  1.00 50.93  ? 1056 LEU C CB  1 
ATOM   3880 C CG  . LEU C 1 178 ? 34.838  43.627  65.182  1.00 50.55  ? 1056 LEU C CG  1 
ATOM   3881 C CD1 . LEU C 1 178 ? 34.777  42.104  65.020  1.00 49.62  ? 1056 LEU C CD1 1 
ATOM   3882 C CD2 . LEU C 1 178 ? 33.754  44.317  64.331  1.00 51.21  ? 1056 LEU C CD2 1 
ATOM   3883 N N   . ARG C 1 179 ? 32.171  46.027  67.426  1.00 44.54  ? 1057 ARG C N   1 
ATOM   3884 C CA  . ARG C 1 179 ? 30.987  46.286  68.233  1.00 44.20  ? 1057 ARG C CA  1 
ATOM   3885 C C   . ARG C 1 179 ? 30.080  45.078  68.477  1.00 44.41  ? 1057 ARG C C   1 
ATOM   3886 O O   . ARG C 1 179 ? 29.380  44.545  67.561  1.00 43.99  ? 1057 ARG C O   1 
ATOM   3887 C CB  . ARG C 1 179 ? 30.212  47.521  67.729  1.00 43.48  ? 1057 ARG C CB  1 
ATOM   3888 C CG  . ARG C 1 179 ? 28.913  47.789  68.464  1.00 43.15  ? 1057 ARG C CG  1 
ATOM   3889 C CD  . ARG C 1 179 ? 28.301  49.097  68.016  1.00 42.74  ? 1057 ARG C CD  1 
ATOM   3890 N NE  . ARG C 1 179 ? 26.864  49.202  68.301  1.00 41.79  ? 1057 ARG C NE  1 
ATOM   3891 C CZ  . ARG C 1 179 ? 25.965  48.271  68.011  1.00 39.43  ? 1057 ARG C CZ  1 
ATOM   3892 N NH1 . ARG C 1 179 ? 26.332  47.121  67.451  1.00 38.12  ? 1057 ARG C NH1 1 
ATOM   3893 N NH2 . ARG C 1 179 ? 24.696  48.486  68.312  1.00 39.97  ? 1057 ARG C NH2 1 
ATOM   3894 N N   . TRP C 1 180 ? 30.103  44.664  69.744  1.00 44.31  ? 1058 TRP C N   1 
ATOM   3895 C CA  . TRP C 1 180 ? 29.325  43.523  70.232  1.00 45.09  ? 1058 TRP C CA  1 
ATOM   3896 C C   . TRP C 1 180 ? 28.160  43.977  71.123  1.00 46.25  ? 1058 TRP C C   1 
ATOM   3897 O O   . TRP C 1 180 ? 28.327  44.225  72.318  1.00 46.55  ? 1058 TRP C O   1 
ATOM   3898 C CB  . TRP C 1 180 ? 30.222  42.519  70.974  1.00 43.54  ? 1058 TRP C CB  1 
ATOM   3899 C CG  . TRP C 1 180 ? 31.296  41.903  70.125  1.00 43.27  ? 1058 TRP C CG  1 
ATOM   3900 C CD1 . TRP C 1 180 ? 32.593  42.312  70.012  1.00 43.42  ? 1058 TRP C CD1 1 
ATOM   3901 C CD2 . TRP C 1 180 ? 31.145  40.806  69.219  1.00 43.61  ? 1058 TRP C CD2 1 
ATOM   3902 N NE1 . TRP C 1 180 ? 33.256  41.557  69.071  1.00 43.52  ? 1058 TRP C NE1 1 
ATOM   3903 C CE2 . TRP C 1 180 ? 32.388  40.636  68.555  1.00 42.61  ? 1058 TRP C CE2 1 
ATOM   3904 C CE3 . TRP C 1 180 ? 30.064  39.977  68.868  1.00 44.11  ? 1058 TRP C CE3 1 
ATOM   3905 C CZ2 . TRP C 1 180 ? 32.623  39.585  67.672  1.00 42.34  ? 1058 TRP C CZ2 1 
ATOM   3906 C CZ3 . TRP C 1 180 ? 30.268  38.994  67.919  1.00 45.16  ? 1058 TRP C CZ3 1 
ATOM   3907 C CH2 . TRP C 1 180 ? 31.554  38.778  67.360  1.00 44.66  ? 1058 TRP C CH2 1 
ATOM   3908 N N   . VAL C 1 181 ? 26.977  44.079  70.519  1.00 44.85  ? 1059 VAL C N   1 
ATOM   3909 C CA  . VAL C 1 181 ? 25.765  44.480  71.229  1.00 45.75  ? 1059 VAL C CA  1 
ATOM   3910 C C   . VAL C 1 181 ? 24.702  43.452  70.926  1.00 47.42  ? 1059 VAL C C   1 
ATOM   3911 O O   . VAL C 1 181 ? 24.439  43.179  69.761  1.00 47.83  ? 1059 VAL C O   1 
ATOM   3912 C CB  . VAL C 1 181 ? 25.298  45.856  70.760  1.00 43.80  ? 1059 VAL C CB  1 
ATOM   3913 C CG1 . VAL C 1 181 ? 24.084  46.278  71.518  1.00 42.10  ? 1059 VAL C CG1 1 
ATOM   3914 C CG2 . VAL C 1 181 ? 26.439  46.857  70.865  1.00 43.72  ? 1059 VAL C CG2 1 
ATOM   3915 N N   . ARG C 1 182 ? 24.088  42.876  71.950  1.00 53.04  ? 1060 ARG C N   1 
ATOM   3916 C CA  . ARG C 1 182 ? 23.056  41.888  71.684  1.00 55.46  ? 1060 ARG C CA  1 
ATOM   3917 C C   . ARG C 1 182 ? 21.938  42.514  70.861  1.00 57.19  ? 1060 ARG C C   1 
ATOM   3918 O O   . ARG C 1 182 ? 21.760  43.719  70.859  1.00 57.45  ? 1060 ARG C O   1 
ATOM   3919 C CB  . ARG C 1 182 ? 22.478  41.311  72.979  1.00 58.73  ? 1060 ARG C CB  1 
ATOM   3920 C CG  . ARG C 1 182 ? 23.393  40.320  73.685  1.00 60.14  ? 1060 ARG C CG  1 
ATOM   3921 C CD  . ARG C 1 182 ? 23.732  39.104  72.813  1.00 62.65  ? 1060 ARG C CD  1 
ATOM   3922 N NE  . ARG C 1 182 ? 23.208  37.855  73.376  1.00 62.82  ? 1060 ARG C NE  1 
ATOM   3923 C CZ  . ARG C 1 182 ? 22.021  37.331  73.067  1.00 62.97  ? 1060 ARG C CZ  1 
ATOM   3924 N NH1 . ARG C 1 182 ? 21.219  37.935  72.199  1.00 65.04  ? 1060 ARG C NH1 1 
ATOM   3925 N NH2 . ARG C 1 182 ? 21.632  36.196  73.617  1.00 61.24  ? 1060 ARG C NH2 1 
ATOM   3926 N N   . LYS C 1 183 ? 21.189  41.688  70.149  1.00 61.08  ? 1061 LYS C N   1 
ATOM   3927 C CA  . LYS C 1 183 ? 20.018  42.159  69.440  1.00 62.71  ? 1061 LYS C CA  1 
ATOM   3928 C C   . LYS C 1 183 ? 18.897  41.837  70.429  1.00 63.69  ? 1061 LYS C C   1 
ATOM   3929 O O   . LYS C 1 183 ? 18.736  40.667  70.822  1.00 63.62  ? 1061 LYS C O   1 
ATOM   3930 C CB  . LYS C 1 183 ? 19.806  41.325  68.170  1.00 64.65  ? 1061 LYS C CB  1 
ATOM   3931 C CG  . LYS C 1 183 ? 19.503  42.102  66.905  1.00 65.87  ? 1061 LYS C CG  1 
ATOM   3932 C CD  . LYS C 1 183 ? 20.478  41.677  65.799  1.00 66.88  ? 1061 LYS C CD  1 
ATOM   3933 C CE  . LYS C 1 183 ? 19.828  41.631  64.416  1.00 67.51  ? 1061 LYS C CE  1 
ATOM   3934 N NZ  . LYS C 1 183 ? 18.983  40.409  64.173  1.00 69.01  ? 1061 LYS C NZ  1 
ATOM   3935 N N   . THR C 1 184 ? 18.149  42.853  70.861  1.00 69.52  ? 1062 THR C N   1 
ATOM   3936 C CA  . THR C 1 184 ? 17.004  42.600  71.751  1.00 71.48  ? 1062 THR C CA  1 
ATOM   3937 C C   . THR C 1 184 ? 15.659  43.032  71.165  1.00 72.24  ? 1062 THR C C   1 
ATOM   3938 O O   . THR C 1 184 ? 15.606  43.939  70.324  1.00 72.16  ? 1062 THR C O   1 
ATOM   3939 C CB  . THR C 1 184 ? 17.180  43.085  73.217  1.00 83.41  ? 1062 THR C CB  1 
ATOM   3940 O OG1 . THR C 1 184 ? 18.312  42.435  73.819  1.00 84.24  ? 1062 THR C OG1 1 
ATOM   3941 C CG2 . THR C 1 184 ? 15.906  42.755  74.032  1.00 82.99  ? 1062 THR C CG2 1 
ATOM   3942 N N   . PRO C 1 185 ? 14.561  42.358  71.591  1.00 74.37  ? 1063 PRO C N   1 
ATOM   3943 C CA  . PRO C 1 185 ? 13.158  42.572  71.202  1.00 74.56  ? 1063 PRO C CA  1 
ATOM   3944 C C   . PRO C 1 185 ? 12.311  43.120  72.347  1.00 74.47  ? 1063 PRO C C   1 
ATOM   3945 O O   . PRO C 1 185 ? 12.066  44.328  72.416  1.00 74.59  ? 1063 PRO C O   1 
ATOM   3946 C CB  . PRO C 1 185 ? 12.684  41.166  70.797  1.00 76.41  ? 1063 PRO C CB  1 
ATOM   3947 C CG  . PRO C 1 185 ? 13.566  40.236  71.559  1.00 76.73  ? 1063 PRO C CG  1 
ATOM   3948 C CD  . PRO C 1 185 ? 14.903  40.919  71.623  1.00 76.28  ? 1063 PRO C CD  1 
ATOM   3949 N N   . GLU D 1 6   ? 17.746  -6.969  52.893  1.00 89.22  ? 884  GLU D N   1 
ATOM   3950 C CA  . GLU D 1 6   ? 18.673  -5.844  53.072  1.00 89.22  ? 884  GLU D CA  1 
ATOM   3951 C C   . GLU D 1 6   ? 18.004  -4.507  52.729  1.00 89.22  ? 884  GLU D C   1 
ATOM   3952 O O   . GLU D 1 6   ? 16.785  -4.451  52.621  1.00 89.22  ? 884  GLU D O   1 
ATOM   3953 C CB  . GLU D 1 6   ? 19.939  -6.017  52.218  1.00 91.47  ? 884  GLU D CB  1 
ATOM   3954 C CG  . GLU D 1 6   ? 20.374  -7.469  51.949  1.00 91.47  ? 884  GLU D CG  1 
ATOM   3955 C CD  . GLU D 1 6   ? 20.880  -7.685  50.514  1.00 91.47  ? 884  GLU D CD  1 
ATOM   3956 O OE1 . GLU D 1 6   ? 20.033  -7.750  49.587  1.00 91.47  ? 884  GLU D OE1 1 
ATOM   3957 O OE2 . GLU D 1 6   ? 22.120  -7.790  50.319  1.00 91.47  ? 884  GLU D OE2 1 
ATOM   3958 N N   . PHE D 1 7   ? 18.805  -3.451  52.541  1.00 82.42  ? 885  PHE D N   1 
ATOM   3959 C CA  . PHE D 1 7   ? 18.333  -2.087  52.215  1.00 82.07  ? 885  PHE D CA  1 
ATOM   3960 C C   . PHE D 1 7   ? 19.463  -1.149  52.643  1.00 82.50  ? 885  PHE D C   1 
ATOM   3961 O O   . PHE D 1 7   ? 20.193  -1.432  53.600  1.00 82.33  ? 885  PHE D O   1 
ATOM   3962 C CB  . PHE D 1 7   ? 17.082  -1.726  53.028  1.00 82.55  ? 885  PHE D CB  1 
ATOM   3963 C CG  . PHE D 1 7   ? 15.969  -1.068  52.236  1.00 81.06  ? 885  PHE D CG  1 
ATOM   3964 C CD1 . PHE D 1 7   ? 15.208  -1.797  51.315  1.00 80.47  ? 885  PHE D CD1 1 
ATOM   3965 C CD2 . PHE D 1 7   ? 15.559  0.224   52.542  1.00 79.13  ? 885  PHE D CD2 1 
ATOM   3966 C CE1 . PHE D 1 7   ? 14.117  -1.215  50.650  1.00 77.79  ? 885  PHE D CE1 1 
ATOM   3967 C CE2 . PHE D 1 7   ? 14.469  0.805   51.885  1.00 77.79  ? 885  PHE D CE2 1 
ATOM   3968 C CZ  . PHE D 1 7   ? 13.746  0.082   50.945  1.00 77.23  ? 885  PHE D CZ  1 
ATOM   3969 N N   . PRO D 1 8   ? 19.601  -0.007  51.963  1.00 80.42  ? 886  PRO D N   1 
ATOM   3970 C CA  . PRO D 1 8   ? 20.699  0.891   52.335  1.00 80.71  ? 886  PRO D CA  1 
ATOM   3971 C C   . PRO D 1 8   ? 20.253  2.120   53.153  1.00 80.86  ? 886  PRO D C   1 
ATOM   3972 O O   . PRO D 1 8   ? 19.206  2.070   53.804  1.00 81.10  ? 886  PRO D O   1 
ATOM   3973 C CB  . PRO D 1 8   ? 21.281  1.279   50.977  1.00 82.10  ? 886  PRO D CB  1 
ATOM   3974 C CG  . PRO D 1 8   ? 21.076  0.047   50.138  1.00 82.56  ? 886  PRO D CG  1 
ATOM   3975 C CD  . PRO D 1 8   ? 19.828  -0.645  50.656  1.00 82.20  ? 886  PRO D CD  1 
ATOM   3976 N N   . GLU D 1 9   ? 21.080  3.178   53.182  1.00 78.10  ? 887  GLU D N   1 
ATOM   3977 C CA  . GLU D 1 9   ? 20.781  4.393   53.969  1.00 78.21  ? 887  GLU D CA  1 
ATOM   3978 C C   . GLU D 1 9   ? 20.913  5.737   53.239  1.00 78.08  ? 887  GLU D C   1 
ATOM   3979 O O   . GLU D 1 9   ? 21.071  6.795   53.874  1.00 78.08  ? 887  GLU D O   1 
ATOM   3980 C CB  . GLU D 1 9   ? 21.599  4.432   55.267  1.00 79.44  ? 887  GLU D CB  1 
ATOM   3981 C CG  . GLU D 1 9   ? 22.681  3.386   55.339  1.00 80.07  ? 887  GLU D CG  1 
ATOM   3982 C CD  . GLU D 1 9   ? 22.114  1.989   55.437  1.00 81.97  ? 887  GLU D CD  1 
ATOM   3983 O OE1 . GLU D 1 9   ? 22.399  1.165   54.531  1.00 82.96  ? 887  GLU D OE1 1 
ATOM   3984 O OE2 . GLU D 1 9   ? 21.318  1.748   56.377  1.00 80.90  ? 887  GLU D OE2 1 
ATOM   3985 N N   . VAL D 1 15  ? 19.657  11.704  45.884  1.00 70.88  ? 893  VAL D N   1 
ATOM   3986 C CA  . VAL D 1 15  ? 18.651  12.277  44.999  1.00 70.76  ? 893  VAL D CA  1 
ATOM   3987 C C   . VAL D 1 15  ? 17.258  11.755  45.336  1.00 70.87  ? 893  VAL D C   1 
ATOM   3988 O O   . VAL D 1 15  ? 16.343  11.825  44.516  1.00 70.90  ? 893  VAL D O   1 
ATOM   3989 C CB  . VAL D 1 15  ? 18.960  11.972  43.521  1.00 74.75  ? 893  VAL D CB  1 
ATOM   3990 C CG1 . VAL D 1 15  ? 18.586  13.158  42.646  1.00 74.06  ? 893  VAL D CG1 1 
ATOM   3991 C CG2 . VAL D 1 15  ? 20.428  11.615  43.349  1.00 73.71  ? 893  VAL D CG2 1 
ATOM   3992 N N   . ILE D 1 16  ? 17.105  11.233  46.548  1.00 67.61  ? 894  ILE D N   1 
ATOM   3993 C CA  . ILE D 1 16  ? 15.879  10.547  46.937  1.00 67.29  ? 894  ILE D CA  1 
ATOM   3994 C C   . ILE D 1 16  ? 15.188  11.264  48.092  1.00 67.93  ? 894  ILE D C   1 
ATOM   3995 O O   . ILE D 1 16  ? 15.817  11.588  49.100  1.00 68.19  ? 894  ILE D O   1 
ATOM   3996 C CB  . ILE D 1 16  ? 16.153  9.087   47.344  1.00 68.60  ? 894  ILE D CB  1 
ATOM   3997 C CG1 . ILE D 1 16  ? 16.607  9.016   48.803  1.00 67.58  ? 894  ILE D CG1 1 
ATOM   3998 C CG2 . ILE D 1 16  ? 17.195  8.465   46.426  1.00 67.78  ? 894  ILE D CG2 1 
ATOM   3999 C CD1 . ILE D 1 16  ? 17.670  7.971   49.062  1.00 66.53  ? 894  ILE D CD1 1 
ATOM   4000 N N   . ASN D 1 17  ? 13.891  11.511  47.938  1.00 66.31  ? 895  ASN D N   1 
ATOM   4001 C CA  . ASN D 1 17  ? 13.068  12.000  49.038  1.00 66.12  ? 895  ASN D CA  1 
ATOM   4002 C C   . ASN D 1 17  ? 13.375  11.285  50.349  1.00 65.71  ? 895  ASN D C   1 
ATOM   4003 O O   . ASN D 1 17  ? 12.916  10.166  50.580  1.00 65.46  ? 895  ASN D O   1 
ATOM   4004 C CB  . ASN D 1 17  ? 11.583  11.861  48.699  1.00 60.70  ? 895  ASN D CB  1 
ATOM   4005 C CG  . ASN D 1 17  ? 10.708  12.785  49.522  1.00 60.70  ? 895  ASN D CG  1 
ATOM   4006 O OD1 . ASN D 1 17  ? 10.176  13.772  49.014  1.00 61.60  ? 895  ASN D OD1 1 
ATOM   4007 N ND2 . ASN D 1 17  ? 10.556  12.470  50.803  1.00 57.17  ? 895  ASN D ND2 1 
ATOM   4008 N N   . GLN D 1 18  ? 14.155  11.938  51.205  1.00 62.95  ? 896  GLN D N   1 
ATOM   4009 C CA  . GLN D 1 18  ? 14.461  11.404  52.518  1.00 62.72  ? 896  GLN D CA  1 
ATOM   4010 C C   . GLN D 1 18  ? 13.276  10.832  53.253  1.00 61.57  ? 896  GLN D C   1 
ATOM   4011 O O   . GLN D 1 18  ? 13.292  9.682   53.665  1.00 61.52  ? 896  GLN D O   1 
ATOM   4012 C CB  . GLN D 1 18  ? 15.177  12.430  53.405  1.00 65.72  ? 896  GLN D CB  1 
ATOM   4013 C CG  . GLN D 1 18  ? 14.928  12.180  54.925  1.00 68.94  ? 896  GLN D CG  1 
ATOM   4014 C CD  . GLN D 1 18  ? 15.707  13.102  55.883  1.00 72.40  ? 896  GLN D CD  1 
ATOM   4015 O OE1 . GLN D 1 18  ? 16.287  12.634  56.874  1.00 75.26  ? 896  GLN D OE1 1 
ATOM   4016 N NE2 . GLN D 1 18  ? 15.621  14.414  55.655  1.00 70.97  ? 896  GLN D NE2 1 
ATOM   4017 N N   . PRO D 1 19  ? 12.226  11.625  53.429  1.00 54.58  ? 897  PRO D N   1 
ATOM   4018 C CA  . PRO D 1 19  ? 11.086  11.098  54.185  1.00 54.74  ? 897  PRO D CA  1 
ATOM   4019 C C   . PRO D 1 19  ? 10.249  9.998   53.501  1.00 55.02  ? 897  PRO D C   1 
ATOM   4020 O O   . PRO D 1 19  ? 9.560   9.264   54.183  1.00 55.11  ? 897  PRO D O   1 
ATOM   4021 C CB  . PRO D 1 19  ? 10.251  12.347  54.500  1.00 55.85  ? 897  PRO D CB  1 
ATOM   4022 C CG  . PRO D 1 19  ? 11.148  13.478  54.291  1.00 54.98  ? 897  PRO D CG  1 
ATOM   4023 C CD  . PRO D 1 19  ? 12.180  13.083  53.295  1.00 56.13  ? 897  PRO D CD  1 
ATOM   4024 N N   . MET D 1 20  ? 10.300  9.875   52.178  1.00 50.60  ? 898  MET D N   1 
ATOM   4025 C CA  . MET D 1 20  ? 9.565   8.810   51.504  1.00 51.03  ? 898  MET D CA  1 
ATOM   4026 C C   . MET D 1 20  ? 10.374  7.515   51.622  1.00 51.27  ? 898  MET D C   1 
ATOM   4027 O O   . MET D 1 20  ? 9.855   6.415   51.862  1.00 51.53  ? 898  MET D O   1 
ATOM   4028 C CB  . MET D 1 20  ? 9.386   9.140   50.028  1.00 53.32  ? 898  MET D CB  1 
ATOM   4029 C CG  . MET D 1 20  ? 8.599   10.409  49.762  1.00 55.36  ? 898  MET D CG  1 
ATOM   4030 S SD  . MET D 1 20  ? 7.311   10.200  48.509  1.00 58.30  ? 898  MET D SD  1 
ATOM   4031 C CE  . MET D 1 20  ? 7.379   8.442   48.356  1.00 59.08  ? 898  MET D CE  1 
ATOM   4032 N N   . MET D 1 21  ? 11.669  7.666   51.455  1.00 48.47  ? 899  MET D N   1 
ATOM   4033 C CA  . MET D 1 21  ? 12.548  6.563   51.637  1.00 48.71  ? 899  MET D CA  1 
ATOM   4034 C C   . MET D 1 21  ? 12.586  6.075   53.083  1.00 48.84  ? 899  MET D C   1 
ATOM   4035 O O   . MET D 1 21  ? 12.817  4.911   53.343  1.00 48.73  ? 899  MET D O   1 
ATOM   4036 C CB  . MET D 1 21  ? 13.901  6.993   51.207  1.00 50.37  ? 899  MET D CB  1 
ATOM   4037 C CG  . MET D 1 21  ? 14.070  6.685   49.773  1.00 52.45  ? 899  MET D CG  1 
ATOM   4038 S SD  . MET D 1 21  ? 14.464  4.919   49.505  1.00 57.10  ? 899  MET D SD  1 
ATOM   4039 C CE  . MET D 1 21  ? 14.996  5.032   47.666  1.00 55.87  ? 899  MET D CE  1 
ATOM   4040 N N   . MET D 1 22  ? 12.358  6.968   54.029  1.00 49.94  ? 900  MET D N   1 
ATOM   4041 C CA  . MET D 1 22  ? 12.370  6.581   55.413  1.00 49.84  ? 900  MET D CA  1 
ATOM   4042 C C   . MET D 1 22  ? 11.168  5.727   55.668  1.00 49.88  ? 900  MET D C   1 
ATOM   4043 O O   . MET D 1 22  ? 11.218  4.771   56.431  1.00 50.50  ? 900  MET D O   1 
ATOM   4044 C CB  . MET D 1 22  ? 12.278  7.809   56.299  1.00 55.46  ? 900  MET D CB  1 
ATOM   4045 C CG  . MET D 1 22  ? 12.825  7.587   57.693  1.00 57.09  ? 900  MET D CG  1 
ATOM   4046 S SD  . MET D 1 22  ? 14.558  7.116   57.582  1.00 60.45  ? 900  MET D SD  1 
ATOM   4047 C CE  . MET D 1 22  ? 15.296  8.653   56.811  1.00 57.62  ? 900  MET D CE  1 
ATOM   4048 N N   . ALA D 1 23  ? 10.053  6.112   55.072  1.00 48.86  ? 901  ALA D N   1 
ATOM   4049 C CA  . ALA D 1 23  ? 8.811   5.383   55.286  1.00 48.06  ? 901  ALA D CA  1 
ATOM   4050 C C   . ALA D 1 23  ? 8.867   4.084   54.504  1.00 47.85  ? 901  ALA D C   1 
ATOM   4051 O O   . ALA D 1 23  ? 8.368   3.069   54.965  1.00 48.01  ? 901  ALA D O   1 
ATOM   4052 C CB  . ALA D 1 23  ? 7.619   6.209   54.884  1.00 48.12  ? 901  ALA D CB  1 
ATOM   4053 N N   . ALA D 1 24  ? 9.488   4.115   53.326  1.00 48.05  ? 902  ALA D N   1 
ATOM   4054 C CA  . ALA D 1 24  ? 9.648   2.915   52.535  1.00 47.81  ? 902  ALA D CA  1 
ATOM   4055 C C   . ALA D 1 24  ? 10.436  1.940   53.392  1.00 47.58  ? 902  ALA D C   1 
ATOM   4056 O O   . ALA D 1 24  ? 10.090  0.778   53.494  1.00 47.29  ? 902  ALA D O   1 
ATOM   4057 C CB  . ALA D 1 24  ? 10.417  3.232   51.285  1.00 48.20  ? 902  ALA D CB  1 
ATOM   4058 N N   . ARG D 1 25  ? 11.513  2.429   54.002  1.00 51.42  ? 903  ARG D N   1 
ATOM   4059 C CA  . ARG D 1 25  ? 12.397  1.610   54.843  1.00 51.90  ? 903  ARG D CA  1 
ATOM   4060 C C   . ARG D 1 25  ? 11.741  1.080   56.086  1.00 51.51  ? 903  ARG D C   1 
ATOM   4061 O O   . ARG D 1 25  ? 11.950  -0.069  56.427  1.00 51.24  ? 903  ARG D O   1 
ATOM   4062 C CB  . ARG D 1 25  ? 13.698  2.332   55.213  1.00 56.83  ? 903  ARG D CB  1 
ATOM   4063 C CG  . ARG D 1 25  ? 14.616  1.559   56.190  1.00 59.32  ? 903  ARG D CG  1 
ATOM   4064 C CD  . ARG D 1 25  ? 16.113  1.965   56.032  1.00 63.19  ? 903  ARG D CD  1 
ATOM   4065 N NE  . ARG D 1 25  ? 16.257  3.423   55.941  1.00 65.42  ? 903  ARG D NE  1 
ATOM   4066 C CZ  . ARG D 1 25  ? 16.746  4.088   54.889  1.00 64.97  ? 903  ARG D CZ  1 
ATOM   4067 N NH1 . ARG D 1 25  ? 17.199  3.434   53.822  1.00 62.75  ? 903  ARG D NH1 1 
ATOM   4068 N NH2 . ARG D 1 25  ? 16.799  5.424   54.918  1.00 66.42  ? 903  ARG D NH2 1 
ATOM   4069 N N   . GLN D 1 26  ? 10.957  1.902   56.769  1.00 50.20  ? 904  GLN D N   1 
ATOM   4070 C CA  . GLN D 1 26  ? 10.285  1.451   57.989  1.00 50.92  ? 904  GLN D CA  1 
ATOM   4071 C C   . GLN D 1 26  ? 9.349   0.277   57.755  1.00 50.38  ? 904  GLN D C   1 
ATOM   4072 O O   . GLN D 1 26  ? 9.245   -0.603  58.603  1.00 50.84  ? 904  GLN D O   1 
ATOM   4073 C CB  . GLN D 1 26  ? 9.509   2.582   58.627  1.00 53.10  ? 904  GLN D CB  1 
ATOM   4074 C CG  . GLN D 1 26  ? 10.357  3.512   59.454  1.00 56.07  ? 904  GLN D CG  1 
ATOM   4075 C CD  . GLN D 1 26  ? 9.503   4.559   60.164  1.00 62.40  ? 904  GLN D CD  1 
ATOM   4076 O OE1 . GLN D 1 26  ? 8.644   4.219   60.987  1.00 63.57  ? 904  GLN D OE1 1 
ATOM   4077 N NE2 . GLN D 1 26  ? 9.696   5.834   59.806  1.00 62.88  ? 904  GLN D NE2 1 
ATOM   4078 N N   . LEU D 1 27  ? 8.656   0.291   56.616  1.00 47.08  ? 905  LEU D N   1 
ATOM   4079 C CA  . LEU D 1 27  ? 7.781   -0.802  56.206  1.00 46.45  ? 905  LEU D CA  1 
ATOM   4080 C C   . LEU D 1 27  ? 8.682   -1.989  55.915  1.00 46.09  ? 905  LEU D C   1 
ATOM   4081 O O   . LEU D 1 27  ? 8.565   -3.028  56.553  1.00 46.39  ? 905  LEU D O   1 
ATOM   4082 C CB  . LEU D 1 27  ? 6.952   -0.450  54.955  1.00 44.62  ? 905  LEU D CB  1 
ATOM   4083 C CG  . LEU D 1 27  ? 6.035   -1.604  54.506  1.00 44.50  ? 905  LEU D CG  1 
ATOM   4084 C CD1 . LEU D 1 27  ? 4.890   -1.819  55.499  1.00 43.16  ? 905  LEU D CD1 1 
ATOM   4085 C CD2 . LEU D 1 27  ? 5.507   -1.443  53.068  1.00 43.72  ? 905  LEU D CD2 1 
ATOM   4086 N N   . HIS D 1 28  ? 9.629   -1.808  55.009  1.00 47.60  ? 906  HIS D N   1 
ATOM   4087 C CA  . HIS D 1 28  ? 10.555  -2.860  54.708  1.00 48.09  ? 906  HIS D CA  1 
ATOM   4088 C C   . HIS D 1 28  ? 11.112  -3.666  55.875  1.00 48.09  ? 906  HIS D C   1 
ATOM   4089 O O   . HIS D 1 28  ? 11.177  -4.879  55.798  1.00 47.42  ? 906  HIS D O   1 
ATOM   4090 C CB  . HIS D 1 28  ? 11.706  -2.369  53.868  1.00 50.07  ? 906  HIS D CB  1 
ATOM   4091 C CG  . HIS D 1 28  ? 12.375  -3.485  53.143  1.00 49.98  ? 906  HIS D CG  1 
ATOM   4092 N ND1 . HIS D 1 28  ? 13.524  -4.082  53.618  1.00 49.04  ? 906  HIS D ND1 1 
ATOM   4093 C CD2 . HIS D 1 28  ? 11.935  -4.252  52.111  1.00 48.95  ? 906  HIS D CD2 1 
ATOM   4094 C CE1 . HIS D 1 28  ? 13.810  -5.118  52.847  1.00 52.04  ? 906  HIS D CE1 1 
ATOM   4095 N NE2 . HIS D 1 28  ? 12.857  -5.249  51.933  1.00 51.32  ? 906  HIS D NE2 1 
ATOM   4096 N N   . ASP D 1 29  ? 11.551  -2.983  56.928  1.00 50.57  ? 907  ASP D N   1 
ATOM   4097 C CA  . ASP D 1 29  ? 12.106  -3.624  58.117  1.00 50.81  ? 907  ASP D CA  1 
ATOM   4098 C C   . ASP D 1 29  ? 11.094  -4.479  58.847  1.00 50.81  ? 907  ASP D C   1 
ATOM   4099 O O   . ASP D 1 29  ? 11.434  -5.557  59.345  1.00 49.91  ? 907  ASP D O   1 
ATOM   4100 C CB  . ASP D 1 29  ? 12.643  -2.575  59.075  1.00 56.64  ? 907  ASP D CB  1 
ATOM   4101 C CG  . ASP D 1 29  ? 13.844  -1.837  58.511  1.00 58.05  ? 907  ASP D CG  1 
ATOM   4102 O OD1 . ASP D 1 29  ? 14.507  -2.370  57.582  1.00 59.73  ? 907  ASP D OD1 1 
ATOM   4103 O OD2 . ASP D 1 29  ? 14.129  -0.709  58.987  1.00 59.52  ? 907  ASP D OD2 1 
ATOM   4104 N N   . GLU D 1 30  ? 9.855   -3.990  58.938  1.00 50.03  ? 908  GLU D N   1 
ATOM   4105 C CA  . GLU D 1 30  ? 8.820   -4.771  59.602  1.00 50.49  ? 908  GLU D CA  1 
ATOM   4106 C C   . GLU D 1 30  ? 8.489   -6.075  58.859  1.00 49.97  ? 908  GLU D C   1 
ATOM   4107 O O   . GLU D 1 30  ? 8.301   -7.105  59.516  1.00 50.20  ? 908  GLU D O   1 
ATOM   4108 C CB  . GLU D 1 30  ? 7.564   -3.952  59.962  1.00 51.92  ? 908  GLU D CB  1 
ATOM   4109 C CG  . GLU D 1 30  ? 6.557   -4.711  60.890  1.00 55.52  ? 908  GLU D CG  1 
ATOM   4110 C CD  . GLU D 1 30  ? 6.971   -4.771  62.399  1.00 61.84  ? 908  GLU D CD  1 
ATOM   4111 O OE1 . GLU D 1 30  ? 7.811   -3.949  62.849  1.00 63.55  ? 908  GLU D OE1 1 
ATOM   4112 O OE2 . GLU D 1 30  ? 6.424   -5.619  63.152  1.00 64.41  ? 908  GLU D OE2 1 
ATOM   4113 N N   . ALA D 1 31  ? 8.446   -6.041  57.517  1.00 43.90  ? 909  ALA D N   1 
ATOM   4114 C CA  . ALA D 1 31  ? 8.147   -7.233  56.724  1.00 43.38  ? 909  ALA D CA  1 
ATOM   4115 C C   . ALA D 1 31  ? 9.341   -8.183  56.514  1.00 43.18  ? 909  ALA D C   1 
ATOM   4116 O O   . ALA D 1 31  ? 9.164   -9.348  56.203  1.00 43.02  ? 909  ALA D O   1 
ATOM   4117 C CB  . ALA D 1 31  ? 7.494   -6.863  55.379  1.00 43.42  ? 909  ALA D CB  1 
ATOM   4118 N N   . ARG D 1 32  ? 10.554  -7.664  56.627  1.00 45.07  ? 910  ARG D N   1 
ATOM   4119 C CA  . ARG D 1 32  ? 11.740  -8.466  56.412  1.00 45.67  ? 910  ARG D CA  1 
ATOM   4120 C C   . ARG D 1 32  ? 11.973  -9.281  57.687  1.00 45.25  ? 910  ARG D C   1 
ATOM   4121 O O   . ARG D 1 32  ? 12.935  -10.051 57.784  1.00 45.75  ? 910  ARG D O   1 
ATOM   4122 C CB  . ARG D 1 32  ? 12.943  -7.555  56.161  1.00 53.50  ? 910  ARG D CB  1 
ATOM   4123 C CG  . ARG D 1 32  ? 13.542  -7.021  57.483  1.00 58.01  ? 910  ARG D CG  1 
ATOM   4124 C CD  . ARG D 1 32  ? 14.518  -5.829  57.303  1.00 62.18  ? 910  ARG D CD  1 
ATOM   4125 N NE  . ARG D 1 32  ? 15.891  -6.266  57.504  1.00 63.20  ? 910  ARG D NE  1 
ATOM   4126 C CZ  . ARG D 1 32  ? 16.505  -7.149  56.719  1.00 64.56  ? 910  ARG D CZ  1 
ATOM   4127 N NH1 . ARG D 1 32  ? 15.900  -7.624  55.630  1.00 64.16  ? 910  ARG D NH1 1 
ATOM   4128 N NH2 . ARG D 1 32  ? 17.736  -7.544  57.004  1.00 65.70  ? 910  ARG D NH2 1 
ATOM   4129 N N   . LYS D 1 33  ? 11.096  -9.091  58.669  1.00 44.06  ? 911  LYS D N   1 
ATOM   4130 C CA  . LYS D 1 33  ? 11.165  -9.832  59.910  1.00 42.77  ? 911  LYS D CA  1 
ATOM   4131 C C   . LYS D 1 33  ? 10.679  -11.235 59.608  1.00 42.38  ? 911  LYS D C   1 
ATOM   4132 O O   . LYS D 1 33  ? 11.050  -12.177 60.277  1.00 42.95  ? 911  LYS D O   1 
ATOM   4133 C CB  . LYS D 1 33  ? 10.235  -9.200  60.937  1.00 47.87  ? 911  LYS D CB  1 
ATOM   4134 C CG  . LYS D 1 33  ? 10.870  -8.154  61.832  1.00 48.79  ? 911  LYS D CG  1 
ATOM   4135 C CD  . LYS D 1 33  ? 9.962   -7.839  63.029  1.00 50.87  ? 911  LYS D CD  1 
ATOM   4136 C CE  . LYS D 1 33  ? 10.650  -6.878  64.057  1.00 51.84  ? 911  LYS D CE  1 
ATOM   4137 N NZ  . LYS D 1 33  ? 10.930  -7.396  65.496  1.00 50.38  ? 911  LYS D NZ  1 
ATOM   4138 N N   . TRP D 1 34  ? 9.878   -11.364 58.554  1.00 43.34  ? 912  TRP D N   1 
ATOM   4139 C CA  . TRP D 1 34  ? 9.253   -12.629 58.151  1.00 41.98  ? 912  TRP D CA  1 
ATOM   4140 C C   . TRP D 1 34  ? 9.567   -13.188 56.763  1.00 41.42  ? 912  TRP D C   1 
ATOM   4141 O O   . TRP D 1 34  ? 9.834   -12.458 55.821  1.00 41.37  ? 912  TRP D O   1 
ATOM   4142 C CB  . TRP D 1 34  ? 7.734   -12.494 58.229  1.00 42.28  ? 912  TRP D CB  1 
ATOM   4143 C CG  . TRP D 1 34  ? 7.268   -11.810 59.414  1.00 41.82  ? 912  TRP D CG  1 
ATOM   4144 C CD1 . TRP D 1 34  ? 7.101   -10.477 59.572  1.00 42.95  ? 912  TRP D CD1 1 
ATOM   4145 C CD2 . TRP D 1 34  ? 6.931   -12.409 60.649  1.00 41.13  ? 912  TRP D CD2 1 
ATOM   4146 N NE1 . TRP D 1 34  ? 6.648   -10.205 60.832  1.00 42.10  ? 912  TRP D NE1 1 
ATOM   4147 C CE2 . TRP D 1 34  ? 6.517   -11.386 61.507  1.00 40.41  ? 912  TRP D CE2 1 
ATOM   4148 C CE3 . TRP D 1 34  ? 6.936   -13.719 61.115  1.00 41.76  ? 912  TRP D CE3 1 
ATOM   4149 C CZ2 . TRP D 1 34  ? 6.129   -11.624 62.809  1.00 40.86  ? 912  TRP D CZ2 1 
ATOM   4150 C CZ3 . TRP D 1 34  ? 6.524   -13.962 62.413  1.00 41.92  ? 912  TRP D CZ3 1 
ATOM   4151 C CH2 . TRP D 1 34  ? 6.137   -12.916 63.247  1.00 40.32  ? 912  TRP D CH2 1 
ATOM   4152 N N   . SER D 1 35  ? 9.420   -14.504 56.634  1.00 41.63  ? 913  SER D N   1 
ATOM   4153 C CA  . SER D 1 35  ? 9.636   -15.177 55.375  1.00 41.39  ? 913  SER D CA  1 
ATOM   4154 C C   . SER D 1 35  ? 8.407   -14.945 54.511  1.00 41.03  ? 913  SER D C   1 
ATOM   4155 O O   . SER D 1 35  ? 7.282   -14.992 54.983  1.00 41.05  ? 913  SER D O   1 
ATOM   4156 C CB  . SER D 1 35  ? 9.863   -16.664 55.590  1.00 44.97  ? 913  SER D CB  1 
ATOM   4157 O OG  . SER D 1 35  ? 9.455   -17.390 54.441  1.00 44.57  ? 913  SER D OG  1 
ATOM   4158 N N   . SER D 1 36  ? 8.641   -14.663 53.246  1.00 39.19  ? 914  SER D N   1 
ATOM   4159 C CA  . SER D 1 36  ? 7.573   -14.401 52.322  1.00 39.37  ? 914  SER D CA  1 
ATOM   4160 C C   . SER D 1 36  ? 6.856   -15.679 52.017  1.00 38.97  ? 914  SER D C   1 
ATOM   4161 O O   . SER D 1 36  ? 5.679   -15.630 51.660  1.00 39.11  ? 914  SER D O   1 
ATOM   4162 C CB  . SER D 1 36  ? 8.145   -13.845 51.011  1.00 42.68  ? 914  SER D CB  1 
ATOM   4163 O OG  . SER D 1 36  ? 8.879   -12.645 51.206  1.00 42.60  ? 914  SER D OG  1 
ATOM   4164 N N   . LYS D 1 37  ? 7.585   -16.802 52.067  1.00 37.22  ? 915  LYS D N   1 
ATOM   4165 C CA  . LYS D 1 37  ? 7.057   -18.134 51.717  1.00 37.98  ? 915  LYS D CA  1 
ATOM   4166 C C   . LYS D 1 37  ? 5.695   -18.393 52.365  1.00 38.21  ? 915  LYS D C   1 
ATOM   4167 O O   . LYS D 1 37  ? 5.609   -18.481 53.602  1.00 38.42  ? 915  LYS D O   1 
ATOM   4168 C CB  . LYS D 1 37  ? 8.058   -19.214 52.148  1.00 38.63  ? 915  LYS D CB  1 
ATOM   4169 C CG  . LYS D 1 37  ? 7.953   -20.581 51.438  1.00 40.91  ? 915  LYS D CG  1 
ATOM   4170 C CD  . LYS D 1 37  ? 6.701   -21.381 51.849  1.00 45.26  ? 915  LYS D CD  1 
ATOM   4171 C CE  . LYS D 1 37  ? 6.948   -22.895 51.800  1.00 46.12  ? 915  LYS D CE  1 
ATOM   4172 N NZ  . LYS D 1 37  ? 5.886   -23.776 52.472  1.00 46.53  ? 915  LYS D NZ  1 
ATOM   4173 N N   . GLY D 1 38  ? 4.631   -18.459 51.552  1.00 37.89  ? 916  GLY D N   1 
ATOM   4174 C CA  . GLY D 1 38  ? 3.261   -18.725 52.011  1.00 37.32  ? 916  GLY D CA  1 
ATOM   4175 C C   . GLY D 1 38  ? 2.528   -17.637 52.787  1.00 37.59  ? 916  GLY D C   1 
ATOM   4176 O O   . GLY D 1 38  ? 1.561   -17.902 53.519  1.00 38.07  ? 916  GLY D O   1 
ATOM   4177 N N   . ASN D 1 39  ? 3.025   -16.413 52.611  1.00 40.12  ? 917  ASN D N   1 
ATOM   4178 C CA  . ASN D 1 39  ? 2.510   -15.176 53.220  1.00 39.71  ? 917  ASN D CA  1 
ATOM   4179 C C   . ASN D 1 39  ? 2.530   -14.017 52.210  1.00 40.07  ? 917  ASN D C   1 
ATOM   4180 O O   . ASN D 1 39  ? 3.452   -13.247 52.164  1.00 39.93  ? 917  ASN D O   1 
ATOM   4181 C CB  . ASN D 1 39  ? 3.301   -14.781 54.476  1.00 36.72  ? 917  ASN D CB  1 
ATOM   4182 C CG  . ASN D 1 39  ? 2.513   -13.841 55.358  1.00 37.96  ? 917  ASN D CG  1 
ATOM   4183 O OD1 . ASN D 1 39  ? 1.622   -13.144 54.864  1.00 42.31  ? 917  ASN D OD1 1 
ATOM   4184 N ND2 . ASN D 1 39  ? 2.767   -13.862 56.666  1.00 35.80  ? 917  ASN D ND2 1 
ATOM   4185 N N   . ASP D 1 40  ? 1.498   -13.936 51.387  1.00 43.38  ? 918  ASP D N   1 
ATOM   4186 C CA  . ASP D 1 40  ? 1.383   -12.932 50.350  1.00 43.58  ? 918  ASP D CA  1 
ATOM   4187 C C   . ASP D 1 40  ? 1.216   -11.539 50.915  1.00 42.94  ? 918  ASP D C   1 
ATOM   4188 O O   . ASP D 1 40  ? 1.299   -10.523 50.181  1.00 42.44  ? 918  ASP D O   1 
ATOM   4189 C CB  . ASP D 1 40  ? 0.200   -13.266 49.450  1.00 47.94  ? 918  ASP D CB  1 
ATOM   4190 C CG  . ASP D 1 40  ? 0.526   -14.365 48.446  1.00 51.57  ? 918  ASP D CG  1 
ATOM   4191 O OD1 . ASP D 1 40  ? 1.725   -14.791 48.409  1.00 54.04  ? 918  ASP D OD1 1 
ATOM   4192 O OD2 . ASP D 1 40  ? -0.410  -14.761 47.689  1.00 55.91  ? 918  ASP D OD2 1 
ATOM   4193 N N   . ILE D 1 41  ? 0.968   -11.492 52.219  1.00 38.59  ? 919  ILE D N   1 
ATOM   4194 C CA  . ILE D 1 41  ? 0.853   -10.216 52.887  1.00 37.21  ? 919  ILE D CA  1 
ATOM   4195 C C   . ILE D 1 41  ? 2.281   -9.651  52.976  1.00 35.90  ? 919  ILE D C   1 
ATOM   4196 O O   . ILE D 1 41  ? 2.508   -8.489  52.665  1.00 36.04  ? 919  ILE D O   1 
ATOM   4197 C CB  . ILE D 1 41  ? 0.099   -10.334 54.239  1.00 39.35  ? 919  ILE D CB  1 
ATOM   4198 C CG1 . ILE D 1 41  ? -1.405  -10.322 53.981  1.00 40.80  ? 919  ILE D CG1 1 
ATOM   4199 C CG2 . ILE D 1 41  ? 0.435   -9.196  55.156  1.00 39.02  ? 919  ILE D CG2 1 
ATOM   4200 C CD1 . ILE D 1 41  ? -2.243  -9.798  55.128  1.00 42.45  ? 919  ILE D CD1 1 
ATOM   4201 N N   . ILE D 1 42  ? 3.250   -10.497 53.316  1.00 31.50  ? 920  ILE D N   1 
ATOM   4202 C CA  . ILE D 1 42  ? 4.622   -10.052 53.407  1.00 31.21  ? 920  ILE D CA  1 
ATOM   4203 C C   . ILE D 1 42  ? 5.185   -9.803  52.002  1.00 31.31  ? 920  ILE D C   1 
ATOM   4204 O O   . ILE D 1 42  ? 5.938   -8.854  51.761  1.00 30.97  ? 920  ILE D O   1 
ATOM   4205 C CB  . ILE D 1 42  ? 5.481   -11.041 54.151  1.00 33.23  ? 920  ILE D CB  1 
ATOM   4206 C CG1 . ILE D 1 42  ? 4.873   -11.379 55.498  1.00 33.24  ? 920  ILE D CG1 1 
ATOM   4207 C CG2 . ILE D 1 42  ? 6.859   -10.451 54.370  1.00 34.06  ? 920  ILE D CG2 1 
ATOM   4208 C CD1 . ILE D 1 42  ? 5.092   -10.304 56.576  1.00 33.98  ? 920  ILE D CD1 1 
ATOM   4209 N N   . ALA D 1 43  ? 4.763   -10.628 51.054  1.00 31.89  ? 921  ALA D N   1 
ATOM   4210 C CA  . ALA D 1 43  ? 5.198   -10.462 49.677  1.00 31.61  ? 921  ALA D CA  1 
ATOM   4211 C C   . ALA D 1 43  ? 4.760   -9.101  49.131  1.00 32.02  ? 921  ALA D C   1 
ATOM   4212 O O   . ALA D 1 43  ? 5.524   -8.402  48.423  1.00 32.08  ? 921  ALA D O   1 
ATOM   4213 C CB  . ALA D 1 43  ? 4.629   -11.538 48.843  1.00 31.65  ? 921  ALA D CB  1 
ATOM   4214 N N   . ALA D 1 44  ? 3.505   -8.764  49.428  1.00 31.39  ? 922  ALA D N   1 
ATOM   4215 C CA  . ALA D 1 44  ? 2.880   -7.523  48.989  1.00 31.25  ? 922  ALA D CA  1 
ATOM   4216 C C   . ALA D 1 44  ? 3.559   -6.317  49.671  1.00 31.59  ? 922  ALA D C   1 
ATOM   4217 O O   . ALA D 1 44  ? 3.961   -5.331  49.004  1.00 31.84  ? 922  ALA D O   1 
ATOM   4218 C CB  . ALA D 1 44  ? 1.388   -7.566  49.357  1.00 31.16  ? 922  ALA D CB  1 
ATOM   4219 N N   . ALA D 1 45  ? 3.688   -6.409  51.001  1.00 31.09  ? 923  ALA D N   1 
ATOM   4220 C CA  . ALA D 1 45  ? 4.295   -5.368  51.767  1.00 30.09  ? 923  ALA D CA  1 
ATOM   4221 C C   . ALA D 1 45  ? 5.704   -5.078  51.264  1.00 29.98  ? 923  ALA D C   1 
ATOM   4222 O O   . ALA D 1 45  ? 6.048   -3.913  51.043  1.00 29.66  ? 923  ALA D O   1 
ATOM   4223 C CB  . ALA D 1 45  ? 4.282   -5.713  53.192  1.00 30.68  ? 923  ALA D CB  1 
ATOM   4224 N N   . LYS D 1 46  ? 6.516   -6.120  51.066  1.00 30.84  ? 924  LYS D N   1 
ATOM   4225 C CA  . LYS D 1 46  ? 7.893   -5.947  50.561  1.00 30.84  ? 924  LYS D CA  1 
ATOM   4226 C C   . LYS D 1 46  ? 7.897   -5.225  49.204  1.00 31.63  ? 924  LYS D C   1 
ATOM   4227 O O   . LYS D 1 46  ? 8.731   -4.331  48.949  1.00 31.98  ? 924  LYS D O   1 
ATOM   4228 C CB  . LYS D 1 46  ? 8.609   -7.289  50.471  1.00 31.92  ? 924  LYS D CB  1 
ATOM   4229 C CG  . LYS D 1 46  ? 9.134   -7.780  51.803  1.00 32.74  ? 924  LYS D CG  1 
ATOM   4230 C CD  . LYS D 1 46  ? 9.605   -9.233  51.720  1.00 35.48  ? 924  LYS D CD  1 
ATOM   4231 C CE  . LYS D 1 46  ? 10.070  -9.806  53.081  1.00 37.12  ? 924  LYS D CE  1 
ATOM   4232 N NZ  . LYS D 1 46  ? 10.187  -11.314 53.119  1.00 34.78  ? 924  LYS D NZ  1 
ATOM   4233 N N   . ARG D 1 47  ? 6.913   -5.571  48.367  1.00 33.12  ? 925  ARG D N   1 
ATOM   4234 C CA  . ARG D 1 47  ? 6.734   -4.953  47.058  1.00 33.20  ? 925  ARG D CA  1 
ATOM   4235 C C   . ARG D 1 47  ? 6.396   -3.461  47.177  1.00 33.49  ? 925  ARG D C   1 
ATOM   4236 O O   . ARG D 1 47  ? 7.061   -2.619  46.579  1.00 33.77  ? 925  ARG D O   1 
ATOM   4237 C CB  . ARG D 1 47  ? 5.621   -5.663  46.314  1.00 30.03  ? 925  ARG D CB  1 
ATOM   4238 C CG  . ARG D 1 47  ? 6.082   -6.599  45.242  1.00 29.60  ? 925  ARG D CG  1 
ATOM   4239 C CD  . ARG D 1 47  ? 4.865   -7.044  44.480  1.00 29.21  ? 925  ARG D CD  1 
ATOM   4240 N NE  . ARG D 1 47  ? 4.390   -8.302  45.036  1.00 30.16  ? 925  ARG D NE  1 
ATOM   4241 C CZ  . ARG D 1 47  ? 3.136   -8.523  45.413  1.00 30.26  ? 925  ARG D CZ  1 
ATOM   4242 N NH1 . ARG D 1 47  ? 2.189   -7.582  45.237  1.00 29.30  ? 925  ARG D NH1 1 
ATOM   4243 N NH2 . ARG D 1 47  ? 2.825   -9.709  45.912  1.00 29.35  ? 925  ARG D NH2 1 
ATOM   4244 N N   . MET D 1 48  ? 5.367   -3.135  47.956  1.00 33.30  ? 926  MET D N   1 
ATOM   4245 C CA  . MET D 1 48  ? 5.025   -1.728  48.216  1.00 33.45  ? 926  MET D CA  1 
ATOM   4246 C C   . MET D 1 48  ? 6.242   -0.932  48.668  1.00 33.13  ? 926  MET D C   1 
ATOM   4247 O O   . MET D 1 48  ? 6.529   0.071   48.052  1.00 32.98  ? 926  MET D O   1 
ATOM   4248 C CB  . MET D 1 48  ? 3.916   -1.602  49.261  1.00 36.08  ? 926  MET D CB  1 
ATOM   4249 C CG  . MET D 1 48  ? 2.578   -2.052  48.749  1.00 36.97  ? 926  MET D CG  1 
ATOM   4250 S SD  . MET D 1 48  ? 1.292   -1.997  49.974  1.00 43.46  ? 926  MET D SD  1 
ATOM   4251 C CE  . MET D 1 48  ? 1.426   -0.260  50.517  1.00 43.51  ? 926  MET D CE  1 
ATOM   4252 N N   . ALA D 1 49  ? 6.940   -1.377  49.729  1.00 31.09  ? 927  ALA D N   1 
ATOM   4253 C CA  . ALA D 1 49  ? 8.150   -0.706  50.224  1.00 31.77  ? 927  ALA D CA  1 
ATOM   4254 C C   . ALA D 1 49  ? 9.140   -0.415  49.073  1.00 32.65  ? 927  ALA D C   1 
ATOM   4255 O O   . ALA D 1 49  ? 9.736   0.660   49.015  1.00 32.67  ? 927  ALA D O   1 
ATOM   4256 C CB  . ALA D 1 49  ? 8.845   -1.529  51.326  1.00 31.69  ? 927  ALA D CB  1 
ATOM   4257 N N   . LEU D 1 50  ? 9.300   -1.381  48.164  1.00 35.08  ? 928  LEU D N   1 
ATOM   4258 C CA  . LEU D 1 50  ? 10.215  -1.266  47.019  1.00 35.70  ? 928  LEU D CA  1 
ATOM   4259 C C   . LEU D 1 50  ? 9.730   -0.252  45.961  1.00 36.34  ? 928  LEU D C   1 
ATOM   4260 O O   . LEU D 1 50  ? 10.543  0.403   45.293  1.00 36.64  ? 928  LEU D O   1 
ATOM   4261 C CB  . LEU D 1 50  ? 10.399  -2.642  46.371  1.00 35.99  ? 928  LEU D CB  1 
ATOM   4262 C CG  . LEU D 1 50  ? 11.748  -3.332  46.499  1.00 34.45  ? 928  LEU D CG  1 
ATOM   4263 C CD1 . LEU D 1 50  ? 12.691  -2.558  47.395  1.00 32.84  ? 928  LEU D CD1 1 
ATOM   4264 C CD2 . LEU D 1 50  ? 11.570  -4.790  46.926  1.00 29.96  ? 928  LEU D CD2 1 
ATOM   4265 N N   . LEU D 1 51  ? 8.410   -0.154  45.804  1.00 35.38  ? 929  LEU D N   1 
ATOM   4266 C CA  . LEU D 1 51  ? 7.796   0.830   44.913  1.00 36.34  ? 929  LEU D CA  1 
ATOM   4267 C C   . LEU D 1 51  ? 7.760   2.246   45.571  1.00 36.44  ? 929  LEU D C   1 
ATOM   4268 O O   . LEU D 1 51  ? 7.703   3.271   44.875  1.00 36.76  ? 929  LEU D O   1 
ATOM   4269 C CB  . LEU D 1 51  ? 6.387   0.411   44.550  1.00 34.51  ? 929  LEU D CB  1 
ATOM   4270 C CG  . LEU D 1 51  ? 6.312   -0.853  43.722  1.00 35.52  ? 929  LEU D CG  1 
ATOM   4271 C CD1 . LEU D 1 51  ? 5.017   -1.561  44.070  1.00 38.14  ? 929  LEU D CD1 1 
ATOM   4272 C CD2 . LEU D 1 51  ? 6.330   -0.477  42.241  1.00 34.60  ? 929  LEU D CD2 1 
ATOM   4273 N N   . MET D 1 52  ? 7.783   2.280   46.906  1.00 38.64  ? 930  MET D N   1 
ATOM   4274 C CA  . MET D 1 52  ? 7.826   3.514   47.659  1.00 38.54  ? 930  MET D CA  1 
ATOM   4275 C C   . MET D 1 52  ? 9.204   4.131   47.567  1.00 38.24  ? 930  MET D C   1 
ATOM   4276 O O   . MET D 1 52  ? 9.373   5.335   47.686  1.00 37.26  ? 930  MET D O   1 
ATOM   4277 C CB  . MET D 1 52  ? 7.567   3.217   49.121  1.00 43.14  ? 930  MET D CB  1 
ATOM   4278 C CG  . MET D 1 52  ? 7.253   4.473   49.893  1.00 44.42  ? 930  MET D CG  1 
ATOM   4279 S SD  . MET D 1 52  ? 5.831   5.253   49.100  1.00 48.37  ? 930  MET D SD  1 
ATOM   4280 C CE  . MET D 1 52  ? 4.988   3.742   48.475  1.00 48.80  ? 930  MET D CE  1 
ATOM   4281 N N   . ALA D 1 53  ? 10.191  3.257   47.517  1.00 37.85  ? 931  ALA D N   1 
ATOM   4282 C CA  . ALA D 1 53  ? 11.575  3.626   47.370  1.00 38.60  ? 931  ALA D CA  1 
ATOM   4283 C C   . ALA D 1 53  ? 11.697  4.227   45.961  1.00 39.78  ? 931  ALA D C   1 
ATOM   4284 O O   . ALA D 1 53  ? 12.308  5.294   45.770  1.00 40.12  ? 931  ALA D O   1 
ATOM   4285 C CB  . ALA D 1 53  ? 12.454  2.371   47.486  1.00 38.46  ? 931  ALA D CB  1 
ATOM   4286 N N   . GLU D 1 54  ? 11.079  3.567   44.974  1.00 40.28  ? 932  GLU D N   1 
ATOM   4287 C CA  . GLU D 1 54  ? 11.140  4.082   43.611  1.00 41.47  ? 932  GLU D CA  1 
ATOM   4288 C C   . GLU D 1 54  ? 10.521  5.480   43.550  1.00 41.80  ? 932  GLU D C   1 
ATOM   4289 O O   . GLU D 1 54  ? 11.009  6.365   42.865  1.00 42.70  ? 932  GLU D O   1 
ATOM   4290 C CB  . GLU D 1 54  ? 10.430  3.147   42.631  1.00 42.36  ? 932  GLU D CB  1 
ATOM   4291 C CG  . GLU D 1 54  ? 9.796   3.878   41.457  1.00 43.08  ? 932  GLU D CG  1 
ATOM   4292 C CD  . GLU D 1 54  ? 9.356   2.958   40.345  1.00 45.27  ? 932  GLU D CD  1 
ATOM   4293 O OE1 . GLU D 1 54  ? 9.304   3.413   39.175  1.00 46.53  ? 932  GLU D OE1 1 
ATOM   4294 O OE2 . GLU D 1 54  ? 9.038   1.785   40.634  1.00 46.89  ? 932  GLU D OE2 1 
ATOM   4295 N N   . MET D 1 55  ? 9.432   5.666   44.267  1.00 41.49  ? 933  MET D N   1 
ATOM   4296 C CA  . MET D 1 55  ? 8.729   6.918   44.234  1.00 42.06  ? 933  MET D CA  1 
ATOM   4297 C C   . MET D 1 55  ? 9.534   8.110   44.724  1.00 42.07  ? 933  MET D C   1 
ATOM   4298 O O   . MET D 1 55  ? 9.476   9.161   44.114  1.00 41.95  ? 933  MET D O   1 
ATOM   4299 C CB  . MET D 1 55  ? 7.426   6.791   45.004  1.00 46.65  ? 933  MET D CB  1 
ATOM   4300 C CG  . MET D 1 55  ? 6.467   7.913   44.695  1.00 47.94  ? 933  MET D CG  1 
ATOM   4301 S SD  . MET D 1 55  ? 4.748   7.412   44.818  1.00 48.41  ? 933  MET D SD  1 
ATOM   4302 C CE  . MET D 1 55  ? 4.341   7.072   43.018  1.00 47.01  ? 933  MET D CE  1 
ATOM   4303 N N   . SER D 1 56  ? 10.274  7.963   45.822  1.00 39.73  ? 934  SER D N   1 
ATOM   4304 C CA  . SER D 1 56  ? 11.062  9.083   46.337  1.00 40.47  ? 934  SER D CA  1 
ATOM   4305 C C   . SER D 1 56  ? 12.068  9.473   45.252  1.00 41.00  ? 934  SER D C   1 
ATOM   4306 O O   . SER D 1 56  ? 12.374  10.644  45.053  1.00 41.39  ? 934  SER D O   1 
ATOM   4307 C CB  . SER D 1 56  ? 11.772  8.705   47.635  1.00 42.76  ? 934  SER D CB  1 
ATOM   4308 O OG  . SER D 1 56  ? 12.353  7.415   47.518  1.00 43.05  ? 934  SER D OG  1 
ATOM   4309 N N   . ARG D 1 57  ? 12.563  8.473   44.533  1.00 43.46  ? 935  ARG D N   1 
ATOM   4310 C CA  . ARG D 1 57  ? 13.452  8.719   43.428  1.00 44.17  ? 935  ARG D CA  1 
ATOM   4311 C C   . ARG D 1 57  ? 12.647  9.514   42.381  1.00 45.21  ? 935  ARG D C   1 
ATOM   4312 O O   . ARG D 1 57  ? 13.020  10.642  42.049  1.00 45.62  ? 935  ARG D O   1 
ATOM   4313 C CB  . ARG D 1 57  ? 13.942  7.393   42.858  1.00 49.86  ? 935  ARG D CB  1 
ATOM   4314 C CG  . ARG D 1 57  ? 15.084  6.761   43.631  1.00 51.11  ? 935  ARG D CG  1 
ATOM   4315 C CD  . ARG D 1 57  ? 15.573  5.478   42.963  1.00 52.97  ? 935  ARG D CD  1 
ATOM   4316 N NE  . ARG D 1 57  ? 14.910  4.261   43.443  1.00 56.55  ? 935  ARG D NE  1 
ATOM   4317 C CZ  . ARG D 1 57  ? 14.338  3.356   42.637  1.00 59.31  ? 935  ARG D CZ  1 
ATOM   4318 N NH1 . ARG D 1 57  ? 14.334  3.548   41.315  1.00 61.19  ? 935  ARG D NH1 1 
ATOM   4319 N NH2 . ARG D 1 57  ? 13.754  2.259   43.128  1.00 59.08  ? 935  ARG D NH2 1 
ATOM   4320 N N   . LEU D 1 58  ? 11.533  8.946   41.898  1.00 44.56  ? 936  LEU D N   1 
ATOM   4321 C CA  . LEU D 1 58  ? 10.659  9.613   40.917  1.00 45.55  ? 936  LEU D CA  1 
ATOM   4322 C C   . LEU D 1 58  ? 10.196  11.014  41.295  1.00 46.30  ? 936  LEU D C   1 
ATOM   4323 O O   . LEU D 1 58  ? 9.964   11.835  40.411  1.00 46.79  ? 936  LEU D O   1 
ATOM   4324 C CB  . LEU D 1 58  ? 9.422   8.778   40.600  1.00 43.41  ? 936  LEU D CB  1 
ATOM   4325 C CG  . LEU D 1 58  ? 9.649   7.497   39.800  1.00 42.73  ? 936  LEU D CG  1 
ATOM   4326 C CD1 . LEU D 1 58  ? 8.336   6.774   39.585  1.00 40.10  ? 936  LEU D CD1 1 
ATOM   4327 C CD2 . LEU D 1 58  ? 10.357  7.788   38.499  1.00 40.18  ? 936  LEU D CD2 1 
ATOM   4328 N N   . VAL D 1 59  ? 10.031  11.266  42.594  1.00 51.53  ? 937  VAL D N   1 
ATOM   4329 C CA  . VAL D 1 59  ? 9.617   12.574  43.120  1.00 52.21  ? 937  VAL D CA  1 
ATOM   4330 C C   . VAL D 1 59  ? 10.655  13.703  42.883  1.00 53.51  ? 937  VAL D C   1 
ATOM   4331 O O   . VAL D 1 59  ? 10.382  14.871  43.114  1.00 53.32  ? 937  VAL D O   1 
ATOM   4332 C CB  . VAL D 1 59  ? 9.042   12.473  44.579  1.00 53.32  ? 937  VAL D CB  1 
ATOM   4333 C CG1 . VAL D 1 59  ? 9.784   13.336  45.577  1.00 51.93  ? 937  VAL D CG1 1 
ATOM   4334 C CG2 . VAL D 1 59  ? 7.579   12.757  44.605  1.00 52.99  ? 937  VAL D CG2 1 
ATOM   4335 N N   . ARG D 1 60  ? 11.812  13.368  42.332  1.00 63.39  ? 938  ARG D N   1 
ATOM   4336 C CA  . ARG D 1 60  ? 12.795  14.387  41.956  1.00 65.04  ? 938  ARG D CA  1 
ATOM   4337 C C   . ARG D 1 60  ? 12.853  14.454  40.427  1.00 65.65  ? 938  ARG D C   1 
ATOM   4338 O O   . ARG D 1 60  ? 13.003  15.525  39.855  1.00 66.12  ? 938  ARG D O   1 
ATOM   4339 C CB  . ARG D 1 60  ? 14.163  14.026  42.498  1.00 72.97  ? 938  ARG D CB  1 
ATOM   4340 C CG  . ARG D 1 60  ? 14.075  13.237  43.770  1.00 74.06  ? 938  ARG D CG  1 
ATOM   4341 C CD  . ARG D 1 60  ? 13.488  14.109  44.816  1.00 76.15  ? 938  ARG D CD  1 
ATOM   4342 N NE  . ARG D 1 60  ? 13.856  15.496  44.576  1.00 80.82  ? 938  ARG D NE  1 
ATOM   4343 C CZ  . ARG D 1 60  ? 14.908  16.114  45.125  1.00 81.94  ? 938  ARG D CZ  1 
ATOM   4344 N NH1 . ARG D 1 60  ? 15.734  15.471  45.957  1.00 82.52  ? 938  ARG D NH1 1 
ATOM   4345 N NH2 . ARG D 1 60  ? 15.130  17.401  44.847  1.00 81.98  ? 938  ARG D NH2 1 
ATOM   4346 N N   . GLY D 1 61  ? 12.686  13.288  39.802  1.00 70.18  ? 939  GLY D N   1 
ATOM   4347 C CA  . GLY D 1 61  ? 12.694  13.001  38.373  1.00 70.60  ? 939  GLY D CA  1 
ATOM   4348 C C   . GLY D 1 61  ? 12.627  14.100  37.339  1.00 70.89  ? 939  GLY D C   1 
ATOM   4349 O O   . GLY D 1 61  ? 13.154  13.944  36.231  1.00 70.69  ? 939  GLY D O   1 
ATOM   4350 N N   . GLY D 1 62  ? 11.960  15.197  37.670  1.00 74.06  ? 940  GLY D N   1 
ATOM   4351 C CA  . GLY D 1 62  ? 11.817  16.303  36.737  1.00 75.25  ? 940  GLY D CA  1 
ATOM   4352 C C   . GLY D 1 62  ? 10.819  15.901  35.667  1.00 76.01  ? 940  GLY D C   1 
ATOM   4353 O O   . GLY D 1 62  ? 9.692   16.393  35.639  1.00 75.97  ? 940  GLY D O   1 
ATOM   4354 N N   . SER D 1 63  ? 11.228  14.970  34.809  1.00 74.95  ? 941  SER D N   1 
ATOM   4355 C CA  . SER D 1 63  ? 10.371  14.401  33.752  1.00 75.43  ? 941  SER D CA  1 
ATOM   4356 C C   . SER D 1 63  ? 11.280  13.338  33.111  1.00 75.70  ? 941  SER D C   1 
ATOM   4357 O O   . SER D 1 63  ? 12.492  13.446  33.287  1.00 76.43  ? 941  SER D O   1 
ATOM   4358 C CB  . SER D 1 63  ? 9.953   15.483  32.732  1.00 80.07  ? 941  SER D CB  1 
ATOM   4359 O OG  . SER D 1 63  ? 8.894   15.015  31.909  1.00 79.53  ? 941  SER D OG  1 
ATOM   4360 N N   . GLY D 1 64  ? 10.807  12.331  32.366  1.00 70.71  ? 942  GLY D N   1 
ATOM   4361 C CA  . GLY D 1 64  ? 9.476   11.870  32.084  1.00 69.01  ? 942  GLY D CA  1 
ATOM   4362 C C   . GLY D 1 64  ? 9.150   10.907  33.213  1.00 68.07  ? 942  GLY D C   1 
ATOM   4363 O O   . GLY D 1 64  ? 8.836   9.696   33.027  1.00 68.26  ? 942  GLY D O   1 
ATOM   4364 N N   . THR D 1 65  ? 9.262   11.473  34.411  1.00 59.52  ? 943  THR D N   1 
ATOM   4365 C CA  . THR D 1 65  ? 8.899   10.772  35.609  1.00 57.78  ? 943  THR D CA  1 
ATOM   4366 C C   . THR D 1 65  ? 7.368   10.866  35.665  1.00 56.73  ? 943  THR D C   1 
ATOM   4367 O O   . THR D 1 65  ? 6.728   10.142  36.438  1.00 56.72  ? 943  THR D O   1 
ATOM   4368 C CB  . THR D 1 65  ? 9.598   11.362  36.848  1.00 54.00  ? 943  THR D CB  1 
ATOM   4369 O OG1 . THR D 1 65  ? 9.497   12.789  36.832  1.00 53.92  ? 943  THR D OG1 1 
ATOM   4370 C CG2 . THR D 1 65  ? 11.047  10.978  36.857  1.00 54.24  ? 943  THR D CG2 1 
ATOM   4371 N N   . LYS D 1 66  ? 6.790   11.725  34.808  1.00 52.70  ? 944  LYS D N   1 
ATOM   4372 C CA  . LYS D 1 66  ? 5.326   11.887  34.717  1.00 51.76  ? 944  LYS D CA  1 
ATOM   4373 C C   . LYS D 1 66  ? 4.610   10.533  34.521  1.00 50.78  ? 944  LYS D C   1 
ATOM   4374 O O   . LYS D 1 66  ? 3.805   10.103  35.363  1.00 50.81  ? 944  LYS D O   1 
ATOM   4375 C CB  . LYS D 1 66  ? 4.944   12.864  33.598  1.00 54.23  ? 944  LYS D CB  1 
ATOM   4376 C CG  . LYS D 1 66  ? 6.094   13.164  32.605  1.00 55.66  ? 944  LYS D CG  1 
ATOM   4377 C CD  . LYS D 1 66  ? 5.786   12.699  31.146  1.00 58.04  ? 944  LYS D CD  1 
ATOM   4378 C CE  . LYS D 1 66  ? 6.917   11.845  30.535  1.00 58.47  ? 944  LYS D CE  1 
ATOM   4379 N NZ  . LYS D 1 66  ? 6.982   10.485  31.134  1.00 59.30  ? 944  LYS D NZ  1 
ATOM   4380 N N   . ARG D 1 67  ? 4.942   9.831   33.446  1.00 45.34  ? 945  ARG D N   1 
ATOM   4381 C CA  . ARG D 1 67  ? 4.327   8.546   33.213  1.00 43.66  ? 945  ARG D CA  1 
ATOM   4382 C C   . ARG D 1 67  ? 4.680   7.557   34.277  1.00 42.48  ? 945  ARG D C   1 
ATOM   4383 O O   . ARG D 1 67  ? 3.851   6.784   34.717  1.00 43.06  ? 945  ARG D O   1 
ATOM   4384 C CB  . ARG D 1 67  ? 4.725   8.000   31.859  1.00 45.25  ? 945  ARG D CB  1 
ATOM   4385 C CG  . ARG D 1 67  ? 3.933   8.559   30.748  1.00 44.60  ? 945  ARG D CG  1 
ATOM   4386 C CD  . ARG D 1 67  ? 3.779   7.502   29.729  1.00 47.84  ? 945  ARG D CD  1 
ATOM   4387 N NE  . ARG D 1 67  ? 4.745   7.704   28.663  1.00 50.00  ? 945  ARG D NE  1 
ATOM   4388 C CZ  . ARG D 1 67  ? 5.013   6.812   27.708  1.00 51.45  ? 945  ARG D CZ  1 
ATOM   4389 N NH1 . ARG D 1 67  ? 4.377   5.642   27.675  1.00 51.33  ? 945  ARG D NH1 1 
ATOM   4390 N NH2 . ARG D 1 67  ? 5.932   7.084   26.784  1.00 50.95  ? 945  ARG D NH2 1 
ATOM   4391 N N   . ALA D 1 68  ? 5.936   7.538   34.662  1.00 41.42  ? 946  ALA D N   1 
ATOM   4392 C CA  . ALA D 1 68  ? 6.387   6.595   35.685  1.00 39.96  ? 946  ALA D CA  1 
ATOM   4393 C C   . ALA D 1 68  ? 5.641   6.846   36.970  1.00 39.16  ? 946  ALA D C   1 
ATOM   4394 O O   . ALA D 1 68  ? 4.939   5.969   37.449  1.00 39.33  ? 946  ALA D O   1 
ATOM   4395 C CB  . ALA D 1 68  ? 7.876   6.715   35.917  1.00 40.11  ? 946  ALA D CB  1 
ATOM   4396 N N   . LEU D 1 69  ? 5.782   8.058   37.509  1.00 36.91  ? 947  LEU D N   1 
ATOM   4397 C CA  . LEU D 1 69  ? 5.123   8.465   38.761  1.00 36.07  ? 947  LEU D CA  1 
ATOM   4398 C C   . LEU D 1 69  ? 3.682   7.975   38.853  1.00 35.21  ? 947  LEU D C   1 
ATOM   4399 O O   . LEU D 1 69  ? 3.273   7.421   39.869  1.00 34.26  ? 947  LEU D O   1 
ATOM   4400 C CB  . LEU D 1 69  ? 5.148   9.983   38.902  1.00 35.77  ? 947  LEU D CB  1 
ATOM   4401 C CG  . LEU D 1 69  ? 4.786   10.370  40.329  1.00 34.24  ? 947  LEU D CG  1 
ATOM   4402 C CD1 . LEU D 1 69  ? 5.339   9.331   41.301  1.00 31.50  ? 947  LEU D CD1 1 
ATOM   4403 C CD2 . LEU D 1 69  ? 5.230   11.764  40.642  1.00 31.26  ? 947  LEU D CD2 1 
ATOM   4404 N N   . ILE D 1 70  ? 2.943   8.151   37.760  1.00 35.94  ? 948  ILE D N   1 
ATOM   4405 C CA  . ILE D 1 70  ? 1.560   7.674   37.655  1.00 36.21  ? 948  ILE D CA  1 
ATOM   4406 C C   . ILE D 1 70  ? 1.484   6.140   37.746  1.00 36.48  ? 948  ILE D C   1 
ATOM   4407 O O   . ILE D 1 70  ? 0.783   5.570   38.621  1.00 36.12  ? 948  ILE D O   1 
ATOM   4408 C CB  . ILE D 1 70  ? 0.886   8.133   36.364  1.00 36.27  ? 948  ILE D CB  1 
ATOM   4409 C CG1 . ILE D 1 70  ? 0.236   9.489   36.549  1.00 35.47  ? 948  ILE D CG1 1 
ATOM   4410 C CG2 . ILE D 1 70  ? -0.195  7.191   36.044  1.00 36.04  ? 948  ILE D CG2 1 
ATOM   4411 C CD1 . ILE D 1 70  ? 0.786   10.515  35.659  1.00 35.41  ? 948  ILE D CD1 1 
ATOM   4412 N N   . GLN D 1 71  ? 2.188   5.465   36.844  1.00 36.76  ? 949  GLN D N   1 
ATOM   4413 C CA  . GLN D 1 71  ? 2.182   4.008   36.884  1.00 38.44  ? 949  GLN D CA  1 
ATOM   4414 C C   . GLN D 1 71  ? 2.595   3.450   38.262  1.00 38.97  ? 949  GLN D C   1 
ATOM   4415 O O   . GLN D 1 71  ? 2.085   2.422   38.719  1.00 39.22  ? 949  GLN D O   1 
ATOM   4416 C CB  . GLN D 1 71  ? 3.148   3.467   35.845  1.00 40.23  ? 949  GLN D CB  1 
ATOM   4417 C CG  . GLN D 1 71  ? 2.773   2.117   35.343  1.00 41.48  ? 949  GLN D CG  1 
ATOM   4418 C CD  . GLN D 1 71  ? 1.258   1.939   35.284  1.00 43.22  ? 949  GLN D CD  1 
ATOM   4419 O OE1 . GLN D 1 71  ? 0.690   1.173   36.081  1.00 44.56  ? 949  GLN D OE1 1 
ATOM   4420 N NE2 . GLN D 1 71  ? 0.586   2.683   34.371  1.00 43.17  ? 949  GLN D NE2 1 
ATOM   4421 N N   . CYS D 1 72  ? 3.565   4.112   38.892  1.00 39.48  ? 950  CYS D N   1 
ATOM   4422 C CA  . CYS D 1 72  ? 4.097   3.652   40.139  1.00 38.99  ? 950  CYS D CA  1 
ATOM   4423 C C   . CYS D 1 72  ? 3.035   3.688   41.245  1.00 38.86  ? 950  CYS D C   1 
ATOM   4424 O O   . CYS D 1 72  ? 2.924   2.760   42.069  1.00 38.17  ? 950  CYS D O   1 
ATOM   4425 C CB  . CYS D 1 72  ? 5.305   4.482   40.491  1.00 39.62  ? 950  CYS D CB  1 
ATOM   4426 S SG  . CYS D 1 72  ? 5.986   4.028   42.084  1.00 42.26  ? 950  CYS D SG  1 
ATOM   4427 N N   . ALA D 1 73  ? 2.244   4.761   41.242  1.00 41.92  ? 951  ALA D N   1 
ATOM   4428 C CA  . ALA D 1 73  ? 1.175   4.951   42.216  1.00 40.99  ? 951  ALA D CA  1 
ATOM   4429 C C   . ALA D 1 73  ? 0.041   3.952   41.909  1.00 40.72  ? 951  ALA D C   1 
ATOM   4430 O O   . ALA D 1 73  ? -0.657  3.454   42.819  1.00 40.71  ? 951  ALA D O   1 
ATOM   4431 C CB  . ALA D 1 73  ? 0.681   6.368   42.170  1.00 40.98  ? 951  ALA D CB  1 
ATOM   4432 N N   . LYS D 1 74  ? -0.094  3.584   40.643  1.00 40.75  ? 952  LYS D N   1 
ATOM   4433 C CA  . LYS D 1 74  ? -1.088  2.572   40.301  1.00 41.18  ? 952  LYS D CA  1 
ATOM   4434 C C   . LYS D 1 74  ? -0.640  1.212   40.808  1.00 41.41  ? 952  LYS D C   1 
ATOM   4435 O O   . LYS D 1 74  ? -1.432  0.419   41.338  1.00 41.63  ? 952  LYS D O   1 
ATOM   4436 C CB  . LYS D 1 74  ? -1.303  2.512   38.805  1.00 43.13  ? 952  LYS D CB  1 
ATOM   4437 C CG  . LYS D 1 74  ? -2.152  3.640   38.320  1.00 43.15  ? 952  LYS D CG  1 
ATOM   4438 C CD  . LYS D 1 74  ? -2.745  3.278   37.014  1.00 45.72  ? 952  LYS D CD  1 
ATOM   4439 C CE  . LYS D 1 74  ? -2.099  4.057   35.900  1.00 48.24  ? 952  LYS D CE  1 
ATOM   4440 N NZ  . LYS D 1 74  ? -2.841  3.852   34.635  1.00 49.58  ? 952  LYS D NZ  1 
ATOM   4441 N N   . ASP D 1 75  ? 0.653   0.957   40.685  1.00 42.36  ? 953  ASP D N   1 
ATOM   4442 C CA  . ASP D 1 75  ? 1.211   -0.281  41.185  1.00 43.58  ? 953  ASP D CA  1 
ATOM   4443 C C   . ASP D 1 75  ? 0.927   -0.350  42.692  1.00 43.61  ? 953  ASP D C   1 
ATOM   4444 O O   . ASP D 1 75  ? 0.372   -1.349  43.196  1.00 43.27  ? 953  ASP D O   1 
ATOM   4445 C CB  . ASP D 1 75  ? 2.723   -0.311  40.939  1.00 46.59  ? 953  ASP D CB  1 
ATOM   4446 C CG  . ASP D 1 75  ? 3.080   -0.668  39.485  1.00 50.48  ? 953  ASP D CG  1 
ATOM   4447 O OD1 . ASP D 1 75  ? 2.135   -0.759  38.641  1.00 51.15  ? 953  ASP D OD1 1 
ATOM   4448 O OD2 . ASP D 1 75  ? 4.300   -0.890  39.189  1.00 54.63  ? 953  ASP D OD2 1 
ATOM   4449 N N   . ILE D 1 76  ? 1.323   0.704   43.410  1.00 40.03  ? 954  ILE D N   1 
ATOM   4450 C CA  . ILE D 1 76  ? 1.214   0.689   44.865  1.00 40.14  ? 954  ILE D CA  1 
ATOM   4451 C C   . ILE D 1 76  ? -0.193  0.321   45.320  1.00 39.85  ? 954  ILE D C   1 
ATOM   4452 O O   . ILE D 1 76  ? -0.388  -0.509  46.247  1.00 40.43  ? 954  ILE D O   1 
ATOM   4453 C CB  . ILE D 1 76  ? 1.719   1.966   45.548  1.00 40.80  ? 954  ILE D CB  1 
ATOM   4454 C CG1 . ILE D 1 76  ? 3.237   1.926   45.704  1.00 41.67  ? 954  ILE D CG1 1 
ATOM   4455 C CG2 . ILE D 1 76  ? 1.110   2.068   46.919  1.00 40.72  ? 954  ILE D CG2 1 
ATOM   4456 C CD1 . ILE D 1 76  ? 3.886   3.341   45.733  1.00 45.48  ? 954  ILE D CD1 1 
ATOM   4457 N N   . ALA D 1 77  ? -1.174  0.921   44.662  1.00 38.76  ? 955  ALA D N   1 
ATOM   4458 C CA  . ALA D 1 77  ? -2.541  0.643   45.027  1.00 38.18  ? 955  ALA D CA  1 
ATOM   4459 C C   . ALA D 1 77  ? -2.871  -0.812  44.717  1.00 37.60  ? 955  ALA D C   1 
ATOM   4460 O O   . ALA D 1 77  ? -3.576  -1.464  45.476  1.00 36.97  ? 955  ALA D O   1 
ATOM   4461 C CB  . ALA D 1 77  ? -3.488  1.604   44.353  1.00 38.41  ? 955  ALA D CB  1 
ATOM   4462 N N   . LYS D 1 78  ? -2.304  -1.366  43.655  1.00 38.57  ? 956  LYS D N   1 
ATOM   4463 C CA  . LYS D 1 78  ? -2.577  -2.779  43.380  1.00 38.56  ? 956  LYS D CA  1 
ATOM   4464 C C   . LYS D 1 78  ? -2.136  -3.628  44.583  1.00 38.10  ? 956  LYS D C   1 
ATOM   4465 O O   . LYS D 1 78  ? -2.925  -4.389  45.138  1.00 38.07  ? 956  LYS D O   1 
ATOM   4466 C CB  . LYS D 1 78  ? -1.896  -3.224  42.090  1.00 42.91  ? 956  LYS D CB  1 
ATOM   4467 C CG  . LYS D 1 78  ? -2.605  -4.352  41.339  1.00 44.12  ? 956  LYS D CG  1 
ATOM   4468 C CD  . LYS D 1 78  ? -1.768  -4.860  40.139  1.00 47.49  ? 956  LYS D CD  1 
ATOM   4469 C CE  . LYS D 1 78  ? -0.391  -4.064  39.971  1.00 51.69  ? 956  LYS D CE  1 
ATOM   4470 N NZ  . LYS D 1 78  ? 0.152   -3.862  38.553  1.00 51.45  ? 956  LYS D NZ  1 
ATOM   4471 N N   . ALA D 1 79  ? -0.894  -3.412  45.017  1.00 38.26  ? 957  ALA D N   1 
ATOM   4472 C CA  . ALA D 1 79  ? -0.312  -4.067  46.202  1.00 37.91  ? 957  ALA D CA  1 
ATOM   4473 C C   . ALA D 1 79  ? -1.144  -3.875  47.479  1.00 38.15  ? 957  ALA D C   1 
ATOM   4474 O O   . ALA D 1 79  ? -1.314  -4.819  48.215  1.00 37.96  ? 957  ALA D O   1 
ATOM   4475 C CB  . ALA D 1 79  ? 1.128   -3.566  46.437  1.00 38.29  ? 957  ALA D CB  1 
ATOM   4476 N N   . SER D 1 80  ? -1.626  -2.663  47.769  1.00 37.87  ? 958  SER D N   1 
ATOM   4477 C CA  . SER D 1 80  ? -2.466  -2.460  48.950  1.00 39.02  ? 958  SER D CA  1 
ATOM   4478 C C   . SER D 1 80  ? -3.779  -3.250  48.856  1.00 40.63  ? 958  SER D C   1 
ATOM   4479 O O   . SER D 1 80  ? -4.179  -3.921  49.820  1.00 40.76  ? 958  SER D O   1 
ATOM   4480 C CB  . SER D 1 80  ? -2.809  -1.001  49.108  1.00 40.90  ? 958  SER D CB  1 
ATOM   4481 O OG  . SER D 1 80  ? -2.055  -0.259  48.183  1.00 43.50  ? 958  SER D OG  1 
ATOM   4482 N N   . ASP D 1 81  ? -4.440  -3.164  47.692  1.00 45.43  ? 959  ASP D N   1 
ATOM   4483 C CA  . ASP D 1 81  ? -5.691  -3.883  47.426  1.00 46.31  ? 959  ASP D CA  1 
ATOM   4484 C C   . ASP D 1 81  ? -5.575  -5.362  47.818  1.00 46.42  ? 959  ASP D C   1 
ATOM   4485 O O   . ASP D 1 81  ? -6.530  -5.957  48.310  1.00 46.63  ? 959  ASP D O   1 
ATOM   4486 C CB  . ASP D 1 81  ? -6.111  -3.736  45.946  1.00 50.46  ? 959  ASP D CB  1 
ATOM   4487 C CG  . ASP D 1 81  ? -6.725  -2.329  45.612  1.00 54.55  ? 959  ASP D CG  1 
ATOM   4488 O OD1 . ASP D 1 81  ? -7.568  -1.808  46.398  1.00 57.04  ? 959  ASP D OD1 1 
ATOM   4489 O OD2 . ASP D 1 81  ? -6.362  -1.737  44.544  1.00 58.57  ? 959  ASP D OD2 1 
ATOM   4490 N N   . GLU D 1 82  ? -4.393  -5.943  47.624  1.00 47.06  ? 960  GLU D N   1 
ATOM   4491 C CA  . GLU D 1 82  ? -4.130  -7.343  47.981  1.00 47.65  ? 960  GLU D CA  1 
ATOM   4492 C C   . GLU D 1 82  ? -3.799  -7.510  49.462  1.00 47.22  ? 960  GLU D C   1 
ATOM   4493 O O   . GLU D 1 82  ? -4.079  -8.538  50.069  1.00 48.05  ? 960  GLU D O   1 
ATOM   4494 C CB  . GLU D 1 82  ? -3.003  -7.921  47.123  1.00 50.93  ? 960  GLU D CB  1 
ATOM   4495 C CG  . GLU D 1 82  ? -3.399  -8.219  45.640  1.00 55.95  ? 960  GLU D CG  1 
ATOM   4496 C CD  . GLU D 1 82  ? -4.810  -7.699  45.200  1.00 60.24  ? 960  GLU D CD  1 
ATOM   4497 O OE1 . GLU D 1 82  ? -4.845  -6.617  44.521  1.00 59.59  ? 960  GLU D OE1 1 
ATOM   4498 O OE2 . GLU D 1 82  ? -5.833  -8.451  45.396  1.00 56.34  ? 960  GLU D OE2 1 
ATOM   4499 N N   . VAL D 1 83  ? -3.229  -6.476  50.060  1.00 42.95  ? 961  VAL D N   1 
ATOM   4500 C CA  . VAL D 1 83  ? -2.953  -6.537  51.488  1.00 41.99  ? 961  VAL D CA  1 
ATOM   4501 C C   . VAL D 1 83  ? -4.312  -6.544  52.191  1.00 41.85  ? 961  VAL D C   1 
ATOM   4502 O O   . VAL D 1 83  ? -4.561  -7.355  53.072  1.00 42.13  ? 961  VAL D O   1 
ATOM   4503 C CB  . VAL D 1 83  ? -2.037  -5.381  51.976  1.00 41.86  ? 961  VAL D CB  1 
ATOM   4504 C CG1 . VAL D 1 83  ? -1.930  -5.426  53.481  1.00 40.72  ? 961  VAL D CG1 1 
ATOM   4505 C CG2 . VAL D 1 83  ? -0.666  -5.479  51.315  1.00 40.47  ? 961  VAL D CG2 1 
ATOM   4506 N N   . THR D 1 84  ? -5.191  -5.653  51.754  1.00 42.05  ? 962  THR D N   1 
ATOM   4507 C CA  . THR D 1 84  ? -6.527  -5.559  52.312  1.00 41.81  ? 962  THR D CA  1 
ATOM   4508 C C   . THR D 1 84  ? -7.298  -6.873  52.108  1.00 42.43  ? 962  THR D C   1 
ATOM   4509 O O   . THR D 1 84  ? -7.789  -7.483  53.067  1.00 42.51  ? 962  THR D O   1 
ATOM   4510 C CB  . THR D 1 84  ? -7.280  -4.394  51.690  1.00 41.30  ? 962  THR D CB  1 
ATOM   4511 O OG1 . THR D 1 84  ? -6.421  -3.252  51.624  1.00 41.78  ? 962  THR D OG1 1 
ATOM   4512 C CG2 . THR D 1 84  ? -8.522  -4.078  52.502  1.00 39.93  ? 962  THR D CG2 1 
ATOM   4513 N N   . ARG D 1 85  ? -7.403  -7.289  50.847  1.00 46.09  ? 963  ARG D N   1 
ATOM   4514 C CA  . ARG D 1 85  ? -8.088  -8.510  50.479  1.00 46.39  ? 963  ARG D CA  1 
ATOM   4515 C C   . ARG D 1 85  ? -7.715  -9.693  51.379  1.00 46.80  ? 963  ARG D C   1 
ATOM   4516 O O   . ARG D 1 85  ? -8.586  -10.433 51.827  1.00 47.07  ? 963  ARG D O   1 
ATOM   4517 C CB  . ARG D 1 85  ? -7.773  -8.860  49.033  1.00 56.62  ? 963  ARG D CB  1 
ATOM   4518 C CG  . ARG D 1 85  ? -8.502  -10.113 48.583  1.00 56.55  ? 963  ARG D CG  1 
ATOM   4519 C CD  . ARG D 1 85  ? -8.206  -10.490 47.143  1.00 54.45  ? 963  ARG D CD  1 
ATOM   4520 N NE  . ARG D 1 85  ? -6.835  -10.975 46.971  1.00 55.04  ? 963  ARG D NE  1 
ATOM   4521 C CZ  . ARG D 1 85  ? -6.410  -12.180 47.356  1.00 56.88  ? 963  ARG D CZ  1 
ATOM   4522 N NH1 . ARG D 1 85  ? -7.259  -13.031 47.952  1.00 55.17  ? 963  ARG D NH1 1 
ATOM   4523 N NH2 . ARG D 1 85  ? -5.141  -12.534 47.129  1.00 55.82  ? 963  ARG D NH2 1 
ATOM   4524 N N   . LEU D 1 86  ? -6.420  -9.866  51.633  1.00 45.67  ? 964  LEU D N   1 
ATOM   4525 C CA  . LEU D 1 86  ? -5.912  -10.969 52.455  1.00 46.50  ? 964  LEU D CA  1 
ATOM   4526 C C   . LEU D 1 86  ? -6.104  -10.738 53.959  1.00 47.45  ? 964  LEU D C   1 
ATOM   4527 O O   . LEU D 1 86  ? -6.374  -11.679 54.725  1.00 47.37  ? 964  LEU D O   1 
ATOM   4528 C CB  . LEU D 1 86  ? -4.428  -11.245 52.145  1.00 46.12  ? 964  LEU D CB  1 
ATOM   4529 C CG  . LEU D 1 86  ? -4.129  -11.740 50.717  1.00 45.76  ? 964  LEU D CG  1 
ATOM   4530 C CD1 . LEU D 1 86  ? -2.646  -11.801 50.389  1.00 45.74  ? 964  LEU D CD1 1 
ATOM   4531 C CD2 . LEU D 1 86  ? -4.764  -13.057 50.446  1.00 43.91  ? 964  LEU D CD2 1 
ATOM   4532 N N   . ALA D 1 87  ? -5.944  -9.489  54.383  1.00 48.12  ? 965  ALA D N   1 
ATOM   4533 C CA  . ALA D 1 87  ? -6.142  -9.151  55.776  1.00 48.59  ? 965  ALA D CA  1 
ATOM   4534 C C   . ALA D 1 87  ? -7.594  -9.453  56.119  1.00 49.21  ? 965  ALA D C   1 
ATOM   4535 O O   . ALA D 1 87  ? -7.912  -9.811  57.241  1.00 49.36  ? 965  ALA D O   1 
ATOM   4536 C CB  . ALA D 1 87  ? -5.836  -7.699  56.011  1.00 48.88  ? 965  ALA D CB  1 
ATOM   4537 N N   . LYS D 1 88  ? -8.478  -9.340  55.136  1.00 51.96  ? 966  LYS D N   1 
ATOM   4538 C CA  . LYS D 1 88  ? -9.894  -9.593  55.389  1.00 52.57  ? 966  LYS D CA  1 
ATOM   4539 C C   . LYS D 1 88  ? -10.229 -11.066 55.519  1.00 52.89  ? 966  LYS D C   1 
ATOM   4540 O O   . LYS D 1 88  ? -11.114 -11.446 56.302  1.00 52.41  ? 966  LYS D O   1 
ATOM   4541 C CB  . LYS D 1 88  ? -10.778 -8.928  54.343  1.00 56.94  ? 966  LYS D CB  1 
ATOM   4542 C CG  . LYS D 1 88  ? -11.334 -7.602  54.809  1.00 57.75  ? 966  LYS D CG  1 
ATOM   4543 C CD  . LYS D 1 88  ? -12.201 -6.949  53.756  1.00 58.53  ? 966  LYS D CD  1 
ATOM   4544 C CE  . LYS D 1 88  ? -12.089 -5.452  53.876  1.00 60.13  ? 966  LYS D CE  1 
ATOM   4545 N NZ  . LYS D 1 88  ? -10.929 -5.133  54.783  1.00 61.15  ? 966  LYS D NZ  1 
ATOM   4546 N N   . GLU D 1 89  ? -9.528  -11.893 54.748  1.00 53.42  ? 967  GLU D N   1 
ATOM   4547 C CA  . GLU D 1 89  ? -9.757  -13.315 54.822  1.00 54.66  ? 967  GLU D CA  1 
ATOM   4548 C C   . GLU D 1 89  ? -9.209  -13.823 56.154  1.00 54.88  ? 967  GLU D C   1 
ATOM   4549 O O   . GLU D 1 89  ? -9.750  -14.763 56.743  1.00 55.24  ? 967  GLU D O   1 
ATOM   4550 C CB  . GLU D 1 89  ? -9.143  -14.038 53.624  1.00 56.91  ? 967  GLU D CB  1 
ATOM   4551 C CG  . GLU D 1 89  ? -10.159 -14.845 52.728  1.00 61.42  ? 967  GLU D CG  1 
ATOM   4552 C CD  . GLU D 1 89  ? -11.368 -15.494 53.484  1.00 65.33  ? 967  GLU D CD  1 
ATOM   4553 O OE1 . GLU D 1 89  ? -12.509 -15.039 53.247  1.00 65.95  ? 967  GLU D OE1 1 
ATOM   4554 O OE2 . GLU D 1 89  ? -11.202 -16.499 54.228  1.00 64.43  ? 967  GLU D OE2 1 
ATOM   4555 N N   . VAL D 1 90  ? -8.185  -13.139 56.666  1.00 51.77  ? 968  VAL D N   1 
ATOM   4556 C CA  . VAL D 1 90  ? -7.593  -13.468 57.956  1.00 51.77  ? 968  VAL D CA  1 
ATOM   4557 C C   . VAL D 1 90  ? -8.573  -13.094 59.035  1.00 52.17  ? 968  VAL D C   1 
ATOM   4558 O O   . VAL D 1 90  ? -8.773  -13.818 59.999  1.00 52.30  ? 968  VAL D O   1 
ATOM   4559 C CB  . VAL D 1 90  ? -6.297  -12.690 58.191  1.00 53.26  ? 968  VAL D CB  1 
ATOM   4560 C CG1 . VAL D 1 90  ? -5.884  -12.784 59.657  1.00 52.16  ? 968  VAL D CG1 1 
ATOM   4561 C CG2 . VAL D 1 90  ? -5.185  -13.162 57.242  1.00 53.31  ? 968  VAL D CG2 1 
ATOM   4562 N N   . ALA D 1 91  ? -9.138  -11.910 58.907  1.00 54.84  ? 969  ALA D N   1 
ATOM   4563 C CA  . ALA D 1 91  ? -10.095 -11.424 59.882  1.00 56.14  ? 969  ALA D CA  1 
ATOM   4564 C C   . ALA D 1 91  ? -11.345 -12.318 59.889  1.00 57.51  ? 969  ALA D C   1 
ATOM   4565 O O   . ALA D 1 91  ? -11.946 -12.557 60.951  1.00 57.88  ? 969  ALA D O   1 
ATOM   4566 C CB  . ALA D 1 91  ? -10.469 -9.980  59.559  1.00 56.67  ? 969  ALA D CB  1 
ATOM   4567 N N   . LYS D 1 92  ? -11.734 -12.792 58.700  1.00 60.75  ? 970  LYS D N   1 
ATOM   4568 C CA  . LYS D 1 92  ? -12.908 -13.651 58.535  1.00 61.71  ? 970  LYS D CA  1 
ATOM   4569 C C   . LYS D 1 92  ? -12.660 -15.008 59.196  1.00 62.02  ? 970  LYS D C   1 
ATOM   4570 O O   . LYS D 1 92  ? -13.598 -15.743 59.496  1.00 62.23  ? 970  LYS D O   1 
ATOM   4571 C CB  . LYS D 1 92  ? -13.230 -13.834 57.037  1.00 66.50  ? 970  LYS D CB  1 
ATOM   4572 C CG  . LYS D 1 92  ? -14.562 -14.541 56.725  1.00 67.63  ? 970  LYS D CG  1 
ATOM   4573 C CD  . LYS D 1 92  ? -14.730 -14.858 55.229  1.00 68.15  ? 970  LYS D CD  1 
ATOM   4574 C CE  . LYS D 1 92  ? -15.481 -16.198 54.976  1.00 69.31  ? 970  LYS D CE  1 
ATOM   4575 N NZ  . LYS D 1 92  ? -15.282 -16.781 53.607  1.00 67.87  ? 970  LYS D NZ  1 
ATOM   4576 N N   . GLN D 1 93  ? -11.393 -15.339 59.415  1.00 62.06  ? 971  GLN D N   1 
ATOM   4577 C CA  . GLN D 1 93  ? -11.039 -16.613 60.036  1.00 62.69  ? 971  GLN D CA  1 
ATOM   4578 C C   . GLN D 1 93  ? -10.788 -16.464 61.541  1.00 62.43  ? 971  GLN D C   1 
ATOM   4579 O O   . GLN D 1 93  ? -10.840 -17.443 62.292  1.00 62.32  ? 971  GLN D O   1 
ATOM   4580 C CB  . GLN D 1 93  ? -9.810  -17.230 59.341  1.00 63.53  ? 971  GLN D CB  1 
ATOM   4581 C CG  . GLN D 1 93  ? -10.045 -18.629 58.705  1.00 66.67  ? 971  GLN D CG  1 
ATOM   4582 C CD  . GLN D 1 93  ? -11.414 -18.761 58.004  1.00 70.36  ? 971  GLN D CD  1 
ATOM   4583 O OE1 . GLN D 1 93  ? -12.170 -19.710 58.270  1.00 73.26  ? 971  GLN D OE1 1 
ATOM   4584 N NE2 . GLN D 1 93  ? -11.735 -17.804 57.104  1.00 68.71  ? 971  GLN D NE2 1 
ATOM   4585 N N   . CYS D 1 94  ? -10.491 -15.241 61.966  1.00 63.73  ? 972  CYS D N   1 
ATOM   4586 C CA  . CYS D 1 94  ? -10.211 -14.972 63.358  1.00 62.63  ? 972  CYS D CA  1 
ATOM   4587 C C   . CYS D 1 94  ? -11.445 -15.214 64.210  1.00 62.38  ? 972  CYS D C   1 
ATOM   4588 O O   . CYS D 1 94  ? -12.578 -14.959 63.764  1.00 62.42  ? 972  CYS D O   1 
ATOM   4589 C CB  . CYS D 1 94  ? -9.735  -13.539 63.511  1.00 62.96  ? 972  CYS D CB  1 
ATOM   4590 S SG  . CYS D 1 94  ? -8.884  -13.216 65.065  1.00 61.22  ? 972  CYS D SG  1 
ATOM   4591 N N   . THR D 1 95  ? -11.222 -15.732 65.421  1.00 61.57  ? 973  THR D N   1 
ATOM   4592 C CA  . THR D 1 95  ? -12.295 -16.026 66.372  1.00 61.26  ? 973  THR D CA  1 
ATOM   4593 C C   . THR D 1 95  ? -12.169 -15.119 67.596  1.00 61.88  ? 973  THR D C   1 
ATOM   4594 O O   . THR D 1 95  ? -12.812 -15.336 68.632  1.00 62.64  ? 973  THR D O   1 
ATOM   4595 C CB  . THR D 1 95  ? -12.336 -17.516 66.772  1.00 60.77  ? 973  THR D CB  1 
ATOM   4596 O OG1 . THR D 1 95  ? -11.187 -17.841 67.559  1.00 59.85  ? 973  THR D OG1 1 
ATOM   4597 C CG2 . THR D 1 95  ? -12.374 -18.413 65.556  1.00 60.30  ? 973  THR D CG2 1 
ATOM   4598 N N   . ASP D 1 96  ? -11.356 -14.078 67.466  1.00 61.90  ? 974  ASP D N   1 
ATOM   4599 C CA  . ASP D 1 96  ? -11.177 -13.132 68.557  1.00 61.96  ? 974  ASP D CA  1 
ATOM   4600 C C   . ASP D 1 96  ? -11.743 -11.727 68.250  1.00 62.02  ? 974  ASP D C   1 
ATOM   4601 O O   . ASP D 1 96  ? -11.125 -10.927 67.535  1.00 62.11  ? 974  ASP D O   1 
ATOM   4602 C CB  . ASP D 1 96  ? -9.711  -13.052 68.951  1.00 63.69  ? 974  ASP D CB  1 
ATOM   4603 C CG  . ASP D 1 96  ? -9.508  -12.261 70.205  1.00 64.28  ? 974  ASP D CG  1 
ATOM   4604 O OD1 . ASP D 1 96  ? -10.514 -11.808 70.790  1.00 66.30  ? 974  ASP D OD1 1 
ATOM   4605 O OD2 . ASP D 1 96  ? -8.349  -12.100 70.618  1.00 64.69  ? 974  ASP D OD2 1 
ATOM   4606 N N   . LYS D 1 97  ? -12.919 -11.428 68.797  1.00 63.11  ? 975  LYS D N   1 
ATOM   4607 C CA  . LYS D 1 97  ? -13.554 -10.133 68.568  1.00 62.52  ? 975  LYS D CA  1 
ATOM   4608 C C   . LYS D 1 97  ? -12.597 -8.952  68.795  1.00 62.17  ? 975  LYS D C   1 
ATOM   4609 O O   . LYS D 1 97  ? -12.609 -7.964  68.060  1.00 62.14  ? 975  LYS D O   1 
ATOM   4610 C CB  . LYS D 1 97  ? -14.786 -9.996  69.460  1.00 66.77  ? 975  LYS D CB  1 
ATOM   4611 C CG  . LYS D 1 97  ? -15.899 -9.154  68.863  1.00 66.83  ? 975  LYS D CG  1 
ATOM   4612 C CD  . LYS D 1 97  ? -16.655 -8.388  69.956  1.00 67.55  ? 975  LYS D CD  1 
ATOM   4613 C CE  . LYS D 1 97  ? -17.987 -7.840  69.442  1.00 67.26  ? 975  LYS D CE  1 
ATOM   4614 N NZ  . LYS D 1 97  ? -18.058 -7.745  67.943  1.00 66.83  ? 975  LYS D NZ  1 
ATOM   4615 N N   . ARG D 1 98  ? -11.772 -9.055  69.825  1.00 62.94  ? 976  ARG D N   1 
ATOM   4616 C CA  . ARG D 1 98  ? -10.848 -7.987  70.121  1.00 62.45  ? 976  ARG D CA  1 
ATOM   4617 C C   . ARG D 1 98  ? -9.993  -7.717  68.908  1.00 62.01  ? 976  ARG D C   1 
ATOM   4618 O O   . ARG D 1 98  ? -10.074 -6.642  68.321  1.00 62.29  ? 976  ARG D O   1 
ATOM   4619 C CB  . ARG D 1 98  ? -9.980  -8.336  71.319  1.00 68.96  ? 976  ARG D CB  1 
ATOM   4620 C CG  . ARG D 1 98  ? -9.435  -7.104  71.960  1.00 68.95  ? 976  ARG D CG  1 
ATOM   4621 C CD  . ARG D 1 98  ? -10.191 -5.940  71.374  1.00 68.22  ? 976  ARG D CD  1 
ATOM   4622 N NE  . ARG D 1 98  ? -9.610  -4.655  71.724  1.00 70.86  ? 976  ARG D NE  1 
ATOM   4623 C CZ  . ARG D 1 98  ? -10.040 -3.493  71.243  1.00 72.79  ? 976  ARG D CZ  1 
ATOM   4624 N NH1 . ARG D 1 98  ? -11.057 -3.473  70.378  1.00 72.58  ? 976  ARG D NH1 1 
ATOM   4625 N NH2 . ARG D 1 98  ? -9.447  -2.358  71.625  1.00 70.53  ? 976  ARG D NH2 1 
ATOM   4626 N N   . ILE D 1 99  ? -9.235  -8.734  68.496  1.00 59.22  ? 977  ILE D N   1 
ATOM   4627 C CA  . ILE D 1 99  ? -8.359  -8.666  67.335  1.00 58.10  ? 977  ILE D CA  1 
ATOM   4628 C C   . ILE D 1 99  ? -9.071  -8.557  65.989  1.00 57.44  ? 977  ILE D C   1 
ATOM   4629 O O   . ILE D 1 99  ? -8.746  -7.684  65.206  1.00 57.27  ? 977  ILE D O   1 
ATOM   4630 C CB  . ILE D 1 99  ? -7.347  -9.803  67.312  1.00 61.54  ? 977  ILE D CB  1 
ATOM   4631 C CG1 . ILE D 1 99  ? -6.722  -10.017 68.685  1.00 60.46  ? 977  ILE D CG1 1 
ATOM   4632 C CG2 . ILE D 1 99  ? -6.267  -9.476  66.328  1.00 62.37  ? 977  ILE D CG2 1 
ATOM   4633 C CD1 . ILE D 1 99  ? -6.334  -8.742  69.367  1.00 61.19  ? 977  ILE D CD1 1 
ATOM   4634 N N   . ARG D 1 100 ? -10.020 -9.443  65.704  1.00 56.16  ? 978  ARG D N   1 
ATOM   4635 C CA  . ARG D 1 100 ? -10.749 -9.373  64.433  1.00 56.52  ? 978  ARG D CA  1 
ATOM   4636 C C   . ARG D 1 100 ? -11.214 -7.938  64.158  1.00 56.61  ? 978  ARG D C   1 
ATOM   4637 O O   . ARG D 1 100 ? -11.354 -7.512  63.001  1.00 56.46  ? 978  ARG D O   1 
ATOM   4638 C CB  . ARG D 1 100 ? -11.970 -10.297 64.432  1.00 54.39  ? 978  ARG D CB  1 
ATOM   4639 C CG  . ARG D 1 100 ? -12.502 -10.605 63.029  1.00 56.32  ? 978  ARG D CG  1 
ATOM   4640 C CD  . ARG D 1 100 ? -14.020 -10.527 62.951  1.00 58.64  ? 978  ARG D CD  1 
ATOM   4641 N NE  . ARG D 1 100 ? -14.648 -10.560 64.275  1.00 61.44  ? 978  ARG D NE  1 
ATOM   4642 C CZ  . ARG D 1 100 ? -14.774 -11.656 65.034  1.00 61.70  ? 978  ARG D CZ  1 
ATOM   4643 N NH1 . ARG D 1 100 ? -14.310 -12.840 64.615  1.00 59.79  ? 978  ARG D NH1 1 
ATOM   4644 N NH2 . ARG D 1 100 ? -15.360 -11.565 66.228  1.00 60.58  ? 978  ARG D NH2 1 
ATOM   4645 N N   . THR D 1 101 ? -11.443 -7.204  65.242  1.00 57.79  ? 979  THR D N   1 
ATOM   4646 C CA  . THR D 1 101 ? -11.916 -5.847  65.152  1.00 56.92  ? 979  THR D CA  1 
ATOM   4647 C C   . THR D 1 101 ? -10.795 -4.899  64.805  1.00 57.41  ? 979  THR D C   1 
ATOM   4648 O O   . THR D 1 101 ? -10.924 -4.082  63.881  1.00 58.22  ? 979  THR D O   1 
ATOM   4649 C CB  . THR D 1 101 ? -12.630 -5.434  66.414  1.00 60.82  ? 979  THR D CB  1 
ATOM   4650 O OG1 . THR D 1 101 ? -13.901 -6.082  66.447  1.00 60.47  ? 979  THR D OG1 1 
ATOM   4651 C CG2 . THR D 1 101 ? -12.818 -3.920  66.448  1.00 58.73  ? 979  THR D CG2 1 
ATOM   4652 N N   . ASN D 1 102 ? -9.690  -5.012  65.531  1.00 56.53  ? 980  ASN D N   1 
ATOM   4653 C CA  . ASN D 1 102 ? -8.573  -4.145  65.250  1.00 56.61  ? 980  ASN D CA  1 
ATOM   4654 C C   . ASN D 1 102 ? -8.139  -4.334  63.811  1.00 56.34  ? 980  ASN D C   1 
ATOM   4655 O O   . ASN D 1 102 ? -7.990  -3.383  63.067  1.00 56.43  ? 980  ASN D O   1 
ATOM   4656 C CB  . ASN D 1 102 ? -7.418  -4.409  66.207  1.00 64.57  ? 980  ASN D CB  1 
ATOM   4657 C CG  . ASN D 1 102 ? -7.810  -4.218  67.666  1.00 65.15  ? 980  ASN D CG  1 
ATOM   4658 O OD1 . ASN D 1 102 ? -7.109  -4.685  68.570  1.00 62.56  ? 980  ASN D OD1 1 
ATOM   4659 N ND2 . ASN D 1 102 ? -8.941  -3.538  67.902  1.00 65.47  ? 980  ASN D ND2 1 
ATOM   4660 N N   . LEU D 1 103 ? -7.995  -5.571  63.397  1.00 54.12  ? 981  LEU D N   1 
ATOM   4661 C CA  . LEU D 1 103 ? -7.614  -5.851  62.027  1.00 54.70  ? 981  LEU D CA  1 
ATOM   4662 C C   . LEU D 1 103 ? -8.479  -5.147  60.975  1.00 55.28  ? 981  LEU D C   1 
ATOM   4663 O O   . LEU D 1 103 ? -7.961  -4.624  59.993  1.00 55.28  ? 981  LEU D O   1 
ATOM   4664 C CB  . LEU D 1 103 ? -7.639  -7.360  61.777  1.00 53.68  ? 981  LEU D CB  1 
ATOM   4665 C CG  . LEU D 1 103 ? -6.967  -7.820  60.493  1.00 54.06  ? 981  LEU D CG  1 
ATOM   4666 C CD1 . LEU D 1 103 ? -5.581  -7.159  60.378  1.00 56.91  ? 981  LEU D CD1 1 
ATOM   4667 C CD2 . LEU D 1 103 ? -6.826  -9.326  60.501  1.00 54.22  ? 981  LEU D CD2 1 
ATOM   4668 N N   . LEU D 1 104 ? -9.794  -5.191  61.134  1.00 56.94  ? 982  LEU D N   1 
ATOM   4669 C CA  . LEU D 1 104 ? -10.658 -4.596  60.139  1.00 57.86  ? 982  LEU D CA  1 
ATOM   4670 C C   . LEU D 1 104 ? -10.536 -3.098  60.162  1.00 59.46  ? 982  LEU D C   1 
ATOM   4671 O O   . LEU D 1 104 ? -10.524 -2.447  59.122  1.00 59.72  ? 982  LEU D O   1 
ATOM   4672 C CB  . LEU D 1 104 ? -12.089 -5.021  60.353  1.00 58.09  ? 982  LEU D CB  1 
ATOM   4673 C CG  . LEU D 1 104 ? -12.227 -6.481  59.940  1.00 56.55  ? 982  LEU D CG  1 
ATOM   4674 C CD1 . LEU D 1 104 ? -13.636 -6.965  60.190  1.00 53.90  ? 982  LEU D CD1 1 
ATOM   4675 C CD2 . LEU D 1 104 ? -11.823 -6.650  58.495  1.00 53.46  ? 982  LEU D CD2 1 
ATOM   4676 N N   . GLN D 1 105 ? -10.382 -2.555  61.359  1.00 63.40  ? 983  GLN D N   1 
ATOM   4677 C CA  . GLN D 1 105 ? -10.236 -1.120  61.527  1.00 64.84  ? 983  GLN D CA  1 
ATOM   4678 C C   . GLN D 1 105 ? -9.076  -0.585  60.723  1.00 64.96  ? 983  GLN D C   1 
ATOM   4679 O O   . GLN D 1 105 ? -9.246  0.259   59.842  1.00 65.54  ? 983  GLN D O   1 
ATOM   4680 C CB  . GLN D 1 105 ? -10.008 -0.805  63.000  1.00 68.26  ? 983  GLN D CB  1 
ATOM   4681 C CG  . GLN D 1 105 ? -9.556  0.612   63.277  1.00 70.98  ? 983  GLN D CG  1 
ATOM   4682 C CD  . GLN D 1 105 ? -8.596  0.660   64.453  1.00 74.18  ? 983  GLN D CD  1 
ATOM   4683 O OE1 . GLN D 1 105 ? -8.442  1.693   65.118  1.00 74.85  ? 983  GLN D OE1 1 
ATOM   4684 N NE2 . GLN D 1 105 ? -7.961  -0.477  64.735  1.00 73.70  ? 983  GLN D NE2 1 
ATOM   4685 N N   . VAL D 1 106 ? -7.890  -1.083  61.047  1.00 64.59  ? 984  VAL D N   1 
ATOM   4686 C CA  . VAL D 1 106 ? -6.646  -0.644  60.415  1.00 64.67  ? 984  VAL D CA  1 
ATOM   4687 C C   . VAL D 1 106 ? -6.546  -0.865  58.920  1.00 64.58  ? 984  VAL D C   1 
ATOM   4688 O O   . VAL D 1 106 ? -5.815  -0.147  58.241  1.00 64.42  ? 984  VAL D O   1 
ATOM   4689 C CB  . VAL D 1 106 ? -5.415  -1.262  61.099  1.00 68.22  ? 984  VAL D CB  1 
ATOM   4690 C CG1 . VAL D 1 106 ? -5.231  -0.719  62.509  1.00 68.21  ? 984  VAL D CG1 1 
ATOM   4691 C CG2 . VAL D 1 106 ? -5.521  -2.760  61.095  1.00 67.17  ? 984  VAL D CG2 1 
ATOM   4692 N N   . CYS D 1 107 ? -7.205  -1.900  58.419  1.00 63.93  ? 985  CYS D N   1 
ATOM   4693 C CA  . CYS D 1 107 ? -7.111  -2.218  57.004  1.00 64.63  ? 985  CYS D CA  1 
ATOM   4694 C C   . CYS D 1 107 ? -8.207  -1.596  56.170  1.00 64.40  ? 985  CYS D C   1 
ATOM   4695 O O   . CYS D 1 107 ? -8.265  -1.783  54.961  1.00 64.36  ? 985  CYS D O   1 
ATOM   4696 C CB  . CYS D 1 107 ? -7.005  -3.736  56.769  1.00 64.17  ? 985  CYS D CB  1 
ATOM   4697 S SG  . CYS D 1 107 ? -8.544  -4.640  56.925  1.00 64.83  ? 985  CYS D SG  1 
ATOM   4698 N N   . GLU D 1 108 ? -9.086  -0.845  56.808  1.00 66.92  ? 986  GLU D N   1 
ATOM   4699 C CA  . GLU D 1 108 ? -10.175 -0.232  56.051  1.00 67.42  ? 986  GLU D CA  1 
ATOM   4700 C C   . GLU D 1 108 ? -9.646  0.995   55.359  1.00 66.12  ? 986  GLU D C   1 
ATOM   4701 O O   . GLU D 1 108 ? -10.000 1.278   54.212  1.00 66.40  ? 986  GLU D O   1 
ATOM   4702 C CB  . GLU D 1 108 ? -11.355 0.162   56.953  1.00 69.32  ? 986  GLU D CB  1 
ATOM   4703 C CG  . GLU D 1 108 ? -12.171 -0.991  57.535  1.00 73.29  ? 986  GLU D CG  1 
ATOM   4704 C CD  . GLU D 1 108 ? -12.366 -2.194  56.591  1.00 77.79  ? 986  GLU D CD  1 
ATOM   4705 O OE1 . GLU D 1 108 ? -12.876 -3.237  57.086  1.00 79.19  ? 986  GLU D OE1 1 
ATOM   4706 O OE2 . GLU D 1 108 ? -12.084 -2.079  55.365  1.00 78.72  ? 986  GLU D OE2 1 
ATOM   4707 N N   . ARG D 1 109 ? -8.815  1.729   56.087  1.00 61.47  ? 987  ARG D N   1 
ATOM   4708 C CA  . ARG D 1 109 ? -8.236  2.964   55.595  1.00 59.77  ? 987  ARG D CA  1 
ATOM   4709 C C   . ARG D 1 109 ? -7.303  2.743   54.414  1.00 57.57  ? 987  ARG D C   1 
ATOM   4710 O O   . ARG D 1 109 ? -7.158  3.618   53.579  1.00 57.42  ? 987  ARG D O   1 
ATOM   4711 C CB  . ARG D 1 109 ? -7.506  3.671   56.735  1.00 66.20  ? 987  ARG D CB  1 
ATOM   4712 C CG  . ARG D 1 109 ? -7.802  3.046   58.086  1.00 68.77  ? 987  ARG D CG  1 
ATOM   4713 C CD  . ARG D 1 109 ? -7.586  4.037   59.210  1.00 71.96  ? 987  ARG D CD  1 
ATOM   4714 N NE  . ARG D 1 109 ? -7.046  3.393   60.405  1.00 74.98  ? 987  ARG D NE  1 
ATOM   4715 C CZ  . ARG D 1 109 ? -5.757  3.120   60.568  1.00 76.28  ? 987  ARG D CZ  1 
ATOM   4716 N NH1 . ARG D 1 109 ? -4.899  3.442   59.605  1.00 76.77  ? 987  ARG D NH1 1 
ATOM   4717 N NH2 . ARG D 1 109 ? -5.326  2.525   61.677  1.00 76.54  ? 987  ARG D NH2 1 
ATOM   4718 N N   . ILE D 1 110 ? -6.681  1.574   54.345  1.00 50.36  ? 988  ILE D N   1 
ATOM   4719 C CA  . ILE D 1 110 ? -5.709  1.285   53.302  1.00 48.75  ? 988  ILE D CA  1 
ATOM   4720 C C   . ILE D 1 110 ? -6.101  1.689   51.901  1.00 48.18  ? 988  ILE D C   1 
ATOM   4721 O O   . ILE D 1 110 ? -5.362  2.402   51.242  1.00 48.18  ? 988  ILE D O   1 
ATOM   4722 C CB  . ILE D 1 110 ? -5.190  -0.147  53.349  1.00 52.02  ? 988  ILE D CB  1 
ATOM   4723 C CG1 . ILE D 1 110 ? -4.469  -0.422  54.681  1.00 51.38  ? 988  ILE D CG1 1 
ATOM   4724 C CG2 . ILE D 1 110 ? -4.330  -0.433  52.110  1.00 49.86  ? 988  ILE D CG2 1 
ATOM   4725 C CD1 . ILE D 1 110 ? -3.638  -1.688  54.668  1.00 48.33  ? 988  ILE D CD1 1 
ATOM   4726 N N   . PRO D 1 111 ? -7.267  1.224   51.418  1.00 46.79  ? 989  PRO D N   1 
ATOM   4727 C CA  . PRO D 1 111 ? -7.814  1.520   50.088  1.00 45.21  ? 989  PRO D CA  1 
ATOM   4728 C C   . PRO D 1 111 ? -7.918  3.027   49.889  1.00 44.17  ? 989  PRO D C   1 
ATOM   4729 O O   . PRO D 1 111 ? -7.528  3.563   48.858  1.00 43.98  ? 989  PRO D O   1 
ATOM   4730 C CB  . PRO D 1 111 ? -9.216  0.919   50.166  1.00 46.67  ? 989  PRO D CB  1 
ATOM   4731 C CG  . PRO D 1 111 ? -9.146  -0.105  51.266  1.00 46.94  ? 989  PRO D CG  1 
ATOM   4732 C CD  . PRO D 1 111 ? -8.234  0.484   52.253  1.00 47.87  ? 989  PRO D CD  1 
ATOM   4733 N N   . THR D 1 112 ? -8.453  3.708   50.894  1.00 42.62  ? 990  THR D N   1 
ATOM   4734 C CA  . THR D 1 112 ? -8.614  5.160   50.854  1.00 41.95  ? 990  THR D CA  1 
ATOM   4735 C C   . THR D 1 112 ? -7.279  5.885   50.729  1.00 41.14  ? 990  THR D C   1 
ATOM   4736 O O   . THR D 1 112 ? -7.097  6.695   49.820  1.00 40.76  ? 990  THR D O   1 
ATOM   4737 C CB  . THR D 1 112 ? -9.361  5.656   52.090  1.00 51.51  ? 990  THR D CB  1 
ATOM   4738 O OG1 . THR D 1 112 ? -10.458 4.779   52.373  1.00 54.40  ? 990  THR D OG1 1 
ATOM   4739 C CG2 . THR D 1 112 ? -9.864  7.059   51.861  1.00 50.97  ? 990  THR D CG2 1 
ATOM   4740 N N   . ILE D 1 113 ? -6.369  5.611   51.673  1.00 37.36  ? 991  ILE D N   1 
ATOM   4741 C CA  . ILE D 1 113 ? -5.041  6.177   51.655  1.00 36.34  ? 991  ILE D CA  1 
ATOM   4742 C C   . ILE D 1 113 ? -4.382  5.939   50.314  1.00 36.40  ? 991  ILE D C   1 
ATOM   4743 O O   . ILE D 1 113 ? -3.764  6.842   49.763  1.00 36.73  ? 991  ILE D O   1 
ATOM   4744 C CB  . ILE D 1 113 ? -4.165  5.654   52.799  1.00 36.36  ? 991  ILE D CB  1 
ATOM   4745 C CG1 . ILE D 1 113 ? -4.820  5.975   54.132  1.00 34.34  ? 991  ILE D CG1 1 
ATOM   4746 C CG2 . ILE D 1 113 ? -2.748  6.262   52.743  1.00 33.84  ? 991  ILE D CG2 1 
ATOM   4747 C CD1 . ILE D 1 113 ? -4.731  4.857   55.106  1.00 33.23  ? 991  ILE D CD1 1 
ATOM   4748 N N   . SER D 1 114 ? -4.513  4.737   49.773  1.00 38.70  ? 992  SER D N   1 
ATOM   4749 C CA  . SER D 1 114 ? -3.891  4.420   48.477  1.00 39.23  ? 992  SER D CA  1 
ATOM   4750 C C   . SER D 1 114 ? -4.533  5.152   47.290  1.00 39.69  ? 992  SER D C   1 
ATOM   4751 O O   . SER D 1 114 ? -3.878  5.428   46.272  1.00 40.31  ? 992  SER D O   1 
ATOM   4752 C CB  . SER D 1 114 ? -3.804  2.907   48.247  1.00 44.18  ? 992  SER D CB  1 
ATOM   4753 O OG  . SER D 1 114 ? -5.085  2.306   48.250  1.00 44.51  ? 992  SER D OG  1 
ATOM   4754 N N   . THR D 1 115 ? -5.794  5.542   47.464  1.00 40.28  ? 993  THR D N   1 
ATOM   4755 C CA  . THR D 1 115 ? -6.521  6.293   46.443  1.00 40.67  ? 993  THR D CA  1 
ATOM   4756 C C   . THR D 1 115 ? -6.121  7.757   46.453  1.00 41.37  ? 993  THR D C   1 
ATOM   4757 O O   . THR D 1 115 ? -5.922  8.354   45.406  1.00 41.90  ? 993  THR D O   1 
ATOM   4758 C CB  . THR D 1 115 ? -8.004  6.100   46.585  1.00 38.19  ? 993  THR D CB  1 
ATOM   4759 O OG1 . THR D 1 115 ? -8.330  4.810   46.061  1.00 37.30  ? 993  THR D OG1 1 
ATOM   4760 C CG2 . THR D 1 115 ? -8.711  7.148   45.801  1.00 37.12  ? 993  THR D CG2 1 
ATOM   4761 N N   . GLN D 1 116 ? -5.946  8.310   47.647  1.00 41.17  ? 994  GLN D N   1 
ATOM   4762 C CA  . GLN D 1 116 ? -5.446  9.662   47.804  1.00 41.91  ? 994  GLN D CA  1 
ATOM   4763 C C   . GLN D 1 116 ? -4.081  9.716   47.127  1.00 41.26  ? 994  GLN D C   1 
ATOM   4764 O O   . GLN D 1 116 ? -3.725  10.662  46.411  1.00 41.05  ? 994  GLN D O   1 
ATOM   4765 C CB  . GLN D 1 116 ? -5.231  9.933   49.278  1.00 43.40  ? 994  GLN D CB  1 
ATOM   4766 C CG  . GLN D 1 116 ? -6.526  9.950   50.076  1.00 47.97  ? 994  GLN D CG  1 
ATOM   4767 C CD  . GLN D 1 116 ? -6.385  10.640  51.450  1.00 53.55  ? 994  GLN D CD  1 
ATOM   4768 O OE1 . GLN D 1 116 ? -5.316  11.223  51.784  1.00 54.45  ? 994  GLN D OE1 1 
ATOM   4769 N NE2 . GLN D 1 116 ? -7.459  10.581  52.249  1.00 53.34  ? 994  GLN D NE2 1 
ATOM   4770 N N   . LEU D 1 117 ? -3.308  8.674   47.356  1.00 39.16  ? 995  LEU D N   1 
ATOM   4771 C CA  . LEU D 1 117 ? -1.996  8.614   46.783  1.00 38.83  ? 995  LEU D CA  1 
ATOM   4772 C C   . LEU D 1 117 ? -1.996  8.695   45.264  1.00 38.67  ? 995  LEU D C   1 
ATOM   4773 O O   . LEU D 1 117 ? -1.124  9.340   44.695  1.00 38.46  ? 995  LEU D O   1 
ATOM   4774 C CB  . LEU D 1 117 ? -1.301  7.361   47.220  1.00 39.01  ? 995  LEU D CB  1 
ATOM   4775 C CG  . LEU D 1 117 ? 0.172   7.473   46.871  1.00 38.49  ? 995  LEU D CG  1 
ATOM   4776 C CD1 . LEU D 1 117 ? 0.873   8.322   47.947  1.00 36.97  ? 995  LEU D CD1 1 
ATOM   4777 C CD2 . LEU D 1 117 ? 0.710   6.052   46.841  1.00 39.17  ? 995  LEU D CD2 1 
ATOM   4778 N N   . LYS D 1 118 ? -2.946  8.023   44.608  1.00 35.91  ? 996  LYS D N   1 
ATOM   4779 C CA  . LYS D 1 118 ? -3.082  8.076   43.140  1.00 35.79  ? 996  LYS D CA  1 
ATOM   4780 C C   . LYS D 1 118 ? -3.466  9.484   42.697  1.00 35.36  ? 996  LYS D C   1 
ATOM   4781 O O   . LYS D 1 118 ? -2.998  9.988   41.672  1.00 35.47  ? 996  LYS D O   1 
ATOM   4782 C CB  . LYS D 1 118 ? -4.190  7.145   42.660  1.00 39.04  ? 996  LYS D CB  1 
ATOM   4783 C CG  . LYS D 1 118 ? -3.985  5.680   42.959  1.00 40.85  ? 996  LYS D CG  1 
ATOM   4784 C CD  . LYS D 1 118 ? -4.705  4.793   41.937  1.00 43.81  ? 996  LYS D CD  1 
ATOM   4785 C CE  . LYS D 1 118 ? -6.198  4.696   42.230  1.00 46.86  ? 996  LYS D CE  1 
ATOM   4786 N NZ  . LYS D 1 118 ? -6.509  3.966   43.510  1.00 48.24  ? 996  LYS D NZ  1 
ATOM   4787 N N   . ILE D 1 119 ? -4.325  10.124  43.473  1.00 32.99  ? 997  ILE D N   1 
ATOM   4788 C CA  . ILE D 1 119 ? -4.755  11.475  43.148  1.00 32.75  ? 997  ILE D CA  1 
ATOM   4789 C C   . ILE D 1 119 ? -3.647  12.511  43.343  1.00 32.58  ? 997  ILE D C   1 
ATOM   4790 O O   . ILE D 1 119 ? -3.423  13.340  42.469  1.00 31.90  ? 997  ILE D O   1 
ATOM   4791 C CB  . ILE D 1 119 ? -6.033  11.825  43.929  1.00 35.49  ? 997  ILE D CB  1 
ATOM   4792 C CG1 . ILE D 1 119 ? -7.227  10.997  43.410  1.00 35.76  ? 997  ILE D CG1 1 
ATOM   4793 C CG2 . ILE D 1 119 ? -6.324  13.313  43.874  1.00 35.05  ? 997  ILE D CG2 1 
ATOM   4794 C CD1 . ILE D 1 119 ? -8.469  11.128  44.296  1.00 37.48  ? 997  ILE D CD1 1 
ATOM   4795 N N   . LEU D 1 120 ? -2.944  12.432  44.480  1.00 35.97  ? 998  LEU D N   1 
ATOM   4796 C CA  . LEU D 1 120 ? -1.841  13.344  44.805  1.00 36.11  ? 998  LEU D CA  1 
ATOM   4797 C C   . LEU D 1 120 ? -0.705  13.213  43.827  1.00 36.83  ? 998  LEU D C   1 
ATOM   4798 O O   . LEU D 1 120 ? -0.020  14.184  43.478  1.00 36.79  ? 998  LEU D O   1 
ATOM   4799 C CB  . LEU D 1 120 ? -1.289  13.061  46.197  1.00 36.44  ? 998  LEU D CB  1 
ATOM   4800 C CG  . LEU D 1 120 ? -2.244  13.407  47.356  1.00 36.39  ? 998  LEU D CG  1 
ATOM   4801 C CD1 . LEU D 1 120 ? -1.712  12.858  48.695  1.00 35.33  ? 998  LEU D CD1 1 
ATOM   4802 C CD2 . LEU D 1 120 ? -2.458  14.923  47.437  1.00 34.53  ? 998  LEU D CD2 1 
ATOM   4803 N N   . SER D 1 121 ? -0.484  11.992  43.388  1.00 39.00  ? 999  SER D N   1 
ATOM   4804 C CA  . SER D 1 121 ? 0.605   11.743  42.476  1.00 39.92  ? 999  SER D CA  1 
ATOM   4805 C C   . SER D 1 121 ? 0.296   12.278  41.098  1.00 40.68  ? 999  SER D C   1 
ATOM   4806 O O   . SER D 1 121 ? 1.208   12.686  40.371  1.00 41.52  ? 999  SER D O   1 
ATOM   4807 C CB  . SER D 1 121 ? 0.917   10.266  42.424  1.00 41.12  ? 999  SER D CB  1 
ATOM   4808 O OG  . SER D 1 121 ? -0.261  9.564   42.145  1.00 42.10  ? 999  SER D OG  1 
ATOM   4809 N N   . THR D 1 122 ? -0.977  12.292  40.718  1.00 43.63  ? 1000 THR D N   1 
ATOM   4810 C CA  . THR D 1 122 ? -1.303  12.829  39.391  1.00 44.40  ? 1000 THR D CA  1 
ATOM   4811 C C   . THR D 1 122 ? -1.023  14.330  39.305  1.00 44.88  ? 1000 THR D C   1 
ATOM   4812 O O   . THR D 1 122 ? -0.398  14.799  38.339  1.00 45.42  ? 1000 THR D O   1 
ATOM   4813 C CB  . THR D 1 122 ? -2.704  12.482  38.920  1.00 48.34  ? 1000 THR D CB  1 
ATOM   4814 O OG1 . THR D 1 122 ? -2.743  11.089  38.600  1.00 48.64  ? 1000 THR D OG1 1 
ATOM   4815 C CG2 . THR D 1 122 ? -3.016  13.278  37.678  1.00 48.60  ? 1000 THR D CG2 1 
ATOM   4816 N N   . VAL D 1 123 ? -1.471  15.074  40.324  1.00 43.72  ? 1001 VAL D N   1 
ATOM   4817 C CA  . VAL D 1 123 ? -1.200  16.519  40.406  1.00 44.17  ? 1001 VAL D CA  1 
ATOM   4818 C C   . VAL D 1 123 ? 0.311   16.724  40.331  1.00 44.22  ? 1001 VAL D C   1 
ATOM   4819 O O   . VAL D 1 123 ? 0.793   17.569  39.593  1.00 43.82  ? 1001 VAL D O   1 
ATOM   4820 C CB  . VAL D 1 123 ? -1.744  17.168  41.730  1.00 46.92  ? 1001 VAL D CB  1 
ATOM   4821 C CG1 . VAL D 1 123 ? -2.698  16.242  42.448  1.00 48.41  ? 1001 VAL D CG1 1 
ATOM   4822 C CG2 . VAL D 1 123 ? -0.597  17.553  42.666  1.00 47.00  ? 1001 VAL D CG2 1 
ATOM   4823 N N   . LYS D 1 124 ? 1.044   15.952  41.122  1.00 44.90  ? 1002 LYS D N   1 
ATOM   4824 C CA  . LYS D 1 124 ? 2.479   16.098  41.174  1.00 45.74  ? 1002 LYS D CA  1 
ATOM   4825 C C   . LYS D 1 124 ? 3.085   15.880  39.824  1.00 46.50  ? 1002 LYS D C   1 
ATOM   4826 O O   . LYS D 1 124 ? 4.031   16.544  39.475  1.00 46.45  ? 1002 LYS D O   1 
ATOM   4827 C CB  . LYS D 1 124 ? 3.110   15.137  42.174  1.00 47.46  ? 1002 LYS D CB  1 
ATOM   4828 C CG  . LYS D 1 124 ? 4.607   15.308  42.250  1.00 46.89  ? 1002 LYS D CG  1 
ATOM   4829 C CD  . LYS D 1 124 ? 4.951   16.318  43.331  1.00 47.99  ? 1002 LYS D CD  1 
ATOM   4830 C CE  . LYS D 1 124 ? 6.005   17.360  42.899  1.00 49.46  ? 1002 LYS D CE  1 
ATOM   4831 N NZ  . LYS D 1 124 ? 5.561   18.800  43.123  1.00 50.89  ? 1002 LYS D NZ  1 
ATOM   4832 N N   . ALA D 1 125 ? 2.523   14.950  39.068  1.00 49.59  ? 1003 ALA D N   1 
ATOM   4833 C CA  . ALA D 1 125 ? 3.038   14.599  37.755  1.00 51.97  ? 1003 ALA D CA  1 
ATOM   4834 C C   . ALA D 1 125 ? 2.926   15.723  36.759  1.00 53.70  ? 1003 ALA D C   1 
ATOM   4835 O O   . ALA D 1 125 ? 3.869   15.995  36.029  1.00 54.27  ? 1003 ALA D O   1 
ATOM   4836 C CB  . ALA D 1 125 ? 2.327   13.366  37.212  1.00 52.70  ? 1003 ALA D CB  1 
ATOM   4837 N N   . THR D 1 126 ? 1.740   16.319  36.671  1.00 58.41  ? 1004 THR D N   1 
ATOM   4838 C CA  . THR D 1 126 ? 1.479   17.417  35.735  1.00 60.63  ? 1004 THR D CA  1 
ATOM   4839 C C   . THR D 1 126 ? 2.279   18.644  36.166  1.00 62.15  ? 1004 THR D C   1 
ATOM   4840 O O   . THR D 1 126 ? 2.713   19.450  35.339  1.00 62.74  ? 1004 THR D O   1 
ATOM   4841 C CB  . THR D 1 126 ? -0.015  17.761  35.703  1.00 64.75  ? 1004 THR D CB  1 
ATOM   4842 O OG1 . THR D 1 126 ? -0.238  18.935  36.500  1.00 63.84  ? 1004 THR D OG1 1 
ATOM   4843 C CG2 . THR D 1 126 ? -0.851  16.593  36.264  1.00 65.03  ? 1004 THR D CG2 1 
ATOM   4844 N N   . MET D 1 127 ? 2.454   18.791  37.476  1.00 66.76  ? 1005 MET D N   1 
ATOM   4845 C CA  . MET D 1 127 ? 3.216   19.904  37.995  1.00 68.16  ? 1005 MET D CA  1 
ATOM   4846 C C   . MET D 1 127 ? 4.654   19.822  37.501  1.00 69.32  ? 1005 MET D C   1 
ATOM   4847 O O   . MET D 1 127 ? 5.265   20.831  37.160  1.00 69.44  ? 1005 MET D O   1 
ATOM   4848 C CB  . MET D 1 127 ? 3.154   19.933  39.509  1.00 70.51  ? 1005 MET D CB  1 
ATOM   4849 C CG  . MET D 1 127 ? 2.306   21.069  39.987  1.00 70.58  ? 1005 MET D CG  1 
ATOM   4850 S SD  . MET D 1 127 ? 2.321   21.244  41.754  1.00 71.81  ? 1005 MET D SD  1 
ATOM   4851 C CE  . MET D 1 127 ? 0.563   21.600  42.064  1.00 71.32  ? 1005 MET D CE  1 
ATOM   4852 N N   . LEU D 1 128 ? 5.188   18.609  37.440  1.00 74.68  ? 1006 LEU D N   1 
ATOM   4853 C CA  . LEU D 1 128 ? 6.543   18.412  36.949  1.00 76.31  ? 1006 LEU D CA  1 
ATOM   4854 C C   . LEU D 1 128 ? 6.714   19.035  35.551  1.00 77.56  ? 1006 LEU D C   1 
ATOM   4855 O O   . LEU D 1 128 ? 5.869   18.881  34.641  1.00 77.74  ? 1006 LEU D O   1 
ATOM   4856 C CB  . LEU D 1 128 ? 6.930   16.926  36.944  1.00 75.96  ? 1006 LEU D CB  1 
ATOM   4857 C CG  . LEU D 1 128 ? 6.898   16.160  38.270  1.00 76.26  ? 1006 LEU D CG  1 
ATOM   4858 C CD1 . LEU D 1 128 ? 7.805   14.930  38.248  1.00 75.54  ? 1006 LEU D CD1 1 
ATOM   4859 C CD2 . LEU D 1 128 ? 7.192   17.063  39.460  1.00 77.54  ? 1006 LEU D CD2 1 
ATOM   4860 N N   . GLY D 1 129 ? 7.822   19.756  35.401  1.00 84.18  ? 1007 GLY D N   1 
ATOM   4861 C CA  . GLY D 1 129 ? 8.152   20.437  34.163  1.00 85.43  ? 1007 GLY D CA  1 
ATOM   4862 C C   . GLY D 1 129 ? 7.750   21.897  34.236  1.00 86.35  ? 1007 GLY D C   1 
ATOM   4863 O O   . GLY D 1 129 ? 8.528   22.790  33.871  1.00 86.92  ? 1007 GLY D O   1 
ATOM   4864 N N   . ARG D 1 130 ? 6.531   22.134  34.715  1.00 89.53  ? 1008 ARG D N   1 
ATOM   4865 C CA  . ARG D 1 130 ? 6.001   23.486  34.847  1.00 89.56  ? 1008 ARG D CA  1 
ATOM   4866 C C   . ARG D 1 130 ? 6.995   24.472  35.476  1.00 89.35  ? 1008 ARG D C   1 
ATOM   4867 O O   . ARG D 1 130 ? 7.807   24.107  36.339  1.00 89.28  ? 1008 ARG D O   1 
ATOM   4868 C CB  . ARG D 1 130 ? 4.667   23.488  35.604  1.00 95.94  ? 1008 ARG D CB  1 
ATOM   4869 C CG  . ARG D 1 130 ? 3.479   23.805  34.729  1.00 96.66  ? 1008 ARG D CG  1 
ATOM   4870 C CD  . ARG D 1 130 ? 3.432   22.896  33.508  1.00 97.69  ? 1008 ARG D CD  1 
ATOM   4871 N NE  . ARG D 1 130 ? 2.202   22.105  33.450  1.00 97.69  ? 1008 ARG D NE  1 
ATOM   4872 C CZ  . ARG D 1 130 ? 0.982   22.579  33.712  1.00 98.33  ? 1008 ARG D CZ  1 
ATOM   4873 N NH1 . ARG D 1 130 ? 0.812   23.856  34.055  1.00 98.42  ? 1008 ARG D NH1 1 
ATOM   4874 N NH2 . ARG D 1 130 ? -0.076  21.777  33.632  1.00 98.36  ? 1008 ARG D NH2 1 
ATOM   4875 N N   . THR D 1 131 ? 6.920   25.720  35.008  1.00 88.29  ? 1009 THR D N   1 
ATOM   4876 C CA  . THR D 1 131 ? 7.795   26.811  35.441  1.00 87.72  ? 1009 THR D CA  1 
ATOM   4877 C C   . THR D 1 131 ? 6.926   27.934  35.999  1.00 87.71  ? 1009 THR D C   1 
ATOM   4878 O O   . THR D 1 131 ? 7.363   28.755  36.804  1.00 87.47  ? 1009 THR D O   1 
ATOM   4879 C CB  . THR D 1 131 ? 8.648   27.301  34.242  1.00 93.85  ? 1009 THR D CB  1 
ATOM   4880 O OG1 . THR D 1 131 ? 7.789   27.674  33.148  1.00 91.97  ? 1009 THR D OG1 1 
ATOM   4881 C CG2 . THR D 1 131 ? 9.588   26.177  33.786  1.00 93.62  ? 1009 THR D CG2 1 
ATOM   4882 N N   . ASN D 1 132 ? 5.675   27.921  35.563  1.00 85.27  ? 1010 ASN D N   1 
ATOM   4883 C CA  . ASN D 1 132 ? 4.679   28.896  35.955  1.00 85.43  ? 1010 ASN D CA  1 
ATOM   4884 C C   . ASN D 1 132 ? 4.138   28.602  37.352  1.00 85.28  ? 1010 ASN D C   1 
ATOM   4885 O O   . ASN D 1 132 ? 3.847   29.524  38.118  1.00 85.22  ? 1010 ASN D O   1 
ATOM   4886 C CB  . ASN D 1 132 ? 3.545   28.908  34.925  1.00 89.29  ? 1010 ASN D CB  1 
ATOM   4887 C CG  . ASN D 1 132 ? 3.316   27.540  34.293  1.00 89.89  ? 1010 ASN D CG  1 
ATOM   4888 O OD1 . ASN D 1 132 ? 2.542   26.732  34.812  1.00 90.61  ? 1010 ASN D OD1 1 
ATOM   4889 N ND2 . ASN D 1 132 ? 4.008   27.264  33.183  1.00 89.12  ? 1010 ASN D ND2 1 
ATOM   4890 N N   . ILE D 1 133 ? 4.010   27.323  37.695  1.00 83.74  ? 1011 ILE D N   1 
ATOM   4891 C CA  . ILE D 1 133 ? 3.513   26.964  39.026  1.00 83.52  ? 1011 ILE D CA  1 
ATOM   4892 C C   . ILE D 1 133 ? 4.377   27.581  40.126  1.00 83.33  ? 1011 ILE D C   1 
ATOM   4893 O O   . ILE D 1 133 ? 5.610   27.620  40.028  1.00 83.63  ? 1011 ILE D O   1 
ATOM   4894 C CB  . ILE D 1 133 ? 3.253   25.436  39.216  1.00 86.43  ? 1011 ILE D CB  1 
ATOM   4895 C CG1 . ILE D 1 133 ? 1.904   25.047  38.592  1.00 86.59  ? 1011 ILE D CG1 1 
ATOM   4896 C CG2 . ILE D 1 133 ? 3.220   25.081  40.706  1.00 85.47  ? 1011 ILE D CG2 1 
ATOM   4897 C CD1 . ILE D 1 133 ? 1.995   24.295  37.260  1.00 85.94  ? 1011 ILE D CD1 1 
ATOM   4898 N N   . SER D 1 134 ? 3.705   28.082  41.160  1.00 82.15  ? 1012 SER D N   1 
ATOM   4899 C CA  . SER D 1 134 ? 4.347   28.777  42.276  1.00 81.27  ? 1012 SER D CA  1 
ATOM   4900 C C   . SER D 1 134 ? 5.242   27.899  43.116  1.00 80.64  ? 1012 SER D C   1 
ATOM   4901 O O   . SER D 1 134 ? 5.096   26.676  43.135  1.00 80.27  ? 1012 SER D O   1 
ATOM   4902 C CB  . SER D 1 134 ? 3.290   29.458  43.164  1.00 84.68  ? 1012 SER D CB  1 
ATOM   4903 O OG  . SER D 1 134 ? 3.312   28.985  44.501  1.00 83.85  ? 1012 SER D OG  1 
ATOM   4904 N N   . ASP D 1 135 ? 6.148   28.546  43.837  1.00 78.62  ? 1013 ASP D N   1 
ATOM   4905 C CA  . ASP D 1 135 ? 7.074   27.848  44.716  1.00 78.70  ? 1013 ASP D CA  1 
ATOM   4906 C C   . ASP D 1 135 ? 6.320   27.112  45.815  1.00 78.26  ? 1013 ASP D C   1 
ATOM   4907 O O   . ASP D 1 135 ? 6.472   25.898  46.014  1.00 78.31  ? 1013 ASP D O   1 
ATOM   4908 C CB  . ASP D 1 135 ? 8.020   28.857  45.358  1.00 81.11  ? 1013 ASP D CB  1 
ATOM   4909 C CG  . ASP D 1 135 ? 8.967   29.477  44.358  1.00 82.09  ? 1013 ASP D CG  1 
ATOM   4910 O OD1 . ASP D 1 135 ? 9.100   30.722  44.374  1.00 81.91  ? 1013 ASP D OD1 1 
ATOM   4911 O OD2 . ASP D 1 135 ? 9.554   28.715  43.549  1.00 83.21  ? 1013 ASP D OD2 1 
ATOM   4912 N N   . GLU D 1 136 ? 5.513   27.875  46.540  1.00 76.34  ? 1014 GLU D N   1 
ATOM   4913 C CA  . GLU D 1 136 ? 4.713   27.330  47.623  1.00 75.74  ? 1014 GLU D CA  1 
ATOM   4914 C C   . GLU D 1 136 ? 3.824   26.178  47.179  1.00 75.13  ? 1014 GLU D C   1 
ATOM   4915 O O   . GLU D 1 136 ? 3.761   25.162  47.865  1.00 75.48  ? 1014 GLU D O   1 
ATOM   4916 C CB  . GLU D 1 136 ? 3.908   28.428  48.303  1.00 77.61  ? 1014 GLU D CB  1 
ATOM   4917 C CG  . GLU D 1 136 ? 4.613   29.066  49.494  1.00 79.17  ? 1014 GLU D CG  1 
ATOM   4918 C CD  . GLU D 1 136 ? 6.109   28.726  49.575  1.00 81.10  ? 1014 GLU D CD  1 
ATOM   4919 O OE1 . GLU D 1 136 ? 6.469   27.525  49.714  1.00 82.55  ? 1014 GLU D OE1 1 
ATOM   4920 O OE2 . GLU D 1 136 ? 6.931   29.677  49.571  1.00 81.64  ? 1014 GLU D OE2 1 
ATOM   4921 N N   . GLU D 1 137 ? 3.176   26.321  46.023  1.00 70.08  ? 1015 GLU D N   1 
ATOM   4922 C CA  . GLU D 1 137 ? 2.311   25.283  45.460  1.00 68.93  ? 1015 GLU D CA  1 
ATOM   4923 C C   . GLU D 1 137 ? 3.035   23.944  45.232  1.00 67.89  ? 1015 GLU D C   1 
ATOM   4924 O O   . GLU D 1 137 ? 2.493   22.886  45.530  1.00 67.38  ? 1015 GLU D O   1 
ATOM   4925 C CB  . GLU D 1 137 ? 1.723   25.764  44.125  1.00 71.73  ? 1015 GLU D CB  1 
ATOM   4926 C CG  . GLU D 1 137 ? 0.200   25.785  44.056  1.00 73.97  ? 1015 GLU D CG  1 
ATOM   4927 C CD  . GLU D 1 137 ? -0.328  25.857  42.629  1.00 77.02  ? 1015 GLU D CD  1 
ATOM   4928 O OE1 . GLU D 1 137 ? 0.460   26.234  41.730  1.00 78.58  ? 1015 GLU D OE1 1 
ATOM   4929 O OE2 . GLU D 1 137 ? -1.520  25.527  42.404  1.00 77.15  ? 1015 GLU D OE2 1 
ATOM   4930 N N   . SER D 1 138 ? 4.241   23.990  44.672  1.00 63.61  ? 1016 SER D N   1 
ATOM   4931 C CA  . SER D 1 138 ? 4.967   22.767  44.375  1.00 62.64  ? 1016 SER D CA  1 
ATOM   4932 C C   . SER D 1 138 ? 5.545   22.041  45.593  1.00 62.01  ? 1016 SER D C   1 
ATOM   4933 O O   . SER D 1 138 ? 5.477   20.815  45.675  1.00 61.97  ? 1016 SER D O   1 
ATOM   4934 C CB  . SER D 1 138 ? 6.026   23.013  43.320  1.00 64.87  ? 1016 SER D CB  1 
ATOM   4935 O OG  . SER D 1 138 ? 6.243   24.397  43.190  1.00 65.62  ? 1016 SER D OG  1 
ATOM   4936 N N   . GLU D 1 139 ? 6.093   22.768  46.557  1.00 59.89  ? 1017 GLU D N   1 
ATOM   4937 C CA  . GLU D 1 139 ? 6.613   22.069  47.714  1.00 59.24  ? 1017 GLU D CA  1 
ATOM   4938 C C   . GLU D 1 139 ? 5.457   21.575  48.569  1.00 57.99  ? 1017 GLU D C   1 
ATOM   4939 O O   . GLU D 1 139 ? 5.608   20.679  49.390  1.00 58.26  ? 1017 GLU D O   1 
ATOM   4940 C CB  . GLU D 1 139 ? 7.608   22.909  48.511  1.00 61.52  ? 1017 GLU D CB  1 
ATOM   4941 C CG  . GLU D 1 139 ? 8.230   22.189  49.772  1.00 64.86  ? 1017 GLU D CG  1 
ATOM   4942 C CD  . GLU D 1 139 ? 9.062   20.867  49.507  1.00 68.44  ? 1017 GLU D CD  1 
ATOM   4943 O OE1 . GLU D 1 139 ? 9.036   19.974  50.391  1.00 67.97  ? 1017 GLU D OE1 1 
ATOM   4944 O OE2 . GLU D 1 139 ? 9.816   20.750  48.502  1.00 68.27  ? 1017 GLU D OE2 1 
ATOM   4945 N N   . GLN D 1 140 ? 4.275   22.126  48.342  1.00 55.00  ? 1018 GLN D N   1 
ATOM   4946 C CA  . GLN D 1 140 ? 3.087   21.652  49.047  1.00 53.59  ? 1018 GLN D CA  1 
ATOM   4947 C C   . GLN D 1 140 ? 2.500   20.386  48.348  1.00 53.44  ? 1018 GLN D C   1 
ATOM   4948 O O   . GLN D 1 140 ? 1.907   19.504  48.994  1.00 53.21  ? 1018 GLN D O   1 
ATOM   4949 C CB  . GLN D 1 140 ? 2.044   22.760  49.134  1.00 54.24  ? 1018 GLN D CB  1 
ATOM   4950 C CG  . GLN D 1 140 ? 1.055   22.557  50.235  1.00 52.15  ? 1018 GLN D CG  1 
ATOM   4951 C CD  . GLN D 1 140 ? 1.712   22.370  51.601  1.00 48.75  ? 1018 GLN D CD  1 
ATOM   4952 O OE1 . GLN D 1 140 ? 1.209   21.610  52.452  1.00 47.94  ? 1018 GLN D OE1 1 
ATOM   4953 N NE2 . GLN D 1 140 ? 2.806   23.093  51.837  1.00 47.64  ? 1018 GLN D NE2 1 
ATOM   4954 N N   . ALA D 1 141 ? 2.663   20.298  47.026  1.00 52.82  ? 1019 ALA D N   1 
ATOM   4955 C CA  . ALA D 1 141 ? 2.122   19.155  46.313  1.00 51.82  ? 1019 ALA D CA  1 
ATOM   4956 C C   . ALA D 1 141 ? 2.918   17.986  46.829  1.00 51.21  ? 1019 ALA D C   1 
ATOM   4957 O O   . ALA D 1 141 ? 2.366   16.939  47.203  1.00 51.58  ? 1019 ALA D O   1 
ATOM   4958 C CB  . ALA D 1 141 ? 2.313   19.312  44.827  1.00 51.98  ? 1019 ALA D CB  1 
ATOM   4959 N N   . THR D 1 142 ? 4.221   18.231  46.935  1.00 49.89  ? 1020 THR D N   1 
ATOM   4960 C CA  . THR D 1 142 ? 5.182   17.235  47.385  1.00 48.88  ? 1020 THR D CA  1 
ATOM   4961 C C   . THR D 1 142 ? 5.025   16.775  48.818  1.00 48.50  ? 1020 THR D C   1 
ATOM   4962 O O   . THR D 1 142 ? 5.282   15.628  49.130  1.00 48.43  ? 1020 THR D O   1 
ATOM   4963 C CB  . THR D 1 142 ? 6.586   17.734  47.180  1.00 46.66  ? 1020 THR D CB  1 
ATOM   4964 O OG1 . THR D 1 142 ? 7.024   17.367  45.866  1.00 45.51  ? 1020 THR D OG1 1 
ATOM   4965 C CG2 . THR D 1 142 ? 7.491   17.146  48.226  1.00 45.63  ? 1020 THR D CG2 1 
ATOM   4966 N N   . GLU D 1 143 ? 4.645   17.681  49.697  1.00 49.19  ? 1021 GLU D N   1 
ATOM   4967 C CA  . GLU D 1 143 ? 4.513   17.334  51.086  1.00 49.06  ? 1021 GLU D CA  1 
ATOM   4968 C C   . GLU D 1 143 ? 3.220   16.658  51.489  1.00 48.09  ? 1021 GLU D C   1 
ATOM   4969 O O   . GLU D 1 143 ? 3.118   16.192  52.630  1.00 48.26  ? 1021 GLU D O   1 
ATOM   4970 C CB  . GLU D 1 143 ? 4.801   18.531  51.968  1.00 52.63  ? 1021 GLU D CB  1 
ATOM   4971 C CG  . GLU D 1 143 ? 6.250   19.000  51.853  1.00 55.90  ? 1021 GLU D CG  1 
ATOM   4972 C CD  . GLU D 1 143 ? 6.694   19.843  53.046  1.00 60.17  ? 1021 GLU D CD  1 
ATOM   4973 O OE1 . GLU D 1 143 ? 7.127   21.020  52.846  1.00 61.79  ? 1021 GLU D OE1 1 
ATOM   4974 O OE2 . GLU D 1 143 ? 6.617   19.307  54.183  1.00 60.01  ? 1021 GLU D OE2 1 
ATOM   4975 N N   . MET D 1 144 ? 2.250   16.568  50.571  1.00 45.27  ? 1022 MET D N   1 
ATOM   4976 C CA  . MET D 1 144 ? 0.988   15.855  50.853  1.00 44.12  ? 1022 MET D CA  1 
ATOM   4977 C C   . MET D 1 144 ? 1.185   14.413  50.415  1.00 43.05  ? 1022 MET D C   1 
ATOM   4978 O O   . MET D 1 144 ? 0.454   13.501  50.833  1.00 43.05  ? 1022 MET D O   1 
ATOM   4979 C CB  . MET D 1 144 ? -0.193  16.400  50.049  1.00 46.96  ? 1022 MET D CB  1 
ATOM   4980 C CG  . MET D 1 144 ? -0.180  17.857  49.760  1.00 48.32  ? 1022 MET D CG  1 
ATOM   4981 S SD  . MET D 1 144 ? -1.866  18.369  49.571  1.00 50.74  ? 1022 MET D SD  1 
ATOM   4982 C CE  . MET D 1 144 ? -1.737  19.369  47.980  1.00 51.08  ? 1022 MET D CE  1 
ATOM   4983 N N   . LEU D 1 145 ? 2.111   14.253  49.477  1.00 41.35  ? 1023 LEU D N   1 
ATOM   4984 C CA  . LEU D 1 145 ? 2.474   12.960  48.928  1.00 40.01  ? 1023 LEU D CA  1 
ATOM   4985 C C   . LEU D 1 145 ? 3.220   12.289  50.052  1.00 39.41  ? 1023 LEU D C   1 
ATOM   4986 O O   . LEU D 1 145 ? 2.797   11.257  50.524  1.00 39.33  ? 1023 LEU D O   1 
ATOM   4987 C CB  . LEU D 1 145 ? 3.408   13.128  47.713  1.00 39.29  ? 1023 LEU D CB  1 
ATOM   4988 C CG  . LEU D 1 145 ? 3.236   12.209  46.505  1.00 38.18  ? 1023 LEU D CG  1 
ATOM   4989 C CD1 . LEU D 1 145 ? 1.953   11.416  46.608  1.00 36.37  ? 1023 LEU D CD1 1 
ATOM   4990 C CD2 . LEU D 1 145 ? 3.227   13.043  45.256  1.00 37.17  ? 1023 LEU D CD2 1 
ATOM   4991 N N   . VAL D 1 146 ? 4.303   12.911  50.500  1.00 39.16  ? 1024 VAL D N   1 
ATOM   4992 C CA  . VAL D 1 146 ? 5.093   12.388  51.611  1.00 39.00  ? 1024 VAL D CA  1 
ATOM   4993 C C   . VAL D 1 146 ? 4.220   12.042  52.816  1.00 39.05  ? 1024 VAL D C   1 
ATOM   4994 O O   . VAL D 1 146 ? 4.479   11.086  53.541  1.00 38.89  ? 1024 VAL D O   1 
ATOM   4995 C CB  . VAL D 1 146 ? 6.208   13.393  52.071  1.00 41.91  ? 1024 VAL D CB  1 
ATOM   4996 C CG1 . VAL D 1 146 ? 6.955   12.841  53.269  1.00 41.62  ? 1024 VAL D CG1 1 
ATOM   4997 C CG2 . VAL D 1 146 ? 7.178   13.679  50.952  1.00 40.73  ? 1024 VAL D CG2 1 
ATOM   4998 N N   . HIS D 1 147 ? 3.230   12.878  53.070  1.00 43.01  ? 1025 HIS D N   1 
ATOM   4999 C CA  . HIS D 1 147 ? 2.353   12.664  54.189  1.00 44.08  ? 1025 HIS D CA  1 
ATOM   5000 C C   . HIS D 1 147 ? 1.465   11.442  53.968  1.00 44.01  ? 1025 HIS D C   1 
ATOM   5001 O O   . HIS D 1 147 ? 1.266   10.642  54.868  1.00 43.78  ? 1025 HIS D O   1 
ATOM   5002 C CB  . HIS D 1 147 ? 1.502   13.910  54.401  1.00 46.96  ? 1025 HIS D CB  1 
ATOM   5003 C CG  . HIS D 1 147 ? 0.557   13.795  55.550  1.00 50.91  ? 1025 HIS D CG  1 
ATOM   5004 N ND1 . HIS D 1 147 ? 0.866   14.264  56.814  1.00 53.94  ? 1025 HIS D ND1 1 
ATOM   5005 C CD2 . HIS D 1 147 ? -0.665  13.208  55.646  1.00 53.45  ? 1025 HIS D CD2 1 
ATOM   5006 C CE1 . HIS D 1 147 ? -0.139  13.989  57.634  1.00 55.49  ? 1025 HIS D CE1 1 
ATOM   5007 N NE2 . HIS D 1 147 ? -1.076  13.343  56.954  1.00 55.24  ? 1025 HIS D NE2 1 
ATOM   5008 N N   . ASN D 1 148 ? 0.896   11.336  52.772  1.00 44.14  ? 1026 ASN D N   1 
ATOM   5009 C CA  . ASN D 1 148 ? 0.030   10.232  52.409  1.00 43.98  ? 1026 ASN D CA  1 
ATOM   5010 C C   . ASN D 1 148 ? 0.831   8.939   52.396  1.00 43.97  ? 1026 ASN D C   1 
ATOM   5011 O O   . ASN D 1 148 ? 0.369   7.904   52.882  1.00 43.60  ? 1026 ASN D O   1 
ATOM   5012 C CB  . ASN D 1 148 ? -0.522  10.486  51.022  1.00 52.92  ? 1026 ASN D CB  1 
ATOM   5013 C CG  . ASN D 1 148 ? -1.917  9.945   50.856  1.00 56.04  ? 1026 ASN D CG  1 
ATOM   5014 O OD1 . ASN D 1 148 ? -2.092  8.742   50.648  1.00 57.99  ? 1026 ASN D OD1 1 
ATOM   5015 N ND2 . ASN D 1 148 ? -2.934  10.816  51.003  1.00 57.00  ? 1026 ASN D ND2 1 
ATOM   5016 N N   . ALA D 1 149 ? 2.050   9.019   51.839  1.00 41.54  ? 1027 ALA D N   1 
ATOM   5017 C CA  . ALA D 1 149 ? 3.003   7.910   51.761  1.00 39.87  ? 1027 ALA D CA  1 
ATOM   5018 C C   . ALA D 1 149 ? 3.380   7.474   53.157  1.00 39.28  ? 1027 ALA D C   1 
ATOM   5019 O O   . ALA D 1 149 ? 3.289   6.323   53.471  1.00 39.87  ? 1027 ALA D O   1 
ATOM   5020 C CB  . ALA D 1 149 ? 4.228   8.324   50.997  1.00 39.68  ? 1027 ALA D CB  1 
ATOM   5021 N N   . GLN D 1 150 ? 3.745   8.398   54.023  1.00 39.07  ? 1028 GLN D N   1 
ATOM   5022 C CA  . GLN D 1 150 ? 4.057   8.029   55.404  1.00 39.15  ? 1028 GLN D CA  1 
ATOM   5023 C C   . GLN D 1 150 ? 2.947   7.207   56.051  1.00 39.09  ? 1028 GLN D C   1 
ATOM   5024 O O   . GLN D 1 150 ? 3.224   6.234   56.762  1.00 38.66  ? 1028 GLN D O   1 
ATOM   5025 C CB  . GLN D 1 150 ? 4.299   9.266   56.273  1.00 41.11  ? 1028 GLN D CB  1 
ATOM   5026 C CG  . GLN D 1 150 ? 5.654   9.861   56.096  1.00 39.36  ? 1028 GLN D CG  1 
ATOM   5027 C CD  . GLN D 1 150 ? 5.727   11.290  56.615  1.00 38.68  ? 1028 GLN D CD  1 
ATOM   5028 O OE1 . GLN D 1 150 ? 4.695   11.924  56.940  1.00 38.03  ? 1028 GLN D OE1 1 
ATOM   5029 N NE2 . GLN D 1 150 ? 6.951   11.821  56.690  1.00 39.15  ? 1028 GLN D NE2 1 
ATOM   5030 N N   . ASN D 1 151 ? 1.707   7.626   55.827  1.00 40.19  ? 1029 ASN D N   1 
ATOM   5031 C CA  . ASN D 1 151 ? 0.557   6.965   56.429  1.00 40.61  ? 1029 ASN D CA  1 
ATOM   5032 C C   . ASN D 1 151 ? 0.169   5.663   55.762  1.00 39.83  ? 1029 ASN D C   1 
ATOM   5033 O O   . ASN D 1 151 ? -0.298  4.754   56.440  1.00 39.76  ? 1029 ASN D O   1 
ATOM   5034 C CB  . ASN D 1 151 ? -0.635  7.903   56.555  1.00 55.77  ? 1029 ASN D CB  1 
ATOM   5035 C CG  . ASN D 1 151 ? -0.261  9.218   57.216  1.00 59.45  ? 1029 ASN D CG  1 
ATOM   5036 O OD1 . ASN D 1 151 ? -1.129  10.052  57.506  1.00 64.23  ? 1029 ASN D OD1 1 
ATOM   5037 N ND2 . ASN D 1 151 ? 1.045   9.433   57.425  1.00 62.18  ? 1029 ASN D ND2 1 
ATOM   5038 N N   . LEU D 1 152 ? 0.411   5.549   54.455  1.00 36.87  ? 1030 LEU D N   1 
ATOM   5039 C CA  . LEU D 1 152 ? 0.115   4.310   53.748  1.00 36.52  ? 1030 LEU D CA  1 
ATOM   5040 C C   . LEU D 1 152 ? 1.036   3.241   54.297  1.00 36.68  ? 1030 LEU D C   1 
ATOM   5041 O O   . LEU D 1 152 ? 0.593   2.149   54.658  1.00 37.20  ? 1030 LEU D O   1 
ATOM   5042 C CB  . LEU D 1 152 ? 0.323   4.467   52.260  1.00 34.42  ? 1030 LEU D CB  1 
ATOM   5043 C CG  . LEU D 1 152 ? 0.055   3.238   51.397  1.00 33.35  ? 1030 LEU D CG  1 
ATOM   5044 C CD1 . LEU D 1 152 ? -1.327  2.652   51.608  1.00 30.82  ? 1030 LEU D CD1 1 
ATOM   5045 C CD2 . LEU D 1 152 ? 0.286   3.591   49.935  1.00 33.54  ? 1030 LEU D CD2 1 
ATOM   5046 N N   . MET D 1 153 ? 2.308   3.596   54.440  1.00 40.59  ? 1031 MET D N   1 
ATOM   5047 C CA  . MET D 1 153 ? 3.304   2.697   54.989  1.00 41.24  ? 1031 MET D CA  1 
ATOM   5048 C C   . MET D 1 153 ? 2.955   2.312   56.405  1.00 41.27  ? 1031 MET D C   1 
ATOM   5049 O O   . MET D 1 153 ? 3.016   1.148   56.749  1.00 41.54  ? 1031 MET D O   1 
ATOM   5050 C CB  . MET D 1 153 ? 4.710   3.309   54.926  1.00 44.00  ? 1031 MET D CB  1 
ATOM   5051 C CG  . MET D 1 153 ? 5.138   3.819   53.532  1.00 45.59  ? 1031 MET D CG  1 
ATOM   5052 S SD  . MET D 1 153 ? 5.541   2.567   52.298  1.00 49.79  ? 1031 MET D SD  1 
ATOM   5053 C CE  . MET D 1 153 ? 3.951   2.517   51.282  1.00 48.53  ? 1031 MET D CE  1 
ATOM   5054 N N   . GLN D 1 154 ? 2.554   3.284   57.214  1.00 43.50  ? 1032 GLN D N   1 
ATOM   5055 C CA  . GLN D 1 154 ? 2.187   3.018   58.597  1.00 43.64  ? 1032 GLN D CA  1 
ATOM   5056 C C   . GLN D 1 154 ? 0.987   2.092   58.717  1.00 43.63  ? 1032 GLN D C   1 
ATOM   5057 O O   . GLN D 1 154 ? 0.878   1.295   59.635  1.00 43.04  ? 1032 GLN D O   1 
ATOM   5058 C CB  . GLN D 1 154 ? 1.889   4.318   59.321  1.00 49.36  ? 1032 GLN D CB  1 
ATOM   5059 C CG  . GLN D 1 154 ? 2.843   4.591   60.484  1.00 49.08  ? 1032 GLN D CG  1 
ATOM   5060 C CD  . GLN D 1 154 ? 2.554   3.703   61.691  1.00 49.48  ? 1032 GLN D CD  1 
ATOM   5061 O OE1 . GLN D 1 154 ? 3.411   2.906   62.129  1.00 50.55  ? 1032 GLN D OE1 1 
ATOM   5062 N NE2 . GLN D 1 154 ? 1.332   3.815   62.224  1.00 50.97  ? 1032 GLN D NE2 1 
ATOM   5063 N N   . SER D 1 155 ? 0.063   2.209   57.783  1.00 42.46  ? 1033 SER D N   1 
ATOM   5064 C CA  . SER D 1 155 ? -1.120  1.378   57.830  1.00 43.13  ? 1033 SER D CA  1 
ATOM   5065 C C   . SER D 1 155 ? -0.773  -0.038  57.420  1.00 43.81  ? 1033 SER D C   1 
ATOM   5066 O O   . SER D 1 155 ? -1.215  -1.003  58.059  1.00 44.35  ? 1033 SER D O   1 
ATOM   5067 C CB  . SER D 1 155 ? -2.211  1.955   56.938  1.00 46.96  ? 1033 SER D CB  1 
ATOM   5068 O OG  . SER D 1 155 ? -2.667  3.188   57.486  1.00 47.71  ? 1033 SER D OG  1 
ATOM   5069 N N   . VAL D 1 156 ? 0.010   -0.175  56.356  1.00 39.76  ? 1034 VAL D N   1 
ATOM   5070 C CA  . VAL D 1 156 ? 0.359   -1.491  55.894  1.00 39.82  ? 1034 VAL D CA  1 
ATOM   5071 C C   . VAL D 1 156 ? 1.124   -2.228  56.975  1.00 40.09  ? 1034 VAL D C   1 
ATOM   5072 O O   . VAL D 1 156 ? 0.887   -3.398  57.206  1.00 39.37  ? 1034 VAL D O   1 
ATOM   5073 C CB  . VAL D 1 156 ? 1.051   -1.437  54.540  1.00 42.01  ? 1034 VAL D CB  1 
ATOM   5074 C CG1 . VAL D 1 156 ? 1.087   -2.774  53.907  1.00 41.59  ? 1034 VAL D CG1 1 
ATOM   5075 C CG2 . VAL D 1 156 ? 0.290   -0.554  53.659  1.00 42.14  ? 1034 VAL D CG2 1 
ATOM   5076 N N   . LYS D 1 157 ? 1.973   -1.527  57.707  1.00 44.20  ? 1035 LYS D N   1 
ATOM   5077 C CA  . LYS D 1 157 ? 2.769   -2.188  58.738  1.00 45.64  ? 1035 LYS D CA  1 
ATOM   5078 C C   . LYS D 1 157 ? 2.014   -2.500  60.009  1.00 46.07  ? 1035 LYS D C   1 
ATOM   5079 O O   . LYS D 1 157 ? 2.357   -3.418  60.746  1.00 46.37  ? 1035 LYS D O   1 
ATOM   5080 C CB  . LYS D 1 157 ? 4.072   -1.444  59.004  1.00 46.74  ? 1035 LYS D CB  1 
ATOM   5081 C CG  . LYS D 1 157 ? 4.204   -0.891  60.374  1.00 49.11  ? 1035 LYS D CG  1 
ATOM   5082 C CD  . LYS D 1 157 ? 5.494   -0.073  60.495  1.00 52.33  ? 1035 LYS D CD  1 
ATOM   5083 C CE  . LYS D 1 157 ? 5.841   0.254   61.986  1.00 54.59  ? 1035 LYS D CE  1 
ATOM   5084 N NZ  . LYS D 1 157 ? 7.320   0.203   62.268  1.00 54.96  ? 1035 LYS D NZ  1 
ATOM   5085 N N   . GLU D 1 158 ? 0.967   -1.739  60.256  1.00 49.05  ? 1036 GLU D N   1 
ATOM   5086 C CA  . GLU D 1 158 ? 0.124   -1.974  61.389  1.00 49.43  ? 1036 GLU D CA  1 
ATOM   5087 C C   . GLU D 1 158 ? -0.728  -3.191  61.056  1.00 49.26  ? 1036 GLU D C   1 
ATOM   5088 O O   . GLU D 1 158 ? -1.068  -3.956  61.947  1.00 49.67  ? 1036 GLU D O   1 
ATOM   5089 C CB  . GLU D 1 158 ? -0.775  -0.774  61.588  1.00 52.44  ? 1036 GLU D CB  1 
ATOM   5090 C CG  . GLU D 1 158 ? -0.602  -0.145  62.931  1.00 56.19  ? 1036 GLU D CG  1 
ATOM   5091 C CD  . GLU D 1 158 ? -0.356  1.347   62.851  1.00 60.58  ? 1036 GLU D CD  1 
ATOM   5092 O OE1 . GLU D 1 158 ? -1.312  2.085   62.464  1.00 61.13  ? 1036 GLU D OE1 1 
ATOM   5093 O OE2 . GLU D 1 158 ? 0.780   1.769   63.219  1.00 62.36  ? 1036 GLU D OE2 1 
ATOM   5094 N N   . THR D 1 159 ? -1.079  -3.367  59.781  1.00 45.18  ? 1037 THR D N   1 
ATOM   5095 C CA  . THR D 1 159 ? -1.871  -4.512  59.328  1.00 44.78  ? 1037 THR D CA  1 
ATOM   5096 C C   . THR D 1 159 ? -1.064  -5.768  59.567  1.00 44.77  ? 1037 THR D C   1 
ATOM   5097 O O   . THR D 1 159 ? -1.482  -6.684  60.250  1.00 44.60  ? 1037 THR D O   1 
ATOM   5098 C CB  . THR D 1 159 ? -2.186  -4.404  57.816  1.00 47.73  ? 1037 THR D CB  1 
ATOM   5099 O OG1 . THR D 1 159 ? -3.246  -3.471  57.603  1.00 47.91  ? 1037 THR D OG1 1 
ATOM   5100 C CG2 . THR D 1 159 ? -2.597  -5.746  57.248  1.00 46.42  ? 1037 THR D CG2 1 
ATOM   5101 N N   . VAL D 1 160 ? 0.095   -5.798  58.948  1.00 47.58  ? 1038 VAL D N   1 
ATOM   5102 C CA  . VAL D 1 160 ? 1.023   -6.887  59.055  1.00 48.28  ? 1038 VAL D CA  1 
ATOM   5103 C C   . VAL D 1 160 ? 1.191   -7.370  60.482  1.00 49.28  ? 1038 VAL D C   1 
ATOM   5104 O O   . VAL D 1 160 ? 1.491   -8.537  60.713  1.00 49.46  ? 1038 VAL D O   1 
ATOM   5105 C CB  . VAL D 1 160 ? 2.355   -6.419  58.555  1.00 51.82  ? 1038 VAL D CB  1 
ATOM   5106 C CG1 . VAL D 1 160 ? 3.440   -7.289  59.121  1.00 52.26  ? 1038 VAL D CG1 1 
ATOM   5107 C CG2 . VAL D 1 160 ? 2.357   -6.368  57.030  1.00 51.40  ? 1038 VAL D CG2 1 
ATOM   5108 N N   . ARG D 1 161 ? 1.057   -6.461  61.441  1.00 52.85  ? 1039 ARG D N   1 
ATOM   5109 C CA  . ARG D 1 161 ? 1.224   -6.809  62.842  1.00 53.75  ? 1039 ARG D CA  1 
ATOM   5110 C C   . ARG D 1 161 ? -0.061  -7.368  63.395  1.00 54.22  ? 1039 ARG D C   1 
ATOM   5111 O O   . ARG D 1 161 ? -0.064  -8.389  64.070  1.00 55.45  ? 1039 ARG D O   1 
ATOM   5112 C CB  . ARG D 1 161 ? 1.732   -5.615  63.652  1.00 58.12  ? 1039 ARG D CB  1 
ATOM   5113 C CG  . ARG D 1 161 ? 3.082   -5.087  63.152  1.00 59.91  ? 1039 ARG D CG  1 
ATOM   5114 C CD  . ARG D 1 161 ? 3.859   -4.366  64.230  1.00 63.16  ? 1039 ARG D CD  1 
ATOM   5115 N NE  . ARG D 1 161 ? 3.288   -3.042  64.435  1.00 67.18  ? 1039 ARG D NE  1 
ATOM   5116 C CZ  . ARG D 1 161 ? 3.984   -1.909  64.542  1.00 69.40  ? 1039 ARG D CZ  1 
ATOM   5117 N NH1 . ARG D 1 161 ? 5.313   -1.935  64.484  1.00 69.59  ? 1039 ARG D NH1 1 
ATOM   5118 N NH2 . ARG D 1 161 ? 3.340   -0.751  64.700  1.00 69.13  ? 1039 ARG D NH2 1 
ATOM   5119 N N   . GLU D 1 162 ? -1.173  -6.746  63.061  1.00 55.18  ? 1040 GLU D N   1 
ATOM   5120 C CA  . GLU D 1 162 ? -2.451  -7.253  63.538  1.00 55.49  ? 1040 GLU D CA  1 
ATOM   5121 C C   . GLU D 1 162 ? -2.885  -8.523  62.795  1.00 55.66  ? 1040 GLU D C   1 
ATOM   5122 O O   . GLU D 1 162 ? -3.652  -9.321  63.325  1.00 55.81  ? 1040 GLU D O   1 
ATOM   5123 C CB  . GLU D 1 162 ? -3.535  -6.171  63.523  1.00 60.74  ? 1040 GLU D CB  1 
ATOM   5124 C CG  . GLU D 1 162 ? -3.478  -5.201  64.729  1.00 61.57  ? 1040 GLU D CG  1 
ATOM   5125 C CD  . GLU D 1 162 ? -3.915  -5.822  66.087  1.00 63.59  ? 1040 GLU D CD  1 
ATOM   5126 O OE1 . GLU D 1 162 ? -3.422  -5.363  67.157  1.00 64.53  ? 1040 GLU D OE1 1 
ATOM   5127 O OE2 . GLU D 1 162 ? -4.776  -6.746  66.098  1.00 65.10  ? 1040 GLU D OE2 1 
ATOM   5128 N N   . ALA D 1 163 ? -2.365  -8.725  61.582  1.00 50.88  ? 1041 ALA D N   1 
ATOM   5129 C CA  . ALA D 1 163 ? -2.652  -9.937  60.794  1.00 50.46  ? 1041 ALA D CA  1 
ATOM   5130 C C   . ALA D 1 163 ? -1.975  -11.114 61.492  1.00 50.44  ? 1041 ALA D C   1 
ATOM   5131 O O   . ALA D 1 163 ? -2.527  -12.224 61.591  1.00 50.16  ? 1041 ALA D O   1 
ATOM   5132 C CB  . ALA D 1 163 ? -2.095  -9.805  59.377  1.00 50.19  ? 1041 ALA D CB  1 
ATOM   5133 N N   . GLU D 1 164 ? -0.765  -10.855 61.978  1.00 48.81  ? 1042 GLU D N   1 
ATOM   5134 C CA  . GLU D 1 164 ? -0.001  -11.885 62.639  1.00 49.31  ? 1042 GLU D CA  1 
ATOM   5135 C C   . GLU D 1 164 ? -0.659  -12.270 63.947  1.00 49.23  ? 1042 GLU D C   1 
ATOM   5136 O O   . GLU D 1 164 ? -0.790  -13.455 64.279  1.00 48.97  ? 1042 GLU D O   1 
ATOM   5137 C CB  . GLU D 1 164 ? 1.435   -11.427 62.839  1.00 52.11  ? 1042 GLU D CB  1 
ATOM   5138 C CG  . GLU D 1 164 ? 2.354   -12.536 63.260  1.00 53.20  ? 1042 GLU D CG  1 
ATOM   5139 C CD  . GLU D 1 164 ? 2.612   -12.497 64.741  1.00 55.29  ? 1042 GLU D CD  1 
ATOM   5140 O OE1 . GLU D 1 164 ? 3.782   -12.679 65.141  1.00 53.95  ? 1042 GLU D OE1 1 
ATOM   5141 O OE2 . GLU D 1 164 ? 1.658   -12.185 65.500  1.00 55.78  ? 1042 GLU D OE2 1 
ATOM   5142 N N   . ALA D 1 165 ? -1.112  -11.264 64.678  1.00 50.86  ? 1043 ALA D N   1 
ATOM   5143 C CA  . ALA D 1 165 ? -1.806  -11.516 65.938  1.00 51.55  ? 1043 ALA D CA  1 
ATOM   5144 C C   . ALA D 1 165 ? -3.107  -12.354 65.750  1.00 51.90  ? 1043 ALA D C   1 
ATOM   5145 O O   . ALA D 1 165 ? -3.466  -13.200 66.577  1.00 51.61  ? 1043 ALA D O   1 
ATOM   5146 C CB  . ALA D 1 165 ? -2.116  -10.194 66.617  1.00 51.82  ? 1043 ALA D CB  1 
ATOM   5147 N N   . ALA D 1 166 ? -3.807  -12.089 64.652  1.00 54.34  ? 1044 ALA D N   1 
ATOM   5148 C CA  . ALA D 1 166 ? -5.046  -12.766 64.316  1.00 54.95  ? 1044 ALA D CA  1 
ATOM   5149 C C   . ALA D 1 166 ? -4.823  -14.136 63.653  1.00 55.64  ? 1044 ALA D C   1 
ATOM   5150 O O   . ALA D 1 166 ? -5.781  -14.813 63.236  1.00 56.14  ? 1044 ALA D O   1 
ATOM   5151 C CB  . ALA D 1 166 ? -5.897  -11.874 63.422  1.00 55.40  ? 1044 ALA D CB  1 
ATOM   5152 N N   . SER D 1 167 ? -3.565  -14.544 63.540  1.00 57.38  ? 1045 SER D N   1 
ATOM   5153 C CA  . SER D 1 167 ? -3.272  -15.842 62.956  1.00 58.42  ? 1045 SER D CA  1 
ATOM   5154 C C   . SER D 1 167 ? -3.266  -16.908 64.075  1.00 58.99  ? 1045 SER D C   1 
ATOM   5155 O O   . SER D 1 167 ? -3.362  -18.120 63.803  1.00 59.02  ? 1045 SER D O   1 
ATOM   5156 C CB  . SER D 1 167 ? -1.956  -15.811 62.165  1.00 60.79  ? 1045 SER D CB  1 
ATOM   5157 O OG  . SER D 1 167 ? -2.151  -15.274 60.862  1.00 61.03  ? 1045 SER D OG  1 
ATOM   5158 N N   . ILE D 1 168 ? -3.260  -16.438 65.327  1.00 58.43  ? 1046 ILE D N   1 
ATOM   5159 C CA  . ILE D 1 168 ? -3.249  -17.292 66.522  1.00 59.14  ? 1046 ILE D CA  1 
ATOM   5160 C C   . ILE D 1 168 ? -4.576  -18.021 66.825  1.00 60.06  ? 1046 ILE D C   1 
ATOM   5161 O O   . ILE D 1 168 ? -4.651  -19.251 66.822  1.00 59.83  ? 1046 ILE D O   1 
ATOM   5162 C CB  . ILE D 1 168 ? -2.762  -16.487 67.730  1.00 60.27  ? 1046 ILE D CB  1 
ATOM   5163 C CG1 . ILE D 1 168 ? -1.653  -15.532 67.300  1.00 60.74  ? 1046 ILE D CG1 1 
ATOM   5164 C CG2 . ILE D 1 168 ? -2.298  -17.381 68.815  1.00 59.67  ? 1046 ILE D CG2 1 
ATOM   5165 C CD1 . ILE D 1 168 ? -0.500  -15.490 68.239  1.00 61.70  ? 1046 ILE D CD1 1 
ATOM   5166 N N   . LYS D 1 169 ? -5.620  -17.253 67.107  1.00 66.59  ? 1047 LYS D N   1 
ATOM   5167 C CA  . LYS D 1 169 ? -6.934  -17.815 67.424  1.00 68.11  ? 1047 LYS D CA  1 
ATOM   5168 C C   . LYS D 1 169 ? -7.656  -18.175 66.141  1.00 69.02  ? 1047 LYS D C   1 
ATOM   5169 O O   . LYS D 1 169 ? -8.520  -17.425 65.696  1.00 69.61  ? 1047 LYS D O   1 
ATOM   5170 C CB  . LYS D 1 169 ? -7.787  -16.768 68.154  1.00 71.58  ? 1047 LYS D CB  1 
ATOM   5171 C CG  . LYS D 1 169 ? -7.054  -15.979 69.241  1.00 72.43  ? 1047 LYS D CG  1 
ATOM   5172 C CD  . LYS D 1 169 ? -5.975  -15.002 68.699  1.00 74.62  ? 1047 LYS D CD  1 
ATOM   5173 C CE  . LYS D 1 169 ? -4.962  -14.602 69.814  1.00 75.14  ? 1047 LYS D CE  1 
ATOM   5174 N NZ  . LYS D 1 169 ? -4.162  -15.752 70.417  1.00 77.23  ? 1047 LYS D NZ  1 
ATOM   5175 N N   . ILE D 1 170 ? -7.312  -19.300 65.530  1.00 72.53  ? 1048 ILE D N   1 
ATOM   5176 C CA  . ILE D 1 170 ? -7.985  -19.682 64.295  1.00 73.07  ? 1048 ILE D CA  1 
ATOM   5177 C C   . ILE D 1 170 ? -9.319  -20.395 64.518  1.00 73.65  ? 1048 ILE D C   1 
ATOM   5178 O O   . ILE D 1 170 ? -9.493  -21.147 65.479  1.00 73.32  ? 1048 ILE D O   1 
ATOM   5179 C CB  . ILE D 1 170 ? -7.074  -20.489 63.363  1.00 75.52  ? 1048 ILE D CB  1 
ATOM   5180 C CG1 . ILE D 1 170 ? -6.017  -19.588 62.737  1.00 74.93  ? 1048 ILE D CG1 1 
ATOM   5181 C CG2 . ILE D 1 170 ? -7.891  -21.116 62.243  1.00 76.70  ? 1048 ILE D CG2 1 
ATOM   5182 C CD1 . ILE D 1 170 ? -5.916  -19.777 61.254  1.00 74.21  ? 1048 ILE D CD1 1 
ATOM   5183 N N   . ARG D 1 171 ? -10.245 -20.174 63.593  1.00 79.55  ? 1049 ARG D N   1 
ATOM   5184 C CA  . ARG D 1 171 ? -11.568 -20.794 63.623  1.00 79.99  ? 1049 ARG D CA  1 
ATOM   5185 C C   . ARG D 1 171 ? -11.511 -22.290 63.214  1.00 80.13  ? 1049 ARG D C   1 
ATOM   5186 O O   . ARG D 1 171 ? -12.032 -23.162 63.938  1.00 80.53  ? 1049 ARG D O   1 
ATOM   5187 C CB  . ARG D 1 171 ? -12.486 -20.023 62.668  1.00 78.40  ? 1049 ARG D CB  1 
ATOM   5188 C CG  . ARG D 1 171 ? -13.958 -20.117 62.964  1.00 78.78  ? 1049 ARG D CG  1 
ATOM   5189 C CD  . ARG D 1 171 ? -14.757 -19.987 61.679  1.00 80.60  ? 1049 ARG D CD  1 
ATOM   5190 N NE  . ARG D 1 171 ? -16.185 -20.144 61.924  1.00 80.52  ? 1049 ARG D NE  1 
ATOM   5191 C CZ  . ARG D 1 171 ? -16.882 -21.245 61.653  1.00 80.32  ? 1049 ARG D CZ  1 
ATOM   5192 N NH1 . ARG D 1 171 ? -16.289 -22.307 61.104  1.00 81.20  ? 1049 ARG D NH1 1 
ATOM   5193 N NH2 . ARG D 1 171 ? -18.176 -21.288 61.947  1.00 78.87  ? 1049 ARG D NH2 1 
ATOM   5194 N N   . THR D 1 172 ? -10.885 -22.559 62.059  1.00 83.07  ? 1050 THR D N   1 
ATOM   5195 C CA  . THR D 1 172 ? -10.733 -23.906 61.488  1.00 83.07  ? 1050 THR D CA  1 
ATOM   5196 C C   . THR D 1 172 ? -9.331  -23.993 60.870  1.00 83.09  ? 1050 THR D C   1 
ATOM   5197 O O   . THR D 1 172 ? -8.847  -22.998 60.298  1.00 83.34  ? 1050 THR D O   1 
ATOM   5198 C CB  . THR D 1 172 ? -11.793 -24.142 60.401  1.00 85.36  ? 1050 THR D CB  1 
ATOM   5199 O OG1 . THR D 1 172 ? -11.150 -24.456 59.161  1.00 85.28  ? 1050 THR D OG1 1 
ATOM   5200 C CG2 . THR D 1 172 ? -12.613 -22.884 60.198  1.00 85.11  ? 1050 THR D CG2 1 
ATOM   5201 N N   . ASP D 1 173 ? -8.678  -25.158 60.970  1.00 87.02  ? 1051 ASP D N   1 
ATOM   5202 C CA  . ASP D 1 173 ? -7.300  -25.303 60.454  1.00 86.52  ? 1051 ASP D CA  1 
ATOM   5203 C C   . ASP D 1 173 ? -7.117  -25.169 58.940  1.00 85.62  ? 1051 ASP D C   1 
ATOM   5204 O O   . ASP D 1 173 ? -5.990  -25.098 58.420  1.00 85.51  ? 1051 ASP D O   1 
ATOM   5205 C CB  . ASP D 1 173 ? -6.577  -26.546 60.997  1.00 90.11  ? 1051 ASP D CB  1 
ATOM   5206 C CG  . ASP D 1 173 ? -5.042  -26.453 60.837  1.00 92.48  ? 1051 ASP D CG  1 
ATOM   5207 O OD1 . ASP D 1 173 ? -4.542  -26.591 59.690  1.00 95.05  ? 1051 ASP D OD1 1 
ATOM   5208 O OD2 . ASP D 1 173 ? -4.337  -26.206 61.847  1.00 94.51  ? 1051 ASP D OD2 1 
ATOM   5209 N N   . ALA D 1 174 ? -8.239  -25.140 58.240  1.00 84.44  ? 1052 ALA D N   1 
ATOM   5210 C CA  . ALA D 1 174 ? -8.260  -24.949 56.801  1.00 83.48  ? 1052 ALA D CA  1 
ATOM   5211 C C   . ALA D 1 174 ? -9.726  -24.751 56.502  1.00 82.70  ? 1052 ALA D C   1 
ATOM   5212 O O   . ALA D 1 174 ? -10.415 -25.730 56.196  1.00 82.65  ? 1052 ALA D O   1 
ATOM   5213 C CB  . ALA D 1 174 ? -7.719  -26.177 56.068  1.00 83.89  ? 1052 ALA D CB  1 
ATOM   5214 N N   . GLY D 1 175 ? -10.229 -23.515 56.657  1.00 78.57  ? 1053 GLY D N   1 
ATOM   5215 C CA  . GLY D 1 175 ? -9.485  -22.320 57.046  1.00 77.18  ? 1053 GLY D CA  1 
ATOM   5216 C C   . GLY D 1 175 ? -8.397  -21.778 56.121  1.00 76.08  ? 1053 GLY D C   1 
ATOM   5217 O O   . GLY D 1 175 ? -7.505  -22.506 55.697  1.00 75.81  ? 1053 GLY D O   1 
ATOM   5218 N N   . PHE D 1 176 ? -8.417  -20.476 55.853  1.00 71.14  ? 1054 PHE D N   1 
ATOM   5219 C CA  . PHE D 1 176 ? -7.333  -19.865 55.071  1.00 69.77  ? 1054 PHE D CA  1 
ATOM   5220 C C   . PHE D 1 176 ? -6.152  -19.630 56.035  1.00 68.23  ? 1054 PHE D C   1 
ATOM   5221 O O   . PHE D 1 176 ? -6.347  -19.550 57.248  1.00 68.46  ? 1054 PHE D O   1 
ATOM   5222 C CB  . PHE D 1 176 ? -7.771  -18.540 54.441  1.00 72.06  ? 1054 PHE D CB  1 
ATOM   5223 C CG  . PHE D 1 176 ? -6.630  -17.749 53.866  1.00 73.63  ? 1054 PHE D CG  1 
ATOM   5224 C CD1 . PHE D 1 176 ? -5.643  -18.380 53.107  1.00 76.33  ? 1054 PHE D CD1 1 
ATOM   5225 C CD2 . PHE D 1 176 ? -6.489  -16.383 54.139  1.00 73.82  ? 1054 PHE D CD2 1 
ATOM   5226 C CE1 . PHE D 1 176 ? -4.542  -17.658 52.619  1.00 75.44  ? 1054 PHE D CE1 1 
ATOM   5227 C CE2 . PHE D 1 176 ? -5.397  -15.657 53.640  1.00 73.15  ? 1054 PHE D CE2 1 
ATOM   5228 C CZ  . PHE D 1 176 ? -4.431  -16.300 52.882  1.00 74.66  ? 1054 PHE D CZ  1 
ATOM   5229 N N   . THR D 1 177 ? -4.927  -19.567 55.520  1.00 61.07  ? 1055 THR D N   1 
ATOM   5230 C CA  . THR D 1 177 ? -3.773  -19.365 56.401  1.00 58.94  ? 1055 THR D CA  1 
ATOM   5231 C C   . THR D 1 177 ? -2.569  -18.620 55.848  1.00 57.32  ? 1055 THR D C   1 
ATOM   5232 O O   . THR D 1 177 ? -2.131  -18.841 54.719  1.00 57.47  ? 1055 THR D O   1 
ATOM   5233 C CB  . THR D 1 177 ? -3.282  -20.668 57.031  1.00 57.82  ? 1055 THR D CB  1 
ATOM   5234 O OG1 . THR D 1 177 ? -4.032  -20.947 58.216  1.00 58.79  ? 1055 THR D OG1 1 
ATOM   5235 C CG2 . THR D 1 177 ? -1.809  -20.533 57.381  1.00 57.27  ? 1055 THR D CG2 1 
ATOM   5236 N N   . LEU D 1 178 ? -1.956  -17.826 56.709  1.00 47.72  ? 1056 LEU D N   1 
ATOM   5237 C CA  . LEU D 1 178 ? -0.743  -17.143 56.337  1.00 45.31  ? 1056 LEU D CA  1 
ATOM   5238 C C   . LEU D 1 178 ? 0.335   -17.820 57.126  1.00 43.88  ? 1056 LEU D C   1 
ATOM   5239 O O   . LEU D 1 178 ? 0.156   -18.100 58.311  1.00 43.54  ? 1056 LEU D O   1 
ATOM   5240 C CB  . LEU D 1 178 ? -0.792  -15.684 56.767  1.00 44.42  ? 1056 LEU D CB  1 
ATOM   5241 C CG  . LEU D 1 178 ? -1.535  -14.794 55.802  1.00 42.48  ? 1056 LEU D CG  1 
ATOM   5242 C CD1 . LEU D 1 178 ? -1.392  -13.377 56.299  1.00 41.28  ? 1056 LEU D CD1 1 
ATOM   5243 C CD2 . LEU D 1 178 ? -0.938  -14.994 54.437  1.00 41.17  ? 1056 LEU D CD2 1 
ATOM   5244 N N   . ARG D 1 179 ? 1.465   -18.046 56.478  1.00 39.08  ? 1057 ARG D N   1 
ATOM   5245 C CA  . ARG D 1 179 ? 2.609   -18.626 57.153  1.00 38.12  ? 1057 ARG D CA  1 
ATOM   5246 C C   . ARG D 1 179 ? 3.402   -17.478 57.815  1.00 38.19  ? 1057 ARG D C   1 
ATOM   5247 O O   . ARG D 1 179 ? 3.800   -16.489 57.155  1.00 38.14  ? 1057 ARG D O   1 
ATOM   5248 C CB  . ARG D 1 179 ? 3.448   -19.450 56.174  1.00 34.33  ? 1057 ARG D CB  1 
ATOM   5249 C CG  . ARG D 1 179 ? 4.790   -19.876 56.691  1.00 32.41  ? 1057 ARG D CG  1 
ATOM   5250 C CD  . ARG D 1 179 ? 5.327   -21.058 55.926  1.00 29.76  ? 1057 ARG D CD  1 
ATOM   5251 N NE  . ARG D 1 179 ? 6.796   -21.137 55.809  1.00 30.58  ? 1057 ARG D NE  1 
ATOM   5252 C CZ  . ARG D 1 179 ? 7.624   -20.104 55.627  1.00 30.63  ? 1057 ARG D CZ  1 
ATOM   5253 N NH1 . ARG D 1 179 ? 7.174   -18.842 55.657  1.00 29.82  ? 1057 ARG D NH1 1 
ATOM   5254 N NH2 . ARG D 1 179 ? 8.916   -20.339 55.415  1.00 29.28  ? 1057 ARG D NH2 1 
ATOM   5255 N N   . TRP D 1 180 ? 3.563   -17.590 59.132  1.00 36.57  ? 1058 TRP D N   1 
ATOM   5256 C CA  . TRP D 1 180 ? 4.241   -16.586 59.936  1.00 36.96  ? 1058 TRP D CA  1 
ATOM   5257 C C   . TRP D 1 180 ? 5.486   -17.211 60.510  1.00 37.85  ? 1058 TRP D C   1 
ATOM   5258 O O   . TRP D 1 180 ? 5.546   -17.586 61.688  1.00 37.82  ? 1058 TRP D O   1 
ATOM   5259 C CB  . TRP D 1 180 ? 3.331   -16.077 61.066  1.00 35.12  ? 1058 TRP D CB  1 
ATOM   5260 C CG  . TRP D 1 180 ? 2.205   -15.192 60.582  1.00 33.29  ? 1058 TRP D CG  1 
ATOM   5261 C CD1 . TRP D 1 180 ? 0.894   -15.540 60.415  1.00 31.12  ? 1058 TRP D CD1 1 
ATOM   5262 C CD2 . TRP D 1 180 ? 2.329   -13.851 60.081  1.00 31.60  ? 1058 TRP D CD2 1 
ATOM   5263 N NE1 . TRP D 1 180 ? 0.199   -14.501 59.843  1.00 28.73  ? 1058 TRP D NE1 1 
ATOM   5264 C CE2 . TRP D 1 180 ? 1.059   -13.451 59.641  1.00 29.32  ? 1058 TRP D CE2 1 
ATOM   5265 C CE3 . TRP D 1 180 ? 3.412   -12.969 59.918  1.00 30.69  ? 1058 TRP D CE3 1 
ATOM   5266 C CZ2 . TRP D 1 180 ? 0.818   -12.188 59.146  1.00 30.08  ? 1058 TRP D CZ2 1 
ATOM   5267 C CZ3 . TRP D 1 180 ? 3.177   -11.740 59.395  1.00 30.31  ? 1058 TRP D CZ3 1 
ATOM   5268 C CH2 . TRP D 1 180 ? 1.891   -11.375 58.960  1.00 30.68  ? 1058 TRP D CH2 1 
ATOM   5269 N N   . VAL D 1 181 ? 6.493   -17.306 59.666  1.00 38.64  ? 1059 VAL D N   1 
ATOM   5270 C CA  . VAL D 1 181 ? 7.770   -17.837 60.093  1.00 39.75  ? 1059 VAL D CA  1 
ATOM   5271 C C   . VAL D 1 181 ? 8.842   -16.736 60.141  1.00 40.85  ? 1059 VAL D C   1 
ATOM   5272 O O   . VAL D 1 181 ? 9.290   -16.246 59.112  1.00 41.26  ? 1059 VAL D O   1 
ATOM   5273 C CB  . VAL D 1 181 ? 8.192   -18.994 59.211  1.00 43.34  ? 1059 VAL D CB  1 
ATOM   5274 C CG1 . VAL D 1 181 ? 9.680   -19.171 59.256  1.00 43.81  ? 1059 VAL D CG1 1 
ATOM   5275 C CG2 . VAL D 1 181 ? 7.437   -20.256 59.599  1.00 44.09  ? 1059 VAL D CG2 1 
ATOM   5276 N N   . ARG D 1 182 ? 9.241   -16.360 61.355  1.00 43.80  ? 1060 ARG D N   1 
ATOM   5277 C CA  . ARG D 1 182 ? 10.269  -15.360 61.548  1.00 45.46  ? 1060 ARG D CA  1 
ATOM   5278 C C   . ARG D 1 182 ? 11.511  -15.700 60.727  1.00 46.91  ? 1060 ARG D C   1 
ATOM   5279 O O   . ARG D 1 182 ? 12.135  -16.757 60.893  1.00 46.10  ? 1060 ARG D O   1 
ATOM   5280 C CB  . ARG D 1 182 ? 10.658  -15.253 63.031  1.00 51.00  ? 1060 ARG D CB  1 
ATOM   5281 C CG  . ARG D 1 182 ? 9.890   -14.247 63.873  1.00 50.52  ? 1060 ARG D CG  1 
ATOM   5282 C CD  . ARG D 1 182 ? 10.009  -12.845 63.326  1.00 52.51  ? 1060 ARG D CD  1 
ATOM   5283 N NE  . ARG D 1 182 ? 10.480  -11.912 64.340  1.00 55.21  ? 1060 ARG D NE  1 
ATOM   5284 C CZ  . ARG D 1 182 ? 11.612  -11.205 64.249  1.00 55.63  ? 1060 ARG D CZ  1 
ATOM   5285 N NH1 . ARG D 1 182 ? 12.402  -11.301 63.170  1.00 55.43  ? 1060 ARG D NH1 1 
ATOM   5286 N NH2 . ARG D 1 182 ? 11.956  -10.383 65.242  1.00 53.95  ? 1060 ARG D NH2 1 
ATOM   5287 N N   . LYS D 1 183 ? 11.874  -14.767 59.854  1.00 55.81  ? 1061 LYS D N   1 
ATOM   5288 C CA  . LYS D 1 183 ? 13.101  -14.871 59.087  1.00 58.30  ? 1061 LYS D CA  1 
ATOM   5289 C C   . LYS D 1 183 ? 14.234  -14.492 60.042  1.00 60.25  ? 1061 LYS D C   1 
ATOM   5290 O O   . LYS D 1 183 ? 14.154  -13.501 60.813  1.00 60.52  ? 1061 LYS D O   1 
ATOM   5291 C CB  . LYS D 1 183 ? 13.099  -13.912 57.909  1.00 58.76  ? 1061 LYS D CB  1 
ATOM   5292 C CG  . LYS D 1 183 ? 13.866  -14.437 56.705  1.00 59.87  ? 1061 LYS D CG  1 
ATOM   5293 C CD  . LYS D 1 183 ? 13.316  -13.877 55.386  1.00 59.68  ? 1061 LYS D CD  1 
ATOM   5294 C CE  . LYS D 1 183 ? 14.366  -13.060 54.652  1.00 60.38  ? 1061 LYS D CE  1 
ATOM   5295 N NZ  . LYS D 1 183 ? 14.802  -11.861 55.449  1.00 59.79  ? 1061 LYS D NZ  1 
ATOM   5296 N N   . THR D 1 184 ? 15.279  -15.306 60.019  1.00 68.74  ? 1062 THR D N   1 
ATOM   5297 C CA  . THR D 1 184 ? 16.416  -15.076 60.889  1.00 70.52  ? 1062 THR D CA  1 
ATOM   5298 C C   . THR D 1 184 ? 17.638  -15.594 60.120  1.00 71.46  ? 1062 THR D C   1 
ATOM   5299 O O   . THR D 1 184 ? 17.488  -16.415 59.195  1.00 71.93  ? 1062 THR D O   1 
ATOM   5300 C CB  . THR D 1 184 ? 16.170  -15.715 62.320  1.00 82.09  ? 1062 THR D CB  1 
ATOM   5301 O OG1 . THR D 1 184 ? 15.029  -15.087 62.935  1.00 81.33  ? 1062 THR D OG1 1 
ATOM   5302 C CG2 . THR D 1 184 ? 17.406  -15.578 63.263  1.00 81.85  ? 1062 THR D CG2 1 
ATOM   5303 N N   . PRO D 1 185 ? 18.845  -15.070 60.452  1.00 75.25  ? 1063 PRO D N   1 
ATOM   5304 C CA  . PRO D 1 185 ? 20.107  -15.430 59.785  1.00 75.49  ? 1063 PRO D CA  1 
ATOM   5305 C C   . PRO D 1 185 ? 20.881  -16.549 60.509  1.00 75.62  ? 1063 PRO D C   1 
ATOM   5306 O O   . PRO D 1 185 ? 21.413  -17.477 59.878  1.00 75.39  ? 1063 PRO D O   1 
ATOM   5307 C CB  . PRO D 1 185 ? 20.906  -14.109 59.825  1.00 77.46  ? 1063 PRO D CB  1 
ATOM   5308 C CG  . PRO D 1 185 ? 20.215  -13.231 60.930  1.00 77.33  ? 1063 PRO D CG  1 
ATOM   5309 C CD  . PRO D 1 185 ? 19.059  -14.029 61.481  1.00 77.39  ? 1063 PRO D CD  1 
ATOM   5310 N N   . HIS E 2 1   ? -29.570 0.506   -27.421 1.00 92.00  ? 57   HIS E N   1 
ATOM   5311 C CA  . HIS E 2 1   ? -30.389 0.698   -26.224 1.00 92.02  ? 57   HIS E CA  1 
ATOM   5312 C C   . HIS E 2 1   ? -30.061 1.974   -25.441 1.00 91.22  ? 57   HIS E C   1 
ATOM   5313 O O   . HIS E 2 1   ? -29.877 3.055   -26.022 1.00 90.73  ? 57   HIS E O   1 
ATOM   5314 C CB  . HIS E 2 1   ? -30.295 -0.517  -25.298 1.00 93.56  ? 57   HIS E CB  1 
ATOM   5315 C CG  . HIS E 2 1   ? -31.560 -1.313  -25.226 1.00 96.25  ? 57   HIS E CG  1 
ATOM   5316 N ND1 . HIS E 2 1   ? -31.953 -2.175  -26.229 1.00 98.53  ? 57   HIS E ND1 1 
ATOM   5317 C CD2 . HIS E 2 1   ? -32.540 -1.350  -24.290 1.00 95.97  ? 57   HIS E CD2 1 
ATOM   5318 C CE1 . HIS E 2 1   ? -33.109 -2.727  -25.903 1.00 98.01  ? 57   HIS E CE1 1 
ATOM   5319 N NE2 . HIS E 2 1   ? -33.489 -2.240  -24.734 1.00 97.01  ? 57   HIS E NE2 1 
ATOM   5320 N N   . MET E 2 2   ? -29.997 1.832   -24.116 1.00 82.82  ? 58   MET E N   1 
ATOM   5321 C CA  . MET E 2 2   ? -29.701 2.952   -23.224 1.00 81.82  ? 58   MET E CA  1 
ATOM   5322 C C   . MET E 2 2   ? -28.337 3.598   -23.492 1.00 80.07  ? 58   MET E C   1 
ATOM   5323 O O   . MET E 2 2   ? -27.581 3.172   -24.379 1.00 80.03  ? 58   MET E O   1 
ATOM   5324 C CB  . MET E 2 2   ? -29.805 2.528   -21.750 1.00 84.16  ? 58   MET E CB  1 
ATOM   5325 C CG  . MET E 2 2   ? -29.949 3.695   -20.762 1.00 87.76  ? 58   MET E CG  1 
ATOM   5326 S SD  . MET E 2 2   ? -31.478 4.657   -21.008 1.00 95.76  ? 58   MET E SD  1 
ATOM   5327 C CE  . MET E 2 2   ? -32.683 3.303   -21.615 1.00 91.91  ? 58   MET E CE  1 
ATOM   5328 N N   . ARG E 2 3   ? -28.036 4.632   -22.711 1.00 71.90  ? 59   ARG E N   1 
ATOM   5329 C CA  . ARG E 2 3   ? -26.778 5.342   -22.854 1.00 69.57  ? 59   ARG E CA  1 
ATOM   5330 C C   . ARG E 2 3   ? -25.943 5.265   -21.583 1.00 67.94  ? 59   ARG E C   1 
ATOM   5331 O O   . ARG E 2 3   ? -25.034 6.062   -21.380 1.00 68.00  ? 59   ARG E O   1 
ATOM   5332 C CB  . ARG E 2 3   ? -27.023 6.798   -23.245 1.00 77.02  ? 59   ARG E CB  1 
ATOM   5333 C CG  . ARG E 2 3   ? -28.460 7.265   -23.068 1.00 76.23  ? 59   ARG E CG  1 
ATOM   5334 C CD  . ARG E 2 3   ? -28.532 8.759   -22.758 1.00 74.28  ? 59   ARG E CD  1 
ATOM   5335 N NE  . ARG E 2 3   ? -29.083 8.989   -21.428 1.00 72.68  ? 59   ARG E NE  1 
ATOM   5336 C CZ  . ARG E 2 3   ? -28.936 10.108  -20.736 1.00 73.17  ? 59   ARG E CZ  1 
ATOM   5337 N NH1 . ARG E 2 3   ? -28.273 11.148  -21.249 1.00 72.63  ? 59   ARG E NH1 1 
ATOM   5338 N NH2 . ARG E 2 3   ? -29.472 10.191  -19.534 1.00 75.30  ? 59   ARG E NH2 1 
ATOM   5339 N N   . LYS E 2 4   ? -26.257 4.297   -20.731 1.00 58.86  ? 60   LYS E N   1 
ATOM   5340 C CA  . LYS E 2 4   ? -25.512 4.092   -19.492 1.00 56.82  ? 60   LYS E CA  1 
ATOM   5341 C C   . LYS E 2 4   ? -24.653 2.866   -19.633 1.00 55.67  ? 60   LYS E C   1 
ATOM   5342 O O   . LYS E 2 4   ? -25.132 1.802   -19.990 1.00 55.10  ? 60   LYS E O   1 
ATOM   5343 C CB  . LYS E 2 4   ? -26.447 3.883   -18.305 1.00 57.30  ? 60   LYS E CB  1 
ATOM   5344 C CG  . LYS E 2 4   ? -27.369 5.037   -18.072 1.00 57.44  ? 60   LYS E CG  1 
ATOM   5345 C CD  . LYS E 2 4   ? -28.334 4.726   -16.967 1.00 58.75  ? 60   LYS E CD  1 
ATOM   5346 C CE  . LYS E 2 4   ? -28.716 5.996   -16.239 1.00 60.27  ? 60   LYS E CE  1 
ATOM   5347 N NZ  . LYS E 2 4   ? -28.197 7.244   -16.924 1.00 59.18  ? 60   LYS E NZ  1 
ATOM   5348 N N   . ILE E 2 5   ? -23.374 3.008   -19.347 1.00 49.32  ? 61   ILE E N   1 
ATOM   5349 C CA  . ILE E 2 5   ? -22.492 1.870   -19.431 1.00 47.64  ? 61   ILE E CA  1 
ATOM   5350 C C   . ILE E 2 5   ? -21.868 1.694   -18.067 1.00 46.99  ? 61   ILE E C   1 
ATOM   5351 O O   . ILE E 2 5   ? -21.864 2.620   -17.264 1.00 47.28  ? 61   ILE E O   1 
ATOM   5352 C CB  . ILE E 2 5   ? -21.414 2.046   -20.521 1.00 49.72  ? 61   ILE E CB  1 
ATOM   5353 C CG1 . ILE E 2 5   ? -20.671 3.362   -20.344 1.00 49.69  ? 61   ILE E CG1 1 
ATOM   5354 C CG2 . ILE E 2 5   ? -22.021 1.980   -21.895 1.00 49.35  ? 61   ILE E CG2 1 
ATOM   5355 C CD1 . ILE E 2 5   ? -19.232 3.277   -20.706 1.00 47.42  ? 61   ILE E CD1 1 
ATOM   5356 N N   . LEU E 2 6   ? -21.366 0.498   -17.799 1.00 44.35  ? 62   LEU E N   1 
ATOM   5357 C CA  . LEU E 2 6   ? -20.682 0.250   -16.562 1.00 43.25  ? 62   LEU E CA  1 
ATOM   5358 C C   . LEU E 2 6   ? -19.384 -0.427  -16.926 1.00 43.31  ? 62   LEU E C   1 
ATOM   5359 O O   . LEU E 2 6   ? -19.356 -1.383  -17.703 1.00 42.98  ? 62   LEU E O   1 
ATOM   5360 C CB  . LEU E 2 6   ? -21.509 -0.597  -15.610 1.00 43.83  ? 62   LEU E CB  1 
ATOM   5361 C CG  . LEU E 2 6   ? -20.755 -1.587  -14.722 1.00 41.44  ? 62   LEU E CG  1 
ATOM   5362 C CD1 . LEU E 2 6   ? -20.281 -0.987  -13.421 1.00 40.25  ? 62   LEU E CD1 1 
ATOM   5363 C CD2 . LEU E 2 6   ? -21.689 -2.753  -14.460 1.00 42.00  ? 62   LEU E CD2 1 
ATOM   5364 N N   . ILE E 2 7   ? -18.310 0.134   -16.369 1.00 43.37  ? 63   ILE E N   1 
ATOM   5365 C CA  . ILE E 2 7   ? -16.918 -0.303  -16.560 1.00 43.08  ? 63   ILE E CA  1 
ATOM   5366 C C   . ILE E 2 7   ? -16.414 -1.076  -15.329 1.00 43.08  ? 63   ILE E C   1 
ATOM   5367 O O   . ILE E 2 7   ? -16.549 -0.602  -14.210 1.00 42.56  ? 63   ILE E O   1 
ATOM   5368 C CB  . ILE E 2 7   ? -15.998 0.930   -16.838 1.00 45.11  ? 63   ILE E CB  1 
ATOM   5369 C CG1 . ILE E 2 7   ? -16.169 1.440   -18.267 1.00 44.57  ? 63   ILE E CG1 1 
ATOM   5370 C CG2 . ILE E 2 7   ? -14.549 0.611   -16.557 1.00 46.30  ? 63   ILE E CG2 1 
ATOM   5371 C CD1 . ILE E 2 7   ? -15.875 2.910   -18.404 1.00 43.25  ? 63   ILE E CD1 1 
ATOM   5372 N N   . ARG E 2 8   ? -15.844 -2.263  -15.553 1.00 43.70  ? 64   ARG E N   1 
ATOM   5373 C CA  . ARG E 2 8   ? -15.301 -3.118  -14.488 1.00 43.49  ? 64   ARG E CA  1 
ATOM   5374 C C   . ARG E 2 8   ? -13.842 -3.389  -14.817 1.00 43.13  ? 64   ARG E C   1 
ATOM   5375 O O   . ARG E 2 8   ? -13.433 -3.379  -15.988 1.00 43.17  ? 64   ARG E O   1 
ATOM   5376 C CB  . ARG E 2 8   ? -16.019 -4.458  -14.469 1.00 50.31  ? 64   ARG E CB  1 
ATOM   5377 C CG  . ARG E 2 8   ? -17.493 -4.411  -14.101 1.00 52.81  ? 64   ARG E CG  1 
ATOM   5378 C CD  . ARG E 2 8   ? -17.796 -5.576  -13.180 1.00 54.57  ? 64   ARG E CD  1 
ATOM   5379 N NE  . ARG E 2 8   ? -19.215 -5.882  -12.989 1.00 57.70  ? 64   ARG E NE  1 
ATOM   5380 C CZ  . ARG E 2 8   ? -19.829 -6.930  -13.538 1.00 60.66  ? 64   ARG E CZ  1 
ATOM   5381 N NH1 . ARG E 2 8   ? -19.163 -7.701  -14.398 1.00 62.01  ? 64   ARG E NH1 1 
ATOM   5382 N NH2 . ARG E 2 8   ? -21.112 -7.178  -13.278 1.00 60.39  ? 64   ARG E NH2 1 
ATOM   5383 N N   . GLY E 2 9   ? -13.047 -3.629  -13.789 1.00 43.75  ? 65   GLY E N   1 
ATOM   5384 C CA  . GLY E 2 9   ? -11.650 -3.948  -13.991 1.00 43.34  ? 65   GLY E CA  1 
ATOM   5385 C C   . GLY E 2 9   ? -10.700 -2.770  -13.948 1.00 43.64  ? 65   GLY E C   1 
ATOM   5386 O O   . GLY E 2 9   ? -9.524  -2.905  -14.331 1.00 44.22  ? 65   GLY E O   1 
ATOM   5387 N N   . LEU E 2 10  ? -11.182 -1.610  -13.498 1.00 42.76  ? 66   LEU E N   1 
ATOM   5388 C CA  . LEU E 2 10  ? -10.337 -0.431  -13.399 1.00 42.11  ? 66   LEU E CA  1 
ATOM   5389 C C   . LEU E 2 10  ? -9.261  -0.676  -12.344 1.00 42.37  ? 66   LEU E C   1 
ATOM   5390 O O   . LEU E 2 10  ? -9.424  -1.537  -11.469 1.00 41.89  ? 66   LEU E O   1 
ATOM   5391 C CB  . LEU E 2 10  ? -11.188 0.779   -13.036 1.00 41.29  ? 66   LEU E CB  1 
ATOM   5392 C CG  . LEU E 2 10  ? -12.215 1.209   -14.093 1.00 41.24  ? 66   LEU E CG  1 
ATOM   5393 C CD1 . LEU E 2 10  ? -13.321 2.020   -13.483 1.00 39.89  ? 66   LEU E CD1 1 
ATOM   5394 C CD2 . LEU E 2 10  ? -11.563 1.972   -15.232 1.00 42.20  ? 66   LEU E CD2 1 
ATOM   5395 N N   . PRO E 2 11  ? -8.132  0.058   -12.425 1.00 44.55  ? 67   PRO E N   1 
ATOM   5396 C CA  . PRO E 2 11  ? -7.008  -0.035  -11.482 1.00 44.40  ? 67   PRO E CA  1 
ATOM   5397 C C   . PRO E 2 11  ? -7.409  0.363   -10.068 1.00 44.52  ? 67   PRO E C   1 
ATOM   5398 O O   . PRO E 2 11  ? -8.397  1.067   -9.881  1.00 44.66  ? 67   PRO E O   1 
ATOM   5399 C CB  . PRO E 2 11  ? -6.036  0.986   -12.030 1.00 45.49  ? 67   PRO E CB  1 
ATOM   5400 C CG  . PRO E 2 11  ? -6.274  0.940   -13.515 1.00 46.24  ? 67   PRO E CG  1 
ATOM   5401 C CD  . PRO E 2 11  ? -7.748  0.730   -13.682 1.00 46.22  ? 67   PRO E CD  1 
ATOM   5402 N N   . GLY E 2 12  ? -6.657  -0.083  -9.065  1.00 45.28  ? 68   GLY E N   1 
ATOM   5403 C CA  . GLY E 2 12  ? -6.940  0.251   -7.674  1.00 45.95  ? 68   GLY E CA  1 
ATOM   5404 C C   . GLY E 2 12  ? -6.826  1.736   -7.378  1.00 46.16  ? 68   GLY E C   1 
ATOM   5405 O O   . GLY E 2 12  ? -7.645  2.340   -6.672  1.00 45.73  ? 68   GLY E O   1 
ATOM   5406 N N   . ASP E 2 13  ? -5.803  2.323   -7.978  1.00 50.59  ? 69   ASP E N   1 
ATOM   5407 C CA  . ASP E 2 13  ? -5.475  3.733   -7.824  1.00 51.79  ? 69   ASP E CA  1 
ATOM   5408 C C   . ASP E 2 13  ? -5.987  4.561   -9.017  1.00 51.94  ? 69   ASP E C   1 
ATOM   5409 O O   . ASP E 2 13  ? -5.347  5.545   -9.412  1.00 52.86  ? 69   ASP E O   1 
ATOM   5410 C CB  . ASP E 2 13  ? -3.946  3.881   -7.727  1.00 54.73  ? 69   ASP E CB  1 
ATOM   5411 C CG  . ASP E 2 13  ? -3.206  3.254   -8.941  1.00 56.63  ? 69   ASP E CG  1 
ATOM   5412 O OD1 . ASP E 2 13  ? -3.831  2.446   -9.681  1.00 56.02  ? 69   ASP E OD1 1 
ATOM   5413 O OD2 . ASP E 2 13  ? -2.014  3.601   -9.172  1.00 56.87  ? 69   ASP E OD2 1 
ATOM   5414 N N   . VAL E 2 14  ? -7.110  4.149   -9.609  1.00 48.60  ? 70   VAL E N   1 
ATOM   5415 C CA  . VAL E 2 14  ? -7.676  4.887   -10.738 1.00 47.98  ? 70   VAL E CA  1 
ATOM   5416 C C   . VAL E 2 14  ? -8.183  6.228   -10.188 1.00 48.02  ? 70   VAL E C   1 
ATOM   5417 O O   . VAL E 2 14  ? -8.500  6.330   -8.994  1.00 47.79  ? 70   VAL E O   1 
ATOM   5418 C CB  . VAL E 2 14  ? -8.801  4.066   -11.443 1.00 48.72  ? 70   VAL E CB  1 
ATOM   5419 C CG1 . VAL E 2 14  ? -10.096 4.180   -10.681 1.00 48.01  ? 70   VAL E CG1 1 
ATOM   5420 C CG2 . VAL E 2 14  ? -8.995  4.498   -12.871 1.00 47.33  ? 70   VAL E CG2 1 
ATOM   5421 N N   . THR E 2 15  ? -8.192  7.255   -11.044 1.00 50.44  ? 71   THR E N   1 
ATOM   5422 C CA  . THR E 2 15  ? -8.724  8.585   -10.703 1.00 50.02  ? 71   THR E CA  1 
ATOM   5423 C C   . THR E 2 15  ? -9.903  8.918   -11.620 1.00 50.55  ? 71   THR E C   1 
ATOM   5424 O O   . THR E 2 15  ? -10.029 8.353   -12.706 1.00 50.61  ? 71   THR E O   1 
ATOM   5425 C CB  . THR E 2 15  ? -7.640  9.680   -10.757 1.00 50.81  ? 71   THR E CB  1 
ATOM   5426 O OG1 . THR E 2 15  ? -7.257  9.960   -12.115 1.00 49.48  ? 71   THR E OG1 1 
ATOM   5427 C CG2 . THR E 2 15  ? -6.445  9.250   -9.963  1.00 50.00  ? 71   THR E CG2 1 
ATOM   5428 N N   . ASN E 2 16  ? -10.772 9.821   -11.196 1.00 51.27  ? 72   ASN E N   1 
ATOM   5429 C CA  . ASN E 2 16  ? -11.880 10.179  -12.057 1.00 52.13  ? 72   ASN E CA  1 
ATOM   5430 C C   . ASN E 2 16  ? -11.320 10.654  -13.399 1.00 52.55  ? 72   ASN E C   1 
ATOM   5431 O O   . ASN E 2 16  ? -11.680 10.108  -14.457 1.00 53.43  ? 72   ASN E O   1 
ATOM   5432 C CB  . ASN E 2 16  ? -12.796 11.201  -11.395 1.00 55.05  ? 72   ASN E CB  1 
ATOM   5433 C CG  . ASN E 2 16  ? -13.307 10.721  -10.036 1.00 55.25  ? 72   ASN E CG  1 
ATOM   5434 O OD1 . ASN E 2 16  ? -14.397 10.144  -9.936  1.00 56.11  ? 72   ASN E OD1 1 
ATOM   5435 N ND2 . ASN E 2 16  ? -12.469 10.846  -9.010  1.00 57.36  ? 72   ASN E ND2 1 
ATOM   5436 N N   . GLN E 2 17  ? -10.332 11.538  -13.344 1.00 51.70  ? 73   GLN E N   1 
ATOM   5437 C CA  . GLN E 2 17  ? -9.684  12.032  -14.554 1.00 51.81  ? 73   GLN E CA  1 
ATOM   5438 C C   . GLN E 2 17  ? -9.378  10.930  -15.561 1.00 51.91  ? 73   GLN E C   1 
ATOM   5439 O O   . GLN E 2 17  ? -9.770  11.005  -16.733 1.00 51.84  ? 73   GLN E O   1 
ATOM   5440 C CB  . GLN E 2 17  ? -8.395  12.780  -14.218 1.00 54.52  ? 73   GLN E CB  1 
ATOM   5441 C CG  . GLN E 2 17  ? -7.974  13.787  -15.294 1.00 55.68  ? 73   GLN E CG  1 
ATOM   5442 C CD  . GLN E 2 17  ? -9.182  14.534  -15.888 1.00 60.84  ? 73   GLN E CD  1 
ATOM   5443 O OE1 . GLN E 2 17  ? -9.337  14.652  -17.121 1.00 61.77  ? 73   GLN E OE1 1 
ATOM   5444 N NE2 . GLN E 2 17  ? -10.083 14.972  -15.011 1.00 59.94  ? 73   GLN E NE2 1 
ATOM   5445 N N   . GLU E 2 18  ? -8.705  9.892   -15.090 1.00 51.30  ? 74   GLU E N   1 
ATOM   5446 C CA  . GLU E 2 18  ? -8.385  8.775   -15.955 1.00 51.84  ? 74   GLU E CA  1 
ATOM   5447 C C   . GLU E 2 18  ? -9.627  8.236   -16.712 1.00 51.21  ? 74   GLU E C   1 
ATOM   5448 O O   . GLU E 2 18  ? -9.538  7.887   -17.903 1.00 51.23  ? 74   GLU E O   1 
ATOM   5449 C CB  . GLU E 2 18  ? -7.669  7.662   -15.174 1.00 55.02  ? 74   GLU E CB  1 
ATOM   5450 C CG  . GLU E 2 18  ? -6.578  8.139   -14.212 1.00 57.28  ? 74   GLU E CG  1 
ATOM   5451 C CD  . GLU E 2 18  ? -5.637  7.001   -13.748 1.00 62.09  ? 74   GLU E CD  1 
ATOM   5452 O OE1 . GLU E 2 18  ? -5.701  5.903   -14.347 1.00 64.52  ? 74   GLU E OE1 1 
ATOM   5453 O OE2 . GLU E 2 18  ? -4.806  7.216   -12.821 1.00 63.56  ? 74   GLU E OE2 1 
ATOM   5454 N N   . VAL E 2 19  ? -10.777 8.189   -16.039 1.00 44.32  ? 75   VAL E N   1 
ATOM   5455 C CA  . VAL E 2 19  ? -11.983 7.687   -16.697 1.00 44.31  ? 75   VAL E CA  1 
ATOM   5456 C C   . VAL E 2 19  ? -12.430 8.625   -17.797 1.00 44.49  ? 75   VAL E C   1 
ATOM   5457 O O   . VAL E 2 19  ? -12.790 8.194   -18.878 1.00 43.56  ? 75   VAL E O   1 
ATOM   5458 C CB  . VAL E 2 19  ? -13.152 7.380   -15.711 1.00 45.77  ? 75   VAL E CB  1 
ATOM   5459 C CG1 . VAL E 2 19  ? -14.309 6.769   -16.450 1.00 43.20  ? 75   VAL E CG1 1 
ATOM   5460 C CG2 . VAL E 2 19  ? -12.716 6.449   -14.629 1.00 44.32  ? 75   VAL E CG2 1 
ATOM   5461 N N   . HIS E 2 20  ? -12.421 9.915   -17.475 1.00 50.27  ? 76   HIS E N   1 
ATOM   5462 C CA  . HIS E 2 20  ? -12.792 10.996  -18.396 1.00 51.42  ? 76   HIS E CA  1 
ATOM   5463 C C   . HIS E 2 20  ? -11.818 11.051  -19.566 1.00 52.26  ? 76   HIS E C   1 
ATOM   5464 O O   . HIS E 2 20  ? -12.198 11.415  -20.671 1.00 52.03  ? 76   HIS E O   1 
ATOM   5465 C CB  . HIS E 2 20  ? -12.723 12.334  -17.654 1.00 53.94  ? 76   HIS E CB  1 
ATOM   5466 C CG  . HIS E 2 20  ? -13.620 12.420  -16.450 1.00 54.04  ? 76   HIS E CG  1 
ATOM   5467 N ND1 . HIS E 2 20  ? -14.273 13.581  -16.092 1.00 53.76  ? 76   HIS E ND1 1 
ATOM   5468 C CD2 . HIS E 2 20  ? -13.959 11.498  -15.517 1.00 53.05  ? 76   HIS E CD2 1 
ATOM   5469 C CE1 . HIS E 2 20  ? -14.990 13.366  -15.003 1.00 53.42  ? 76   HIS E CE1 1 
ATOM   5470 N NE2 . HIS E 2 20  ? -14.806 12.114  -14.624 1.00 53.94  ? 76   HIS E NE2 1 
ATOM   5471 N N   . ASP E 2 21  ? -10.553 10.725  -19.288 1.00 54.77  ? 77   ASP E N   1 
ATOM   5472 C CA  . ASP E 2 21  ? -9.509  10.698  -20.304 1.00 55.62  ? 77   ASP E CA  1 
ATOM   5473 C C   . ASP E 2 21  ? -9.744  9.495   -21.188 1.00 55.68  ? 77   ASP E C   1 
ATOM   5474 O O   . ASP E 2 21  ? -9.593  9.545   -22.419 1.00 56.15  ? 77   ASP E O   1 
ATOM   5475 C CB  . ASP E 2 21  ? -8.144  10.573  -19.648 1.00 58.46  ? 77   ASP E CB  1 
ATOM   5476 C CG  . ASP E 2 21  ? -7.655  11.895  -19.099 1.00 61.35  ? 77   ASP E CG  1 
ATOM   5477 O OD1 . ASP E 2 21  ? -8.125  12.947  -19.636 1.00 63.65  ? 77   ASP E OD1 1 
ATOM   5478 O OD2 . ASP E 2 21  ? -6.850  11.885  -18.112 1.00 64.23  ? 77   ASP E OD2 1 
ATOM   5479 N N   . LEU E 2 22  ? -10.065 8.390   -20.537 1.00 54.86  ? 78   LEU E N   1 
ATOM   5480 C CA  . LEU E 2 22  ? -10.354 7.172   -21.248 1.00 54.77  ? 78   LEU E CA  1 
ATOM   5481 C C   . LEU E 2 22  ? -11.393 7.462   -22.346 1.00 54.90  ? 78   LEU E C   1 
ATOM   5482 O O   . LEU E 2 22  ? -11.124 7.320   -23.543 1.00 54.95  ? 78   LEU E O   1 
ATOM   5483 C CB  . LEU E 2 22  ? -10.895 6.148   -20.261 1.00 53.99  ? 78   LEU E CB  1 
ATOM   5484 C CG  . LEU E 2 22  ? -11.222 4.799   -20.873 1.00 54.75  ? 78   LEU E CG  1 
ATOM   5485 C CD1 . LEU E 2 22  ? -9.949  4.121   -21.373 1.00 53.57  ? 78   LEU E CD1 1 
ATOM   5486 C CD2 . LEU E 2 22  ? -11.967 3.952   -19.866 1.00 53.75  ? 78   LEU E CD2 1 
ATOM   5487 N N   . LEU E 2 23  ? -12.556 7.926   -21.914 1.00 53.35  ? 79   LEU E N   1 
ATOM   5488 C CA  . LEU E 2 23  ? -13.663 8.247   -22.796 1.00 53.35  ? 79   LEU E CA  1 
ATOM   5489 C C   . LEU E 2 23  ? -13.658 9.717   -23.182 1.00 53.86  ? 79   LEU E C   1 
ATOM   5490 O O   . LEU E 2 23  ? -14.704 10.374  -23.197 1.00 53.50  ? 79   LEU E O   1 
ATOM   5491 C CB  . LEU E 2 23  ? -14.967 7.915   -22.090 1.00 53.52  ? 79   LEU E CB  1 
ATOM   5492 C CG  . LEU E 2 23  ? -14.797 6.808   -21.047 1.00 52.82  ? 79   LEU E CG  1 
ATOM   5493 C CD1 . LEU E 2 23  ? -15.740 6.931   -19.846 1.00 51.08  ? 79   LEU E CD1 1 
ATOM   5494 C CD2 . LEU E 2 23  ? -14.844 5.419   -21.649 1.00 52.83  ? 79   LEU E CD2 1 
ATOM   5495 N N   . SER E 2 24  ? -12.465 10.223  -23.480 1.00 56.85  ? 80   SER E N   1 
ATOM   5496 C CA  . SER E 2 24  ? -12.286 11.604  -23.916 1.00 57.87  ? 80   SER E CA  1 
ATOM   5497 C C   . SER E 2 24  ? -12.984 11.865  -25.254 1.00 58.90  ? 80   SER E C   1 
ATOM   5498 O O   . SER E 2 24  ? -13.262 13.013  -25.598 1.00 59.61  ? 80   SER E O   1 
ATOM   5499 C CB  . SER E 2 24  ? -10.793 11.981  -23.992 1.00 59.13  ? 80   SER E CB  1 
ATOM   5500 O OG  . SER E 2 24  ? -10.050 11.068  -24.768 1.00 57.87  ? 80   SER E OG  1 
ATOM   5501 N N   . ASP E 2 25  ? -13.311 10.799  -25.982 1.00 58.33  ? 81   ASP E N   1 
ATOM   5502 C CA  . ASP E 2 25  ? -13.979 10.924  -27.275 1.00 58.77  ? 81   ASP E CA  1 
ATOM   5503 C C   . ASP E 2 25  ? -15.497 10.982  -27.212 1.00 58.82  ? 81   ASP E C   1 
ATOM   5504 O O   . ASP E 2 25  ? -16.151 10.951  -28.252 1.00 58.65  ? 81   ASP E O   1 
ATOM   5505 C CB  . ASP E 2 25  ? -13.564 9.766   -28.178 1.00 63.21  ? 81   ASP E CB  1 
ATOM   5506 C CG  . ASP E 2 25  ? -12.580 10.188  -29.242 1.00 63.79  ? 81   ASP E CG  1 
ATOM   5507 O OD1 . ASP E 2 25  ? -11.646 9.401   -29.502 1.00 63.57  ? 81   ASP E OD1 1 
ATOM   5508 O OD2 . ASP E 2 25  ? -12.760 11.284  -29.829 1.00 62.85  ? 81   ASP E OD2 1 
ATOM   5509 N N   . TYR E 2 26  ? -16.053 11.031  -26.000 1.00 57.29  ? 82   TYR E N   1 
ATOM   5510 C CA  . TYR E 2 26  ? -17.523 11.046  -25.792 1.00 58.04  ? 82   TYR E CA  1 
ATOM   5511 C C   . TYR E 2 26  ? -18.026 12.151  -24.870 1.00 58.05  ? 82   TYR E C   1 
ATOM   5512 O O   . TYR E 2 26  ? -17.247 12.854  -24.226 1.00 58.20  ? 82   TYR E O   1 
ATOM   5513 C CB  . TYR E 2 26  ? -18.050 9.670   -25.315 1.00 58.43  ? 82   TYR E CB  1 
ATOM   5514 C CG  . TYR E 2 26  ? -17.549 8.519   -26.164 1.00 58.68  ? 82   TYR E CG  1 
ATOM   5515 C CD1 . TYR E 2 26  ? -18.186 8.193   -27.358 1.00 58.09  ? 82   TYR E CD1 1 
ATOM   5516 C CD2 . TYR E 2 26  ? -16.352 7.877   -25.861 1.00 58.73  ? 82   TYR E CD2 1 
ATOM   5517 C CE1 . TYR E 2 26  ? -17.683 7.226   -28.197 1.00 58.21  ? 82   TYR E CE1 1 
ATOM   5518 C CE2 . TYR E 2 26  ? -15.839 6.909   -26.694 1.00 59.90  ? 82   TYR E CE2 1 
ATOM   5519 C CZ  . TYR E 2 26  ? -16.507 6.591   -27.870 1.00 58.91  ? 82   TYR E CZ  1 
ATOM   5520 O OH  . TYR E 2 26  ? -15.981 5.634   -28.708 1.00 58.53  ? 82   TYR E OH  1 
ATOM   5521 N N   . GLU E 2 27  ? -19.336 12.305  -24.807 1.00 56.73  ? 83   GLU E N   1 
ATOM   5522 C CA  . GLU E 2 27  ? -19.914 13.325  -23.951 1.00 57.48  ? 83   GLU E CA  1 
ATOM   5523 C C   . GLU E 2 27  ? -20.439 12.720  -22.682 1.00 57.49  ? 83   GLU E C   1 
ATOM   5524 O O   . GLU E 2 27  ? -21.538 12.131  -22.654 1.00 57.38  ? 83   GLU E O   1 
ATOM   5525 C CB  . GLU E 2 27  ? -21.048 14.071  -24.648 1.00 59.76  ? 83   GLU E CB  1 
ATOM   5526 C CG  . GLU E 2 27  ? -21.226 15.508  -24.151 1.00 62.43  ? 83   GLU E CG  1 
ATOM   5527 C CD  . GLU E 2 27  ? -22.520 16.159  -24.629 1.00 65.93  ? 83   GLU E CD  1 
ATOM   5528 O OE1 . GLU E 2 27  ? -22.722 17.376  -24.358 1.00 66.67  ? 83   GLU E OE1 1 
ATOM   5529 O OE2 . GLU E 2 27  ? -23.326 15.451  -25.277 1.00 66.82  ? 83   GLU E OE2 1 
ATOM   5530 N N   . LEU E 2 28  ? -19.655 12.883  -21.622 1.00 56.62  ? 84   LEU E N   1 
ATOM   5531 C CA  . LEU E 2 28  ? -20.055 12.363  -20.332 1.00 56.26  ? 84   LEU E CA  1 
ATOM   5532 C C   . LEU E 2 28  ? -21.156 13.240  -19.792 1.00 55.79  ? 84   LEU E C   1 
ATOM   5533 O O   . LEU E 2 28  ? -21.030 14.452  -19.793 1.00 55.65  ? 84   LEU E O   1 
ATOM   5534 C CB  . LEU E 2 28  ? -18.871 12.364  -19.368 1.00 56.28  ? 84   LEU E CB  1 
ATOM   5535 C CG  . LEU E 2 28  ? -17.847 11.273  -19.686 1.00 57.87  ? 84   LEU E CG  1 
ATOM   5536 C CD1 . LEU E 2 28  ? -17.160 10.753  -18.398 1.00 56.52  ? 84   LEU E CD1 1 
ATOM   5537 C CD2 . LEU E 2 28  ? -18.491 10.128  -20.511 1.00 56.26  ? 84   LEU E CD2 1 
ATOM   5538 N N   . LYS E 2 29  ? -22.250 12.619  -19.374 1.00 55.64  ? 85   LYS E N   1 
ATOM   5539 C CA  . LYS E 2 29  ? -23.356 13.327  -18.732 1.00 55.50  ? 85   LYS E CA  1 
ATOM   5540 C C   . LYS E 2 29  ? -23.326 12.901  -17.268 1.00 54.81  ? 85   LYS E C   1 
ATOM   5541 O O   . LYS E 2 29  ? -23.657 13.677  -16.382 1.00 54.97  ? 85   LYS E O   1 
ATOM   5542 C CB  . LYS E 2 29  ? -24.695 12.967  -19.380 1.00 55.55  ? 85   LYS E CB  1 
ATOM   5543 C CG  . LYS E 2 29  ? -24.755 13.296  -20.870 1.00 57.31  ? 85   LYS E CG  1 
ATOM   5544 C CD  . LYS E 2 29  ? -25.396 14.666  -21.077 1.00 59.31  ? 85   LYS E CD  1 
ATOM   5545 C CE  . LYS E 2 29  ? -24.898 15.371  -22.353 1.00 60.62  ? 85   LYS E CE  1 
ATOM   5546 N NZ  . LYS E 2 29  ? -25.400 16.794  -22.443 1.00 62.49  ? 85   LYS E NZ  1 
ATOM   5547 N N   . TYR E 2 30  ? -22.872 11.676  -17.022 1.00 57.05  ? 86   TYR E N   1 
ATOM   5548 C CA  . TYR E 2 30  ? -22.735 11.175  -15.666 1.00 56.68  ? 86   TYR E CA  1 
ATOM   5549 C C   . TYR E 2 30  ? -21.472 10.320  -15.504 1.00 56.13  ? 86   TYR E C   1 
ATOM   5550 O O   . TYR E 2 30  ? -21.068 9.599   -16.437 1.00 57.09  ? 86   TYR E O   1 
ATOM   5551 C CB  . TYR E 2 30  ? -23.968 10.398  -15.232 1.00 59.83  ? 86   TYR E CB  1 
ATOM   5552 C CG  . TYR E 2 30  ? -23.924 9.995   -13.772 1.00 61.25  ? 86   TYR E CG  1 
ATOM   5553 C CD1 . TYR E 2 30  ? -24.017 10.958  -12.776 1.00 62.56  ? 86   TYR E CD1 1 
ATOM   5554 C CD2 . TYR E 2 30  ? -23.771 8.656   -13.382 1.00 62.34  ? 86   TYR E CD2 1 
ATOM   5555 C CE1 . TYR E 2 30  ? -23.981 10.626  -11.427 1.00 62.41  ? 86   TYR E CE1 1 
ATOM   5556 C CE2 . TYR E 2 30  ? -23.743 8.301   -12.028 1.00 63.03  ? 86   TYR E CE2 1 
ATOM   5557 C CZ  . TYR E 2 30  ? -23.840 9.304   -11.059 1.00 64.13  ? 86   TYR E CZ  1 
ATOM   5558 O OH  . TYR E 2 30  ? -23.813 9.000   -9.717  1.00 67.61  ? 86   TYR E OH  1 
ATOM   5559 N N   . CYS E 2 31  ? -20.847 10.403  -14.322 1.00 54.32  ? 87   CYS E N   1 
ATOM   5560 C CA  . CYS E 2 31  ? -19.614 9.671   -14.082 1.00 52.93  ? 87   CYS E CA  1 
ATOM   5561 C C   . CYS E 2 31  ? -19.298 9.413   -12.638 1.00 52.11  ? 87   CYS E C   1 
ATOM   5562 O O   . CYS E 2 31  ? -18.777 10.259  -11.936 1.00 51.81  ? 87   CYS E O   1 
ATOM   5563 C CB  . CYS E 2 31  ? -18.442 10.380  -14.745 1.00 53.83  ? 87   CYS E CB  1 
ATOM   5564 S SG  . CYS E 2 31  ? -17.027 9.335   -14.929 1.00 52.13  ? 87   CYS E SG  1 
ATOM   5565 N N   . PHE E 2 32  ? -19.582 8.208   -12.200 1.00 53.06  ? 88   PHE E N   1 
ATOM   5566 C CA  . PHE E 2 32  ? -19.287 7.841   -10.831 1.00 53.68  ? 88   PHE E CA  1 
ATOM   5567 C C   . PHE E 2 32  ? -18.331 6.657   -10.698 1.00 53.78  ? 88   PHE E C   1 
ATOM   5568 O O   . PHE E 2 32  ? -18.684 5.514   -10.972 1.00 53.30  ? 88   PHE E O   1 
ATOM   5569 C CB  . PHE E 2 32  ? -20.542 7.556   -10.041 1.00 56.88  ? 88   PHE E CB  1 
ATOM   5570 C CG  . PHE E 2 32  ? -20.258 7.072   -8.658  1.00 58.17  ? 88   PHE E CG  1 
ATOM   5571 C CD1 . PHE E 2 32  ? -20.359 5.717   -8.347  1.00 59.37  ? 88   PHE E CD1 1 
ATOM   5572 C CD2 . PHE E 2 32  ? -19.807 7.967   -7.678  1.00 58.49  ? 88   PHE E CD2 1 
ATOM   5573 C CE1 . PHE E 2 32  ? -20.069 5.254   -7.067  1.00 58.31  ? 88   PHE E CE1 1 
ATOM   5574 C CE2 . PHE E 2 32  ? -19.514 7.518   -6.391  1.00 58.12  ? 88   PHE E CE2 1 
ATOM   5575 C CZ  . PHE E 2 32  ? -19.654 6.149   -6.086  1.00 58.09  ? 88   PHE E CZ  1 
ATOM   5576 N N   . VAL E 2 33  ? -17.127 6.965   -10.228 1.00 54.06  ? 89   VAL E N   1 
ATOM   5577 C CA  . VAL E 2 33  ? -16.059 6.002   -10.051 1.00 54.32  ? 89   VAL E CA  1 
ATOM   5578 C C   . VAL E 2 33  ? -16.030 5.412   -8.625  1.00 54.56  ? 89   VAL E C   1 
ATOM   5579 O O   . VAL E 2 33  ? -15.963 6.155   -7.624  1.00 54.70  ? 89   VAL E O   1 
ATOM   5580 C CB  . VAL E 2 33  ? -14.728 6.668   -10.407 1.00 56.37  ? 89   VAL E CB  1 
ATOM   5581 C CG1 . VAL E 2 33  ? -13.583 5.956   -9.704  1.00 56.91  ? 89   VAL E CG1 1 
ATOM   5582 C CG2 . VAL E 2 33  ? -14.531 6.712   -11.925 1.00 54.97  ? 89   VAL E CG2 1 
ATOM   5583 N N   . ASP E 2 34  ? -16.058 4.082   -8.538  1.00 56.40  ? 90   ASP E N   1 
ATOM   5584 C CA  . ASP E 2 34  ? -16.038 3.401   -7.254  1.00 56.32  ? 90   ASP E CA  1 
ATOM   5585 C C   . ASP E 2 34  ? -14.653 2.856   -7.043  1.00 56.12  ? 90   ASP E C   1 
ATOM   5586 O O   . ASP E 2 34  ? -14.344 1.759   -7.500  1.00 56.34  ? 90   ASP E O   1 
ATOM   5587 C CB  . ASP E 2 34  ? -17.045 2.252   -7.247  1.00 59.63  ? 90   ASP E CB  1 
ATOM   5588 C CG  . ASP E 2 34  ? -17.259 1.678   -5.861  1.00 61.06  ? 90   ASP E CG  1 
ATOM   5589 O OD1 . ASP E 2 34  ? -18.158 0.824   -5.682  1.00 62.58  ? 90   ASP E OD1 1 
ATOM   5590 O OD2 . ASP E 2 34  ? -16.504 2.061   -4.953  1.00 63.66  ? 90   ASP E OD2 1 
ATOM   5591 N N   . LYS E 2 35  ? -13.810 3.619   -6.356  1.00 57.40  ? 91   LYS E N   1 
ATOM   5592 C CA  . LYS E 2 35  ? -12.428 3.215   -6.128  1.00 57.29  ? 91   LYS E CA  1 
ATOM   5593 C C   . LYS E 2 35  ? -12.224 1.923   -5.344  1.00 57.34  ? 91   LYS E C   1 
ATOM   5594 O O   . LYS E 2 35  ? -11.250 1.199   -5.572  1.00 57.44  ? 91   LYS E O   1 
ATOM   5595 C CB  . LYS E 2 35  ? -11.631 4.361   -5.548  1.00 62.20  ? 91   LYS E CB  1 
ATOM   5596 C CG  . LYS E 2 35  ? -12.015 5.702   -6.152  1.00 63.44  ? 91   LYS E CG  1 
ATOM   5597 C CD  . LYS E 2 35  ? -10.798 6.456   -6.657  1.00 64.50  ? 91   LYS E CD  1 
ATOM   5598 C CE  . LYS E 2 35  ? -11.144 7.906   -6.937  1.00 65.95  ? 91   LYS E CE  1 
ATOM   5599 N NZ  . LYS E 2 35  ? -10.240 8.817   -6.175  1.00 66.87  ? 91   LYS E NZ  1 
ATOM   5600 N N   . TYR E 2 36  ? -13.163 1.616   -4.453  1.00 57.16  ? 92   TYR E N   1 
ATOM   5601 C CA  . TYR E 2 36  ? -13.088 0.394   -3.693  1.00 56.64  ? 92   TYR E CA  1 
ATOM   5602 C C   . TYR E 2 36  ? -13.497 -0.791  -4.555  1.00 55.12  ? 92   TYR E C   1 
ATOM   5603 O O   . TYR E 2 36  ? -13.165 -1.919  -4.246  1.00 55.01  ? 92   TYR E O   1 
ATOM   5604 C CB  . TYR E 2 36  ? -13.929 0.461   -2.411  1.00 60.09  ? 92   TYR E CB  1 
ATOM   5605 C CG  . TYR E 2 36  ? -14.188 -0.922  -1.801  1.00 63.42  ? 92   TYR E CG  1 
ATOM   5606 C CD1 . TYR E 2 36  ? -13.240 -1.542  -0.969  1.00 66.37  ? 92   TYR E CD1 1 
ATOM   5607 C CD2 . TYR E 2 36  ? -15.340 -1.652  -2.135  1.00 67.09  ? 92   TYR E CD2 1 
ATOM   5608 C CE1 . TYR E 2 36  ? -13.445 -2.836  -0.470  1.00 66.69  ? 92   TYR E CE1 1 
ATOM   5609 C CE2 . TYR E 2 36  ? -15.555 -2.936  -1.635  1.00 66.93  ? 92   TYR E CE2 1 
ATOM   5610 C CZ  . TYR E 2 36  ? -14.604 -3.526  -0.812  1.00 67.60  ? 92   TYR E CZ  1 
ATOM   5611 O OH  . TYR E 2 36  ? -14.845 -4.795  -0.317  1.00 69.36  ? 92   TYR E OH  1 
ATOM   5612 N N   . LYS E 2 37  ? -14.203 -0.549  -5.648  1.00 52.35  ? 93   LYS E N   1 
ATOM   5613 C CA  . LYS E 2 37  ? -14.628 -1.650  -6.514  1.00 51.27  ? 93   LYS E CA  1 
ATOM   5614 C C   . LYS E 2 37  ? -14.016 -1.637  -7.912  1.00 50.28  ? 93   LYS E C   1 
ATOM   5615 O O   . LYS E 2 37  ? -14.154 -2.607  -8.662  1.00 49.52  ? 93   LYS E O   1 
ATOM   5616 C CB  . LYS E 2 37  ? -16.142 -1.703  -6.608  1.00 53.00  ? 93   LYS E CB  1 
ATOM   5617 C CG  . LYS E 2 37  ? -16.807 -1.748  -5.289  1.00 52.20  ? 93   LYS E CG  1 
ATOM   5618 C CD  . LYS E 2 37  ? -16.695 -3.131  -4.712  1.00 55.19  ? 93   LYS E CD  1 
ATOM   5619 C CE  . LYS E 2 37  ? -18.000 -3.560  -4.013  1.00 58.75  ? 93   LYS E CE  1 
ATOM   5620 N NZ  . LYS E 2 37  ? -18.268 -2.798  -2.730  1.00 59.99  ? 93   LYS E NZ  1 
ATOM   5621 N N   . GLY E 2 38  ? -13.336 -0.552  -8.262  1.00 47.32  ? 94   GLY E N   1 
ATOM   5622 C CA  . GLY E 2 38  ? -12.711 -0.457  -9.564  1.00 46.86  ? 94   GLY E CA  1 
ATOM   5623 C C   . GLY E 2 38  ? -13.739 -0.550  -10.667 1.00 46.62  ? 94   GLY E C   1 
ATOM   5624 O O   . GLY E 2 38  ? -13.514 -1.130  -11.717 1.00 46.58  ? 94   GLY E O   1 
ATOM   5625 N N   . THR E 2 39  ? -14.896 0.037   -10.405 1.00 47.20  ? 95   THR E N   1 
ATOM   5626 C CA  . THR E 2 39  ? -15.987 0.047   -11.365 1.00 47.36  ? 95   THR E CA  1 
ATOM   5627 C C   . THR E 2 39  ? -16.502 1.474   -11.511 1.00 47.76  ? 95   THR E C   1 
ATOM   5628 O O   . THR E 2 39  ? -16.661 2.187   -10.512 1.00 48.49  ? 95   THR E O   1 
ATOM   5629 C CB  . THR E 2 39  ? -17.128 -0.930  -10.956 1.00 48.82  ? 95   THR E CB  1 
ATOM   5630 O OG1 . THR E 2 39  ? -17.832 -0.385  -9.850  1.00 48.65  ? 95   THR E OG1 1 
ATOM   5631 C CG2 . THR E 2 39  ? -16.569 -2.261  -10.543 1.00 47.37  ? 95   THR E CG2 1 
ATOM   5632 N N   . ALA E 2 40  ? -16.795 1.865   -12.747 1.00 44.83  ? 96   ALA E N   1 
ATOM   5633 C CA  . ALA E 2 40  ? -17.302 3.192   -13.037 1.00 45.45  ? 96   ALA E CA  1 
ATOM   5634 C C   . ALA E 2 40  ? -18.712 3.122   -13.601 1.00 46.44  ? 96   ALA E C   1 
ATOM   5635 O O   . ALA E 2 40  ? -19.083 2.162   -14.276 1.00 46.68  ? 96   ALA E O   1 
ATOM   5636 C CB  . ALA E 2 40  ? -16.378 3.935   -14.007 1.00 45.62  ? 96   ALA E CB  1 
ATOM   5637 N N   . PHE E 2 41  ? -19.501 4.159   -13.328 1.00 49.78  ? 97   PHE E N   1 
ATOM   5638 C CA  . PHE E 2 41  ? -20.841 4.237   -13.855 1.00 50.79  ? 97   PHE E CA  1 
ATOM   5639 C C   . PHE E 2 41  ? -20.915 5.505   -14.646 1.00 51.60  ? 97   PHE E C   1 
ATOM   5640 O O   . PHE E 2 41  ? -21.053 6.596   -14.083 1.00 52.03  ? 97   PHE E O   1 
ATOM   5641 C CB  . PHE E 2 41  ? -21.845 4.286   -12.743 1.00 53.07  ? 97   PHE E CB  1 
ATOM   5642 C CG  . PHE E 2 41  ? -21.870 3.059   -11.938 1.00 54.80  ? 97   PHE E CG  1 
ATOM   5643 C CD1 . PHE E 2 41  ? -20.925 2.868   -10.940 1.00 56.88  ? 97   PHE E CD1 1 
ATOM   5644 C CD2 . PHE E 2 41  ? -22.790 2.064   -12.211 1.00 56.39  ? 97   PHE E CD2 1 
ATOM   5645 C CE1 . PHE E 2 41  ? -20.906 1.706   -10.199 1.00 59.15  ? 97   PHE E CE1 1 
ATOM   5646 C CE2 . PHE E 2 41  ? -22.808 0.890   -11.470 1.00 56.59  ? 97   PHE E CE2 1 
ATOM   5647 C CZ  . PHE E 2 41  ? -21.862 0.699   -10.465 1.00 56.74  ? 97   PHE E CZ  1 
ATOM   5648 N N   . VAL E 2 42  ? -20.768 5.360   -15.955 1.00 52.13  ? 98   VAL E N   1 
ATOM   5649 C CA  . VAL E 2 42  ? -20.813 6.497   -16.843 1.00 52.69  ? 98   VAL E CA  1 
ATOM   5650 C C   . VAL E 2 42  ? -22.154 6.470   -17.547 1.00 53.39  ? 98   VAL E C   1 
ATOM   5651 O O   . VAL E 2 42  ? -22.817 5.422   -17.626 1.00 53.32  ? 98   VAL E O   1 
ATOM   5652 C CB  . VAL E 2 42  ? -19.622 6.527   -17.823 1.00 54.53  ? 98   VAL E CB  1 
ATOM   5653 C CG1 . VAL E 2 42  ? -19.143 7.958   -18.043 1.00 54.59  ? 98   VAL E CG1 1 
ATOM   5654 C CG2 . VAL E 2 42  ? -18.502 5.734   -17.250 1.00 54.05  ? 98   VAL E CG2 1 
ATOM   5655 N N   . THR E 2 43  ? -22.550 7.654   -18.005 1.00 54.17  ? 99   THR E N   1 
ATOM   5656 C CA  . THR E 2 43  ? -23.804 7.872   -18.694 1.00 54.68  ? 99   THR E CA  1 
ATOM   5657 C C   . THR E 2 43  ? -23.356 8.723   -19.885 1.00 54.82  ? 99   THR E C   1 
ATOM   5658 O O   . THR E 2 43  ? -22.680 9.744   -19.701 1.00 54.58  ? 99   THR E O   1 
ATOM   5659 C CB  . THR E 2 43  ? -24.806 8.609   -17.744 1.00 61.92  ? 99   THR E CB  1 
ATOM   5660 O OG1 . THR E 2 43  ? -25.346 7.668   -16.800 1.00 63.11  ? 99   THR E OG1 1 
ATOM   5661 C CG2 . THR E 2 43  ? -25.934 9.314   -18.514 1.00 61.34  ? 99   THR E CG2 1 
ATOM   5662 N N   . LEU E 2 44  ? -23.661 8.260   -21.101 1.00 54.18  ? 100  LEU E N   1 
ATOM   5663 C CA  . LEU E 2 44  ? -23.258 8.981   -22.300 1.00 54.67  ? 100  LEU E CA  1 
ATOM   5664 C C   . LEU E 2 44  ? -24.378 9.791   -22.906 1.00 54.95  ? 100  LEU E C   1 
ATOM   5665 O O   . LEU E 2 44  ? -25.517 9.737   -22.432 1.00 54.70  ? 100  LEU E O   1 
ATOM   5666 C CB  . LEU E 2 44  ? -22.649 8.040   -23.319 1.00 53.69  ? 100  LEU E CB  1 
ATOM   5667 C CG  . LEU E 2 44  ? -21.346 7.446   -22.788 1.00 54.27  ? 100  LEU E CG  1 
ATOM   5668 C CD1 . LEU E 2 44  ? -20.590 6.741   -23.870 1.00 53.71  ? 100  LEU E CD1 1 
ATOM   5669 C CD2 . LEU E 2 44  ? -20.475 8.529   -22.170 1.00 55.78  ? 100  LEU E CD2 1 
ATOM   5670 N N   . LEU E 2 45  ? -24.038 10.551  -23.945 1.00 55.44  ? 101  LEU E N   1 
ATOM   5671 C CA  . LEU E 2 45  ? -25.004 11.392  -24.653 1.00 55.68  ? 101  LEU E CA  1 
ATOM   5672 C C   . LEU E 2 45  ? -26.208 10.626  -25.217 1.00 55.64  ? 101  LEU E C   1 
ATOM   5673 O O   . LEU E 2 45  ? -27.351 11.083  -25.078 1.00 55.82  ? 101  LEU E O   1 
ATOM   5674 C CB  . LEU E 2 45  ? -24.320 12.192  -25.767 1.00 55.24  ? 101  LEU E CB  1 
ATOM   5675 C CG  . LEU E 2 45  ? -25.267 13.100  -26.563 1.00 55.00  ? 101  LEU E CG  1 
ATOM   5676 C CD1 . LEU E 2 45  ? -26.232 13.770  -25.598 1.00 52.53  ? 101  LEU E CD1 1 
ATOM   5677 C CD2 . LEU E 2 45  ? -24.522 14.143  -27.412 1.00 52.58  ? 101  LEU E CD2 1 
ATOM   5678 N N   . ASN E 2 46  ? -25.961 9.473   -25.844 1.00 55.41  ? 102  ASN E N   1 
ATOM   5679 C CA  . ASN E 2 46  ? -27.049 8.672   -26.419 1.00 55.70  ? 102  ASN E CA  1 
ATOM   5680 C C   . ASN E 2 46  ? -26.769 7.174   -26.652 1.00 56.00  ? 102  ASN E C   1 
ATOM   5681 O O   . ASN E 2 46  ? -25.746 6.641   -26.238 1.00 56.13  ? 102  ASN E O   1 
ATOM   5682 C CB  . ASN E 2 46  ? -27.509 9.302   -27.719 1.00 56.39  ? 102  ASN E CB  1 
ATOM   5683 C CG  . ASN E 2 46  ? -26.365 9.497   -28.699 1.00 56.50  ? 102  ASN E CG  1 
ATOM   5684 O OD1 . ASN E 2 46  ? -25.719 8.527   -29.120 1.00 57.20  ? 102  ASN E OD1 1 
ATOM   5685 N ND2 . ASN E 2 46  ? -26.077 10.763  -29.036 1.00 56.29  ? 102  ASN E ND2 1 
ATOM   5686 N N   . GLY E 2 47  ? -27.706 6.487   -27.294 1.00 56.39  ? 103  GLY E N   1 
ATOM   5687 C CA  . GLY E 2 47  ? -27.565 5.072   -27.559 1.00 55.92  ? 103  GLY E CA  1 
ATOM   5688 C C   . GLY E 2 47  ? -26.299 4.768   -28.328 1.00 55.61  ? 103  GLY E C   1 
ATOM   5689 O O   . GLY E 2 47  ? -25.575 3.847   -27.967 1.00 55.59  ? 103  GLY E O   1 
ATOM   5690 N N   . GLU E 2 48  ? -26.044 5.514   -29.401 1.00 58.98  ? 104  GLU E N   1 
ATOM   5691 C CA  . GLU E 2 48  ? -24.871 5.275   -30.242 1.00 59.43  ? 104  GLU E CA  1 
ATOM   5692 C C   . GLU E 2 48  ? -23.541 5.450   -29.512 1.00 59.24  ? 104  GLU E C   1 
ATOM   5693 O O   . GLU E 2 48  ? -22.609 4.675   -29.726 1.00 59.10  ? 104  GLU E O   1 
ATOM   5694 C CB  . GLU E 2 48  ? -24.891 6.155   -31.485 1.00 62.18  ? 104  GLU E CB  1 
ATOM   5695 C CG  . GLU E 2 48  ? -24.616 5.398   -32.757 1.00 65.22  ? 104  GLU E CG  1 
ATOM   5696 C CD  . GLU E 2 48  ? -25.701 4.359   -33.056 1.00 69.66  ? 104  GLU E CD  1 
ATOM   5697 O OE1 . GLU E 2 48  ? -25.368 3.278   -33.623 1.00 69.62  ? 104  GLU E OE1 1 
ATOM   5698 O OE2 . GLU E 2 48  ? -26.884 4.630   -32.711 1.00 71.24  ? 104  GLU E OE2 1 
ATOM   5699 N N   . GLN E 2 49  ? -23.438 6.484   -28.679 1.00 58.14  ? 105  GLN E N   1 
ATOM   5700 C CA  . GLN E 2 49  ? -22.206 6.735   -27.929 1.00 57.52  ? 105  GLN E CA  1 
ATOM   5701 C C   . GLN E 2 49  ? -21.912 5.558   -27.002 1.00 57.84  ? 105  GLN E C   1 
ATOM   5702 O O   . GLN E 2 49  ? -20.792 5.065   -26.935 1.00 58.65  ? 105  GLN E O   1 
ATOM   5703 C CB  . GLN E 2 49  ? -22.294 8.033   -27.117 1.00 60.63  ? 105  GLN E CB  1 
ATOM   5704 C CG  . GLN E 2 49  ? -22.225 9.294   -27.945 1.00 59.29  ? 105  GLN E CG  1 
ATOM   5705 C CD  . GLN E 2 49  ? -21.505 10.434  -27.239 1.00 58.15  ? 105  GLN E CD  1 
ATOM   5706 O OE1 . GLN E 2 49  ? -21.894 10.858  -26.149 1.00 57.03  ? 105  GLN E OE1 1 
ATOM   5707 N NE2 . GLN E 2 49  ? -20.465 10.962  -27.881 1.00 57.65  ? 105  GLN E NE2 1 
ATOM   5708 N N   . ALA E 2 50  ? -22.930 5.084   -26.303 1.00 57.16  ? 106  ALA E N   1 
ATOM   5709 C CA  . ALA E 2 50  ? -22.764 3.942   -25.410 1.00 57.11  ? 106  ALA E CA  1 
ATOM   5710 C C   . ALA E 2 50  ? -22.286 2.698   -26.168 1.00 57.46  ? 106  ALA E C   1 
ATOM   5711 O O   . ALA E 2 50  ? -21.576 1.848   -25.622 1.00 57.93  ? 106  ALA E O   1 
ATOM   5712 C CB  . ALA E 2 50  ? -24.071 3.653   -24.678 1.00 57.57  ? 106  ALA E CB  1 
ATOM   5713 N N   . GLU E 2 51  ? -22.699 2.591   -27.429 1.00 60.29  ? 107  GLU E N   1 
ATOM   5714 C CA  . GLU E 2 51  ? -22.345 1.464   -28.286 1.00 59.82  ? 107  GLU E CA  1 
ATOM   5715 C C   . GLU E 2 51  ? -20.885 1.571   -28.700 1.00 59.03  ? 107  GLU E C   1 
ATOM   5716 O O   . GLU E 2 51  ? -20.111 0.622   -28.560 1.00 59.70  ? 107  GLU E O   1 
ATOM   5717 C CB  . GLU E 2 51  ? -23.206 1.499   -29.535 1.00 63.54  ? 107  GLU E CB  1 
ATOM   5718 C CG  . GLU E 2 51  ? -22.953 0.350   -30.440 1.00 65.89  ? 107  GLU E CG  1 
ATOM   5719 C CD  . GLU E 2 51  ? -24.032 -0.697  -30.327 1.00 69.46  ? 107  GLU E CD  1 
ATOM   5720 O OE1 . GLU E 2 51  ? -25.154 -0.405  -30.811 1.00 68.59  ? 107  GLU E OE1 1 
ATOM   5721 O OE2 . GLU E 2 51  ? -23.774 -1.777  -29.719 1.00 71.75  ? 107  GLU E OE2 1 
ATOM   5722 N N   . ALA E 2 52  ? -20.515 2.724   -29.234 1.00 53.38  ? 108  ALA E N   1 
ATOM   5723 C CA  . ALA E 2 52  ? -19.158 2.924   -29.679 1.00 52.70  ? 108  ALA E CA  1 
ATOM   5724 C C   . ALA E 2 52  ? -18.183 2.777   -28.513 1.00 52.69  ? 108  ALA E C   1 
ATOM   5725 O O   . ALA E 2 52  ? -17.073 2.248   -28.699 1.00 52.83  ? 108  ALA E O   1 
ATOM   5726 C CB  . ALA E 2 52  ? -19.013 4.278   -30.321 1.00 53.13  ? 108  ALA E CB  1 
ATOM   5727 N N   . ALA E 2 53  ? -18.573 3.285   -27.331 1.00 49.14  ? 109  ALA E N   1 
ATOM   5728 C CA  . ALA E 2 53  ? -17.752 3.194   -26.115 1.00 47.75  ? 109  ALA E CA  1 
ATOM   5729 C C   . ALA E 2 53  ? -17.535 1.716   -25.768 1.00 47.08  ? 109  ALA E C   1 
ATOM   5730 O O   . ALA E 2 53  ? -16.407 1.257   -25.625 1.00 47.38  ? 109  ALA E O   1 
ATOM   5731 C CB  . ALA E 2 53  ? -18.421 3.906   -24.982 1.00 47.35  ? 109  ALA E CB  1 
ATOM   5732 N N   . ILE E 2 54  ? -18.621 0.958   -25.676 1.00 46.09  ? 110  ILE E N   1 
ATOM   5733 C CA  . ILE E 2 54  ? -18.526 -0.474  -25.415 1.00 45.55  ? 110  ILE E CA  1 
ATOM   5734 C C   . ILE E 2 54  ? -17.560 -1.120  -26.419 1.00 46.00  ? 110  ILE E C   1 
ATOM   5735 O O   . ILE E 2 54  ? -16.623 -1.824  -26.042 1.00 45.38  ? 110  ILE E O   1 
ATOM   5736 C CB  . ILE E 2 54  ? -19.953 -1.180  -25.447 1.00 46.15  ? 110  ILE E CB  1 
ATOM   5737 C CG1 . ILE E 2 54  ? -20.816 -0.689  -24.281 1.00 46.44  ? 110  ILE E CG1 1 
ATOM   5738 C CG2 . ILE E 2 54  ? -19.822 -2.678  -25.362 1.00 43.61  ? 110  ILE E CG2 1 
ATOM   5739 C CD1 . ILE E 2 54  ? -22.210 -1.279  -24.207 1.00 46.28  ? 110  ILE E CD1 1 
ATOM   5740 N N   . ASN E 2 55  ? -17.787 -0.867  -27.705 1.00 50.34  ? 111  ASN E N   1 
ATOM   5741 C CA  . ASN E 2 55  ? -17.006 -1.508  -28.765 1.00 51.05  ? 111  ASN E CA  1 
ATOM   5742 C C   . ASN E 2 55  ? -15.512 -1.162  -28.764 1.00 50.93  ? 111  ASN E C   1 
ATOM   5743 O O   . ASN E 2 55  ? -14.666 -2.032  -28.971 1.00 51.19  ? 111  ASN E O   1 
ATOM   5744 C CB  . ASN E 2 55  ? -17.612 -1.195  -30.136 1.00 59.83  ? 111  ASN E CB  1 
ATOM   5745 C CG  . ASN E 2 55  ? -18.679 -2.192  -30.543 1.00 62.09  ? 111  ASN E CG  1 
ATOM   5746 O OD1 . ASN E 2 55  ? -18.461 -3.403  -30.503 1.00 60.80  ? 111  ASN E OD1 1 
ATOM   5747 N ND2 . ASN E 2 55  ? -19.841 -1.687  -30.939 1.00 64.49  ? 111  ASN E ND2 1 
ATOM   5748 N N   . ALA E 2 56  ? -15.198 0.109   -28.530 1.00 49.20  ? 112  ALA E N   1 
ATOM   5749 C CA  . ALA E 2 56  ? -13.814 0.577   -28.449 1.00 48.82  ? 112  ALA E CA  1 
ATOM   5750 C C   . ALA E 2 56  ? -13.116 0.084   -27.181 1.00 48.71  ? 112  ALA E C   1 
ATOM   5751 O O   . ALA E 2 56  ? -11.916 -0.226  -27.190 1.00 49.80  ? 112  ALA E O   1 
ATOM   5752 C CB  . ALA E 2 56  ? -13.771 2.090   -28.491 1.00 48.54  ? 112  ALA E CB  1 
ATOM   5753 N N   . PHE E 2 57  ? -13.888 -0.006  -26.095 1.00 46.91  ? 113  PHE E N   1 
ATOM   5754 C CA  . PHE E 2 57  ? -13.336 -0.156  -24.743 1.00 46.85  ? 113  PHE E CA  1 
ATOM   5755 C C   . PHE E 2 57  ? -13.638 -1.454  -23.957 1.00 46.96  ? 113  PHE E C   1 
ATOM   5756 O O   . PHE E 2 57  ? -13.127 -1.619  -22.850 1.00 47.10  ? 113  PHE E O   1 
ATOM   5757 C CB  . PHE E 2 57  ? -13.718 1.056   -23.887 1.00 48.12  ? 113  PHE E CB  1 
ATOM   5758 C CG  . PHE E 2 57  ? -13.086 2.341   -24.338 1.00 48.12  ? 113  PHE E CG  1 
ATOM   5759 C CD1 . PHE E 2 57  ? -11.717 2.426   -24.528 1.00 48.12  ? 113  PHE E CD1 1 
ATOM   5760 C CD2 . PHE E 2 57  ? -13.860 3.465   -24.573 1.00 48.12  ? 113  PHE E CD2 1 
ATOM   5761 C CE1 . PHE E 2 57  ? -11.132 3.607   -24.943 1.00 48.12  ? 113  PHE E CE1 1 
ATOM   5762 C CE2 . PHE E 2 57  ? -13.281 4.649   -24.989 1.00 48.12  ? 113  PHE E CE2 1 
ATOM   5763 C CZ  . PHE E 2 57  ? -11.915 4.720   -25.174 1.00 48.12  ? 113  PHE E CZ  1 
ATOM   5764 N N   . HIS E 2 58  ? -14.447 -2.367  -24.497 1.00 49.03  ? 114  HIS E N   1 
ATOM   5765 C CA  . HIS E 2 58  ? -14.637 -3.652  -23.849 1.00 48.53  ? 114  HIS E CA  1 
ATOM   5766 C C   . HIS E 2 58  ? -13.447 -4.535  -24.174 1.00 48.57  ? 114  HIS E C   1 
ATOM   5767 O O   . HIS E 2 58  ? -13.118 -4.723  -25.353 1.00 49.56  ? 114  HIS E O   1 
ATOM   5768 C CB  . HIS E 2 58  ? -15.918 -4.331  -24.309 1.00 49.32  ? 114  HIS E CB  1 
ATOM   5769 C CG  . HIS E 2 58  ? -16.102 -5.690  -23.711 1.00 48.60  ? 114  HIS E CG  1 
ATOM   5770 N ND1 . HIS E 2 58  ? -16.274 -5.890  -22.358 1.00 47.70  ? 114  HIS E ND1 1 
ATOM   5771 C CD2 . HIS E 2 58  ? -16.042 -6.921  -24.264 1.00 47.78  ? 114  HIS E CD2 1 
ATOM   5772 C CE1 . HIS E 2 58  ? -16.326 -7.182  -22.106 1.00 46.87  ? 114  HIS E CE1 1 
ATOM   5773 N NE2 . HIS E 2 58  ? -16.192 -7.830  -23.246 1.00 47.37  ? 114  HIS E NE2 1 
ATOM   5774 N N   . GLN E 2 59  ? -12.760 -5.018  -23.145 1.00 51.66  ? 115  GLN E N   1 
ATOM   5775 C CA  . GLN E 2 59  ? -11.599 -5.882  -23.334 1.00 50.99  ? 115  GLN E CA  1 
ATOM   5776 C C   . GLN E 2 59  ? -10.264 -5.206  -23.653 1.00 50.04  ? 115  GLN E C   1 
ATOM   5777 O O   . GLN E 2 59  ? -9.286  -5.886  -23.997 1.00 49.90  ? 115  GLN E O   1 
ATOM   5778 C CB  . GLN E 2 59  ? -11.887 -6.963  -24.349 1.00 53.54  ? 115  GLN E CB  1 
ATOM   5779 C CG  . GLN E 2 59  ? -12.783 -8.023  -23.830 1.00 55.84  ? 115  GLN E CG  1 
ATOM   5780 C CD  . GLN E 2 59  ? -12.725 -9.302  -24.670 1.00 60.27  ? 115  GLN E CD  1 
ATOM   5781 O OE1 . GLN E 2 59  ? -13.119 -9.337  -25.861 1.00 58.97  ? 115  GLN E OE1 1 
ATOM   5782 N NE2 . GLN E 2 59  ? -12.208 -10.360 -24.056 1.00 61.73  ? 115  GLN E NE2 1 
ATOM   5783 N N   . SER E 2 60  ? -10.224 -3.879  -23.563 1.00 47.71  ? 116  SER E N   1 
ATOM   5784 C CA  . SER E 2 60  ? -8.983  -3.145  -23.779 1.00 47.42  ? 116  SER E CA  1 
ATOM   5785 C C   . SER E 2 60  ? -8.209  -3.096  -22.456 1.00 47.52  ? 116  SER E C   1 
ATOM   5786 O O   . SER E 2 60  ? -8.687  -3.534  -21.401 1.00 47.40  ? 116  SER E O   1 
ATOM   5787 C CB  . SER E 2 60  ? -9.248  -1.739  -24.303 1.00 50.50  ? 116  SER E CB  1 
ATOM   5788 O OG  . SER E 2 60  ? -10.089 -1.012  -23.429 1.00 50.63  ? 116  SER E OG  1 
ATOM   5789 N N   . ARG E 2 61  ? -6.996  -2.602  -22.516 1.00 45.41  ? 117  ARG E N   1 
ATOM   5790 C CA  . ARG E 2 61  ? -6.188  -2.576  -21.329 1.00 45.39  ? 117  ARG E CA  1 
ATOM   5791 C C   . ARG E 2 61  ? -5.985  -1.161  -20.832 1.00 45.93  ? 117  ARG E C   1 
ATOM   5792 O O   . ARG E 2 61  ? -5.688  -0.244  -21.615 1.00 45.99  ? 117  ARG E O   1 
ATOM   5793 C CB  . ARG E 2 61  ? -4.839  -3.228  -21.617 1.00 43.37  ? 117  ARG E CB  1 
ATOM   5794 C CG  . ARG E 2 61  ? -4.906  -4.700  -22.031 1.00 43.09  ? 117  ARG E CG  1 
ATOM   5795 C CD  . ARG E 2 61  ? -4.382  -5.579  -20.912 1.00 44.36  ? 117  ARG E CD  1 
ATOM   5796 N NE  . ARG E 2 61  ? -4.713  -6.992  -21.089 1.00 46.40  ? 117  ARG E NE  1 
ATOM   5797 C CZ  . ARG E 2 61  ? -4.800  -7.871  -20.091 1.00 47.12  ? 117  ARG E CZ  1 
ATOM   5798 N NH1 . ARG E 2 61  ? -4.628  -7.496  -18.830 1.00 48.55  ? 117  ARG E NH1 1 
ATOM   5799 N NH2 . ARG E 2 61  ? -5.054  -9.137  -20.351 1.00 44.78  ? 117  ARG E NH2 1 
ATOM   5800 N N   . LEU E 2 62  ? -6.166  -0.980  -19.525 1.00 46.83  ? 118  LEU E N   1 
ATOM   5801 C CA  . LEU E 2 62  ? -5.944  0.322   -18.903 1.00 46.40  ? 118  LEU E CA  1 
ATOM   5802 C C   . LEU E 2 62  ? -4.833  0.107   -17.880 1.00 46.18  ? 118  LEU E C   1 
ATOM   5803 O O   . LEU E 2 62  ? -5.037  -0.579  -16.869 1.00 45.55  ? 118  LEU E O   1 
ATOM   5804 C CB  . LEU E 2 62  ? -7.229  0.886   -18.253 1.00 46.32  ? 118  LEU E CB  1 
ATOM   5805 C CG  . LEU E 2 62  ? -7.059  2.327   -17.718 1.00 45.31  ? 118  LEU E CG  1 
ATOM   5806 C CD1 . LEU E 2 62  ? -6.675  3.261   -18.839 1.00 41.81  ? 118  LEU E CD1 1 
ATOM   5807 C CD2 . LEU E 2 62  ? -8.225  2.914   -16.881 1.00 42.85  ? 118  LEU E CD2 1 
ATOM   5808 N N   . ARG E 2 63  ? -3.691  0.523   -18.203 1.00 47.17  ? 119  ARG E N   1 
ATOM   5809 C CA  . ARG E 2 63  ? -2.644  0.302   -17.352 1.00 47.50  ? 119  ARG E CA  1 
ATOM   5810 C C   . ARG E 2 63  ? -2.423  -1.028  -16.984 1.00 47.75  ? 119  ARG E C   1 
ATOM   5811 O O   . ARG E 2 63  ? -1.998  -1.274  -16.030 1.00 47.02  ? 119  ARG E O   1 
ATOM   5812 C CB  . ARG E 2 63  ? -2.615  1.206   -16.188 1.00 48.31  ? 119  ARG E CB  1 
ATOM   5813 C CG  . ARG E 2 63  ? -2.319  2.494   -16.556 1.00 48.76  ? 119  ARG E CG  1 
ATOM   5814 C CD  . ARG E 2 63  ? -2.591  3.460   -15.585 1.00 48.93  ? 119  ARG E CD  1 
ATOM   5815 N NE  . ARG E 2 63  ? -2.637  2.988   -14.275 1.00 46.35  ? 119  ARG E NE  1 
ATOM   5816 C CZ  . ARG E 2 63  ? -3.341  3.502   -13.331 1.00 45.54  ? 119  ARG E CZ  1 
ATOM   5817 N NH1 . ARG E 2 63  ? -4.046  4.492   -13.460 1.00 42.53  ? 119  ARG E NH1 1 
ATOM   5818 N NH2 . ARG E 2 63  ? -3.334  2.943   -12.231 1.00 47.45  ? 119  ARG E NH2 1 
ATOM   5819 N N   . GLU E 2 64  ? -2.459  -1.861  -17.897 1.00 49.69  ? 120  GLU E N   1 
ATOM   5820 C CA  . GLU E 2 64  ? -2.179  -3.286  -17.736 1.00 50.25  ? 120  GLU E CA  1 
ATOM   5821 C C   . GLU E 2 64  ? -3.360  -4.081  -17.177 1.00 50.27  ? 120  GLU E C   1 
ATOM   5822 O O   . GLU E 2 64  ? -3.216  -5.254  -16.833 1.00 50.10  ? 120  GLU E O   1 
ATOM   5823 C CB  . GLU E 2 64  ? -0.948  -3.490  -16.850 1.00 52.40  ? 120  GLU E CB  1 
ATOM   5824 C CG  . GLU E 2 64  ? 0.368   -3.508  -17.611 1.00 54.20  ? 120  GLU E CG  1 
ATOM   5825 C CD  . GLU E 2 64  ? 0.485   -4.695  -18.547 1.00 57.87  ? 120  GLU E CD  1 
ATOM   5826 O OE1 . GLU E 2 64  ? 0.753   -5.813  -18.060 1.00 59.55  ? 120  GLU E OE1 1 
ATOM   5827 O OE2 . GLU E 2 64  ? 0.308   -4.510  -19.769 1.00 58.59  ? 120  GLU E OE2 1 
ATOM   5828 N N   . ARG E 2 65  ? -4.524  -3.445  -17.087 1.00 49.26  ? 121  ARG E N   1 
ATOM   5829 C CA  . ARG E 2 65  ? -5.727  -4.123  -16.609 1.00 49.02  ? 121  ARG E CA  1 
ATOM   5830 C C   . ARG E 2 65  ? -6.790  -4.244  -17.700 1.00 49.50  ? 121  ARG E C   1 
ATOM   5831 O O   . ARG E 2 65  ? -7.126  -3.262  -18.363 1.00 49.11  ? 121  ARG E O   1 
ATOM   5832 C CB  . ARG E 2 65  ? -6.303  -3.396  -15.392 1.00 46.80  ? 121  ARG E CB  1 
ATOM   5833 C CG  . ARG E 2 65  ? -5.375  -2.350  -14.796 1.00 45.84  ? 121  ARG E CG  1 
ATOM   5834 C CD  . ARG E 2 65  ? -4.199  -2.997  -14.083 1.00 43.42  ? 121  ARG E CD  1 
ATOM   5835 N NE  . ARG E 2 65  ? -4.153  -2.639  -12.669 1.00 41.56  ? 121  ARG E NE  1 
ATOM   5836 C CZ  . ARG E 2 65  ? -3.300  -1.763  -12.147 1.00 40.85  ? 121  ARG E CZ  1 
ATOM   5837 N NH1 . ARG E 2 65  ? -2.417  -1.151  -12.924 1.00 40.03  ? 121  ARG E NH1 1 
ATOM   5838 N NH2 . ARG E 2 65  ? -3.330  -1.499  -10.848 1.00 39.37  ? 121  ARG E NH2 1 
ATOM   5839 N N   . GLU E 2 66  ? -7.316  -5.453  -17.880 1.00 53.64  ? 122  GLU E N   1 
ATOM   5840 C CA  . GLU E 2 66  ? -8.318  -5.713  -18.914 1.00 54.17  ? 122  GLU E CA  1 
ATOM   5841 C C   . GLU E 2 66  ? -9.661  -5.147  -18.449 1.00 53.76  ? 122  GLU E C   1 
ATOM   5842 O O   . GLU E 2 66  ? -10.139 -5.448  -17.354 1.00 53.94  ? 122  GLU E O   1 
ATOM   5843 C CB  . GLU E 2 66  ? -8.459  -7.210  -19.188 1.00 57.90  ? 122  GLU E CB  1 
ATOM   5844 C CG  . GLU E 2 66  ? -8.690  -7.531  -20.656 1.00 59.74  ? 122  GLU E CG  1 
ATOM   5845 C CD  . GLU E 2 66  ? -9.457  -8.848  -20.868 1.00 61.88  ? 122  GLU E CD  1 
ATOM   5846 O OE1 . GLU E 2 66  ? -10.720 -8.805  -20.970 1.00 63.78  ? 122  GLU E OE1 1 
ATOM   5847 O OE2 . GLU E 2 66  ? -8.802  -9.924  -20.960 1.00 61.59  ? 122  GLU E OE2 1 
ATOM   5848 N N   . LEU E 2 67  ? -10.249 -4.302  -19.287 1.00 49.10  ? 123  LEU E N   1 
ATOM   5849 C CA  . LEU E 2 67  ? -11.521 -3.673  -18.975 1.00 48.47  ? 123  LEU E CA  1 
ATOM   5850 C C   . LEU E 2 67  ? -12.715 -4.435  -19.565 1.00 48.00  ? 123  LEU E C   1 
ATOM   5851 O O   . LEU E 2 67  ? -12.646 -5.028  -20.636 1.00 47.58  ? 123  LEU E O   1 
ATOM   5852 C CB  . LEU E 2 67  ? -11.526 -2.224  -19.491 1.00 46.33  ? 123  LEU E CB  1 
ATOM   5853 C CG  . LEU E 2 67  ? -10.567 -1.204  -18.876 1.00 46.86  ? 123  LEU E CG  1 
ATOM   5854 C CD1 . LEU E 2 67  ? -10.814 0.160   -19.463 1.00 45.81  ? 123  LEU E CD1 1 
ATOM   5855 C CD2 . LEU E 2 67  ? -10.699 -1.131  -17.368 1.00 48.25  ? 123  LEU E CD2 1 
ATOM   5856 N N   . SER E 2 68  ? -13.826 -4.365  -18.853 1.00 48.40  ? 124  SER E N   1 
ATOM   5857 C CA  . SER E 2 68  ? -15.070 -4.952  -19.303 1.00 47.93  ? 124  SER E CA  1 
ATOM   5858 C C   . SER E 2 68  ? -16.111 -3.834  -19.273 1.00 48.39  ? 124  SER E C   1 
ATOM   5859 O O   . SER E 2 68  ? -16.619 -3.427  -18.209 1.00 48.86  ? 124  SER E O   1 
ATOM   5860 C CB  . SER E 2 68  ? -15.494 -6.115  -18.416 1.00 47.64  ? 124  SER E CB  1 
ATOM   5861 O OG  . SER E 2 68  ? -16.520 -5.727  -17.544 1.00 46.02  ? 124  SER E OG  1 
ATOM   5862 N N   . VAL E 2 69  ? -16.377 -3.310  -20.463 1.00 49.62  ? 125  VAL E N   1 
ATOM   5863 C CA  . VAL E 2 69  ? -17.338 -2.259  -20.681 1.00 49.17  ? 125  VAL E CA  1 
ATOM   5864 C C   . VAL E 2 69  ? -18.593 -2.919  -21.241 1.00 49.87  ? 125  VAL E C   1 
ATOM   5865 O O   . VAL E 2 69  ? -18.526 -3.705  -22.178 1.00 50.76  ? 125  VAL E O   1 
ATOM   5866 C CB  . VAL E 2 69  ? -16.775 -1.258  -21.660 1.00 52.15  ? 125  VAL E CB  1 
ATOM   5867 C CG1 . VAL E 2 69  ? -17.639 -0.030  -21.684 1.00 52.87  ? 125  VAL E CG1 1 
ATOM   5868 C CG2 . VAL E 2 69  ? -15.317 -0.947  -21.320 1.00 49.90  ? 125  VAL E CG2 1 
ATOM   5869 N N   . GLN E 2 70  ? -19.736 -2.609  -20.645 1.00 53.49  ? 126  GLN E N   1 
ATOM   5870 C CA  . GLN E 2 70  ? -21.003 -3.180  -21.063 1.00 53.59  ? 126  GLN E CA  1 
ATOM   5871 C C   . GLN E 2 70  ? -22.174 -2.315  -20.589 1.00 54.06  ? 126  GLN E C   1 
ATOM   5872 O O   . GLN E 2 70  ? -22.033 -1.548  -19.640 1.00 53.92  ? 126  GLN E O   1 
ATOM   5873 C CB  . GLN E 2 70  ? -21.118 -4.591  -20.502 1.00 58.07  ? 126  GLN E CB  1 
ATOM   5874 C CG  . GLN E 2 70  ? -21.816 -4.654  -19.135 1.00 57.57  ? 126  GLN E CG  1 
ATOM   5875 C CD  . GLN E 2 70  ? -21.315 -5.813  -18.256 1.00 57.18  ? 126  GLN E CD  1 
ATOM   5876 O OE1 . GLN E 2 70  ? -21.903 -6.906  -18.294 1.00 56.99  ? 126  GLN E OE1 1 
ATOM   5877 N NE2 . GLN E 2 70  ? -20.222 -5.581  -17.466 1.00 56.50  ? 126  GLN E NE2 1 
ATOM   5878 N N   . LEU E 2 71  ? -23.329 -2.449  -21.242 1.00 55.46  ? 127  LEU E N   1 
ATOM   5879 C CA  . LEU E 2 71  ? -24.514 -1.669  -20.855 1.00 56.74  ? 127  LEU E CA  1 
ATOM   5880 C C   . LEU E 2 71  ? -24.808 -1.861  -19.376 1.00 58.50  ? 127  LEU E C   1 
ATOM   5881 O O   . LEU E 2 71  ? -24.718 -2.986  -18.875 1.00 59.30  ? 127  LEU E O   1 
ATOM   5882 C CB  . LEU E 2 71  ? -25.736 -2.080  -21.674 1.00 55.74  ? 127  LEU E CB  1 
ATOM   5883 C CG  . LEU E 2 71  ? -25.802 -1.574  -23.122 1.00 53.98  ? 127  LEU E CG  1 
ATOM   5884 C CD1 . LEU E 2 71  ? -27.141 -1.891  -23.736 1.00 51.91  ? 127  LEU E CD1 1 
ATOM   5885 C CD2 . LEU E 2 71  ? -25.461 -0.086  -23.290 1.00 52.25  ? 127  LEU E CD2 1 
ATOM   5886 N N   . GLN E 2 72  ? -25.107 -0.775  -18.663 1.00 65.24  ? 128  GLN E N   1 
ATOM   5887 C CA  . GLN E 2 72  ? -25.390 -0.875  -17.230 1.00 67.09  ? 128  GLN E CA  1 
ATOM   5888 C C   . GLN E 2 72  ? -26.466 -1.917  -17.069 1.00 68.92  ? 128  GLN E C   1 
ATOM   5889 O O   . GLN E 2 72  ? -27.535 -1.805  -17.674 1.00 69.56  ? 128  GLN E O   1 
ATOM   5890 C CB  . GLN E 2 72  ? -25.864 0.460   -16.638 1.00 70.52  ? 128  GLN E CB  1 
ATOM   5891 C CG  . GLN E 2 72  ? -25.025 0.963   -15.436 1.00 71.31  ? 128  GLN E CG  1 
ATOM   5892 C CD  . GLN E 2 72  ? -24.919 2.505   -15.360 1.00 71.87  ? 128  GLN E CD  1 
ATOM   5893 O OE1 . GLN E 2 72  ? -23.950 3.118   -15.843 1.00 69.96  ? 128  GLN E OE1 1 
ATOM   5894 N NE2 . GLN E 2 72  ? -25.900 3.122   -14.713 1.00 71.73  ? 128  GLN E NE2 1 
ATOM   5895 N N   . PRO E 2 73  ? -26.155 -3.003  -16.335 1.00 73.93  ? 129  PRO E N   1 
ATOM   5896 C CA  . PRO E 2 73  ? -27.077 -4.123  -16.082 1.00 74.82  ? 129  PRO E CA  1 
ATOM   5897 C C   . PRO E 2 73  ? -28.448 -3.588  -15.704 1.00 75.97  ? 129  PRO E C   1 
ATOM   5898 O O   . PRO E 2 73  ? -28.611 -2.911  -14.677 1.00 76.68  ? 129  PRO E O   1 
ATOM   5899 C CB  . PRO E 2 73  ? -26.432 -4.871  -14.905 1.00 76.87  ? 129  PRO E CB  1 
ATOM   5900 C CG  . PRO E 2 73  ? -25.462 -3.922  -14.297 1.00 76.27  ? 129  PRO E CG  1 
ATOM   5901 C CD  . PRO E 2 73  ? -25.005 -3.006  -15.411 1.00 76.28  ? 129  PRO E CD  1 
ATOM   5902 N N   . THR E 2 74  ? -29.416 -3.829  -16.588 1.00 78.40  ? 130  THR E N   1 
ATOM   5903 C CA  . THR E 2 74  ? -30.780 -3.327  -16.399 1.00 78.46  ? 130  THR E CA  1 
ATOM   5904 C C   . THR E 2 74  ? -31.738 -4.427  -16.003 1.00 78.38  ? 130  THR E C   1 
ATOM   5905 O O   . THR E 2 74  ? -31.685 -4.787  -14.806 1.00 78.17  ? 130  THR E O   1 
ATOM   5906 C CB  . THR E 2 74  ? -31.295 -2.553  -17.649 1.00 94.37  ? 130  THR E CB  1 
ATOM   5907 O OG1 . THR E 2 74  ? -30.288 -1.625  -18.099 1.00 94.51  ? 130  THR E OG1 1 
ATOM   5908 C CG2 . THR E 2 74  ? -32.588 -1.788  -17.314 1.00 92.72  ? 130  THR E CG2 1 
ATOM   5909 O OXT . THR E 2 74  ? -32.513 -4.839  -16.897 1.00 94.51  ? 130  THR E OXT 1 
ATOM   5910 N N   . MET F 2 2   ? 28.271  26.166  -16.370 1.00 84.14  ? 58   MET F N   1 
ATOM   5911 C CA  . MET F 2 2   ? 28.044  25.342  -15.181 1.00 82.95  ? 58   MET F CA  1 
ATOM   5912 C C   . MET F 2 2   ? 26.678  24.655  -15.242 1.00 81.18  ? 58   MET F C   1 
ATOM   5913 O O   . MET F 2 2   ? 25.990  24.733  -16.265 1.00 81.35  ? 58   MET F O   1 
ATOM   5914 C CB  . MET F 2 2   ? 28.161  26.200  -13.908 1.00 86.85  ? 58   MET F CB  1 
ATOM   5915 C CG  . MET F 2 2   ? 28.162  25.411  -12.578 1.00 89.17  ? 58   MET F CG  1 
ATOM   5916 S SD  . MET F 2 2   ? 29.731  24.568  -12.198 1.00 94.90  ? 58   MET F SD  1 
ATOM   5917 C CE  . MET F 2 2   ? 30.892  25.461  -13.365 1.00 90.83  ? 58   MET F CE  1 
ATOM   5918 N N   . ARG F 2 3   ? 26.290  23.983  -14.154 1.00 72.84  ? 59   ARG F N   1 
ATOM   5919 C CA  . ARG F 2 3   ? 24.985  23.326  -14.086 1.00 70.65  ? 59   ARG F CA  1 
ATOM   5920 C C   . ARG F 2 3   ? 24.071  23.820  -12.969 1.00 69.04  ? 59   ARG F C   1 
ATOM   5921 O O   . ARG F 2 3   ? 23.026  23.227  -12.717 1.00 68.15  ? 59   ARG F O   1 
ATOM   5922 C CB  . ARG F 2 3   ? 25.111  21.812  -14.031 1.00 74.35  ? 59   ARG F CB  1 
ATOM   5923 C CG  . ARG F 2 3   ? 26.482  21.323  -13.711 1.00 75.18  ? 59   ARG F CG  1 
ATOM   5924 C CD  . ARG F 2 3   ? 26.394  20.020  -12.957 1.00 76.82  ? 59   ARG F CD  1 
ATOM   5925 N NE  . ARG F 2 3   ? 26.933  20.138  -11.609 1.00 77.26  ? 59   ARG F NE  1 
ATOM   5926 C CZ  . ARG F 2 3   ? 26.645  19.308  -10.614 1.00 77.68  ? 59   ARG F CZ  1 
ATOM   5927 N NH1 . ARG F 2 3   ? 25.803  18.304  -10.809 1.00 76.79  ? 59   ARG F NH1 1 
ATOM   5928 N NH2 . ARG F 2 3   ? 27.205  19.483  -9.420  1.00 77.38  ? 59   ARG F NH2 1 
ATOM   5929 N N   . LYS F 2 4   ? 24.461  24.915  -12.318 1.00 61.89  ? 60   LYS F N   1 
ATOM   5930 C CA  . LYS F 2 4   ? 23.650  25.508  -11.256 1.00 59.42  ? 60   LYS F CA  1 
ATOM   5931 C C   . LYS F 2 4   ? 22.922  26.704  -11.825 1.00 57.75  ? 60   LYS F C   1 
ATOM   5932 O O   . LYS F 2 4   ? 23.509  27.502  -12.557 1.00 57.47  ? 60   LYS F O   1 
ATOM   5933 C CB  . LYS F 2 4   ? 24.512  25.979  -10.091 1.00 63.50  ? 60   LYS F CB  1 
ATOM   5934 C CG  . LYS F 2 4   ? 25.556  25.003  -9.657  1.00 62.72  ? 60   LYS F CG  1 
ATOM   5935 C CD  . LYS F 2 4   ? 26.475  25.660  -8.648  1.00 59.95  ? 60   LYS F CD  1 
ATOM   5936 C CE  . LYS F 2 4   ? 26.812  24.685  -7.550  1.00 56.65  ? 60   LYS F CE  1 
ATOM   5937 N NZ  . LYS F 2 4   ? 26.398  23.306  -7.942  1.00 53.84  ? 60   LYS F NZ  1 
ATOM   5938 N N   . ILE F 2 5   ? 21.640  26.813  -11.503 1.00 51.86  ? 61   ILE F N   1 
ATOM   5939 C CA  . ILE F 2 5   ? 20.833  27.923  -11.972 1.00 49.85  ? 61   ILE F CA  1 
ATOM   5940 C C   . ILE F 2 5   ? 20.256  28.517  -10.715 1.00 48.55  ? 61   ILE F C   1 
ATOM   5941 O O   . ILE F 2 5   ? 20.161  27.821  -9.679  1.00 48.13  ? 61   ILE F O   1 
ATOM   5942 C CB  . ILE F 2 5   ? 19.656  27.457  -12.891 1.00 51.57  ? 61   ILE F CB  1 
ATOM   5943 C CG1 . ILE F 2 5   ? 18.882  26.308  -12.235 1.00 51.51  ? 61   ILE F CG1 1 
ATOM   5944 C CG2 . ILE F 2 5   ? 20.124  27.139  -14.313 1.00 50.72  ? 61   ILE F CG2 1 
ATOM   5945 C CD1 . ILE F 2 5   ? 17.418  26.403  -12.431 1.00 51.14  ? 61   ILE F CD1 1 
ATOM   5946 N N   . LEU F 2 6   ? 19.839  29.783  -10.816 1.00 47.27  ? 62   LEU F N   1 
ATOM   5947 C CA  . LEU F 2 6   ? 19.160  30.441  -9.710  1.00 45.63  ? 62   LEU F CA  1 
ATOM   5948 C C   . LEU F 2 6   ? 17.865  31.050  -10.236 1.00 44.62  ? 62   LEU F C   1 
ATOM   5949 O O   . LEU F 2 6   ? 17.886  31.731  -11.253 1.00 43.83  ? 62   LEU F O   1 
ATOM   5950 C CB  . LEU F 2 6   ? 20.055  31.468  -9.033  1.00 44.92  ? 62   LEU F CB  1 
ATOM   5951 C CG  . LEU F 2 6   ? 19.329  32.704  -8.518  1.00 45.02  ? 62   LEU F CG  1 
ATOM   5952 C CD1 . LEU F 2 6   ? 18.764  32.463  -7.099  1.00 46.14  ? 62   LEU F CD1 1 
ATOM   5953 C CD2 . LEU F 2 6   ? 20.284  33.917  -8.559  1.00 45.17  ? 62   LEU F CD2 1 
ATOM   5954 N N   . ILE F 2 7   ? 16.744  30.701  -9.589  1.00 45.86  ? 63   ILE F N   1 
ATOM   5955 C CA  . ILE F 2 7   ? 15.390  31.163  -9.958  1.00 44.73  ? 63   ILE F CA  1 
ATOM   5956 C C   . ILE F 2 7   ? 14.950  32.341  -9.085  1.00 44.47  ? 63   ILE F C   1 
ATOM   5957 O O   . ILE F 2 7   ? 15.140  32.315  -7.878  1.00 44.98  ? 63   ILE F O   1 
ATOM   5958 C CB  . ILE F 2 7   ? 14.354  30.023  -9.782  1.00 47.19  ? 63   ILE F CB  1 
ATOM   5959 C CG1 . ILE F 2 7   ? 14.529  28.959  -10.872 1.00 46.14  ? 63   ILE F CG1 1 
ATOM   5960 C CG2 . ILE F 2 7   ? 12.919  30.599  -9.739  1.00 46.37  ? 63   ILE F CG2 1 
ATOM   5961 C CD1 . ILE F 2 7   ? 13.902  27.606  -10.542 1.00 42.07  ? 63   ILE F CD1 1 
ATOM   5962 N N   . ARG F 2 8   ? 14.336  33.352  -9.688  1.00 44.41  ? 64   ARG F N   1 
ATOM   5963 C CA  . ARG F 2 8   ? 13.828  34.500  -8.937  1.00 43.70  ? 64   ARG F CA  1 
ATOM   5964 C C   . ARG F 2 8   ? 12.391  34.736  -9.350  1.00 42.71  ? 64   ARG F C   1 
ATOM   5965 O O   . ARG F 2 8   ? 11.999  34.401  -10.461 1.00 41.91  ? 64   ARG F O   1 
ATOM   5966 C CB  . ARG F 2 8   ? 14.632  35.767  -9.239  1.00 47.86  ? 64   ARG F CB  1 
ATOM   5967 C CG  . ARG F 2 8   ? 16.084  35.789  -8.744  1.00 52.24  ? 64   ARG F CG  1 
ATOM   5968 C CD  . ARG F 2 8   ? 16.484  37.197  -8.264  1.00 56.85  ? 64   ARG F CD  1 
ATOM   5969 N NE  . ARG F 2 8   ? 17.940  37.408  -8.212  1.00 62.08  ? 64   ARG F NE  1 
ATOM   5970 C CZ  . ARG F 2 8   ? 18.650  38.047  -9.149  1.00 64.82  ? 64   ARG F CZ  1 
ATOM   5971 N NH1 . ARG F 2 8   ? 18.050  38.525  -10.244 1.00 65.13  ? 64   ARG F NH1 1 
ATOM   5972 N NH2 . ARG F 2 8   ? 19.967  38.192  -9.010  1.00 65.64  ? 64   ARG F NH2 1 
ATOM   5973 N N   . GLY F 2 9   ? 11.610  35.309  -8.443  1.00 44.73  ? 65   GLY F N   1 
ATOM   5974 C CA  . GLY F 2 9   ? 10.206  35.655  -8.682  1.00 44.30  ? 65   GLY F CA  1 
ATOM   5975 C C   . GLY F 2 9   ? 9.133   34.668  -8.218  1.00 44.13  ? 65   GLY F C   1 
ATOM   5976 O O   . GLY F 2 9   ? 7.924   34.842  -8.496  1.00 43.94  ? 65   GLY F O   1 
ATOM   5977 N N   . LEU F 2 10  ? 9.590   33.627  -7.521  1.00 44.41  ? 66   LEU F N   1 
ATOM   5978 C CA  . LEU F 2 10  ? 8.716   32.573  -7.011  1.00 44.39  ? 66   LEU F CA  1 
ATOM   5979 C C   . LEU F 2 10  ? 7.661   33.126  -6.050  1.00 44.26  ? 66   LEU F C   1 
ATOM   5980 O O   . LEU F 2 10  ? 7.903   34.112  -5.339  1.00 43.77  ? 66   LEU F O   1 
ATOM   5981 C CB  . LEU F 2 10  ? 9.548   31.496  -6.295  1.00 42.59  ? 66   LEU F CB  1 
ATOM   5982 C CG  . LEU F 2 10  ? 10.518  30.676  -7.144  1.00 43.72  ? 66   LEU F CG  1 
ATOM   5983 C CD1 . LEU F 2 10  ? 11.568  30.075  -6.250  1.00 44.55  ? 66   LEU F CD1 1 
ATOM   5984 C CD2 . LEU F 2 10  ? 9.787   29.603  -7.954  1.00 43.78  ? 66   LEU F CD2 1 
ATOM   5985 N N   . PRO F 2 11  ? 6.499   32.464  -5.980  1.00 46.25  ? 67   PRO F N   1 
ATOM   5986 C CA  . PRO F 2 11  ? 5.431   32.885  -5.070  1.00 46.72  ? 67   PRO F CA  1 
ATOM   5987 C C   . PRO F 2 11  ? 5.873   32.958  -3.575  1.00 47.33  ? 67   PRO F C   1 
ATOM   5988 O O   . PRO F 2 11  ? 6.873   32.323  -3.171  1.00 47.78  ? 67   PRO F O   1 
ATOM   5989 C CB  . PRO F 2 11  ? 4.364   31.809  -5.293  1.00 47.98  ? 67   PRO F CB  1 
ATOM   5990 C CG  . PRO F 2 11  ? 4.502   31.456  -6.752  1.00 47.93  ? 67   PRO F CG  1 
ATOM   5991 C CD  . PRO F 2 11  ? 5.995   31.613  -7.073  1.00 47.95  ? 67   PRO F CD  1 
ATOM   5992 N N   . GLY F 2 12  ? 5.179   33.768  -2.764  1.00 47.64  ? 68   GLY F N   1 
ATOM   5993 C CA  . GLY F 2 12  ? 5.491   33.857  -1.346  1.00 47.59  ? 68   GLY F CA  1 
ATOM   5994 C C   . GLY F 2 12  ? 5.265   32.500  -0.672  1.00 47.61  ? 68   GLY F C   1 
ATOM   5995 O O   . GLY F 2 12  ? 6.059   32.051  0.167   1.00 47.14  ? 68   GLY F O   1 
ATOM   5996 N N   . ASP F 2 13  ? 4.188   31.829  -1.086  1.00 51.59  ? 69   ASP F N   1 
ATOM   5997 C CA  . ASP F 2 13  ? 3.791   30.522  -0.557  1.00 52.78  ? 69   ASP F CA  1 
ATOM   5998 C C   . ASP F 2 13  ? 4.251   29.336  -1.443  1.00 52.96  ? 69   ASP F C   1 
ATOM   5999 O O   . ASP F 2 13  ? 3.586   28.276  -1.481  1.00 52.84  ? 69   ASP F O   1 
ATOM   6000 C CB  . ASP F 2 13  ? 2.267   30.470  -0.356  1.00 55.19  ? 69   ASP F CB  1 
ATOM   6001 C CG  . ASP F 2 13  ? 1.500   30.631  -1.658  1.00 57.05  ? 69   ASP F CG  1 
ATOM   6002 O OD1 . ASP F 2 13  ? 2.083   31.175  -2.629  1.00 59.37  ? 69   ASP F OD1 1 
ATOM   6003 O OD2 . ASP F 2 13  ? 0.330   30.184  -1.727  1.00 58.71  ? 69   ASP F OD2 1 
ATOM   6004 N N   . VAL F 2 14  ? 5.385   29.506  -2.126  1.00 47.73  ? 70   VAL F N   1 
ATOM   6005 C CA  . VAL F 2 14  ? 5.952   28.438  -2.939  1.00 48.50  ? 70   VAL F CA  1 
ATOM   6006 C C   . VAL F 2 14  ? 6.486   27.311  -2.038  1.00 49.68  ? 70   VAL F C   1 
ATOM   6007 O O   . VAL F 2 14  ? 7.077   27.585  -0.986  1.00 49.51  ? 70   VAL F O   1 
ATOM   6008 C CB  . VAL F 2 14  ? 7.085   28.960  -3.886  1.00 49.93  ? 70   VAL F CB  1 
ATOM   6009 C CG1 . VAL F 2 14  ? 8.384   29.206  -3.101  1.00 48.76  ? 70   VAL F CG1 1 
ATOM   6010 C CG2 . VAL F 2 14  ? 7.345   27.972  -5.012  1.00 48.74  ? 70   VAL F CG2 1 
ATOM   6011 N N   . THR F 2 15  ? 6.303   26.055  -2.475  1.00 49.87  ? 71   THR F N   1 
ATOM   6012 C CA  . THR F 2 15  ? 6.817   24.883  -1.750  1.00 51.37  ? 71   THR F CA  1 
ATOM   6013 C C   . THR F 2 15  ? 7.942   24.229  -2.546  1.00 52.25  ? 71   THR F C   1 
ATOM   6014 O O   . THR F 2 15  ? 8.065   24.433  -3.730  1.00 52.61  ? 71   THR F O   1 
ATOM   6015 C CB  . THR F 2 15  ? 5.715   23.846  -1.389  1.00 53.48  ? 71   THR F CB  1 
ATOM   6016 O OG1 . THR F 2 15  ? 5.282   23.158  -2.570  1.00 54.80  ? 71   THR F OG1 1 
ATOM   6017 C CG2 . THR F 2 15  ? 4.527   24.517  -0.737  1.00 53.65  ? 71   THR F CG2 1 
ATOM   6018 N N   . ASN F 2 16  ? 8.777   23.441  -1.899  1.00 52.74  ? 72   ASN F N   1 
ATOM   6019 C CA  . ASN F 2 16  ? 9.846   22.796  -2.627  1.00 53.13  ? 72   ASN F CA  1 
ATOM   6020 C C   . ASN F 2 16  ? 9.259   21.928  -3.709  1.00 53.45  ? 72   ASN F C   1 
ATOM   6021 O O   . ASN F 2 16  ? 9.713   21.992  -4.852  1.00 53.46  ? 72   ASN F O   1 
ATOM   6022 C CB  . ASN F 2 16  ? 10.703  22.003  -1.668  1.00 56.54  ? 72   ASN F CB  1 
ATOM   6023 C CG  . ASN F 2 16  ? 11.155  22.851  -0.518  1.00 57.15  ? 72   ASN F CG  1 
ATOM   6024 O OD1 . ASN F 2 16  ? 12.140  23.600  -0.650  1.00 59.26  ? 72   ASN F OD1 1 
ATOM   6025 N ND2 . ASN F 2 16  ? 10.302  22.940  0.518   1.00 58.85  ? 72   ASN F ND2 1 
ATOM   6026 N N   . GLN F 2 17  ? 8.176   21.215  -3.361  1.00 53.99  ? 73   GLN F N   1 
ATOM   6027 C CA  . GLN F 2 17  ? 7.458   20.357  -4.301  1.00 54.15  ? 73   GLN F CA  1 
ATOM   6028 C C   . GLN F 2 17  ? 7.240   21.107  -5.590  1.00 53.97  ? 73   GLN F C   1 
ATOM   6029 O O   . GLN F 2 17  ? 7.711   20.684  -6.641  1.00 53.59  ? 73   GLN F O   1 
ATOM   6030 C CB  . GLN F 2 17  ? 6.107   19.892  -3.743  1.00 55.51  ? 73   GLN F CB  1 
ATOM   6031 C CG  . GLN F 2 17  ? 5.602   18.547  -4.354  1.00 58.45  ? 73   GLN F CG  1 
ATOM   6032 C CD  . GLN F 2 17  ? 6.738   17.541  -4.734  1.00 61.82  ? 73   GLN F CD  1 
ATOM   6033 O OE1 . GLN F 2 17  ? 6.767   17.009  -5.855  1.00 62.92  ? 73   GLN F OE1 1 
ATOM   6034 N NE2 . GLN F 2 17  ? 7.670   17.289  -3.796  1.00 61.65  ? 73   GLN F NE2 1 
ATOM   6035 N N   . GLU F 2 18  ? 6.609   22.273  -5.479  1.00 53.89  ? 74   GLU F N   1 
ATOM   6036 C CA  . GLU F 2 18  ? 6.360   23.129  -6.629  1.00 53.95  ? 74   GLU F CA  1 
ATOM   6037 C C   . GLU F 2 18  ? 7.600   23.388  -7.496  1.00 53.36  ? 74   GLU F C   1 
ATOM   6038 O O   . GLU F 2 18  ? 7.492   23.484  -8.717  1.00 53.99  ? 74   GLU F O   1 
ATOM   6039 C CB  . GLU F 2 18  ? 5.679   24.435  -6.209  1.00 57.23  ? 74   GLU F CB  1 
ATOM   6040 C CG  . GLU F 2 18  ? 4.507   24.294  -5.224  1.00 59.05  ? 74   GLU F CG  1 
ATOM   6041 C CD  . GLU F 2 18  ? 3.641   25.572  -5.133  1.00 63.21  ? 74   GLU F CD  1 
ATOM   6042 O OE1 . GLU F 2 18  ? 3.675   26.411  -6.078  1.00 63.37  ? 74   GLU F OE1 1 
ATOM   6043 O OE2 . GLU F 2 18  ? 2.898   25.728  -4.120  1.00 66.92  ? 74   GLU F OE2 1 
ATOM   6044 N N   . VAL F 2 19  ? 8.779   23.451  -6.899  1.00 47.13  ? 75   VAL F N   1 
ATOM   6045 C CA  . VAL F 2 19  ? 9.962   23.666  -7.716  1.00 46.21  ? 75   VAL F CA  1 
ATOM   6046 C C   . VAL F 2 19  ? 10.340  22.404  -8.449  1.00 46.47  ? 75   VAL F C   1 
ATOM   6047 O O   . VAL F 2 19  ? 10.698  22.444  -9.618  1.00 46.09  ? 75   VAL F O   1 
ATOM   6048 C CB  . VAL F 2 19  ? 11.143  24.197  -6.929  1.00 47.27  ? 75   VAL F CB  1 
ATOM   6049 C CG1 . VAL F 2 19  ? 12.381  24.252  -7.824  1.00 45.57  ? 75   VAL F CG1 1 
ATOM   6050 C CG2 . VAL F 2 19  ? 10.811  25.577  -6.351  1.00 46.36  ? 75   VAL F CG2 1 
ATOM   6051 N N   . HIS F 2 20  ? 10.279  21.284  -7.740  1.00 52.46  ? 76   HIS F N   1 
ATOM   6052 C CA  . HIS F 2 20  ? 10.575  19.982  -8.326  1.00 52.74  ? 76   HIS F CA  1 
ATOM   6053 C C   . HIS F 2 20  ? 9.570   19.653  -9.445  1.00 52.93  ? 76   HIS F C   1 
ATOM   6054 O O   . HIS F 2 20  ? 9.907   18.944  -10.391 1.00 52.83  ? 76   HIS F O   1 
ATOM   6055 C CB  . HIS F 2 20  ? 10.544  18.868  -7.265  1.00 54.02  ? 76   HIS F CB  1 
ATOM   6056 C CG  . HIS F 2 20  ? 11.468  19.096  -6.102  1.00 56.03  ? 76   HIS F CG  1 
ATOM   6057 N ND1 . HIS F 2 20  ? 12.371  18.149  -5.670  1.00 55.97  ? 76   HIS F ND1 1 
ATOM   6058 C CD2 . HIS F 2 20  ? 11.605  20.150  -5.256  1.00 57.00  ? 76   HIS F CD2 1 
ATOM   6059 C CE1 . HIS F 2 20  ? 13.031  18.612  -4.622  1.00 54.98  ? 76   HIS F CE1 1 
ATOM   6060 N NE2 . HIS F 2 20  ? 12.576  19.819  -4.341  1.00 55.09  ? 76   HIS F NE2 1 
ATOM   6061 N N   . ASP F 2 21  ? 8.336   20.145  -9.308  1.00 56.36  ? 77   ASP F N   1 
ATOM   6062 C CA  . ASP F 2 21  ? 7.257   19.920  -10.275 1.00 56.22  ? 77   ASP F CA  1 
ATOM   6063 C C   . ASP F 2 21  ? 7.482   20.788  -11.502 1.00 56.36  ? 77   ASP F C   1 
ATOM   6064 O O   . ASP F 2 21  ? 7.257   20.389  -12.632 1.00 56.74  ? 77   ASP F O   1 
ATOM   6065 C CB  . ASP F 2 21  ? 5.929   20.322  -9.651  1.00 61.10  ? 77   ASP F CB  1 
ATOM   6066 C CG  . ASP F 2 21  ? 5.373   19.267  -8.704  1.00 61.87  ? 77   ASP F CG  1 
ATOM   6067 O OD1 . ASP F 2 21  ? 5.734   18.063  -8.848  1.00 61.75  ? 77   ASP F OD1 1 
ATOM   6068 O OD2 . ASP F 2 21  ? 4.548   19.653  -7.833  1.00 61.70  ? 77   ASP F OD2 1 
ATOM   6069 N N   . LEU F 2 22  ? 7.887   22.016  -11.246 1.00 56.55  ? 78   LEU F N   1 
ATOM   6070 C CA  . LEU F 2 22  ? 8.234   22.954  -12.285 1.00 56.43  ? 78   LEU F CA  1 
ATOM   6071 C C   . LEU F 2 22  ? 9.272   22.299  -13.189 1.00 56.70  ? 78   LEU F C   1 
ATOM   6072 O O   . LEU F 2 22  ? 9.042   22.179  -14.389 1.00 57.71  ? 78   LEU F O   1 
ATOM   6073 C CB  . LEU F 2 22  ? 8.865   24.187  -11.639 1.00 56.26  ? 78   LEU F CB  1 
ATOM   6074 C CG  . LEU F 2 22  ? 9.408   25.245  -12.594 1.00 56.32  ? 78   LEU F CG  1 
ATOM   6075 C CD1 . LEU F 2 22  ? 8.249   25.924  -13.282 1.00 54.74  ? 78   LEU F CD1 1 
ATOM   6076 C CD2 . LEU F 2 22  ? 10.240  26.259  -11.837 1.00 57.80  ? 78   LEU F CD2 1 
ATOM   6077 N N   . LEU F 2 23  ? 10.409  21.886  -12.614 1.00 54.26  ? 79   LEU F N   1 
ATOM   6078 C CA  . LEU F 2 23  ? 11.500  21.266  -13.357 1.00 54.43  ? 79   LEU F CA  1 
ATOM   6079 C C   . LEU F 2 23  ? 11.435  19.751  -13.277 1.00 55.43  ? 79   LEU F C   1 
ATOM   6080 O O   . LEU F 2 23  ? 12.426  19.058  -13.010 1.00 55.16  ? 79   LEU F O   1 
ATOM   6081 C CB  . LEU F 2 23  ? 12.819  21.773  -12.814 1.00 54.51  ? 79   LEU F CB  1 
ATOM   6082 C CG  . LEU F 2 23  ? 12.665  23.090  -12.066 1.00 54.13  ? 79   LEU F CG  1 
ATOM   6083 C CD1 . LEU F 2 23  ? 13.681  23.201  -10.947 1.00 53.91  ? 79   LEU F CD1 1 
ATOM   6084 C CD2 . LEU F 2 23  ? 12.810  24.225  -13.036 1.00 52.33  ? 79   LEU F CD2 1 
ATOM   6085 N N   . SER F 2 24  ? 10.236  19.236  -13.516 1.00 58.82  ? 80   SER F N   1 
ATOM   6086 C CA  . SER F 2 24  ? 9.987   17.793  -13.490 1.00 59.84  ? 80   SER F CA  1 
ATOM   6087 C C   . SER F 2 24  ? 10.680  17.103  -14.643 1.00 60.27  ? 80   SER F C   1 
ATOM   6088 O O   . SER F 2 24  ? 10.907  15.900  -14.588 1.00 60.57  ? 80   SER F O   1 
ATOM   6089 C CB  . SER F 2 24  ? 8.489   17.469  -13.507 1.00 60.63  ? 80   SER F CB  1 
ATOM   6090 O OG  . SER F 2 24  ? 7.844   18.080  -14.605 1.00 61.54  ? 80   SER F OG  1 
ATOM   6091 N N   . ASP F 2 25  ? 11.044  17.865  -15.669 1.00 58.97  ? 81   ASP F N   1 
ATOM   6092 C CA  . ASP F 2 25  ? 11.752  17.296  -16.798 1.00 59.93  ? 81   ASP F CA  1 
ATOM   6093 C C   . ASP F 2 25  ? 13.257  17.204  -16.631 1.00 59.98  ? 81   ASP F C   1 
ATOM   6094 O O   . ASP F 2 25  ? 13.945  16.849  -17.577 1.00 60.38  ? 81   ASP F O   1 
ATOM   6095 C CB  . ASP F 2 25  ? 11.450  18.060  -18.067 1.00 62.51  ? 81   ASP F CB  1 
ATOM   6096 C CG  . ASP F 2 25  ? 10.550  17.280  -18.997 1.00 65.42  ? 81   ASP F CG  1 
ATOM   6097 O OD1 . ASP F 2 25  ? 9.551   17.861  -19.490 1.00 69.17  ? 81   ASP F OD1 1 
ATOM   6098 O OD2 . ASP F 2 25  ? 10.797  16.059  -19.164 1.00 65.10  ? 81   ASP F OD2 1 
ATOM   6099 N N   . TYR F 2 26  ? 13.770  17.521  -15.444 1.00 59.65  ? 82   TYR F N   1 
ATOM   6100 C CA  . TYR F 2 26  ? 15.210  17.507  -15.215 1.00 59.38  ? 82   TYR F CA  1 
ATOM   6101 C C   . TYR F 2 26  ? 15.603  16.738  -13.955 1.00 59.32  ? 82   TYR F C   1 
ATOM   6102 O O   . TYR F 2 26  ? 14.749  16.401  -13.149 1.00 59.08  ? 82   TYR F O   1 
ATOM   6103 C CB  . TYR F 2 26  ? 15.757  18.948  -15.160 1.00 61.70  ? 82   TYR F CB  1 
ATOM   6104 C CG  . TYR F 2 26  ? 15.378  19.764  -16.369 1.00 60.21  ? 82   TYR F CG  1 
ATOM   6105 C CD1 . TYR F 2 26  ? 16.115  19.690  -17.544 1.00 59.94  ? 82   TYR F CD1 1 
ATOM   6106 C CD2 . TYR F 2 26  ? 14.246  20.547  -16.359 1.00 59.57  ? 82   TYR F CD2 1 
ATOM   6107 C CE1 . TYR F 2 26  ? 15.725  20.363  -18.668 1.00 58.44  ? 82   TYR F CE1 1 
ATOM   6108 C CE2 . TYR F 2 26  ? 13.851  21.233  -17.470 1.00 58.68  ? 82   TYR F CE2 1 
ATOM   6109 C CZ  . TYR F 2 26  ? 14.585  21.129  -18.630 1.00 58.51  ? 82   TYR F CZ  1 
ATOM   6110 O OH  . TYR F 2 26  ? 14.183  21.810  -19.760 1.00 59.71  ? 82   TYR F OH  1 
ATOM   6111 N N   . GLU F 2 27  ? 16.904  16.490  -13.793 1.00 58.57  ? 83   GLU F N   1 
ATOM   6112 C CA  . GLU F 2 27  ? 17.436  15.774  -12.634 1.00 59.07  ? 83   GLU F CA  1 
ATOM   6113 C C   . GLU F 2 27  ? 18.028  16.771  -11.684 1.00 58.58  ? 83   GLU F C   1 
ATOM   6114 O O   . GLU F 2 27  ? 19.135  17.258  -11.892 1.00 58.73  ? 83   GLU F O   1 
ATOM   6115 C CB  . GLU F 2 27  ? 18.541  14.790  -13.047 1.00 60.50  ? 83   GLU F CB  1 
ATOM   6116 C CG  . GLU F 2 27  ? 18.822  13.669  -12.044 1.00 62.72  ? 83   GLU F CG  1 
ATOM   6117 C CD  . GLU F 2 27  ? 20.037  12.820  -12.452 1.00 67.71  ? 83   GLU F CD  1 
ATOM   6118 O OE1 . GLU F 2 27  ? 20.294  11.763  -11.829 1.00 68.54  ? 83   GLU F OE1 1 
ATOM   6119 O OE2 . GLU F 2 27  ? 20.724  13.195  -13.427 1.00 69.72  ? 83   GLU F OE2 1 
ATOM   6120 N N   . LEU F 2 28  ? 17.299  17.056  -10.621 1.00 57.44  ? 84   LEU F N   1 
ATOM   6121 C CA  . LEU F 2 28  ? 17.805  17.967  -9.613  1.00 57.16  ? 84   LEU F CA  1 
ATOM   6122 C C   . LEU F 2 28  ? 18.766  17.235  -8.713  1.00 56.82  ? 84   LEU F C   1 
ATOM   6123 O O   . LEU F 2 28  ? 18.407  16.267  -8.072  1.00 56.69  ? 84   LEU F O   1 
ATOM   6124 C CB  . LEU F 2 28  ? 16.680  18.511  -8.747  1.00 57.66  ? 84   LEU F CB  1 
ATOM   6125 C CG  . LEU F 2 28  ? 15.446  19.086  -9.450  1.00 58.39  ? 84   LEU F CG  1 
ATOM   6126 C CD1 . LEU F 2 28  ? 14.768  20.054  -8.471  1.00 59.22  ? 84   LEU F CD1 1 
ATOM   6127 C CD2 . LEU F 2 28  ? 15.837  19.786  -10.755 1.00 58.08  ? 84   LEU F CD2 1 
ATOM   6128 N N   . LYS F 2 29  ? 19.996  17.709  -8.681  1.00 57.00  ? 85   LYS F N   1 
ATOM   6129 C CA  . LYS F 2 29  ? 21.004  17.157  -7.817  1.00 56.87  ? 85   LYS F CA  1 
ATOM   6130 C C   . LYS F 2 29  ? 20.996  18.022  -6.547  1.00 57.21  ? 85   LYS F C   1 
ATOM   6131 O O   . LYS F 2 29  ? 21.386  17.587  -5.464  1.00 57.68  ? 85   LYS F O   1 
ATOM   6132 C CB  . LYS F 2 29  ? 22.349  17.209  -8.529  1.00 59.25  ? 85   LYS F CB  1 
ATOM   6133 C CG  . LYS F 2 29  ? 22.380  16.392  -9.787  1.00 58.48  ? 85   LYS F CG  1 
ATOM   6134 C CD  . LYS F 2 29  ? 22.971  15.007  -9.520  1.00 57.35  ? 85   LYS F CD  1 
ATOM   6135 C CE  . LYS F 2 29  ? 22.479  13.981  -10.554 1.00 58.88  ? 85   LYS F CE  1 
ATOM   6136 N NZ  . LYS F 2 29  ? 22.809  12.554  -10.265 1.00 59.47  ? 85   LYS F NZ  1 
ATOM   6137 N N   . TYR F 2 30  ? 20.518  19.251  -6.677  1.00 58.65  ? 86   TYR F N   1 
ATOM   6138 C CA  . TYR F 2 30  ? 20.415  20.134  -5.529  1.00 58.56  ? 86   TYR F CA  1 
ATOM   6139 C C   . TYR F 2 30  ? 19.241  21.072  -5.678  1.00 58.13  ? 86   TYR F C   1 
ATOM   6140 O O   . TYR F 2 30  ? 18.977  21.600  -6.755  1.00 57.87  ? 86   TYR F O   1 
ATOM   6141 C CB  . TYR F 2 30  ? 21.671  20.962  -5.340  1.00 61.93  ? 86   TYR F CB  1 
ATOM   6142 C CG  . TYR F 2 30  ? 21.631  21.750  -4.057  1.00 62.87  ? 86   TYR F CG  1 
ATOM   6143 C CD1 . TYR F 2 30  ? 21.507  21.099  -2.840  1.00 63.68  ? 86   TYR F CD1 1 
ATOM   6144 C CD2 . TYR F 2 30  ? 21.674  23.145  -4.058  1.00 64.12  ? 86   TYR F CD2 1 
ATOM   6145 C CE1 . TYR F 2 30  ? 21.467  21.793  -1.655  1.00 63.74  ? 86   TYR F CE1 1 
ATOM   6146 C CE2 . TYR F 2 30  ? 21.651  23.855  -2.855  1.00 64.02  ? 86   TYR F CE2 1 
ATOM   6147 C CZ  . TYR F 2 30  ? 21.549  23.156  -1.657  1.00 64.65  ? 86   TYR F CZ  1 
ATOM   6148 O OH  . TYR F 2 30  ? 21.500  23.800  -0.443  1.00 67.33  ? 86   TYR F OH  1 
ATOM   6149 N N   . CYS F 2 31  ? 18.538  21.295  -4.580  1.00 55.81  ? 87   CYS F N   1 
ATOM   6150 C CA  . CYS F 2 31  ? 17.424  22.218  -4.599  1.00 55.09  ? 87   CYS F CA  1 
ATOM   6151 C C   . CYS F 2 31  ? 17.218  22.874  -3.262  1.00 54.68  ? 87   CYS F C   1 
ATOM   6152 O O   . CYS F 2 31  ? 16.929  22.207  -2.277  1.00 54.09  ? 87   CYS F O   1 
ATOM   6153 C CB  . CYS F 2 31  ? 16.140  21.551  -5.063  1.00 55.85  ? 87   CYS F CB  1 
ATOM   6154 S SG  . CYS F 2 31  ? 14.929  22.806  -5.580  1.00 56.21  ? 87   CYS F SG  1 
ATOM   6155 N N   . PHE F 2 32  ? 17.386  24.189  -3.241  1.00 54.87  ? 88   PHE F N   1 
ATOM   6156 C CA  . PHE F 2 32  ? 17.203  24.955  -2.020  1.00 55.48  ? 88   PHE F CA  1 
ATOM   6157 C C   . PHE F 2 32  ? 16.322  26.158  -2.283  1.00 55.60  ? 88   PHE F C   1 
ATOM   6158 O O   . PHE F 2 32  ? 16.687  27.065  -3.032  1.00 55.75  ? 88   PHE F O   1 
ATOM   6159 C CB  . PHE F 2 32  ? 18.530  25.398  -1.394  1.00 59.07  ? 88   PHE F CB  1 
ATOM   6160 C CG  . PHE F 2 32  ? 18.337  26.264  -0.200  1.00 58.79  ? 88   PHE F CG  1 
ATOM   6161 C CD1 . PHE F 2 32  ? 18.464  27.648  -0.310  1.00 60.42  ? 88   PHE F CD1 1 
ATOM   6162 C CD2 . PHE F 2 32  ? 17.830  25.720  0.979   1.00 57.70  ? 88   PHE F CD2 1 
ATOM   6163 C CE1 . PHE F 2 32  ? 18.192  28.476  0.771   1.00 61.11  ? 88   PHE F CE1 1 
ATOM   6164 C CE2 . PHE F 2 32  ? 17.560  26.535  2.081   1.00 60.32  ? 88   PHE F CE2 1 
ATOM   6165 C CZ  . PHE F 2 32  ? 17.752  27.916  1.975   1.00 60.68  ? 88   PHE F CZ  1 
ATOM   6166 N N   . VAL F 2 33  ? 15.154  26.159  -1.656  1.00 54.30  ? 89   VAL F N   1 
ATOM   6167 C CA  . VAL F 2 33  ? 14.184  27.226  -1.850  1.00 54.56  ? 89   VAL F CA  1 
ATOM   6168 C C   . VAL F 2 33  ? 14.238  28.209  -0.693  1.00 55.27  ? 89   VAL F C   1 
ATOM   6169 O O   . VAL F 2 33  ? 14.191  27.812  0.472   1.00 55.39  ? 89   VAL F O   1 
ATOM   6170 C CB  . VAL F 2 33  ? 12.767  26.626  -2.030  1.00 56.81  ? 89   VAL F CB  1 
ATOM   6171 C CG1 . VAL F 2 33  ? 11.722  27.636  -1.679  1.00 56.64  ? 89   VAL F CG1 1 
ATOM   6172 C CG2 . VAL F 2 33  ? 12.565  26.066  -3.430  1.00 54.62  ? 89   VAL F CG2 1 
ATOM   6173 N N   . ASP F 2 34  ? 14.356  29.495  -1.000  1.00 56.99  ? 90   ASP F N   1 
ATOM   6174 C CA  . ASP F 2 34  ? 14.362  30.520  0.056   1.00 58.53  ? 90   ASP F CA  1 
ATOM   6175 C C   . ASP F 2 34  ? 12.963  31.151  0.103   1.00 58.93  ? 90   ASP F C   1 
ATOM   6176 O O   . ASP F 2 34  ? 12.633  32.001  -0.727  1.00 59.25  ? 90   ASP F O   1 
ATOM   6177 C CB  . ASP F 2 34  ? 15.423  31.595  -0.216  1.00 62.03  ? 90   ASP F CB  1 
ATOM   6178 C CG  . ASP F 2 34  ? 15.612  32.547  0.975   1.00 63.84  ? 90   ASP F CG  1 
ATOM   6179 O OD1 . ASP F 2 34  ? 16.575  33.364  0.992   1.00 64.51  ? 90   ASP F OD1 1 
ATOM   6180 O OD2 . ASP F 2 34  ? 14.787  32.474  1.912   1.00 65.67  ? 90   ASP F OD2 1 
ATOM   6181 N N   . LYS F 2 35  ? 12.111  30.686  1.015   1.00 58.86  ? 91   LYS F N   1 
ATOM   6182 C CA  . LYS F 2 35  ? 10.749  31.191  1.046   1.00 59.11  ? 91   LYS F CA  1 
ATOM   6183 C C   . LYS F 2 35  ? 10.647  32.685  1.358   1.00 59.19  ? 91   LYS F C   1 
ATOM   6184 O O   . LYS F 2 35  ? 9.782   33.397  0.820   1.00 59.65  ? 91   LYS F O   1 
ATOM   6185 C CB  . LYS F 2 35  ? 9.848   30.324  1.921   1.00 61.48  ? 91   LYS F CB  1 
ATOM   6186 C CG  . LYS F 2 35  ? 10.143  28.844  1.771   1.00 62.67  ? 91   LYS F CG  1 
ATOM   6187 C CD  . LYS F 2 35  ? 8.887   28.020  1.484   1.00 66.40  ? 91   LYS F CD  1 
ATOM   6188 C CE  . LYS F 2 35  ? 9.178   26.485  1.505   1.00 70.00  ? 91   LYS F CE  1 
ATOM   6189 N NZ  . LYS F 2 35  ? 8.245   25.709  2.435   1.00 73.73  ? 91   LYS F NZ  1 
ATOM   6190 N N   . TYR F 2 36  ? 11.572  33.182  2.173   1.00 59.26  ? 92   TYR F N   1 
ATOM   6191 C CA  . TYR F 2 36  ? 11.574  34.603  2.482   1.00 58.38  ? 92   TYR F CA  1 
ATOM   6192 C C   . TYR F 2 36  ? 11.975  35.498  1.291   1.00 57.00  ? 92   TYR F C   1 
ATOM   6193 O O   . TYR F 2 36  ? 11.619  36.667  1.248   1.00 56.66  ? 92   TYR F O   1 
ATOM   6194 C CB  . TYR F 2 36  ? 12.398  34.906  3.726   1.00 62.63  ? 92   TYR F CB  1 
ATOM   6195 C CG  . TYR F 2 36  ? 12.685  36.385  3.841   1.00 65.19  ? 92   TYR F CG  1 
ATOM   6196 C CD1 . TYR F 2 36  ? 11.719  37.266  4.311   1.00 67.82  ? 92   TYR F CD1 1 
ATOM   6197 C CD2 . TYR F 2 36  ? 13.879  36.928  3.356   1.00 67.41  ? 92   TYR F CD2 1 
ATOM   6198 C CE1 . TYR F 2 36  ? 11.963  38.644  4.367   1.00 69.33  ? 92   TYR F CE1 1 
ATOM   6199 C CE2 . TYR F 2 36  ? 14.126  38.298  3.397   1.00 68.78  ? 92   TYR F CE2 1 
ATOM   6200 C CZ  . TYR F 2 36  ? 13.174  39.147  3.925   1.00 69.55  ? 92   TYR F CZ  1 
ATOM   6201 O OH  . TYR F 2 36  ? 13.419  40.509  4.001   1.00 70.22  ? 92   TYR F OH  1 
ATOM   6202 N N   . LYS F 2 37  ? 12.693  34.951  0.317   1.00 53.36  ? 93   LYS F N   1 
ATOM   6203 C CA  . LYS F 2 37  ? 13.065  35.728  -0.884  1.00 52.98  ? 93   LYS F CA  1 
ATOM   6204 C C   . LYS F 2 37  ? 12.412  35.267  -2.226  1.00 52.28  ? 93   LYS F C   1 
ATOM   6205 O O   . LYS F 2 37  ? 12.580  35.922  -3.253  1.00 52.09  ? 93   LYS F O   1 
ATOM   6206 C CB  . LYS F 2 37  ? 14.586  35.841  -1.064  1.00 56.34  ? 93   LYS F CB  1 
ATOM   6207 C CG  . LYS F 2 37  ? 15.373  36.123  0.201   1.00 57.09  ? 93   LYS F CG  1 
ATOM   6208 C CD  . LYS F 2 37  ? 15.206  37.574  0.642   1.00 58.61  ? 93   LYS F CD  1 
ATOM   6209 C CE  . LYS F 2 37  ? 16.524  38.214  1.096   1.00 59.12  ? 93   LYS F CE  1 
ATOM   6210 N NZ  . LYS F 2 37  ? 16.810  38.193  2.585   1.00 56.97  ? 93   LYS F NZ  1 
ATOM   6211 N N   . GLY F 2 38  ? 11.668  34.158  -2.221  1.00 50.48  ? 94   GLY F N   1 
ATOM   6212 C CA  . GLY F 2 38  ? 11.066  33.661  -3.436  1.00 49.76  ? 94   GLY F CA  1 
ATOM   6213 C C   . GLY F 2 38  ? 12.141  33.369  -4.477  1.00 49.59  ? 94   GLY F C   1 
ATOM   6214 O O   . GLY F 2 38  ? 11.981  33.641  -5.679  1.00 49.66  ? 94   GLY F O   1 
ATOM   6215 N N   . THR F 2 39  ? 13.239  32.782  -4.019  1.00 49.60  ? 95   THR F N   1 
ATOM   6216 C CA  . THR F 2 39  ? 14.330  32.412  -4.899  1.00 48.93  ? 95   THR F CA  1 
ATOM   6217 C C   . THR F 2 39  ? 14.750  30.981  -4.576  1.00 48.69  ? 95   THR F C   1 
ATOM   6218 O O   . THR F 2 39  ? 14.917  30.612  -3.406  1.00 49.34  ? 95   THR F O   1 
ATOM   6219 C CB  . THR F 2 39  ? 15.551  33.353  -4.709  1.00 51.26  ? 95   THR F CB  1 
ATOM   6220 O OG1 . THR F 2 39  ? 16.147  33.103  -3.423  1.00 51.10  ? 95   THR F OG1 1 
ATOM   6221 C CG2 . THR F 2 39  ? 15.161  34.806  -4.827  1.00 50.55  ? 95   THR F CG2 1 
ATOM   6222 N N   . ALA F 2 40  ? 15.015  30.201  -5.613  1.00 48.76  ? 96   ALA F N   1 
ATOM   6223 C CA  . ALA F 2 40  ? 15.499  28.838  -5.428  1.00 48.06  ? 96   ALA F CA  1 
ATOM   6224 C C   . ALA F 2 40  ? 16.912  28.700  -6.009  1.00 47.67  ? 96   ALA F C   1 
ATOM   6225 O O   . ALA F 2 40  ? 17.304  29.424  -6.929  1.00 48.00  ? 96   ALA F O   1 
ATOM   6226 C CB  . ALA F 2 40  ? 14.561  27.859  -6.088  1.00 47.84  ? 96   ALA F CB  1 
ATOM   6227 N N   . PHE F 2 41  ? 17.664  27.759  -5.459  1.00 52.53  ? 97   PHE F N   1 
ATOM   6228 C CA  . PHE F 2 41  ? 18.997  27.451  -5.926  1.00 52.25  ? 97   PHE F CA  1 
ATOM   6229 C C   . PHE F 2 41  ? 19.015  25.988  -6.300  1.00 51.85  ? 97   PHE F C   1 
ATOM   6230 O O   . PHE F 2 41  ? 19.148  25.113  -5.434  1.00 52.00  ? 97   PHE F O   1 
ATOM   6231 C CB  . PHE F 2 41  ? 20.009  27.681  -4.823  1.00 54.87  ? 97   PHE F CB  1 
ATOM   6232 C CG  . PHE F 2 41  ? 20.110  29.097  -4.412  1.00 55.52  ? 97   PHE F CG  1 
ATOM   6233 C CD1 . PHE F 2 41  ? 19.201  29.627  -3.521  1.00 57.81  ? 97   PHE F CD1 1 
ATOM   6234 C CD2 . PHE F 2 41  ? 21.047  29.931  -4.995  1.00 57.45  ? 97   PHE F CD2 1 
ATOM   6235 C CE1 . PHE F 2 41  ? 19.257  30.964  -3.181  1.00 59.49  ? 97   PHE F CE1 1 
ATOM   6236 C CE2 . PHE F 2 41  ? 21.110  31.264  -4.663  1.00 58.97  ? 97   PHE F CE2 1 
ATOM   6237 C CZ  . PHE F 2 41  ? 20.220  31.783  -3.759  1.00 59.23  ? 97   PHE F CZ  1 
ATOM   6238 N N   . VAL F 2 42  ? 18.860  25.729  -7.594  1.00 54.07  ? 98   VAL F N   1 
ATOM   6239 C CA  . VAL F 2 42  ? 18.889  24.377  -8.132  1.00 53.17  ? 98   VAL F CA  1 
ATOM   6240 C C   . VAL F 2 42  ? 20.245  24.098  -8.769  1.00 53.43  ? 98   VAL F C   1 
ATOM   6241 O O   . VAL F 2 42  ? 20.969  25.019  -9.174  1.00 53.50  ? 98   VAL F O   1 
ATOM   6242 C CB  . VAL F 2 42  ? 17.756  24.144  -9.122  1.00 55.41  ? 98   VAL F CB  1 
ATOM   6243 C CG1 . VAL F 2 42  ? 17.348  22.705  -9.083  1.00 55.08  ? 98   VAL F CG1 1 
ATOM   6244 C CG2 . VAL F 2 42  ? 16.593  25.008  -8.774  1.00 54.13  ? 98   VAL F CG2 1 
ATOM   6245 N N   . THR F 2 43  ? 20.595  22.815  -8.769  1.00 54.86  ? 99   THR F N   1 
ATOM   6246 C CA  . THR F 2 43  ? 21.836  22.292  -9.333  1.00 55.02  ? 99   THR F CA  1 
ATOM   6247 C C   . THR F 2 43  ? 21.359  21.141  -10.214 1.00 55.02  ? 99   THR F C   1 
ATOM   6248 O O   . THR F 2 43  ? 20.685  20.239  -9.738  1.00 54.79  ? 99   THR F O   1 
ATOM   6249 C CB  . THR F 2 43  ? 22.801  21.776  -8.230  1.00 62.76  ? 99   THR F CB  1 
ATOM   6250 O OG1 . THR F 2 43  ? 23.311  22.868  -7.447  1.00 63.19  ? 99   THR F OG1 1 
ATOM   6251 C CG2 . THR F 2 43  ? 23.946  21.022  -8.854  1.00 62.67  ? 99   THR F CG2 1 
ATOM   6252 N N   . LEU F 2 44  ? 21.637  21.227  -11.511 1.00 55.60  ? 100  LEU F N   1 
ATOM   6253 C CA  . LEU F 2 44  ? 21.192  20.226  -12.466 1.00 55.91  ? 100  LEU F CA  1 
ATOM   6254 C C   . LEU F 2 44  ? 22.285  19.215  -12.845 1.00 56.67  ? 100  LEU F C   1 
ATOM   6255 O O   . LEU F 2 44  ? 23.445  19.347  -12.438 1.00 57.11  ? 100  LEU F O   1 
ATOM   6256 C CB  . LEU F 2 44  ? 20.617  20.911  -13.702 1.00 55.47  ? 100  LEU F CB  1 
ATOM   6257 C CG  . LEU F 2 44  ? 19.371  21.744  -13.417 1.00 54.62  ? 100  LEU F CG  1 
ATOM   6258 C CD1 . LEU F 2 44  ? 18.566  21.933  -14.681 1.00 53.74  ? 100  LEU F CD1 1 
ATOM   6259 C CD2 . LEU F 2 44  ? 18.541  21.012  -12.382 1.00 56.23  ? 100  LEU F CD2 1 
ATOM   6260 N N   . LEU F 2 45  ? 21.898  18.191  -13.603 1.00 57.21  ? 101  LEU F N   1 
ATOM   6261 C CA  . LEU F 2 45  ? 22.821  17.141  -14.013 1.00 56.75  ? 101  LEU F CA  1 
ATOM   6262 C C   . LEU F 2 45  ? 24.095  17.675  -14.722 1.00 57.16  ? 101  LEU F C   1 
ATOM   6263 O O   . LEU F 2 45  ? 25.214  17.276  -14.407 1.00 56.94  ? 101  LEU F O   1 
ATOM   6264 C CB  . LEU F 2 45  ? 22.073  16.132  -14.894 1.00 55.70  ? 101  LEU F CB  1 
ATOM   6265 C CG  . LEU F 2 45  ? 22.862  14.920  -15.357 1.00 54.62  ? 101  LEU F CG  1 
ATOM   6266 C CD1 . LEU F 2 45  ? 23.731  14.459  -14.220 1.00 57.00  ? 101  LEU F CD1 1 
ATOM   6267 C CD2 . LEU F 2 45  ? 21.955  13.819  -15.829 1.00 51.71  ? 101  LEU F CD2 1 
ATOM   6268 N N   . ASN F 2 46  ? 23.924  18.587  -15.671 1.00 57.22  ? 102  ASN F N   1 
ATOM   6269 C CA  . ASN F 2 46  ? 25.048  19.116  -16.433 1.00 57.17  ? 102  ASN F CA  1 
ATOM   6270 C C   . ASN F 2 46  ? 24.743  20.477  -17.095 1.00 57.78  ? 102  ASN F C   1 
ATOM   6271 O O   . ASN F 2 46  ? 23.673  21.066  -16.897 1.00 57.97  ? 102  ASN F O   1 
ATOM   6272 C CB  . ASN F 2 46  ? 25.454  18.116  -17.511 1.00 58.50  ? 102  ASN F CB  1 
ATOM   6273 C CG  . ASN F 2 46  ? 24.270  17.662  -18.372 1.00 57.48  ? 102  ASN F CG  1 
ATOM   6274 O OD1 . ASN F 2 46  ? 23.628  18.458  -19.039 1.00 57.83  ? 102  ASN F OD1 1 
ATOM   6275 N ND2 . ASN F 2 46  ? 24.011  16.369  -18.380 1.00 54.98  ? 102  ASN F ND2 1 
ATOM   6276 N N   . GLY F 2 47  ? 25.696  20.972  -17.882 1.00 56.53  ? 103  GLY F N   1 
ATOM   6277 C CA  . GLY F 2 47  ? 25.563  22.251  -18.538 1.00 56.95  ? 103  GLY F CA  1 
ATOM   6278 C C   . GLY F 2 47  ? 24.395  22.297  -19.494 1.00 57.51  ? 103  GLY F C   1 
ATOM   6279 O O   . GLY F 2 47  ? 23.757  23.321  -19.622 1.00 57.45  ? 103  GLY F O   1 
ATOM   6280 N N   . GLU F 2 48  ? 24.113  21.204  -20.188 1.00 58.61  ? 104  GLU F N   1 
ATOM   6281 C CA  . GLU F 2 48  ? 23.022  21.226  -21.139 1.00 60.26  ? 104  GLU F CA  1 
ATOM   6282 C C   . GLU F 2 48  ? 21.702  21.350  -20.457 1.00 60.10  ? 104  GLU F C   1 
ATOM   6283 O O   . GLU F 2 48  ? 20.846  22.073  -20.919 1.00 60.63  ? 104  GLU F O   1 
ATOM   6284 C CB  . GLU F 2 48  ? 23.019  20.010  -22.048 1.00 61.80  ? 104  GLU F CB  1 
ATOM   6285 C CG  . GLU F 2 48  ? 22.756  20.372  -23.509 1.00 65.94  ? 104  GLU F CG  1 
ATOM   6286 C CD  . GLU F 2 48  ? 23.805  21.352  -24.067 1.00 72.47  ? 104  GLU F CD  1 
ATOM   6287 O OE1 . GLU F 2 48  ? 23.465  22.100  -25.015 1.00 74.75  ? 104  GLU F OE1 1 
ATOM   6288 O OE2 . GLU F 2 48  ? 24.966  21.378  -23.560 1.00 73.55  ? 104  GLU F OE2 1 
ATOM   6289 N N   . GLN F 2 49  ? 21.524  20.616  -19.370 1.00 58.10  ? 105  GLN F N   1 
ATOM   6290 C CA  . GLN F 2 49  ? 20.286  20.640  -18.607 1.00 57.77  ? 105  GLN F CA  1 
ATOM   6291 C C   . GLN F 2 49  ? 19.996  22.052  -18.112 1.00 57.45  ? 105  GLN F C   1 
ATOM   6292 O O   . GLN F 2 49  ? 18.904  22.579  -18.316 1.00 56.98  ? 105  GLN F O   1 
ATOM   6293 C CB  . GLN F 2 49  ? 20.418  19.685  -17.425 1.00 57.97  ? 105  GLN F CB  1 
ATOM   6294 C CG  . GLN F 2 49  ? 20.198  18.221  -17.762 1.00 59.17  ? 105  GLN F CG  1 
ATOM   6295 C CD  . GLN F 2 49  ? 19.299  17.568  -16.747 1.00 62.69  ? 105  GLN F CD  1 
ATOM   6296 O OE1 . GLN F 2 49  ? 19.467  17.757  -15.525 1.00 62.71  ? 105  GLN F OE1 1 
ATOM   6297 N NE2 . GLN F 2 49  ? 18.279  16.874  -17.234 1.00 61.85  ? 105  GLN F NE2 1 
ATOM   6298 N N   . ALA F 2 50  ? 20.994  22.665  -17.481 1.00 57.60  ? 106  ALA F N   1 
ATOM   6299 C CA  . ALA F 2 50  ? 20.878  24.035  -16.994 1.00 58.32  ? 106  ALA F CA  1 
ATOM   6300 C C   . ALA F 2 50  ? 20.539  25.036  -18.124 1.00 58.88  ? 106  ALA F C   1 
ATOM   6301 O O   . ALA F 2 50  ? 19.886  26.056  -17.900 1.00 59.31  ? 106  ALA F O   1 
ATOM   6302 C CB  . ALA F 2 50  ? 22.143  24.447  -16.228 1.00 58.53  ? 106  ALA F CB  1 
ATOM   6303 N N   . GLU F 2 51  ? 20.944  24.726  -19.347 1.00 59.65  ? 107  GLU F N   1 
ATOM   6304 C CA  . GLU F 2 51  ? 20.641  25.578  -20.497 1.00 59.91  ? 107  GLU F CA  1 
ATOM   6305 C C   . GLU F 2 51  ? 19.183  25.492  -20.907 1.00 59.06  ? 107  GLU F C   1 
ATOM   6306 O O   . GLU F 2 51  ? 18.518  26.520  -21.087 1.00 59.05  ? 107  GLU F O   1 
ATOM   6307 C CB  . GLU F 2 51  ? 21.469  25.147  -21.683 1.00 62.11  ? 107  GLU F CB  1 
ATOM   6308 C CG  . GLU F 2 51  ? 21.389  26.109  -22.812 1.00 66.00  ? 107  GLU F CG  1 
ATOM   6309 C CD  . GLU F 2 51  ? 22.599  27.029  -22.839 1.00 73.06  ? 107  GLU F CD  1 
ATOM   6310 O OE1 . GLU F 2 51  ? 23.720  26.490  -23.040 1.00 74.14  ? 107  GLU F OE1 1 
ATOM   6311 O OE2 . GLU F 2 51  ? 22.437  28.266  -22.602 1.00 76.97  ? 107  GLU F OE2 1 
ATOM   6312 N N   . ALA F 2 52  ? 18.720  24.254  -21.112 1.00 54.53  ? 108  ALA F N   1 
ATOM   6313 C CA  . ALA F 2 52  ? 17.328  23.957  -21.469 1.00 54.14  ? 108  ALA F CA  1 
ATOM   6314 C C   . ALA F 2 52  ? 16.390  24.435  -20.362 1.00 53.83  ? 108  ALA F C   1 
ATOM   6315 O O   . ALA F 2 52  ? 15.323  24.980  -20.626 1.00 53.99  ? 108  ALA F O   1 
ATOM   6316 C CB  . ALA F 2 52  ? 17.148  22.500  -21.708 1.00 54.10  ? 108  ALA F CB  1 
ATOM   6317 N N   . ALA F 2 53  ? 16.828  24.291  -19.119 1.00 50.50  ? 109  ALA F N   1 
ATOM   6318 C CA  . ALA F 2 53  ? 16.048  24.781  -17.989 1.00 50.17  ? 109  ALA F CA  1 
ATOM   6319 C C   . ALA F 2 53  ? 15.920  26.317  -18.047 1.00 49.85  ? 109  ALA F C   1 
ATOM   6320 O O   . ALA F 2 53  ? 14.826  26.879  -17.890 1.00 49.54  ? 109  ALA F O   1 
ATOM   6321 C CB  . ALA F 2 53  ? 16.701  24.350  -16.682 1.00 50.45  ? 109  ALA F CB  1 
ATOM   6322 N N   . ILE F 2 54  ? 17.040  26.991  -18.297 1.00 47.85  ? 110  ILE F N   1 
ATOM   6323 C CA  . ILE F 2 54  ? 17.029  28.437  -18.392 1.00 47.72  ? 110  ILE F CA  1 
ATOM   6324 C C   . ILE F 2 54  ? 16.108  28.901  -19.505 1.00 48.28  ? 110  ILE F C   1 
ATOM   6325 O O   . ILE F 2 54  ? 15.289  29.804  -19.304 1.00 48.02  ? 110  ILE F O   1 
ATOM   6326 C CB  . ILE F 2 54  ? 18.421  28.998  -18.588 1.00 48.42  ? 110  ILE F CB  1 
ATOM   6327 C CG1 . ILE F 2 54  ? 19.199  28.893  -17.291 1.00 48.31  ? 110  ILE F CG1 1 
ATOM   6328 C CG2 . ILE F 2 54  ? 18.334  30.433  -18.988 1.00 47.38  ? 110  ILE F CG2 1 
ATOM   6329 C CD1 . ILE F 2 54  ? 20.652  29.209  -17.464 1.00 47.45  ? 110  ILE F CD1 1 
ATOM   6330 N N   . ASN F 2 55  ? 16.250  28.278  -20.678 1.00 54.23  ? 111  ASN F N   1 
ATOM   6331 C CA  . ASN F 2 55  ? 15.455  28.657  -21.850 1.00 53.58  ? 111  ASN F CA  1 
ATOM   6332 C C   . ASN F 2 55  ? 13.983  28.362  -21.729 1.00 52.82  ? 111  ASN F C   1 
ATOM   6333 O O   . ASN F 2 55  ? 13.163  29.241  -21.994 1.00 52.94  ? 111  ASN F O   1 
ATOM   6334 C CB  . ASN F 2 55  ? 16.067  28.164  -23.168 1.00 61.89  ? 111  ASN F CB  1 
ATOM   6335 C CG  . ASN F 2 55  ? 17.278  29.007  -23.588 1.00 63.24  ? 111  ASN F CG  1 
ATOM   6336 O OD1 . ASN F 2 55  ? 17.196  30.246  -23.641 1.00 63.67  ? 111  ASN F OD1 1 
ATOM   6337 N ND2 . ASN F 2 55  ? 18.435  28.354  -23.753 1.00 65.29  ? 111  ASN F ND2 1 
ATOM   6338 N N   . ALA F 2 56  ? 13.645  27.175  -21.234 1.00 50.75  ? 112  ALA F N   1 
ATOM   6339 C CA  . ALA F 2 56  ? 12.243  26.826  -21.055 1.00 49.49  ? 112  ALA F CA  1 
ATOM   6340 C C   . ALA F 2 56  ? 11.584  27.716  -20.047 1.00 49.30  ? 112  ALA F C   1 
ATOM   6341 O O   . ALA F 2 56  ? 10.454  28.150  -20.241 1.00 50.13  ? 112  ALA F O   1 
ATOM   6342 C CB  . ALA F 2 56  ? 12.089  25.397  -20.627 1.00 50.10  ? 112  ALA F CB  1 
ATOM   6343 N N   . PHE F 2 57  ? 12.313  28.021  -18.969 1.00 48.31  ? 113  PHE F N   1 
ATOM   6344 C CA  . PHE F 2 57  ? 11.733  28.635  -17.767 1.00 47.65  ? 113  PHE F CA  1 
ATOM   6345 C C   . PHE F 2 57  ? 12.152  30.074  -17.372 1.00 47.46  ? 113  PHE F C   1 
ATOM   6346 O O   . PHE F 2 57  ? 11.679  30.579  -16.354 1.00 47.51  ? 113  PHE F O   1 
ATOM   6347 C CB  . PHE F 2 57  ? 11.928  27.705  -16.563 1.00 48.82  ? 113  PHE F CB  1 
ATOM   6348 C CG  . PHE F 2 57  ? 11.220  26.387  -16.695 1.00 48.82  ? 113  PHE F CG  1 
ATOM   6349 C CD1 . PHE F 2 57  ? 9.855   26.338  -16.920 1.00 48.82  ? 113  PHE F CD1 1 
ATOM   6350 C CD2 . PHE F 2 57  ? 11.920  25.196  -16.593 1.00 48.82  ? 113  PHE F CD2 1 
ATOM   6351 C CE1 . PHE F 2 57  ? 9.201   25.126  -17.041 1.00 48.82  ? 113  PHE F CE1 1 
ATOM   6352 C CE2 . PHE F 2 57  ? 11.272  23.982  -16.713 1.00 48.82  ? 113  PHE F CE2 1 
ATOM   6353 C CZ  . PHE F 2 57  ? 9.911   23.947  -16.938 1.00 48.82  ? 113  PHE F CZ  1 
ATOM   6354 N N   . HIS F 2 58  ? 13.015  30.736  -18.144 1.00 49.19  ? 114  HIS F N   1 
ATOM   6355 C CA  . HIS F 2 58  ? 13.228  32.163  -17.961 1.00 49.52  ? 114  HIS F CA  1 
ATOM   6356 C C   . HIS F 2 58  ? 12.111  33.011  -18.584 1.00 49.61  ? 114  HIS F C   1 
ATOM   6357 O O   . HIS F 2 58  ? 11.881  32.954  -19.786 1.00 49.33  ? 114  HIS F O   1 
ATOM   6358 C CB  . HIS F 2 58  ? 14.601  32.601  -18.445 1.00 48.99  ? 114  HIS F CB  1 
ATOM   6359 C CG  . HIS F 2 58  ? 14.801  34.077  -18.355 1.00 50.13  ? 114  HIS F CG  1 
ATOM   6360 N ND1 . HIS F 2 58  ? 15.207  34.700  -17.191 1.00 50.61  ? 114  HIS F ND1 1 
ATOM   6361 C CD2 . HIS F 2 58  ? 14.554  35.065  -19.247 1.00 50.37  ? 114  HIS F CD2 1 
ATOM   6362 C CE1 . HIS F 2 58  ? 15.259  36.003  -17.393 1.00 50.74  ? 114  HIS F CE1 1 
ATOM   6363 N NE2 . HIS F 2 58  ? 14.863  36.251  -18.631 1.00 51.21  ? 114  HIS F NE2 1 
ATOM   6364 N N   . GLN F 2 59  ? 11.379  33.736  -17.738 1.00 53.60  ? 115  GLN F N   1 
ATOM   6365 C CA  . GLN F 2 59  ? 10.260  34.593  -18.166 1.00 54.16  ? 115  GLN F CA  1 
ATOM   6366 C C   . GLN F 2 59  ? 8.892   33.917  -18.233 1.00 53.73  ? 115  GLN F C   1 
ATOM   6367 O O   . GLN F 2 59  ? 7.911   34.517  -18.700 1.00 54.66  ? 115  GLN F O   1 
ATOM   6368 C CB  . GLN F 2 59  ? 10.558  35.344  -19.460 1.00 57.85  ? 115  GLN F CB  1 
ATOM   6369 C CG  . GLN F 2 59  ? 11.485  36.521  -19.233 1.00 60.47  ? 115  GLN F CG  1 
ATOM   6370 C CD  . GLN F 2 59  ? 11.576  37.445  -20.437 1.00 60.50  ? 115  GLN F CD  1 
ATOM   6371 O OE1 . GLN F 2 59  ? 11.850  36.992  -21.565 1.00 59.54  ? 115  GLN F OE1 1 
ATOM   6372 N NE2 . GLN F 2 59  ? 11.339  38.749  -20.210 1.00 59.68  ? 115  GLN F NE2 1 
ATOM   6373 N N   . SER F 2 60  ? 8.821   32.686  -17.744 1.00 50.02  ? 116  SER F N   1 
ATOM   6374 C CA  . SER F 2 60  ? 7.562   31.972  -17.700 1.00 49.03  ? 116  SER F CA  1 
ATOM   6375 C C   . SER F 2 60  ? 6.838   32.381  -16.407 1.00 48.31  ? 116  SER F C   1 
ATOM   6376 O O   . SER F 2 60  ? 7.417   33.068  -15.552 1.00 48.30  ? 116  SER F O   1 
ATOM   6377 C CB  . SER F 2 60  ? 7.804   30.462  -17.761 1.00 52.49  ? 116  SER F CB  1 
ATOM   6378 O OG  . SER F 2 60  ? 8.429   29.991  -16.576 1.00 52.47  ? 116  SER F OG  1 
ATOM   6379 N N   . ARG F 2 61  ? 5.558   32.011  -16.302 1.00 47.86  ? 117  ARG F N   1 
ATOM   6380 C CA  . ARG F 2 61  ? 4.745   32.394  -15.149 1.00 46.88  ? 117  ARG F CA  1 
ATOM   6381 C C   . ARG F 2 61  ? 4.436   31.207  -14.297 1.00 46.43  ? 117  ARG F C   1 
ATOM   6382 O O   . ARG F 2 61  ? 3.969   30.206  -14.791 1.00 45.81  ? 117  ARG F O   1 
ATOM   6383 C CB  . ARG F 2 61  ? 3.425   33.045  -15.571 1.00 44.80  ? 117  ARG F CB  1 
ATOM   6384 C CG  . ARG F 2 61  ? 3.588   34.268  -16.392 1.00 44.80  ? 117  ARG F CG  1 
ATOM   6385 C CD  . ARG F 2 61  ? 3.201   35.492  -15.624 1.00 44.55  ? 117  ARG F CD  1 
ATOM   6386 N NE  . ARG F 2 61  ? 3.622   36.699  -16.330 1.00 45.18  ? 117  ARG F NE  1 
ATOM   6387 C CZ  . ARG F 2 61  ? 3.653   37.920  -15.796 1.00 48.62  ? 117  ARG F CZ  1 
ATOM   6388 N NH1 . ARG F 2 61  ? 3.261   38.137  -14.542 1.00 49.68  ? 117  ARG F NH1 1 
ATOM   6389 N NH2 . ARG F 2 61  ? 4.123   38.936  -16.509 1.00 49.66  ? 117  ARG F NH2 1 
ATOM   6390 N N   . LEU F 2 62  ? 4.721   31.328  -13.011 1.00 46.82  ? 118  LEU F N   1 
ATOM   6391 C CA  . LEU F 2 62  ? 4.392   30.281  -12.048 1.00 47.10  ? 118  LEU F CA  1 
ATOM   6392 C C   . LEU F 2 62  ? 3.294   30.868  -11.147 1.00 46.97  ? 118  LEU F C   1 
ATOM   6393 O O   . LEU F 2 62  ? 3.539   31.845  -10.428 1.00 46.51  ? 118  LEU F O   1 
ATOM   6394 C CB  . LEU F 2 62  ? 5.616   29.874  -11.208 1.00 45.71  ? 118  LEU F CB  1 
ATOM   6395 C CG  . LEU F 2 62  ? 5.222   28.805  -10.177 1.00 46.40  ? 118  LEU F CG  1 
ATOM   6396 C CD1 . LEU F 2 62  ? 4.696   27.596  -10.906 1.00 45.98  ? 118  LEU F CD1 1 
ATOM   6397 C CD2 . LEU F 2 62  ? 6.270   28.426  -9.160  1.00 44.85  ? 118  LEU F CD2 1 
ATOM   6398 N N   . ARG F 2 63  ? 2.089   30.292  -11.224 1.00 48.58  ? 119  ARG F N   1 
ATOM   6399 C CA  . ARG F 2 63  ? 0.894   30.809  -10.524 1.00 48.69  ? 119  ARG F CA  1 
ATOM   6400 C C   . ARG F 2 63  ? 0.786   32.318  -10.619 1.00 48.75  ? 119  ARG F C   1 
ATOM   6401 O O   . ARG F 2 63  ? 0.593   33.016  -9.634  1.00 48.83  ? 119  ARG F O   1 
ATOM   6402 C CB  . ARG F 2 63  ? 0.777   30.312  -9.091  1.00 44.74  ? 119  ARG F CB  1 
ATOM   6403 C CG  . ARG F 2 63  ? 0.672   28.810  -9.000  1.00 46.03  ? 119  ARG F CG  1 
ATOM   6404 C CD  . ARG F 2 63  ? 1.156   28.308  -7.656  1.00 47.69  ? 119  ARG F CD  1 
ATOM   6405 N NE  . ARG F 2 63  ? 0.925   29.303  -6.612  1.00 51.88  ? 119  ARG F NE  1 
ATOM   6406 C CZ  . ARG F 2 63  ? 1.701   29.464  -5.539  1.00 53.15  ? 119  ARG F CZ  1 
ATOM   6407 N NH1 . ARG F 2 63  ? 2.769   28.680  -5.355  1.00 50.79  ? 119  ARG F NH1 1 
ATOM   6408 N NH2 . ARG F 2 63  ? 1.385   30.397  -4.638  1.00 53.51  ? 119  ARG F NH2 1 
ATOM   6409 N N   . GLU F 2 64  ? 0.896   32.822  -11.846 1.00 50.81  ? 120  GLU F N   1 
ATOM   6410 C CA  . GLU F 2 64  ? 0.667   34.238  -12.126 1.00 51.30  ? 120  GLU F CA  1 
ATOM   6411 C C   . GLU F 2 64  ? 1.884   35.132  -11.870 1.00 51.10  ? 120  GLU F C   1 
ATOM   6412 O O   . GLU F 2 64  ? 1.777   36.358  -11.919 1.00 51.07  ? 120  GLU F O   1 
ATOM   6413 C CB  . GLU F 2 64  ? -0.533  34.751  -11.325 1.00 53.02  ? 120  GLU F CB  1 
ATOM   6414 C CG  . GLU F 2 64  ? -1.855  34.679  -12.072 1.00 53.57  ? 120  GLU F CG  1 
ATOM   6415 C CD  . GLU F 2 64  ? -1.857  35.519  -13.334 1.00 59.63  ? 120  GLU F CD  1 
ATOM   6416 O OE1 . GLU F 2 64  ? -2.143  36.731  -13.243 1.00 59.44  ? 120  GLU F OE1 1 
ATOM   6417 O OE2 . GLU F 2 64  ? -1.573  34.966  -14.418 1.00 62.83  ? 120  GLU F OE2 1 
ATOM   6418 N N   . ARG F 2 65  ? 3.034   34.524  -11.598 1.00 49.05  ? 121  ARG F N   1 
ATOM   6419 C CA  . ARG F 2 65  ? 4.254   35.285  -11.332 1.00 49.74  ? 121  ARG F CA  1 
ATOM   6420 C C   . ARG F 2 65  ? 5.338   35.029  -12.380 1.00 50.69  ? 121  ARG F C   1 
ATOM   6421 O O   . ARG F 2 65  ? 5.638   33.880  -12.705 1.00 50.72  ? 121  ARG F O   1 
ATOM   6422 C CB  . ARG F 2 65  ? 4.790   34.965  -9.935  1.00 43.95  ? 121  ARG F CB  1 
ATOM   6423 C CG  . ARG F 2 65  ? 3.823   34.180  -9.064  1.00 45.04  ? 121  ARG F CG  1 
ATOM   6424 C CD  . ARG F 2 65  ? 2.706   35.069  -8.541  1.00 43.73  ? 121  ARG F CD  1 
ATOM   6425 N NE  . ARG F 2 65  ? 2.645   35.070  -7.083  1.00 43.53  ? 121  ARG F NE  1 
ATOM   6426 C CZ  . ARG F 2 65  ? 1.713   34.441  -6.374  1.00 45.81  ? 121  ARG F CZ  1 
ATOM   6427 N NH1 . ARG F 2 65  ? 0.758   33.757  -6.989  1.00 45.33  ? 121  ARG F NH1 1 
ATOM   6428 N NH2 . ARG F 2 65  ? 1.735   34.496  -5.049  1.00 47.13  ? 121  ARG F NH2 1 
ATOM   6429 N N   . GLU F 2 66  ? 5.923   36.104  -12.906 1.00 53.17  ? 122  GLU F N   1 
ATOM   6430 C CA  . GLU F 2 66  ? 6.954   35.987  -13.939 1.00 54.38  ? 122  GLU F CA  1 
ATOM   6431 C C   . GLU F 2 66  ? 8.267   35.565  -13.273 1.00 54.31  ? 122  GLU F C   1 
ATOM   6432 O O   . GLU F 2 66  ? 8.650   36.136  -12.261 1.00 54.44  ? 122  GLU F O   1 
ATOM   6433 C CB  . GLU F 2 66  ? 7.163   37.308  -14.672 1.00 56.44  ? 122  GLU F CB  1 
ATOM   6434 C CG  . GLU F 2 66  ? 7.550   37.131  -16.142 1.00 60.69  ? 122  GLU F CG  1 
ATOM   6435 C CD  . GLU F 2 66  ? 8.403   38.292  -16.703 1.00 66.55  ? 122  GLU F CD  1 
ATOM   6436 O OE1 . GLU F 2 66  ? 9.660   38.143  -16.791 1.00 69.50  ? 122  GLU F OE1 1 
ATOM   6437 O OE2 . GLU F 2 66  ? 7.811   39.345  -17.077 1.00 66.30  ? 122  GLU F OE2 1 
ATOM   6438 N N   . LEU F 2 67  ? 8.923   34.542  -13.831 1.00 49.58  ? 123  LEU F N   1 
ATOM   6439 C CA  . LEU F 2 67  ? 10.130  33.976  -13.249 1.00 49.46  ? 123  LEU F CA  1 
ATOM   6440 C C   . LEU F 2 67  ? 11.321  34.381  -14.041 1.00 50.24  ? 123  LEU F C   1 
ATOM   6441 O O   . LEU F 2 67  ? 11.263  34.512  -15.261 1.00 50.80  ? 123  LEU F O   1 
ATOM   6442 C CB  . LEU F 2 67  ? 10.070  32.453  -13.273 1.00 48.99  ? 123  LEU F CB  1 
ATOM   6443 C CG  . LEU F 2 67  ? 8.968   31.760  -12.491 1.00 48.11  ? 123  LEU F CG  1 
ATOM   6444 C CD1 . LEU F 2 67  ? 9.069   30.256  -12.721 1.00 45.32  ? 123  LEU F CD1 1 
ATOM   6445 C CD2 . LEU F 2 67  ? 9.132   32.133  -11.024 1.00 47.04  ? 123  LEU F CD2 1 
ATOM   6446 N N   . SER F 2 68  ? 12.423  34.512  -13.332 1.00 48.83  ? 124  SER F N   1 
ATOM   6447 C CA  . SER F 2 68  ? 13.691  34.826  -13.952 1.00 49.99  ? 124  SER F CA  1 
ATOM   6448 C C   . SER F 2 68  ? 14.694  33.700  -13.614 1.00 51.14  ? 124  SER F C   1 
ATOM   6449 O O   . SER F 2 68  ? 15.217  33.597  -12.481 1.00 51.26  ? 124  SER F O   1 
ATOM   6450 C CB  . SER F 2 68  ? 14.206  36.193  -13.501 1.00 50.13  ? 124  SER F CB  1 
ATOM   6451 O OG  . SER F 2 68  ? 15.110  36.071  -12.423 1.00 49.66  ? 124  SER F OG  1 
ATOM   6452 N N   . VAL F 2 69  ? 14.897  32.820  -14.592 1.00 50.69  ? 125  VAL F N   1 
ATOM   6453 C CA  . VAL F 2 69  ? 15.814  31.715  -14.444 1.00 51.25  ? 125  VAL F CA  1 
ATOM   6454 C C   . VAL F 2 69  ? 17.126  32.103  -15.128 1.00 52.08  ? 125  VAL F C   1 
ATOM   6455 O O   . VAL F 2 69  ? 17.125  32.565  -16.259 1.00 52.89  ? 125  VAL F O   1 
ATOM   6456 C CB  . VAL F 2 69  ? 15.196  30.431  -15.034 1.00 53.15  ? 125  VAL F CB  1 
ATOM   6457 C CG1 . VAL F 2 69  ? 15.999  29.225  -14.606 1.00 53.31  ? 125  VAL F CG1 1 
ATOM   6458 C CG2 . VAL F 2 69  ? 13.714  30.297  -14.632 1.00 52.37  ? 125  VAL F CG2 1 
ATOM   6459 N N   . GLN F 2 70  ? 18.241  31.971  -14.430 1.00 54.28  ? 126  GLN F N   1 
ATOM   6460 C CA  . GLN F 2 70  ? 19.526  32.299  -15.018 1.00 55.08  ? 126  GLN F CA  1 
ATOM   6461 C C   . GLN F 2 70  ? 20.618  31.511  -14.308 1.00 55.71  ? 126  GLN F C   1 
ATOM   6462 O O   . GLN F 2 70  ? 20.373  30.941  -13.238 1.00 55.87  ? 126  GLN F O   1 
ATOM   6463 C CB  . GLN F 2 70  ? 19.784  33.802  -14.923 1.00 58.91  ? 126  GLN F CB  1 
ATOM   6464 C CG  . GLN F 2 70  ? 20.432  34.238  -13.598 1.00 59.16  ? 126  GLN F CG  1 
ATOM   6465 C CD  . GLN F 2 70  ? 19.834  35.528  -12.987 1.00 59.11  ? 126  GLN F CD  1 
ATOM   6466 O OE1 . GLN F 2 70  ? 20.497  36.580  -12.955 1.00 57.92  ? 126  GLN F OE1 1 
ATOM   6467 N NE2 . GLN F 2 70  ? 18.627  35.415  -12.402 1.00 60.12  ? 126  GLN F NE2 1 
ATOM   6468 N N   . LEU F 2 71  ? 21.811  31.464  -14.902 1.00 56.85  ? 127  LEU F N   1 
ATOM   6469 C CA  . LEU F 2 71  ? 22.938  30.747  -14.303 1.00 57.52  ? 127  LEU F CA  1 
ATOM   6470 C C   . LEU F 2 71  ? 23.285  31.373  -12.977 1.00 58.18  ? 127  LEU F C   1 
ATOM   6471 O O   . LEU F 2 71  ? 23.352  32.595  -12.882 1.00 57.87  ? 127  LEU F O   1 
ATOM   6472 C CB  . LEU F 2 71  ? 24.153  30.812  -15.205 1.00 56.47  ? 127  LEU F CB  1 
ATOM   6473 C CG  . LEU F 2 71  ? 24.073  29.988  -16.482 1.00 56.08  ? 127  LEU F CG  1 
ATOM   6474 C CD1 . LEU F 2 71  ? 25.419  30.055  -17.120 1.00 55.06  ? 127  LEU F CD1 1 
ATOM   6475 C CD2 . LEU F 2 71  ? 23.654  28.533  -16.224 1.00 54.55  ? 127  LEU F CD2 1 
ATOM   6476 N N   . GLN F 2 72  ? 23.471  30.536  -11.955 1.00 67.08  ? 128  GLN F N   1 
ATOM   6477 C CA  . GLN F 2 72  ? 23.776  31.011  -10.606 1.00 68.64  ? 128  GLN F CA  1 
ATOM   6478 C C   . GLN F 2 72  ? 24.940  31.957  -10.719 1.00 70.01  ? 128  GLN F C   1 
ATOM   6479 O O   . GLN F 2 72  ? 26.044  31.547  -11.119 1.00 70.11  ? 128  GLN F O   1 
ATOM   6480 C CB  . GLN F 2 72  ? 24.126  29.858  -9.661  1.00 71.90  ? 128  GLN F CB  1 
ATOM   6481 C CG  . GLN F 2 72  ? 23.228  29.778  -8.428  1.00 73.08  ? 128  GLN F CG  1 
ATOM   6482 C CD  . GLN F 2 72  ? 23.107  28.354  -7.844  1.00 74.28  ? 128  GLN F CD  1 
ATOM   6483 O OE1 . GLN F 2 72  ? 22.160  27.596  -8.151  1.00 71.86  ? 128  GLN F OE1 1 
ATOM   6484 N NE2 . GLN F 2 72  ? 24.028  28.017  -6.935  1.00 74.28  ? 128  GLN F NE2 1 
ATOM   6485 N N   . PRO F 2 73  ? 24.687  33.259  -10.465 1.00 75.30  ? 129  PRO F N   1 
ATOM   6486 C CA  . PRO F 2 73  ? 25.649  34.366  -10.564 1.00 76.27  ? 129  PRO F CA  1 
ATOM   6487 C C   . PRO F 2 73  ? 27.001  33.956  -10.008 1.00 77.49  ? 129  PRO F C   1 
ATOM   6488 O O   . PRO F 2 73  ? 27.148  33.707  -8.797  1.00 78.07  ? 129  PRO F O   1 
ATOM   6489 C CB  . PRO F 2 73  ? 25.013  35.479  -9.725  1.00 77.99  ? 129  PRO F CB  1 
ATOM   6490 C CG  . PRO F 2 73  ? 24.091  34.788  -8.794  1.00 78.38  ? 129  PRO F CG  1 
ATOM   6491 C CD  . PRO F 2 73  ? 23.605  33.545  -9.505  1.00 77.81  ? 129  PRO F CD  1 
ATOM   6492 N N   . THR F 2 74  ? 27.966  33.820  -10.920 1.00 79.20  ? 130  THR F N   1 
ATOM   6493 C CA  . THR F 2 74  ? 29.322  33.413  -10.557 1.00 80.37  ? 130  THR F CA  1 
ATOM   6494 C C   . THR F 2 74  ? 30.293  34.589  -10.671 1.00 80.62  ? 130  THR F C   1 
ATOM   6495 O O   . THR F 2 74  ? 30.324  35.425  -9.734  1.00 80.75  ? 130  THR F O   1 
ATOM   6496 C CB  . THR F 2 74  ? 29.797  32.182  -11.376 1.00 95.02  ? 130  THR F CB  1 
ATOM   6497 O OG1 . THR F 2 74  ? 28.730  31.222  -11.470 1.00 95.90  ? 130  THR F OG1 1 
ATOM   6498 C CG2 . THR F 2 74  ? 31.016  31.530  -10.707 1.00 94.66  ? 130  THR F CG2 1 
ATOM   6499 O OXT . THR F 2 74  ? 30.994  34.660  -11.707 1.00 110.12 ? 130  THR F OXT 1 
ATOM   6500 N N   . HIS G 2 1   ? -0.356  41.445  30.591  1.00 91.88  ? 57   HIS G N   1 
ATOM   6501 C CA  . HIS G 2 1   ? -1.481  41.441  31.524  1.00 91.94  ? 57   HIS G CA  1 
ATOM   6502 C C   . HIS G 2 1   ? -1.235  42.419  32.652  1.00 91.31  ? 57   HIS G C   1 
ATOM   6503 O O   . HIS G 2 1   ? -1.839  43.493  32.731  1.00 91.49  ? 57   HIS G O   1 
ATOM   6504 C CB  . HIS G 2 1   ? -1.672  40.051  32.123  1.00 93.24  ? 57   HIS G CB  1 
ATOM   6505 C CG  . HIS G 2 1   ? -2.260  39.062  31.168  1.00 96.27  ? 57   HIS G CG  1 
ATOM   6506 N ND1 . HIS G 2 1   ? -1.691  37.827  30.929  1.00 98.28  ? 57   HIS G ND1 1 
ATOM   6507 C CD2 . HIS G 2 1   ? -3.361  39.129  30.380  1.00 97.68  ? 57   HIS G CD2 1 
ATOM   6508 C CE1 . HIS G 2 1   ? -2.424  37.173  30.045  1.00 98.56  ? 57   HIS G CE1 1 
ATOM   6509 N NE2 . HIS G 2 1   ? -3.442  37.941  29.693  1.00 99.06  ? 57   HIS G NE2 1 
ATOM   6510 N N   . MET G 2 2   ? -0.334  42.027  33.534  1.00 83.74  ? 58   MET G N   1 
ATOM   6511 C CA  . MET G 2 2   ? -0.009  42.851  34.671  1.00 82.86  ? 58   MET G CA  1 
ATOM   6512 C C   . MET G 2 2   ? 1.370   43.484  34.517  1.00 81.52  ? 58   MET G C   1 
ATOM   6513 O O   . MET G 2 2   ? 2.039   43.324  33.486  1.00 81.52  ? 58   MET G O   1 
ATOM   6514 C CB  . MET G 2 2   ? -0.096  42.019  35.958  1.00 86.75  ? 58   MET G CB  1 
ATOM   6515 C CG  . MET G 2 2   ? -0.253  42.840  37.249  1.00 88.69  ? 58   MET G CG  1 
ATOM   6516 S SD  . MET G 2 2   ? -1.778  43.863  37.291  1.00 93.16  ? 58   MET G SD  1 
ATOM   6517 C CE  . MET G 2 2   ? -2.982  42.792  36.272  1.00 91.86  ? 58   MET G CE  1 
ATOM   6518 N N   . ARG G 2 3   ? 1.771   44.220  35.552  1.00 71.73  ? 59   ARG G N   1 
ATOM   6519 C CA  . ARG G 2 3   ? 3.066   44.872  35.577  1.00 70.13  ? 59   ARG G CA  1 
ATOM   6520 C C   . ARG G 2 3   ? 3.940   44.389  36.733  1.00 68.46  ? 59   ARG G C   1 
ATOM   6521 O O   . ARG G 2 3   ? 4.983   44.959  37.010  1.00 67.51  ? 59   ARG G O   1 
ATOM   6522 C CB  . ARG G 2 3   ? 2.910   46.384  35.597  1.00 71.61  ? 59   ARG G CB  1 
ATOM   6523 C CG  . ARG G 2 3   ? 1.528   46.855  35.954  1.00 73.22  ? 59   ARG G CG  1 
ATOM   6524 C CD  . ARG G 2 3   ? 1.612   48.159  36.724  1.00 75.39  ? 59   ARG G CD  1 
ATOM   6525 N NE  . ARG G 2 3   ? 1.014   48.055  38.049  1.00 77.82  ? 59   ARG G NE  1 
ATOM   6526 C CZ  . ARG G 2 3   ? 1.240   48.915  39.041  1.00 79.29  ? 59   ARG G CZ  1 
ATOM   6527 N NH1 . ARG G 2 3   ? 2.068   49.947  38.860  1.00 80.07  ? 59   ARG G NH1 1 
ATOM   6528 N NH2 . ARG G 2 3   ? 0.631   48.747  40.218  1.00 78.18  ? 59   ARG G NH2 1 
ATOM   6529 N N   . LYS G 2 4   ? 3.520   43.314  37.388  1.00 60.89  ? 60   LYS G N   1 
ATOM   6530 C CA  . LYS G 2 4   ? 4.316   42.715  38.450  1.00 58.29  ? 60   LYS G CA  1 
ATOM   6531 C C   . LYS G 2 4   ? 5.018   41.513  37.861  1.00 56.16  ? 60   LYS G C   1 
ATOM   6532 O O   . LYS G 2 4   ? 4.438   40.764  37.075  1.00 56.11  ? 60   LYS G O   1 
ATOM   6533 C CB  . LYS G 2 4   ? 3.442   42.247  39.603  1.00 59.41  ? 60   LYS G CB  1 
ATOM   6534 C CG  . LYS G 2 4   ? 2.391   43.225  39.998  1.00 59.28  ? 60   LYS G CG  1 
ATOM   6535 C CD  . LYS G 2 4   ? 1.493   42.585  41.019  1.00 59.71  ? 60   LYS G CD  1 
ATOM   6536 C CE  . LYS G 2 4   ? 1.291   43.545  42.151  1.00 59.66  ? 60   LYS G CE  1 
ATOM   6537 N NZ  . LYS G 2 4   ? 1.867   44.865  41.754  1.00 60.12  ? 60   LYS G NZ  1 
ATOM   6538 N N   . ILE G 2 5   ? 6.281   41.362  38.221  1.00 51.36  ? 61   ILE G N   1 
ATOM   6539 C CA  . ILE G 2 5   ? 7.102   40.270  37.728  1.00 48.78  ? 61   ILE G CA  1 
ATOM   6540 C C   . ILE G 2 5   ? 7.738   39.708  38.963  1.00 47.68  ? 61   ILE G C   1 
ATOM   6541 O O   . ILE G 2 5   ? 7.903   40.426  39.964  1.00 47.23  ? 61   ILE G O   1 
ATOM   6542 C CB  . ILE G 2 5   ? 8.224   40.784  36.798  1.00 50.68  ? 61   ILE G CB  1 
ATOM   6543 C CG1 . ILE G 2 5   ? 8.996   41.925  37.480  1.00 49.87  ? 61   ILE G CG1 1 
ATOM   6544 C CG2 . ILE G 2 5   ? 7.682   41.112  35.420  1.00 49.35  ? 61   ILE G CG2 1 
ATOM   6545 C CD1 . ILE G 2 5   ? 10.467  41.895  37.255  1.00 48.60  ? 61   ILE G CD1 1 
ATOM   6546 N N   . LEU G 2 6   ? 8.129   38.439  38.881  1.00 45.20  ? 62   LEU G N   1 
ATOM   6547 C CA  . LEU G 2 6   ? 8.830   37.814  39.988  1.00 44.61  ? 62   LEU G CA  1 
ATOM   6548 C C   . LEU G 2 6   ? 10.125  37.235  39.478  1.00 44.07  ? 62   LEU G C   1 
ATOM   6549 O O   . LEU G 2 6   ? 10.134  36.553  38.449  1.00 43.36  ? 62   LEU G O   1 
ATOM   6550 C CB  . LEU G 2 6   ? 7.979   36.755  40.672  1.00 43.23  ? 62   LEU G CB  1 
ATOM   6551 C CG  . LEU G 2 6   ? 8.768   35.550  41.167  1.00 44.80  ? 62   LEU G CG  1 
ATOM   6552 C CD1 . LEU G 2 6   ? 9.230   35.687  42.639  1.00 45.95  ? 62   LEU G CD1 1 
ATOM   6553 C CD2 . LEU G 2 6   ? 7.883   34.328  40.991  1.00 47.40  ? 62   LEU G CD2 1 
ATOM   6554 N N   . ILE G 2 7   ? 11.220  37.578  40.170  1.00 44.05  ? 63   ILE G N   1 
ATOM   6555 C CA  . ILE G 2 7   ? 12.571  37.104  39.817  1.00 43.76  ? 63   ILE G CA  1 
ATOM   6556 C C   . ILE G 2 7   ? 13.036  35.910  40.658  1.00 44.21  ? 63   ILE G C   1 
ATOM   6557 O O   . ILE G 2 7   ? 12.951  35.939  41.882  1.00 45.19  ? 63   ILE G O   1 
ATOM   6558 C CB  . ILE G 2 7   ? 13.615  38.219  39.915  1.00 46.16  ? 63   ILE G CB  1 
ATOM   6559 C CG1 . ILE G 2 7   ? 13.366  39.289  38.847  1.00 45.10  ? 63   ILE G CG1 1 
ATOM   6560 C CG2 . ILE G 2 7   ? 15.028  37.610  39.834  1.00 44.99  ? 63   ILE G CG2 1 
ATOM   6561 C CD1 . ILE G 2 7   ? 14.009  40.638  39.164  1.00 42.03  ? 63   ILE G CD1 1 
ATOM   6562 N N   . ARG G 2 8   ? 13.580  34.891  40.005  1.00 43.58  ? 64   ARG G N   1 
ATOM   6563 C CA  . ARG G 2 8   ? 14.075  33.722  40.710  1.00 43.49  ? 64   ARG G CA  1 
ATOM   6564 C C   . ARG G 2 8   ? 15.522  33.487  40.359  1.00 42.56  ? 64   ARG G C   1 
ATOM   6565 O O   . ARG G 2 8   ? 15.951  33.822  39.272  1.00 42.24  ? 64   ARG G O   1 
ATOM   6566 C CB  . ARG G 2 8   ? 13.256  32.486  40.340  1.00 52.34  ? 64   ARG G CB  1 
ATOM   6567 C CG  . ARG G 2 8   ? 11.824  32.486  40.901  1.00 55.50  ? 64   ARG G CG  1 
ATOM   6568 C CD  . ARG G 2 8   ? 11.452  31.123  41.528  1.00 58.23  ? 64   ARG G CD  1 
ATOM   6569 N NE  . ARG G 2 8   ? 10.003  30.843  41.504  1.00 60.04  ? 64   ARG G NE  1 
ATOM   6570 C CZ  . ARG G 2 8   ? 9.373   30.153  40.541  1.00 61.45  ? 64   ARG G CZ  1 
ATOM   6571 N NH1 . ARG G 2 8   ? 10.053  29.675  39.479  1.00 62.69  ? 64   ARG G NH1 1 
ATOM   6572 N NH2 . ARG G 2 8   ? 8.055   29.942  40.625  1.00 60.07  ? 64   ARG G NH2 1 
ATOM   6573 N N   . GLY G 2 9   ? 16.280  32.948  41.306  1.00 44.44  ? 65   GLY G N   1 
ATOM   6574 C CA  . GLY G 2 9   ? 17.682  32.636  41.078  1.00 43.79  ? 65   GLY G CA  1 
ATOM   6575 C C   . GLY G 2 9   ? 18.744  33.661  41.451  1.00 43.74  ? 65   GLY G C   1 
ATOM   6576 O O   . GLY G 2 9   ? 19.922  33.513  41.082  1.00 43.68  ? 65   GLY G O   1 
ATOM   6577 N N   . LEU G 2 10  ? 18.339  34.690  42.190  1.00 44.06  ? 66   LEU G N   1 
ATOM   6578 C CA  . LEU G 2 10  ? 19.273  35.718  42.643  1.00 44.13  ? 66   LEU G CA  1 
ATOM   6579 C C   . LEU G 2 10  ? 20.323  35.160  43.629  1.00 44.62  ? 66   LEU G C   1 
ATOM   6580 O O   . LEU G 2 10  ? 20.088  34.156  44.331  1.00 44.59  ? 66   LEU G O   1 
ATOM   6581 C CB  . LEU G 2 10  ? 18.506  36.879  43.292  1.00 43.91  ? 66   LEU G CB  1 
ATOM   6582 C CG  . LEU G 2 10  ? 17.497  37.632  42.403  1.00 43.09  ? 66   LEU G CG  1 
ATOM   6583 C CD1 . LEU G 2 10  ? 16.319  38.107  43.223  1.00 41.41  ? 66   LEU G CD1 1 
ATOM   6584 C CD2 . LEU G 2 10  ? 18.166  38.797  41.676  1.00 40.56  ? 66   LEU G CD2 1 
ATOM   6585 N N   . PRO G 2 11  ? 21.496  35.803  43.686  1.00 45.51  ? 67   PRO G N   1 
ATOM   6586 C CA  . PRO G 2 11  ? 22.570  35.421  44.598  1.00 46.10  ? 67   PRO G CA  1 
ATOM   6587 C C   . PRO G 2 11  ? 22.102  35.403  46.080  1.00 47.02  ? 67   PRO G C   1 
ATOM   6588 O O   . PRO G 2 11  ? 21.093  36.048  46.442  1.00 47.77  ? 67   PRO G O   1 
ATOM   6589 C CB  . PRO G 2 11  ? 23.600  36.522  44.363  1.00 47.45  ? 67   PRO G CB  1 
ATOM   6590 C CG  . PRO G 2 11  ? 23.447  36.854  42.915  1.00 47.18  ? 67   PRO G CG  1 
ATOM   6591 C CD  . PRO G 2 11  ? 21.982  36.665  42.596  1.00 47.23  ? 67   PRO G CD  1 
ATOM   6592 N N   . GLY G 2 12  ? 22.781  34.629  46.930  1.00 47.11  ? 68   GLY G N   1 
ATOM   6593 C CA  . GLY G 2 12  ? 22.394  34.568  48.333  1.00 47.18  ? 68   GLY G CA  1 
ATOM   6594 C C   . GLY G 2 12  ? 22.622  35.912  49.013  1.00 47.19  ? 68   GLY G C   1 
ATOM   6595 O O   . GLY G 2 12  ? 21.796  36.398  49.800  1.00 46.32  ? 68   GLY G O   1 
ATOM   6596 N N   . ASP G 2 13  ? 23.766  36.509  48.680  1.00 51.27  ? 69   ASP G N   1 
ATOM   6597 C CA  . ASP G 2 13  ? 24.195  37.801  49.215  1.00 52.61  ? 69   ASP G CA  1 
ATOM   6598 C C   . ASP G 2 13  ? 23.724  38.967  48.317  1.00 53.49  ? 69   ASP G C   1 
ATOM   6599 O O   . ASP G 2 13  ? 24.405  40.005  48.243  1.00 54.06  ? 69   ASP G O   1 
ATOM   6600 C CB  . ASP G 2 13  ? 25.734  37.836  49.374  1.00 55.73  ? 69   ASP G CB  1 
ATOM   6601 C CG  . ASP G 2 13  ? 26.474  37.644  48.037  1.00 56.94  ? 69   ASP G CG  1 
ATOM   6602 O OD1 . ASP G 2 13  ? 25.814  37.225  47.057  1.00 56.41  ? 69   ASP G OD1 1 
ATOM   6603 O OD2 . ASP G 2 13  ? 27.693  37.936  47.946  1.00 58.60  ? 69   ASP G OD2 1 
ATOM   6604 N N   . VAL G 2 14  ? 22.588  38.787  47.624  1.00 49.12  ? 70   VAL G N   1 
ATOM   6605 C CA  . VAL G 2 14  ? 22.007  39.833  46.774  1.00 48.75  ? 70   VAL G CA  1 
ATOM   6606 C C   . VAL G 2 14  ? 21.491  40.970  47.679  1.00 49.51  ? 70   VAL G C   1 
ATOM   6607 O O   . VAL G 2 14  ? 21.035  40.705  48.799  1.00 49.29  ? 70   VAL G O   1 
ATOM   6608 C CB  . VAL G 2 14  ? 20.845  39.275  45.908  1.00 49.44  ? 70   VAL G CB  1 
ATOM   6609 C CG1 . VAL G 2 14  ? 19.619  39.039  46.756  1.00 47.92  ? 70   VAL G CG1 1 
ATOM   6610 C CG2 . VAL G 2 14  ? 20.498  40.228  44.748  1.00 48.87  ? 70   VAL G CG2 1 
ATOM   6611 N N   . THR G 2 15  ? 21.606  42.224  47.208  1.00 49.74  ? 71   THR G N   1 
ATOM   6612 C CA  . THR G 2 15  ? 21.075  43.393  47.922  1.00 50.73  ? 71   THR G CA  1 
ATOM   6613 C C   . THR G 2 15  ? 19.942  44.032  47.114  1.00 51.45  ? 71   THR G C   1 
ATOM   6614 O O   . THR G 2 15  ? 19.778  43.792  45.920  1.00 52.16  ? 71   THR G O   1 
ATOM   6615 C CB  . THR G 2 15  ? 22.150  44.452  48.330  1.00 52.86  ? 71   THR G CB  1 
ATOM   6616 O OG1 . THR G 2 15  ? 22.569  45.214  47.186  1.00 53.66  ? 71   THR G OG1 1 
ATOM   6617 C CG2 . THR G 2 15  ? 23.342  43.799  48.994  1.00 51.61  ? 71   THR G CG2 1 
ATOM   6618 N N   . ASN G 2 16  ? 19.147  44.862  47.758  1.00 52.57  ? 72   ASN G N   1 
ATOM   6619 C CA  . ASN G 2 16  ? 18.073  45.514  47.037  1.00 53.13  ? 72   ASN G CA  1 
ATOM   6620 C C   . ASN G 2 16  ? 18.648  46.363  45.933  1.00 52.96  ? 72   ASN G C   1 
ATOM   6621 O O   . ASN G 2 16  ? 18.207  46.264  44.790  1.00 52.68  ? 72   ASN G O   1 
ATOM   6622 C CB  . ASN G 2 16  ? 17.231  46.320  48.004  1.00 57.07  ? 72   ASN G CB  1 
ATOM   6623 C CG  . ASN G 2 16  ? 16.753  45.467  49.162  1.00 57.66  ? 72   ASN G CG  1 
ATOM   6624 O OD1 . ASN G 2 16  ? 15.680  44.816  49.070  1.00 59.10  ? 72   ASN G OD1 1 
ATOM   6625 N ND2 . ASN G 2 16  ? 17.635  45.293  50.174  1.00 58.53  ? 72   ASN G ND2 1 
ATOM   6626 N N   . GLN G 2 17  ? 19.707  47.102  46.278  1.00 54.05  ? 73   GLN G N   1 
ATOM   6627 C CA  . GLN G 2 17  ? 20.433  47.931  45.336  1.00 53.83  ? 73   GLN G CA  1 
ATOM   6628 C C   . GLN G 2 17  ? 20.687  47.141  44.069  1.00 53.51  ? 73   GLN G C   1 
ATOM   6629 O O   . GLN G 2 17  ? 20.329  47.571  42.994  1.00 52.94  ? 73   GLN G O   1 
ATOM   6630 C CB  . GLN G 2 17  ? 21.775  48.389  45.927  1.00 57.83  ? 73   GLN G CB  1 
ATOM   6631 C CG  . GLN G 2 17  ? 22.299  49.729  45.349  1.00 59.02  ? 73   GLN G CG  1 
ATOM   6632 C CD  . GLN G 2 17  ? 21.170  50.724  44.981  1.00 59.75  ? 73   GLN G CD  1 
ATOM   6633 O OE1 . GLN G 2 17  ? 21.090  51.212  43.837  1.00 61.16  ? 73   GLN G OE1 1 
ATOM   6634 N NE2 . GLN G 2 17  ? 20.251  50.955  45.924  1.00 57.50  ? 73   GLN G NE2 1 
ATOM   6635 N N   . GLU G 2 18  ? 21.283  45.963  44.203  1.00 53.13  ? 74   GLU G N   1 
ATOM   6636 C CA  . GLU G 2 18  ? 21.577  45.142  43.038  1.00 53.49  ? 74   GLU G CA  1 
ATOM   6637 C C   . GLU G 2 18  ? 20.353  44.850  42.153  1.00 53.09  ? 74   GLU G C   1 
ATOM   6638 O O   . GLU G 2 18  ? 20.490  44.630  40.959  1.00 52.88  ? 74   GLU G O   1 
ATOM   6639 C CB  . GLU G 2 18  ? 22.312  43.852  43.421  1.00 57.17  ? 74   GLU G CB  1 
ATOM   6640 C CG  . GLU G 2 18  ? 23.448  43.990  44.438  1.00 58.96  ? 74   GLU G CG  1 
ATOM   6641 C CD  . GLU G 2 18  ? 24.341  42.725  44.489  1.00 62.70  ? 74   GLU G CD  1 
ATOM   6642 O OE1 . GLU G 2 18  ? 24.282  41.925  43.503  1.00 60.90  ? 74   GLU G OE1 1 
ATOM   6643 O OE2 . GLU G 2 18  ? 25.114  42.552  45.489  1.00 64.36  ? 74   GLU G OE2 1 
ATOM   6644 N N   . VAL G 2 19  ? 19.160  44.844  42.732  1.00 46.88  ? 75   VAL G N   1 
ATOM   6645 C CA  . VAL G 2 19  ? 17.969  44.596  41.927  1.00 46.45  ? 75   VAL G CA  1 
ATOM   6646 C C   . VAL G 2 19  ? 17.578  45.850  41.174  1.00 46.68  ? 75   VAL G C   1 
ATOM   6647 O O   . VAL G 2 19  ? 17.153  45.796  40.007  1.00 46.60  ? 75   VAL G O   1 
ATOM   6648 C CB  . VAL G 2 19  ? 16.798  44.122  42.753  1.00 46.47  ? 75   VAL G CB  1 
ATOM   6649 C CG1 . VAL G 2 19  ? 15.577  44.111  41.897  1.00 45.41  ? 75   VAL G CG1 1 
ATOM   6650 C CG2 . VAL G 2 19  ? 17.066  42.744  43.299  1.00 46.38  ? 75   VAL G CG2 1 
ATOM   6651 N N   . HIS G 2 20  ? 17.690  46.975  41.875  1.00 52.34  ? 76   HIS G N   1 
ATOM   6652 C CA  . HIS G 2 20  ? 17.397  48.291  41.312  1.00 52.35  ? 76   HIS G CA  1 
ATOM   6653 C C   . HIS G 2 20  ? 18.392  48.630  40.199  1.00 52.32  ? 76   HIS G C   1 
ATOM   6654 O O   . HIS G 2 20  ? 18.035  49.306  39.255  1.00 52.24  ? 76   HIS G O   1 
ATOM   6655 C CB  . HIS G 2 20  ? 17.421  49.390  42.399  1.00 54.07  ? 76   HIS G CB  1 
ATOM   6656 C CG  . HIS G 2 20  ? 16.437  49.175  43.512  1.00 55.00  ? 76   HIS G CG  1 
ATOM   6657 N ND1 . HIS G 2 20  ? 15.424  50.066  43.796  1.00 55.14  ? 76   HIS G ND1 1 
ATOM   6658 C CD2 . HIS G 2 20  ? 16.314  48.169  44.418  1.00 56.86  ? 76   HIS G CD2 1 
ATOM   6659 C CE1 . HIS G 2 20  ? 14.727  49.624  44.833  1.00 55.92  ? 76   HIS G CE1 1 
ATOM   6660 N NE2 . HIS G 2 20  ? 15.247  48.477  45.232  1.00 55.70  ? 76   HIS G NE2 1 
ATOM   6661 N N   . ASP G 2 21  ? 19.634  48.164  40.332  1.00 55.61  ? 77   ASP G N   1 
ATOM   6662 C CA  . ASP G 2 21  ? 20.708  48.392  39.354  1.00 56.08  ? 77   ASP G CA  1 
ATOM   6663 C C   . ASP G 2 21  ? 20.493  47.487  38.147  1.00 55.87  ? 77   ASP G C   1 
ATOM   6664 O O   . ASP G 2 21  ? 20.831  47.827  37.027  1.00 56.41  ? 77   ASP G O   1 
ATOM   6665 C CB  . ASP G 2 21  ? 22.070  48.018  39.965  1.00 60.17  ? 77   ASP G CB  1 
ATOM   6666 C CG  . ASP G 2 21  ? 22.661  49.120  40.889  1.00 62.44  ? 77   ASP G CG  1 
ATOM   6667 O OD1 . ASP G 2 21  ? 22.277  50.320  40.767  1.00 64.16  ? 77   ASP G OD1 1 
ATOM   6668 O OD2 . ASP G 2 21  ? 23.549  48.768  41.715  1.00 62.43  ? 77   ASP G OD2 1 
ATOM   6669 N N   . LEU G 2 22  ? 19.979  46.297  38.410  1.00 56.70  ? 78   LEU G N   1 
ATOM   6670 C CA  . LEU G 2 22  ? 19.660  45.329  37.379  1.00 55.87  ? 78   LEU G CA  1 
ATOM   6671 C C   . LEU G 2 22  ? 18.644  45.982  36.460  1.00 55.66  ? 78   LEU G C   1 
ATOM   6672 O O   . LEU G 2 22  ? 18.890  46.147  35.270  1.00 56.07  ? 78   LEU G O   1 
ATOM   6673 C CB  . LEU G 2 22  ? 19.010  44.097  38.027  1.00 55.66  ? 78   LEU G CB  1 
ATOM   6674 C CG  . LEU G 2 22  ? 18.553  42.974  37.090  1.00 55.31  ? 78   LEU G CG  1 
ATOM   6675 C CD1 . LEU G 2 22  ? 19.693  42.437  36.263  1.00 54.84  ? 78   LEU G CD1 1 
ATOM   6676 C CD2 . LEU G 2 22  ? 17.891  41.848  37.845  1.00 54.44  ? 78   LEU G CD2 1 
ATOM   6677 N N   . LEU G 2 23  ? 17.510  46.368  37.042  1.00 55.16  ? 79   LEU G N   1 
ATOM   6678 C CA  . LEU G 2 23  ? 16.422  46.996  36.318  1.00 54.69  ? 79   LEU G CA  1 
ATOM   6679 C C   . LEU G 2 23  ? 16.516  48.513  36.411  1.00 54.80  ? 79   LEU G C   1 
ATOM   6680 O O   . LEU G 2 23  ? 15.536  49.208  36.724  1.00 54.33  ? 79   LEU G O   1 
ATOM   6681 C CB  . LEU G 2 23  ? 15.103  46.511  36.907  1.00 54.96  ? 79   LEU G CB  1 
ATOM   6682 C CG  . LEU G 2 23  ? 15.242  45.158  37.606  1.00 54.79  ? 79   LEU G CG  1 
ATOM   6683 C CD1 . LEU G 2 23  ? 14.351  45.015  38.834  1.00 54.40  ? 79   LEU G CD1 1 
ATOM   6684 C CD2 . LEU G 2 23  ? 14.978  44.066  36.608  1.00 51.20  ? 79   LEU G CD2 1 
ATOM   6685 N N   . SER G 2 24  ? 17.713  49.026  36.150  1.00 57.07  ? 80   SER G N   1 
ATOM   6686 C CA  . SER G 2 24  ? 17.954  50.465  36.201  1.00 58.13  ? 80   SER G CA  1 
ATOM   6687 C C   . SER G 2 24  ? 17.268  51.171  35.051  1.00 58.76  ? 80   SER G C   1 
ATOM   6688 O O   . SER G 2 24  ? 17.169  52.396  35.055  1.00 59.31  ? 80   SER G O   1 
ATOM   6689 C CB  . SER G 2 24  ? 19.454  50.789  36.186  1.00 60.24  ? 80   SER G CB  1 
ATOM   6690 O OG  . SER G 2 24  ? 20.143  50.128  35.131  1.00 61.04  ? 80   SER G OG  1 
ATOM   6691 N N   . ASP G 2 25  ? 16.798  50.394  34.075  1.00 58.41  ? 81   ASP G N   1 
ATOM   6692 C CA  . ASP G 2 25  ? 16.132  50.945  32.914  1.00 59.21  ? 81   ASP G CA  1 
ATOM   6693 C C   . ASP G 2 25  ? 14.628  51.047  33.053  1.00 58.98  ? 81   ASP G C   1 
ATOM   6694 O O   . ASP G 2 25  ? 13.934  51.394  32.099  1.00 59.36  ? 81   ASP G O   1 
ATOM   6695 C CB  . ASP G 2 25  ? 16.465  50.135  31.681  1.00 60.74  ? 81   ASP G CB  1 
ATOM   6696 C CG  . ASP G 2 25  ? 17.316  50.913  30.710  1.00 65.09  ? 81   ASP G CG  1 
ATOM   6697 O OD1 . ASP G 2 25  ? 18.286  50.325  30.173  1.00 69.08  ? 81   ASP G OD1 1 
ATOM   6698 O OD2 . ASP G 2 25  ? 17.059  52.137  30.541  1.00 68.11  ? 81   ASP G OD2 1 
ATOM   6699 N N   . TYR G 2 26  ? 14.122  50.733  34.237  1.00 59.06  ? 82   TYR G N   1 
ATOM   6700 C CA  . TYR G 2 26  ? 12.689  50.750  34.460  1.00 58.33  ? 82   TYR G CA  1 
ATOM   6701 C C   . TYR G 2 26  ? 12.332  51.450  35.762  1.00 57.81  ? 82   TYR G C   1 
ATOM   6702 O O   . TYR G 2 26  ? 13.180  51.672  36.609  1.00 57.98  ? 82   TYR G O   1 
ATOM   6703 C CB  . TYR G 2 26  ? 12.121  49.318  34.450  1.00 59.89  ? 82   TYR G CB  1 
ATOM   6704 C CG  . TYR G 2 26  ? 12.543  48.499  33.253  1.00 59.77  ? 82   TYR G CG  1 
ATOM   6705 C CD1 . TYR G 2 26  ? 11.782  48.485  32.081  1.00 58.71  ? 82   TYR G CD1 1 
ATOM   6706 C CD2 . TYR G 2 26  ? 13.729  47.800  33.266  1.00 59.85  ? 82   TYR G CD2 1 
ATOM   6707 C CE1 . TYR G 2 26  ? 12.196  47.806  30.971  1.00 56.56  ? 82   TYR G CE1 1 
ATOM   6708 C CE2 . TYR G 2 26  ? 14.159  47.139  32.150  1.00 60.17  ? 82   TYR G CE2 1 
ATOM   6709 C CZ  . TYR G 2 26  ? 13.385  47.147  31.010  1.00 58.11  ? 82   TYR G CZ  1 
ATOM   6710 O OH  . TYR G 2 26  ? 13.826  46.468  29.916  1.00 59.65  ? 82   TYR G OH  1 
ATOM   6711 N N   . GLU G 2 27  ? 11.053  51.762  35.909  1.00 58.23  ? 83   GLU G N   1 
ATOM   6712 C CA  . GLU G 2 27  ? 10.539  52.453  37.078  1.00 58.47  ? 83   GLU G CA  1 
ATOM   6713 C C   . GLU G 2 27  ? 9.933   51.429  38.000  1.00 57.90  ? 83   GLU G C   1 
ATOM   6714 O O   . GLU G 2 27  ? 8.867   50.876  37.751  1.00 57.91  ? 83   GLU G O   1 
ATOM   6715 C CB  . GLU G 2 27  ? 9.468   53.482  36.678  1.00 60.42  ? 83   GLU G CB  1 
ATOM   6716 C CG  . GLU G 2 27  ? 9.178   54.572  37.718  1.00 62.38  ? 83   GLU G CG  1 
ATOM   6717 C CD  . GLU G 2 27  ? 7.931   55.383  37.360  1.00 66.90  ? 83   GLU G CD  1 
ATOM   6718 O OE1 . GLU G 2 27  ? 7.691   56.448  37.998  1.00 67.13  ? 83   GLU G OE1 1 
ATOM   6719 O OE2 . GLU G 2 27  ? 7.206   54.948  36.420  1.00 69.26  ? 83   GLU G OE2 1 
ATOM   6720 N N   . LEU G 2 28  ? 10.622  51.188  39.091  1.00 57.81  ? 84   LEU G N   1 
ATOM   6721 C CA  . LEU G 2 28  ? 10.130  50.248  40.052  1.00 56.64  ? 84   LEU G CA  1 
ATOM   6722 C C   . LEU G 2 28  ? 9.141   50.958  40.922  1.00 56.45  ? 84   LEU G C   1 
ATOM   6723 O O   . LEU G 2 28  ? 9.469   51.930  41.580  1.00 56.34  ? 84   LEU G O   1 
ATOM   6724 C CB  . LEU G 2 28  ? 11.278  49.747  40.921  1.00 58.06  ? 84   LEU G CB  1 
ATOM   6725 C CG  . LEU G 2 28  ? 12.506  49.171  40.213  1.00 56.55  ? 84   LEU G CG  1 
ATOM   6726 C CD1 . LEU G 2 28  ? 13.207  48.240  41.168  1.00 55.14  ? 84   LEU G CD1 1 
ATOM   6727 C CD2 . LEU G 2 28  ? 12.097  48.433  38.939  1.00 55.37  ? 84   LEU G CD2 1 
ATOM   6728 N N   . LYS G 2 29  ? 7.922   50.462  40.940  1.00 55.82  ? 85   LYS G N   1 
ATOM   6729 C CA  . LYS G 2 29  ? 6.920   51.013  41.807  1.00 55.99  ? 85   LYS G CA  1 
ATOM   6730 C C   . LYS G 2 29  ? 6.958   50.197  43.110  1.00 57.00  ? 85   LYS G C   1 
ATOM   6731 O O   . LYS G 2 29  ? 6.569   50.659  44.177  1.00 57.26  ? 85   LYS G O   1 
ATOM   6732 C CB  . LYS G 2 29  ? 5.575   50.938  41.106  1.00 61.58  ? 85   LYS G CB  1 
ATOM   6733 C CG  . LYS G 2 29  ? 5.542   51.740  39.826  1.00 60.13  ? 85   LYS G CG  1 
ATOM   6734 C CD  . LYS G 2 29  ? 4.946   53.124  40.087  1.00 57.27  ? 85   LYS G CD  1 
ATOM   6735 C CE  . LYS G 2 29  ? 5.535   54.225  39.226  1.00 54.87  ? 85   LYS G CE  1 
ATOM   6736 N NZ  . LYS G 2 29  ? 5.064   55.571  39.656  1.00 52.32  ? 85   LYS G NZ  1 
ATOM   6737 N N   . TYR G 2 30  ? 7.484   48.985  43.024  1.00 56.77  ? 86   TYR G N   1 
ATOM   6738 C CA  . TYR G 2 30  ? 7.593   48.113  44.183  1.00 57.71  ? 86   TYR G CA  1 
ATOM   6739 C C   . TYR G 2 30  ? 8.758   47.155  44.028  1.00 57.84  ? 86   TYR G C   1 
ATOM   6740 O O   . TYR G 2 30  ? 9.009   46.604  42.952  1.00 58.28  ? 86   TYR G O   1 
ATOM   6741 C CB  . TYR G 2 30  ? 6.317   47.301  44.379  1.00 60.50  ? 86   TYR G CB  1 
ATOM   6742 C CG  . TYR G 2 30  ? 6.327   46.500  45.654  1.00 61.83  ? 86   TYR G CG  1 
ATOM   6743 C CD1 . TYR G 2 30  ? 6.381   47.142  46.879  1.00 64.16  ? 86   TYR G CD1 1 
ATOM   6744 C CD2 . TYR G 2 30  ? 6.307   45.099  45.640  1.00 63.91  ? 86   TYR G CD2 1 
ATOM   6745 C CE1 . TYR G 2 30  ? 6.389   46.435  48.068  1.00 64.73  ? 86   TYR G CE1 1 
ATOM   6746 C CE2 . TYR G 2 30  ? 6.308   44.373  46.843  1.00 64.65  ? 86   TYR G CE2 1 
ATOM   6747 C CZ  . TYR G 2 30  ? 6.342   45.066  48.056  1.00 64.71  ? 86   TYR G CZ  1 
ATOM   6748 O OH  . TYR G 2 30  ? 6.346   44.420  49.273  1.00 65.19  ? 86   TYR G OH  1 
ATOM   6749 N N   . CYS G 2 31  ? 9.456   46.935  45.128  1.00 54.53  ? 87   CYS G N   1 
ATOM   6750 C CA  . CYS G 2 31  ? 10.582  46.024  45.135  1.00 54.21  ? 87   CYS G CA  1 
ATOM   6751 C C   . CYS G 2 31  ? 10.757  45.360  46.467  1.00 53.83  ? 87   CYS G C   1 
ATOM   6752 O O   . CYS G 2 31  ? 11.076  46.007  47.452  1.00 53.45  ? 87   CYS G O   1 
ATOM   6753 C CB  . CYS G 2 31  ? 11.882  46.722  44.759  1.00 54.51  ? 87   CYS G CB  1 
ATOM   6754 S SG  . CYS G 2 31  ? 13.118  45.500  44.222  1.00 56.48  ? 87   CYS G SG  1 
ATOM   6755 N N   . PHE G 2 32  ? 10.550  44.051  46.483  1.00 54.38  ? 88   PHE G N   1 
ATOM   6756 C CA  . PHE G 2 32  ? 10.743  43.275  47.689  1.00 54.61  ? 88   PHE G CA  1 
ATOM   6757 C C   . PHE G 2 32  ? 11.629  42.070  47.411  1.00 54.54  ? 88   PHE G C   1 
ATOM   6758 O O   . PHE G 2 32  ? 11.260  41.177  46.664  1.00 54.80  ? 88   PHE G O   1 
ATOM   6759 C CB  . PHE G 2 32  ? 9.430   42.840  48.335  1.00 57.67  ? 88   PHE G CB  1 
ATOM   6760 C CG  . PHE G 2 32  ? 9.644   41.978  49.536  1.00 57.95  ? 88   PHE G CG  1 
ATOM   6761 C CD1 . PHE G 2 32  ? 9.486   40.587  49.444  1.00 58.84  ? 88   PHE G CD1 1 
ATOM   6762 C CD2 . PHE G 2 32  ? 10.208  42.519  50.699  1.00 59.28  ? 88   PHE G CD2 1 
ATOM   6763 C CE1 . PHE G 2 32  ? 9.788   39.759  50.534  1.00 60.57  ? 88   PHE G CE1 1 
ATOM   6764 C CE2 . PHE G 2 32  ? 10.508  41.700  51.801  1.00 61.14  ? 88   PHE G CE2 1 
ATOM   6765 C CZ  . PHE G 2 32  ? 10.288  40.322  51.716  1.00 61.61  ? 88   PHE G CZ  1 
ATOM   6766 N N   . VAL G 2 33  ? 12.804  42.062  48.026  1.00 53.98  ? 89   VAL G N   1 
ATOM   6767 C CA  . VAL G 2 33  ? 13.782  41.010  47.831  1.00 53.91  ? 89   VAL G CA  1 
ATOM   6768 C C   . VAL G 2 33  ? 13.779  40.034  48.995  1.00 54.44  ? 89   VAL G C   1 
ATOM   6769 O O   . VAL G 2 33  ? 13.865  40.426  50.156  1.00 54.68  ? 89   VAL G O   1 
ATOM   6770 C CB  . VAL G 2 33  ? 15.171  41.624  47.650  1.00 56.55  ? 89   VAL G CB  1 
ATOM   6771 C CG1 . VAL G 2 33  ? 16.238  40.624  48.013  1.00 56.08  ? 89   VAL G CG1 1 
ATOM   6772 C CG2 . VAL G 2 33  ? 15.360  42.160  46.239  1.00 55.56  ? 89   VAL G CG2 1 
ATOM   6773 N N   . ASP G 2 34  ? 13.686  38.751  48.685  1.00 56.47  ? 90   ASP G N   1 
ATOM   6774 C CA  . ASP G 2 34  ? 13.698  37.739  49.724  1.00 57.08  ? 90   ASP G CA  1 
ATOM   6775 C C   . ASP G 2 34  ? 15.095  37.154  49.752  1.00 57.26  ? 90   ASP G C   1 
ATOM   6776 O O   . ASP G 2 34  ? 15.452  36.346  48.901  1.00 57.35  ? 90   ASP G O   1 
ATOM   6777 C CB  . ASP G 2 34  ? 12.667  36.644  49.432  1.00 60.44  ? 90   ASP G CB  1 
ATOM   6778 C CG  . ASP G 2 34  ? 12.434  35.724  50.635  1.00 62.87  ? 90   ASP G CG  1 
ATOM   6779 O OD1 . ASP G 2 34  ? 11.488  34.891  50.606  1.00 64.18  ? 90   ASP G OD1 1 
ATOM   6780 O OD2 . ASP G 2 34  ? 13.180  35.867  51.636  1.00 66.50  ? 90   ASP G OD2 1 
ATOM   6781 N N   . LYS G 2 35  ? 15.911  37.587  50.707  1.00 58.90  ? 91   LYS G N   1 
ATOM   6782 C CA  . LYS G 2 35  ? 17.279  37.090  50.764  1.00 58.82  ? 91   LYS G CA  1 
ATOM   6783 C C   . LYS G 2 35  ? 17.362  35.611  51.113  1.00 58.61  ? 91   LYS G C   1 
ATOM   6784 O O   . LYS G 2 35  ? 18.251  34.904  50.650  1.00 58.58  ? 91   LYS G O   1 
ATOM   6785 C CB  . LYS G 2 35  ? 18.165  37.951  51.657  1.00 62.85  ? 91   LYS G CB  1 
ATOM   6786 C CG  . LYS G 2 35  ? 17.885  39.429  51.523  1.00 64.34  ? 91   LYS G CG  1 
ATOM   6787 C CD  . LYS G 2 35  ? 19.134  40.239  51.190  1.00 64.99  ? 91   LYS G CD  1 
ATOM   6788 C CE  . LYS G 2 35  ? 18.834  41.757  51.231  1.00 67.27  ? 91   LYS G CE  1 
ATOM   6789 N NZ  . LYS G 2 35  ? 19.833  42.544  52.049  1.00 68.38  ? 91   LYS G NZ  1 
ATOM   6790 N N   . TYR G 2 36  ? 16.400  35.120  51.879  1.00 58.40  ? 92   TYR G N   1 
ATOM   6791 C CA  . TYR G 2 36  ? 16.403  33.707  52.202  1.00 58.03  ? 92   TYR G CA  1 
ATOM   6792 C C   . TYR G 2 36  ? 16.009  32.794  51.034  1.00 56.45  ? 92   TYR G C   1 
ATOM   6793 O O   . TYR G 2 36  ? 16.354  31.615  51.034  1.00 55.56  ? 92   TYR G O   1 
ATOM   6794 C CB  . TYR G 2 36  ? 15.592  33.392  53.455  1.00 61.36  ? 92   TYR G CB  1 
ATOM   6795 C CG  . TYR G 2 36  ? 15.317  31.900  53.575  1.00 64.73  ? 92   TYR G CG  1 
ATOM   6796 C CD1 . TYR G 2 36  ? 16.243  31.041  54.171  1.00 67.74  ? 92   TYR G CD1 1 
ATOM   6797 C CD2 . TYR G 2 36  ? 14.207  31.324  52.956  1.00 65.72  ? 92   TYR G CD2 1 
ATOM   6798 C CE1 . TYR G 2 36  ? 16.020  29.657  54.228  1.00 69.05  ? 92   TYR G CE1 1 
ATOM   6799 C CE2 . TYR G 2 36  ? 13.970  29.955  53.028  1.00 66.61  ? 92   TYR G CE2 1 
ATOM   6800 C CZ  . TYR G 2 36  ? 14.873  29.131  53.674  1.00 69.29  ? 92   TYR G CZ  1 
ATOM   6801 O OH  . TYR G 2 36  ? 14.636  27.772  53.753  1.00 72.11  ? 92   TYR G OH  1 
ATOM   6802 N N   . LYS G 2 37  ? 15.309  33.328  50.036  1.00 53.01  ? 93   LYS G N   1 
ATOM   6803 C CA  . LYS G 2 37  ? 14.942  32.529  48.856  1.00 52.54  ? 93   LYS G CA  1 
ATOM   6804 C C   . LYS G 2 37  ? 15.575  33.003  47.522  1.00 52.10  ? 93   LYS G C   1 
ATOM   6805 O O   . LYS G 2 37  ? 15.345  32.390  46.478  1.00 52.33  ? 93   LYS G O   1 
ATOM   6806 C CB  . LYS G 2 37  ? 13.422  32.444  48.684  1.00 55.87  ? 93   LYS G CB  1 
ATOM   6807 C CG  . LYS G 2 37  ? 12.659  32.161  49.943  1.00 55.81  ? 93   LYS G CG  1 
ATOM   6808 C CD  . LYS G 2 37  ? 12.842  30.713  50.361  1.00 56.55  ? 93   LYS G CD  1 
ATOM   6809 C CE  . LYS G 2 37  ? 11.534  30.063  50.785  1.00 57.16  ? 93   LYS G CE  1 
ATOM   6810 N NZ  . LYS G 2 37  ? 11.139  30.280  52.222  1.00 58.62  ? 93   LYS G NZ  1 
ATOM   6811 N N   . GLY G 2 38  ? 16.325  34.103  47.527  1.00 48.75  ? 94   GLY G N   1 
ATOM   6812 C CA  . GLY G 2 38  ? 16.876  34.590  46.280  1.00 48.99  ? 94   GLY G CA  1 
ATOM   6813 C C   . GLY G 2 38  ? 15.793  34.892  45.234  1.00 48.98  ? 94   GLY G C   1 
ATOM   6814 O O   . GLY G 2 38  ? 15.971  34.703  44.009  1.00 49.24  ? 94   GLY G O   1 
ATOM   6815 N N   . THR G 2 39  ? 14.666  35.399  45.713  1.00 48.96  ? 95   THR G N   1 
ATOM   6816 C CA  . THR G 2 39  ? 13.562  35.790  44.844  1.00 48.30  ? 95   THR G CA  1 
ATOM   6817 C C   . THR G 2 39  ? 13.134  37.223  45.128  1.00 47.74  ? 95   THR G C   1 
ATOM   6818 O O   . THR G 2 39  ? 12.975  37.625  46.275  1.00 47.72  ? 95   THR G O   1 
ATOM   6819 C CB  . THR G 2 39  ? 12.384  34.854  45.025  1.00 50.17  ? 95   THR G CB  1 
ATOM   6820 O OG1 . THR G 2 39  ? 11.732  35.175  46.256  1.00 51.52  ? 95   THR G OG1 1 
ATOM   6821 C CG2 . THR G 2 39  ? 12.871  33.434  45.083  1.00 49.65  ? 95   THR G CG2 1 
ATOM   6822 N N   . ALA G 2 40  ? 12.914  37.983  44.070  1.00 47.22  ? 96   ALA G N   1 
ATOM   6823 C CA  . ALA G 2 40  ? 12.486  39.365  44.209  1.00 47.06  ? 96   ALA G CA  1 
ATOM   6824 C C   . ALA G 2 40  ? 11.060  39.508  43.674  1.00 47.07  ? 96   ALA G C   1 
ATOM   6825 O O   . ALA G 2 40  ? 10.636  38.772  42.775  1.00 47.61  ? 96   ALA G O   1 
ATOM   6826 C CB  . ALA G 2 40  ? 13.445  40.288  43.438  1.00 46.79  ? 96   ALA G CB  1 
ATOM   6827 N N   . PHE G 2 41  ? 10.342  40.491  44.198  1.00 51.91  ? 97   PHE G N   1 
ATOM   6828 C CA  . PHE G 2 41  ? 8.998   40.795  43.736  1.00 51.91  ? 97   PHE G CA  1 
ATOM   6829 C C   . PHE G 2 41  ? 8.978   42.241  43.357  1.00 51.63  ? 97   PHE G C   1 
ATOM   6830 O O   . PHE G 2 41  ? 8.937   43.114  44.216  1.00 51.93  ? 97   PHE G O   1 
ATOM   6831 C CB  . PHE G 2 41  ? 7.987   40.562  44.843  1.00 55.38  ? 97   PHE G CB  1 
ATOM   6832 C CG  . PHE G 2 41  ? 7.917   39.148  45.286  1.00 56.01  ? 97   PHE G CG  1 
ATOM   6833 C CD1 . PHE G 2 41  ? 8.854   38.646  46.179  1.00 56.22  ? 97   PHE G CD1 1 
ATOM   6834 C CD2 . PHE G 2 41  ? 6.966   38.304  44.754  1.00 56.65  ? 97   PHE G CD2 1 
ATOM   6835 C CE1 . PHE G 2 41  ? 8.801   37.337  46.581  1.00 57.88  ? 97   PHE G CE1 1 
ATOM   6836 C CE2 . PHE G 2 41  ? 6.905   36.992  45.141  1.00 57.54  ? 97   PHE G CE2 1 
ATOM   6837 C CZ  . PHE G 2 41  ? 7.809   36.507  46.072  1.00 58.88  ? 97   PHE G CZ  1 
ATOM   6838 N N   . VAL G 2 42  ? 9.049   42.498  42.065  1.00 53.26  ? 98   VAL G N   1 
ATOM   6839 C CA  . VAL G 2 42  ? 9.021   43.867  41.585  1.00 52.88  ? 98   VAL G CA  1 
ATOM   6840 C C   . VAL G 2 42  ? 7.663   44.202  40.964  1.00 53.21  ? 98   VAL G C   1 
ATOM   6841 O O   . VAL G 2 42  ? 6.911   43.320  40.518  1.00 53.33  ? 98   VAL G O   1 
ATOM   6842 C CB  . VAL G 2 42  ? 10.189  44.166  40.631  1.00 55.54  ? 98   VAL G CB  1 
ATOM   6843 C CG1 . VAL G 2 42  ? 10.617  45.594  40.790  1.00 54.59  ? 98   VAL G CG1 1 
ATOM   6844 C CG2 . VAL G 2 42  ? 11.356  43.235  40.903  1.00 53.16  ? 98   VAL G CG2 1 
ATOM   6845 N N   . THR G 2 43  ? 7.338   45.484  40.988  1.00 54.17  ? 99   THR G N   1 
ATOM   6846 C CA  . THR G 2 43  ? 6.099   45.977  40.420  1.00 54.35  ? 99   THR G CA  1 
ATOM   6847 C C   . THR G 2 43  ? 6.544   47.101  39.513  1.00 54.07  ? 99   THR G C   1 
ATOM   6848 O O   . THR G 2 43  ? 7.211   48.009  39.969  1.00 54.57  ? 99   THR G O   1 
ATOM   6849 C CB  . THR G 2 43  ? 5.160   46.490  41.519  1.00 62.59  ? 99   THR G CB  1 
ATOM   6850 O OG1 . THR G 2 43  ? 4.673   45.388  42.292  1.00 63.28  ? 99   THR G OG1 1 
ATOM   6851 C CG2 . THR G 2 43  ? 3.993   47.218  40.909  1.00 62.28  ? 99   THR G CG2 1 
ATOM   6852 N N   . LEU G 2 44  ? 6.258   46.991  38.218  1.00 55.09  ? 100  LEU G N   1 
ATOM   6853 C CA  . LEU G 2 44  ? 6.696   47.981  37.247  1.00 54.85  ? 100  LEU G CA  1 
ATOM   6854 C C   . LEU G 2 44  ? 5.617   49.005  36.849  1.00 55.31  ? 100  LEU G C   1 
ATOM   6855 O O   . LEU G 2 44  ? 4.459   48.891  37.239  1.00 55.91  ? 100  LEU G O   1 
ATOM   6856 C CB  . LEU G 2 44  ? 7.316   47.294  36.031  1.00 54.87  ? 100  LEU G CB  1 
ATOM   6857 C CG  . LEU G 2 44  ? 8.587   46.499  36.340  1.00 54.23  ? 100  LEU G CG  1 
ATOM   6858 C CD1 . LEU G 2 44  ? 9.409   46.204  35.104  1.00 50.74  ? 100  LEU G CD1 1 
ATOM   6859 C CD2 . LEU G 2 44  ? 9.426   47.247  37.372  1.00 55.93  ? 100  LEU G CD2 1 
ATOM   6860 N N   . LEU G 2 45  ? 6.016   50.033  36.107  1.00 55.95  ? 101  LEU G N   1 
ATOM   6861 C CA  . LEU G 2 45  ? 5.095   51.086  35.690  1.00 55.90  ? 101  LEU G CA  1 
ATOM   6862 C C   . LEU G 2 45  ? 3.843   50.560  34.992  1.00 56.52  ? 101  LEU G C   1 
ATOM   6863 O O   . LEU G 2 45  ? 2.743   51.031  35.263  1.00 55.89  ? 101  LEU G O   1 
ATOM   6864 C CB  . LEU G 2 45  ? 5.813   52.076  34.774  1.00 55.47  ? 101  LEU G CB  1 
ATOM   6865 C CG  . LEU G 2 45  ? 4.986   53.271  34.338  1.00 54.36  ? 101  LEU G CG  1 
ATOM   6866 C CD1 . LEU G 2 45  ? 4.137   53.651  35.499  1.00 54.93  ? 101  LEU G CD1 1 
ATOM   6867 C CD2 . LEU G 2 45  ? 5.858   54.437  33.922  1.00 52.18  ? 101  LEU G CD2 1 
ATOM   6868 N N   . ASN G 2 46  ? 4.017   49.604  34.078  1.00 55.97  ? 102  ASN G N   1 
ATOM   6869 C CA  . ASN G 2 46  ? 2.905   49.065  33.293  1.00 56.16  ? 102  ASN G CA  1 
ATOM   6870 C C   . ASN G 2 46  ? 3.250   47.739  32.617  1.00 56.80  ? 102  ASN G C   1 
ATOM   6871 O O   . ASN G 2 46  ? 4.335   47.210  32.812  1.00 56.96  ? 102  ASN G O   1 
ATOM   6872 C CB  . ASN G 2 46  ? 2.456   50.067  32.221  1.00 56.81  ? 102  ASN G CB  1 
ATOM   6873 C CG  . ASN G 2 46  ? 3.610   50.553  31.330  1.00 56.43  ? 102  ASN G CG  1 
ATOM   6874 O OD1 . ASN G 2 46  ? 4.280   49.764  30.669  1.00 58.85  ? 102  ASN G OD1 1 
ATOM   6875 N ND2 . ASN G 2 46  ? 3.813   51.863  31.288  1.00 53.64  ? 102  ASN G ND2 1 
ATOM   6876 N N   . GLY G 2 47  ? 2.313   47.226  31.815  1.00 55.65  ? 103  GLY G N   1 
ATOM   6877 C CA  . GLY G 2 47  ? 2.438   45.973  31.101  1.00 55.80  ? 103  GLY G CA  1 
ATOM   6878 C C   . GLY G 2 47  ? 3.601   45.909  30.129  1.00 56.54  ? 103  GLY G C   1 
ATOM   6879 O O   . GLY G 2 47  ? 4.273   44.895  30.027  1.00 56.56  ? 103  GLY G O   1 
ATOM   6880 N N   . GLU G 2 48  ? 3.861   46.990  29.408  1.00 58.50  ? 104  GLU G N   1 
ATOM   6881 C CA  . GLU G 2 48  ? 4.973   46.987  28.472  1.00 60.15  ? 104  GLU G CA  1 
ATOM   6882 C C   . GLU G 2 48  ? 6.257   46.852  29.231  1.00 60.68  ? 104  GLU G C   1 
ATOM   6883 O O   . GLU G 2 48  ? 7.077   46.014  28.900  1.00 61.35  ? 104  GLU G O   1 
ATOM   6884 C CB  . GLU G 2 48  ? 5.011   48.243  27.618  1.00 62.97  ? 104  GLU G CB  1 
ATOM   6885 C CG  . GLU G 2 48  ? 5.138   47.939  26.127  1.00 65.96  ? 104  GLU G CG  1 
ATOM   6886 C CD  . GLU G 2 48  ? 4.170   46.833  25.648  1.00 70.69  ? 104  GLU G CD  1 
ATOM   6887 O OE1 . GLU G 2 48  ? 4.567   46.031  24.766  1.00 70.97  ? 104  GLU G OE1 1 
ATOM   6888 O OE2 . GLU G 2 48  ? 2.999   46.788  26.118  1.00 71.59  ? 104  GLU G OE2 1 
ATOM   6889 N N   . GLN G 2 49  ? 6.422   47.656  30.276  1.00 57.89  ? 105  GLN G N   1 
ATOM   6890 C CA  . GLN G 2 49  ? 7.624   47.591  31.116  1.00 57.87  ? 105  GLN G CA  1 
ATOM   6891 C C   . GLN G 2 49  ? 7.906   46.185  31.663  1.00 57.32  ? 105  GLN G C   1 
ATOM   6892 O O   . GLN G 2 49  ? 9.024   45.688  31.565  1.00 57.04  ? 105  GLN G O   1 
ATOM   6893 C CB  . GLN G 2 49  ? 7.518   48.588  32.261  1.00 57.92  ? 105  GLN G CB  1 
ATOM   6894 C CG  . GLN G 2 49  ? 7.856   50.019  31.885  1.00 59.42  ? 105  GLN G CG  1 
ATOM   6895 C CD  . GLN G 2 49  ? 8.686   50.698  32.974  1.00 62.04  ? 105  GLN G CD  1 
ATOM   6896 O OE1 . GLN G 2 49  ? 8.456   50.508  34.193  1.00 60.97  ? 105  GLN G OE1 1 
ATOM   6897 N NE2 . GLN G 2 49  ? 9.712   51.428  32.540  1.00 62.49  ? 105  GLN G NE2 1 
ATOM   6898 N N   . ALA G 2 50  ? 6.881   45.550  32.223  1.00 57.13  ? 106  ALA G N   1 
ATOM   6899 C CA  . ALA G 2 50  ? 7.006   44.197  32.735  1.00 57.76  ? 106  ALA G CA  1 
ATOM   6900 C C   . ALA G 2 50  ? 7.376   43.192  31.624  1.00 58.72  ? 106  ALA G C   1 
ATOM   6901 O O   . ALA G 2 50  ? 8.001   42.152  31.893  1.00 59.36  ? 106  ALA G O   1 
ATOM   6902 C CB  . ALA G 2 50  ? 5.738   43.786  33.420  1.00 58.05  ? 106  ALA G CB  1 
ATOM   6903 N N   . GLU G 2 51  ? 6.994   43.499  30.382  1.00 60.21  ? 107  GLU G N   1 
ATOM   6904 C CA  . GLU G 2 51  ? 7.308   42.638  29.239  1.00 60.14  ? 107  GLU G CA  1 
ATOM   6905 C C   . GLU G 2 51  ? 8.773   42.734  28.840  1.00 59.60  ? 107  GLU G C   1 
ATOM   6906 O O   . GLU G 2 51  ? 9.446   41.711  28.676  1.00 59.66  ? 107  GLU G O   1 
ATOM   6907 C CB  . GLU G 2 51  ? 6.487   43.062  28.040  1.00 63.92  ? 107  GLU G CB  1 
ATOM   6908 C CG  . GLU G 2 51  ? 6.543   42.088  26.904  1.00 66.12  ? 107  GLU G CG  1 
ATOM   6909 C CD  . GLU G 2 51  ? 5.236   41.317  26.771  1.00 70.67  ? 107  GLU G CD  1 
ATOM   6910 O OE1 . GLU G 2 51  ? 4.196   41.981  26.519  1.00 70.42  ? 107  GLU G OE1 1 
ATOM   6911 O OE2 . GLU G 2 51  ? 5.238   40.065  26.963  1.00 73.83  ? 107  GLU G OE2 1 
ATOM   6912 N N   . ALA G 2 52  ? 9.233   43.970  28.623  1.00 53.97  ? 108  ALA G N   1 
ATOM   6913 C CA  . ALA G 2 52  ? 10.606  44.247  28.213  1.00 53.26  ? 108  ALA G CA  1 
ATOM   6914 C C   . ALA G 2 52  ? 11.540  43.720  29.272  1.00 53.33  ? 108  ALA G C   1 
ATOM   6915 O O   . ALA G 2 52  ? 12.574  43.145  28.964  1.00 53.43  ? 108  ALA G O   1 
ATOM   6916 C CB  . ALA G 2 52  ? 10.807  45.707  28.049  1.00 53.27  ? 108  ALA G CB  1 
ATOM   6917 N N   . ALA G 2 53  ? 11.155  43.910  30.528  1.00 49.97  ? 109  ALA G N   1 
ATOM   6918 C CA  . ALA G 2 53  ? 11.950  43.444  31.635  1.00 49.41  ? 109  ALA G CA  1 
ATOM   6919 C C   . ALA G 2 53  ? 12.052  41.923  31.569  1.00 49.26  ? 109  ALA G C   1 
ATOM   6920 O O   . ALA G 2 53  ? 13.125  41.349  31.789  1.00 49.62  ? 109  ALA G O   1 
ATOM   6921 C CB  . ALA G 2 53  ? 11.320  43.875  32.940  1.00 49.55  ? 109  ALA G CB  1 
ATOM   6922 N N   . ILE G 2 54  ? 10.931  41.260  31.289  1.00 48.04  ? 110  ILE G N   1 
ATOM   6923 C CA  . ILE G 2 54  ? 10.936  39.807  31.237  1.00 47.33  ? 110  ILE G CA  1 
ATOM   6924 C C   . ILE G 2 54  ? 11.794  39.347  30.098  1.00 47.71  ? 110  ILE G C   1 
ATOM   6925 O O   . ILE G 2 54  ? 12.602  38.443  30.259  1.00 48.11  ? 110  ILE G O   1 
ATOM   6926 C CB  . ILE G 2 54  ? 9.542   39.197  31.135  1.00 47.90  ? 110  ILE G CB  1 
ATOM   6927 C CG1 . ILE G 2 54  ? 8.790   39.376  32.453  1.00 46.95  ? 110  ILE G CG1 1 
ATOM   6928 C CG2 . ILE G 2 54  ? 9.662   37.731  30.770  1.00 46.14  ? 110  ILE G CG2 1 
ATOM   6929 C CD1 . ILE G 2 54  ? 7.304   39.122  32.349  1.00 47.32  ? 110  ILE G CD1 1 
ATOM   6930 N N   . ASN G 2 55  ? 11.649  39.992  28.947  1.00 52.92  ? 111  ASN G N   1 
ATOM   6931 C CA  . ASN G 2 55  ? 12.447  39.600  27.795  1.00 52.79  ? 111  ASN G CA  1 
ATOM   6932 C C   . ASN G 2 55  ? 13.927  39.913  27.901  1.00 52.16  ? 111  ASN G C   1 
ATOM   6933 O O   . ASN G 2 55  ? 14.753  39.114  27.470  1.00 52.88  ? 111  ASN G O   1 
ATOM   6934 C CB  . ASN G 2 55  ? 11.824  40.045  26.476  1.00 62.88  ? 111  ASN G CB  1 
ATOM   6935 C CG  . ASN G 2 55  ? 10.579  39.215  26.115  1.00 63.78  ? 111  ASN G CG  1 
ATOM   6936 O OD1 . ASN G 2 55  ? 10.601  37.969  26.155  1.00 62.39  ? 111  ASN G OD1 1 
ATOM   6937 N ND2 . ASN G 2 55  ? 9.467   39.906  25.839  1.00 62.74  ? 111  ASN G ND2 1 
ATOM   6938 N N   . ALA G 2 56  ? 14.271  41.022  28.549  1.00 50.84  ? 112  ALA G N   1 
ATOM   6939 C CA  . ALA G 2 56  ? 15.672  41.385  28.698  1.00 49.49  ? 112  ALA G CA  1 
ATOM   6940 C C   . ALA G 2 56  ? 16.349  40.518  29.699  1.00 48.66  ? 112  ALA G C   1 
ATOM   6941 O O   . ALA G 2 56  ? 17.517  40.195  29.547  1.00 48.89  ? 112  ALA G O   1 
ATOM   6942 C CB  . ALA G 2 56  ? 15.822  42.813  29.111  1.00 49.85  ? 112  ALA G CB  1 
ATOM   6943 N N   . PHE G 2 57  ? 15.603  40.137  30.739  1.00 48.14  ? 113  PHE G N   1 
ATOM   6944 C CA  . PHE G 2 57  ? 16.182  39.576  31.962  1.00 47.63  ? 113  PHE G CA  1 
ATOM   6945 C C   . PHE G 2 57  ? 15.819  38.120  32.330  1.00 47.54  ? 113  PHE G C   1 
ATOM   6946 O O   . PHE G 2 57  ? 16.327  37.604  33.325  1.00 47.44  ? 113  PHE G O   1 
ATOM   6947 C CB  . PHE G 2 57  ? 15.880  40.493  33.153  1.00 48.28  ? 113  PHE G CB  1 
ATOM   6948 C CG  . PHE G 2 57  ? 16.598  41.811  33.099  1.00 48.28  ? 113  PHE G CG  1 
ATOM   6949 C CD1 . PHE G 2 57  ? 17.951  41.867  32.811  1.00 48.28  ? 113  PHE G CD1 1 
ATOM   6950 C CD2 . PHE G 2 57  ? 15.919  42.995  33.336  1.00 48.28  ? 113  PHE G CD2 1 
ATOM   6951 C CE1 . PHE G 2 57  ? 18.614  43.078  32.761  1.00 48.28  ? 113  PHE G CE1 1 
ATOM   6952 C CE2 . PHE G 2 57  ? 16.576  44.209  33.288  1.00 48.28  ? 113  PHE G CE2 1 
ATOM   6953 C CZ  . PHE G 2 57  ? 17.926  44.251  33.000  1.00 48.28  ? 113  PHE G CZ  1 
ATOM   6954 N N   . HIS G 2 58  ? 14.960  37.456  31.556  1.00 48.76  ? 114  HIS G N   1 
ATOM   6955 C CA  . HIS G 2 58  ? 14.750  36.036  31.755  1.00 48.78  ? 114  HIS G CA  1 
ATOM   6956 C C   . HIS G 2 58  ? 15.885  35.204  31.133  1.00 48.71  ? 114  HIS G C   1 
ATOM   6957 O O   . HIS G 2 58  ? 16.088  35.237  29.915  1.00 48.03  ? 114  HIS G O   1 
ATOM   6958 C CB  . HIS G 2 58  ? 13.398  35.578  31.242  1.00 48.42  ? 114  HIS G CB  1 
ATOM   6959 C CG  . HIS G 2 58  ? 13.216  34.105  31.347  1.00 49.50  ? 114  HIS G CG  1 
ATOM   6960 N ND1 . HIS G 2 58  ? 12.838  33.493  32.521  1.00 50.02  ? 114  HIS G ND1 1 
ATOM   6961 C CD2 . HIS G 2 58  ? 13.500  33.108  30.476  1.00 49.91  ? 114  HIS G CD2 1 
ATOM   6962 C CE1 . HIS G 2 58  ? 12.838  32.185  32.348  1.00 50.44  ? 114  HIS G CE1 1 
ATOM   6963 N NE2 . HIS G 2 58  ? 13.244  31.924  31.119  1.00 49.55  ? 114  HIS G NE2 1 
ATOM   6964 N N   . GLN G 2 59  ? 16.638  34.505  31.996  1.00 51.70  ? 115  GLN G N   1 
ATOM   6965 C CA  . GLN G 2 59  ? 17.766  33.634  31.608  1.00 52.56  ? 115  GLN G CA  1 
ATOM   6966 C C   . GLN G 2 59  ? 19.145  34.314  31.524  1.00 52.08  ? 115  GLN G C   1 
ATOM   6967 O O   . GLN G 2 59  ? 20.140  33.735  31.062  1.00 51.89  ? 115  GLN G O   1 
ATOM   6968 C CB  . GLN G 2 59  ? 17.466  32.856  30.335  1.00 54.03  ? 115  GLN G CB  1 
ATOM   6969 C CG  . GLN G 2 59  ? 16.512  31.719  30.554  1.00 57.79  ? 115  GLN G CG  1 
ATOM   6970 C CD  . GLN G 2 59  ? 16.385  30.845  29.330  1.00 62.41  ? 115  GLN G CD  1 
ATOM   6971 O OE1 . GLN G 2 59  ? 16.061  31.340  28.225  1.00 61.36  ? 115  GLN G OE1 1 
ATOM   6972 N NE2 . GLN G 2 59  ? 16.700  29.541  29.492  1.00 63.97  ? 115  GLN G NE2 1 
ATOM   6973 N N   . SER G 2 60  ? 19.211  35.550  31.979  1.00 48.59  ? 116  SER G N   1 
ATOM   6974 C CA  . SER G 2 60  ? 20.479  36.229  31.977  1.00 48.51  ? 116  SER G CA  1 
ATOM   6975 C C   . SER G 2 60  ? 21.206  35.821  33.257  1.00 48.21  ? 116  SER G C   1 
ATOM   6976 O O   . SER G 2 60  ? 20.658  35.117  34.131  1.00 48.26  ? 116  SER G O   1 
ATOM   6977 C CB  . SER G 2 60  ? 20.295  37.744  31.884  1.00 51.80  ? 116  SER G CB  1 
ATOM   6978 O OG  . SER G 2 60  ? 19.455  38.217  32.924  1.00 53.57  ? 116  SER G OG  1 
ATOM   6979 N N   . ARG G 2 61  ? 22.466  36.237  33.337  1.00 47.41  ? 117  ARG G N   1 
ATOM   6980 C CA  . ARG G 2 61  ? 23.283  35.890  34.476  1.00 46.66  ? 117  ARG G CA  1 
ATOM   6981 C C   . ARG G 2 61  ? 23.545  37.104  35.323  1.00 46.32  ? 117  ARG G C   1 
ATOM   6982 O O   . ARG G 2 61  ? 23.860  38.170  34.818  1.00 46.38  ? 117  ARG G O   1 
ATOM   6983 C CB  . ARG G 2 61  ? 24.598  35.242  34.041  1.00 43.75  ? 117  ARG G CB  1 
ATOM   6984 C CG  . ARG G 2 61  ? 24.395  34.004  33.264  1.00 42.89  ? 117  ARG G CG  1 
ATOM   6985 C CD  . ARG G 2 61  ? 24.917  32.788  33.992  1.00 44.51  ? 117  ARG G CD  1 
ATOM   6986 N NE  . ARG G 2 61  ? 24.484  31.574  33.306  1.00 45.94  ? 117  ARG G NE  1 
ATOM   6987 C CZ  . ARG G 2 61  ? 24.389  30.366  33.860  1.00 47.59  ? 117  ARG G CZ  1 
ATOM   6988 N NH1 . ARG G 2 61  ? 24.738  30.157  35.119  1.00 48.94  ? 117  ARG G NH1 1 
ATOM   6989 N NH2 . ARG G 2 61  ? 23.904  29.354  33.153  1.00 49.54  ? 117  ARG G NH2 1 
ATOM   6990 N N   . LEU G 2 62  ? 23.361  36.947  36.619  1.00 46.81  ? 118  LEU G N   1 
ATOM   6991 C CA  . LEU G 2 62  ? 23.677  38.019  37.535  1.00 46.82  ? 118  LEU G CA  1 
ATOM   6992 C C   . LEU G 2 62  ? 24.769  37.408  38.429  1.00 46.93  ? 118  LEU G C   1 
ATOM   6993 O O   . LEU G 2 62  ? 24.544  36.360  39.072  1.00 46.49  ? 118  LEU G O   1 
ATOM   6994 C CB  . LEU G 2 62  ? 22.449  38.440  38.343  1.00 46.26  ? 118  LEU G CB  1 
ATOM   6995 C CG  . LEU G 2 62  ? 22.844  39.448  39.418  1.00 45.37  ? 118  LEU G CG  1 
ATOM   6996 C CD1 . LEU G 2 62  ? 23.451  40.631  38.712  1.00 45.49  ? 118  LEU G CD1 1 
ATOM   6997 C CD2 . LEU G 2 62  ? 21.704  39.860  40.358  1.00 43.09  ? 118  LEU G CD2 1 
ATOM   6998 N N   . ARG G 2 63  ? 25.967  38.004  38.379  1.00 48.60  ? 119  ARG G N   1 
ATOM   6999 C CA  . ARG G 2 63  ? 27.128  37.492  39.118  1.00 48.56  ? 119  ARG G CA  1 
ATOM   7000 C C   . ARG G 2 63  ? 27.213  35.983  39.021  1.00 48.90  ? 119  ARG G C   1 
ATOM   7001 O O   . ARG G 2 63  ? 27.377  35.283  40.019  1.00 48.89  ? 119  ARG G O   1 
ATOM   7002 C CB  . ARG G 2 63  ? 27.126  37.961  40.567  1.00 47.27  ? 119  ARG G CB  1 
ATOM   7003 C CG  . ARG G 2 63  ? 27.151  39.463  40.665  1.00 47.59  ? 119  ARG G CG  1 
ATOM   7004 C CD  . ARG G 2 63  ? 26.682  39.928  42.009  1.00 49.25  ? 119  ARG G CD  1 
ATOM   7005 N NE  . ARG G 2 63  ? 26.973  38.942  43.048  1.00 50.32  ? 119  ARG G NE  1 
ATOM   7006 C CZ  . ARG G 2 63  ? 26.295  38.820  44.194  1.00 49.38  ? 119  ARG G CZ  1 
ATOM   7007 N NH1 . ARG G 2 63  ? 25.262  39.618  44.473  1.00 50.10  ? 119  ARG G NH1 1 
ATOM   7008 N NH2 . ARG G 2 63  ? 26.658  37.894  45.072  1.00 48.56  ? 119  ARG G NH2 1 
ATOM   7009 N N   . GLU G 2 64  ? 27.101  35.477  37.795  1.00 50.60  ? 120  GLU G N   1 
ATOM   7010 C CA  . GLU G 2 64  ? 27.330  34.060  37.514  1.00 50.96  ? 120  GLU G CA  1 
ATOM   7011 C C   . GLU G 2 64  ? 26.116  33.159  37.771  1.00 50.65  ? 120  GLU G C   1 
ATOM   7012 O O   . GLU G 2 64  ? 26.226  31.935  37.709  1.00 50.55  ? 120  GLU G O   1 
ATOM   7013 C CB  . GLU G 2 64  ? 28.533  33.548  38.311  1.00 52.94  ? 120  GLU G CB  1 
ATOM   7014 C CG  . GLU G 2 64  ? 29.845  33.582  37.544  1.00 54.33  ? 120  GLU G CG  1 
ATOM   7015 C CD  . GLU G 2 64  ? 29.822  32.702  36.310  1.00 60.16  ? 120  GLU G CD  1 
ATOM   7016 O OE1 . GLU G 2 64  ? 29.995  31.474  36.451  1.00 58.20  ? 120  GLU G OE1 1 
ATOM   7017 O OE2 . GLU G 2 64  ? 29.630  33.239  35.198  1.00 61.12  ? 120  GLU G OE2 1 
ATOM   7018 N N   . ARG G 2 65  ? 24.965  33.760  38.058  1.00 49.31  ? 121  ARG G N   1 
ATOM   7019 C CA  . ARG G 2 65  ? 23.752  32.991  38.339  1.00 49.76  ? 121  ARG G CA  1 
ATOM   7020 C C   . ARG G 2 65  ? 22.639  33.265  37.326  1.00 50.07  ? 121  ARG G C   1 
ATOM   7021 O O   . ARG G 2 65  ? 22.336  34.419  37.026  1.00 50.03  ? 121  ARG G O   1 
ATOM   7022 C CB  . ARG G 2 65  ? 23.252  33.279  39.757  1.00 42.14  ? 121  ARG G CB  1 
ATOM   7023 C CG  . ARG G 2 65  ? 24.154  34.206  40.556  1.00 43.86  ? 121  ARG G CG  1 
ATOM   7024 C CD  . ARG G 2 65  ? 24.751  33.493  41.758  1.00 43.83  ? 121  ARG G CD  1 
ATOM   7025 N NE  . ARG G 2 65  ? 26.130  33.903  42.009  1.00 44.68  ? 121  ARG G NE  1 
ATOM   7026 C CZ  . ARG G 2 65  ? 26.651  34.071  43.219  1.00 46.15  ? 121  ARG G CZ  1 
ATOM   7027 N NH1 . ARG G 2 65  ? 27.916  34.446  43.353  1.00 45.21  ? 121  ARG G NH1 1 
ATOM   7028 N NH2 . ARG G 2 65  ? 25.908  33.864  44.298  1.00 48.17  ? 121  ARG G NH2 1 
ATOM   7029 N N   . GLU G 2 66  ? 22.032  32.201  36.801  1.00 53.42  ? 122  GLU G N   1 
ATOM   7030 C CA  . GLU G 2 66  ? 21.029  32.342  35.742  1.00 54.18  ? 122  GLU G CA  1 
ATOM   7031 C C   . GLU G 2 66  ? 19.691  32.760  36.354  1.00 53.78  ? 122  GLU G C   1 
ATOM   7032 O O   . GLU G 2 66  ? 19.196  32.128  37.274  1.00 53.82  ? 122  GLU G O   1 
ATOM   7033 C CB  . GLU G 2 66  ? 20.841  31.024  34.993  1.00 57.59  ? 122  GLU G CB  1 
ATOM   7034 C CG  . GLU G 2 66  ? 20.470  31.179  33.526  1.00 60.18  ? 122  GLU G CG  1 
ATOM   7035 C CD  . GLU G 2 66  ? 19.679  29.985  33.017  1.00 64.35  ? 122  GLU G CD  1 
ATOM   7036 O OE1 . GLU G 2 66  ? 18.415  30.043  33.059  1.00 66.64  ? 122  GLU G OE1 1 
ATOM   7037 O OE2 . GLU G 2 66  ? 20.316  28.962  32.650  1.00 63.98  ? 122  GLU G OE2 1 
ATOM   7038 N N   . LEU G 2 67  ? 19.113  33.836  35.834  1.00 49.05  ? 123  LEU G N   1 
ATOM   7039 C CA  . LEU G 2 67  ? 17.893  34.372  36.391  1.00 48.79  ? 123  LEU G CA  1 
ATOM   7040 C C   . LEU G 2 67  ? 16.702  33.940  35.612  1.00 49.22  ? 123  LEU G C   1 
ATOM   7041 O O   . LEU G 2 67  ? 16.756  33.781  34.392  1.00 49.49  ? 123  LEU G O   1 
ATOM   7042 C CB  . LEU G 2 67  ? 17.940  35.897  36.382  1.00 48.54  ? 123  LEU G CB  1 
ATOM   7043 C CG  . LEU G 2 67  ? 19.013  36.586  37.205  1.00 46.31  ? 123  LEU G CG  1 
ATOM   7044 C CD1 . LEU G 2 67  ? 18.931  38.056  36.986  1.00 45.54  ? 123  LEU G CD1 1 
ATOM   7045 C CD2 . LEU G 2 67  ? 18.758  36.246  38.646  1.00 45.66  ? 123  LEU G CD2 1 
ATOM   7046 N N   . SER G 2 68  ? 15.609  33.812  36.341  1.00 47.66  ? 124  SER G N   1 
ATOM   7047 C CA  . SER G 2 68  ? 14.332  33.481  35.769  1.00 48.62  ? 124  SER G CA  1 
ATOM   7048 C C   . SER G 2 68  ? 13.325  34.602  36.080  1.00 49.65  ? 124  SER G C   1 
ATOM   7049 O O   . SER G 2 68  ? 12.754  34.715  37.184  1.00 49.75  ? 124  SER G O   1 
ATOM   7050 C CB  . SER G 2 68  ? 13.857  32.072  36.177  1.00 49.69  ? 124  SER G CB  1 
ATOM   7051 O OG  . SER G 2 68  ? 12.942  32.085  37.261  1.00 48.54  ? 124  SER G OG  1 
ATOM   7052 N N   . VAL G 2 69  ? 13.131  35.451  35.085  1.00 49.63  ? 125  VAL G N   1 
ATOM   7053 C CA  . VAL G 2 69  ? 12.190  36.534  35.199  1.00 50.87  ? 125  VAL G CA  1 
ATOM   7054 C C   . VAL G 2 69  ? 10.870  36.133  34.515  1.00 51.40  ? 125  VAL G C   1 
ATOM   7055 O O   . VAL G 2 69  ? 10.884  35.625  33.402  1.00 52.00  ? 125  VAL G O   1 
ATOM   7056 C CB  . VAL G 2 69  ? 12.806  37.804  34.611  1.00 53.02  ? 125  VAL G CB  1 
ATOM   7057 C CG1 . VAL G 2 69  ? 11.961  39.009  34.976  1.00 52.42  ? 125  VAL G CG1 1 
ATOM   7058 C CG2 . VAL G 2 69  ? 14.265  37.947  35.088  1.00 53.45  ? 125  VAL G CG2 1 
ATOM   7059 N N   . GLN G 2 70  ? 9.746   36.314  35.207  1.00 53.20  ? 126  GLN G N   1 
ATOM   7060 C CA  . GLN G 2 70  ? 8.433   35.981  34.673  1.00 53.94  ? 126  GLN G CA  1 
ATOM   7061 C C   . GLN G 2 70  ? 7.334   36.741  35.394  1.00 54.65  ? 126  GLN G C   1 
ATOM   7062 O O   . GLN G 2 70  ? 7.567   37.315  36.457  1.00 54.41  ? 126  GLN G O   1 
ATOM   7063 C CB  . GLN G 2 70  ? 8.182   34.479  34.756  1.00 57.46  ? 126  GLN G CB  1 
ATOM   7064 C CG  . GLN G 2 70  ? 7.536   34.030  36.050  1.00 57.66  ? 126  GLN G CG  1 
ATOM   7065 C CD  . GLN G 2 70  ? 8.076   32.698  36.557  1.00 58.52  ? 126  GLN G CD  1 
ATOM   7066 O OE1 . GLN G 2 70  ? 7.474   31.648  36.307  1.00 59.02  ? 126  GLN G OE1 1 
ATOM   7067 N NE2 . GLN G 2 70  ? 9.194   32.742  37.320  1.00 58.67  ? 126  GLN G NE2 1 
ATOM   7068 N N   . LEU G 2 71  ? 6.137   36.753  34.807  1.00 55.20  ? 127  LEU G N   1 
ATOM   7069 C CA  . LEU G 2 71  ? 5.002   37.461  35.397  1.00 56.51  ? 127  LEU G CA  1 
ATOM   7070 C C   . LEU G 2 71  ? 4.624   36.825  36.693  1.00 57.54  ? 127  LEU G C   1 
ATOM   7071 O O   . LEU G 2 71  ? 4.419   35.621  36.730  1.00 57.29  ? 127  LEU G O   1 
ATOM   7072 C CB  . LEU G 2 71  ? 3.805   37.386  34.493  1.00 55.51  ? 127  LEU G CB  1 
ATOM   7073 C CG  . LEU G 2 71  ? 3.823   38.256  33.251  1.00 56.00  ? 127  LEU G CG  1 
ATOM   7074 C CD1 . LEU G 2 71  ? 2.414   38.262  32.713  1.00 54.09  ? 127  LEU G CD1 1 
ATOM   7075 C CD2 . LEU G 2 71  ? 4.330   39.683  33.535  1.00 55.97  ? 127  LEU G CD2 1 
ATOM   7076 N N   . GLN G 2 72  ? 4.540   37.641  37.742  1.00 64.72  ? 128  GLN G N   1 
ATOM   7077 C CA  . GLN G 2 72  ? 4.221   37.179  39.092  1.00 67.38  ? 128  GLN G CA  1 
ATOM   7078 C C   . GLN G 2 72  ? 3.053   36.240  38.998  1.00 68.93  ? 128  GLN G C   1 
ATOM   7079 O O   . GLN G 2 72  ? 1.965   36.634  38.543  1.00 68.81  ? 128  GLN G O   1 
ATOM   7080 C CB  . GLN G 2 72  ? 3.893   38.337  40.043  1.00 67.37  ? 128  GLN G CB  1 
ATOM   7081 C CG  . GLN G 2 72  ? 4.795   38.392  41.295  1.00 71.04  ? 128  GLN G CG  1 
ATOM   7082 C CD  . GLN G 2 72  ? 4.995   39.822  41.851  1.00 75.91  ? 128  GLN G CD  1 
ATOM   7083 O OE1 . GLN G 2 72  ? 5.974   40.521  41.517  1.00 76.16  ? 128  GLN G OE1 1 
ATOM   7084 N NE2 . GLN G 2 72  ? 4.086   40.236  42.749  1.00 78.10  ? 128  GLN G NE2 1 
ATOM   7085 N N   . PRO G 2 73  ? 3.293   34.951  39.339  1.00 74.86  ? 129  PRO G N   1 
ATOM   7086 C CA  . PRO G 2 73  ? 2.324   33.852  39.253  1.00 75.73  ? 129  PRO G CA  1 
ATOM   7087 C C   . PRO G 2 73  ? 0.952   34.278  39.759  1.00 77.02  ? 129  PRO G C   1 
ATOM   7088 O O   . PRO G 2 73  ? 0.755   34.575  40.950  1.00 77.18  ? 129  PRO G O   1 
ATOM   7089 C CB  . PRO G 2 73  ? 2.946   32.748  40.128  1.00 77.45  ? 129  PRO G CB  1 
ATOM   7090 C CG  . PRO G 2 73  ? 3.929   33.437  41.007  1.00 77.03  ? 129  PRO G CG  1 
ATOM   7091 C CD  . PRO G 2 73  ? 4.435   34.614  40.217  1.00 76.86  ? 129  PRO G CD  1 
ATOM   7092 N N   . THR G 2 74  ? 0.016   34.368  38.821  1.00 78.73  ? 130  THR G N   1 
ATOM   7093 C CA  . THR G 2 74  ? -1.353  34.751  39.147  1.00 79.39  ? 130  THR G CA  1 
ATOM   7094 C C   . THR G 2 74  ? -2.225  33.503  38.976  1.00 80.00  ? 130  THR G C   1 
ATOM   7095 O O   . THR G 2 74  ? -2.229  32.667  39.912  1.00 80.73  ? 130  THR G O   1 
ATOM   7096 C CB  . THR G 2 74  ? -1.858  35.988  38.312  1.00 95.03  ? 130  THR G CB  1 
ATOM   7097 O OG1 . THR G 2 74  ? -0.850  37.019  38.284  1.00 94.27  ? 130  THR G OG1 1 
ATOM   7098 C CG2 . THR G 2 74  ? -3.117  36.568  38.937  1.00 94.57  ? 130  THR G CG2 1 
ATOM   7099 O OXT . THR G 2 74  ? -2.805  33.330  37.879  1.00 97.05  ? 130  THR G OXT 1 
ATOM   7100 N N   . MET H 2 2   ? 33.347  -2.336  25.565  1.00 82.52  ? 58   MET H N   1 
ATOM   7101 C CA  . MET H 2 2   ? 33.090  -3.470  26.458  1.00 80.92  ? 58   MET H CA  1 
ATOM   7102 C C   . MET H 2 2   ? 31.748  -4.163  26.197  1.00 78.75  ? 58   MET H C   1 
ATOM   7103 O O   . MET H 2 2   ? 31.017  -3.804  25.263  1.00 78.19  ? 58   MET H O   1 
ATOM   7104 C CB  . MET H 2 2   ? 33.187  -3.047  27.933  1.00 84.29  ? 58   MET H CB  1 
ATOM   7105 C CG  . MET H 2 2   ? 33.283  -4.209  28.937  1.00 87.35  ? 58   MET H CG  1 
ATOM   7106 S SD  . MET H 2 2   ? 34.833  -5.175  28.844  1.00 92.81  ? 58   MET H SD  1 
ATOM   7107 C CE  . MET H 2 2   ? 36.034  -3.911  28.117  1.00 90.90  ? 58   MET H CE  1 
ATOM   7108 N N   . ARG H 2 3   ? 31.452  -5.171  27.022  1.00 71.54  ? 59   ARG H N   1 
ATOM   7109 C CA  . ARG H 2 3   ? 30.213  -5.940  26.910  1.00 68.84  ? 59   ARG H CA  1 
ATOM   7110 C C   . ARG H 2 3   ? 29.368  -5.903  28.191  1.00 66.66  ? 59   ARG H C   1 
ATOM   7111 O O   . ARG H 2 3   ? 28.438  -6.697  28.378  1.00 66.90  ? 59   ARG H O   1 
ATOM   7112 C CB  . ARG H 2 3   ? 30.466  -7.379  26.441  1.00 69.60  ? 59   ARG H CB  1 
ATOM   7113 C CG  . ARG H 2 3   ? 31.867  -7.895  26.669  1.00 70.32  ? 59   ARG H CG  1 
ATOM   7114 C CD  . ARG H 2 3   ? 31.846  -9.375  27.007  1.00 73.02  ? 59   ARG H CD  1 
ATOM   7115 N NE  . ARG H 2 3   ? 32.369  -9.616  28.346  1.00 75.99  ? 59   ARG H NE  1 
ATOM   7116 C CZ  . ARG H 2 3   ? 32.222  -10.749 29.025  1.00 76.81  ? 59   ARG H CZ  1 
ATOM   7117 N NH1 . ARG H 2 3   ? 31.559  -11.770 28.495  1.00 78.86  ? 59   ARG H NH1 1 
ATOM   7118 N NH2 . ARG H 2 3   ? 32.743  -10.860 30.236  1.00 77.09  ? 59   ARG H NH2 1 
ATOM   7119 N N   . LYS H 2 4   ? 29.674  -4.936  29.047  1.00 58.67  ? 60   LYS H N   1 
ATOM   7120 C CA  . LYS H 2 4   ? 28.923  -4.720  30.271  1.00 55.60  ? 60   LYS H CA  1 
ATOM   7121 C C   . LYS H 2 4   ? 28.082  -3.477  30.131  1.00 54.42  ? 60   LYS H C   1 
ATOM   7122 O O   . LYS H 2 4   ? 28.605  -2.391  29.912  1.00 53.63  ? 60   LYS H O   1 
ATOM   7123 C CB  . LYS H 2 4   ? 29.875  -4.499  31.424  1.00 59.05  ? 60   LYS H CB  1 
ATOM   7124 C CG  . LYS H 2 4   ? 30.838  -5.611  31.624  1.00 58.06  ? 60   LYS H CG  1 
ATOM   7125 C CD  . LYS H 2 4   ? 31.683  -5.332  32.840  1.00 56.25  ? 60   LYS H CD  1 
ATOM   7126 C CE  . LYS H 2 4   ? 32.117  -6.625  33.498  1.00 56.86  ? 60   LYS H CE  1 
ATOM   7127 N NZ  . LYS H 2 4   ? 31.580  -7.839  32.766  1.00 56.30  ? 60   LYS H NZ  1 
ATOM   7128 N N   . ILE H 2 5   ? 26.773  -3.627  30.283  1.00 48.30  ? 61   ILE H N   1 
ATOM   7129 C CA  . ILE H 2 5   ? 25.863  -2.482  30.214  1.00 47.23  ? 61   ILE H CA  1 
ATOM   7130 C C   . ILE H 2 5   ? 25.286  -2.274  31.592  1.00 46.37  ? 61   ILE H C   1 
ATOM   7131 O O   . ILE H 2 5   ? 25.354  -3.175  32.424  1.00 46.00  ? 61   ILE H O   1 
ATOM   7132 C CB  . ILE H 2 5   ? 24.721  -2.656  29.175  1.00 48.68  ? 61   ILE H CB  1 
ATOM   7133 C CG1 . ILE H 2 5   ? 23.993  -3.970  29.377  1.00 49.73  ? 61   ILE H CG1 1 
ATOM   7134 C CG2 . ILE H 2 5   ? 25.241  -2.587  27.763  1.00 48.84  ? 61   ILE H CG2 1 
ATOM   7135 C CD1 . ILE H 2 5   ? 22.560  -3.925  28.988  1.00 47.90  ? 61   ILE H CD1 1 
ATOM   7136 N N   . LEU H 2 6   ? 24.769  -1.072  31.843  1.00 44.13  ? 62   LEU H N   1 
ATOM   7137 C CA  . LEU H 2 6   ? 24.111  -0.783  33.103  1.00 43.53  ? 62   LEU H CA  1 
ATOM   7138 C C   . LEU H 2 6   ? 22.814  -0.113  32.761  1.00 43.06  ? 62   LEU H C   1 
ATOM   7139 O O   . LEU H 2 6   ? 22.813  0.826   31.968  1.00 42.85  ? 62   LEU H O   1 
ATOM   7140 C CB  . LEU H 2 6   ? 24.956  0.085   34.037  1.00 44.40  ? 62   LEU H CB  1 
ATOM   7141 C CG  . LEU H 2 6   ? 24.254  1.077   34.988  1.00 42.95  ? 62   LEU H CG  1 
ATOM   7142 C CD1 . LEU H 2 6   ? 23.652  0.458   36.247  1.00 38.30  ? 62   LEU H CD1 1 
ATOM   7143 C CD2 . LEU H 2 6   ? 25.265  2.170   35.356  1.00 43.92  ? 62   LEU H CD2 1 
ATOM   7144 N N   . ILE H 2 7   ? 21.728  -0.667  33.331  1.00 42.95  ? 63   ILE H N   1 
ATOM   7145 C CA  . ILE H 2 7   ? 20.322  -0.243  33.133  1.00 42.51  ? 63   ILE H CA  1 
ATOM   7146 C C   . ILE H 2 7   ? 19.771  0.489   34.350  1.00 42.33  ? 63   ILE H C   1 
ATOM   7147 O O   . ILE H 2 7   ? 19.772  -0.058  35.441  1.00 41.96  ? 63   ILE H O   1 
ATOM   7148 C CB  . ILE H 2 7   ? 19.399  -1.462  32.854  1.00 44.66  ? 63   ILE H CB  1 
ATOM   7149 C CG1 . ILE H 2 7   ? 19.653  -2.075  31.482  1.00 43.93  ? 63   ILE H CG1 1 
ATOM   7150 C CG2 . ILE H 2 7   ? 17.949  -1.100  33.013  1.00 44.09  ? 63   ILE H CG2 1 
ATOM   7151 C CD1 . ILE H 2 7   ? 19.347  -3.565  31.447  1.00 43.16  ? 63   ILE H CD1 1 
ATOM   7152 N N   . ARG H 2 8   ? 19.252  1.702   34.134  1.00 43.03  ? 64   ARG H N   1 
ATOM   7153 C CA  . ARG H 2 8   ? 18.672  2.542   35.189  1.00 42.42  ? 64   ARG H CA  1 
ATOM   7154 C C   . ARG H 2 8   ? 17.207  2.794   34.858  1.00 42.23  ? 64   ARG H C   1 
ATOM   7155 O O   . ARG H 2 8   ? 16.797  2.758   33.685  1.00 42.23  ? 64   ARG H O   1 
ATOM   7156 C CB  . ARG H 2 8   ? 19.372  3.896   35.220  1.00 48.60  ? 64   ARG H CB  1 
ATOM   7157 C CG  . ARG H 2 8   ? 20.812  3.870   35.691  1.00 49.96  ? 64   ARG H CG  1 
ATOM   7158 C CD  . ARG H 2 8   ? 21.106  5.035   36.627  1.00 52.19  ? 64   ARG H CD  1 
ATOM   7159 N NE  . ARG H 2 8   ? 22.530  5.325   36.810  1.00 56.85  ? 64   ARG H NE  1 
ATOM   7160 C CZ  . ARG H 2 8   ? 23.187  6.314   36.195  1.00 61.05  ? 64   ARG H CZ  1 
ATOM   7161 N NH1 . ARG H 2 8   ? 22.555  7.094   35.321  1.00 62.25  ? 64   ARG H NH1 1 
ATOM   7162 N NH2 . ARG H 2 8   ? 24.484  6.518   36.437  1.00 62.63  ? 64   ARG H NH2 1 
ATOM   7163 N N   . GLY H 2 9   ? 16.409  3.051   35.889  1.00 42.47  ? 65   GLY H N   1 
ATOM   7164 C CA  . GLY H 2 9   ? 15.016  3.390   35.697  1.00 41.98  ? 65   GLY H CA  1 
ATOM   7165 C C   . GLY H 2 9   ? 14.062  2.239   35.769  1.00 42.00  ? 65   GLY H C   1 
ATOM   7166 O O   . GLY H 2 9   ? 12.881  2.383   35.466  1.00 42.99  ? 65   GLY H O   1 
ATOM   7167 N N   . LEU H 2 10  ? 14.563  1.080   36.168  1.00 41.48  ? 66   LEU H N   1 
ATOM   7168 C CA  . LEU H 2 10  ? 13.726  -0.106  36.303  1.00 42.08  ? 66   LEU H CA  1 
ATOM   7169 C C   . LEU H 2 10  ? 12.620  0.143   37.337  1.00 42.89  ? 66   LEU H C   1 
ATOM   7170 O O   . LEU H 2 10  ? 12.781  1.000   38.215  1.00 43.41  ? 66   LEU H O   1 
ATOM   7171 C CB  . LEU H 2 10  ? 14.605  -1.299  36.700  1.00 41.74  ? 66   LEU H CB  1 
ATOM   7172 C CG  . LEU H 2 10  ? 15.534  -1.789  35.576  1.00 41.31  ? 66   LEU H CG  1 
ATOM   7173 C CD1 . LEU H 2 10  ? 16.717  -2.571  36.107  1.00 40.70  ? 66   LEU H CD1 1 
ATOM   7174 C CD2 . LEU H 2 10  ? 14.792  -2.546  34.464  1.00 39.33  ? 66   LEU H CD2 1 
ATOM   7175 N N   . PRO H 2 11  ? 11.480  -0.593  37.245  1.00 43.77  ? 67   PRO H N   1 
ATOM   7176 C CA  . PRO H 2 11  ? 10.352  -0.515  38.200  1.00 44.38  ? 67   PRO H CA  1 
ATOM   7177 C C   . PRO H 2 11  ? 10.744  -0.934  39.636  1.00 44.74  ? 67   PRO H C   1 
ATOM   7178 O O   . PRO H 2 11  ? 11.706  -1.695  39.828  1.00 44.95  ? 67   PRO H O   1 
ATOM   7179 C CB  . PRO H 2 11  ? 9.357   -1.508  37.624  1.00 45.65  ? 67   PRO H CB  1 
ATOM   7180 C CG  . PRO H 2 11  ? 9.627   -1.492  36.145  1.00 46.11  ? 67   PRO H CG  1 
ATOM   7181 C CD  . PRO H 2 11  ? 11.097  -1.281  35.992  1.00 45.25  ? 67   PRO H CD  1 
ATOM   7182 N N   . GLY H 2 12  ? 10.025  -0.442  40.645  1.00 43.92  ? 68   GLY H N   1 
ATOM   7183 C CA  . GLY H 2 12  ? 10.325  -0.803  42.024  1.00 45.28  ? 68   GLY H CA  1 
ATOM   7184 C C   . GLY H 2 12  ? 10.167  -2.294  42.310  1.00 46.44  ? 68   GLY H C   1 
ATOM   7185 O O   . GLY H 2 12  ? 10.931  -2.931  43.057  1.00 46.37  ? 68   GLY H O   1 
ATOM   7186 N N   . ASP H 2 13  ? 9.163   -2.862  41.667  1.00 50.38  ? 69   ASP H N   1 
ATOM   7187 C CA  . ASP H 2 13  ? 8.834   -4.255  41.847  1.00 51.40  ? 69   ASP H CA  1 
ATOM   7188 C C   . ASP H 2 13  ? 9.339   -5.099  40.661  1.00 51.15  ? 69   ASP H C   1 
ATOM   7189 O O   . ASP H 2 13  ? 8.740   -6.130  40.308  1.00 50.97  ? 69   ASP H O   1 
ATOM   7190 C CB  . ASP H 2 13  ? 7.319   -4.367  41.979  1.00 54.02  ? 69   ASP H CB  1 
ATOM   7191 C CG  . ASP H 2 13  ? 6.593   -3.726  40.796  1.00 56.61  ? 69   ASP H CG  1 
ATOM   7192 O OD1 . ASP H 2 13  ? 7.273   -2.980  40.052  1.00 56.13  ? 69   ASP H OD1 1 
ATOM   7193 O OD2 . ASP H 2 13  ? 5.391   -4.043  40.551  1.00 58.15  ? 69   ASP H OD2 1 
ATOM   7194 N N   . VAL H 2 14  ? 10.453  -4.682  40.068  1.00 47.53  ? 70   VAL H N   1 
ATOM   7195 C CA  . VAL H 2 14  ? 11.020  -5.429  38.960  1.00 47.36  ? 70   VAL H CA  1 
ATOM   7196 C C   . VAL H 2 14  ? 11.550  -6.757  39.513  1.00 47.41  ? 70   VAL H C   1 
ATOM   7197 O O   . VAL H 2 14  ? 11.994  -6.830  40.683  1.00 47.59  ? 70   VAL H O   1 
ATOM   7198 C CB  . VAL H 2 14  ? 12.117  -4.602  38.254  1.00 47.57  ? 70   VAL H CB  1 
ATOM   7199 C CG1 . VAL H 2 14  ? 13.386  -4.632  39.051  1.00 47.44  ? 70   VAL H CG1 1 
ATOM   7200 C CG2 . VAL H 2 14  ? 12.367  -5.086  36.863  1.00 47.23  ? 70   VAL H CG2 1 
ATOM   7201 N N   . THR H 2 15  ? 11.478  -7.811  38.688  1.00 50.45  ? 71   THR H N   1 
ATOM   7202 C CA  . THR H 2 15  ? 12.040  -9.124  39.044  1.00 50.04  ? 71   THR H CA  1 
ATOM   7203 C C   . THR H 2 15  ? 13.241  -9.432  38.135  1.00 49.62  ? 71   THR H C   1 
ATOM   7204 O O   . THR H 2 15  ? 13.399  -8.827  37.068  1.00 49.62  ? 71   THR H O   1 
ATOM   7205 C CB  . THR H 2 15  ? 10.983  -10.247 38.985  1.00 50.61  ? 71   THR H CB  1 
ATOM   7206 O OG1 . THR H 2 15  ? 10.634  -10.536 37.617  1.00 51.31  ? 71   THR H OG1 1 
ATOM   7207 C CG2 . THR H 2 15  ? 9.756   -9.851  39.742  1.00 50.11  ? 71   THR H CG2 1 
ATOM   7208 N N   . ASN H 2 16  ? 14.090  -10.367 38.538  1.00 51.55  ? 72   ASN H N   1 
ATOM   7209 C CA  . ASN H 2 16  ? 15.209  -10.711 37.689  1.00 51.05  ? 72   ASN H CA  1 
ATOM   7210 C C   . ASN H 2 16  ? 14.664  -11.221 36.364  1.00 51.21  ? 72   ASN H C   1 
ATOM   7211 O O   . ASN H 2 16  ? 15.106  -10.794 35.308  1.00 51.36  ? 72   ASN H O   1 
ATOM   7212 C CB  . ASN H 2 16  ? 16.108  -11.733 38.361  1.00 54.74  ? 72   ASN H CB  1 
ATOM   7213 C CG  . ASN H 2 16  ? 16.677  -11.219 39.643  1.00 54.67  ? 72   ASN H CG  1 
ATOM   7214 O OD1 . ASN H 2 16  ? 17.627  -10.426 39.643  1.00 56.71  ? 72   ASN H OD1 1 
ATOM   7215 N ND2 . ASN H 2 16  ? 15.990  -11.508 40.731  1.00 56.05  ? 72   ASN H ND2 1 
ATOM   7216 N N   . GLN H 2 17  ? 13.633  -12.046 36.433  1.00 51.21  ? 73   GLN H N   1 
ATOM   7217 C CA  . GLN H 2 17  ? 13.006  -12.573 35.239  1.00 51.55  ? 73   GLN H CA  1 
ATOM   7218 C C   . GLN H 2 17  ? 12.694  -11.490 34.220  1.00 51.36  ? 73   GLN H C   1 
ATOM   7219 O O   . GLN H 2 17  ? 13.079  -11.579 33.051  1.00 51.20  ? 73   GLN H O   1 
ATOM   7220 C CB  . GLN H 2 17  ? 11.728  -13.333 35.590  1.00 55.44  ? 73   GLN H CB  1 
ATOM   7221 C CG  . GLN H 2 17  ? 11.288  -14.326 34.500  1.00 55.53  ? 73   GLN H CG  1 
ATOM   7222 C CD  . GLN H 2 17  ? 12.470  -15.103 33.923  1.00 58.42  ? 73   GLN H CD  1 
ATOM   7223 O OE1 . GLN H 2 17  ? 12.585  -15.268 32.704  1.00 60.08  ? 73   GLN H OE1 1 
ATOM   7224 N NE2 . GLN H 2 17  ? 13.396  -15.520 34.798  1.00 59.10  ? 73   GLN H NE2 1 
ATOM   7225 N N   . GLU H 2 18  ? 12.013  -10.451 34.673  1.00 51.03  ? 74   GLU H N   1 
ATOM   7226 C CA  . GLU H 2 18  ? 11.689  -9.354  33.784  1.00 51.45  ? 74   GLU H CA  1 
ATOM   7227 C C   . GLU H 2 18  ? 12.900  -8.812  32.994  1.00 50.68  ? 74   GLU H C   1 
ATOM   7228 O O   . GLU H 2 18  ? 12.756  -8.426  31.829  1.00 50.74  ? 74   GLU H O   1 
ATOM   7229 C CB  . GLU H 2 18  ? 10.990  -8.232  34.550  1.00 54.73  ? 74   GLU H CB  1 
ATOM   7230 C CG  . GLU H 2 18  ? 9.919   -8.690  35.550  1.00 57.87  ? 74   GLU H CG  1 
ATOM   7231 C CD  . GLU H 2 18  ? 8.993   -7.525  36.030  1.00 61.83  ? 74   GLU H CD  1 
ATOM   7232 O OE1 . GLU H 2 18  ? 9.043   -6.414  35.438  1.00 62.42  ? 74   GLU H OE1 1 
ATOM   7233 O OE2 . GLU H 2 18  ? 8.193   -7.736  36.982  1.00 62.56  ? 74   GLU H OE2 1 
ATOM   7234 N N   . VAL H 2 19  ? 14.078  -8.794  33.619  1.00 44.40  ? 75   VAL H N   1 
ATOM   7235 C CA  . VAL H 2 19  ? 15.284  -8.280  32.963  1.00 43.92  ? 75   VAL H CA  1 
ATOM   7236 C C   . VAL H 2 19  ? 15.744  -9.221  31.886  1.00 43.74  ? 75   VAL H C   1 
ATOM   7237 O O   . VAL H 2 19  ? 16.113  -8.801  30.813  1.00 43.00  ? 75   VAL H O   1 
ATOM   7238 C CB  . VAL H 2 19  ? 16.442  -7.984  33.972  1.00 45.08  ? 75   VAL H CB  1 
ATOM   7239 C CG1 . VAL H 2 19  ? 17.662  -7.446  33.250  1.00 42.19  ? 75   VAL H CG1 1 
ATOM   7240 C CG2 . VAL H 2 19  ? 15.994  -7.023  35.020  1.00 45.17  ? 75   VAL H CG2 1 
ATOM   7241 N N   . HIS H 2 20  ? 15.763  -10.501 32.220  1.00 49.92  ? 76   HIS H N   1 
ATOM   7242 C CA  . HIS H 2 20  ? 16.192  -11.540 31.302  1.00 50.80  ? 76   HIS H CA  1 
ATOM   7243 C C   . HIS H 2 20  ? 15.200  -11.559 30.138  1.00 51.56  ? 76   HIS H C   1 
ATOM   7244 O O   . HIS H 2 20  ? 15.563  -11.813 28.984  1.00 51.58  ? 76   HIS H O   1 
ATOM   7245 C CB  . HIS H 2 20  ? 16.182  -12.909 32.001  1.00 53.21  ? 76   HIS H CB  1 
ATOM   7246 C CG  . HIS H 2 20  ? 17.062  -12.996 33.220  1.00 54.04  ? 76   HIS H CG  1 
ATOM   7247 N ND1 . HIS H 2 20  ? 17.760  -14.142 33.547  1.00 54.70  ? 76   HIS H ND1 1 
ATOM   7248 C CD2 . HIS H 2 20  ? 17.278  -12.126 34.239  1.00 53.02  ? 76   HIS H CD2 1 
ATOM   7249 C CE1 . HIS H 2 20  ? 18.408  -13.952 34.686  1.00 53.59  ? 76   HIS H CE1 1 
ATOM   7250 N NE2 . HIS H 2 20  ? 18.119  -12.744 35.137  1.00 53.02  ? 76   HIS H NE2 1 
ATOM   7251 N N   . ASP H 2 21  ? 13.938  -11.313 30.465  1.00 54.02  ? 77   ASP H N   1 
ATOM   7252 C CA  . ASP H 2 21  ? 12.898  -11.311 29.465  1.00 54.56  ? 77   ASP H CA  1 
ATOM   7253 C C   . ASP H 2 21  ? 13.099  -10.123 28.552  1.00 54.84  ? 77   ASP H C   1 
ATOM   7254 O O   . ASP H 2 21  ? 12.814  -10.181 27.341  1.00 55.66  ? 77   ASP H O   1 
ATOM   7255 C CB  . ASP H 2 21  ? 11.535  -11.220 30.133  1.00 58.42  ? 77   ASP H CB  1 
ATOM   7256 C CG  . ASP H 2 21  ? 11.039  -12.569 30.625  1.00 60.09  ? 77   ASP H CG  1 
ATOM   7257 O OD1 . ASP H 2 21  ? 11.567  -13.619 30.141  1.00 60.58  ? 77   ASP H OD1 1 
ATOM   7258 O OD2 . ASP H 2 21  ? 10.155  -12.570 31.534  1.00 62.17  ? 77   ASP H OD2 1 
ATOM   7259 N N   . LEU H 2 22  ? 13.519  -9.021  29.163  1.00 53.89  ? 78   LEU H N   1 
ATOM   7260 C CA  . LEU H 2 22  ? 13.758  -7.784  28.448  1.00 54.11  ? 78   LEU H CA  1 
ATOM   7261 C C   . LEU H 2 22  ? 14.832  -8.013  27.380  1.00 54.89  ? 78   LEU H C   1 
ATOM   7262 O O   . LEU H 2 22  ? 14.616  -7.785  26.181  1.00 55.00  ? 78   LEU H O   1 
ATOM   7263 C CB  . LEU H 2 22  ? 14.189  -6.711  29.436  1.00 53.53  ? 78   LEU H CB  1 
ATOM   7264 C CG  . LEU H 2 22  ? 14.658  -5.391  28.836  1.00 54.02  ? 78   LEU H CG  1 
ATOM   7265 C CD1 . LEU H 2 22  ? 13.502  -4.595  28.236  1.00 53.73  ? 78   LEU H CD1 1 
ATOM   7266 C CD2 . LEU H 2 22  ? 15.427  -4.585  29.878  1.00 54.59  ? 78   LEU H CD2 1 
ATOM   7267 N N   . LEU H 2 23  ? 15.962  -8.552  27.812  1.00 52.23  ? 79   LEU H N   1 
ATOM   7268 C CA  . LEU H 2 23  ? 17.050  -8.853  26.913  1.00 52.41  ? 79   LEU H CA  1 
ATOM   7269 C C   . LEU H 2 23  ? 17.012  -10.329 26.552  1.00 53.14  ? 79   LEU H C   1 
ATOM   7270 O O   . LEU H 2 23  ? 17.993  -11.042 26.692  1.00 53.28  ? 79   LEU H O   1 
ATOM   7271 C CB  . LEU H 2 23  ? 18.340  -8.521  27.623  1.00 52.08  ? 79   LEU H CB  1 
ATOM   7272 C CG  . LEU H 2 23  ? 18.113  -7.486  28.725  1.00 52.78  ? 79   LEU H CG  1 
ATOM   7273 C CD1 . LEU H 2 23  ? 19.138  -7.643  29.862  1.00 51.91  ? 79   LEU H CD1 1 
ATOM   7274 C CD2 . LEU H 2 23  ? 18.087  -6.055  28.175  1.00 52.43  ? 79   LEU H CD2 1 
ATOM   7275 N N   . SER H 2 24  ? 15.847  -10.781 26.102  1.00 56.40  ? 80   SER H N   1 
ATOM   7276 C CA  . SER H 2 24  ? 15.641  -12.180 25.748  1.00 57.03  ? 80   SER H CA  1 
ATOM   7277 C C   . SER H 2 24  ? 16.383  -12.509 24.481  1.00 57.96  ? 80   SER H C   1 
ATOM   7278 O O   . SER H 2 24  ? 16.688  -13.669 24.213  1.00 58.88  ? 80   SER H O   1 
ATOM   7279 C CB  . SER H 2 24  ? 14.146  -12.527 25.605  1.00 58.17  ? 80   SER H CB  1 
ATOM   7280 O OG  . SER H 2 24  ? 13.414  -11.512 24.949  1.00 57.47  ? 80   SER H OG  1 
ATOM   7281 N N   . ASP H 2 25  ? 16.720  -11.469 23.732  1.00 57.76  ? 81   ASP H N   1 
ATOM   7282 C CA  . ASP H 2 25  ? 17.397  -11.626 22.457  1.00 58.38  ? 81   ASP H CA  1 
ATOM   7283 C C   . ASP H 2 25  ? 18.916  -11.688 22.526  1.00 58.69  ? 81   ASP H C   1 
ATOM   7284 O O   . ASP H 2 25  ? 19.578  -11.691 21.482  1.00 59.07  ? 81   ASP H O   1 
ATOM   7285 C CB  . ASP H 2 25  ? 16.976  -10.487 21.542  1.00 63.16  ? 81   ASP H CB  1 
ATOM   7286 C CG  . ASP H 2 25  ? 15.995  -10.932 20.498  1.00 63.99  ? 81   ASP H CG  1 
ATOM   7287 O OD1 . ASP H 2 25  ? 15.028  -10.181 20.232  1.00 62.70  ? 81   ASP H OD1 1 
ATOM   7288 O OD2 . ASP H 2 25  ? 16.200  -12.037 19.950  1.00 63.40  ? 81   ASP H OD2 1 
ATOM   7289 N N   . TYR H 2 26  ? 19.465  -11.697 23.742  1.00 57.09  ? 82   TYR H N   1 
ATOM   7290 C CA  . TYR H 2 26  ? 20.925  -11.693 23.951  1.00 57.38  ? 82   TYR H CA  1 
ATOM   7291 C C   . TYR H 2 26  ? 21.425  -12.762 24.917  1.00 57.20  ? 82   TYR H C   1 
ATOM   7292 O O   . TYR H 2 26  ? 20.656  -13.340 25.696  1.00 57.33  ? 82   TYR H O   1 
ATOM   7293 C CB  . TYR H 2 26  ? 21.419  -10.301 24.426  1.00 58.90  ? 82   TYR H CB  1 
ATOM   7294 C CG  . TYR H 2 26  ? 20.933  -9.162  23.556  1.00 58.76  ? 82   TYR H CG  1 
ATOM   7295 C CD1 . TYR H 2 26  ? 21.567  -8.875  22.338  1.00 58.16  ? 82   TYR H CD1 1 
ATOM   7296 C CD2 . TYR H 2 26  ? 19.764  -8.473  23.871  1.00 56.73  ? 82   TYR H CD2 1 
ATOM   7297 C CE1 . TYR H 2 26  ? 21.057  -7.934  21.457  1.00 57.40  ? 82   TYR H CE1 1 
ATOM   7298 C CE2 . TYR H 2 26  ? 19.243  -7.527  23.001  1.00 57.25  ? 82   TYR H CE2 1 
ATOM   7299 C CZ  . TYR H 2 26  ? 19.896  -7.256  21.790  1.00 58.57  ? 82   TYR H CZ  1 
ATOM   7300 O OH  . TYR H 2 26  ? 19.383  -6.299  20.924  1.00 60.46  ? 82   TYR H OH  1 
ATOM   7301 N N   . GLU H 2 27  ? 22.730  -12.990 24.890  1.00 56.56  ? 83   GLU H N   1 
ATOM   7302 C CA  . GLU H 2 27  ? 23.334  -13.944 25.801  1.00 57.27  ? 83   GLU H CA  1 
ATOM   7303 C C   . GLU H 2 27  ? 23.847  -13.299 27.079  1.00 57.19  ? 83   GLU H C   1 
ATOM   7304 O O   . GLU H 2 27  ? 24.917  -12.675 27.100  1.00 57.06  ? 83   GLU H O   1 
ATOM   7305 C CB  . GLU H 2 27  ? 24.459  -14.721 25.140  1.00 60.74  ? 83   GLU H CB  1 
ATOM   7306 C CG  . GLU H 2 27  ? 24.733  -16.090 25.798  1.00 62.59  ? 83   GLU H CG  1 
ATOM   7307 C CD  . GLU H 2 27  ? 25.976  -16.774 25.234  1.00 64.76  ? 83   GLU H CD  1 
ATOM   7308 O OE1 . GLU H 2 27  ? 26.205  -17.979 25.516  1.00 65.23  ? 83   GLU H OE1 1 
ATOM   7309 O OE2 . GLU H 2 27  ? 26.716  -16.093 24.490  1.00 64.69  ? 83   GLU H OE2 1 
ATOM   7310 N N   . LEU H 2 28  ? 23.080  -13.482 28.149  1.00 55.47  ? 84   LEU H N   1 
ATOM   7311 C CA  . LEU H 2 28  ? 23.447  -12.933 29.428  1.00 55.46  ? 84   LEU H CA  1 
ATOM   7312 C C   . LEU H 2 28  ? 24.519  -13.820 30.006  1.00 55.78  ? 84   LEU H C   1 
ATOM   7313 O O   . LEU H 2 28  ? 24.355  -15.027 30.042  1.00 56.54  ? 84   LEU H O   1 
ATOM   7314 C CB  . LEU H 2 28  ? 22.250  -12.923 30.359  1.00 55.29  ? 84   LEU H CB  1 
ATOM   7315 C CG  . LEU H 2 28  ? 21.132  -11.993 29.934  1.00 55.85  ? 84   LEU H CG  1 
ATOM   7316 C CD1 . LEU H 2 28  ? 20.335  -11.553 31.162  1.00 56.87  ? 84   LEU H CD1 1 
ATOM   7317 C CD2 . LEU H 2 28  ? 21.711  -10.796 29.172  1.00 56.68  ? 84   LEU H CD2 1 
ATOM   7318 N N   . LYS H 2 29  ? 25.618  -13.212 30.434  1.00 54.67  ? 85   LYS H N   1 
ATOM   7319 C CA  . LYS H 2 29  ? 26.716  -13.922 31.060  1.00 54.96  ? 85   LYS H CA  1 
ATOM   7320 C C   . LYS H 2 29  ? 26.778  -13.463 32.524  1.00 54.67  ? 85   LYS H C   1 
ATOM   7321 O O   . LYS H 2 29  ? 27.303  -14.160 33.395  1.00 54.22  ? 85   LYS H O   1 
ATOM   7322 C CB  . LYS H 2 29  ? 28.022  -13.599 30.332  1.00 54.45  ? 85   LYS H CB  1 
ATOM   7323 C CG  . LYS H 2 29  ? 28.000  -13.931 28.830  1.00 56.48  ? 85   LYS H CG  1 
ATOM   7324 C CD  . LYS H 2 29  ? 28.844  -15.170 28.569  1.00 59.52  ? 85   LYS H CD  1 
ATOM   7325 C CE  . LYS H 2 29  ? 28.213  -16.071 27.498  1.00 61.10  ? 85   LYS H CE  1 
ATOM   7326 N NZ  . LYS H 2 29  ? 28.874  -17.434 27.403  1.00 62.89  ? 85   LYS H NZ  1 
ATOM   7327 N N   . TYR H 2 30  ? 26.221  -12.280 32.780  1.00 57.28  ? 86   TYR H N   1 
ATOM   7328 C CA  . TYR H 2 30  ? 26.116  -11.722 34.130  1.00 56.36  ? 86   TYR H CA  1 
ATOM   7329 C C   . TYR H 2 30  ? 24.886  -10.837 34.269  1.00 55.67  ? 86   TYR H C   1 
ATOM   7330 O O   . TYR H 2 30  ? 24.537  -10.083 33.348  1.00 55.81  ? 86   TYR H O   1 
ATOM   7331 C CB  . TYR H 2 30  ? 27.329  -10.922 34.532  1.00 58.71  ? 86   TYR H CB  1 
ATOM   7332 C CG  . TYR H 2 30  ? 27.280  -10.533 35.990  1.00 59.55  ? 86   TYR H CG  1 
ATOM   7333 C CD1 . TYR H 2 30  ? 27.381  -11.501 36.979  1.00 60.74  ? 86   TYR H CD1 1 
ATOM   7334 C CD2 . TYR H 2 30  ? 27.094  -9.209  36.383  1.00 61.60  ? 86   TYR H CD2 1 
ATOM   7335 C CE1 . TYR H 2 30  ? 27.339  -11.177 38.319  1.00 62.66  ? 86   TYR H CE1 1 
ATOM   7336 C CE2 . TYR H 2 30  ? 27.071  -8.855  37.731  1.00 63.82  ? 86   TYR H CE2 1 
ATOM   7337 C CZ  . TYR H 2 30  ? 27.186  -9.855  38.699  1.00 64.67  ? 86   TYR H CZ  1 
ATOM   7338 O OH  . TYR H 2 30  ? 27.159  -9.555  40.059  1.00 67.08  ? 86   TYR H OH  1 
ATOM   7339 N N   . CYS H 2 31  ? 24.221  -10.938 35.419  1.00 53.05  ? 87   CYS H N   1 
ATOM   7340 C CA  . CYS H 2 31  ? 23.001  -10.203 35.636  1.00 52.14  ? 87   CYS H CA  1 
ATOM   7341 C C   . CYS H 2 31  ? 22.714  -9.998  37.081  1.00 51.34  ? 87   CYS H C   1 
ATOM   7342 O O   . CYS H 2 31  ? 22.262  -10.890 37.770  1.00 51.47  ? 87   CYS H O   1 
ATOM   7343 C CB  . CYS H 2 31  ? 21.834  -10.927 34.989  1.00 51.79  ? 87   CYS H CB  1 
ATOM   7344 S SG  . CYS H 2 31  ? 20.478  -9.857  34.744  1.00 52.50  ? 87   CYS H SG  1 
ATOM   7345 N N   . PHE H 2 32  ? 22.942  -8.792  37.546  1.00 52.77  ? 88   PHE H N   1 
ATOM   7346 C CA  . PHE H 2 32  ? 22.634  -8.488  38.925  1.00 52.69  ? 88   PHE H CA  1 
ATOM   7347 C C   . PHE H 2 32  ? 21.677  -7.307  39.021  1.00 52.36  ? 88   PHE H C   1 
ATOM   7348 O O   . PHE H 2 32  ? 22.014  -6.186  38.655  1.00 50.96  ? 88   PHE H O   1 
ATOM   7349 C CB  . PHE H 2 32  ? 23.888  -8.220  39.734  1.00 54.84  ? 88   PHE H CB  1 
ATOM   7350 C CG  . PHE H 2 32  ? 23.603  -7.669  41.094  1.00 56.35  ? 88   PHE H CG  1 
ATOM   7351 C CD1 . PHE H 2 32  ? 23.727  -6.307  41.358  1.00 57.85  ? 88   PHE H CD1 1 
ATOM   7352 C CD2 . PHE H 2 32  ? 23.141  -8.516  42.100  1.00 58.81  ? 88   PHE H CD2 1 
ATOM   7353 C CE1 . PHE H 2 32  ? 23.430  -5.801  42.608  1.00 59.36  ? 88   PHE H CE1 1 
ATOM   7354 C CE2 . PHE H 2 32  ? 22.826  -8.024  43.374  1.00 59.08  ? 88   PHE H CE2 1 
ATOM   7355 C CZ  . PHE H 2 32  ? 22.988  -6.665  43.630  1.00 60.54  ? 88   PHE H CZ  1 
ATOM   7356 N N   . VAL H 2 33  ? 20.479  -7.594  39.518  1.00 52.98  ? 89   VAL H N   1 
ATOM   7357 C CA  . VAL H 2 33  ? 19.419  -6.604  39.659  1.00 53.44  ? 89   VAL H CA  1 
ATOM   7358 C C   . VAL H 2 33  ? 19.367  -5.994  41.064  1.00 53.75  ? 89   VAL H C   1 
ATOM   7359 O O   . VAL H 2 33  ? 19.302  -6.722  42.067  1.00 53.96  ? 89   VAL H O   1 
ATOM   7360 C CB  . VAL H 2 33  ? 18.074  -7.214  39.263  1.00 55.38  ? 89   VAL H CB  1 
ATOM   7361 C CG1 . VAL H 2 33  ? 16.955  -6.416  39.869  1.00 55.95  ? 89   VAL H CG1 1 
ATOM   7362 C CG2 . VAL H 2 33  ? 17.953  -7.293  37.755  1.00 55.00  ? 89   VAL H CG2 1 
ATOM   7363 N N   . ASP H 2 34  ? 19.398  -4.665  41.133  1.00 56.05  ? 90   ASP H N   1 
ATOM   7364 C CA  . ASP H 2 34  ? 19.369  -3.973  42.415  1.00 56.06  ? 90   ASP H CA  1 
ATOM   7365 C C   . ASP H 2 34  ? 17.979  -3.412  42.638  1.00 55.74  ? 90   ASP H C   1 
ATOM   7366 O O   . ASP H 2 34  ? 17.661  -2.311  42.185  1.00 55.71  ? 90   ASP H O   1 
ATOM   7367 C CB  . ASP H 2 34  ? 20.410  -2.853  42.448  1.00 59.32  ? 90   ASP H CB  1 
ATOM   7368 C CG  . ASP H 2 34  ? 20.613  -2.290  43.836  1.00 61.34  ? 90   ASP H CG  1 
ATOM   7369 O OD1 . ASP H 2 34  ? 21.586  -1.522  44.042  1.00 62.51  ? 90   ASP H OD1 1 
ATOM   7370 O OD2 . ASP H 2 34  ? 19.769  -2.580  44.712  1.00 63.76  ? 90   ASP H OD2 1 
ATOM   7371 N N   . LYS H 2 35  ? 17.136  -4.180  43.315  1.00 57.23  ? 91   LYS H N   1 
ATOM   7372 C CA  . LYS H 2 35  ? 15.768  -3.759  43.552  1.00 57.42  ? 91   LYS H CA  1 
ATOM   7373 C C   . LYS H 2 35  ? 15.617  -2.450  44.327  1.00 57.78  ? 91   LYS H C   1 
ATOM   7374 O O   . LYS H 2 35  ? 14.697  -1.672  44.055  1.00 57.62  ? 91   LYS H O   1 
ATOM   7375 C CB  . LYS H 2 35  ? 14.961  -4.887  44.163  1.00 65.13  ? 91   LYS H CB  1 
ATOM   7376 C CG  . LYS H 2 35  ? 15.357  -6.240  43.617  1.00 65.30  ? 91   LYS H CG  1 
ATOM   7377 C CD  . LYS H 2 35  ? 14.171  -6.987  43.019  1.00 63.92  ? 91   LYS H CD  1 
ATOM   7378 C CE  . LYS H 2 35  ? 14.489  -8.469  42.827  1.00 62.63  ? 91   LYS H CE  1 
ATOM   7379 N NZ  . LYS H 2 35  ? 13.676  -9.306  43.765  1.00 60.50  ? 91   LYS H NZ  1 
ATOM   7380 N N   . TYR H 2 36  ? 16.536  -2.185  45.257  1.00 56.81  ? 92   TYR H N   1 
ATOM   7381 C CA  . TYR H 2 36  ? 16.485  -0.939  46.002  1.00 56.94  ? 92   TYR H CA  1 
ATOM   7382 C C   . TYR H 2 36  ? 16.822  0.265   45.104  1.00 56.37  ? 92   TYR H C   1 
ATOM   7383 O O   . TYR H 2 36  ? 16.356  1.375   45.341  1.00 56.05  ? 92   TYR H O   1 
ATOM   7384 C CB  . TYR H 2 36  ? 17.358  -0.974  47.274  1.00 62.12  ? 92   TYR H CB  1 
ATOM   7385 C CG  . TYR H 2 36  ? 17.607  0.417   47.861  1.00 64.17  ? 92   TYR H CG  1 
ATOM   7386 C CD1 . TYR H 2 36  ? 16.647  1.053   48.654  1.00 64.83  ? 92   TYR H CD1 1 
ATOM   7387 C CD2 . TYR H 2 36  ? 18.753  1.149   47.509  1.00 65.72  ? 92   TYR H CD2 1 
ATOM   7388 C CE1 . TYR H 2 36  ? 16.844  2.360   49.122  1.00 64.57  ? 92   TYR H CE1 1 
ATOM   7389 C CE2 . TYR H 2 36  ? 18.956  2.450   47.972  1.00 65.53  ? 92   TYR H CE2 1 
ATOM   7390 C CZ  . TYR H 2 36  ? 18.004  3.057   48.772  1.00 66.01  ? 92   TYR H CZ  1 
ATOM   7391 O OH  . TYR H 2 36  ? 18.234  4.357   49.218  1.00 66.67  ? 92   TYR H OH  1 
ATOM   7392 N N   . LYS H 2 37  ? 17.601  0.049   44.055  1.00 51.69  ? 93   LYS H N   1 
ATOM   7393 C CA  . LYS H 2 37  ? 17.976  1.147   43.169  1.00 51.54  ? 93   LYS H CA  1 
ATOM   7394 C C   . LYS H 2 37  ? 17.329  1.094   41.779  1.00 50.79  ? 93   LYS H C   1 
ATOM   7395 O O   . LYS H 2 37  ? 17.404  2.056   41.019  1.00 50.14  ? 93   LYS H O   1 
ATOM   7396 C CB  . LYS H 2 37  ? 19.493  1.245   43.053  1.00 52.71  ? 93   LYS H CB  1 
ATOM   7397 C CG  . LYS H 2 37  ? 20.209  1.231   44.381  1.00 53.93  ? 93   LYS H CG  1 
ATOM   7398 C CD  . LYS H 2 37  ? 20.026  2.560   45.071  1.00 56.73  ? 93   LYS H CD  1 
ATOM   7399 C CE  . LYS H 2 37  ? 21.343  3.118   45.628  1.00 57.43  ? 93   LYS H CE  1 
ATOM   7400 N NZ  . LYS H 2 37  ? 21.682  2.517   46.967  1.00 58.90  ? 93   LYS H NZ  1 
ATOM   7401 N N   . GLY H 2 38  ? 16.677  -0.010  41.442  1.00 48.02  ? 94   GLY H N   1 
ATOM   7402 C CA  . GLY H 2 38  ? 16.058  -0.097  40.137  1.00 47.48  ? 94   GLY H CA  1 
ATOM   7403 C C   . GLY H 2 38  ? 17.097  -0.055  39.036  1.00 46.98  ? 94   GLY H C   1 
ATOM   7404 O O   . GLY H 2 38  ? 16.851  0.453   37.944  1.00 47.15  ? 94   GLY H O   1 
ATOM   7405 N N   . THR H 2 39  ? 18.275  -0.592  39.334  1.00 47.21  ? 95   THR H N   1 
ATOM   7406 C CA  . THR H 2 39  ? 19.371  -0.640  38.366  1.00 46.85  ? 95   THR H CA  1 
ATOM   7407 C C   . THR H 2 39  ? 19.886  -2.066  38.225  1.00 46.90  ? 95   THR H C   1 
ATOM   7408 O O   . THR H 2 39  ? 19.974  -2.814  39.213  1.00 47.51  ? 95   THR H O   1 
ATOM   7409 C CB  . THR H 2 39  ? 20.518  0.376   38.661  1.00 48.33  ? 95   THR H CB  1 
ATOM   7410 O OG1 . THR H 2 39  ? 21.414  -0.164  39.630  1.00 47.80  ? 95   THR H OG1 1 
ATOM   7411 C CG2 . THR H 2 39  ? 19.964  1.664   39.184  1.00 48.38  ? 95   THR H CG2 1 
ATOM   7412 N N   . ALA H 2 40  ? 20.188  -2.443  36.986  1.00 45.22  ? 96   ALA H N   1 
ATOM   7413 C CA  . ALA H 2 40  ? 20.669  -3.769  36.694  1.00 45.19  ? 96   ALA H CA  1 
ATOM   7414 C C   . ALA H 2 40  ? 22.084  -3.727  36.111  1.00 45.69  ? 96   ALA H C   1 
ATOM   7415 O O   . ALA H 2 40  ? 22.435  -2.836  35.329  1.00 46.16  ? 96   ALA H O   1 
ATOM   7416 C CB  . ALA H 2 40  ? 19.687  -4.512  35.756  1.00 44.65  ? 96   ALA H CB  1 
ATOM   7417 N N   . PHE H 2 41  ? 22.897  -4.716  36.468  1.00 49.73  ? 97   PHE H N   1 
ATOM   7418 C CA  . PHE H 2 41  ? 24.230  -4.814  35.909  1.00 50.34  ? 97   PHE H CA  1 
ATOM   7419 C C   . PHE H 2 41  ? 24.300  -6.092  35.111  1.00 50.51  ? 97   PHE H C   1 
ATOM   7420 O O   . PHE H 2 41  ? 24.458  -7.173  35.670  1.00 50.15  ? 97   PHE H O   1 
ATOM   7421 C CB  . PHE H 2 41  ? 25.282  -4.843  36.994  1.00 53.15  ? 97   PHE H CB  1 
ATOM   7422 C CG  . PHE H 2 41  ? 25.302  -3.621  37.834  1.00 54.68  ? 97   PHE H CG  1 
ATOM   7423 C CD1 . PHE H 2 41  ? 24.383  -3.459  38.866  1.00 55.43  ? 97   PHE H CD1 1 
ATOM   7424 C CD2 . PHE H 2 41  ? 26.226  -2.622  37.591  1.00 55.99  ? 97   PHE H CD2 1 
ATOM   7425 C CE1 . PHE H 2 41  ? 24.377  -2.304  39.631  1.00 57.20  ? 97   PHE H CE1 1 
ATOM   7426 C CE2 . PHE H 2 41  ? 26.252  -1.469  38.375  1.00 57.18  ? 97   PHE H CE2 1 
ATOM   7427 C CZ  . PHE H 2 41  ? 25.322  -1.297  39.378  1.00 56.83  ? 97   PHE H CZ  1 
ATOM   7428 N N   . VAL H 2 42  ? 24.150  -5.945  33.800  1.00 51.05  ? 98   VAL H N   1 
ATOM   7429 C CA  . VAL H 2 42  ? 24.245  -7.054  32.873  1.00 51.94  ? 98   VAL H CA  1 
ATOM   7430 C C   . VAL H 2 42  ? 25.601  -7.043  32.175  1.00 52.92  ? 98   VAL H C   1 
ATOM   7431 O O   . VAL H 2 42  ? 26.278  -6.009  32.105  1.00 53.38  ? 98   VAL H O   1 
ATOM   7432 C CB  . VAL H 2 42  ? 23.080  -7.100  31.897  1.00 53.65  ? 98   VAL H CB  1 
ATOM   7433 C CG1 . VAL H 2 42  ? 22.706  -8.536  31.599  1.00 53.85  ? 98   VAL H CG1 1 
ATOM   7434 C CG2 . VAL H 2 42  ? 21.920  -6.420  32.521  1.00 53.01  ? 98   VAL H CG2 1 
ATOM   7435 N N   . THR H 2 43  ? 26.002  -8.239  31.744  1.00 53.24  ? 99   THR H N   1 
ATOM   7436 C CA  . THR H 2 43  ? 27.254  -8.498  31.039  1.00 54.05  ? 99   THR H CA  1 
ATOM   7437 C C   . THR H 2 43  ? 26.830  -9.390  29.855  1.00 54.21  ? 99   THR H C   1 
ATOM   7438 O O   . THR H 2 43  ? 26.221  -10.446 30.043  1.00 53.97  ? 99   THR H O   1 
ATOM   7439 C CB  . THR H 2 43  ? 28.266  -9.201  31.989  1.00 61.14  ? 99   THR H CB  1 
ATOM   7440 O OG1 . THR H 2 43  ? 28.775  -8.255  32.938  1.00 61.28  ? 99   THR H OG1 1 
ATOM   7441 C CG2 . THR H 2 43  ? 29.413  -9.825  31.223  1.00 62.39  ? 99   THR H CG2 1 
ATOM   7442 N N   . LEU H 2 44  ? 27.059  -8.909  28.637  1.00 54.12  ? 100  LEU H N   1 
ATOM   7443 C CA  . LEU H 2 44  ? 26.644  -9.659  27.447  1.00 54.70  ? 100  LEU H CA  1 
ATOM   7444 C C   . LEU H 2 44  ? 27.768  -10.448 26.798  1.00 54.64  ? 100  LEU H C   1 
ATOM   7445 O O   . LEU H 2 44  ? 28.930  -10.349 27.196  1.00 54.74  ? 100  LEU H O   1 
ATOM   7446 C CB  . LEU H 2 44  ? 25.969  -8.744  26.418  1.00 53.90  ? 100  LEU H CB  1 
ATOM   7447 C CG  . LEU H 2 44  ? 24.683  -8.094  26.947  1.00 54.78  ? 100  LEU H CG  1 
ATOM   7448 C CD1 . LEU H 2 44  ? 23.949  -7.323  25.882  1.00 52.74  ? 100  LEU H CD1 1 
ATOM   7449 C CD2 . LEU H 2 44  ? 23.779  -9.137  27.633  1.00 55.62  ? 100  LEU H CD2 1 
ATOM   7450 N N   . LEU H 2 45  ? 27.418  -11.228 25.789  1.00 55.31  ? 101  LEU H N   1 
ATOM   7451 C CA  . LEU H 2 45  ? 28.403  -12.037 25.092  1.00 55.34  ? 101  LEU H CA  1 
ATOM   7452 C C   . LEU H 2 45  ? 29.599  -11.264 24.527  1.00 55.25  ? 101  LEU H C   1 
ATOM   7453 O O   . LEU H 2 45  ? 30.737  -11.729 24.616  1.00 55.78  ? 101  LEU H O   1 
ATOM   7454 C CB  . LEU H 2 45  ? 27.734  -12.864 23.993  1.00 55.60  ? 101  LEU H CB  1 
ATOM   7455 C CG  . LEU H 2 45  ? 28.677  -13.770 23.193  1.00 54.37  ? 101  LEU H CG  1 
ATOM   7456 C CD1 . LEU H 2 45  ? 29.634  -14.470 24.137  1.00 49.13  ? 101  LEU H CD1 1 
ATOM   7457 C CD2 . LEU H 2 45  ? 27.896  -14.767 22.335  1.00 52.41  ? 101  LEU H CD2 1 
ATOM   7458 N N   . ASN H 2 46  ? 29.359  -10.098 23.940  1.00 55.07  ? 102  ASN H N   1 
ATOM   7459 C CA  . ASN H 2 46  ? 30.453  -9.329  23.353  1.00 55.20  ? 102  ASN H CA  1 
ATOM   7460 C C   . ASN H 2 46  ? 30.178  -7.837  23.126  1.00 55.89  ? 102  ASN H C   1 
ATOM   7461 O O   . ASN H 2 46  ? 29.220  -7.274  23.652  1.00 56.30  ? 102  ASN H O   1 
ATOM   7462 C CB  . ASN H 2 46  ? 30.875  -9.962  22.044  1.00 56.19  ? 102  ASN H CB  1 
ATOM   7463 C CG  . ASN H 2 46  ? 29.716  -10.132 21.094  1.00 56.11  ? 102  ASN H CG  1 
ATOM   7464 O OD1 . ASN H 2 46  ? 29.083  -9.153  20.684  1.00 55.39  ? 102  ASN H OD1 1 
ATOM   7465 N ND2 . ASN H 2 46  ? 29.396  -11.386 20.770  1.00 54.98  ? 102  ASN H ND2 1 
ATOM   7466 N N   . GLY H 2 47  ? 31.047  -7.192  22.355  1.00 55.94  ? 103  GLY H N   1 
ATOM   7467 C CA  . GLY H 2 47  ? 30.938  -5.769  22.118  1.00 55.63  ? 103  GLY H CA  1 
ATOM   7468 C C   . GLY H 2 47  ? 29.703  -5.460  21.334  1.00 55.66  ? 103  GLY H C   1 
ATOM   7469 O O   . GLY H 2 47  ? 28.981  -4.527  21.658  1.00 55.43  ? 103  GLY H O   1 
ATOM   7470 N N   . GLU H 2 48  ? 29.477  -6.230  20.281  1.00 58.87  ? 104  GLU H N   1 
ATOM   7471 C CA  . GLU H 2 48  ? 28.344  -5.988  19.405  1.00 59.45  ? 104  GLU H CA  1 
ATOM   7472 C C   . GLU H 2 48  ? 27.022  -6.151  20.093  1.00 59.37  ? 104  GLU H C   1 
ATOM   7473 O O   . GLU H 2 48  ? 26.081  -5.438  19.763  1.00 59.26  ? 104  GLU H O   1 
ATOM   7474 C CB  . GLU H 2 48  ? 28.365  -6.897  18.197  1.00 63.76  ? 104  GLU H CB  1 
ATOM   7475 C CG  . GLU H 2 48  ? 28.057  -6.162  16.940  1.00 65.15  ? 104  GLU H CG  1 
ATOM   7476 C CD  . GLU H 2 48  ? 29.138  -5.158  16.653  1.00 67.42  ? 104  GLU H CD  1 
ATOM   7477 O OE1 . GLU H 2 48  ? 28.828  -4.077  16.090  1.00 68.91  ? 104  GLU H OE1 1 
ATOM   7478 O OE2 . GLU H 2 48  ? 30.298  -5.438  17.055  1.00 67.39  ? 104  GLU H OE2 1 
ATOM   7479 N N   . GLN H 2 49  ? 26.937  -7.126  21.000  1.00 57.13  ? 105  GLN H N   1 
ATOM   7480 C CA  . GLN H 2 49  ? 25.696  -7.390  21.727  1.00 56.75  ? 105  GLN H CA  1 
ATOM   7481 C C   . GLN H 2 49  ? 25.353  -6.195  22.618  1.00 56.86  ? 105  GLN H C   1 
ATOM   7482 O O   . GLN H 2 49  ? 24.229  -5.705  22.606  1.00 57.49  ? 105  GLN H O   1 
ATOM   7483 C CB  . GLN H 2 49  ? 25.795  -8.682  22.557  1.00 58.33  ? 105  GLN H CB  1 
ATOM   7484 C CG  . GLN H 2 49  ? 25.624  -9.975  21.776  1.00 58.54  ? 105  GLN H CG  1 
ATOM   7485 C CD  . GLN H 2 49  ? 24.871  -11.066 22.553  1.00 59.22  ? 105  GLN H CD  1 
ATOM   7486 O OE1 . GLN H 2 49  ? 25.197  -11.372 23.706  1.00 59.96  ? 105  GLN H OE1 1 
ATOM   7487 N NE2 . GLN H 2 49  ? 23.892  -11.691 21.897  1.00 58.77  ? 105  GLN H NE2 1 
ATOM   7488 N N   . ALA H 2 50  ? 26.332  -5.709  23.371  1.00 56.97  ? 106  ALA H N   1 
ATOM   7489 C CA  . ALA H 2 50  ? 26.116  -4.569  24.261  1.00 56.88  ? 106  ALA H CA  1 
ATOM   7490 C C   . ALA H 2 50  ? 25.701  -3.304  23.491  1.00 57.15  ? 106  ALA H C   1 
ATOM   7491 O O   . ALA H 2 50  ? 25.013  -2.419  24.019  1.00 57.82  ? 106  ALA H O   1 
ATOM   7492 C CB  . ALA H 2 50  ? 27.351  -4.311  25.122  1.00 57.31  ? 106  ALA H CB  1 
ATOM   7493 N N   . GLU H 2 51  ? 26.101  -3.239  22.231  1.00 59.30  ? 107  GLU H N   1 
ATOM   7494 C CA  . GLU H 2 51  ? 25.751  -2.121  21.373  1.00 58.68  ? 107  GLU H CA  1 
ATOM   7495 C C   . GLU H 2 51  ? 24.285  -2.212  20.957  1.00 57.65  ? 107  GLU H C   1 
ATOM   7496 O O   . GLU H 2 51  ? 23.540  -1.245  21.057  1.00 57.95  ? 107  GLU H O   1 
ATOM   7497 C CB  . GLU H 2 51  ? 26.623  -2.134  20.123  1.00 61.17  ? 107  GLU H CB  1 
ATOM   7498 C CG  . GLU H 2 51  ? 26.393  -0.952  19.246  1.00 63.74  ? 107  GLU H CG  1 
ATOM   7499 C CD  . GLU H 2 51  ? 27.504  0.063   19.391  1.00 69.70  ? 107  GLU H CD  1 
ATOM   7500 O OE1 . GLU H 2 51  ? 28.619  -0.263  18.931  1.00 72.25  ? 107  GLU H OE1 1 
ATOM   7501 O OE2 . GLU H 2 51  ? 27.295  1.142   20.009  1.00 72.10  ? 107  GLU H OE2 1 
ATOM   7502 N N   . ALA H 2 52  ? 23.883  -3.363  20.439  1.00 53.27  ? 108  ALA H N   1 
ATOM   7503 C CA  . ALA H 2 52  ? 22.516  -3.539  19.993  1.00 52.16  ? 108  ALA H CA  1 
ATOM   7504 C C   . ALA H 2 52  ? 21.542  -3.371  21.161  1.00 51.60  ? 108  ALA H C   1 
ATOM   7505 O O   . ALA H 2 52  ? 20.444  -2.802  21.001  1.00 51.65  ? 108  ALA H O   1 
ATOM   7506 C CB  . ALA H 2 52  ? 22.351  -4.902  19.374  1.00 52.73  ? 108  ALA H CB  1 
ATOM   7507 N N   . ALA H 2 53  ? 21.942  -3.917  22.317  1.00 48.44  ? 109  ALA H N   1 
ATOM   7508 C CA  . ALA H 2 53  ? 21.175  -3.849  23.545  1.00 47.33  ? 109  ALA H CA  1 
ATOM   7509 C C   . ALA H 2 53  ? 20.994  -2.380  23.923  1.00 46.95  ? 109  ALA H C   1 
ATOM   7510 O O   . ALA H 2 53  ? 19.897  -1.935  24.233  1.00 47.05  ? 109  ALA H O   1 
ATOM   7511 C CB  . ALA H 2 53  ? 21.896  -4.587  24.620  1.00 47.11  ? 109  ALA H CB  1 
ATOM   7512 N N   . ILE H 2 54  ? 22.067  -1.607  23.866  1.00 45.82  ? 110  ILE H N   1 
ATOM   7513 C CA  . ILE H 2 54  ? 21.972  -0.186  24.180  1.00 44.94  ? 110  ILE H CA  1 
ATOM   7514 C C   . ILE H 2 54  ? 21.003  0.492   23.208  1.00 45.47  ? 110  ILE H C   1 
ATOM   7515 O O   . ILE H 2 54  ? 20.142  1.284   23.590  1.00 45.80  ? 110  ILE H O   1 
ATOM   7516 C CB  . ILE H 2 54  ? 23.393  0.513   24.173  1.00 45.70  ? 110  ILE H CB  1 
ATOM   7517 C CG1 . ILE H 2 54  ? 24.167  0.172   25.459  1.00 45.56  ? 110  ILE H CG1 1 
ATOM   7518 C CG2 . ILE H 2 54  ? 23.266  1.998   24.038  1.00 42.68  ? 110  ILE H CG2 1 
ATOM   7519 C CD1 . ILE H 2 54  ? 25.591  0.675   25.497  1.00 46.81  ? 110  ILE H CD1 1 
ATOM   7520 N N   . ASN H 2 55  ? 21.158  0.200   21.929  1.00 50.40  ? 111  ASN H N   1 
ATOM   7521 C CA  . ASN H 2 55  ? 20.358  0.888   20.949  1.00 50.51  ? 111  ASN H CA  1 
ATOM   7522 C C   . ASN H 2 55  ? 18.901  0.532   20.921  1.00 50.18  ? 111  ASN H C   1 
ATOM   7523 O O   . ASN H 2 55  ? 18.051  1.411   20.762  1.00 50.83  ? 111  ASN H O   1 
ATOM   7524 C CB  . ASN H 2 55  ? 21.053  0.970   19.594  1.00 60.34  ? 111  ASN H CB  1 
ATOM   7525 C CG  . ASN H 2 55  ? 22.262  1.940   19.622  1.00 61.66  ? 111  ASN H CG  1 
ATOM   7526 O OD1 . ASN H 2 55  ? 22.114  3.150   19.898  1.00 60.20  ? 111  ASN H OD1 1 
ATOM   7527 N ND2 . ASN H 2 55  ? 23.469  1.382   19.472  1.00 62.68  ? 111  ASN H ND2 1 
ATOM   7528 N N   . ALA H 2 56  ? 18.599  -0.734  21.194  1.00 48.60  ? 112  ALA H N   1 
ATOM   7529 C CA  . ALA H 2 56  ? 17.202  -1.191  21.252  1.00 48.15  ? 112  ALA H CA  1 
ATOM   7530 C C   . ALA H 2 56  ? 16.491  -0.695  22.501  1.00 47.86  ? 112  ALA H C   1 
ATOM   7531 O O   . ALA H 2 56  ? 15.298  -0.331  22.461  1.00 48.02  ? 112  ALA H O   1 
ATOM   7532 C CB  . ALA H 2 56  ? 17.132  -2.700  21.214  1.00 48.34  ? 112  ALA H CB  1 
ATOM   7533 N N   . PHE H 2 57  ? 17.184  -0.802  23.632  1.00 46.30  ? 113  PHE H N   1 
ATOM   7534 C CA  . PHE H 2 57  ? 16.535  -0.782  24.940  1.00 45.94  ? 113  PHE H CA  1 
ATOM   7535 C C   . PHE H 2 57  ? 16.696  0.547   25.674  1.00 46.60  ? 113  PHE H C   1 
ATOM   7536 O O   . PHE H 2 57  ? 16.050  0.781   26.695  1.00 47.32  ? 113  PHE H O   1 
ATOM   7537 C CB  . PHE H 2 57  ? 17.062  -1.925  25.813  1.00 46.87  ? 113  PHE H CB  1 
ATOM   7538 C CG  . PHE H 2 57  ? 16.460  -3.262  25.487  1.00 46.87  ? 113  PHE H CG  1 
ATOM   7539 C CD1 . PHE H 2 57  ? 15.096  -3.395  25.293  1.00 46.87  ? 113  PHE H CD1 1 
ATOM   7540 C CD2 . PHE H 2 57  ? 17.260  -4.387  25.376  1.00 46.87  ? 113  PHE H CD2 1 
ATOM   7541 C CE1 . PHE H 2 57  ? 14.540  -4.624  24.994  1.00 46.87  ? 113  PHE H CE1 1 
ATOM   7542 C CE2 . PHE H 2 57  ? 16.710  -5.619  25.077  1.00 46.87  ? 113  PHE H CE2 1 
ATOM   7543 C CZ  . PHE H 2 57  ? 15.348  -5.738  24.886  1.00 46.87  ? 113  PHE H CZ  1 
ATOM   7544 N N   . HIS H 2 58  ? 17.557  1.415   25.152  1.00 47.50  ? 114  HIS H N   1 
ATOM   7545 C CA  . HIS H 2 58  ? 17.738  2.743   25.727  1.00 47.56  ? 114  HIS H CA  1 
ATOM   7546 C C   . HIS H 2 58  ? 16.472  3.560   25.525  1.00 47.83  ? 114  HIS H C   1 
ATOM   7547 O O   . HIS H 2 58  ? 15.819  3.445   24.488  1.00 48.16  ? 114  HIS H O   1 
ATOM   7548 C CB  . HIS H 2 58  ? 18.932  3.449   25.085  1.00 46.10  ? 114  HIS H CB  1 
ATOM   7549 C CG  . HIS H 2 58  ? 19.270  4.763   25.719  1.00 47.90  ? 114  HIS H CG  1 
ATOM   7550 N ND1 . HIS H 2 58  ? 19.673  4.873   27.032  1.00 49.09  ? 114  HIS H ND1 1 
ATOM   7551 C CD2 . HIS H 2 58  ? 19.264  6.021   25.220  1.00 48.79  ? 114  HIS H CD2 1 
ATOM   7552 C CE1 . HIS H 2 58  ? 19.901  6.143   27.315  1.00 49.82  ? 114  HIS H CE1 1 
ATOM   7553 N NE2 . HIS H 2 58  ? 19.660  6.861   26.232  1.00 49.93  ? 114  HIS H NE2 1 
ATOM   7554 N N   . GLN H 2 59  ? 16.026  4.273   26.547  1.00 51.60  ? 115  GLN H N   1 
ATOM   7555 C CA  . GLN H 2 59  ? 14.955  5.232   26.337  1.00 51.23  ? 115  GLN H CA  1 
ATOM   7556 C C   . GLN H 2 59  ? 13.800  4.483   25.677  1.00 50.13  ? 115  GLN H C   1 
ATOM   7557 O O   . GLN H 2 59  ? 13.084  5.034   24.841  1.00 49.80  ? 115  GLN H O   1 
ATOM   7558 C CB  . GLN H 2 59  ? 15.424  6.380   25.445  1.00 52.36  ? 115  GLN H CB  1 
ATOM   7559 C CG  . GLN H 2 59  ? 15.820  7.635   26.205  1.00 55.65  ? 115  GLN H CG  1 
ATOM   7560 C CD  . GLN H 2 59  ? 16.090  8.812   25.288  1.00 61.39  ? 115  GLN H CD  1 
ATOM   7561 O OE1 . GLN H 2 59  ? 16.629  8.649   24.193  1.00 60.56  ? 115  GLN H OE1 1 
ATOM   7562 N NE2 . GLN H 2 59  ? 15.716  10.006  25.731  1.00 62.35  ? 115  GLN H NE2 1 
ATOM   7563 N N   . SER H 2 60  ? 13.629  3.223   26.062  1.00 48.88  ? 116  SER H N   1 
ATOM   7564 C CA  . SER H 2 60  ? 12.376  2.488   25.846  1.00 47.80  ? 116  SER H CA  1 
ATOM   7565 C C   . SER H 2 60  ? 11.583  2.488   27.166  1.00 47.43  ? 116  SER H C   1 
ATOM   7566 O O   . SER H 2 60  ? 12.087  2.955   28.213  1.00 47.86  ? 116  SER H O   1 
ATOM   7567 C CB  . SER H 2 60  ? 12.643  1.056   25.366  1.00 50.63  ? 116  SER H CB  1 
ATOM   7568 O OG  . SER H 2 60  ? 13.487  0.353   26.265  1.00 50.19  ? 116  SER H OG  1 
ATOM   7569 N N   . ARG H 2 61  ? 10.358  1.986   27.136  1.00 45.75  ? 117  ARG H N   1 
ATOM   7570 C CA  . ARG H 2 61  ? 9.571   1.985   28.348  1.00 44.78  ? 117  ARG H CA  1 
ATOM   7571 C C   . ARG H 2 61  ? 9.352   0.600   28.839  1.00 44.78  ? 117  ARG H C   1 
ATOM   7572 O O   . ARG H 2 61  ? 8.957   -0.267  28.055  1.00 45.17  ? 117  ARG H O   1 
ATOM   7573 C CB  . ARG H 2 61  ? 8.223   2.631   28.122  1.00 44.90  ? 117  ARG H CB  1 
ATOM   7574 C CG  . ARG H 2 61  ? 8.321   4.069   27.713  1.00 44.83  ? 117  ARG H CG  1 
ATOM   7575 C CD  . ARG H 2 61  ? 8.022   4.945   28.887  1.00 44.68  ? 117  ARG H CD  1 
ATOM   7576 N NE  . ARG H 2 61  ? 8.288   6.350   28.600  1.00 44.38  ? 117  ARG H NE  1 
ATOM   7577 C CZ  . ARG H 2 61  ? 8.241   7.314   29.510  1.00 43.35  ? 117  ARG H CZ  1 
ATOM   7578 N NH1 . ARG H 2 61  ? 7.975   7.031   30.778  1.00 46.94  ? 117  ARG H NH1 1 
ATOM   7579 N NH2 . ARG H 2 61  ? 8.469   8.560   29.159  1.00 43.25  ? 117  ARG H NH2 1 
ATOM   7580 N N   . LEU H 2 62  ? 9.610   0.386   30.133  1.00 45.37  ? 118  LEU H N   1 
ATOM   7581 C CA  . LEU H 2 62  ? 9.342   -0.896  30.761  1.00 44.72  ? 118  LEU H CA  1 
ATOM   7582 C C   . LEU H 2 62  ? 8.213   -0.687  31.784  1.00 45.09  ? 118  LEU H C   1 
ATOM   7583 O O   . LEU H 2 62  ? 8.401   -0.002  32.791  1.00 44.65  ? 118  LEU H O   1 
ATOM   7584 C CB  . LEU H 2 62  ? 10.595  -1.472  31.409  1.00 43.86  ? 118  LEU H CB  1 
ATOM   7585 C CG  . LEU H 2 62  ? 10.350  -2.856  32.033  1.00 43.93  ? 118  LEU H CG  1 
ATOM   7586 C CD1 . LEU H 2 62  ? 9.880   -3.819  30.984  1.00 43.38  ? 118  LEU H CD1 1 
ATOM   7587 C CD2 . LEU H 2 62  ? 11.536  -3.430  32.831  1.00 42.78  ? 118  LEU H CD2 1 
ATOM   7588 N N   . ARG H 2 63  ? 7.049   -1.277  31.516  1.00 46.55  ? 119  ARG H N   1 
ATOM   7589 C CA  . ARG H 2 63  ? 5.868   -1.116  32.369  1.00 46.80  ? 119  ARG H CA  1 
ATOM   7590 C C   . ARG H 2 63  ? 5.685   0.363   32.707  1.00 47.21  ? 119  ARG H C   1 
ATOM   7591 O O   . ARG H 2 63  ? 5.438   0.754   33.851  1.00 47.30  ? 119  ARG H O   1 
ATOM   7592 C CB  . ARG H 2 63  ? 5.873   -2.044  33.584  1.00 47.39  ? 119  ARG H CB  1 
ATOM   7593 C CG  . ARG H 2 63  ? 5.825   -3.537  33.212  1.00 48.32  ? 119  ARG H CG  1 
ATOM   7594 C CD  . ARG H 2 63  ? 6.252   -4.481  34.369  1.00 47.33  ? 119  ARG H CD  1 
ATOM   7595 N NE  . ARG H 2 63  ? 6.076   -3.848  35.685  1.00 46.13  ? 119  ARG H NE  1 
ATOM   7596 C CZ  . ARG H 2 63  ? 6.892   -3.986  36.739  1.00 45.25  ? 119  ARG H CZ  1 
ATOM   7597 N NH1 . ARG H 2 63  ? 7.966   -4.780  36.701  1.00 43.84  ? 119  ARG H NH1 1 
ATOM   7598 N NH2 . ARG H 2 63  ? 6.614   -3.321  37.856  1.00 47.20  ? 119  ARG H NH2 1 
ATOM   7599 N N   . GLU H 2 64  ? 5.806   1.198   31.677  1.00 49.36  ? 120  GLU H N   1 
ATOM   7600 C CA  . GLU H 2 64  ? 5.545   2.632   31.800  1.00 49.65  ? 120  GLU H CA  1 
ATOM   7601 C C   . GLU H 2 64  ? 6.724   3.466   32.319  1.00 49.65  ? 120  GLU H C   1 
ATOM   7602 O O   . GLU H 2 64  ? 6.565   4.654   32.603  1.00 49.66  ? 120  GLU H O   1 
ATOM   7603 C CB  . GLU H 2 64  ? 4.314   2.873   32.680  1.00 52.72  ? 120  GLU H CB  1 
ATOM   7604 C CG  . GLU H 2 64  ? 2.998   2.874   31.919  1.00 54.05  ? 120  GLU H CG  1 
ATOM   7605 C CD  . GLU H 2 64  ? 2.850   4.080   31.013  1.00 56.03  ? 120  GLU H CD  1 
ATOM   7606 O OE1 . GLU H 2 64  ? 2.601   5.189   31.533  1.00 56.96  ? 120  GLU H OE1 1 
ATOM   7607 O OE2 . GLU H 2 64  ? 2.982   3.920   29.782  1.00 58.05  ? 120  GLU H OE2 1 
ATOM   7608 N N   . ARG H 2 65  ? 7.898   2.854   32.442  1.00 48.25  ? 121  ARG H N   1 
ATOM   7609 C CA  . ARG H 2 65  ? 9.068   3.551   32.981  1.00 48.44  ? 121  ARG H CA  1 
ATOM   7610 C C   . ARG H 2 65  ? 10.209  3.663   31.965  1.00 48.64  ? 121  ARG H C   1 
ATOM   7611 O O   . ARG H 2 65  ? 10.576  2.678   31.325  1.00 48.84  ? 121  ARG H O   1 
ATOM   7612 C CB  . ARG H 2 65  ? 9.565   2.857   34.251  1.00 41.29  ? 121  ARG H CB  1 
ATOM   7613 C CG  . ARG H 2 65  ? 8.549   1.920   34.884  1.00 41.78  ? 121  ARG H CG  1 
ATOM   7614 C CD  . ARG H 2 65  ? 7.582   2.678   35.779  1.00 43.19  ? 121  ARG H CD  1 
ATOM   7615 N NE  . ARG H 2 65  ? 7.528   2.117   37.126  1.00 43.79  ? 121  ARG H NE  1 
ATOM   7616 C CZ  . ARG H 2 65  ? 6.665   1.183   37.512  1.00 44.51  ? 121  ARG H CZ  1 
ATOM   7617 N NH1 . ARG H 2 65  ? 5.778   0.701   36.652  1.00 45.46  ? 121  ARG H NH1 1 
ATOM   7618 N NH2 . ARG H 2 65  ? 6.688   0.730   38.758  1.00 43.00  ? 121  ARG H NH2 1 
ATOM   7619 N N   . GLU H 2 66  ? 10.767  4.865   31.821  1.00 52.46  ? 122  GLU H N   1 
ATOM   7620 C CA  . GLU H 2 66  ? 11.762  5.117   30.796  1.00 52.96  ? 122  GLU H CA  1 
ATOM   7621 C C   . GLU H 2 66  ? 13.113  4.542   31.240  1.00 52.86  ? 122  GLU H C   1 
ATOM   7622 O O   . GLU H 2 66  ? 13.672  4.924   32.277  1.00 52.76  ? 122  GLU H O   1 
ATOM   7623 C CB  . GLU H 2 66  ? 11.894  6.619   30.532  1.00 56.27  ? 122  GLU H CB  1 
ATOM   7624 C CG  . GLU H 2 66  ? 12.134  6.929   29.064  1.00 59.30  ? 122  GLU H CG  1 
ATOM   7625 C CD  . GLU H 2 66  ? 12.882  8.241   28.832  1.00 61.97  ? 122  GLU H CD  1 
ATOM   7626 O OE1 . GLU H 2 66  ? 14.136  8.188   28.711  1.00 64.29  ? 122  GLU H OE1 1 
ATOM   7627 O OE2 . GLU H 2 66  ? 12.214  9.312   28.721  1.00 62.89  ? 122  GLU H OE2 1 
ATOM   7628 N N   . LEU H 2 67  ? 13.642  3.619   30.447  1.00 47.81  ? 123  LEU H N   1 
ATOM   7629 C CA  . LEU H 2 67  ? 14.940  3.012   30.743  1.00 47.06  ? 123  LEU H CA  1 
ATOM   7630 C C   . LEU H 2 67  ? 16.118  3.772   30.153  1.00 47.13  ? 123  LEU H C   1 
ATOM   7631 O O   . LEU H 2 67  ? 16.081  4.272   29.038  1.00 46.84  ? 123  LEU H O   1 
ATOM   7632 C CB  . LEU H 2 67  ? 14.990  1.583   30.199  1.00 46.25  ? 123  LEU H CB  1 
ATOM   7633 C CG  . LEU H 2 67  ? 13.946  0.613   30.709  1.00 45.50  ? 123  LEU H CG  1 
ATOM   7634 C CD1 . LEU H 2 67  ? 14.210  -0.760  30.125  1.00 44.36  ? 123  LEU H CD1 1 
ATOM   7635 C CD2 . LEU H 2 67  ? 13.975  0.601   32.250  1.00 46.27  ? 123  LEU H CD2 1 
ATOM   7636 N N   . SER H 2 68  ? 17.202  3.765   30.895  1.00 46.19  ? 124  SER H N   1 
ATOM   7637 C CA  . SER H 2 68  ? 18.431  4.357   30.430  1.00 46.83  ? 124  SER H CA  1 
ATOM   7638 C C   . SER H 2 68  ? 19.484  3.239   30.424  1.00 47.94  ? 124  SER H C   1 
ATOM   7639 O O   . SER H 2 68  ? 19.976  2.796   31.469  1.00 48.21  ? 124  SER H O   1 
ATOM   7640 C CB  . SER H 2 68  ? 18.839  5.544   31.294  1.00 46.71  ? 124  SER H CB  1 
ATOM   7641 O OG  . SER H 2 68  ? 19.803  5.143   32.231  1.00 46.46  ? 124  SER H OG  1 
ATOM   7642 N N   . VAL H 2 69  ? 19.741  2.731   29.224  1.00 48.57  ? 125  VAL H N   1 
ATOM   7643 C CA  . VAL H 2 69  ? 20.694  1.664   28.982  1.00 49.01  ? 125  VAL H CA  1 
ATOM   7644 C C   . VAL H 2 69  ? 21.959  2.294   28.391  1.00 50.07  ? 125  VAL H C   1 
ATOM   7645 O O   . VAL H 2 69  ? 21.901  3.098   27.469  1.00 50.89  ? 125  VAL H O   1 
ATOM   7646 C CB  . VAL H 2 69  ? 20.092  0.616   28.028  1.00 51.86  ? 125  VAL H CB  1 
ATOM   7647 C CG1 . VAL H 2 69  ? 20.927  -0.633  28.039  1.00 52.26  ? 125  VAL H CG1 1 
ATOM   7648 C CG2 . VAL H 2 69  ? 18.624  0.330   28.381  1.00 49.29  ? 125  VAL H CG2 1 
ATOM   7649 N N   . GLN H 2 70  ? 23.103  1.950   28.955  1.00 52.69  ? 126  GLN H N   1 
ATOM   7650 C CA  . GLN H 2 70  ? 24.365  2.532   28.527  1.00 53.85  ? 126  GLN H CA  1 
ATOM   7651 C C   . GLN H 2 70  ? 25.516  1.667   29.041  1.00 54.37  ? 126  GLN H C   1 
ATOM   7652 O O   . GLN H 2 70  ? 25.355  0.945   30.033  1.00 54.12  ? 126  GLN H O   1 
ATOM   7653 C CB  . GLN H 2 70  ? 24.481  3.948   29.114  1.00 56.59  ? 126  GLN H CB  1 
ATOM   7654 C CG  . GLN H 2 70  ? 25.159  3.996   30.522  1.00 57.84  ? 126  GLN H CG  1 
ATOM   7655 C CD  . GLN H 2 70  ? 24.676  5.171   31.384  1.00 57.58  ? 126  GLN H CD  1 
ATOM   7656 O OE1 . GLN H 2 70  ? 25.338  6.222   31.441  1.00 56.54  ? 126  GLN H OE1 1 
ATOM   7657 N NE2 . GLN H 2 70  ? 23.502  5.006   32.035  1.00 56.21  ? 126  GLN H NE2 1 
ATOM   7658 N N   . LEU H 2 71  ? 26.679  1.790   28.402  1.00 55.04  ? 127  LEU H N   1 
ATOM   7659 C CA  . LEU H 2 71  ? 27.873  1.048   28.812  1.00 56.44  ? 127  LEU H CA  1 
ATOM   7660 C C   . LEU H 2 71  ? 28.195  1.248   30.297  1.00 58.01  ? 127  LEU H C   1 
ATOM   7661 O O   . LEU H 2 71  ? 28.115  2.378   30.793  1.00 58.61  ? 127  LEU H O   1 
ATOM   7662 C CB  . LEU H 2 71  ? 29.062  1.483   27.964  1.00 55.53  ? 127  LEU H CB  1 
ATOM   7663 C CG  . LEU H 2 71  ? 29.133  0.925   26.533  1.00 53.87  ? 127  LEU H CG  1 
ATOM   7664 C CD1 . LEU H 2 71  ? 30.547  1.070   25.989  1.00 51.92  ? 127  LEU H CD1 1 
ATOM   7665 C CD2 . LEU H 2 71  ? 28.675  -0.518  26.438  1.00 51.94  ? 127  LEU H CD2 1 
ATOM   7666 N N   . GLN H 2 72  ? 28.514  0.163   31.013  1.00 64.75  ? 128  GLN H N   1 
ATOM   7667 C CA  . GLN H 2 72  ? 28.805  0.279   32.446  1.00 66.28  ? 128  GLN H CA  1 
ATOM   7668 C C   . GLN H 2 72  ? 29.867  1.326   32.615  1.00 67.84  ? 128  GLN H C   1 
ATOM   7669 O O   . GLN H 2 72  ? 30.967  1.195   32.059  1.00 68.02  ? 128  GLN H O   1 
ATOM   7670 C CB  . GLN H 2 72  ? 29.290  -1.033  33.060  1.00 68.93  ? 128  GLN H CB  1 
ATOM   7671 C CG  . GLN H 2 72  ? 28.428  -1.539  34.215  1.00 69.69  ? 128  GLN H CG  1 
ATOM   7672 C CD  . GLN H 2 72  ? 28.288  -3.064  34.228  1.00 70.52  ? 128  GLN H CD  1 
ATOM   7673 O OE1 . GLN H 2 72  ? 27.283  -3.632  33.770  1.00 70.58  ? 128  GLN H OE1 1 
ATOM   7674 N NE2 . GLN H 2 72  ? 29.294  -3.730  34.773  1.00 70.76  ? 128  GLN H NE2 1 
ATOM   7675 N N   . PRO H 2 73  ? 29.521  2.427   33.312  1.00 73.62  ? 129  PRO H N   1 
ATOM   7676 C CA  . PRO H 2 73  ? 30.416  3.560   33.569  1.00 74.20  ? 129  PRO H CA  1 
ATOM   7677 C C   . PRO H 2 73  ? 31.765  3.028   33.974  1.00 75.15  ? 129  PRO H C   1 
ATOM   7678 O O   . PRO H 2 73  ? 31.898  2.369   35.019  1.00 75.02  ? 129  PRO H O   1 
ATOM   7679 C CB  . PRO H 2 73  ? 29.758  4.293   34.749  1.00 76.26  ? 129  PRO H CB  1 
ATOM   7680 C CG  . PRO H 2 73  ? 28.824  3.322   35.373  1.00 76.48  ? 129  PRO H CG  1 
ATOM   7681 C CD  . PRO H 2 73  ? 28.380  2.396   34.249  1.00 76.19  ? 129  PRO H CD  1 
ATOM   7682 N N   . THR H 2 74  ? 32.734  3.228   33.079  1.00 77.40  ? 130  THR H N   1 
ATOM   7683 C CA  . THR H 2 74  ? 34.110  2.769   33.280  1.00 78.64  ? 130  THR H CA  1 
ATOM   7684 C C   . THR H 2 74  ? 35.006  3.967   33.579  1.00 79.20  ? 130  THR H C   1 
ATOM   7685 O O   . THR H 2 74  ? 34.991  4.375   34.769  1.00 79.41  ? 130  THR H O   1 
ATOM   7686 C CB  . THR H 2 74  ? 34.621  1.921   32.079  1.00 92.82  ? 130  THR H CB  1 
ATOM   7687 O OG1 . THR H 2 74  ? 33.602  0.982   31.683  1.00 93.81  ? 130  THR H OG1 1 
ATOM   7688 C CG2 . THR H 2 74  ? 35.906  1.165   32.461  1.00 92.85  ? 130  THR H CG2 1 
ATOM   7689 O OXT . THR H 2 74  ? 35.616  4.507   32.618  1.00 100.06 ? 130  THR H OXT 1 
HETATM 7690 O O   . HOH I 3 .   ? 2.375   10.569  -2.308  1.00 29.53  ? 4    HOH A O   1 
HETATM 7691 O O   . HOH J 3 .   ? 0.442   39.838  23.048  1.00 41.13  ? 2    HOH B O   1 
HETATM 7692 O O   . HOH K 3 .   ? 23.646  11.917  -7.565  1.00 42.59  ? 3    HOH F O   1 
HETATM 7693 O O   . HOH L 3 .   ? 14.697  28.603  31.066  1.00 54.47  ? 1    HOH G O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   879  ?    ?   ?   A . n 
A 1 2   GLU 2   880  ?    ?   ?   A . n 
A 1 3   LYS 3   881  ?    ?   ?   A . n 
A 1 4   ASP 4   882  ?    ?   ?   A . n 
A 1 5   GLU 5   883  ?    ?   ?   A . n 
A 1 6   GLU 6   884  884  GLU GLU A . n 
A 1 7   PHE 7   885  885  PHE PHE A . n 
A 1 8   PRO 8   886  886  PRO PRO A . n 
A 1 9   GLU 9   887  887  GLU GLY A . n 
A 1 10  GLN 10  888  888  GLN GLN A . n 
A 1 11  LYS 11  889  ?    ?   ?   A . n 
A 1 12  ALA 12  890  ?    ?   ?   A . n 
A 1 13  GLY 13  891  ?    ?   ?   A . n 
A 1 14  GLU 14  892  ?    ?   ?   A . n 
A 1 15  VAL 15  893  893  VAL VAL A . n 
A 1 16  ILE 16  894  894  ILE ILE A . n 
A 1 17  ASN 17  895  895  ASN ASN A . n 
A 1 18  GLN 18  896  896  GLN GLN A . n 
A 1 19  PRO 19  897  897  PRO PRO A . n 
A 1 20  MET 20  898  898  MET MET A . n 
A 1 21  MET 21  899  899  MET MET A . n 
A 1 22  MET 22  900  900  MET MET A . n 
A 1 23  ALA 23  901  901  ALA ALA A . n 
A 1 24  ALA 24  902  902  ALA ALA A . n 
A 1 25  ARG 25  903  903  ARG ARG A . n 
A 1 26  GLN 26  904  904  GLN GLN A . n 
A 1 27  LEU 27  905  905  LEU LEU A . n 
A 1 28  HIS 28  906  906  HIS HIS A . n 
A 1 29  ASP 29  907  907  ASP ASP A . n 
A 1 30  GLU 30  908  908  GLU GLU A . n 
A 1 31  ALA 31  909  909  ALA ALA A . n 
A 1 32  ARG 32  910  910  ARG ARG A . n 
A 1 33  LYS 33  911  911  LYS LYS A . n 
A 1 34  TRP 34  912  912  TRP TRP A . n 
A 1 35  SER 35  913  913  SER SER A . n 
A 1 36  SER 36  914  914  SER SER A . n 
A 1 37  LYS 37  915  915  LYS LYS A . n 
A 1 38  GLY 38  916  916  GLY GLY A . n 
A 1 39  ASN 39  917  917  ASN ASN A . n 
A 1 40  ASP 40  918  918  ASP ASP A . n 
A 1 41  ILE 41  919  919  ILE ILE A . n 
A 1 42  ILE 42  920  920  ILE ILE A . n 
A 1 43  ALA 43  921  921  ALA ALA A . n 
A 1 44  ALA 44  922  922  ALA ALA A . n 
A 1 45  ALA 45  923  923  ALA ALA A . n 
A 1 46  LYS 46  924  924  LYS LYS A . n 
A 1 47  ARG 47  925  925  ARG ARG A . n 
A 1 48  MET 48  926  926  MET MET A . n 
A 1 49  ALA 49  927  927  ALA ALA A . n 
A 1 50  LEU 50  928  928  LEU LEU A . n 
A 1 51  LEU 51  929  929  LEU LEU A . n 
A 1 52  MET 52  930  930  MET MET A . n 
A 1 53  ALA 53  931  931  ALA ALA A . n 
A 1 54  GLU 54  932  932  GLU GLU A . n 
A 1 55  MET 55  933  933  MET MET A . n 
A 1 56  SER 56  934  934  SER SER A . n 
A 1 57  ARG 57  935  935  ARG ARG A . n 
A 1 58  LEU 58  936  936  LEU LEU A . n 
A 1 59  VAL 59  937  937  VAL VAL A . n 
A 1 60  ARG 60  938  938  ARG ARG A . n 
A 1 61  GLY 61  939  939  GLY GLY A . n 
A 1 62  GLY 62  940  940  GLY GLY A . n 
A 1 63  SER 63  941  941  SER SER A . n 
A 1 64  GLY 64  942  942  GLY GLY A . n 
A 1 65  THR 65  943  943  THR THR A . n 
A 1 66  LYS 66  944  944  LYS LYS A . n 
A 1 67  ARG 67  945  945  ARG ARG A . n 
A 1 68  ALA 68  946  946  ALA ALA A . n 
A 1 69  LEU 69  947  947  LEU LEU A . n 
A 1 70  ILE 70  948  948  ILE ILE A . n 
A 1 71  GLN 71  949  949  GLN GLN A . n 
A 1 72  CYS 72  950  950  CYS CYS A . n 
A 1 73  ALA 73  951  951  ALA ALA A . n 
A 1 74  LYS 74  952  952  LYS LYS A . n 
A 1 75  ASP 75  953  953  ASP ASP A . n 
A 1 76  ILE 76  954  954  ILE ILE A . n 
A 1 77  ALA 77  955  955  ALA ALA A . n 
A 1 78  LYS 78  956  956  LYS LYS A . n 
A 1 79  ALA 79  957  957  ALA ALA A . n 
A 1 80  SER 80  958  958  SER SER A . n 
A 1 81  ASP 81  959  959  ASP ASP A . n 
A 1 82  GLU 82  960  960  GLU GLU A . n 
A 1 83  VAL 83  961  961  VAL VAL A . n 
A 1 84  THR 84  962  962  THR THR A . n 
A 1 85  ARG 85  963  963  ARG ARG A . n 
A 1 86  LEU 86  964  964  LEU LEU A . n 
A 1 87  ALA 87  965  965  ALA ALA A . n 
A 1 88  LYS 88  966  966  LYS LYS A . n 
A 1 89  GLU 89  967  967  GLU GLU A . n 
A 1 90  VAL 90  968  968  VAL VAL A . n 
A 1 91  ALA 91  969  969  ALA ALA A . n 
A 1 92  LYS 92  970  970  LYS LYS A . n 
A 1 93  GLN 93  971  971  GLN GLN A . n 
A 1 94  CYS 94  972  972  CYS CYS A . n 
A 1 95  THR 95  973  973  THR THR A . n 
A 1 96  ASP 96  974  974  ASP ASP A . n 
A 1 97  LYS 97  975  975  LYS LYS A . n 
A 1 98  ARG 98  976  976  ARG ARG A . n 
A 1 99  ILE 99  977  977  ILE ILE A . n 
A 1 100 ARG 100 978  978  ARG ARG A . n 
A 1 101 THR 101 979  979  THR THR A . n 
A 1 102 ASN 102 980  980  ASN ASN A . n 
A 1 103 LEU 103 981  981  LEU LEU A . n 
A 1 104 LEU 104 982  982  LEU LEU A . n 
A 1 105 GLN 105 983  983  GLN GLN A . n 
A 1 106 VAL 106 984  984  VAL VAL A . n 
A 1 107 CYS 107 985  985  CYS CYS A . n 
A 1 108 GLU 108 986  986  GLU GLU A . n 
A 1 109 ARG 109 987  987  ARG ARG A . n 
A 1 110 ILE 110 988  988  ILE ILE A . n 
A 1 111 PRO 111 989  989  PRO PRO A . n 
A 1 112 THR 112 990  990  THR THR A . n 
A 1 113 ILE 113 991  991  ILE ILE A . n 
A 1 114 SER 114 992  992  SER SER A . n 
A 1 115 THR 115 993  993  THR THR A . n 
A 1 116 GLN 116 994  994  GLN GLN A . n 
A 1 117 LEU 117 995  995  LEU LEU A . n 
A 1 118 LYS 118 996  996  LYS LYS A . n 
A 1 119 ILE 119 997  997  ILE ILE A . n 
A 1 120 LEU 120 998  998  LEU LEU A . n 
A 1 121 SER 121 999  999  SER SER A . n 
A 1 122 THR 122 1000 1000 THR THR A . n 
A 1 123 VAL 123 1001 1001 VAL VAL A . n 
A 1 124 LYS 124 1002 1002 LYS LYS A . n 
A 1 125 ALA 125 1003 1003 ALA ALA A . n 
A 1 126 THR 126 1004 1004 THR THR A . n 
A 1 127 MET 127 1005 1005 MET MET A . n 
A 1 128 LEU 128 1006 1006 LEU LEU A . n 
A 1 129 GLY 129 1007 1007 GLY GLY A . n 
A 1 130 ARG 130 1008 1008 ARG ARG A . n 
A 1 131 THR 131 1009 1009 THR THR A . n 
A 1 132 ASN 132 1010 1010 ASN ASN A . n 
A 1 133 ILE 133 1011 1011 ILE ILE A . n 
A 1 134 SER 134 1012 1012 SER SER A . n 
A 1 135 ASP 135 1013 1013 ASP ASP A . n 
A 1 136 GLU 136 1014 1014 GLU GLU A . n 
A 1 137 GLU 137 1015 1015 GLU GLU A . n 
A 1 138 SER 138 1016 1016 SER SER A . n 
A 1 139 GLU 139 1017 1017 GLU GLU A . n 
A 1 140 GLN 140 1018 1018 GLN GLN A . n 
A 1 141 ALA 141 1019 1019 ALA ALA A . n 
A 1 142 THR 142 1020 1020 THR THR A . n 
A 1 143 GLU 143 1021 1021 GLU GLU A . n 
A 1 144 MET 144 1022 1022 MET MET A . n 
A 1 145 LEU 145 1023 1023 LEU LEU A . n 
A 1 146 VAL 146 1024 1024 VAL VAL A . n 
A 1 147 HIS 147 1025 1025 HIS HIS A . n 
A 1 148 ASN 148 1026 1026 ASN ASN A . n 
A 1 149 ALA 149 1027 1027 ALA ALA A . n 
A 1 150 GLN 150 1028 1028 GLN GLN A . n 
A 1 151 ASN 151 1029 1029 ASN ASN A . n 
A 1 152 LEU 152 1030 1030 LEU LEU A . n 
A 1 153 MET 153 1031 1031 MET MET A . n 
A 1 154 GLN 154 1032 1032 GLN GLN A . n 
A 1 155 SER 155 1033 1033 SER SER A . n 
A 1 156 VAL 156 1034 1034 VAL VAL A . n 
A 1 157 LYS 157 1035 1035 LYS LYS A . n 
A 1 158 GLU 158 1036 1036 GLU GLU A . n 
A 1 159 THR 159 1037 1037 THR THR A . n 
A 1 160 VAL 160 1038 1038 VAL VAL A . n 
A 1 161 ARG 161 1039 1039 ARG ARG A . n 
A 1 162 GLU 162 1040 1040 GLU GLU A . n 
A 1 163 ALA 163 1041 1041 ALA ALA A . n 
A 1 164 GLU 164 1042 1042 GLU GLU A . n 
A 1 165 ALA 165 1043 1043 ALA ALA A . n 
A 1 166 ALA 166 1044 1044 ALA ALA A . n 
A 1 167 SER 167 1045 1045 SER SER A . n 
A 1 168 ILE 168 1046 1046 ILE ILE A . n 
A 1 169 LYS 169 1047 1047 LYS LYS A . n 
A 1 170 ILE 170 1048 1048 ILE ILE A . n 
A 1 171 ARG 171 1049 1049 ARG ARG A . n 
A 1 172 THR 172 1050 1050 THR THR A . n 
A 1 173 ASP 173 1051 1051 ASP ASP A . n 
A 1 174 ALA 174 1052 1052 ALA ALA A . n 
A 1 175 GLY 175 1053 1053 GLY GLY A . n 
A 1 176 PHE 176 1054 1054 PHE PHE A . n 
A 1 177 THR 177 1055 1055 THR THR A . n 
A 1 178 LEU 178 1056 1056 LEU LEU A . n 
A 1 179 ARG 179 1057 1057 ARG ARG A . n 
A 1 180 TRP 180 1058 1058 TRP TRP A . n 
A 1 181 VAL 181 1059 1059 VAL VAL A . n 
A 1 182 ARG 182 1060 1060 ARG ARG A . n 
A 1 183 LYS 183 1061 1061 LYS LYS A . n 
A 1 184 THR 184 1062 ?    ?   ?   A . n 
A 1 185 PRO 185 1063 ?    ?   ?   A . n 
A 1 186 TRP 186 1064 ?    ?   ?   A . n 
A 1 187 TYR 187 1065 ?    ?   ?   A . n 
A 1 188 GLN 188 1066 ?    ?   ?   A . n 
B 1 1   GLU 1   879  ?    ?   ?   B . n 
B 1 2   GLU 2   880  ?    ?   ?   B . n 
B 1 3   LYS 3   881  ?    ?   ?   B . n 
B 1 4   ASP 4   882  ?    ?   ?   B . n 
B 1 5   GLU 5   883  ?    ?   ?   B . n 
B 1 6   GLU 6   884  884  GLU GLU B . n 
B 1 7   PHE 7   885  885  PHE PHE B . n 
B 1 8   PRO 8   886  886  PRO PRO B . n 
B 1 9   GLU 9   887  887  GLU GLU B . n 
B 1 10  GLN 10  888  ?    ?   ?   B . n 
B 1 11  LYS 11  889  ?    ?   ?   B . n 
B 1 12  ALA 12  890  ?    ?   ?   B . n 
B 1 13  GLY 13  891  ?    ?   ?   B . n 
B 1 14  GLU 14  892  892  GLU GLU B . n 
B 1 15  VAL 15  893  893  VAL VAL B . n 
B 1 16  ILE 16  894  894  ILE ILE B . n 
B 1 17  ASN 17  895  895  ASN ASN B . n 
B 1 18  GLN 18  896  896  GLN GLN B . n 
B 1 19  PRO 19  897  897  PRO PRO B . n 
B 1 20  MET 20  898  898  MET MET B . n 
B 1 21  MET 21  899  899  MET MET B . n 
B 1 22  MET 22  900  900  MET MET B . n 
B 1 23  ALA 23  901  901  ALA ALA B . n 
B 1 24  ALA 24  902  902  ALA ALA B . n 
B 1 25  ARG 25  903  903  ARG ARG B . n 
B 1 26  GLN 26  904  904  GLN GLN B . n 
B 1 27  LEU 27  905  905  LEU LEU B . n 
B 1 28  HIS 28  906  906  HIS HIS B . n 
B 1 29  ASP 29  907  907  ASP ASP B . n 
B 1 30  GLU 30  908  908  GLU GLU B . n 
B 1 31  ALA 31  909  909  ALA ALA B . n 
B 1 32  ARG 32  910  910  ARG ARG B . n 
B 1 33  LYS 33  911  911  LYS LYS B . n 
B 1 34  TRP 34  912  912  TRP TRP B . n 
B 1 35  SER 35  913  913  SER SER B . n 
B 1 36  SER 36  914  914  SER SER B . n 
B 1 37  LYS 37  915  915  LYS LYS B . n 
B 1 38  GLY 38  916  916  GLY GLY B . n 
B 1 39  ASN 39  917  917  ASN ASN B . n 
B 1 40  ASP 40  918  918  ASP ASP B . n 
B 1 41  ILE 41  919  919  ILE ILE B . n 
B 1 42  ILE 42  920  920  ILE ILE B . n 
B 1 43  ALA 43  921  921  ALA ALA B . n 
B 1 44  ALA 44  922  922  ALA ALA B . n 
B 1 45  ALA 45  923  923  ALA ALA B . n 
B 1 46  LYS 46  924  924  LYS LYS B . n 
B 1 47  ARG 47  925  925  ARG ARG B . n 
B 1 48  MET 48  926  926  MET MET B . n 
B 1 49  ALA 49  927  927  ALA ALA B . n 
B 1 50  LEU 50  928  928  LEU LEU B . n 
B 1 51  LEU 51  929  929  LEU LEU B . n 
B 1 52  MET 52  930  930  MET MET B . n 
B 1 53  ALA 53  931  931  ALA ALA B . n 
B 1 54  GLU 54  932  932  GLU GLU B . n 
B 1 55  MET 55  933  933  MET MET B . n 
B 1 56  SER 56  934  934  SER SER B . n 
B 1 57  ARG 57  935  935  ARG ARG B . n 
B 1 58  LEU 58  936  936  LEU LEU B . n 
B 1 59  VAL 59  937  937  VAL VAL B . n 
B 1 60  ARG 60  938  938  ARG ARG B . n 
B 1 61  GLY 61  939  939  GLY GLY B . n 
B 1 62  GLY 62  940  940  GLY GLY B . n 
B 1 63  SER 63  941  941  SER SER B . n 
B 1 64  GLY 64  942  942  GLY GLY B . n 
B 1 65  THR 65  943  943  THR THR B . n 
B 1 66  LYS 66  944  944  LYS LYS B . n 
B 1 67  ARG 67  945  945  ARG ARG B . n 
B 1 68  ALA 68  946  946  ALA ALA B . n 
B 1 69  LEU 69  947  947  LEU LEU B . n 
B 1 70  ILE 70  948  948  ILE ILE B . n 
B 1 71  GLN 71  949  949  GLN GLN B . n 
B 1 72  CYS 72  950  950  CYS CYS B . n 
B 1 73  ALA 73  951  951  ALA ALA B . n 
B 1 74  LYS 74  952  952  LYS LYS B . n 
B 1 75  ASP 75  953  953  ASP ASP B . n 
B 1 76  ILE 76  954  954  ILE ILE B . n 
B 1 77  ALA 77  955  955  ALA ALA B . n 
B 1 78  LYS 78  956  956  LYS LYS B . n 
B 1 79  ALA 79  957  957  ALA ALA B . n 
B 1 80  SER 80  958  958  SER SER B . n 
B 1 81  ASP 81  959  959  ASP ASP B . n 
B 1 82  GLU 82  960  960  GLU GLU B . n 
B 1 83  VAL 83  961  961  VAL VAL B . n 
B 1 84  THR 84  962  962  THR THR B . n 
B 1 85  ARG 85  963  963  ARG ARG B . n 
B 1 86  LEU 86  964  964  LEU LEU B . n 
B 1 87  ALA 87  965  965  ALA ALA B . n 
B 1 88  LYS 88  966  966  LYS LYS B . n 
B 1 89  GLU 89  967  967  GLU GLU B . n 
B 1 90  VAL 90  968  968  VAL VAL B . n 
B 1 91  ALA 91  969  969  ALA ALA B . n 
B 1 92  LYS 92  970  970  LYS LYS B . n 
B 1 93  GLN 93  971  971  GLN GLN B . n 
B 1 94  CYS 94  972  972  CYS CYS B . n 
B 1 95  THR 95  973  973  THR THR B . n 
B 1 96  ASP 96  974  974  ASP ASP B . n 
B 1 97  LYS 97  975  975  LYS LYS B . n 
B 1 98  ARG 98  976  976  ARG ARG B . n 
B 1 99  ILE 99  977  977  ILE ILE B . n 
B 1 100 ARG 100 978  978  ARG ARG B . n 
B 1 101 THR 101 979  979  THR THR B . n 
B 1 102 ASN 102 980  980  ASN ASN B . n 
B 1 103 LEU 103 981  981  LEU LEU B . n 
B 1 104 LEU 104 982  982  LEU LEU B . n 
B 1 105 GLN 105 983  983  GLN GLN B . n 
B 1 106 VAL 106 984  984  VAL VAL B . n 
B 1 107 CYS 107 985  985  CYS CYS B . n 
B 1 108 GLU 108 986  986  GLU GLU B . n 
B 1 109 ARG 109 987  987  ARG ARG B . n 
B 1 110 ILE 110 988  988  ILE ILE B . n 
B 1 111 PRO 111 989  989  PRO PRO B . n 
B 1 112 THR 112 990  990  THR THR B . n 
B 1 113 ILE 113 991  991  ILE ILE B . n 
B 1 114 SER 114 992  992  SER SER B . n 
B 1 115 THR 115 993  993  THR THR B . n 
B 1 116 GLN 116 994  994  GLN GLN B . n 
B 1 117 LEU 117 995  995  LEU LEU B . n 
B 1 118 LYS 118 996  996  LYS LYS B . n 
B 1 119 ILE 119 997  997  ILE ILE B . n 
B 1 120 LEU 120 998  998  LEU LEU B . n 
B 1 121 SER 121 999  999  SER SER B . n 
B 1 122 THR 122 1000 1000 THR THR B . n 
B 1 123 VAL 123 1001 1001 VAL VAL B . n 
B 1 124 LYS 124 1002 1002 LYS LYS B . n 
B 1 125 ALA 125 1003 1003 ALA ALA B . n 
B 1 126 THR 126 1004 1004 THR THR B . n 
B 1 127 MET 127 1005 1005 MET MET B . n 
B 1 128 LEU 128 1006 1006 LEU LEU B . n 
B 1 129 GLY 129 1007 1007 GLY GLY B . n 
B 1 130 ARG 130 1008 1008 ARG ARG B . n 
B 1 131 THR 131 1009 1009 THR THR B . n 
B 1 132 ASN 132 1010 1010 ASN ASN B . n 
B 1 133 ILE 133 1011 1011 ILE ILE B . n 
B 1 134 SER 134 1012 1012 SER SER B . n 
B 1 135 ASP 135 1013 1013 ASP ASP B . n 
B 1 136 GLU 136 1014 1014 GLU GLU B . n 
B 1 137 GLU 137 1015 1015 GLU GLU B . n 
B 1 138 SER 138 1016 1016 SER SER B . n 
B 1 139 GLU 139 1017 1017 GLU GLU B . n 
B 1 140 GLN 140 1018 1018 GLN GLN B . n 
B 1 141 ALA 141 1019 1019 ALA ALA B . n 
B 1 142 THR 142 1020 1020 THR THR B . n 
B 1 143 GLU 143 1021 1021 GLU GLU B . n 
B 1 144 MET 144 1022 1022 MET MET B . n 
B 1 145 LEU 145 1023 1023 LEU LEU B . n 
B 1 146 VAL 146 1024 1024 VAL VAL B . n 
B 1 147 HIS 147 1025 1025 HIS HIS B . n 
B 1 148 ASN 148 1026 1026 ASN ASN B . n 
B 1 149 ALA 149 1027 1027 ALA ALA B . n 
B 1 150 GLN 150 1028 1028 GLN GLN B . n 
B 1 151 ASN 151 1029 1029 ASN ASN B . n 
B 1 152 LEU 152 1030 1030 LEU LEU B . n 
B 1 153 MET 153 1031 1031 MET MET B . n 
B 1 154 GLN 154 1032 1032 GLN GLN B . n 
B 1 155 SER 155 1033 1033 SER SER B . n 
B 1 156 VAL 156 1034 1034 VAL VAL B . n 
B 1 157 LYS 157 1035 1035 LYS LYS B . n 
B 1 158 GLU 158 1036 1036 GLU GLU B . n 
B 1 159 THR 159 1037 1037 THR THR B . n 
B 1 160 VAL 160 1038 1038 VAL VAL B . n 
B 1 161 ARG 161 1039 1039 ARG ARG B . n 
B 1 162 GLU 162 1040 1040 GLU GLU B . n 
B 1 163 ALA 163 1041 1041 ALA ALA B . n 
B 1 164 GLU 164 1042 1042 GLU GLU B . n 
B 1 165 ALA 165 1043 1043 ALA ALA B . n 
B 1 166 ALA 166 1044 1044 ALA ALA B . n 
B 1 167 SER 167 1045 1045 SER SER B . n 
B 1 168 ILE 168 1046 ?    ?   ?   B . n 
B 1 169 LYS 169 1047 ?    ?   ?   B . n 
B 1 170 ILE 170 1048 ?    ?   ?   B . n 
B 1 171 ARG 171 1049 ?    ?   ?   B . n 
B 1 172 THR 172 1050 ?    ?   ?   B . n 
B 1 173 ASP 173 1051 ?    ?   ?   B . n 
B 1 174 ALA 174 1052 ?    ?   ?   B . n 
B 1 175 GLY 175 1053 ?    ?   ?   B . n 
B 1 176 PHE 176 1054 ?    ?   ?   B . n 
B 1 177 THR 177 1055 1055 THR THR B . n 
B 1 178 LEU 178 1056 1056 LEU LEU B . n 
B 1 179 ARG 179 1057 1057 ARG ARG B . n 
B 1 180 TRP 180 1058 1058 TRP TRP B . n 
B 1 181 VAL 181 1059 1059 VAL VAL B . n 
B 1 182 ARG 182 1060 1060 ARG ARG B . n 
B 1 183 LYS 183 1061 1061 LYS LYS B . n 
B 1 184 THR 184 1062 1062 THR THR B . n 
B 1 185 PRO 185 1063 1063 PRO PRO B . n 
B 1 186 TRP 186 1064 ?    ?   ?   B . n 
B 1 187 TYR 187 1065 ?    ?   ?   B . n 
B 1 188 GLN 188 1066 ?    ?   ?   B . n 
C 1 1   GLU 1   879  ?    ?   ?   C . n 
C 1 2   GLU 2   880  ?    ?   ?   C . n 
C 1 3   LYS 3   881  ?    ?   ?   C . n 
C 1 4   ASP 4   882  ?    ?   ?   C . n 
C 1 5   GLU 5   883  ?    ?   ?   C . n 
C 1 6   GLU 6   884  884  GLU GLU C . n 
C 1 7   PHE 7   885  885  PHE PHE C . n 
C 1 8   PRO 8   886  886  PRO PRO C . n 
C 1 9   GLU 9   887  887  GLU GLU C . n 
C 1 10  GLN 10  888  ?    ?   ?   C . n 
C 1 11  LYS 11  889  ?    ?   ?   C . n 
C 1 12  ALA 12  890  ?    ?   ?   C . n 
C 1 13  GLY 13  891  ?    ?   ?   C . n 
C 1 14  GLU 14  892  ?    ?   ?   C . n 
C 1 15  VAL 15  893  893  VAL VAL C . n 
C 1 16  ILE 16  894  894  ILE ILE C . n 
C 1 17  ASN 17  895  895  ASN ASN C . n 
C 1 18  GLN 18  896  896  GLN GLN C . n 
C 1 19  PRO 19  897  897  PRO PRO C . n 
C 1 20  MET 20  898  898  MET MET C . n 
C 1 21  MET 21  899  899  MET MET C . n 
C 1 22  MET 22  900  900  MET MET C . n 
C 1 23  ALA 23  901  901  ALA ALA C . n 
C 1 24  ALA 24  902  902  ALA ALA C . n 
C 1 25  ARG 25  903  903  ARG ARG C . n 
C 1 26  GLN 26  904  904  GLN GLN C . n 
C 1 27  LEU 27  905  905  LEU LEU C . n 
C 1 28  HIS 28  906  906  HIS HIS C . n 
C 1 29  ASP 29  907  907  ASP ASP C . n 
C 1 30  GLU 30  908  908  GLU GLU C . n 
C 1 31  ALA 31  909  909  ALA ALA C . n 
C 1 32  ARG 32  910  910  ARG ARG C . n 
C 1 33  LYS 33  911  911  LYS LYS C . n 
C 1 34  TRP 34  912  912  TRP TRP C . n 
C 1 35  SER 35  913  913  SER SER C . n 
C 1 36  SER 36  914  914  SER SER C . n 
C 1 37  LYS 37  915  915  LYS LYS C . n 
C 1 38  GLY 38  916  916  GLY GLY C . n 
C 1 39  ASN 39  917  917  ASN ASN C . n 
C 1 40  ASP 40  918  918  ASP ASP C . n 
C 1 41  ILE 41  919  919  ILE ILE C . n 
C 1 42  ILE 42  920  920  ILE ILE C . n 
C 1 43  ALA 43  921  921  ALA ALA C . n 
C 1 44  ALA 44  922  922  ALA ALA C . n 
C 1 45  ALA 45  923  923  ALA ALA C . n 
C 1 46  LYS 46  924  924  LYS LYS C . n 
C 1 47  ARG 47  925  925  ARG ARG C . n 
C 1 48  MET 48  926  926  MET MET C . n 
C 1 49  ALA 49  927  927  ALA ALA C . n 
C 1 50  LEU 50  928  928  LEU LEU C . n 
C 1 51  LEU 51  929  929  LEU LEU C . n 
C 1 52  MET 52  930  930  MET MET C . n 
C 1 53  ALA 53  931  931  ALA ALA C . n 
C 1 54  GLU 54  932  932  GLU GLU C . n 
C 1 55  MET 55  933  933  MET MET C . n 
C 1 56  SER 56  934  934  SER SER C . n 
C 1 57  ARG 57  935  935  ARG ARG C . n 
C 1 58  LEU 58  936  936  LEU LEU C . n 
C 1 59  VAL 59  937  937  VAL VAL C . n 
C 1 60  ARG 60  938  938  ARG ARG C . n 
C 1 61  GLY 61  939  939  GLY GLY C . n 
C 1 62  GLY 62  940  940  GLY GLY C . n 
C 1 63  SER 63  941  941  SER SER C . n 
C 1 64  GLY 64  942  942  GLY GLY C . n 
C 1 65  THR 65  943  943  THR THR C . n 
C 1 66  LYS 66  944  944  LYS LYS C . n 
C 1 67  ARG 67  945  945  ARG ARG C . n 
C 1 68  ALA 68  946  946  ALA ALA C . n 
C 1 69  LEU 69  947  947  LEU LEU C . n 
C 1 70  ILE 70  948  948  ILE ILE C . n 
C 1 71  GLN 71  949  949  GLN GLN C . n 
C 1 72  CYS 72  950  950  CYS CYS C . n 
C 1 73  ALA 73  951  951  ALA ALA C . n 
C 1 74  LYS 74  952  952  LYS LYS C . n 
C 1 75  ASP 75  953  953  ASP ASP C . n 
C 1 76  ILE 76  954  954  ILE ILE C . n 
C 1 77  ALA 77  955  955  ALA ALA C . n 
C 1 78  LYS 78  956  956  LYS LYS C . n 
C 1 79  ALA 79  957  957  ALA ALA C . n 
C 1 80  SER 80  958  958  SER SER C . n 
C 1 81  ASP 81  959  959  ASP ASP C . n 
C 1 82  GLU 82  960  960  GLU GLU C . n 
C 1 83  VAL 83  961  961  VAL VAL C . n 
C 1 84  THR 84  962  962  THR THR C . n 
C 1 85  ARG 85  963  963  ARG ARG C . n 
C 1 86  LEU 86  964  964  LEU LEU C . n 
C 1 87  ALA 87  965  965  ALA ALA C . n 
C 1 88  LYS 88  966  966  LYS LYS C . n 
C 1 89  GLU 89  967  967  GLU GLU C . n 
C 1 90  VAL 90  968  968  VAL VAL C . n 
C 1 91  ALA 91  969  969  ALA ALA C . n 
C 1 92  LYS 92  970  970  LYS LYS C . n 
C 1 93  GLN 93  971  971  GLN GLN C . n 
C 1 94  CYS 94  972  972  CYS CYS C . n 
C 1 95  THR 95  973  973  THR THR C . n 
C 1 96  ASP 96  974  974  ASP ASP C . n 
C 1 97  LYS 97  975  975  LYS LYS C . n 
C 1 98  ARG 98  976  976  ARG ARG C . n 
C 1 99  ILE 99  977  977  ILE ILE C . n 
C 1 100 ARG 100 978  978  ARG ARG C . n 
C 1 101 THR 101 979  979  THR THR C . n 
C 1 102 ASN 102 980  980  ASN ASN C . n 
C 1 103 LEU 103 981  981  LEU LEU C . n 
C 1 104 LEU 104 982  982  LEU LEU C . n 
C 1 105 GLN 105 983  983  GLN GLN C . n 
C 1 106 VAL 106 984  984  VAL VAL C . n 
C 1 107 CYS 107 985  985  CYS CYS C . n 
C 1 108 GLU 108 986  986  GLU GLU C . n 
C 1 109 ARG 109 987  987  ARG ARG C . n 
C 1 110 ILE 110 988  988  ILE ILE C . n 
C 1 111 PRO 111 989  989  PRO PRO C . n 
C 1 112 THR 112 990  990  THR THR C . n 
C 1 113 ILE 113 991  991  ILE ILE C . n 
C 1 114 SER 114 992  992  SER SER C . n 
C 1 115 THR 115 993  993  THR THR C . n 
C 1 116 GLN 116 994  994  GLN GLN C . n 
C 1 117 LEU 117 995  995  LEU LEU C . n 
C 1 118 LYS 118 996  996  LYS LYS C . n 
C 1 119 ILE 119 997  997  ILE ILE C . n 
C 1 120 LEU 120 998  998  LEU LEU C . n 
C 1 121 SER 121 999  999  SER SER C . n 
C 1 122 THR 122 1000 1000 THR THR C . n 
C 1 123 VAL 123 1001 1001 VAL VAL C . n 
C 1 124 LYS 124 1002 1002 LYS LYS C . n 
C 1 125 ALA 125 1003 1003 ALA ALA C . n 
C 1 126 THR 126 1004 1004 THR THR C . n 
C 1 127 MET 127 1005 1005 MET MET C . n 
C 1 128 LEU 128 1006 1006 LEU LEU C . n 
C 1 129 GLY 129 1007 1007 GLY GLY C . n 
C 1 130 ARG 130 1008 1008 ARG ARG C . n 
C 1 131 THR 131 1009 1009 THR THR C . n 
C 1 132 ASN 132 1010 1010 ASN ASN C . n 
C 1 133 ILE 133 1011 1011 ILE ILE C . n 
C 1 134 SER 134 1012 1012 SER SER C . n 
C 1 135 ASP 135 1013 1013 ASP ASP C . n 
C 1 136 GLU 136 1014 1014 GLU GLU C . n 
C 1 137 GLU 137 1015 1015 GLU GLU C . n 
C 1 138 SER 138 1016 1016 SER SER C . n 
C 1 139 GLU 139 1017 1017 GLU GLU C . n 
C 1 140 GLN 140 1018 1018 GLN GLN C . n 
C 1 141 ALA 141 1019 1019 ALA ALA C . n 
C 1 142 THR 142 1020 1020 THR THR C . n 
C 1 143 GLU 143 1021 1021 GLU GLU C . n 
C 1 144 MET 144 1022 1022 MET MET C . n 
C 1 145 LEU 145 1023 1023 LEU LEU C . n 
C 1 146 VAL 146 1024 1024 VAL VAL C . n 
C 1 147 HIS 147 1025 1025 HIS HIS C . n 
C 1 148 ASN 148 1026 1026 ASN ASN C . n 
C 1 149 ALA 149 1027 1027 ALA ALA C . n 
C 1 150 GLN 150 1028 1028 GLN GLN C . n 
C 1 151 ASN 151 1029 1029 ASN ASN C . n 
C 1 152 LEU 152 1030 1030 LEU LEU C . n 
C 1 153 MET 153 1031 1031 MET MET C . n 
C 1 154 GLN 154 1032 1032 GLN GLN C . n 
C 1 155 SER 155 1033 1033 SER SER C . n 
C 1 156 VAL 156 1034 1034 VAL VAL C . n 
C 1 157 LYS 157 1035 1035 LYS LYS C . n 
C 1 158 GLU 158 1036 1036 GLU GLU C . n 
C 1 159 THR 159 1037 1037 THR THR C . n 
C 1 160 VAL 160 1038 1038 VAL VAL C . n 
C 1 161 ARG 161 1039 1039 ARG ARG C . n 
C 1 162 GLU 162 1040 1040 GLU GLU C . n 
C 1 163 ALA 163 1041 1041 ALA ALA C . n 
C 1 164 GLU 164 1042 1042 GLU GLU C . n 
C 1 165 ALA 165 1043 1043 ALA ALA C . n 
C 1 166 ALA 166 1044 1044 ALA ALA C . n 
C 1 167 SER 167 1045 1045 SER SER C . n 
C 1 168 ILE 168 1046 1046 ILE ILE C . n 
C 1 169 LYS 169 1047 ?    ?   ?   C . n 
C 1 170 ILE 170 1048 ?    ?   ?   C . n 
C 1 171 ARG 171 1049 ?    ?   ?   C . n 
C 1 172 THR 172 1050 ?    ?   ?   C . n 
C 1 173 ASP 173 1051 ?    ?   ?   C . n 
C 1 174 ALA 174 1052 ?    ?   ?   C . n 
C 1 175 GLY 175 1053 ?    ?   ?   C . n 
C 1 176 PHE 176 1054 ?    ?   ?   C . n 
C 1 177 THR 177 1055 1055 THR THR C . n 
C 1 178 LEU 178 1056 1056 LEU LEU C . n 
C 1 179 ARG 179 1057 1057 ARG ARG C . n 
C 1 180 TRP 180 1058 1058 TRP TRP C . n 
C 1 181 VAL 181 1059 1059 VAL VAL C . n 
C 1 182 ARG 182 1060 1060 ARG ARG C . n 
C 1 183 LYS 183 1061 1061 LYS LYS C . n 
C 1 184 THR 184 1062 1062 THR THR C . n 
C 1 185 PRO 185 1063 1063 PRO PRO C . n 
C 1 186 TRP 186 1064 ?    ?   ?   C . n 
C 1 187 TYR 187 1065 ?    ?   ?   C . n 
C 1 188 GLN 188 1066 ?    ?   ?   C . n 
D 1 1   GLU 1   879  ?    ?   ?   D . n 
D 1 2   GLU 2   880  ?    ?   ?   D . n 
D 1 3   LYS 3   881  ?    ?   ?   D . n 
D 1 4   ASP 4   882  ?    ?   ?   D . n 
D 1 5   GLU 5   883  ?    ?   ?   D . n 
D 1 6   GLU 6   884  884  GLU GLU D . n 
D 1 7   PHE 7   885  885  PHE PHE D . n 
D 1 8   PRO 8   886  886  PRO PRO D . n 
D 1 9   GLU 9   887  887  GLU GLU D . n 
D 1 10  GLN 10  888  ?    ?   ?   D . n 
D 1 11  LYS 11  889  ?    ?   ?   D . n 
D 1 12  ALA 12  890  ?    ?   ?   D . n 
D 1 13  GLY 13  891  ?    ?   ?   D . n 
D 1 14  GLU 14  892  ?    ?   ?   D . n 
D 1 15  VAL 15  893  893  VAL VAL D . n 
D 1 16  ILE 16  894  894  ILE ILE D . n 
D 1 17  ASN 17  895  895  ASN ASN D . n 
D 1 18  GLN 18  896  896  GLN GLN D . n 
D 1 19  PRO 19  897  897  PRO PRO D . n 
D 1 20  MET 20  898  898  MET MET D . n 
D 1 21  MET 21  899  899  MET MET D . n 
D 1 22  MET 22  900  900  MET MET D . n 
D 1 23  ALA 23  901  901  ALA ALA D . n 
D 1 24  ALA 24  902  902  ALA ALA D . n 
D 1 25  ARG 25  903  903  ARG ARG D . n 
D 1 26  GLN 26  904  904  GLN GLN D . n 
D 1 27  LEU 27  905  905  LEU LEU D . n 
D 1 28  HIS 28  906  906  HIS HIS D . n 
D 1 29  ASP 29  907  907  ASP ASP D . n 
D 1 30  GLU 30  908  908  GLU GLU D . n 
D 1 31  ALA 31  909  909  ALA ALA D . n 
D 1 32  ARG 32  910  910  ARG ARG D . n 
D 1 33  LYS 33  911  911  LYS LYS D . n 
D 1 34  TRP 34  912  912  TRP TRP D . n 
D 1 35  SER 35  913  913  SER SER D . n 
D 1 36  SER 36  914  914  SER SER D . n 
D 1 37  LYS 37  915  915  LYS LYS D . n 
D 1 38  GLY 38  916  916  GLY GLY D . n 
D 1 39  ASN 39  917  917  ASN ASN D . n 
D 1 40  ASP 40  918  918  ASP ASP D . n 
D 1 41  ILE 41  919  919  ILE ILE D . n 
D 1 42  ILE 42  920  920  ILE ILE D . n 
D 1 43  ALA 43  921  921  ALA ALA D . n 
D 1 44  ALA 44  922  922  ALA ALA D . n 
D 1 45  ALA 45  923  923  ALA ALA D . n 
D 1 46  LYS 46  924  924  LYS LYS D . n 
D 1 47  ARG 47  925  925  ARG ARG D . n 
D 1 48  MET 48  926  926  MET MET D . n 
D 1 49  ALA 49  927  927  ALA ALA D . n 
D 1 50  LEU 50  928  928  LEU LEU D . n 
D 1 51  LEU 51  929  929  LEU LEU D . n 
D 1 52  MET 52  930  930  MET MET D . n 
D 1 53  ALA 53  931  931  ALA ALA D . n 
D 1 54  GLU 54  932  932  GLU GLU D . n 
D 1 55  MET 55  933  933  MET MET D . n 
D 1 56  SER 56  934  934  SER SER D . n 
D 1 57  ARG 57  935  935  ARG ARG D . n 
D 1 58  LEU 58  936  936  LEU LEU D . n 
D 1 59  VAL 59  937  937  VAL VAL D . n 
D 1 60  ARG 60  938  938  ARG ARG D . n 
D 1 61  GLY 61  939  939  GLY GLY D . n 
D 1 62  GLY 62  940  940  GLY GLY D . n 
D 1 63  SER 63  941  941  SER SER D . n 
D 1 64  GLY 64  942  942  GLY GLY D . n 
D 1 65  THR 65  943  943  THR THR D . n 
D 1 66  LYS 66  944  944  LYS LYS D . n 
D 1 67  ARG 67  945  945  ARG ARG D . n 
D 1 68  ALA 68  946  946  ALA ALA D . n 
D 1 69  LEU 69  947  947  LEU LEU D . n 
D 1 70  ILE 70  948  948  ILE ILE D . n 
D 1 71  GLN 71  949  949  GLN GLN D . n 
D 1 72  CYS 72  950  950  CYS CYS D . n 
D 1 73  ALA 73  951  951  ALA ALA D . n 
D 1 74  LYS 74  952  952  LYS LYS D . n 
D 1 75  ASP 75  953  953  ASP ASP D . n 
D 1 76  ILE 76  954  954  ILE ILE D . n 
D 1 77  ALA 77  955  955  ALA ALA D . n 
D 1 78  LYS 78  956  956  LYS LYS D . n 
D 1 79  ALA 79  957  957  ALA ALA D . n 
D 1 80  SER 80  958  958  SER SER D . n 
D 1 81  ASP 81  959  959  ASP ASP D . n 
D 1 82  GLU 82  960  960  GLU GLU D . n 
D 1 83  VAL 83  961  961  VAL VAL D . n 
D 1 84  THR 84  962  962  THR THR D . n 
D 1 85  ARG 85  963  963  ARG ARG D . n 
D 1 86  LEU 86  964  964  LEU LEU D . n 
D 1 87  ALA 87  965  965  ALA ALA D . n 
D 1 88  LYS 88  966  966  LYS LYS D . n 
D 1 89  GLU 89  967  967  GLU GLU D . n 
D 1 90  VAL 90  968  968  VAL VAL D . n 
D 1 91  ALA 91  969  969  ALA ALA D . n 
D 1 92  LYS 92  970  970  LYS LYS D . n 
D 1 93  GLN 93  971  971  GLN GLN D . n 
D 1 94  CYS 94  972  972  CYS CYS D . n 
D 1 95  THR 95  973  973  THR THR D . n 
D 1 96  ASP 96  974  974  ASP ASP D . n 
D 1 97  LYS 97  975  975  LYS LYS D . n 
D 1 98  ARG 98  976  976  ARG ARG D . n 
D 1 99  ILE 99  977  977  ILE ILE D . n 
D 1 100 ARG 100 978  978  ARG ARG D . n 
D 1 101 THR 101 979  979  THR THR D . n 
D 1 102 ASN 102 980  980  ASN ASN D . n 
D 1 103 LEU 103 981  981  LEU LEU D . n 
D 1 104 LEU 104 982  982  LEU LEU D . n 
D 1 105 GLN 105 983  983  GLN GLN D . n 
D 1 106 VAL 106 984  984  VAL VAL D . n 
D 1 107 CYS 107 985  985  CYS CYS D . n 
D 1 108 GLU 108 986  986  GLU GLU D . n 
D 1 109 ARG 109 987  987  ARG ARG D . n 
D 1 110 ILE 110 988  988  ILE ILE D . n 
D 1 111 PRO 111 989  989  PRO PRO D . n 
D 1 112 THR 112 990  990  THR THR D . n 
D 1 113 ILE 113 991  991  ILE ILE D . n 
D 1 114 SER 114 992  992  SER SER D . n 
D 1 115 THR 115 993  993  THR THR D . n 
D 1 116 GLN 116 994  994  GLN GLN D . n 
D 1 117 LEU 117 995  995  LEU LEU D . n 
D 1 118 LYS 118 996  996  LYS LYS D . n 
D 1 119 ILE 119 997  997  ILE ILE D . n 
D 1 120 LEU 120 998  998  LEU LEU D . n 
D 1 121 SER 121 999  999  SER SER D . n 
D 1 122 THR 122 1000 1000 THR THR D . n 
D 1 123 VAL 123 1001 1001 VAL VAL D . n 
D 1 124 LYS 124 1002 1002 LYS LYS D . n 
D 1 125 ALA 125 1003 1003 ALA ALA D . n 
D 1 126 THR 126 1004 1004 THR THR D . n 
D 1 127 MET 127 1005 1005 MET MET D . n 
D 1 128 LEU 128 1006 1006 LEU LEU D . n 
D 1 129 GLY 129 1007 1007 GLY GLY D . n 
D 1 130 ARG 130 1008 1008 ARG ARG D . n 
D 1 131 THR 131 1009 1009 THR THR D . n 
D 1 132 ASN 132 1010 1010 ASN ASN D . n 
D 1 133 ILE 133 1011 1011 ILE ILE D . n 
D 1 134 SER 134 1012 1012 SER SER D . n 
D 1 135 ASP 135 1013 1013 ASP ASP D . n 
D 1 136 GLU 136 1014 1014 GLU GLU D . n 
D 1 137 GLU 137 1015 1015 GLU GLU D . n 
D 1 138 SER 138 1016 1016 SER SER D . n 
D 1 139 GLU 139 1017 1017 GLU GLU D . n 
D 1 140 GLN 140 1018 1018 GLN GLN D . n 
D 1 141 ALA 141 1019 1019 ALA ALA D . n 
D 1 142 THR 142 1020 1020 THR THR D . n 
D 1 143 GLU 143 1021 1021 GLU GLU D . n 
D 1 144 MET 144 1022 1022 MET MET D . n 
D 1 145 LEU 145 1023 1023 LEU LEU D . n 
D 1 146 VAL 146 1024 1024 VAL VAL D . n 
D 1 147 HIS 147 1025 1025 HIS HIS D . n 
D 1 148 ASN 148 1026 1026 ASN ASN D . n 
D 1 149 ALA 149 1027 1027 ALA ALA D . n 
D 1 150 GLN 150 1028 1028 GLN GLN D . n 
D 1 151 ASN 151 1029 1029 ASN ASN D . n 
D 1 152 LEU 152 1030 1030 LEU LEU D . n 
D 1 153 MET 153 1031 1031 MET MET D . n 
D 1 154 GLN 154 1032 1032 GLN GLN D . n 
D 1 155 SER 155 1033 1033 SER SER D . n 
D 1 156 VAL 156 1034 1034 VAL VAL D . n 
D 1 157 LYS 157 1035 1035 LYS LYS D . n 
D 1 158 GLU 158 1036 1036 GLU GLU D . n 
D 1 159 THR 159 1037 1037 THR THR D . n 
D 1 160 VAL 160 1038 1038 VAL VAL D . n 
D 1 161 ARG 161 1039 1039 ARG ARG D . n 
D 1 162 GLU 162 1040 1040 GLU GLU D . n 
D 1 163 ALA 163 1041 1041 ALA ALA D . n 
D 1 164 GLU 164 1042 1042 GLU GLU D . n 
D 1 165 ALA 165 1043 1043 ALA ALA D . n 
D 1 166 ALA 166 1044 1044 ALA ALA D . n 
D 1 167 SER 167 1045 1045 SER SER D . n 
D 1 168 ILE 168 1046 1046 ILE ILE D . n 
D 1 169 LYS 169 1047 1047 LYS LYS D . n 
D 1 170 ILE 170 1048 1048 ILE ILE D . n 
D 1 171 ARG 171 1049 1049 ARG ARG D . n 
D 1 172 THR 172 1050 1050 THR THR D . n 
D 1 173 ASP 173 1051 1051 ASP ASP D . n 
D 1 174 ALA 174 1052 1052 ALA ALA D . n 
D 1 175 GLY 175 1053 1053 GLY GLY D . n 
D 1 176 PHE 176 1054 1054 PHE PHE D . n 
D 1 177 THR 177 1055 1055 THR THR D . n 
D 1 178 LEU 178 1056 1056 LEU LEU D . n 
D 1 179 ARG 179 1057 1057 ARG ARG D . n 
D 1 180 TRP 180 1058 1058 TRP TRP D . n 
D 1 181 VAL 181 1059 1059 VAL VAL D . n 
D 1 182 ARG 182 1060 1060 ARG ARG D . n 
D 1 183 LYS 183 1061 1061 LYS LYS D . n 
D 1 184 THR 184 1062 1062 THR THR D . n 
D 1 185 PRO 185 1063 1063 PRO PRO D . n 
D 1 186 TRP 186 1064 ?    ?   ?   D . n 
D 1 187 TYR 187 1065 ?    ?   ?   D . n 
D 1 188 GLN 188 1066 ?    ?   ?   D . n 
E 2 1   HIS 1   57   57   HIS HIS E . n 
E 2 2   MET 2   58   58   MET MET E . n 
E 2 3   ARG 3   59   59   ARG ARG E . n 
E 2 4   LYS 4   60   60   LYS LYS E . n 
E 2 5   ILE 5   61   61   ILE ILE E . n 
E 2 6   LEU 6   62   62   LEU LEU E . n 
E 2 7   ILE 7   63   63   ILE ILE E . n 
E 2 8   ARG 8   64   64   ARG ARG E . n 
E 2 9   GLY 9   65   65   GLY GLY E . n 
E 2 10  LEU 10  66   66   LEU LEU E . n 
E 2 11  PRO 11  67   67   PRO PRO E . n 
E 2 12  GLY 12  68   68   GLY GLY E . n 
E 2 13  ASP 13  69   69   ASP ASP E . n 
E 2 14  VAL 14  70   70   VAL VAL E . n 
E 2 15  THR 15  71   71   THR THR E . n 
E 2 16  ASN 16  72   72   ASN ASN E . n 
E 2 17  GLN 17  73   73   GLN GLN E . n 
E 2 18  GLU 18  74   74   GLU GLU E . n 
E 2 19  VAL 19  75   75   VAL VAL E . n 
E 2 20  HIS 20  76   76   HIS HIS E . n 
E 2 21  ASP 21  77   77   ASP ASP E . n 
E 2 22  LEU 22  78   78   LEU LEU E . n 
E 2 23  LEU 23  79   79   LEU LEU E . n 
E 2 24  SER 24  80   80   SER SER E . n 
E 2 25  ASP 25  81   81   ASP ASP E . n 
E 2 26  TYR 26  82   82   TYR TYR E . n 
E 2 27  GLU 27  83   83   GLU GLU E . n 
E 2 28  LEU 28  84   84   LEU LEU E . n 
E 2 29  LYS 29  85   85   LYS LYS E . n 
E 2 30  TYR 30  86   86   TYR TYR E . n 
E 2 31  CYS 31  87   87   CYS CYS E . n 
E 2 32  PHE 32  88   88   PHE PHE E . n 
E 2 33  VAL 33  89   89   VAL VAL E . n 
E 2 34  ASP 34  90   90   ASP ASP E . n 
E 2 35  LYS 35  91   91   LYS LYS E . n 
E 2 36  TYR 36  92   92   TYR TYR E . n 
E 2 37  LYS 37  93   93   LYS LYS E . n 
E 2 38  GLY 38  94   94   GLY GLY E . n 
E 2 39  THR 39  95   95   THR THR E . n 
E 2 40  ALA 40  96   96   ALA ALA E . n 
E 2 41  PHE 41  97   97   PHE PHE E . n 
E 2 42  VAL 42  98   98   VAL VAL E . n 
E 2 43  THR 43  99   99   THR THR E . n 
E 2 44  LEU 44  100  100  LEU LEU E . n 
E 2 45  LEU 45  101  101  LEU LEU E . n 
E 2 46  ASN 46  102  102  ASN ASN E . n 
E 2 47  GLY 47  103  103  GLY GLY E . n 
E 2 48  GLU 48  104  104  GLU GLU E . n 
E 2 49  GLN 49  105  105  GLN GLN E . n 
E 2 50  ALA 50  106  106  ALA ALA E . n 
E 2 51  GLU 51  107  107  GLU GLU E . n 
E 2 52  ALA 52  108  108  ALA ALA E . n 
E 2 53  ALA 53  109  109  ALA ALA E . n 
E 2 54  ILE 54  110  110  ILE ILE E . n 
E 2 55  ASN 55  111  111  ASN ASN E . n 
E 2 56  ALA 56  112  112  ALA ALA E . n 
E 2 57  PHE 57  113  113  PHE PHE E . n 
E 2 58  HIS 58  114  114  HIS HIS E . n 
E 2 59  GLN 59  115  115  GLN GLN E . n 
E 2 60  SER 60  116  116  SER SER E . n 
E 2 61  ARG 61  117  117  ARG ARG E . n 
E 2 62  LEU 62  118  118  LEU LEU E . n 
E 2 63  ARG 63  119  119  ARG ARG E . n 
E 2 64  GLU 64  120  120  GLU GLU E . n 
E 2 65  ARG 65  121  121  ARG ARG E . n 
E 2 66  GLU 66  122  122  GLU GLU E . n 
E 2 67  LEU 67  123  123  LEU LEU E . n 
E 2 68  SER 68  124  124  SER SER E . n 
E 2 69  VAL 69  125  125  VAL VAL E . n 
E 2 70  GLN 70  126  126  GLN GLN E . n 
E 2 71  LEU 71  127  127  LEU LEU E . n 
E 2 72  GLN 72  128  128  GLN GLN E . n 
E 2 73  PRO 73  129  129  PRO PRO E . n 
E 2 74  THR 74  130  130  THR THR E . n 
F 2 1   HIS 1   57   ?    ?   ?   F . n 
F 2 2   MET 2   58   58   MET MET F . n 
F 2 3   ARG 3   59   59   ARG ARG F . n 
F 2 4   LYS 4   60   60   LYS LYS F . n 
F 2 5   ILE 5   61   61   ILE ILE F . n 
F 2 6   LEU 6   62   62   LEU LEU F . n 
F 2 7   ILE 7   63   63   ILE ILE F . n 
F 2 8   ARG 8   64   64   ARG ARG F . n 
F 2 9   GLY 9   65   65   GLY GLY F . n 
F 2 10  LEU 10  66   66   LEU LEU F . n 
F 2 11  PRO 11  67   67   PRO PRO F . n 
F 2 12  GLY 12  68   68   GLY GLY F . n 
F 2 13  ASP 13  69   69   ASP ASP F . n 
F 2 14  VAL 14  70   70   VAL VAL F . n 
F 2 15  THR 15  71   71   THR THR F . n 
F 2 16  ASN 16  72   72   ASN ASN F . n 
F 2 17  GLN 17  73   73   GLN GLN F . n 
F 2 18  GLU 18  74   74   GLU GLU F . n 
F 2 19  VAL 19  75   75   VAL VAL F . n 
F 2 20  HIS 20  76   76   HIS HIS F . n 
F 2 21  ASP 21  77   77   ASP ASP F . n 
F 2 22  LEU 22  78   78   LEU LEU F . n 
F 2 23  LEU 23  79   79   LEU LEU F . n 
F 2 24  SER 24  80   80   SER SER F . n 
F 2 25  ASP 25  81   81   ASP ASP F . n 
F 2 26  TYR 26  82   82   TYR TYR F . n 
F 2 27  GLU 27  83   83   GLU GLU F . n 
F 2 28  LEU 28  84   84   LEU LEU F . n 
F 2 29  LYS 29  85   85   LYS LYS F . n 
F 2 30  TYR 30  86   86   TYR TYR F . n 
F 2 31  CYS 31  87   87   CYS CYS F . n 
F 2 32  PHE 32  88   88   PHE PHE F . n 
F 2 33  VAL 33  89   89   VAL VAL F . n 
F 2 34  ASP 34  90   90   ASP ASP F . n 
F 2 35  LYS 35  91   91   LYS LYS F . n 
F 2 36  TYR 36  92   92   TYR TYR F . n 
F 2 37  LYS 37  93   93   LYS LYS F . n 
F 2 38  GLY 38  94   94   GLY GLY F . n 
F 2 39  THR 39  95   95   THR THR F . n 
F 2 40  ALA 40  96   96   ALA ALA F . n 
F 2 41  PHE 41  97   97   PHE PHE F . n 
F 2 42  VAL 42  98   98   VAL VAL F . n 
F 2 43  THR 43  99   99   THR THR F . n 
F 2 44  LEU 44  100  100  LEU LEU F . n 
F 2 45  LEU 45  101  101  LEU LEU F . n 
F 2 46  ASN 46  102  102  ASN ASN F . n 
F 2 47  GLY 47  103  103  GLY GLY F . n 
F 2 48  GLU 48  104  104  GLU GLU F . n 
F 2 49  GLN 49  105  105  GLN GLN F . n 
F 2 50  ALA 50  106  106  ALA ALA F . n 
F 2 51  GLU 51  107  107  GLU GLU F . n 
F 2 52  ALA 52  108  108  ALA ALA F . n 
F 2 53  ALA 53  109  109  ALA ALA F . n 
F 2 54  ILE 54  110  110  ILE ILE F . n 
F 2 55  ASN 55  111  111  ASN ASN F . n 
F 2 56  ALA 56  112  112  ALA ALA F . n 
F 2 57  PHE 57  113  113  PHE PHE F . n 
F 2 58  HIS 58  114  114  HIS HIS F . n 
F 2 59  GLN 59  115  115  GLN GLN F . n 
F 2 60  SER 60  116  116  SER SER F . n 
F 2 61  ARG 61  117  117  ARG ARG F . n 
F 2 62  LEU 62  118  118  LEU LEU F . n 
F 2 63  ARG 63  119  119  ARG ARG F . n 
F 2 64  GLU 64  120  120  GLU GLU F . n 
F 2 65  ARG 65  121  121  ARG ARG F . n 
F 2 66  GLU 66  122  122  GLU GLU F . n 
F 2 67  LEU 67  123  123  LEU LEU F . n 
F 2 68  SER 68  124  124  SER SER F . n 
F 2 69  VAL 69  125  125  VAL VAL F . n 
F 2 70  GLN 70  126  126  GLN GLN F . n 
F 2 71  LEU 71  127  127  LEU LEU F . n 
F 2 72  GLN 72  128  128  GLN GLN F . n 
F 2 73  PRO 73  129  129  PRO PRO F . n 
F 2 74  THR 74  130  130  THR THR F . n 
G 2 1   HIS 1   57   57   HIS HIS G . n 
G 2 2   MET 2   58   58   MET MET G . n 
G 2 3   ARG 3   59   59   ARG ARG G . n 
G 2 4   LYS 4   60   60   LYS LYS G . n 
G 2 5   ILE 5   61   61   ILE ILE G . n 
G 2 6   LEU 6   62   62   LEU LEU G . n 
G 2 7   ILE 7   63   63   ILE ILE G . n 
G 2 8   ARG 8   64   64   ARG ARG G . n 
G 2 9   GLY 9   65   65   GLY GLY G . n 
G 2 10  LEU 10  66   66   LEU LEU G . n 
G 2 11  PRO 11  67   67   PRO PRO G . n 
G 2 12  GLY 12  68   68   GLY GLY G . n 
G 2 13  ASP 13  69   69   ASP ASP G . n 
G 2 14  VAL 14  70   70   VAL VAL G . n 
G 2 15  THR 15  71   71   THR THR G . n 
G 2 16  ASN 16  72   72   ASN ASN G . n 
G 2 17  GLN 17  73   73   GLN GLN G . n 
G 2 18  GLU 18  74   74   GLU GLU G . n 
G 2 19  VAL 19  75   75   VAL VAL G . n 
G 2 20  HIS 20  76   76   HIS HIS G . n 
G 2 21  ASP 21  77   77   ASP ASP G . n 
G 2 22  LEU 22  78   78   LEU LEU G . n 
G 2 23  LEU 23  79   79   LEU LEU G . n 
G 2 24  SER 24  80   80   SER SER G . n 
G 2 25  ASP 25  81   81   ASP ASP G . n 
G 2 26  TYR 26  82   82   TYR TYR G . n 
G 2 27  GLU 27  83   83   GLU GLU G . n 
G 2 28  LEU 28  84   84   LEU LEU G . n 
G 2 29  LYS 29  85   85   LYS LYS G . n 
G 2 30  TYR 30  86   86   TYR TYR G . n 
G 2 31  CYS 31  87   87   CYS CYS G . n 
G 2 32  PHE 32  88   88   PHE PHE G . n 
G 2 33  VAL 33  89   89   VAL VAL G . n 
G 2 34  ASP 34  90   90   ASP ASP G . n 
G 2 35  LYS 35  91   91   LYS LYS G . n 
G 2 36  TYR 36  92   92   TYR TYR G . n 
G 2 37  LYS 37  93   93   LYS LYS G . n 
G 2 38  GLY 38  94   94   GLY GLY G . n 
G 2 39  THR 39  95   95   THR THR G . n 
G 2 40  ALA 40  96   96   ALA ALA G . n 
G 2 41  PHE 41  97   97   PHE PHE G . n 
G 2 42  VAL 42  98   98   VAL VAL G . n 
G 2 43  THR 43  99   99   THR THR G . n 
G 2 44  LEU 44  100  100  LEU LEU G . n 
G 2 45  LEU 45  101  101  LEU LEU G . n 
G 2 46  ASN 46  102  102  ASN ASN G . n 
G 2 47  GLY 47  103  103  GLY GLY G . n 
G 2 48  GLU 48  104  104  GLU GLU G . n 
G 2 49  GLN 49  105  105  GLN GLN G . n 
G 2 50  ALA 50  106  106  ALA ALA G . n 
G 2 51  GLU 51  107  107  GLU GLU G . n 
G 2 52  ALA 52  108  108  ALA ALA G . n 
G 2 53  ALA 53  109  109  ALA ALA G . n 
G 2 54  ILE 54  110  110  ILE ILE G . n 
G 2 55  ASN 55  111  111  ASN ASN G . n 
G 2 56  ALA 56  112  112  ALA ALA G . n 
G 2 57  PHE 57  113  113  PHE PHE G . n 
G 2 58  HIS 58  114  114  HIS HIS G . n 
G 2 59  GLN 59  115  115  GLN GLN G . n 
G 2 60  SER 60  116  116  SER SER G . n 
G 2 61  ARG 61  117  117  ARG ARG G . n 
G 2 62  LEU 62  118  118  LEU LEU G . n 
G 2 63  ARG 63  119  119  ARG ARG G . n 
G 2 64  GLU 64  120  120  GLU GLU G . n 
G 2 65  ARG 65  121  121  ARG ARG G . n 
G 2 66  GLU 66  122  122  GLU GLU G . n 
G 2 67  LEU 67  123  123  LEU LEU G . n 
G 2 68  SER 68  124  124  SER SER G . n 
G 2 69  VAL 69  125  125  VAL VAL G . n 
G 2 70  GLN 70  126  126  GLN GLN G . n 
G 2 71  LEU 71  127  127  LEU LEU G . n 
G 2 72  GLN 72  128  128  GLN GLN G . n 
G 2 73  PRO 73  129  129  PRO PRO G . n 
G 2 74  THR 74  130  130  THR THR G . n 
H 2 1   HIS 1   57   ?    ?   ?   H . n 
H 2 2   MET 2   58   58   MET MET H . n 
H 2 3   ARG 3   59   59   ARG ARG H . n 
H 2 4   LYS 4   60   60   LYS LYS H . n 
H 2 5   ILE 5   61   61   ILE ILE H . n 
H 2 6   LEU 6   62   62   LEU LEU H . n 
H 2 7   ILE 7   63   63   ILE ILE H . n 
H 2 8   ARG 8   64   64   ARG ARG H . n 
H 2 9   GLY 9   65   65   GLY GLY H . n 
H 2 10  LEU 10  66   66   LEU LEU H . n 
H 2 11  PRO 11  67   67   PRO PRO H . n 
H 2 12  GLY 12  68   68   GLY GLY H . n 
H 2 13  ASP 13  69   69   ASP ASP H . n 
H 2 14  VAL 14  70   70   VAL VAL H . n 
H 2 15  THR 15  71   71   THR THR H . n 
H 2 16  ASN 16  72   72   ASN ASN H . n 
H 2 17  GLN 17  73   73   GLN GLN H . n 
H 2 18  GLU 18  74   74   GLU GLU H . n 
H 2 19  VAL 19  75   75   VAL VAL H . n 
H 2 20  HIS 20  76   76   HIS HIS H . n 
H 2 21  ASP 21  77   77   ASP ASP H . n 
H 2 22  LEU 22  78   78   LEU LEU H . n 
H 2 23  LEU 23  79   79   LEU LEU H . n 
H 2 24  SER 24  80   80   SER SER H . n 
H 2 25  ASP 25  81   81   ASP ASP H . n 
H 2 26  TYR 26  82   82   TYR TYR H . n 
H 2 27  GLU 27  83   83   GLU GLU H . n 
H 2 28  LEU 28  84   84   LEU LEU H . n 
H 2 29  LYS 29  85   85   LYS LYS H . n 
H 2 30  TYR 30  86   86   TYR TYR H . n 
H 2 31  CYS 31  87   87   CYS CYS H . n 
H 2 32  PHE 32  88   88   PHE PHE H . n 
H 2 33  VAL 33  89   89   VAL VAL H . n 
H 2 34  ASP 34  90   90   ASP ASP H . n 
H 2 35  LYS 35  91   91   LYS LYS H . n 
H 2 36  TYR 36  92   92   TYR TYR H . n 
H 2 37  LYS 37  93   93   LYS LYS H . n 
H 2 38  GLY 38  94   94   GLY GLY H . n 
H 2 39  THR 39  95   95   THR THR H . n 
H 2 40  ALA 40  96   96   ALA ALA H . n 
H 2 41  PHE 41  97   97   PHE PHE H . n 
H 2 42  VAL 42  98   98   VAL VAL H . n 
H 2 43  THR 43  99   99   THR THR H . n 
H 2 44  LEU 44  100  100  LEU LEU H . n 
H 2 45  LEU 45  101  101  LEU LEU H . n 
H 2 46  ASN 46  102  102  ASN ASN H . n 
H 2 47  GLY 47  103  103  GLY GLY H . n 
H 2 48  GLU 48  104  104  GLU GLU H . n 
H 2 49  GLN 49  105  105  GLN GLN H . n 
H 2 50  ALA 50  106  106  ALA ALA H . n 
H 2 51  GLU 51  107  107  GLU GLU H . n 
H 2 52  ALA 52  108  108  ALA ALA H . n 
H 2 53  ALA 53  109  109  ALA ALA H . n 
H 2 54  ILE 54  110  110  ILE ILE H . n 
H 2 55  ASN 55  111  111  ASN ASN H . n 
H 2 56  ALA 56  112  112  ALA ALA H . n 
H 2 57  PHE 57  113  113  PHE PHE H . n 
H 2 58  HIS 58  114  114  HIS HIS H . n 
H 2 59  GLN 59  115  115  GLN GLN H . n 
H 2 60  SER 60  116  116  SER SER H . n 
H 2 61  ARG 61  117  117  ARG ARG H . n 
H 2 62  LEU 62  118  118  LEU LEU H . n 
H 2 63  ARG 63  119  119  ARG ARG H . n 
H 2 64  GLU 64  120  120  GLU GLU H . n 
H 2 65  ARG 65  121  121  ARG ARG H . n 
H 2 66  GLU 66  122  122  GLU GLU H . n 
H 2 67  LEU 67  123  123  LEU LEU H . n 
H 2 68  SER 68  124  124  SER SER H . n 
H 2 69  VAL 69  125  125  VAL VAL H . n 
H 2 70  GLN 70  126  126  GLN GLN H . n 
H 2 71  LEU 71  127  127  LEU LEU H . n 
H 2 72  GLN 72  128  128  GLN GLN H . n 
H 2 73  PRO 73  129  129  PRO PRO H . n 
H 2 74  THR 74  130  130  THR THR H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 3 HOH 1 4 4 HOH HOH A . 
J 3 HOH 1 2 2 HOH HOH B . 
K 3 HOH 1 3 3 HOH HOH F . 
L 3 HOH 1 1 1 HOH HOH G . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
3 author_defined_assembly ? dimeric 2 
4 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,I   
2 1 B,F,J,K 
3 1 C,G,L   
4 1 D,H     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-07-28 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_software.name             BUSTER-TNT 
_software.classification   refinement 
_software.version          2.3.0 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CG  A PHE 885  ? ? CD1 A PHE 885  ? ? 1.254 1.383 -0.129 0.015 N 
2  1 CZ  A PHE 885  ? ? CE2 A PHE 885  ? ? 1.179 1.369 -0.190 0.019 N 
3  1 CE2 A PHE 885  ? ? CD2 A PHE 885  ? ? 1.231 1.388 -0.157 0.020 N 
4  1 C   A PHE 885  ? ? O   A PHE 885  ? ? 1.112 1.229 -0.117 0.019 N 
5  1 CG  A PRO 886  ? ? CD  A PRO 886  ? ? 1.261 1.502 -0.241 0.033 N 
6  1 N   A VAL 1038 ? ? CA  A VAL 1038 ? ? 1.337 1.459 -0.122 0.020 N 
7  1 CA  A VAL 1038 ? ? CB  A VAL 1038 ? ? 1.277 1.543 -0.266 0.021 N 
8  1 CB  A VAL 1038 ? ? CG1 A VAL 1038 ? ? 1.178 1.524 -0.346 0.021 N 
9  1 CB  A VAL 1038 ? ? CG2 A VAL 1038 ? ? 1.347 1.524 -0.177 0.021 N 
10 1 CA  A VAL 1038 ? ? C   A VAL 1038 ? ? 1.351 1.525 -0.174 0.026 N 
11 1 C   A VAL 1038 ? ? O   A VAL 1038 ? ? 1.035 1.229 -0.194 0.019 N 
12 1 CB  A ARG 1039 ? ? CG  A ARG 1039 ? ? 1.327 1.521 -0.194 0.027 N 
13 1 CZ  A ARG 1039 ? ? NH2 A ARG 1039 ? ? 1.242 1.326 -0.084 0.013 N 
14 1 CA  A ARG 1039 ? ? C   A ARG 1039 ? ? 1.353 1.525 -0.172 0.026 N 
15 1 C   A ARG 1039 ? ? O   A ARG 1039 ? ? 1.050 1.229 -0.179 0.019 N 
16 1 N   A GLU 1040 ? ? CA  A GLU 1040 ? ? 1.333 1.459 -0.126 0.020 N 
17 1 CD  A GLU 1040 ? ? OE2 A GLU 1040 ? ? 1.164 1.252 -0.088 0.011 N 
18 1 C   A GLU 1040 ? ? O   A GLU 1040 ? ? 1.039 1.229 -0.190 0.019 N 
19 1 CZ  E ARG 119  ? ? NH1 E ARG 119  ? ? 1.222 1.326 -0.104 0.013 N 
20 1 CZ  E ARG 119  ? ? NH2 E ARG 119  ? ? 1.234 1.326 -0.092 0.013 N 
21 1 C   E ARG 119  ? ? O   E ARG 119  ? ? 1.073 1.229 -0.156 0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C   A PHE 885  ? ? N  A PRO 886  ? ? CD  A PRO 886  ? ? 113.18 128.40 -15.22 2.10 Y 
2  1 NE  A ARG 1039 ? ? CZ A ARG 1039 ? ? NH1 A ARG 1039 ? ? 124.45 120.30 4.15   0.50 N 
3  1 OE1 A GLU 1040 ? ? CD A GLU 1040 ? ? OE2 A GLU 1040 ? ? 113.29 123.30 -10.01 1.20 N 
4  1 C   B ILE 988  ? ? N  B PRO 989  ? ? CA  B PRO 989  ? ? 129.77 119.30 10.47  1.50 Y 
5  1 C   B THR 1062 ? ? N  B PRO 1063 ? ? CA  B PRO 1063 ? ? 129.20 119.30 9.90   1.50 Y 
6  1 C   B THR 1062 ? ? N  B PRO 1063 ? ? CD  B PRO 1063 ? ? 115.77 128.40 -12.63 2.10 Y 
7  1 C   C ILE 988  ? ? N  C PRO 989  ? ? CA  C PRO 989  ? ? 128.67 119.30 9.37   1.50 Y 
8  1 C   C THR 1062 ? ? N  C PRO 1063 ? ? CD  C PRO 1063 ? ? 107.63 128.40 -20.77 2.10 Y 
9  1 C   D PHE 885  ? ? N  D PRO 886  ? ? CD  D PRO 886  ? ? 95.59  128.40 -32.81 2.10 Y 
10 1 NE  E ARG 119  ? ? CZ E ARG 119  ? ? NH1 E ARG 119  ? ? 124.23 120.30 3.93   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 887  ? ? -48.15  -149.62 
2  1 ILE A 894  ? ? -127.43 -140.71 
3  1 PRO B 886  ? ? -77.26  -167.86 
4  1 VAL B 893  ? ? -104.69 53.38   
5  1 ILE B 894  ? ? -122.62 -145.07 
6  1 GLN B 896  ? ? -25.84  -56.53  
7  1 LYS B 915  ? ? -51.60  100.48  
8  1 VAL B 937  ? ? -55.59  -8.55   
9  1 PRO C 886  ? ? -61.49  -174.63 
10 1 ILE C 894  ? ? -124.64 -144.67 
11 1 LYS C 915  ? ? -57.81  108.65  
12 1 VAL C 937  ? ? -57.30  -5.01   
13 1 GLN C 983  ? ? -51.21  -71.55  
14 1 PHE D 885  ? ? 157.76  150.34  
15 1 PRO D 886  ? ? -103.62 -159.92 
16 1 ASN D 895  ? ? -42.39  100.58  
17 1 ALA D 1052 ? ? -170.61 83.82   
18 1 TRP D 1058 ? ? -115.47 78.19   
19 1 ASP E 69   ? ? -99.70  32.06   
20 1 LEU E 79   ? ? -93.86  42.47   
21 1 GLN E 115  ? ? 81.41   8.49    
22 1 GLU E 120  ? ? 80.46   9.15    
23 1 ASP F 69   ? ? -97.73  30.78   
24 1 LEU F 79   ? ? -96.93  47.53   
25 1 GLN F 115  ? ? 88.78   8.10    
26 1 GLU F 120  ? ? 83.74   8.37    
27 1 LEU G 79   ? ? -95.06  48.23   
28 1 GLN G 115  ? ? 89.17   8.87    
29 1 GLU G 120  ? ? 83.73   7.78    
30 1 LEU H 79   ? ? -98.76  52.07   
31 1 ASN H 102  ? ? -160.44 -166.82 
32 1 GLU H 120  ? ? 84.21   8.31    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 887 ? CB  ? A GLU 9 CB  
2 1 Y 1 A GLU 887 ? CG  ? A GLU 9 CG  
3 1 Y 1 A GLU 887 ? CD  ? A GLU 9 CD  
4 1 Y 1 A GLU 887 ? OE1 ? A GLU 9 OE1 
5 1 Y 1 A GLU 887 ? OE2 ? A GLU 9 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 879  ? A GLU 1   
2  1 Y 1 A GLU 880  ? A GLU 2   
3  1 Y 1 A LYS 881  ? A LYS 3   
4  1 Y 1 A ASP 882  ? A ASP 4   
5  1 Y 1 A GLU 883  ? A GLU 5   
6  1 Y 1 A LYS 889  ? A LYS 11  
7  1 Y 1 A ALA 890  ? A ALA 12  
8  1 Y 1 A GLY 891  ? A GLY 13  
9  1 Y 1 A GLU 892  ? A GLU 14  
10 1 Y 1 A THR 1062 ? A THR 184 
11 1 Y 1 A PRO 1063 ? A PRO 185 
12 1 Y 1 A TRP 1064 ? A TRP 186 
13 1 Y 1 A TYR 1065 ? A TYR 187 
14 1 Y 1 A GLN 1066 ? A GLN 188 
15 1 Y 1 B GLU 879  ? B GLU 1   
16 1 Y 1 B GLU 880  ? B GLU 2   
17 1 Y 1 B LYS 881  ? B LYS 3   
18 1 Y 1 B ASP 882  ? B ASP 4   
19 1 Y 1 B GLU 883  ? B GLU 5   
20 1 Y 1 B GLN 888  ? B GLN 10  
21 1 Y 1 B LYS 889  ? B LYS 11  
22 1 Y 1 B ALA 890  ? B ALA 12  
23 1 Y 1 B GLY 891  ? B GLY 13  
24 1 Y 1 B ILE 1046 ? B ILE 168 
25 1 Y 1 B LYS 1047 ? B LYS 169 
26 1 Y 1 B ILE 1048 ? B ILE 170 
27 1 Y 1 B ARG 1049 ? B ARG 171 
28 1 Y 1 B THR 1050 ? B THR 172 
29 1 Y 1 B ASP 1051 ? B ASP 173 
30 1 Y 1 B ALA 1052 ? B ALA 174 
31 1 Y 1 B GLY 1053 ? B GLY 175 
32 1 Y 1 B PHE 1054 ? B PHE 176 
33 1 Y 1 B TRP 1064 ? B TRP 186 
34 1 Y 1 B TYR 1065 ? B TYR 187 
35 1 Y 1 B GLN 1066 ? B GLN 188 
36 1 Y 1 C GLU 879  ? C GLU 1   
37 1 Y 1 C GLU 880  ? C GLU 2   
38 1 Y 1 C LYS 881  ? C LYS 3   
39 1 Y 1 C ASP 882  ? C ASP 4   
40 1 Y 1 C GLU 883  ? C GLU 5   
41 1 Y 1 C GLN 888  ? C GLN 10  
42 1 Y 1 C LYS 889  ? C LYS 11  
43 1 Y 1 C ALA 890  ? C ALA 12  
44 1 Y 1 C GLY 891  ? C GLY 13  
45 1 Y 1 C GLU 892  ? C GLU 14  
46 1 Y 1 C LYS 1047 ? C LYS 169 
47 1 Y 1 C ILE 1048 ? C ILE 170 
48 1 Y 1 C ARG 1049 ? C ARG 171 
49 1 Y 1 C THR 1050 ? C THR 172 
50 1 Y 1 C ASP 1051 ? C ASP 173 
51 1 Y 1 C ALA 1052 ? C ALA 174 
52 1 Y 1 C GLY 1053 ? C GLY 175 
53 1 Y 1 C PHE 1054 ? C PHE 176 
54 1 Y 1 C TRP 1064 ? C TRP 186 
55 1 Y 1 C TYR 1065 ? C TYR 187 
56 1 Y 1 C GLN 1066 ? C GLN 188 
57 1 Y 1 D GLU 879  ? D GLU 1   
58 1 Y 1 D GLU 880  ? D GLU 2   
59 1 Y 1 D LYS 881  ? D LYS 3   
60 1 Y 1 D ASP 882  ? D ASP 4   
61 1 Y 1 D GLU 883  ? D GLU 5   
62 1 Y 1 D GLN 888  ? D GLN 10  
63 1 Y 1 D LYS 889  ? D LYS 11  
64 1 Y 1 D ALA 890  ? D ALA 12  
65 1 Y 1 D GLY 891  ? D GLY 13  
66 1 Y 1 D GLU 892  ? D GLU 14  
67 1 Y 1 D TRP 1064 ? D TRP 186 
68 1 Y 1 D TYR 1065 ? D TYR 187 
69 1 Y 1 D GLN 1066 ? D GLN 188 
70 1 Y 1 F HIS 57   ? F HIS 1   
71 1 Y 1 H HIS 57   ? H HIS 1   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#